BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1914_g1_i1 len=1020 path=[998:0-682 1681:683-1019]

Length=1020
                                                                      Score     E

sp|Q9FPN0.1|NEC1_PETHY  RecName: Full=Bidirectional sugar transpo...    315   5e-103   Petunia x hybrida [garden petunia]
ref|XP_011085139.1|  PREDICTED: bidirectional sugar transporter N...    308   4e-100   
gb|AGL98401.1|  sucrose transporter SWEET9                              308   5e-100   
ref|XP_009783143.1|  PREDICTED: bidirectional sugar transporter N...    305   6e-99    
ref|XP_009337947.1|  PREDICTED: bidirectional sugar transporter N...    301   3e-97    
ref|XP_004302124.1|  PREDICTED: bidirectional sugar transporter N...    297   5e-96    
ref|XP_008370771.1|  PREDICTED: bidirectional sugar transporter N...    296   3e-95    
ref|XP_007205793.1|  hypothetical protein PRUPE_ppa010594mg             293   2e-94    
ref|XP_009586714.1|  PREDICTED: bidirectional sugar transporter N...    293   2e-94    
emb|CDP09549.1|  unnamed protein product                                292   1e-93    
ref|XP_009379704.1|  PREDICTED: bidirectional sugar transporter N...    287   8e-92    
gb|EYU30738.1|  hypothetical protein MIMGU_mgv1a012552mg                280   2e-89    
ref|XP_010027132.1|  PREDICTED: bidirectional sugar transporter N...    276   1e-87    
gb|KGN61326.1|  hypothetical protein Csa_2G083730                       272   4e-86    
gb|AFK47472.1|  unknown                                                 272   4e-86    
ref|XP_004155149.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    268   1e-84    
ref|XP_004138979.1|  PREDICTED: bidirectional sugar transporter N...    266   8e-84    
ref|XP_006479044.1|  PREDICTED: bidirectional sugar transporter S...    263   6e-83    
ref|XP_008234052.1|  PREDICTED: bidirectional sugar transporter N...    262   7e-83    
ref|XP_008441813.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    263   9e-83    
ref|XP_003523161.1|  PREDICTED: bidirectional sugar transporter S...    262   3e-82    
ref|XP_007030240.1|  Nodulin MtN3 family protein isoform 1              263   5e-82    
ref|XP_007139174.1|  hypothetical protein PHAVU_008G007600g             261   7e-82    
ref|XP_006578712.1|  PREDICTED: bidirectional sugar transporter S...    261   1e-81    
ref|XP_008441812.1|  PREDICTED: bidirectional sugar transporter N...    260   2e-81    
ref|XP_011069431.1|  PREDICTED: bidirectional sugar transporter N...    259   2e-81    
gb|ACU23483.1|  unknown                                                 259   2e-81    Glycine max [soybeans]
ref|XP_003552719.1|  PREDICTED: bidirectional sugar transporter N...    259   3e-81    
ref|XP_008218389.1|  PREDICTED: bidirectional sugar transporter N...    256   6e-81    
ref|XP_008389034.1|  PREDICTED: bidirectional sugar transporter N...    259   7e-81    
gb|KHN17298.1|  Bidirectional sugar transporter NEC1                    258   1e-80    
ref|XP_010999465.1|  PREDICTED: bidirectional sugar transporter S...    257   1e-80    
gb|KHN23963.1|  Bidirectional sugar transporter SWEET14                 258   1e-80    
ref|XP_002270131.1|  PREDICTED: bidirectional sugar transporter S...    258   2e-80    Vitis vinifera
emb|CBI32263.3|  unnamed protein product                                259   5e-80    
ref|XP_004489106.1|  PREDICTED: bidirectional sugar transporter S...    256   8e-80    
ref|XP_009765830.1|  PREDICTED: bidirectional sugar transporter N...    256   8e-80    
ref|XP_009609628.1|  PREDICTED: bidirectional sugar transporter N...    256   1e-79    
ref|XP_006844581.1|  hypothetical protein AMTR_s00016p00202420          256   1e-79    
gb|KEH21559.1|  bidirectional sugar transporter                         254   3e-79    
gb|KDP28088.1|  hypothetical protein JCGZ_13859                         254   4e-79    
ref|XP_010242697.1|  PREDICTED: bidirectional sugar transporter S...    254   5e-79    
gb|KCW61425.1|  hypothetical protein EUGRSUZ_H04154                     252   2e-78    
ref|XP_004297512.1|  PREDICTED: bidirectional sugar transporter S...    253   2e-78    
ref|NP_001242732.1|  uncharacterized protein LOC100810962               252   2e-78    
ref|XP_010674202.1|  PREDICTED: bidirectional sugar transporter N...    251   4e-78    
ref|XP_004138978.1|  PREDICTED: bidirectional sugar transporter N...    251   4e-78    
ref|XP_003518628.1|  PREDICTED: bidirectional sugar transporter NEC1    251   7e-78    
ref|XP_007209422.1|  hypothetical protein PRUPE_ppa009422mg             252   8e-78    
ref|XP_009614916.1|  PREDICTED: bidirectional sugar transporter S...    252   9e-78    
ref|XP_009605550.1|  PREDICTED: bidirectional sugar transporter S...    252   1e-77    
ref|XP_008239633.1|  PREDICTED: bidirectional sugar transporter S...    250   3e-77    
ref|XP_010929602.1|  PREDICTED: bidirectional sugar transporter S...    250   5e-77    
ref|XP_010093933.1|  Bidirectional sugar transporter SWEET10            249   1e-76    
ref|XP_007030241.1|  Nodulin MtN3 family protein isoform 2              249   1e-76    
gb|EYU46728.1|  hypothetical protein MIMGU_mgv1a011381mg                248   2e-76    
gb|EYU34244.1|  hypothetical protein MIMGU_mgv1a022710mg                246   4e-76    
ref|XP_009605549.1|  PREDICTED: bidirectional sugar transporter S...    247   5e-76    
ref|XP_009587580.1|  PREDICTED: bidirectional sugar transporter S...    247   5e-76    
emb|CAN71371.1|  hypothetical protein VITISV_023352                     246   7e-76    Vitis vinifera
ref|XP_009762335.1|  PREDICTED: bidirectional sugar transporter S...    247   7e-76    
ref|XP_002284244.1|  PREDICTED: bidirectional sugar transporter S...    246   7e-76    Vitis vinifera
ref|XP_009758167.1|  PREDICTED: bidirectional sugar transporter S...    246   9e-76    
ref|XP_009758165.1|  PREDICTED: bidirectional sugar transporter S...    246   9e-76    
ref|XP_007200238.1|  hypothetical protein PRUPE_ppa015264mg             246   1e-75    
ref|XP_008235079.1|  PREDICTED: bidirectional sugar transporter S...    246   1e-75    
ref|XP_004247459.1|  PREDICTED: bidirectional sugar transporter NEC1    246   1e-75    
ref|NP_001237418.1|  N3 protein                                         245   2e-75    
ref|XP_009614915.1|  PREDICTED: bidirectional sugar transporter S...    246   2e-75    
ref|XP_004952573.1|  PREDICTED: bidirectional sugar transporter S...    247   2e-75    
ref|XP_009591687.1|  PREDICTED: bidirectional sugar transporter N...    246   2e-75    
ref|XP_010250599.1|  PREDICTED: bidirectional sugar transporter S...    245   2e-75    
ref|XP_004979336.1|  PREDICTED: bidirectional sugar transporter S...    245   3e-75    
ref|XP_009412768.1|  PREDICTED: bidirectional sugar transporter S...    245   3e-75    
ref|XP_003531061.1|  PREDICTED: bidirectional sugar transporter N...    244   4e-75    
ref|XP_009787633.1|  PREDICTED: bidirectional sugar transporter N...    245   4e-75    
ref|XP_009385515.1|  PREDICTED: bidirectional sugar transporter S...    244   5e-75    
ref|XP_010528779.1|  PREDICTED: bidirectional sugar transporter S...    243   6e-75    
ref|XP_009794695.1|  PREDICTED: bidirectional sugar transporter N...    244   7e-75    
ref|XP_009758166.1|  PREDICTED: bidirectional sugar transporter S...    244   7e-75    
ref|XP_006347347.1|  PREDICTED: bidirectional sugar transporter S...    244   8e-75    
ref|XP_002511128.1|  conserved hypothetical protein                     243   9e-75    Ricinus communis
ref|XP_009796436.1|  PREDICTED: bidirectional sugar transporter S...    244   1e-74    
emb|CDP03543.1|  unnamed protein product                                243   1e-74    
ref|XP_009597195.1|  PREDICTED: bidirectional sugar transporter S...    243   1e-74    
ref|XP_006347346.1|  PREDICTED: bidirectional sugar transporter S...    243   1e-74    
gb|KFK36797.1|  hypothetical protein AALP_AA4G172400                    243   1e-74    
gb|KHN39181.1|  Bidirectional sugar transporter N3                      243   2e-74    
ref|XP_006363981.1|  PREDICTED: bidirectional sugar transporter S...    243   2e-74    
ref|NP_001131289.1|  mtN3-like protein                                  243   3e-74    Zea mays [maize]
gb|ACV71016.1|  UPA16                                                   243   3e-74    Capsicum annuum
ref|XP_004241452.1|  PREDICTED: bidirectional sugar transporter S...    243   3e-74    
ref|XP_011079737.1|  PREDICTED: bidirectional sugar transporter N...    242   3e-74    
ref|XP_009599477.1|  PREDICTED: bidirectional sugar transporter S...    242   3e-74    
ref|XP_002442119.1|  hypothetical protein SORBIDRAFT_08g014040          243   3e-74    Sorghum bicolor [broomcorn]
ref|XP_004235326.1|  PREDICTED: bidirectional sugar transporter N3      243   4e-74    
ref|XP_004235339.1|  PREDICTED: bidirectional sugar transporter S...    242   5e-74    
ref|XP_010243612.1|  PREDICTED: bidirectional sugar transporter S...    241   5e-74    
ref|XP_007050795.1|  Medicago truncatula MTN3                           242   6e-74    
ref|XP_006347633.1|  PREDICTED: bidirectional sugar transporter S...    241   8e-74    
ref|XP_002443167.1|  hypothetical protein SORBIDRAFT_08g013840          242   8e-74    Sorghum bicolor [broomcorn]
ref|XP_006444236.1|  hypothetical protein CICLE_v10023774mg             241   1e-73    
gb|EMT22394.1|  Protein RUPTURED POLLEN GRAIN 1                         241   1e-73    
ref|XP_009802194.1|  PREDICTED: bidirectional sugar transporter S...    241   1e-73    
ref|XP_003532478.1|  PREDICTED: bidirectional sugar transporter S...    239   1e-73    
gb|KDO87388.1|  hypothetical protein CISIN_1g036251mg                   240   1e-73    
ref|XP_004297511.1|  PREDICTED: bidirectional sugar transporter S...    241   2e-73    
ref|XP_011020821.1|  PREDICTED: bidirectional sugar transporter N...    240   2e-73    
ref|XP_008464393.1|  PREDICTED: bidirectional sugar transporter S...    241   2e-73    
ref|XP_002450786.1|  hypothetical protein SORBIDRAFT_05g018110          240   2e-73    Sorghum bicolor [broomcorn]
ref|XP_007137870.1|  hypothetical protein PHAVU_009G162700g             239   2e-73    
ref|XP_004980522.1|  PREDICTED: bidirectional sugar transporter S...    241   2e-73    
ref|XP_006296061.1|  hypothetical protein CARUB_v10025211mg             239   4e-73    
ref|XP_010045482.1|  PREDICTED: bidirectional sugar transporter S...    239   4e-73    
ref|XP_002453892.1|  hypothetical protein SORBIDRAFT_04g021000          241   4e-73    Sorghum bicolor [broomcorn]
ref|XP_004235342.2|  PREDICTED: uncharacterized protein LOC101265905    248   4e-73    
ref|XP_004138032.1|  PREDICTED: bidirectional sugar transporter S...    239   5e-73    
ref|XP_006347634.1|  PREDICTED: bidirectional sugar transporter S...    239   6e-73    
ref|XP_006347635.1|  PREDICTED: bidirectional sugar transporter S...    239   6e-73    
ref|XP_006411131.1|  hypothetical protein EUTSA_v10017080mg             238   6e-73    
ref|NP_001288941.1|  bidirectional sugar transporter SWEET9             238   8e-73    
ref|XP_008392727.1|  PREDICTED: bidirectional sugar transporter S...    239   8e-73    
gb|KDP32879.1|  hypothetical protein JCGZ_12171                         238   8e-73    
ref|XP_008392763.1|  PREDICTED: bidirectional sugar transporter S...    237   8e-73    
gb|EAY83053.1|  hypothetical protein OsI_38270                          239   9e-73    Oryza sativa Indica Group [Indian rice]
sp|Q2QR07.1|SWT13_ORYSJ  RecName: Full=Bidirectional sugar transp...    239   1e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008677256.1|  PREDICTED: LOC100282648 isoform X1                 238   2e-72    
ref|XP_010696414.1|  PREDICTED: bidirectional sugar transporter S...    239   2e-72    
ref|XP_004962649.1|  PREDICTED: bidirectional sugar transporter S...    238   2e-72    
ref|XP_004235334.1|  PREDICTED: bidirectional sugar transporter S...    238   2e-72    
ref|XP_007159993.1|  hypothetical protein PHAVU_002G283900g             237   2e-72    
gb|AFK48645.1|  unknown                                                 236   2e-72    
ref|XP_011023930.1|  PREDICTED: bidirectional sugar transporter S...    237   2e-72    
ref|XP_010509074.1|  PREDICTED: bidirectional sugar transporter S...    236   2e-72    
ref|XP_010517242.1|  PREDICTED: bidirectional sugar transporter S...    236   2e-72    
ref|XP_009393865.1|  PREDICTED: bidirectional sugar transporter S...    237   2e-72    
ref|XP_006663471.1|  PREDICTED: bidirectional sugar transporter S...    238   3e-72    
ref|XP_006347632.1|  PREDICTED: bidirectional sugar transporter S...    238   3e-72    
gb|EYU43032.1|  hypothetical protein MIMGU_mgv1a010677mg                238   3e-72    
ref|NP_001241307.1|  uncharacterized protein LOC100810946               236   3e-72    
ref|XP_006664549.1|  PREDICTED: bidirectional sugar transporter S...    236   3e-72    
ref|XP_010505570.1|  PREDICTED: bidirectional sugar transporter S...    236   4e-72    
ref|XP_004235333.1|  PREDICTED: bidirectional sugar transporter S...    237   4e-72    
ref|NP_001141106.1|  uncharacterized protein LOC100273190               237   6e-72    Zea mays [maize]
ref|XP_002881628.1|  nodulin MtN3 family protein                        235   6e-72    
gb|EYU43030.1|  hypothetical protein MIMGU_mgv1a011435mg                236   7e-72    
ref|XP_010112742.1|  Bidirectional sugar transporter NEC1               235   7e-72    
ref|XP_011073105.1|  PREDICTED: bidirectional sugar transporter N...    236   7e-72    
ref|XP_009337539.1|  PREDICTED: bidirectional sugar transporter N3      236   7e-72    
ref|NP_001046944.1|  Os02g0513100                                       237   8e-72    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001149028.1|  LOC100282648                                       237   8e-72    Zea mays [maize]
ref|XP_006480106.1|  PREDICTED: bidirectional sugar transporter S...    236   9e-72    
ref|XP_006347652.1|  PREDICTED: bidirectional sugar transporter S...    242   1e-71    
gb|KHG20984.1|  Bidirectional sugar transporter SWEET15 -like pro...    236   1e-71    
sp|A2X5B4.1|SWT15_ORYSI  RecName: Full=Bidirectional sugar transp...    237   1e-71    Oryza sativa Indica Group [Indian rice]
sp|B8BKP4.1|SWT14_ORYSI  RecName: Full=Bidirectional sugar transp...    236   1e-71    Oryza sativa Indica Group [Indian rice]
ref|NP_001067955.1|  Os11g0508600                                       236   1e-71    Oryza sativa Japonica Group [Japonica rice]
gb|AAM63257.1|  similar to MtN3 protein                                 234   1e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010442555.1|  PREDICTED: bidirectional sugar transporter S...    236   1e-71    
ref|XP_006647263.1|  PREDICTED: bidirectional sugar transporter S...    236   1e-71    
gb|EYU43031.1|  hypothetical protein MIMGU_mgv1a011488mg                235   1e-71    
dbj|BAJ85621.1|  predicted protein                                      236   1e-71    
ref|NP_181439.1|  bidirectional sugar transporter SWEET9                234   1e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865823.1|  nodulin MtN3 family protein                        236   2e-71    
gb|ACG28570.1|  MTN3                                                    236   2e-71    Zea mays [maize]
ref|XP_010442345.1|  PREDICTED: bidirectional sugar transporter S...    235   2e-71    
ref|XP_004235340.1|  PREDICTED: bidirectional sugar transporter S...    235   2e-71    
gb|EMT11081.1|  Protein RUPTURED POLLEN GRAIN 1                         235   2e-71    
dbj|BAJ94651.1|  predicted protein                                      235   2e-71    
ref|NP_199892.1|  bidirectional sugar transporter SWEET10               235   3e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004491680.1|  PREDICTED: bidirectional sugar transporter N...    234   3e-71    
ref|XP_003576036.1|  PREDICTED: bidirectional sugar transporter S...    234   5e-71    
gb|EMT20481.1|  Protein RUPTURED POLLEN GRAIN 1                         234   5e-71    
ref|XP_008239523.1|  PREDICTED: bidirectional sugar transporter N3      234   6e-71    
ref|XP_009802608.1|  PREDICTED: bidirectional sugar transporter S...    234   6e-71    
ref|XP_004501816.1|  PREDICTED: bidirectional sugar transporter S...    233   6e-71    
gb|EMT20480.1|  Protein RUPTURED POLLEN GRAIN 1                         234   6e-71    
ref|XP_008464392.1|  PREDICTED: bidirectional sugar transporter S...    234   1e-70    
ref|XP_009411801.1|  PREDICTED: bidirectional sugar transporter S...    233   1e-70    
emb|CDY69440.1|  BnaCnng63490D                                          231   1e-70    
ref|XP_010482380.1|  PREDICTED: bidirectional sugar transporter S...    233   1e-70    
ref|XP_004138250.1|  PREDICTED: bidirectional sugar transporter S...    233   1e-70    
ref|XP_010249453.1|  PREDICTED: bidirectional sugar transporter S...    233   1e-70    
ref|XP_011073577.1|  PREDICTED: bidirectional sugar transporter S...    232   2e-70    
ref|XP_010090683.1|  Bidirectional sugar transporter N3                 233   2e-70    
ref|XP_003524088.1|  PREDICTED: bidirectional sugar transporter N...    233   2e-70    
ref|XP_006281748.1|  hypothetical protein CARUB_v10027907mg             233   2e-70    
ref|XP_004242139.1|  PREDICTED: bidirectional sugar transporter S...    233   2e-70    
ref|XP_008791098.1|  PREDICTED: bidirectional sugar transporter S...    233   2e-70    
ref|XP_002511127.1|  conserved hypothetical protein                     232   2e-70    Ricinus communis
ref|XP_002303766.2|  hypothetical protein POPTR_0003s16520g             233   2e-70    Populus trichocarpa [western balsam poplar]
gb|KDP26857.1|  hypothetical protein JCGZ_18015                         233   2e-70    
ref|NP_001132836.1|  hypothetical protein                               234   2e-70    Zea mays [maize]
ref|XP_008356571.1|  PREDICTED: bidirectional sugar transporter S...    233   3e-70    
ref|NP_001149087.1|  MTN3                                               233   3e-70    Zea mays [maize]
ref|XP_010235464.1|  PREDICTED: bidirectional sugar transporter S...    233   3e-70    
ref|XP_007159040.1|  hypothetical protein PHAVU_002G203600g             231   3e-70    
emb|CDX84877.1|  BnaA03g13530D                                          231   3e-70    
gb|EMT20808.1|  Protein RUPTURED POLLEN GRAIN 1                         232   4e-70    
ref|XP_010556111.1|  PREDICTED: bidirectional sugar transporter S...    233   4e-70    
gb|EMS51422.1|  Bidirectional sugar transporter SWEET13                 232   4e-70    
ref|XP_010093935.1|  Bidirectional sugar transporter SWEET12            232   5e-70    
gb|KFK26707.1|  hypothetical protein AALP_AA8G282900                    231   5e-70    
gb|EMT03611.1|  Protein RUPTURED POLLEN GRAIN 1                         232   5e-70    
ref|XP_002443163.1|  hypothetical protein SORBIDRAFT_08g013620          232   6e-70    Sorghum bicolor [broomcorn]
gb|AHL43546.1|  nodule-specific sucrose transporter                     231   6e-70    
ref|XP_009132693.1|  PREDICTED: bidirectional sugar transporter S...    231   7e-70    
ref|XP_011083538.1|  PREDICTED: bidirectional sugar transporter S...    231   7e-70    
ref|XP_004145146.1|  PREDICTED: bidirectional sugar transporter S...    231   7e-70    
ref|XP_011071246.1|  PREDICTED: bidirectional sugar transporter N3      231   8e-70    
ref|XP_008374287.1|  PREDICTED: bidirectional sugar transporter N...    231   9e-70    
ref|XP_010926783.1|  PREDICTED: bidirectional sugar transporter S...    230   1e-69    
ref|XP_009802195.1|  PREDICTED: bidirectional sugar transporter S...    231   1e-69    
ref|XP_009421186.1|  PREDICTED: bidirectional sugar transporter S...    231   1e-69    
ref|XP_002264875.1|  PREDICTED: bidirectional sugar transporter N3      230   1e-69    Vitis vinifera
ref|XP_002321730.2|  N3 like family protein                             230   1e-69    Populus trichocarpa [western balsam poplar]
gb|KHN24976.1|  Bidirectional sugar transporter N3                      229   2e-69    
ref|XP_003530901.1|  PREDICTED: bidirectional sugar transporter N...    229   2e-69    
ref|XP_006402062.1|  hypothetical protein EUTSA_v10014273mg             230   2e-69    
ref|XP_006436900.1|  hypothetical protein CICLE_v10033645mg             229   2e-69    
ref|XP_003551863.1|  PREDICTED: bidirectional sugar transporter N...    229   3e-69    
ref|NP_001239695.1|  uncharacterized protein LOC100777741               229   3e-69    
ref|XP_008386620.1|  PREDICTED: bidirectional sugar transporter S...    230   3e-69    
ref|XP_003576225.1|  PREDICTED: bidirectional sugar transporter S...    229   3e-69    
gb|KHN03192.1|  Bidirectional sugar transporter N3                      229   3e-69    
ref|XP_003602780.1|  Protein RUPTURED POLLEN GRAIN                      229   3e-69    
gb|EYU42078.1|  hypothetical protein MIMGU_mgv1a010705mg                230   4e-69    
ref|NP_001141654.1|  hypothetical protein                               229   5e-69    Zea mays [maize]
ref|XP_009347840.1|  PREDICTED: bidirectional sugar transporter N...    230   5e-69    
gb|EPS64389.1|  hypothetical protein M569_10392                         228   5e-69    
ref|XP_010943754.1|  PREDICTED: bidirectional sugar transporter S...    229   6e-69    
ref|XP_009801964.1|  PREDICTED: bidirectional sugar transporter S...    229   6e-69    
ref|XP_008392764.1|  PREDICTED: bidirectional sugar transporter S...    228   8e-69    
ref|XP_004503778.1|  PREDICTED: bidirectional sugar transporter S...    227   8e-69    
ref|XP_008222221.1|  PREDICTED: bidirectional sugar transporter N3      228   9e-69    
ref|XP_009405955.1|  PREDICTED: bidirectional sugar transporter S...    228   1e-68    
gb|EMS48886.1|  Bidirectional sugar transporter SWEET13                 231   1e-68    
ref|XP_003620983.1|  Protein RUPTURED POLLEN GRAIN                      228   1e-68    
ref|XP_004153501.1|  PREDICTED: bidirectional sugar transporter S...    228   1e-68    
ref|XP_004161952.1|  PREDICTED: bidirectional sugar transporter S...    228   1e-68    
ref|XP_004962650.1|  PREDICTED: bidirectional sugar transporter S...    227   1e-68    
emb|CAC44123.1|  N3 like protein                                        226   2e-68    Medicago truncatula
gb|KEH20983.1|  bidirectional sugar transporter                         226   2e-68    
ref|XP_006371147.1|  hypothetical protein POPTR_0019s04590g             226   2e-68    
gb|KEH21447.1|  sugar efflux transporter for intercellular exchan...    227   2e-68    
ref|XP_002321731.1|  N3 like family protein                             227   2e-68    Populus trichocarpa [western balsam poplar]
ref|XP_004161953.1|  PREDICTED: bidirectional sugar transporter S...    228   2e-68    
gb|EYU23059.1|  hypothetical protein MIMGU_mgv1a019104mg                227   2e-68    
ref|XP_003617528.1|  Protein RUPTURED POLLEN GRAIN                      226   2e-68    
ref|XP_009337540.1|  PREDICTED: bidirectional sugar transporter NEC1    228   2e-68    
ref|XP_004235470.1|  PREDICTED: bidirectional sugar transporter S...    227   2e-68    
ref|XP_007043874.1|  Senescence-associated gene 29                      227   2e-68    
ref|XP_006388397.1|  hypothetical protein POPTR_0198s00220g             225   3e-68    
gb|KHN47229.1|  Bidirectional sugar transporter NEC1-like protein       225   3e-68    
ref|XP_007222479.1|  hypothetical protein PRUPE_ppa009789mg             226   3e-68    
ref|XP_008440025.1|  PREDICTED: bidirectional sugar transporter S...    227   3e-68    
ref|XP_010027258.1|  PREDICTED: bidirectional sugar transporter N...    227   3e-68    
ref|XP_007038075.1|  Nodulin MtN3 family protein, putative isoform 1    226   4e-68    
ref|XP_006347653.1|  PREDICTED: bidirectional sugar transporter S...    226   4e-68    
ref|XP_010039121.1|  PREDICTED: bidirectional sugar transporter S...    226   5e-68    
emb|CDP21121.1|  unnamed protein product                                226   5e-68    
ref|XP_009605548.1|  PREDICTED: bidirectional sugar transporter S...    226   6e-68    
gb|AFK35161.1|  unknown                                                 225   6e-68    
ref|XP_011023934.1|  PREDICTED: bidirectional sugar transporter S...    226   7e-68    
ref|XP_004145147.1|  PREDICTED: bidirectional sugar transporter S...    226   7e-68    
ref|XP_002520679.1|  conserved hypothetical protein                     226   9e-68    Ricinus communis
ref|XP_011023933.1|  PREDICTED: bidirectional sugar transporter S...    225   9e-68    
ref|XP_004490502.1|  PREDICTED: bidirectional sugar transporter N...    225   1e-67    
ref|XP_011015361.1|  PREDICTED: bidirectional sugar transporter S...    225   1e-67    
ref|XP_006493253.1|  PREDICTED: bidirectional sugar transporter S...    225   1e-67    
gb|EMS53876.1|  Bidirectional sugar transporter SWEET14                 233   1e-67    
ref|XP_006436901.1|  hypothetical protein CICLE_v10032313mg             225   1e-67    
ref|XP_009794853.1|  PREDICTED: bidirectional sugar transporter S...    225   2e-67    
gb|KDP22573.1|  hypothetical protein JCGZ_26404                         225   2e-67    
ref|XP_002322282.2|  hypothetical protein POPTR_0015s11380g             224   2e-67    Populus trichocarpa [western balsam poplar]
ref|XP_006438820.1|  hypothetical protein CICLE_v10032218mg             225   2e-67    
ref|NP_190443.1|  bidirectional sugar transporter SWEET11               225   2e-67    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006366913.1|  PREDICTED: bidirectional sugar transporter S...    227   2e-67    
gb|KHG13555.1|  Bidirectional sugar transporter SWEET15                 224   2e-67    
ref|XP_011036129.1|  PREDICTED: bidirectional sugar transporter S...    224   2e-67    
ref|XP_010037373.1|  PREDICTED: bidirectional sugar transporter S...    224   2e-67    
gb|AFW71563.1|  hypothetical protein ZEAMMB73_472818                    226   3e-67    
ref|XP_007030239.1|  Nodulin MtN3 family protein                        223   3e-67    
ref|XP_002280599.1|  PREDICTED: bidirectional sugar transporter S...    224   3e-67    
gb|KFK27668.1|  hypothetical protein AALP_AA8G413300                    224   5e-67    
ref|XP_002299333.2|  hypothetical protein POPTR_0001s13410g             224   5e-67    
ref|XP_006366912.1|  PREDICTED: bidirectional sugar transporter S...    223   7e-67    
ref|XP_002267792.1|  PREDICTED: bidirectional sugar transporter NEC1    223   7e-67    
ref|XP_010027261.1|  PREDICTED: bidirectional sugar transporter N...    223   9e-67    
gb|KHG03157.1|  Bidirectional sugar transporter SWEET15 -like pro...    223   1e-66    
emb|CDX73521.1|  BnaC08g24820D                                          222   1e-66    
ref|XP_010926782.1|  PREDICTED: bidirectional sugar transporter S...    223   1e-66    
ref|XP_009125890.1|  PREDICTED: bidirectional sugar transporter S...    223   1e-66    
gb|EMS46194.1|  Bidirectional sugar transporter SWEET15                 224   1e-66    
gb|AHB08882.1|  bidirectional sugar transporter SWEET14-like protein    224   1e-66    
emb|CDX85668.1|  BnaA02g01450D                                          223   2e-66    
ref|XP_011023931.1|  PREDICTED: bidirectional sugar transporter S...    221   2e-66    
emb|CDX91144.1|  BnaC02g04530D                                          223   2e-66    
ref|XP_009779208.1|  PREDICTED: bidirectional sugar transporter S...    221   2e-66    
ref|NP_196821.1|  senescence-associated protein 29                      222   2e-66    
gb|EMT20483.1|  Protein RUPTURED POLLEN GRAIN 1                         223   2e-66    
ref|XP_007038076.1|  Nodulin MtN3 family protein, putative isoform 2    222   2e-66    
ref|XP_006399805.1|  hypothetical protein EUTSA_v10014234mg             222   3e-66    
ref|XP_006404221.1|  hypothetical protein EUTSA_v10010591mg             222   3e-66    
gb|AAM65389.1|  senescence-associated protein (SAG29)                   222   3e-66    
ref|XP_002873602.1|  nodulin MtN3 family protein                        222   3e-66    
ref|XP_002877629.1|  nodulin MtN3 family protein                        222   3e-66    
ref|XP_009803865.1|  PREDICTED: bidirectional sugar transporter S...    222   3e-66    
ref|XP_010037364.1|  PREDICTED: bidirectional sugar transporter S...    221   4e-66    
ref|XP_010453373.1|  PREDICTED: bidirectional sugar transporter S...    222   4e-66    
ref|XP_010426372.1|  PREDICTED: bidirectional sugar transporter S...    221   5e-66    
ref|XP_009601079.1|  PREDICTED: bidirectional sugar transporter S...    221   5e-66    
ref|XP_007038077.1|  Medicago truncatula MTN3, putative                 221   5e-66    
ref|XP_009614917.1|  PREDICTED: bidirectional sugar transporter S...    221   5e-66    
ref|XP_002511125.1|  conserved hypothetical protein                     221   5e-66    
ref|XP_002514863.1|  conserved hypothetical protein                     221   5e-66    
ref|XP_010503515.1|  PREDICTED: bidirectional sugar transporter S...    221   6e-66    
ref|XP_011084749.1|  PREDICTED: bidirectional sugar transporter N...    221   6e-66    
ref|XP_010025272.1|  PREDICTED: bidirectional sugar transporter N...    221   7e-66    
ref|XP_010419882.1|  PREDICTED: bidirectional sugar transporter S...    221   7e-66    
ref|XP_010036837.1|  PREDICTED: bidirectional sugar transporter N...    219   7e-66    
gb|KCW49071.1|  hypothetical protein EUGRSUZ_K02671                     220   8e-66    
emb|CDX77928.1|  BnaC03g52910D                                          221   8e-66    
ref|XP_010534707.1|  PREDICTED: bidirectional sugar transporter S...    221   8e-66    
ref|XP_002322281.2|  N3 like family protein                             220   1e-65    
ref|XP_010042796.1|  PREDICTED: bidirectional sugar transporter N...    220   1e-65    
gb|AFK39311.1|  unknown                                                 219   1e-65    
ref|XP_006288378.1|  hypothetical protein CARUB_v10001629mg             220   1e-65    
ref|XP_006289174.1|  hypothetical protein CARUB_v10002612mg             220   1e-65    
ref|XP_007137871.1|  hypothetical protein PHAVU_009G162800g             217   1e-65    
ref|XP_010550745.1|  PREDICTED: bidirectional sugar transporter S...    220   1e-65    
emb|CDY08093.1|  BnaA06g16330D                                          220   1e-65    
ref|XP_003602778.1|  Protein RUPTURED POLLEN GRAIN                      221   1e-65    
ref|XP_006394628.1|  hypothetical protein EUTSA_v10004719mg             220   1e-65    
ref|XP_010037362.1|  PREDICTED: bidirectional sugar transporter S...    220   1e-65    
ref|XP_010492063.1|  PREDICTED: bidirectional sugar transporter S...    220   1e-65    
ref|XP_009149800.1|  PREDICTED: bidirectional sugar transporter S...    220   2e-65    
ref|XP_004239304.1|  PREDICTED: bidirectional sugar transporter N3      220   2e-65    
emb|CDX83046.1|  BnaA01g20460D                                          220   2e-65    
ref|XP_009150178.1|  PREDICTED: bidirectional sugar transporter S...    220   2e-65    
ref|XP_009336454.1|  PREDICTED: bidirectional sugar transporter N...    220   2e-65    
ref|XP_008389921.1|  PREDICTED: bidirectional sugar transporter N...    220   2e-65    
ref|XP_007137872.1|  hypothetical protein PHAVU_009G162900g             220   2e-65    
ref|XP_002877428.1|  hypothetical protein ARALYDRAFT_484952             219   2e-65    
emb|CDY05867.1|  BnaC08g20440D                                          219   3e-65    
ref|XP_010421173.1|  PREDICTED: bidirectional sugar transporter S...    219   3e-65    
ref|XP_009403777.1|  PREDICTED: bidirectional sugar transporter S...    219   3e-65    
ref|XP_010454652.1|  PREDICTED: bidirectional sugar transporter S...    219   4e-65    
ref|XP_010027262.1|  PREDICTED: bidirectional sugar transporter N...    218   4e-65    
ref|XP_010545940.1|  PREDICTED: bidirectional sugar transporter S...    219   5e-65    
gb|AAM65058.1|  MtN3-like protein                                       219   5e-65    
ref|XP_010493487.1|  PREDICTED: bidirectional sugar transporter S...    219   5e-65    
ref|NP_197755.1|  bidirectional sugar transporter SWEET12               218   5e-65    
ref|XP_006493252.1|  PREDICTED: bidirectional sugar transporter S...    219   5e-65    
gb|EMT09236.1|  Protein RUPTURED POLLEN GRAIN 1                         219   6e-65    
ref|NP_199893.1|  bidirectional sugar transporter SWEET13               219   6e-65    
gb|ACU14542.1|  unknown                                                 215   6e-65    
emb|CBI15715.3|  unnamed protein product                                218   7e-65    
gb|EMS51423.1|  Bidirectional sugar transporter SWEET13                 219   7e-65    
ref|XP_003615405.1|  Protein RUPTURED POLLEN GRAIN                      218   8e-65    
gb|EMS49335.1|  Bidirectional sugar transporter SWEET14                 220   8e-65    
ref|XP_010025273.1|  PREDICTED: bidirectional sugar transporter N...    218   9e-65    
gb|KDP22572.1|  hypothetical protein JCGZ_26403                         218   9e-65    
gb|KFK25541.1|  hypothetical protein AALP_AA8G128400                    218   1e-64    
ref|XP_004957300.1|  PREDICTED: bidirectional sugar transporter S...    218   1e-64    
gb|KCW61894.1|  hypothetical protein EUGRSUZ_H04587                     216   1e-64    
ref|XP_004310113.1|  PREDICTED: bidirectional sugar transporter S...    218   1e-64    
ref|XP_010045483.1|  PREDICTED: bidirectional sugar transporter S...    217   1e-64    
gb|KEH21448.1|  bidirectional sugar transporter                         216   2e-64    
emb|CDX97233.1|  BnaC09g43920D                                          218   2e-64    
ref|XP_010027260.1|  PREDICTED: bidirectional sugar transporter N...    217   2e-64    
ref|XP_010027259.1|  PREDICTED: bidirectional sugar transporter N...    216   3e-64    
ref|XP_006291603.1|  hypothetical protein CARUB_v10017757mg             216   5e-64    
ref|XP_010678288.1|  PREDICTED: bidirectional sugar transporter N3      217   5e-64    
ref|XP_010039124.1|  PREDICTED: bidirectional sugar transporter S...    214   5e-64    
emb|CDX68492.1|  BnaC01g25700D                                          216   5e-64    
ref|XP_009121791.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    216   5e-64    
ref|XP_010678287.1|  PREDICTED: bidirectional sugar transporter S...    216   6e-64    
ref|XP_010041902.1|  PREDICTED: bidirectional sugar transporter S...    215   6e-64    
ref|XP_009109231.1|  PREDICTED: bidirectional sugar transporter S...    215   7e-64    
ref|XP_009141677.1|  PREDICTED: bidirectional sugar transporter S...    215   8e-64    
ref|XP_008459891.1|  PREDICTED: bidirectional sugar transporter N3      215   9e-64    
gb|KHG27148.1|  Bidirectional sugar transporter SWEET10 -like pro...    215   1e-63    
ref|XP_002862913.1|  nodulin MtN3 family protein                        215   1e-63    
ref|XP_008802109.1|  PREDICTED: bidirectional sugar transporter S...    214   1e-63    
ref|XP_009391576.1|  PREDICTED: bidirectional sugar transporter S...    214   1e-63    
gb|KHG02402.1|  Bidirectional sugar transporter SWEET10 -like pro...    214   1e-63    
ref|XP_009150896.1|  PREDICTED: bidirectional sugar transporter S...    215   1e-63    
emb|CDX88041.1|  BnaA06g26320D                                          215   1e-63    
gb|KFK34174.1|  hypothetical protein AALP_AA5G110100                    215   2e-63    
emb|CDX69663.1|  BnaA10g20120D                                          215   2e-63    
ref|XP_002511126.1|  conserved hypothetical protein                     214   3e-63    
ref|XP_006282018.1|  hypothetical protein CARUB_v10028257mg             214   3e-63    
ref|XP_009612477.1|  PREDICTED: bidirectional sugar transporter N...    215   3e-63    
emb|CDP21120.1|  unnamed protein product                                213   4e-63    
dbj|BAK04274.1|  predicted protein                                      214   4e-63    
gb|EPS65273.1|  hypothetical protein M569_09501                         211   5e-63    
emb|CDX80379.1|  BnaC07g30650D                                          214   5e-63    
emb|CDX87161.1|  BnaC09g04760D                                          213   5e-63    
ref|XP_010027247.1|  PREDICTED: bidirectional sugar transporter N...    214   6e-63    
ref|XP_010442358.1|  PREDICTED: bidirectional sugar transporter S...    214   6e-63    
ref|XP_010037379.1|  PREDICTED: bidirectional sugar transporter S...    212   7e-63    
emb|CDY16863.1|  BnaA09g05190D                                          213   7e-63    
ref|XP_006413354.1|  hypothetical protein EUTSA_v10025975mg             212   8e-63    
ref|XP_006285021.1|  hypothetical protein CARUB_v10006328mg             213   9e-63    
ref|XP_004491681.1|  PREDICTED: bidirectional sugar transporter N...    212   9e-63    
emb|CDY53626.1|  BnaC03g71480D                                          213   9e-63    
ref|XP_002865824.1|  nodulin MtN3 family protein                        213   9e-63    
ref|XP_007139099.1|  hypothetical protein PHAVU_008G001100g             212   1e-62    
gb|KDO64483.1|  hypothetical protein CISIN_1g020739mg                   212   1e-62    
gb|KCW61896.1|  hypothetical protein EUGRSUZ_H04589                     211   1e-62    
ref|XP_010536596.1|  PREDICTED: bidirectional sugar transporter S...    213   1e-62    
ref|XP_009383909.1|  PREDICTED: bidirectional sugar transporter N...    214   2e-62    
ref|XP_008340254.1|  PREDICTED: bidirectional sugar transporter N...    213   2e-62    
emb|CDP21733.1|  unnamed protein product                                211   2e-62    
emb|CDY24854.1|  BnaA08g14560D                                          211   2e-62    
ref|XP_004157602.1|  PREDICTED: bidirectional sugar transporter S...    211   2e-62    
ref|XP_009777590.1|  PREDICTED: bidirectional sugar transporter N...    213   2e-62    
ref|XP_010442559.1|  PREDICTED: bidirectional sugar transporter S...    212   2e-62    
emb|CDY07676.1|  BnaA03g18350D                                          211   2e-62    
ref|XP_004140547.1|  PREDICTED: bidirectional sugar transporter S...    211   2e-62    
gb|KCW61897.1|  hypothetical protein EUGRSUZ_H04592                     211   3e-62    
ref|XP_009349481.1|  PREDICTED: bidirectional sugar transporter N...    212   3e-62    
ref|XP_010519500.1|  PREDICTED: bidirectional sugar transporter S...    211   3e-62    
ref|XP_010482381.1|  PREDICTED: bidirectional sugar transporter S...    212   3e-62    
ref|XP_003532319.1|  PREDICTED: bidirectional sugar transporter N...    211   3e-62    
ref|XP_010037381.1|  PREDICTED: bidirectional sugar transporter S...    211   4e-62    
emb|CDY03395.1|  BnaC01g16870D                                          211   4e-62    
ref|XP_009138751.1|  PREDICTED: bidirectional sugar transporter S...    211   4e-62    
emb|CDY34333.1|  BnaA01g14360D                                          210   5e-62    
gb|KHN24975.1|  Bidirectional sugar transporter N3                      210   5e-62    
sp|P93332.1|NOD3_MEDTR  RecName: Full=Bidirectional sugar transpo...    210   5e-62    
ref|XP_010438942.1|  PREDICTED: bidirectional sugar transporter S...    210   7e-62    
ref|XP_010448490.1|  PREDICTED: bidirectional sugar transporter S...    210   7e-62    
ref|NP_194231.1|  bidirectional sugar transporter SWEET14               210   8e-62    
ref|XP_009123765.1|  PREDICTED: bidirectional sugar transporter S...    211   8e-62    
emb|CDX78511.1|  BnaA03g04230D                                          211   8e-62    
ref|XP_007139100.1|  hypothetical protein PHAVU_008G001200g             210   9e-62    
ref|XP_010039123.1|  PREDICTED: bidirectional sugar transporter S...    209   9e-62    
ref|XP_002867630.1|  nodulin MtN3 family protein                        209   1e-61    
ref|XP_004503779.1|  PREDICTED: bidirectional sugar transporter S...    209   2e-61    
ref|XP_006402061.1|  hypothetical protein EUTSA_v10014268mg             209   2e-61    
ref|XP_011042931.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    209   2e-61    
emb|CDX71659.1|  BnaC09g27000D                                          209   3e-61    
ref|XP_010682692.1|  PREDICTED: bidirectional sugar transporter S...    207   4e-61    
ref|XP_003578398.1|  PREDICTED: bidirectional sugar transporter S...    209   4e-61    
ref|XP_007038078.1|  Medicago truncatula MTN3, putative                 208   7e-61    
ref|XP_009137488.1|  PREDICTED: bidirectional sugar transporter S...    207   1e-60    
emb|CDX92666.1|  BnaC07g39240D                                          207   1e-60    
gb|AFK36312.1|  unknown                                                 207   1e-60    
gb|AFW71562.1|  hypothetical protein ZEAMMB73_472818                    208   1e-60    
ref|XP_003532471.1|  PREDICTED: bidirectional sugar transporter S...    207   2e-60    
ref|NP_001136928.1|  hypothetical protein                               207   3e-60    
gb|KDO64482.1|  hypothetical protein CISIN_1g047365mg                   205   3e-60    
gb|KHN31280.1|  Bidirectional sugar transporter SWEET14-like protein    207   4e-60    
gb|EMT31640.1|  Protein RUPTURED POLLEN GRAIN 1                         206   4e-60    
gb|KCW61900.1|  hypothetical protein EUGRSUZ_H04596                     205   5e-60    
gb|EPS72542.1|  hypothetical protein M569_02215                         203   6e-60    
ref|XP_007159991.1|  hypothetical protein PHAVU_002G283800g             206   7e-60    
gb|EYU43027.1|  hypothetical protein MIMGU_mgv1a022177mg                203   8e-60    
ref|XP_004501726.1|  PREDICTED: bidirectional sugar transporter S...    205   1e-59    
gb|KDO64484.1|  hypothetical protein CISIN_1g020739mg                   206   1e-59    
dbj|BAK07340.1|  predicted protein                                      204   2e-59    
gb|KFK26708.1|  hypothetical protein AALP_AA8G283000                    204   2e-59    
gb|EMS45810.1|  Bidirectional sugar transporter SWEET11                 204   2e-59    
ref|XP_003593107.1|  Protein RUPTURED POLLEN GRAIN                      204   2e-59    
gb|ACJ84828.1|  unknown                                                 203   3e-59    
dbj|BAJ99068.1|  predicted protein                                      204   3e-59    
gb|ABD78942.1|  disease resistant allele xa13                           204   3e-59    
gb|KHN23961.1|  Bidirectional sugar transporter SWEET12                 204   3e-59    
ref|NP_001062354.1|  Os08g0535200                                       204   3e-59    
ref|XP_003526939.1|  PREDICTED: bidirectional sugar transporter S...    204   3e-59    
ref|XP_004309712.1|  PREDICTED: bidirectional sugar transporter S...    202   3e-59    
ref|XP_004984398.1|  PREDICTED: bidirectional sugar transporter S...    204   4e-59    
gb|KCW49087.1|  hypothetical protein EUGRSUZ_K02694                     202   6e-59    
ref|XP_007148462.1|  hypothetical protein PHAVU_006G210800g             202   8e-59    
ref|XP_010039128.1|  PREDICTED: bidirectional sugar transporter S...    202   8e-59    
ref|XP_002465280.1|  hypothetical protein SORBIDRAFT_01g035490          203   1e-58    
ref|XP_006661417.1|  PREDICTED: bidirectional sugar transporter S...    200   1e-58    
gb|EMT23597.1|  Protein RUPTURED POLLEN GRAIN 1                         202   1e-58    
ref|XP_006347482.1|  PREDICTED: bidirectional sugar transporter S...    201   1e-58    
gb|EMT31030.1|  Protein RUPTURED POLLEN GRAIN 1                         200   2e-58    
ref|NP_001149496.1|  MTN3                                               201   3e-58    
ref|XP_010037372.1|  PREDICTED: bidirectional sugar transporter S...    200   3e-58    
ref|XP_004974017.1|  PREDICTED: bidirectional sugar transporter S...    202   3e-58    
emb|CDP14988.1|  unnamed protein product                                200   6e-58    
sp|A2XGM7.1|SWT12_ORYSI  RecName: Full=Bidirectional sugar transp...    201   6e-58    
ref|NP_001240121.1|  uncharacterized protein LOC100800347               200   7e-58    
ref|XP_006651370.1|  PREDICTED: bidirectional sugar transporter S...    201   9e-58    
gb|AES73031.2|  sugar efflux transporter for intercellular exchan...    197   1e-57    
ref|XP_009417933.1|  PREDICTED: bidirectional sugar transporter S...    198   2e-57    
ref|XP_006659632.1|  PREDICTED: bidirectional sugar transporter S...    199   3e-57    
ref|NP_001050099.1|  Os03g0347500                                       199   4e-57    
ref|XP_004309713.1|  PREDICTED: bidirectional sugar transporter N...    198   4e-57    
gb|KCW49075.1|  hypothetical protein EUGRSUZ_K026741                    196   7e-57    
emb|CDP13388.1|  unnamed protein product                                197   9e-57    
gb|KDP22571.1|  hypothetical protein JCGZ_26402                         196   1e-56    
ref|XP_007030242.1|  Nodulin MtN3 family protein isoform 3              196   1e-56    
ref|XP_004169143.1|  PREDICTED: bidirectional sugar transporter N...    192   1e-56    
gb|EMT20482.1|  Protein RUPTURED POLLEN GRAIN 1                         198   1e-56    



>sp|Q9FPN0.1|NEC1_PETHY RecName: Full=Bidirectional sugar transporter NEC1; AltName: 
Full=NEC1 [Petunia x hybrida]
 gb|AAG34696.1| NEC1 [Petunia x hybrida]
Length=265

 Score =   315 bits (808),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 161/266 (61%), Positives = 199/266 (75%), Gaps = 11/266 (4%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MA L    L+ +FGLLGNIVSF VFLAP+PTFYKIYKRKSS+GYQ+IPY+VALFSA LLL
Sbjct  1    MAQLRADDLSFIFGLLGNIVSFMVFLAPVPTFYKIYKRKSSEGYQAIPYMVALFSAGLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDILFFGAVIIVS  615
            YYA ++ NAYLIV INGFGCAIEL +IS++LFYA +K KIFT  L+LL++   G V+ ++
Sbjct  61   YYAYLRKNAYLIVSINGFGCAIELTYISLFLFYAPRKSKIFTGWLMLLELGALGMVMPIT  120

Query  614  LFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWF  435
              L  GS R+ +VGW CA INVAVFAAPLSIMRQVI+T++ +FMP TLS+ L  CAT WF
Sbjct  121  YLLAEGSHRVMIVGWICAAINVAVFAAPLSIMRQVIKTKSVEFMPFTLSLFLTLCATMWF  180

Query  434  FYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGK------GAEYKEGIE--I  279
            FYG F KD+YIAFPNILGFLFG+ Q++LY +YKDSK+ +D K        + KEG+E  I
Sbjct  181  FYGFFKKDFYIAFPNILGFLFGIVQMLLYFVYKDSKRIDDEKSDPVREATKSKEGVEIII  240

Query  278  QVKNDGRR*I*QRIEVTGRRSDVLRT  201
             +++D      Q +E    R   LRT
Sbjct  241  NIEDDNSDNALQSMEKDFSR---LRT  263



>ref|XP_011085139.1| PREDICTED: bidirectional sugar transporter NEC1-like [Sesamum 
indicum]
Length=262

 Score =   308 bits (789),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/243 (61%), Positives = 193/243 (79%), Gaps = 3/243 (1%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MALLSV+HLA+LFGLLGN+VSF VFLAP+PTFY I+K+KSS+G+QSIPY VA  SA LLL
Sbjct  1    MALLSVEHLAVLFGLLGNLVSFLVFLAPMPTFYTIWKKKSSEGFQSIPYSVAFLSASLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIV  618
            YYA +KTNAY+IV ING GC IE++++ +Y+ YA KK ++FTIKL++L +    G V++V
Sbjct  61   YYAFLKTNAYMIVSINGIGCVIEMIYLLIYITYAPKKARMFTIKLVVLFNFGGMGLVMLV  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            SL    GSKR++LVGW CA+ N+AVFAAPLSIMR+VIRT++ +FMP TLS  L  CAT W
Sbjct  121  SLLAYKGSKRVSLVGWACAIFNLAVFAAPLSIMRRVIRTKSVEFMPFTLSFFLTLCATMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYK--EGIEIQVKND  264
            FFYG F KDYYIA PN+LGFLFG+AQ++LY +YK++KKE + K  E +  + +E++   D
Sbjct  181  FFYGFFVKDYYIALPNVLGFLFGIAQMILYFIYKNAKKEVESKNVELETSKDVELETSKD  240

Query  263  GRR  255
              +
Sbjct  241  VEK  243



>gb|AGL98401.1| sucrose transporter SWEET9 [Nicotiana attenuata]
Length=272

 Score =   308 bits (789),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 148/240 (62%), Positives = 190/240 (79%), Gaps = 4/240 (2%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M LLSVQ LA LFGLLGNIVSF VFLAP+PTFYKIYK+ SS+G+Q+IPYVVALFSA LLL
Sbjct  1    MTLLSVQELAFLFGLLGNIVSFMVFLAPVPTFYKIYKKGSSEGFQAIPYVVALFSAGLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDILFFGAVIIVS  615
            YYA +  NA+LIV IN FGC IEL +I ++LFYA+KK K+ T+ L+LLD+   G V++ S
Sbjct  61   YYAYLTKNAFLIVTINAFGCVIELTYIFLFLFYASKKSKMTTVWLMLLDVGALGIVMLFS  120

Query  614  LFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWF  435
                 G+KR+ +VGW CA++N+AVFAAPLSIMRQVI+T++ +FMP TLS+ L  CAT WF
Sbjct  121  YLFAKGTKRVEIVGWICAIVNIAVFAAPLSIMRQVIKTKSVEFMPFTLSLFLTLCATMWF  180

Query  434  FYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYK-EGIEIQVKNDGR  258
            FYG F KDYYIA PN+LGFL G+ Q++LY +YK ++++ +G   E++ EGI+I +K DG 
Sbjct  181  FYGYFKKDYYIALPNVLGFLLGIVQMILYIVYKYARRKYNG---EWELEGIDINIKTDGN  237



>ref|XP_009783143.1| PREDICTED: bidirectional sugar transporter NEC1-like [Nicotiana 
sylvestris]
Length=263

 Score =   305 bits (781),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 148/239 (62%), Positives = 188/239 (79%), Gaps = 4/239 (2%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M LLSVQ LA LFGLLGNIVSF VFLAP+PTFYKIYK+ SS+G+Q+IPYVVALFSA LLL
Sbjct  1    MTLLSVQELAFLFGLLGNIVSFMVFLAPVPTFYKIYKKGSSEGFQAIPYVVALFSAGLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDILFFGAVIIVS  615
            YYA +  NA LIV IN FGC IEL++I ++LFYA+KK K+ T+ L+LLD+   G V++ S
Sbjct  61   YYAYLTKNAILIVTINAFGCVIELIYILLFLFYASKKSKMTTVWLMLLDVGALGIVMLFS  120

Query  614  LFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWF  435
                 GSKR+ +VGW CA +N+AVFAAPLSIMRQVI+T++ +FMP TLS+ L  CAT WF
Sbjct  121  YLFAKGSKRVEIVGWICATVNIAVFAAPLSIMRQVIKTKSVEFMPFTLSLFLTLCATMWF  180

Query  434  FYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYK-EGIEIQVKNDG  261
            FYG F KDYYIA PN+LGFL G+ Q++LY +YK ++++ +    E++ EGI+I +K DG
Sbjct  181  FYGYFKKDYYIALPNVLGFLLGIVQMILYIVYKYARRKYN---REWELEGIDINIKTDG  236



>ref|XP_009337947.1| PREDICTED: bidirectional sugar transporter NEC1-like [Pyrus x 
bretschneideri]
Length=267

 Score =   301 bits (770),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 181/225 (80%), Gaps = 1/225 (0%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M  L+ + LA +FGLLGNIVSF VFLAPIPTFY IYK+KSS G+QSIPYVVAL SA LLL
Sbjct  1    MQFLNTEQLAFIFGLLGNIVSFMVFLAPIPTFYTIYKKKSSKGFQSIPYVVALLSATLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIV  618
            YY V+KTNAYLIV ING G  IE+ ++ +Y+ YA+KKDKI T+ L+LL ++  FG V+ V
Sbjct  61   YYGVLKTNAYLIVSINGIGIVIEVTYLILYIVYASKKDKITTLSLILLVNVATFGLVLAV  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            ++FL+ G+ RI  VGW CAV N+AVFAAPLSIMRQVIRT++ +FMP +LS+ L  CAT W
Sbjct  121  TVFLLGGTARICAVGWICAVFNIAVFAAPLSIMRQVIRTKSVEFMPFSLSLFLTLCATMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGA  303
            FFYGLF+KDYYIA PN+LGFLFG+AQ++LY  YK+S K+ + K +
Sbjct  181  FFYGLFTKDYYIALPNVLGFLFGVAQMILYMTYKNSGKDVEAKKS  225



>ref|XP_004302124.1| PREDICTED: bidirectional sugar transporter NEC1-like [Fragaria 
vesca subsp. vesca]
Length=257

 Score =   297 bits (761),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 142/236 (60%), Positives = 186/236 (79%), Gaps = 1/236 (0%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MA  + + LA  FGLLGNIVSF VFLAP+PTFY+IYK+KSS+G+QSIPYVVAL SA LLL
Sbjct  1    MAYSTTEQLAFSFGLLGNIVSFMVFLAPMPTFYRIYKKKSSEGFQSIPYVVALLSAMLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDILFFGAVIIVS  615
            YY VIKTNA LI+ IN FG  IE+ ++  YL YA KK +IFT+ L+LL  + FG  +  +
Sbjct  61   YYGVIKTNAILIISINAFGIVIEVAYLIFYLTYAPKKQRIFTLNLILLVNVAFGLTLAAT  120

Query  614  LFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWF  435
            +FL++G+KR+A VGW CAV N+AVFAAPLSIMR+VIRT++ +FMP  LS+ L  CAT WF
Sbjct  121  IFLLSGTKRVAAVGWICAVFNIAVFAAPLSIMREVIRTKSVEFMPFGLSLFLTLCATTWF  180

Query  434  FYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYK-EGIEIQVK  270
            FYGLF+KDYYIA PN+LGFLFG+AQ++LY +Y++S K+ D   A+ +  G +++++
Sbjct  181  FYGLFTKDYYIALPNVLGFLFGIAQMILYMVYRNSGKDHDEVEAKTRTNGDDLEMR  236



>ref|XP_008370771.1| PREDICTED: bidirectional sugar transporter NEC1-like [Malus domestica]
Length=267

 Score =   296 bits (757),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 152/263 (58%), Positives = 194/263 (74%), Gaps = 15/263 (6%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M  L+ + LA +FGLLGNIVSF VFLAPIPTFY IYK+KSS G+QSIPYVVAL SA LLL
Sbjct  1    MQFLNTEQLAFVFGLLGNIVSFMVFLAPIPTFYTIYKKKSSKGFQSIPYVVALLSATLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIV  618
            YY V+KTNAYLIV IN  G  IE+ ++ +Y+ YA+KKDKI T+ L+LL ++  FG V+ V
Sbjct  61   YYGVLKTNAYLIVSINVIGIXIEVTYLILYIVYASKKDKITTLSLILLVNVAAFGLVLAV  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            ++FL+ G+ R+  VGW CAV N+AVFAAPLSIMRQVIRT++ +FMP +LS+ L  CAT W
Sbjct  121  TVFLLGGTARVCAVGWICAVFNIAVFAAPLSIMRQVIRTKSVEFMPFSLSLFLTLCATMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQVKNDGR  258
            FFYGLF+KDYYIA PN+LGFLFG+AQ++LY  YK+S K+ + K    K  +E++  +   
Sbjct  181  FFYGLFTKDYYIALPNVLGFLFGIAQMILYMTYKNSGKDVEVK----KSTMEMKKLSST-  235

Query  257  R*I*QRIEVTG-----RRSDVLR  204
                 R  +TG      RSD L+
Sbjct  236  ----NRPNLTGSVNKNSRSDELK  254



>ref|XP_007205793.1| hypothetical protein PRUPE_ppa010594mg [Prunus persica]
 gb|EMJ06992.1| hypothetical protein PRUPE_ppa010594mg [Prunus persica]
Length=244

 Score =   293 bits (749),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/227 (63%), Positives = 183/227 (81%), Gaps = 2/227 (1%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M  LS + LA +FGLLGNIVSF VFLAPIPTFY IYK+KSS G+QSIPYVVAL SA LLL
Sbjct  1    MKFLSNEQLAFVFGLLGNIVSFMVFLAPIPTFYTIYKKKSSKGFQSIPYVVALLSAMLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIV  618
            YY V+KTNA+LI+ ING GC IE++++  Y+ +A+KKDKI T+ L+LL ++  FG V+ V
Sbjct  61   YYGVLKTNAFLIISINGIGCVIEIIYLIFYIVHASKKDKITTMSLILLVNVAAFGLVMAV  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            +LFL+  +KR++ VGW CAV N+AVFAAPLSI+RQVIRT++ ++MP +LS  L  CAT W
Sbjct  121  TLFLLGEAKRVSAVGWMCAVFNIAVFAAPLSIVRQVIRTKSVEYMPFSLSFFLTLCATMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDS-KKEEDGKGAE  300
            FFYGLF+KDYYIA PN+LGFL G+AQ++LY  YK+S K + + KG++
Sbjct  181  FFYGLFTKDYYIALPNVLGFLLGVAQMILYLKYKNSGKNDAENKGSQ  227



>ref|XP_009586714.1| PREDICTED: bidirectional sugar transporter NEC1-like [Nicotiana 
tomentosiformis]
Length=264

 Score =   293 bits (751),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/232 (62%), Positives = 180/232 (78%), Gaps = 1/232 (0%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M LLSVQ LA LFGLLGNIVSF VFLAPIPTFYKIYK+ SSDG+Q+IPYVVA FSA LLL
Sbjct  1    MTLLSVQELAFLFGLLGNIVSFMVFLAPIPTFYKIYKKGSSDGFQAIPYVVAFFSAGLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDILFFGAVIIVS  615
            YY  +  NA LIV IN FGC IE+ ++ ++LFYA+KK K+ T+ L+LLD+   G V+++S
Sbjct  61   YYGYLIKNAILIVTINAFGCVIEVAYLFLFLFYASKKTKVTTVWLMLLDVGALGIVMLLS  120

Query  614  LFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWF  435
                 G+KR+ +VGW CA++N+AVFAAPLSIMRQVI+T++ +FMP TLS+ L  CAT WF
Sbjct  121  YLFAKGAKRVEIVGWICAIVNIAVFAAPLSIMRQVIKTKSVEFMPFTLSIFLTLCATMWF  180

Query  434  FYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEI  279
            FYG F KDYYIAFPN+LGF+ G+ Q++LY +YK +K     KG    EG++I
Sbjct  181  FYGYFKKDYYIAFPNVLGFVLGIVQMILYIVYKYAKSRPY-KGEWELEGVDI  231



>emb|CDP09549.1| unnamed protein product [Coffea canephora]
Length=280

 Score =   292 bits (747),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 149/252 (59%), Positives = 192/252 (76%), Gaps = 16/252 (6%)
 Frame = -2

Query  974  MALLSVQHLALLFGLL----------GNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYV  825
            MA+LS Q LAL+FGLL          GNI+SF VFLAP+PTFY IYK+K+S+G+QSIPYV
Sbjct  1    MAVLSAQVLALIFGLLVWLSNFEFSTGNIISFLVFLAPLPTFYTIYKKKTSEGFQSIPYV  60

Query  824  VALFSAELLLYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLL-LLD  648
            VALFSA LLLYYA +KTNA LIV IN  GC IE +++SMY+ YA K  K+FT+KLL   +
Sbjct  61   VALFSASLLLYYAFLKTNALLIVTINAIGCIIETIYLSMYVLYAPKTSKMFTLKLLGFFN  120

Query  647  ILFFGAVIIVSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLS  468
            I   G ++ VSL L  G+KR++LVGW CAVIN+AVFAAPLSIM QVIRT++ ++MP TLS
Sbjct  121  IGCLGVIVAVSLALAKGAKRVSLVGWFCAVINLAVFAAPLSIMAQVIRTKSVEYMPFTLS  180

Query  467  VCLVFCATAWFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEED----GKGA-  303
              L  CAT+WFFYG F +DYYIA PN++GFLFG+ Q++LY +YK++KK+ +     +GA 
Sbjct  181  FFLTLCATSWFFYGFFVRDYYIAVPNVMGFLFGIVQMILYFIYKNAKKDGEINTKLEGAM  240

Query  302  EYKEGIEIQVKN  267
            E KEGI++ ++ 
Sbjct  241  EQKEGIQMNIEG  252



>ref|XP_009379704.1| PREDICTED: bidirectional sugar transporter NEC1-like [Pyrus x 
bretschneideri]
Length=267

 Score =   287 bits (734),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 140/231 (61%), Positives = 175/231 (76%), Gaps = 3/231 (1%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M  L+ + LA +FGLLGNIVSF  FLAPIPTFY IYK+KSS G+QSIPYV+AL SA LLL
Sbjct  1    MQFLNTEQLAFIFGLLGNIVSFMTFLAPIPTFYTIYKKKSSKGFQSIPYVIALLSATLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFT-IKLLLLDILFFGAVIIV  618
            YY  +KTNAYLI+ IN  G  IE+ ++ +Y+ YA+K DKI T I +LL+++   G V+ V
Sbjct  61   YYGALKTNAYLIISINSIGTVIEVTYLILYIVYASKNDKITTLIWILLVNVAALGLVVAV  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            + FL+ G+ RI+ VGW CAV N+AVFAAPLSIMRQVIRT++ +FMP +LS  L  CAT W
Sbjct  121  TFFLLGGTVRISTVGWICAVFNIAVFAAPLSIMRQVIRTKSVEFMPFSLSFFLTLCATMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK--EEDGKGAEYKE  291
            FFYGLF+KDYYIA PN+LGFLFG+AQ++LY  YK+S    EE     E K+
Sbjct  181  FFYGLFTKDYYIALPNVLGFLFGIAQMILYMTYKNSGNNVEEKRSTQEMKK  231



>gb|EYU30738.1| hypothetical protein MIMGU_mgv1a012552mg [Erythranthe guttata]
Length=246

 Score =   280 bits (716),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 176/235 (75%), Gaps = 2/235 (1%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M  LS + L  +FGLLGNI+SF VFL+P+PTFY I+K+KSS G+QSIPY VA FSA LLL
Sbjct  1    MGSLSAKELEFIFGLLGNIISFLVFLSPLPTFYTIWKQKSSKGFQSIPYSVAFFSASLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVIIV  618
            YYA +KTNAY+IV ING GC IE +++ +YL YA KK KIFT++L++  +I   G +  V
Sbjct  61   YYAFLKTNAYMIVSINGIGCVIEAIYLLIYLMYAPKKSKIFTMRLIVFFNIGGLGLMTAV  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            S     G KR++ VGW CA++N+AVFAAPLSIMRQVIRT++ +FMP TLS  L  CA  W
Sbjct  121  SQLGFKGPKRVSFVGWVCAIVNIAVFAAPLSIMRQVIRTKSVEFMPFTLSFFLTLCAITW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK-EEDGKGAEYKEGIEIQ  276
            FFYG F +DYYIA PN+LGFLFG+AQ++LY +YK++KK  E     E K+  +++
Sbjct  181  FFYGFFVRDYYIAMPNVLGFLFGIAQMILYMIYKNAKKVGETNLDRELKQNRDVE  235



>ref|XP_010027132.1| PREDICTED: bidirectional sugar transporter NEC1-like [Eucalyptus 
grandis]
Length=268

 Score =   276 bits (706),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 177/231 (77%), Gaps = 3/231 (1%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MA  + + LA +FGLLGNIVSF VFLAPIPTFY I+K+KSSDGYQSIPYVVAL SA LLL
Sbjct  1    MAFSNEKELAFIFGLLGNIVSFLVFLAPIPTFYAIFKKKSSDGYQSIPYVVALSSASLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIV  618
            YY V+KTNA +I+ IN  G  IEL ++ ++L YA+ K+K++  KL+L+ ++  FG ++ +
Sbjct  61   YYGVLKTNATMIISINAIGIVIELTYLILFLIYASTKEKMYVAKLMLVFNVGGFGVMMAL  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            ++FL+ G +R+  VGW CA  N+AVFAAPLSIMR+VI+T++ +FMP TLS  L  CATAW
Sbjct  121  TIFLLKGPQRVDAVGWICAAFNLAVFAAPLSIMRRVIKTKSVEFMPFTLSFFLTLCATAW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYK--DSKKEEDGKGAEYKE  291
            FFYGLF KD +IA PN LGFLFG+AQ++LY +YK  + K  E  KG+  +E
Sbjct  181  FFYGLFVKDMFIALPNTLGFLFGIAQMILYMIYKYGNKKLAETDKGSNQQE  231



>gb|KGN61326.1| hypothetical protein Csa_2G083730 [Cucumis sativus]
Length=262

 Score =   272 bits (696),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 133/268 (50%), Positives = 191/268 (71%), Gaps = 10/268 (4%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M  LSV  L  +FGLLGNI+SF VFLAP+PTF+ IYK+K+S+G+QSIPYVVAL SA LLL
Sbjct  1    MNGLSVHQLQFIFGLLGNIISFLVFLAPMPTFWTIYKKKTSEGFQSIPYVVALMSAMLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKL-LLLDILFFGAVIIV  618
            YYA +KTNAYL+V IN FGC IE+++I++YLFYA KK KIFT+KL ++ ++ F G ++  
Sbjct  61   YYAALKTNAYLLVSINSFGCVIEVIYIALYLFYAPKKQKIFTLKLFIIFNLGFSGVMVGG  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            ++F ++G KR   VGW CA  N++VFA+PLSIM++VI T++ ++MP +LS  L   AT W
Sbjct  121  TMFFLHGMKRTNAVGWICAAFNLSVFASPLSIMKRVITTKSVEYMPFSLSFFLTLSATMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQVKNDGR  258
            FFYG F KD +IA PN++GFL G+ Q+++Y +YKDSK + + K    +EG +   ++D  
Sbjct  181  FFYGFFIKDLFIALPNVVGFLLGMVQMIMYMIYKDSKGKVEEK---LEEGAKFCEEDD--  235

Query  257  R*I*QRIEVTGRRSDVLRTVLIKPHHAR  174
                Q + +   +S+     + + +H +
Sbjct  236  ----QTLSIVKTQSETKEINMAETNHYK  259



>gb|AFK47472.1| unknown [Lotus japonicus]
Length=260

 Score =   272 bits (695),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 133/241 (55%), Positives = 178/241 (74%), Gaps = 5/241 (2%)
 Frame = -2

Query  962  SVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAV  783
            S + + L+FGLLGNIVSF VFLAP+PTFY IYK+K S+G+QSIPYVVAL SA LLLYY  
Sbjct  5    SEREMVLIFGLLGNIVSFMVFLAPLPTFYTIYKKKPSEGFQSIPYVVALLSAMLLLYYGF  64

Query  782  IKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIVSLFL  606
            +KTNA LI+ IN  GCAIE+ ++ MY+ YA KK KI T+ L+L+ DI   G  +I+++F+
Sbjct  65   LKTNALLIITINCIGCAIEVSYLMMYIIYAPKKQKISTLLLILMADIGGLGLTMIITMFV  124

Query  605  VNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYG  426
            V  ++R+  VG  CA+ N+AVFAAPLS MR+VI+TR+ ++MP +LS+ L  CAT WFFYG
Sbjct  125  VKSAERVHAVGLICAIFNIAVFAAPLSTMRKVIKTRSVEYMPFSLSLFLTLCATMWFFYG  184

Query  425  LFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKE----GIEIQVKNDGR  258
            LF KD YI  PN+LGFLFG++Q++LY +YK++KK+ + +  E +E        Q  NDG 
Sbjct  185  LFDKDNYIMMPNVLGFLFGISQMILYIIYKNAKKKVEVEATEQQEWGNTEKPAQHSNDGN  244

Query  257  R  255
             
Sbjct  245  N  245



>ref|XP_004155149.1| PREDICTED: LOW QUALITY PROTEIN: bidirectional sugar transporter 
NEC1-like [Cucumis sativus]
Length=262

 Score =   268 bits (686),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/268 (49%), Positives = 189/268 (71%), Gaps = 10/268 (4%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M  LSV  L  +FGLLGNI+SF VFLAP+PTF+ IYK+K+S+G+QSIPYVVAL SA LLL
Sbjct  1    MNGLSVHQLQFIFGLLGNIISFLVFLAPMPTFWTIYKKKTSEGFQSIPYVVALMSAMLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKL-LLLDILFFGAVIIV  618
            YYA +KTNAYL+V IN FGC IE+++I++YLFYA KK KIFT+KL ++ ++ F G ++  
Sbjct  61   YYAALKTNAYLLVSINSFGCVIEVIYIALYLFYAPKKQKIFTLKLFIIFNLGFSGVMVGG  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            +   ++G KR   VGW CA  N++VFA+PLSIM++VI T++ ++MP +LS  L   AT W
Sbjct  121  TXVFLHGMKRTNAVGWICAAFNLSVFASPLSIMKRVITTKSVEYMPFSLSFFLTLSATMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQVKNDGR  258
            FFYG F KD +IA PN++GFL G+ Q+++Y +YKDSK + + K    +EG +   ++D  
Sbjct  181  FFYGFFIKDLFIALPNVVGFLLGMVQMIMYMIYKDSKGKVEEK---LEEGAKFCEEDD--  235

Query  257  R*I*QRIEVTGRRSDVLRTVLIKPHHAR  174
                Q + +   +S+     + + +H +
Sbjct  236  ----QTLSIVKTQSETKEINMAETNHYK  259



>ref|XP_004138979.1| PREDICTED: bidirectional sugar transporter NEC1-like [Cucumis 
sativus]
Length=274

 Score =   266 bits (681),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 131/248 (53%), Positives = 180/248 (73%), Gaps = 8/248 (3%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M  LSV  L  +FGLLGNI+SF VFLAP+PTF+ +YK+K+S+G+Q IPYVVAL SA LLL
Sbjct  1    MKGLSVHQLQFIFGLLGNIISFMVFLAPVPTFWTVYKKKTSEGFQCIPYVVALMSAMLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVIIV  618
            YYAV+KTNAYL++ IN FGC IEL++I++Y +YA KK KIFT+KLL+ L++  +G ++  
Sbjct  61   YYAVLKTNAYLLISINSFGCVIELIYIALYFYYAPKKLKIFTLKLLMILNLGSYGVMVGG  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            ++ +++G+KR   VGW CA  N+AVFA+PL+IM++VI T++ ++MP +LS  L   AT W
Sbjct  121  TMLILHGNKRTHAVGWICAAFNLAVFASPLAIMKRVITTKSVEYMPFSLSFFLTLSATMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK-------EEDGKGAEYKEGIEI  279
            FFYG F KD +IA PNI+GFL G+ Q+++Y +YKD K        EE GK  E  +    
Sbjct  181  FFYGFFIKDLFIALPNIVGFLLGMVQMIMYMIYKDRKGNSLEEKLEEGGKKYEVDDQSLS  240

Query  278  QVKNDGRR  255
            + K   RR
Sbjct  241  KYKGQIRR  248



>ref|XP_006479044.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Citrus 
sinensis]
 gb|KDO45545.1| hypothetical protein CISIN_1g042377mg [Citrus sinensis]
Length=255

 Score =   263 bits (673),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 174/240 (73%), Gaps = 1/240 (0%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M +L+   LA +FGLLGNIVSF VFLAP+PTF  IYK+KSS+GY SIPYV+AL SA LLL
Sbjct  1    MGILTPHQLAFIFGLLGNIVSFLVFLAPVPTFLIIYKKKSSEGYHSIPYVIALSSATLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIV  618
            YY ++K+NA LI+ IN  GC IE++++ +YL YA +K K FTIKL+L+ ++  F  ++++
Sbjct  61   YYGLLKSNAVLIITINSIGCVIEVIYLMLYLIYAPQKQKSFTIKLILVFNVGAFALMMVI  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
              F V G  R+  VG  CAV NVAVF+APLSIMR+VI+T++ ++MP +LS  L  CAT W
Sbjct  121  VNFFVKGPNRVTAVGCVCAVYNVAVFSAPLSIMRRVIKTKSVEYMPFSLSFFLTLCATMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQVKNDGR  258
            FFYGLF KD  IA PN+LGFLFG+AQ++LY +YK  K  E  +  +    +++ +  D +
Sbjct  181  FFYGLFVKDMVIALPNVLGFLFGIAQMILYLVYKGKKGNESNQKQQECTEMKMNLTEDDK  240



>ref|XP_008234052.1| PREDICTED: bidirectional sugar transporter NEC1-like [Prunus 
mume]
Length=213

 Score =   262 bits (669),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 161/211 (76%), Gaps = 1/211 (0%)
 Frame = -2

Query  962  SVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAV  783
            S + LA +FGL+GNIVS  VFLAPIPTFYKIYK KSS+G+QS PYVVAL SA LLL+Y V
Sbjct  3    SNEQLAFIFGLIGNIVSVMVFLAPIPTFYKIYKNKSSEGFQSTPYVVALLSAMLLLFYGV  62

Query  782  IKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFT-IKLLLLDILFFGAVIIVSLFL  606
            +KTNA LI+ IN  GC IE+ ++  Y  YA+KKDKI T I++L+L++  FG V+ V+  L
Sbjct  63   LKTNAALIISINVIGCVIEITYLIFYFVYASKKDKITTMIQILVLNVAVFGLVVAVTFLL  122

Query  605  VNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYG  426
            V   KR++ VGW CAV  VAVFAAPL IMR VI+T++ ++MP  LS  L  CAT WF YG
Sbjct  123  VGEDKRVSTVGWICAVFGVAVFAAPLLIMRIVIQTKSVEYMPFYLSFSLTICATLWFLYG  182

Query  425  LFSKDYYIAFPNILGFLFGLAQIVLYCMYKD  333
            LF KDYYIAFPN+LGFL G+AQ++LY  YKD
Sbjct  183  LFVKDYYIAFPNVLGFLLGIAQMILYFKYKD  213



>ref|XP_008441813.1| PREDICTED: LOW QUALITY PROTEIN: bidirectional sugar transporter 
NEC1-like [Cucumis melo]
Length=264

 Score =   263 bits (673),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 178/247 (72%), Gaps = 8/247 (3%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M    V  L  +FGLLGNI+S  VFLAP+PTF++IYK+K+S+G+Q IPYVVAL SA LLL
Sbjct  1    MKAFRVLQLQFIFGLLGNIISLMVFLAPVPTFWRIYKKKTSEGFQCIPYVVALMSAMLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVIIV  618
            YYAV+KTNAYL++ IN FGC IEL++I++Y +YA KK KIFT+KLL+ L++  +G ++  
Sbjct  61   YYAVLKTNAYLLISINSFGCVIELIYIALYFYYAPKKLKIFTLKLLMILNLGSYGVMVGG  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            ++ +++G+KR   VGW CA  N+AVFA+PL+IM++VIRT++ ++MP  LS  L   AT W
Sbjct  121  TMLILHGNKRTHAVGWICAAFNLAVFASPLTIMKRVIRTKSVEYMPFFLSFFLTLSATMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK-------EEDGKGAEYKEGIEI  279
            FFYG F KD +IA PNI+GFL G+ Q+++Y +YKD K        EE GK  E  +    
Sbjct  181  FFYGFFIKDLFIALPNIVGFLLGMVQMIMYMIYKDRKGNSLEEKLEEGGKNYEVDDQSLS  240

Query  278  QVKNDGR  258
            +VK   +
Sbjct  241  KVKKSNQ  247



>ref|XP_003523161.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Glycine 
max]
 gb|KHN31282.1| Bidirectional sugar transporter SWEET14-like protein [Glycine 
soja]
Length=258

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/281 (47%), Positives = 195/281 (69%), Gaps = 32/281 (11%)
 Frame = -2

Query  965  LSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYA  786
            +S +  A +FGLLGN++SF VFLAP+PTFY+IYK+KSS+G+QS+PYVVALFS+ L +YYA
Sbjct  3    ISHETWAFIFGLLGNVISFMVFLAPLPTFYQIYKKKSSEGFQSLPYVVALFSSMLWIYYA  62

Query  785  VIKTNA-YLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVIIVSL  612
            ++K +A  L++ IN FGC IE ++++++L YA  K +++TIKLLL L++  FG +++ +L
Sbjct  63   LVKKDASLLLITINSFGCVIETIYLAIFLVYAPSKTRLWTIKLLLMLNVFGFGGMLLSTL  122

Query  611  FLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFF  432
            +L  GSKR++++GW C V N++VFAAPL IM++VI+TR+ +FMP +LS+ L   A  WFF
Sbjct  123  YLTTGSKRLSVIGWICLVFNISVFAAPLCIMKRVIKTRSVEFMPFSLSLSLTINAVMWFF  182

Query  431  YGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQVKNDGRR*  252
            YGL  KDYYIA PN LGFLFG+ Q+VLY +Y+++K +        +E  ++Q        
Sbjct  183  YGLLLKDYYIALPNTLGFLFGIIQMVLYLVYRNAKPQ------TLEEPTKVQ--------  228

Query  251  I*QRIEVTGRRSDVLRTVLIKPHHARQLMMFQLNCHVYLIN  129
                 E+ G   DV     +KP+HA +      N HV +I 
Sbjct  229  -----ELNGHIIDV-----VKPNHATK------NGHVPVIE  253



>ref|XP_007030240.1| Nodulin MtN3 family protein isoform 1 [Theobroma cacao]
 gb|EOY10742.1| Nodulin MtN3 family protein isoform 1 [Theobroma cacao]
Length=301

 Score =   263 bits (672),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 183/238 (77%), Gaps = 7/238 (3%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            M  L+  H LA +FGLLGNIVSF VFLAP+PTFY+I K+K+++GY SIPY+VAL SA +L
Sbjct  1    MGFLAPHHQLAFIFGLLGNIVSFLVFLAPVPTFYQICKKKTAEGYHSIPYMVALSSAMML  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVII  621
            LYY ++KTNA LI+ IN  GCAIE+V++ +Y+ YA K++K+ T+K +LL ++  +G +I+
Sbjct  61   LYYGILKTNAVLIISINVIGCAIEIVYLVLYIIYAPKREKVSTMKFILLFNMGGYGLIIL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++  L  GSKR+ ++GW CAV NVAVFA+PLSIMR V+RT++ + MP +LS+ L  CAT 
Sbjct  121  LTNLLTEGSKRVTVMGWICAVYNVAVFASPLSIMRHVVRTKSVEHMPFSLSLFLTLCATM  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQVKN  267
            WFFYGLF  D++IA PN+LGFLFG+AQ++LY  YK++ K+      E ++ ++I++K 
Sbjct  181  WFFYGLFMMDFFIALPNVLGFLFGIAQMILYVTYKNANKD-----VEMQKEVDIELKQ  233



>ref|XP_007139174.1| hypothetical protein PHAVU_008G007600g [Phaseolus vulgaris]
 gb|ESW11168.1| hypothetical protein PHAVU_008G007600g [Phaseolus vulgaris]
Length=259

 Score =   261 bits (667),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 133/229 (58%), Positives = 172/229 (75%), Gaps = 1/229 (0%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M   S   + L+FGLLGNIVSF VFLAP+PTFYKIYK KSS+G+QSIPYVVAL SA LLL
Sbjct  1    MVSFSDHEMVLIFGLLGNIVSFLVFLAPLPTFYKIYKNKSSEGFQSIPYVVALLSALLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIV  618
            YY  IKTNA LIV IN  GC IE+ +++MY+ YA+KK KI T+ ++L+ D+  FG  +++
Sbjct  61   YYGFIKTNALLIVTINCIGCVIEVTYLAMYIIYAHKKQKISTLVMILIADVGGFGLTMLI  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            S F V G  R+  VGW CA+ N+AVFAAPLSIMR+VI+T++ ++MP +LS+ L  CAT W
Sbjct  121  STFAVKGIARVHAVGWICAIFNIAVFAAPLSIMRKVIKTKSVEYMPFSLSLFLTLCATMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKE  291
            FFYGLF KD +I  PN+LGFLFG++Q++LY +YK+  K      AE +E
Sbjct  181  FFYGLFDKDEFIMLPNVLGFLFGISQMILYIIYKNVGKNTKTNCAEQQE  229



>ref|XP_006578712.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Glycine 
max]
 gb|KHN31281.1| Bidirectional sugar transporter SWEET14-like protein [Glycine 
soja]
Length=282

 Score =   261 bits (667),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/231 (54%), Positives = 177/231 (77%), Gaps = 4/231 (2%)
 Frame = -2

Query  965  LSVQH--LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLY  792
            +++ H   A +FGLLGN++SF VFLAP+PTFY+IYK+KSS+G+QS+PYVVALFS+ L +Y
Sbjct  1    MAIHHETWAFVFGLLGNVISFMVFLAPLPTFYQIYKKKSSEGFQSLPYVVALFSSMLWIY  60

Query  791  YAVIKTNA-YLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVIIV  618
            YA +K +A  L++ IN FGC IE ++++++L YA  K +++TIKLLL L++  FGA+++ 
Sbjct  61   YAFVKKDASLLLITINSFGCVIETIYLAIFLVYAPSKTRLWTIKLLLMLNVFGFGAMLLS  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            +L+L  GSKR+ ++GW C V N++VFAAPL IM++VI+T++ +FMP +LS  L   A  W
Sbjct  121  TLYLTTGSKRLTVIGWICLVFNISVFAAPLCIMKRVIKTKSVEFMPFSLSFSLTINAVMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGI  285
            FFYGL  KDYYIA PN LGFLFG+ Q+VLY +Y+++KK+E  K  E    I
Sbjct  181  FFYGLLLKDYYIALPNTLGFLFGIIQMVLYLIYRNAKKDEPMKLEELNSHI  231



>ref|XP_008441812.1| PREDICTED: bidirectional sugar transporter NEC1-like [Cucumis 
melo]
Length=262

 Score =   260 bits (664),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/232 (54%), Positives = 175/232 (75%), Gaps = 4/232 (2%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M  LS   L  +FGLLGNI+SF VFLAP+PTF+ IYK+K+S+G+QSIPYVVAL SA LLL
Sbjct  1    MNGLSAHQLQFIFGLLGNIISFLVFLAPMPTFWTIYKKKTSEGFQSIPYVVALMSAMLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKL-LLLDILFFGAVIIV  618
            YYA +KT+AYL++ IN FGC IE+++I++YLFYA KK KIFT+KL ++ ++   G ++  
Sbjct  61   YYAALKTDAYLLISINSFGCVIEVIYIALYLFYAPKKQKIFTLKLFIIFNLGCSGVMVGG  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            ++  ++G KR   VGW CA  N++VFA+PLSIM++VIRT++ ++MP  LS  L   AT W
Sbjct  121  TMVFLHGMKRTNAVGWICAAFNLSVFASPLSIMKRVIRTKSVEYMPFFLSFFLTLSATMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSK---KEEDGKGAEYKE  291
            FFYG F KD +IA PN++GFL G+ Q+++Y +YKD K   +E+  +GA++ E
Sbjct  181  FFYGFFIKDLFIALPNVVGFLLGMVQMIMYMIYKDRKGKVEEKLDEGAKFWE  232



>ref|XP_011069431.1| PREDICTED: bidirectional sugar transporter NEC1-like, partial 
[Sesamum indicum]
Length=236

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 165/214 (77%), Gaps = 3/214 (1%)
 Frame = -2

Query  887  PTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKTNAYLIVCINGFGCAIELVFISM  708
            PTFY I+K+KSS+G+QSIPY VA  SA LLLYYA +KTNAY+IV ING GC IE++++ +
Sbjct  4    PTFYTIWKKKSSEGFQSIPYSVAFLSASLLLYYAFLKTNAYMIVSINGIGCVIEMIYLLI  63

Query  707  YLFYANKKDKIFTIKLLLL-DILFFGAVIIVSLFLVNGSKRIALVGWTCAVINVAVFAAP  531
            Y+ YA KK ++FTIKL++L +    G V++VSL    GSKR++LVGW CA+ N+AVFAAP
Sbjct  64   YITYAPKKARMFTIKLVVLFNFGGMGLVMLVSLLAYKGSKRVSLVGWACAIFNLAVFAAP  123

Query  530  LSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFSKDYYIAFPNILGFLFGLAQIVL  351
            LSIMR+VIRT++ +FMP TLS  L  CAT WFFYG F KDYYIA PN+LGFLFG+AQ++L
Sbjct  124  LSIMRRVIRTKSVEFMPFTLSFFLTLCATMWFFYGFFVKDYYIALPNVLGFLFGIAQMIL  183

Query  350  YCMYKDSKKEEDGKGAEYK--EGIEIQVKNDGRR  255
            Y +YK++KKE + K  E +  + +E++   D  +
Sbjct  184  YFIYKNAKKEVESKNVELETSKDVELETSKDVEK  217



>gb|ACU23483.1| unknown [Glycine max]
Length=258

 Score =   259 bits (663),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/281 (47%), Positives = 193/281 (69%), Gaps = 32/281 (11%)
 Frame = -2

Query  965  LSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYA  786
            +S +  A +FGLLGN++SF VFLAP+PTFY+IYK+KSS+G+QS+PYVVALFS+ L +YYA
Sbjct  3    ISHETWAFIFGLLGNVISFMVFLAPLPTFYQIYKKKSSEGFQSLPYVVALFSSMLWIYYA  62

Query  785  VIKTNA-YLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVIIVSL  612
            ++K +A  L++ IN FGC IE + ++++L YA  K +++TIKLLL L++  FG +++ +L
Sbjct  63   LVKKDASLLLITINSFGCVIETIHLAIFLVYAPSKTRLWTIKLLLMLNVFGFGGMLLSTL  122

Query  611  FLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFF  432
            +L  GSKR++++GW C V N++VFAAPL IM++VI+TR+ +FMP +LS  L   A  WFF
Sbjct  123  YLTTGSKRLSVIGWICLVFNISVFAAPLCIMKRVIKTRSVEFMPFSLSSSLTINAVMWFF  182

Query  431  YGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQVKNDGRR*  252
            YGL  KDYYIA PN LGFLFG+ Q+VLY +Y+++K +        +E  ++Q        
Sbjct  183  YGLLLKDYYIALPNTLGFLFGIIQMVLYLVYRNAKPQ------TLEEPTKVQ--------  228

Query  251  I*QRIEVTGRRSDVLRTVLIKPHHARQLMMFQLNCHVYLIN  129
                 E+ G   DV     +KP+HA +      N HV +I 
Sbjct  229  -----ELNGHIIDV-----VKPNHATK------NGHVPVIE  253



>ref|XP_003552719.1| PREDICTED: bidirectional sugar transporter NEC1-like [Glycine 
max]
Length=262

 Score =   259 bits (663),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/229 (58%), Positives = 172/229 (75%), Gaps = 1/229 (0%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M L S   L L+FGLLGNIVSF VFLAP+PTFY IYK KSS+G+QSIPYVVAL SA LLL
Sbjct  1    MVLFSDHELVLIFGLLGNIVSFMVFLAPLPTFYTIYKNKSSEGFQSIPYVVALLSALLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIV  618
            YY  IKTNA LI+ IN  GC IE+ +++MY+ YA +K KI T+ ++L+ DI  FG  +++
Sbjct  61   YYGFIKTNATLIITINCIGCVIEVSYLAMYIIYAPRKQKISTLVMILIADIGGFGLTMLI  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            + F V G  R+  VGW CA+ N+AVFAAPLSIMR+VI+T++ +FMP +LS+ L  CAT W
Sbjct  121  TTFAVKGINRVHAVGWICAIFNIAVFAAPLSIMRRVIKTKSVEFMPFSLSLFLTLCATMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKE  291
            FFYG F KD +I  PN+LGFLFG++Q++LY +YK++KK  +    E +E
Sbjct  181  FFYGFFDKDNFIMLPNVLGFLFGISQMILYMIYKNAKKNGEINCTEQQE  229



>ref|XP_008218389.1| PREDICTED: bidirectional sugar transporter NEC1-like [Prunus 
mume]
Length=197

 Score =   256 bits (655),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 155/193 (80%), Gaps = 1/193 (1%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M  LS + LA +FGLLGNIVSF VFLAPIPTFY IYK+KSS G+QSIPYVVAL SA LLL
Sbjct  1    MKFLSNEQLAFVFGLLGNIVSFMVFLAPIPTFYTIYKQKSSKGFQSIPYVVALLSATLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIV  618
            YY V+KTNA+LI+ ING GC IE++++  Y+ YA+KKDKI T+ L+LL ++  FG V  V
Sbjct  61   YYGVLKTNAFLIISINGVGCVIEIIYLIFYIVYASKKDKITTMSLILLVNVAAFGLVTAV  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            ++FL+  +KR++ VGW CAV N+AVFAAPLSIMRQVIRT + ++MP +LS  L  CAT W
Sbjct  121  TVFLLGEAKRLSAVGWMCAVFNIAVFAAPLSIMRQVIRTNSVEYMPFSLSFFLTLCATMW  180

Query  437  FFYGLFSKDYYIA  399
            FFYGLF+KDYYIA
Sbjct  181  FFYGLFTKDYYIA  193



>ref|XP_008389034.1| PREDICTED: bidirectional sugar transporter NEC1-like [Malus domestica]
Length=267

 Score =   259 bits (661),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 160/214 (75%), Gaps = 3/214 (1%)
 Frame = -2

Query  923  NIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKTNAYLIVCING  744
            NIVSF  FLAPIPTFY IYK+KSS G+QSIPYV+AL SA LLLYY V+KTNAYLI+ IN 
Sbjct  18   NIVSFMTFLAPIPTFYTIYKKKSSKGFQSIPYVIALLSATLLLYYGVLKTNAYLIISINS  77

Query  743  FGCAIELVFISMYLFYANKKDKIFT-IKLLLLDILFFGAVIIVSLFLVNGSKRIALVGWT  567
             G  IE+ ++ +Y+ YA+K DKI T I +LL+++   G V+ V+ FL+ G+ RI+ VGW 
Sbjct  78   IGIVIEVTYLILYIVYASKNDKITTLIWILLVNVAALGLVLAVTFFLLGGTVRISAVGWI  137

Query  566  CAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFSKDYYIAFPNI  387
            CAV N+AVFAA LSIMRQVIRT++ +FMP +LS  L  CAT WFFYG F+KDYYIA PN+
Sbjct  138  CAVFNIAVFAAXLSIMRQVIRTKSVEFMPFSLSFFLTLCATMWFFYGFFTKDYYIALPNV  197

Query  386  LGFLFGLAQIVLYCMYKDS--KKEEDGKGAEYKE  291
            LGFL G+AQ++LY  YK S    EE     E K+
Sbjct  198  LGFLXGIAQMILYMTYKTSGNNXEEKKSTQEMKK  231



>gb|KHN17298.1| Bidirectional sugar transporter NEC1 [Glycine soja]
Length=262

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/229 (57%), Positives = 172/229 (75%), Gaps = 1/229 (0%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M L S   L L+FGLLGNIVSF VFLAP+PTFY IYK KSS+G+QSIPYVVAL SA LLL
Sbjct  1    MVLFSDHELVLIFGLLGNIVSFMVFLAPLPTFYTIYKNKSSEGFQSIPYVVALLSALLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIV  618
            YY  IKTNA LI+ IN  GC IE+ +++MY+ YA +K KI T+ ++L+ DI  FG  +++
Sbjct  61   YYGFIKTNATLIITINCIGCVIEVSYLAMYIIYAPRKQKISTLVMILIADIGGFGLTMLI  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            + F V G  R+  VGW CA+ N+AVFAAPLSIMR+VI+T++ +FMP +LS+ L  CAT W
Sbjct  121  TTFAVKGINRVHAVGWICAIFNIAVFAAPLSIMRRVIKTKSVEFMPFSLSLFLTLCATMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKE  291
            FFYG F +D +I  PN+LGFLFG++Q++LY +YK++KK  +    E +E
Sbjct  181  FFYGFFDEDNFIMLPNVLGFLFGISQMILYMIYKNAKKNGEINCTEQQE  229



>ref|XP_010999465.1| PREDICTED: bidirectional sugar transporter SWEET9 [Populus euphratica]
Length=240

 Score =   257 bits (657),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/239 (54%), Positives = 178/239 (74%), Gaps = 2/239 (1%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M  LS  HL  LFGLLGNIV+  +FLAP PTFY I+KRKSS+G+QSIPY VAL SA LLL
Sbjct  1    MGFLSNDHLTFLFGLLGNIVAPGMFLAPAPTFYTIFKRKSSEGFQSIPYSVALMSASLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIV  618
            YY ++KTNAYL++ IN  GCA E+ ++ +YL YA K++K+ T+KLLL+ ++  FG V+++
Sbjct  61   YYGLLKTNAYLLISINSIGCAFEVTYLIIYLIYAPKQEKMHTMKLLLIFNMGSFGVVLLL  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            ++ L+ G  R+++VGW CAV +VAV AAPLSIMR+V+RT++ +++  TLS  +   A  W
Sbjct  121  TMLLMKGKPRLSVVGWICAVFSVAVCAAPLSIMRRVVRTKSVEYLSFTLSASITLNAVMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIE-IQVKND  264
            FFYGL   DYYIA PN+LGFLFG+AQ++LY +YK++KK  + K  +     E +Q+ N+
Sbjct  181  FFYGLLQHDYYIALPNVLGFLFGIAQMILYMVYKNAKKNVEEKSEQLAGNKEVVQMTNE  239



>gb|KHN23963.1| Bidirectional sugar transporter SWEET14 [Glycine soja]
Length=258

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/269 (48%), Positives = 192/269 (71%), Gaps = 28/269 (10%)
 Frame = -2

Query  965  LSVQH--LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLY  792
            +++ H   A +FGLLGN++SF VFLAP+PTFY+IYK+KS+DG+QS+PY+VALFS+ L +Y
Sbjct  1    MAINHETWAFIFGLLGNVISFMVFLAPLPTFYQIYKKKSTDGFQSLPYIVALFSSMLWIY  60

Query  791  YAVIKTNA-YLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVIIV  618
            YA++K +A  L++ IN FGC IE ++++++L YA  K +++TIKLLL L++  FGA+++ 
Sbjct  61   YALVKKDASLLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAMLLS  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            +L+L  GSKR++++GW C V+N++VFAAPL IM++VI+T++ +FMP +LS  L   A  W
Sbjct  121  TLYLTTGSKRLSVIGWICLVLNISVFAAPLCIMKRVIKTKSVEFMPFSLSFFLTINAVMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQVKNDGR  258
            FFYGL  KDYYIA PN LGFLFG+ Q+VLY +Y+++K +    G E  E  ++Q      
Sbjct  181  FFYGLLLKDYYIALPNTLGFLFGIIQMVLYLIYRNAKPQ----GLE--EPTKVQ------  228

Query  257  R*I*QRIEVTGRRSDVLRTVLIKPHHARQ  171
                   E+ G   DV     +KP+H  +
Sbjct  229  -------ELNGHIIDV-----VKPNHVTK  245



>ref|XP_002270131.1| PREDICTED: bidirectional sugar transporter SWEET14 [Vitis vinifera]
Length=276

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/229 (56%), Positives = 172/229 (75%), Gaps = 5/229 (2%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MA+L+V H+A  FG+LGNIVSF V+L+P+PTFY+IYKRKS++G+QSIPY VALFSA LLL
Sbjct  1    MAMLTVPHMAFAFGILGNIVSFLVYLSPLPTFYRIYKRKSTEGFQSIPYSVALFSAMLLL  60

Query  794  YYAVIKT-NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVII  621
            YYA +KT N  +++ IN  G  IE  ++ +Y+ YA +  KI+T KLLLL +   +GA+++
Sbjct  61   YYAFLKTDNQIMLITINSVGTCIEATYLLVYMIYAPRTAKIYTAKLLLLFNTGVYGAIVL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
             + FL  G +R  +VGW CA  ++ VFAAPLSIMR VIRT++ ++MP  LS  L  CA  
Sbjct  121  STFFLSKGHRRAKIVGWVCAAFSLCVFAAPLSIMRLVIRTKSVEYMPFPLSFFLTICAVM  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYK  294
            WFFYGL  +D+YIAFPNILGF FG+AQ++LY +YK++KK   G  AE+K
Sbjct  181  WFFYGLLIRDFYIAFPNILGFAFGIAQMILYTIYKNAKK---GVLAEFK  226



>emb|CBI32263.3| unnamed protein product [Vitis vinifera]
Length=341

 Score =   259 bits (662),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 128/229 (56%), Positives = 172/229 (75%), Gaps = 5/229 (2%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MA+L+V H+A  FG+LGNIVSF V+L+P+PTFY+IYKRKS++G+QSIPY VALFSA LLL
Sbjct  1    MAMLTVPHMAFAFGILGNIVSFLVYLSPLPTFYRIYKRKSTEGFQSIPYSVALFSAMLLL  60

Query  794  YYAVIKT-NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVII  621
            YYA +KT N  +++ IN  G  IE  ++ +Y+ YA +  KI+T KLLLL +   +GA+++
Sbjct  61   YYAFLKTDNQIMLITINSVGTCIEATYLLVYMIYAPRTAKIYTAKLLLLFNTGVYGAIVL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
             + FL  G +R  +VGW CA  ++ VFAAPLSIMR VIRT++ ++MP  LS  L  CA  
Sbjct  121  STFFLSKGHRRAKIVGWVCAAFSLCVFAAPLSIMRLVIRTKSVEYMPFPLSFFLTICAVM  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYK  294
            WFFYGL  +D+YIAFPNILGF FG+AQ++LY +YK++KK   G  AE+K
Sbjct  181  WFFYGLLIRDFYIAFPNILGFAFGIAQMILYTIYKNAKK---GVLAEFK  226



>ref|XP_004489106.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Cicer 
arietinum]
Length=254

 Score =   256 bits (653),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 128/242 (53%), Positives = 175/242 (72%), Gaps = 5/242 (2%)
 Frame = -2

Query  977  KMALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            KM   S   + L+FGLLGNIVSF VFLAP+PTFY I K+K+S+G+QSIPYVVAL SA LL
Sbjct  3    KMFTFSDHEMVLIFGLLGNIVSFLVFLAPLPTFYSICKKKTSEGFQSIPYVVALLSAMLL  62

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVII  621
            LYY ++KTNA LI+ IN  GC IE++++ +Y+ YA +K KI T+ L+L+ D+   G  +I
Sbjct  63   LYYGLLKTNAILIITINCIGCVIEVLYLIIYIIYAPRKLKISTLALILVADLGGLGLTLI  122

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++ F+V    R+  VG  CA+ N+AVFAAPLSIMR+VI+TR+ ++MP  LS+ L  CAT 
Sbjct  123  ITNFIVKSYYRVHAVGLICAIFNIAVFAAPLSIMRKVIKTRSVEYMPFFLSLFLTLCATM  182

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQVKNDG  261
            WFFYGLF KD YI  PN+LGFLFG++Q++LY +YK++K + +    E +E       +DG
Sbjct  183  WFFYGLFDKDNYIMLPNVLGFLFGISQMILYLIYKNAKNKVEANSNEQQE----YGDDDG  238

Query  260  RR  255
             +
Sbjct  239  NK  240



>ref|XP_009765830.1| PREDICTED: bidirectional sugar transporter NEC1-like [Nicotiana 
sylvestris]
Length=278

 Score =   256 bits (655),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 124/234 (53%), Positives = 171/234 (73%), Gaps = 2/234 (1%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MA+ +  HLA +FG+LGN VSF V+L+PIPTFY+IYKRKS++G+QSIPY VALFSA L L
Sbjct  1    MAIFTASHLAFVFGVLGNGVSFLVYLSPIPTFYRIYKRKSTEGFQSIPYSVALFSAMLYL  60

Query  794  YYAVIKT-NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKL-LLLDILFFGAVII  621
            YYA +K  N  L++ IN FG AIE ++++++L YA ++ KI+T KL LLL+I  FGA++ 
Sbjct  61   YYAYLKEKNGILLITINSFGTAIEFIYLTIFLMYATREAKIYTTKLVLLLNIGSFGAIVA  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++        R+ +VGW CAV +V VFAAPLSIMR+VI+TR+ +FMP  LS  L  CA  
Sbjct  121  LTYIFAKDKTRVTIVGWICAVFSVCVFAAPLSIMRRVIKTRSVEFMPFPLSFFLTICAVM  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEI  279
            WFFYGL  KD YIA PNILGF FG+AQ++LY ++++ K++     +  K+  ++
Sbjct  181  WFFYGLLIKDMYIATPNILGFTFGIAQMILYAIFRNRKQQIQPADSNLKDLTQV  234



>ref|XP_009609628.1| PREDICTED: bidirectional sugar transporter NEC1-like [Nicotiana 
tomentosiformis]
Length=277

 Score =   256 bits (654),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/234 (53%), Positives = 171/234 (73%), Gaps = 2/234 (1%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MA+ +   LA +FG+LGN VSF V+L+PIPTFY+IYKRKS++G+QSIPY VALFSA L L
Sbjct  1    MAIFTASQLAFVFGVLGNGVSFLVYLSPIPTFYRIYKRKSTEGFQSIPYSVALFSAMLYL  60

Query  794  YYAVIKT-NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKL-LLLDILFFGAVII  621
            YYA +K  N  L+V IN FG AIEL++++++L YA ++ KI+T KL LLL+I  +GA++ 
Sbjct  61   YYAYLKEKNGILLVTINSFGTAIELIYLTIFLIYATREAKIYTTKLVLLLNIGSYGAIVA  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++        R+ +VGW CAV +V VFAAPLSIMR+VIRTR+ +FMP  LS  L  CA  
Sbjct  121  LTYIFAKDETRVTIVGWICAVFSVCVFAAPLSIMRRVIRTRSVEFMPFPLSFFLTICAVM  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEI  279
            WFFYGL  KD YIA PNILGF FG+AQ++LY ++++ K++     +  K+  ++
Sbjct  181  WFFYGLLIKDMYIATPNILGFTFGIAQMILYAIFRNRKQQIQPADSNLKDLTQV  234



>ref|XP_006844581.1| hypothetical protein AMTR_s00016p00202420 [Amborella trichopoda]
 gb|ERN06256.1| hypothetical protein AMTR_s00016p00202420 [Amborella trichopoda]
Length=282

 Score =   256 bits (654),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/219 (56%), Positives = 169/219 (77%), Gaps = 2/219 (1%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA LSV H  A  FGLLGNI+SF V+L+P+PTF+++YK+KS++G+QS+PYVVALFSA L 
Sbjct  1    MAFLSVHHPWAFTFGLLGNIISFMVYLSPLPTFHRVYKKKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKL-LLLDILFFGAVII  621
            +YYA++KT+ YL++ IN  GC IE ++I+MY+ YA KK KI T KL +LL++  F  +++
Sbjct  61   IYYALLKTDGYLLITINTLGCIIESIYITMYIIYAPKKAKIATAKLVVLLNLGVFCMILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++LF V G KR+ ++GW C   +V VFAAPLSIMR VI+T++ +FMP +LS  L   A  
Sbjct  121  LTLFFVQGPKRVRVLGWVCVTFSVCVFAAPLSIMRLVIQTKSVEFMPFSLSFSLTLSAVM  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK  324
            WF YGL +KD+YIA PN+LGF+FG+ Q+VLY +YK +KK
Sbjct  181  WFSYGLLTKDFYIALPNVLGFIFGIIQMVLYIIYKGTKK  219



>gb|KEH21559.1| bidirectional sugar transporter [Medicago truncatula]
Length=253

 Score =   254 bits (649),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 173/235 (74%), Gaps = 2/235 (1%)
 Frame = -2

Query  962  SVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAV  783
            S   + L+FGLLGNIVSF VFLAP+PTFY IYK+KSS+GYQSIPYVVAL SA LLLYY  
Sbjct  5    SDHEMVLIFGLLGNIVSFMVFLAPLPTFYSIYKKKSSEGYQSIPYVVALLSALLLLYYGF  64

Query  782  IKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIVSLFL  606
            +KTNA LI+ IN  GC IE+ ++ MY+ YA KK KI T+  +L+ D+  FG  +I++ F+
Sbjct  65   LKTNAILIITINCIGCVIEVAYLIMYIIYAPKKLKISTLVFILVADLGGFGLTMIITFFV  124

Query  605  VNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYG  426
            V  S R+  VG  CA+ N+AVFAAPLSIMR+VIRTR+ ++MP +LS+ L  CAT WFFYG
Sbjct  125  VKSSFRVHAVGLICAIFNIAVFAAPLSIMRKVIRTRSVEYMPFSLSLFLTLCATMWFFYG  184

Query  425  LFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSK-KEEDGKGAEYKEGIEIQVKND  264
            LF KD YI  PN+LGFLFG++Q++LY +YK++K K E     E + G +   K D
Sbjct  185  LFDKDNYIMLPNVLGFLFGVSQMILYLIYKNAKNKVETNSTEEQEHGCDDGNKQD  239



>gb|KDP28088.1| hypothetical protein JCGZ_13859 [Jatropha curcas]
Length=272

 Score =   254 bits (650),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/256 (49%), Positives = 180/256 (70%), Gaps = 7/256 (3%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MAL S  HL L+FGLLGN +SFFV+LAP+PTFY+I+K+KS++G+QSIPY VALFSA L L
Sbjct  1    MALHS-SHLVLVFGLLGNAISFFVYLAPLPTFYRIFKKKSTEGFQSIPYSVALFSAMLTL  59

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIV  618
            YY  +K + ++++ IN  GC IE +++ +Y+ YANK  +I+T+K+L+L + + +  ++++
Sbjct  60   YYGTLKADGFMLITINSVGCVIEALYLIIYMIYANKSSRIYTLKILVLFNTIAYLLIVVL  119

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            + FL +GS+R+ +VGW CAV +V+VFAAPLSIMR VIRT++ ++MP +LS  L  CAT+W
Sbjct  120  TTFLSHGSQRVNVVGWICAVFSVSVFAAPLSIMRLVIRTKSVEYMPFSLSFFLTLCATSW  179

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKE--EDGKGAEYKEGIEIQVKND  264
              YGL  +DYYIA PN+ GF FG+AQ++LY +YK  K E   + K  E         K+D
Sbjct  180  LGYGLAVEDYYIATPNVFGFGFGIAQMILYLIYKKKKNEILPETKSQELASEPCQMCKDD  239

Query  263  GRR*I*QRIEVTGRRS  216
                   + E    RS
Sbjct  240  DNS---NQTEEEAERS  252



>ref|XP_010242697.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Nelumbo 
nucifera]
Length=276

 Score =   254 bits (650),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 167/219 (76%), Gaps = 1/219 (0%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MA+ +   L   FG+LGNIVS  V+LAP+PTFY+IYK+KS++G+QSIPYVVALFSA L +
Sbjct  1    MAITNSHTLVFAFGILGNIVSCAVYLAPVPTFYRIYKKKSTEGFQSIPYVVALFSAMLWI  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVIIV  618
            YYA++KTN  +++ ING GC IE ++I++YL YA K  KIFT+K LLLL++  +G ++++
Sbjct  61   YYALLKTNVTMLITINGIGCTIETIYITLYLVYAPKGTKIFTVKLLLLLNMGAYGLILLL  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            S     G  R+ +VGW CA  +V VFAAPLSIMR+VIRT++ +FMP++LS  L  CA  W
Sbjct  121  SFLFFKGFGRVTVVGWVCAGFSVIVFAAPLSIMRRVIRTKSVEFMPISLSFFLTLCAVFW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKE  321
            FFYG+  KD YIA PN+LGF  G+AQ++LY +Y+DSKK 
Sbjct  181  FFYGILMKDLYIAIPNVLGFALGVAQMILYIIYRDSKKH  219



>gb|KCW61425.1| hypothetical protein EUGRSUZ_H04154 [Eucalyptus grandis]
Length=241

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 158/230 (69%), Gaps = 28/230 (12%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MA  + + LA +FGLLGNIVSF VFLAPIPTFY I+K+KSSDGYQSIPYVVAL SA LLL
Sbjct  1    MAFSNEKELAFIFGLLGNIVSFLVFLAPIPTFYAIFKKKSSDGYQSIPYVVALSSASLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDILFFGAVIIVS  615
            YY V+KTNA +I+ IN  G  IEL ++ ++L YA+ K+K                     
Sbjct  61   YYGVLKTNATMIISINAIGIVIELTYLILFLIYASTKEK---------------------  99

Query  614  LFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWF  435
                 G +R+  VGW CA  N+AVFAAPLSIMR+VI+T++ +FMP TLS  L  CATAWF
Sbjct  100  -----GPQRVDAVGWICAAFNLAVFAAPLSIMRRVIKTKSVEFMPFTLSFFLTLCATAWF  154

Query  434  FYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYK--DSKKEEDGKGAEYKE  291
            FYGLF KD +IA PN LGFLFG+AQ++LY +YK  + K  E  KG+  +E
Sbjct  155  FYGLFVKDMFIALPNTLGFLFGIAQMILYMIYKYGNKKLAETDKGSNQQE  204



>ref|XP_004297512.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Fragaria 
vesca subsp. vesca]
Length=292

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 174/233 (75%), Gaps = 6/233 (3%)
 Frame = -2

Query  965  LSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYY  789
            +++ H L L FGLLGNI+SF VFLAP+PTFYKIYK+K+++G+Q++PY VALFS  L +YY
Sbjct  1    MAIHHPLTLAFGLLGNIISFMVFLAPMPTFYKIYKKKTTEGFQALPYAVALFSCMLWIYY  60

Query  788  AVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVIIVSL  612
            A++K +A  ++ IN  GC IE V+++++LFY+ KK +I T+K LLLL++L +G +++++L
Sbjct  61   ALLKQDATFLITINSVGCVIETVYLAIFLFYSPKKARISTVKFLLLLNVLGYGLMLVLTL  120

Query  611  FLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFF  432
            FL  G  R+ +VGW C V N+ VFAAPL I+++VIRT++ +FMP  LS  L   A  WFF
Sbjct  121  FLAKGEIRLKVVGWICLVFNLTVFAAPLCILKKVIRTKSVEFMPFPLSFFLTLGAVMWFF  180

Query  431  YGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK----EEDGKGAEYKEGI  285
            YG   KDY IAFPNILGF+FG+AQ+VLY +YK++KK    EE  K  E  + I
Sbjct  181  YGFLLKDYNIAFPNILGFMFGIAQMVLYIVYKNAKKVVLLEEPSKVQELSDHI  233



>ref|NP_001242732.1| uncharacterized protein LOC100810962 [Glycine max]
 gb|ACU20322.1| unknown [Glycine max]
Length=258

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/269 (47%), Positives = 190/269 (71%), Gaps = 28/269 (10%)
 Frame = -2

Query  965  LSVQH--LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLY  792
            +++ H   A +FGLLGN++SF VFLA +PT Y+IYK+KS+DG+QS+PY+VALFS+ L +Y
Sbjct  1    MAINHETWAFIFGLLGNVISFMVFLASLPTLYQIYKKKSTDGFQSLPYIVALFSSMLWIY  60

Query  791  YAVIKTNA-YLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVIIV  618
            YA++K +A  L++ IN FGC IE ++++++L YA  K +++TIKLLL L++  FGA+++ 
Sbjct  61   YALVKKDASLLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAMLLS  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            +L+L  GSKR++++GW C V+N++VFAAPL IM++VI+T++ +FMP +LS  L   A  W
Sbjct  121  TLYLTTGSKRLSVIGWICLVLNISVFAAPLCIMKRVIKTKSVEFMPFSLSFFLTINAVMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQVKNDGR  258
            FFYGL  KDYYIA PN LGFLFG+ Q+VLY +Y+++K +    G E  E  ++Q      
Sbjct  181  FFYGLLLKDYYIALPNTLGFLFGIIQMVLYLIYRNAKPQ----GLE--EPTKVQ------  228

Query  257  R*I*QRIEVTGRRSDVLRTVLIKPHHARQ  171
                   E+ G   DV     +KP+H  +
Sbjct  229  -------ELNGHIIDV-----VKPNHVTK  245



>ref|XP_010674202.1| PREDICTED: bidirectional sugar transporter NEC1-like [Beta vulgaris 
subsp. vulgaris]
Length=262

 Score =   251 bits (642),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 126/237 (53%), Positives = 170/237 (72%), Gaps = 9/237 (4%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M  L+VQ LA +FG+LGNIVS  VFL+P+PTFY+IYKRKSS+GY+S+PY V LFSA +LL
Sbjct  1    MTTLTVQTLAAIFGILGNIVSVGVFLSPVPTFYRIYKRKSSEGYKSLPYAVGLFSAMMLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIV  618
            YY  +K    L++ IN FGC IE++++ ++L YA K+ K FT+KL+LL ++     V+++
Sbjct  61   YYGSLKPGGILLITINSFGCFIEVIYLVIFLVYAPKESKYFTLKLILLFNLGACSLVMLL  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            +  L  GSKRI +VGW  AVIN+ VFAAP+SIMRQVI+TR+ +FMP++LS+ L   A  W
Sbjct  121  TTLLCKGSKRITVVGWINAVINLCVFAAPMSIMRQVIKTRSVEFMPISLSLALTLNACMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYK--------DSKKEEDGKGAEYKE  291
            FFYG F KDY+IA PNILGFL G+ Q+ LY  YK        DS  +E  K + + +
Sbjct  181  FFYGFFLKDYFIAGPNILGFLLGIVQMTLYIFYKWCNSKIGQDSNHDETSKESNHDD  237



>ref|XP_004138978.1| PREDICTED: bidirectional sugar transporter NEC1-like [Cucumis 
sativus]
Length=236

 Score =   251 bits (640),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 160/206 (78%), Gaps = 1/206 (0%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M  LSV  L  +FGLLGNI+SF VFLAP+PTF+ IYK+K+S+G+QSIPYVVAL SA LLL
Sbjct  1    MNGLSVHQLQFIFGLLGNIISFLVFLAPMPTFWTIYKKKTSEGFQSIPYVVALMSAMLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKL-LLLDILFFGAVIIV  618
            YYA +KTNAYL+V IN FGC IE+++I++YLFYA KK KIFT+KL ++ ++ F G ++  
Sbjct  61   YYAALKTNAYLLVSINSFGCVIEVIYIALYLFYAPKKQKIFTLKLFIIFNLGFSGVMVGG  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            ++F ++G KR   VGW CA  N++VFA+PLSIM++VI T++ ++MP +LS  L   AT W
Sbjct  121  TMFFLHGMKRTNAVGWICAAFNLSVFASPLSIMKRVITTKSVEYMPFSLSFFLTLSATMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQ  360
            FFYG F KD +IA PN++GFL G+ Q
Sbjct  181  FFYGFFIKDLFIALPNVVGFLLGMVQ  206



>ref|XP_003518628.1| PREDICTED: bidirectional sugar transporter NEC1 [Glycine max]
Length=262

 Score =   251 bits (641),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 131/229 (57%), Positives = 173/229 (76%), Gaps = 1/229 (0%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M  +S   L L+FGLLGNIVSF VFLAP+PTFY IYK+KSS+G+QSIPY VAL SA LLL
Sbjct  1    MVSISDHELVLIFGLLGNIVSFMVFLAPLPTFYTIYKKKSSEGFQSIPYAVALLSALLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIV  618
            YY  IKTNA LI+ IN  GC IE+ +++MY+ YA +K KI T+ ++L+ DI  FG  +++
Sbjct  61   YYGFIKTNATLIITINCIGCVIEVSYLTMYIIYAPRKQKISTLVMILIADIGGFGLTMLI  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            + F V G  R+  VGW CA+ N+AVFAAPLSIMR+VI+T++ +FMP +LS+ L  CAT W
Sbjct  121  TTFAVKGINRVHAVGWICAIFNIAVFAAPLSIMRRVIKTKSVEFMPFSLSLFLTLCATMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKE  291
            FFYG F KD +I FPN+LGF+FG++Q++LY +YK+SKK  +    E +E
Sbjct  181  FFYGFFDKDDFIMFPNVLGFIFGISQMILYMIYKNSKKNGETNCTEQQE  229



>ref|XP_007209422.1| hypothetical protein PRUPE_ppa009422mg [Prunus persica]
 gb|EMJ10621.1| hypothetical protein PRUPE_ppa009422mg [Prunus persica]
Length=293

 Score =   252 bits (643),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 124/235 (53%), Positives = 174/235 (74%), Gaps = 8/235 (3%)
 Frame = -2

Query  965  LSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYY  789
            +++QH L L FGLLGNI+SF VFLAP+PTFY IYKRK+++G+Q++PYV+AL S+ L +YY
Sbjct  1    MAIQHPLTLSFGLLGNIISFLVFLAPVPTFYTIYKRKTAEGFQALPYVIALLSSMLYIYY  60

Query  788  AVIKT----NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLL-LLDILFFGAVI  624
            A++K     +A  ++ IN FGC +E ++IS++LFYA KK +I T+ L+ LL++  FG ++
Sbjct  61   ALLKEEFKEDATFLITINSFGCVVETLYISLFLFYAPKKARISTLTLVFLLNLFGFGLMM  120

Query  623  IVSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCAT  444
            +++ FL  G  R+ +VGW C V +++VF APL ++R+VIRT++ +FMP  LS  L   A 
Sbjct  121  LLTHFLATGEMRLKIVGWICLVFSLSVFVAPLGVLRRVIRTKSVEFMPFPLSFFLTLGAV  180

Query  443  AWFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK--EEDGKGAEYKEGI  285
             WFFYGL  KDY IAFPNILGFLFG+AQ+VLY +YK++KK  EE  K  E  E I
Sbjct  181  TWFFYGLLIKDYNIAFPNILGFLFGIAQMVLYIVYKNTKKVLEEQPKVQELSEHI  235



>ref|XP_009614916.1| PREDICTED: bidirectional sugar transporter SWEET12-like isoform 
X2 [Nicotiana tomentosiformis]
Length=298

 Score =   252 bits (643),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 162/213 (76%), Gaps = 3/213 (1%)
 Frame = -2

Query  953  HLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKT  774
            H A  FG+LGNIVSFFVFL+P+PTFYKIY++KS++GYQSIPYVVALFSA L +YYA +K+
Sbjct  7    HWAFTFGVLGNIVSFFVFLSPLPTFYKIYRKKSTEGYQSIPYVVALFSAMLWIYYAFLKS  66

Query  773  NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDILF-FGAVIIVSLFLVNG  597
            N  L++ IN FGC +E +++  YLFYA KK ++ T+KLLLL +   FGA+++V+ FL  G
Sbjct  67   NTTLLITINSFGCFVETIYVGFYLFYAPKKARVQTVKLLLLSVFAGFGAIVLVTQFLFKG  126

Query  596  SKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFS  417
              R+ +VGW C V ++ VF +PL IMRQVI+T++ ++MP  LSV L   A  WFFYGL  
Sbjct  127  VVRVQVVGWICLVFSLCVFVSPLCIMRQVIKTKSAEYMPFFLSVFLTLSAVMWFFYGLLL  186

Query  416  KDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEE  318
            KD+ IA PN+LGF+ G+ Q+VLY MY  +KKEE
Sbjct  187  KDFNIAIPNVLGFILGILQMVLYVMY--NKKEE  217



>ref|XP_009605550.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=296

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 171/237 (72%), Gaps = 4/237 (2%)
 Frame = -2

Query  953  HLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKT  774
            H A  FG+LGNIVSF VFL+P+PTFYKIYK+KS++GYQSIPYVVALFS+ L +YYA +KT
Sbjct  7    HWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYAFLKT  66

Query  773  NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDIL-FFGAVIIVSLFLVNG  597
            N  LI+ IN FGC IE +++S YLFYA KK ++ T+K+L+L ++  FGA+++V+ FL  G
Sbjct  67   NTTLIITINSFGCFIETIYVSFYLFYAPKKARVQTVKMLVLSVVGGFGAIVLVTQFLFKG  126

Query  596  SKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFS  417
            + R   VGW C V ++ VF APL I+RQVI+T++ ++MPL LSV L   A  WFFYGL  
Sbjct  127  AARGQAVGWICLVFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLV  186

Query  416  KDYYIAFPNILGFLFGLAQIVLYCMYKDSKK---EEDGKGAEYKEGIEIQVKNDGRR  255
            KD  IA PN+LGF+ G+ QIVLY +Y   +K   +E    A+ +  + I  +N+ ++
Sbjct  187  KDINIAIPNVLGFILGILQIVLYVIYNKKEKAILKEQKLPAKIQNHVIIVDENNNQK  243



>ref|XP_008239633.1| PREDICTED: bidirectional sugar transporter SWEET10 [Prunus mume]
Length=291

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/235 (52%), Positives = 174/235 (74%), Gaps = 8/235 (3%)
 Frame = -2

Query  965  LSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYY  789
            +++QH L L FGLLGNI+SF VFLAP+PTFY +YKRK+++G+Q++PYV+AL S+ L +YY
Sbjct  1    MAIQHPLTLAFGLLGNIISFLVFLAPVPTFYTVYKRKTAEGFQALPYVIALLSSMLYIYY  60

Query  788  AVIKT----NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLL-LLDILFFGAVI  624
            A++K     +A  ++ IN FGC +E ++IS++LFYA KK +I T+ L+ LL++  +G ++
Sbjct  61   ALLKEEFKEDATFLITINSFGCVVETLYISLFLFYAPKKARISTLTLVFLLNVFGYGLMM  120

Query  623  IVSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCAT  444
            +++ FL  G  R+ +VGW C V +++VF APL ++RQVIRT++ +FMP  LS  L   A 
Sbjct  121  MLTHFLATGEIRLKIVGWICLVFSLSVFVAPLGVLRQVIRTKSVEFMPFPLSFFLTLGAV  180

Query  443  AWFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK--EEDGKGAEYKEGI  285
             WFFYGL  KDY IAFPNILGFLFG+AQ+VLY +YK++KK  EE  K  E  E I
Sbjct  181  TWFFYGLLIKDYNIAFPNILGFLFGIAQMVLYIVYKNTKKVLEEQPKVQELSEHI  235



>ref|XP_010929602.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Elaeis 
guineensis]
 ref|XP_010929603.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Elaeis 
guineensis]
Length=295

 Score =   250 bits (638),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 165/219 (75%), Gaps = 2/219 (1%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA LS+ H  A  FG+LGNI+SF V+LAP+PTFY++YK+KS++G+QS+PYVVALFSA L 
Sbjct  1    MAGLSLDHPWAFTFGILGNIISFMVYLAPLPTFYRVYKKKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVII  621
            +YYA IK +AYL+V IN  GC IE ++I MYL YA KK +IFT + LLLL++  FG +++
Sbjct  61   IYYAFIKADAYLLVTINSIGCVIETMYIVMYLSYAPKKARIFTAQVLLLLNVGLFGLIVL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            V+L +  G +R+ ++GW C   +++VF APLSI+R VIRT++ +FMP  LS  L   A A
Sbjct  121  VTLMVAKGPERVHVLGWVCVSFSISVFVAPLSIIRLVIRTKSVEFMPFWLSFFLTMSAIA  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK  324
            WF YGL +KD Y+A PNILGF+FG+ Q+ +Y  YK ++K
Sbjct  181  WFSYGLLTKDIYVALPNILGFIFGVVQMGIYIAYKGTEK  219



>ref|XP_010093933.1| Bidirectional sugar transporter SWEET10 [Morus notabilis]
 gb|EXB54896.1| Bidirectional sugar transporter SWEET10 [Morus notabilis]
Length=295

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 167/214 (78%), Gaps = 1/214 (0%)
 Frame = -2

Query  962  SVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAV  783
            S  +L L FGLLGNIVSF VFLAPIPTF+KIYK+KS++G+QS+PYV+AL S+ L +YYA+
Sbjct  3    SHHYLTLAFGLLGNIVSFMVFLAPIPTFHKIYKKKSAEGFQSLPYVIALLSSMLWIYYAL  62

Query  782  IKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVIIVSLFL  606
            +K +A L++ IN  GC IE V+I+++LFYA KK +I T+KLLL L+++ +G ++++++FL
Sbjct  63   LKKDALLLITINSVGCVIETVYIALFLFYAPKKTRIETVKLLLMLNVVGYGLMLVLTIFL  122

Query  605  VNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYG  426
              G KR+  VGW C   N++VFAAPL IMRQVIRT++ +FMP  LS  L   A  WFFYG
Sbjct  123  AEGEKRLQAVGWICLAFNLSVFAAPLCIMRQVIRTKSVEFMPFPLSFFLTLGAVMWFFYG  182

Query  425  LFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK  324
            L  KDY IAFPN+LGF FG+AQ+ LY +YK++KK
Sbjct  183  LLLKDYNIAFPNVLGFFFGIAQMALYIVYKNAKK  216



>ref|XP_007030241.1| Nodulin MtN3 family protein isoform 2 [Theobroma cacao]
 gb|EOY10743.1| Nodulin MtN3 family protein isoform 2 [Theobroma cacao]
Length=294

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/222 (54%), Positives = 173/222 (78%), Gaps = 6/222 (3%)
 Frame = -2

Query  929  LGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKTNAYLIVCI  750
            +GNIVSF VFLAP+PTFY+I K+K+++GY SIPY+VAL SA +LLYY ++KTNA LI+ I
Sbjct  10   VGNIVSFLVFLAPVPTFYQICKKKTAEGYHSIPYMVALSSAMMLLYYGILKTNAVLIISI  69

Query  749  NGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIVSLFLVNGSKRIALVG  573
            N  GCAIE+V++ +Y+ YA K++K+ T+K +LL ++  +G +I+++  L  GSKR+ ++G
Sbjct  70   NVIGCAIEIVYLVLYIIYAPKREKVSTMKFILLFNMGGYGLIILLTNLLTEGSKRVTVMG  129

Query  572  WTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFSKDYYIAFP  393
            W CAV NVAVFA+PLSIMR V+RT++ + MP +LS+ L  CAT WFFYGLF  D++IA P
Sbjct  130  WICAVYNVAVFASPLSIMRHVVRTKSVEHMPFSLSLFLTLCATMWFFYGLFMMDFFIALP  189

Query  392  NILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQVKN  267
            N+LGFLFG+AQ++LY  YK++ K+      E ++ ++I++K 
Sbjct  190  NVLGFLFGIAQMILYVTYKNANKD-----VEMQKEVDIELKQ  226



>gb|EYU46728.1| hypothetical protein MIMGU_mgv1a011381mg [Erythranthe guttata]
Length=283

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 169/234 (72%), Gaps = 1/234 (0%)
 Frame = -2

Query  965  LSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYA  786
            ++   +A +FG+LGNIVSF V+L+P+PTFY+I+K+KS++G+QSIPY VALFSA L LYYA
Sbjct  1    MATPMVATVFGVLGNIVSFLVYLSPMPTFYRIFKKKSTEGFQSIPYSVALFSAMLYLYYA  60

Query  785  VIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIVSLF  609
             +KTN  ++V IN FG  +E+ ++  YL YA K+ ++FT KLL+L ++   G +I V+ F
Sbjct  61   FLKTNVLILVTINSFGSVVEVGYLVTYLIYATKESRVFTTKLLMLFNVSSLGFIIAVTHF  120

Query  608  LVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFY  429
            L NG  R+ +VGW CA  +V+VFAAPLSIMR+VI+T++ +FMP TLS+ L  CA  WFFY
Sbjct  121  LANGDTRLKIVGWICAAFSVSVFAAPLSIMRRVIQTKSVEFMPFTLSLFLTICAVVWFFY  180

Query  428  GLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQVKN  267
            G    D+YIA PNI+GF+ G+AQ+ LY +YK+   +++    E  +  ++Q   
Sbjct  181  GFLIHDFYIATPNIVGFVLGIAQMTLYVVYKNKNPKKNILPVEITKVHDLQTST  234



>gb|EYU34244.1| hypothetical protein MIMGU_mgv1a022710mg [Erythranthe guttata]
Length=250

 Score =   246 bits (628),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 131/232 (56%), Positives = 174/232 (75%), Gaps = 1/232 (0%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MA  + + LA +FG++GNI+SF VFLAP+PTFY I+K+KSS  +QSIPY VA FSA LLL
Sbjct  1    MASFTSKELAFIFGIIGNIISFLVFLAPVPTFYTIWKKKSSKSFQSIPYSVAFFSASLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIV  618
            YY  +KTNAY+IV ING GC IE +++ +YL YA  K KIFT+KL+++ ++   G +  V
Sbjct  61   YYGFLKTNAYMIVSINGIGCVIEAIYLVIYLIYAPNKAKIFTMKLIIVFNVGGLGLITGV  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            SL    G KR++ VGW CA+  +AVFAAPLSIMR+V+RT++ +FMP TLS  L  CAT W
Sbjct  121  SLVAFKGVKRVSFVGWVCAIFTIAVFAAPLSIMRRVVRTKSVEFMPFTLSFFLTLCATTW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIE  282
            FFYG F +DYYIA PN+LGFLFG+AQ++LY +YK++KK ++ K     + IE
Sbjct  181  FFYGFFVRDYYIALPNVLGFLFGIAQMILYLIYKNAKKVDETKLEPPNKDIE  232



>ref|XP_009605549.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=296

 Score =   247 bits (631),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 127/245 (52%), Positives = 175/245 (71%), Gaps = 7/245 (3%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MA +S  H A  FG+LGNIVSF VFL+P+PTFYKIYK+KS++GYQSIPYVVALFS+ L +
Sbjct  1    MAAIS-GHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWI  59

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDIL-FFGAVIIV  618
            YYA +KTN  LI+ IN FGC IE +++  YLFYA KK ++ T+K+LLL ++  FG +++V
Sbjct  60   YYAFLKTNTTLIITINSFGCFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGVIVLV  119

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            + FL  G+ R   VGW C V ++ VF APL I+RQVI+T++ ++MPL LSV L   A  W
Sbjct  120  TQFLFKGAARGQAVGWICLVFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMW  179

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQV----K  270
            FFYGL  KD  IA PN+LGF+ G+ Q+VLY +Y + K++ + K  +  E I+  V    +
Sbjct  180  FFYGLLVKDINIAIPNVLGFILGIFQMVLYIIY-NKKEKANLKEQKLPEKIQNHVIIVDE  238

Query  269  NDGRR  255
            N+ ++
Sbjct  239  NNSQK  243



>ref|XP_009587580.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=298

 Score =   247 bits (631),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 165/220 (75%), Gaps = 3/220 (1%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MA  S  H A  FG+LGNIVSF VFL+P+PTFYKIYK+KS++GYQSIPYV+ALFS+ L +
Sbjct  1    MAGFSTDHWAFAFGVLGNIVSFIVFLSPMPTFYKIYKKKSAEGYQSIPYVIALFSSMLWI  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDIL-FFGAVIIV  618
            YYA +KTN  L++ IN FG  IE +++  YLFYA KK ++ T+K+LLL ++  FGA+++V
Sbjct  61   YYAFLKTNTTLLITINSFGVFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGAIVLV  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            + FL  G+ R  +VGW C V ++ VF APL I+R+VI+T++ ++MPL LSV L   A  W
Sbjct  121  TQFLFKGAVRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEE  318
            FFYGL  KD  IA PN+LGF+FG+ QIVLY +Y  SKKE+
Sbjct  181  FFYGLLLKDINIAAPNVLGFIFGILQIVLYVIY--SKKEK  218



>emb|CAN71371.1| hypothetical protein VITISV_023352 [Vitis vinifera]
Length=273

 Score =   246 bits (628),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 173/233 (74%), Gaps = 3/233 (1%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MAL  + H L  +FG+LGN++SF V+LAP+PTFY+IYKRKS++G+QS+PYVVALFSA L 
Sbjct  1    MALFPIHHPLVFIFGILGNLISFMVYLAPLPTFYQIYKRKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLL-LLDILFFGAVII  621
            +YYA + T+A L++ IN  GC IE  +I M+L YA KK +I T+KL+ L++I  FG++++
Sbjct  61   IYYAFLNTDASLLITINSVGCVIETSYIVMFLVYAPKKARITTVKLVFLMNICGFGSILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++L L  G+ R+ ++GW C V +++VF APL IMRQVIRT++ ++MP  LS  L   A  
Sbjct  121  LTLLLAEGANRVRILGWVCLVFSLSVFLAPLCIMRQVIRTKSVEYMPFLLSFFLTLSAVM  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKE-EDGKGAEYKEGI  285
            WFFYGL  KD+YIA PNILGF+FG+ Q+VLY +Y++ KK  E+ K  E  E I
Sbjct  181  WFFYGLMLKDFYIAGPNILGFVFGIVQMVLYLIYRNRKKVLENEKLPELSEQI  233



>ref|XP_009762335.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Nicotiana 
sylvestris]
Length=299

 Score =   247 bits (630),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 164/220 (75%), Gaps = 3/220 (1%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MA  S  H A  FG+LGNIVSF VFL+P+PTFYKIYK+KS++GYQSIPYV+ALFS+ L +
Sbjct  1    MAGFSTDHWAFAFGVLGNIVSFIVFLSPMPTFYKIYKKKSAEGYQSIPYVIALFSSMLWI  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDIL-FFGAVIIV  618
            YYA +KTN  L++ IN FG  IE +++  YLFYA KK ++ T+K+LLL ++  FGA+++V
Sbjct  61   YYAFLKTNTTLLITINSFGVFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGAIVLV  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            + FL  G+ R  +VGW C V ++ VF APL I+R+VI+T++ ++MPL LSV L   A  W
Sbjct  121  TQFLFKGAVRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEE  318
            FFYGL  KD  IA PN+LGF+FG+ QIVLY +Y  SKKE 
Sbjct  181  FFYGLLLKDINIAAPNVLGFIFGILQIVLYVIY--SKKEN  218



>ref|XP_002284244.1| PREDICTED: bidirectional sugar transporter SWEET14 [Vitis vinifera]
 emb|CBI15714.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   246 bits (628),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 173/233 (74%), Gaps = 3/233 (1%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MAL  + H L  +FG+LGN++SF V+LAP+PTFY+IYKRKS++G+QS+PYVVALFSA L 
Sbjct  1    MALFPIHHPLVFIFGILGNLISFMVYLAPLPTFYQIYKRKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLL-LLDILFFGAVII  621
            +YYA + T+A L++ IN  GC IE  +I M+L YA KK +I T+KL+ L++I  FG++++
Sbjct  61   IYYAFLNTDASLLITINSVGCVIETSYIVMFLVYAPKKARITTVKLVFLMNICGFGSILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++L L  G+ R+ ++GW C V +++VF APL IMRQVIRT++ ++MP  LS  L   A  
Sbjct  121  LTLLLAEGANRVRILGWVCLVFSLSVFLAPLCIMRQVIRTKSVEYMPFLLSFFLTLSAVM  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKE-EDGKGAEYKEGI  285
            WFFYGL  KD+YIA PNILGF+FG+ Q+VLY +Y++ KK  E+ K  E  E I
Sbjct  181  WFFYGLMLKDFYIAGPNILGFVFGIVQMVLYLIYRNRKKVLENEKLPELSEQI  233



>ref|XP_009758167.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=296

 Score =   246 bits (629),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 161/218 (74%), Gaps = 2/218 (1%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MA +S  H A  FG+LGNIVSF VFL+P+PTFYKIYK+KS++GYQSIPYVVALFS+ L +
Sbjct  1    MAAIS-GHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWV  59

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDIL-FFGAVIIV  618
            YYA +KTN  LI+ IN FGC IE +++  YLFYA KK +I T+K+L+L ++  FG +++V
Sbjct  60   YYAFLKTNTTLIITINSFGCFIETIYVGFYLFYAPKKARIQTVKMLVLSVVGGFGVIVLV  119

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            + FL  G+ R   VGW C V ++ VF APL I+RQVI+T++ ++MPL LSV L   A  W
Sbjct  120  TQFLFKGAARGQAVGWICLVFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMW  179

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK  324
            FFYGL  KD  IA PN+LGF+ G+ QIVLY +Y   +K
Sbjct  180  FFYGLLVKDINIAIPNVLGFVLGILQIVLYVIYNKKEK  217



>ref|XP_009758165.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=296

 Score =   246 bits (629),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 157/211 (74%), Gaps = 1/211 (0%)
 Frame = -2

Query  953  HLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKT  774
            H A  FG+LGNI+SF VFL+P+PTFYKIYK+KS++GYQSIPYVVALFS+ L +YYA +KT
Sbjct  7    HWAFAFGVLGNIISFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYAFLKT  66

Query  773  NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDIL-FFGAVIIVSLFLVNG  597
            N  LI+ IN FGC IE +++  YLFYA KK ++ T+K+LLL ++  FG +++V+ FL  G
Sbjct  67   NTTLIITINSFGCFIETIYVGFYLFYAPKKARVQTLKMLLLSVVGGFGVIVLVTQFLFKG  126

Query  596  SKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFS  417
            + R   VGW C V ++ VF APL I+RQVI+T++ ++MPL LSV L   A  WFFYGL  
Sbjct  127  AARGQAVGWICLVFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLV  186

Query  416  KDYYIAFPNILGFLFGLAQIVLYCMYKDSKK  324
            KD  IA PNILGF+ G+ QIVLY +Y   +K
Sbjct  187  KDINIAIPNILGFILGILQIVLYIIYNKKEK  217



>ref|XP_007200238.1| hypothetical protein PRUPE_ppa015264mg [Prunus persica]
 gb|EMJ01437.1| hypothetical protein PRUPE_ppa015264mg [Prunus persica]
Length=284

 Score =   246 bits (628),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 160/211 (76%), Gaps = 1/211 (0%)
 Frame = -2

Query  950  LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKTN  771
            LA +FG+LGNIV+F V+LAP+PTFY+I+K+KS++G+QSIPY VALFSA L+LYYA +KTN
Sbjct  9    LASVFGILGNIVAFMVYLAPLPTFYRIFKKKSTEGFQSIPYSVALFSAMLMLYYAFLKTN  68

Query  770  AYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIVSLFLVNGS  594
            A++++ IN  GC IE  ++ MY+ YA  K +I+T KLL+L ++  +G +++ +  + N  
Sbjct  69   AFMLITINSVGCIIETSYLVMYMIYAPAKTRIYTAKLLVLFNVGVYGVIVLSTYLIPNHF  128

Query  593  KRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFSK  414
             RI +VGW   V +V VFAAPLSIMR VIRTR+ +FM   LS CL  CA  WFFYGL  +
Sbjct  129  LRIKVVGWISVVFSVCVFAAPLSIMRLVIRTRSVEFMSFPLSFCLTLCAVMWFFYGLLVR  188

Query  413  DYYIAFPNILGFLFGLAQIVLYCMYKDSKKE  321
            D +IA PNILGF FGLAQ+++Y M+K+SKK 
Sbjct  189  DLFIAAPNILGFAFGLAQMIMYLMFKNSKKS  219



>ref|XP_008235079.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Prunus 
mume]
Length=275

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 159/211 (75%), Gaps = 1/211 (0%)
 Frame = -2

Query  950  LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKTN  771
            LA +FG+LGNIV+F V+LAP+PTFY+I+K+KS++G+QSIPY VALFSA L+LYYA +KTN
Sbjct  9    LASVFGILGNIVAFMVYLAPLPTFYRIFKKKSTEGFQSIPYSVALFSAMLMLYYAFLKTN  68

Query  770  AYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIVSLFLVNGS  594
            A++++ IN  GC IE  F+ MY+ YA  K +I+T KLL+L +   +G +I+ +  + N  
Sbjct  69   AFMLITINSVGCIIETSFLVMYIIYAPAKTRIYTAKLLVLFNAGVYGVIILSTYLIPNHF  128

Query  593  KRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFSK  414
             RI +VGW   V +V VFAAPLSIMR VIRTR+ +FM   LS CL  CA  WFFYGL  +
Sbjct  129  LRIKVVGWISVVFSVCVFAAPLSIMRLVIRTRSVEFMSFPLSFCLTLCAVMWFFYGLLVR  188

Query  413  DYYIAFPNILGFLFGLAQIVLYCMYKDSKKE  321
            D +IA PNILGF FGLAQ+++Y M+K+SKK 
Sbjct  189  DLFIAAPNILGFAFGLAQMIMYLMFKNSKKS  219



>ref|XP_004247459.1| PREDICTED: bidirectional sugar transporter NEC1 [Solanum lycopersicum]
Length=286

 Score =   246 bits (628),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 165/220 (75%), Gaps = 2/220 (1%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M L +   LA  FG+LGN VSF V+L+P+PTFY+I+KRKS++G+QSIPY V+LFSA L L
Sbjct  1    MPLFTTLQLAFAFGILGNGVSFLVYLSPLPTFYRIFKRKSTEGFQSIPYSVSLFSAMLYL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVIIV  618
            YYA +K N  L++ IN FG  I+L+++++++ YA K  KIF  KLL+  +++ FGA++ +
Sbjct  61   YYAYLKKNEILLITINSFGTGIQLIYLTIFMIYATKSAKIFATKLLIGFNLVAFGAIVGL  120

Query  617  SLFLVNGSK-RIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            +    N +  RI++VGW CAV +V+VFAAPLSIMR+VI+T++ +FMP  LS  L  CA  
Sbjct  121  TYVFANENDLRISIVGWICAVFSVSVFAAPLSIMRRVIQTKSVEFMPFPLSFFLTICAVM  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKE  321
            WFFYGL  KD YIA PNILGF FG+AQ++LY +Y++ K++
Sbjct  181  WFFYGLLKKDMYIAMPNILGFSFGIAQMILYAIYRNRKQQ  220



>ref|NP_001237418.1| N3 protein [Glycine max]
 gb|ABT17358.1| N3 protein [Glycine max]
 gb|KHN23962.1| Bidirectional sugar transporter SWEET14 [Glycine soja]
Length=260

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 171/220 (78%), Gaps = 4/220 (2%)
 Frame = -2

Query  965  LSVQH--LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLY  792
            +++ H   A +FGLLGN++SF VFLAP+PTFY+IYK+KS++ +QS+PYVVALFS+ L +Y
Sbjct  1    MAINHETWAFVFGLLGNVISFMVFLAPLPTFYQIYKKKSTEEFQSLPYVVALFSSMLWIY  60

Query  791  YAVIKTNA-YLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVIIV  618
            YA++K +A  L++ IN FGC IE ++++++L YA  K +++TIKLLL L++  FGA+++ 
Sbjct  61   YALVKKDASLLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAMLLS  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            +L+L  GSKR+ ++GW C V N++VFAAPL I+++VI+T++ +FMP +LS  L   A  W
Sbjct  121  TLYLTTGSKRLTVIGWICLVFNISVFAAPLCIIKRVIKTKSVEFMPFSLSFFLTINAVMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEE  318
            FFYGL  KDYY+A PN LGFLF + Q+VLY +Y+++K  +
Sbjct  181  FFYGLLLKDYYVALPNTLGFLFSIIQMVLYLIYRNAKTPD  220



>ref|XP_009614915.1| PREDICTED: bidirectional sugar transporter SWEET12-like isoform 
X1 [Nicotiana tomentosiformis]
Length=302

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 162/217 (75%), Gaps = 7/217 (3%)
 Frame = -2

Query  953  HLALLFGLLGNIVSFFVFLAPI----PTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYA  786
            H A  FG+LGNIVSFFVFL+P+    PTFYKIY++KS++GYQSIPYVVALFSA L +YYA
Sbjct  7    HWAFTFGVLGNIVSFFVFLSPLYVRRPTFYKIYRKKSTEGYQSIPYVVALFSAMLWIYYA  66

Query  785  VIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDILF-FGAVIIVSLF  609
             +K+N  L++ IN FGC +E +++  YLFYA KK ++ T+KLLLL +   FGA+++V+ F
Sbjct  67   FLKSNTTLLITINSFGCFVETIYVGFYLFYAPKKARVQTVKLLLLSVFAGFGAIVLVTQF  126

Query  608  LVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFY  429
            L  G  R+ +VGW C V ++ VF +PL IMRQVI+T++ ++MP  LSV L   A  WFFY
Sbjct  127  LFKGVVRVQVVGWICLVFSLCVFVSPLCIMRQVIKTKSAEYMPFFLSVFLTLSAVMWFFY  186

Query  428  GLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEE  318
            GL  KD+ IA PN+LGF+ G+ Q+VLY MY  +KKEE
Sbjct  187  GLLLKDFNIAIPNVLGFILGILQMVLYVMY--NKKEE  221



>ref|XP_004952573.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Setaria 
italica]
Length=319

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/249 (50%), Positives = 175/249 (70%), Gaps = 10/249 (4%)
 Frame = -2

Query  974  MALLSV--QHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAEL  801
            MA L++  Q  A  FG+LGNI+S  VFL+P+PTFY++Y++KS++G+QS PYVV LFS  L
Sbjct  1    MAFLNMEQQTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCML  60

Query  800  LLYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVI  624
             ++YA++KT A L+V ING GC IE V+I+MYL YA +  ++ T K+LL L++  FG V 
Sbjct  61   WIFYALLKTGAVLLVTINGVGCVIETVYIAMYLVYAPRAARVLTAKMLLGLNVGVFGLVS  120

Query  623  IVSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCAT  444
            +V++ L NG+ R+ ++GW C  + ++VFAAPLSIMRQVIRT++ +FMP +LS  LV  A 
Sbjct  121  LVTMVLSNGNLRVHVLGWICVSVALSVFAAPLSIMRQVIRTKSVEFMPFSLSFFLVLSAV  180

Query  443  AWFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKE------EDGKGAEY-KEGI  285
             WF YG   KD ++AFPN+LGF+FGLAQ+ LY  Y++ K        E+ K  E+ KE  
Sbjct  181  IWFAYGALKKDVFVAFPNVLGFVFGLAQMALYMAYRNRKPAAAVVMVEEVKLPEHVKEVA  240

Query  284  EIQVKNDGR  258
               V ++GR
Sbjct  241  AAPVAHEGR  249



>ref|XP_009591687.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
tomentosiformis]
Length=297

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 163/213 (77%), Gaps = 3/213 (1%)
 Frame = -2

Query  953  HLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKT  774
            H A  FG+LGNI+SF VFL+P+PTFY+IYK+KS++GYQSIPYVVALFS+ L +YYA++KT
Sbjct  7    HWAFAFGVLGNIISFIVFLSPLPTFYRIYKKKSTEGYQSIPYVVALFSSMLWIYYALLKT  66

Query  773  NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDIL-FFGAVIIVSLFLVNG  597
            N  L++ IN FG  IE +++  YLFYA KK K+ T+K+LLL ++  FGA+++V+ FL  G
Sbjct  67   NTTLLITINSFGVFIETIYVGFYLFYAPKKAKVQTVKMLLLSVVGGFGAIVLVTQFLFKG  126

Query  596  SKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFS  417
            + R  +VGW C V ++ VF APL I+R+VI+T++ ++MPL LSV L   A  WFFYGL  
Sbjct  127  AVRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLL  186

Query  416  KDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEE  318
            KD  IA PN+LGF+FG+ QIVLY +Y  SKKE+
Sbjct  187  KDINIAAPNVLGFIFGILQIVLYAIY--SKKEK  217



>ref|XP_010250599.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nelumbo 
nucifera]
Length=287

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 173/231 (75%), Gaps = 5/231 (2%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MAL ++ H     FGLLGN++SF V+LAP+PTF++IYK+KS++G+QS+PYVVALFSA L 
Sbjct  1    MALFNIHHPWTFTFGLLGNLISFMVYLAPLPTFFRIYKKKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVII  621
            +YYA +K +A+L++ IN FGC IE V+I M++ YA+KK +I TIKLLLL ++  F  +++
Sbjct  61   IYYAFLKPDAHLLITINSFGCFIETVYIVMFMIYASKKVRIETIKLLLLLNVGTFCLILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++LFL +G+KR  +VGW C   +V+VFAAPLSIMR VIRT++ +FMP +LS  L   A  
Sbjct  121  LTLFLAHGTKRAQIVGWLCVAFSVSVFAAPLSIMRLVIRTKSVEFMPFSLSFFLTLSAVM  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK---EEDGKGAEY  297
            WF YG   KD Y+A PNILGF+FG+ Q++LY +YKDSKK   EE     E+
Sbjct  181  WFSYGFLQKDLYVALPNILGFIFGILQMLLYVIYKDSKKVIIEEQKVNNEH  231



>ref|XP_004979336.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Setaria 
italica]
Length=296

 Score =   245 bits (626),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 170/233 (73%), Gaps = 3/233 (1%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA LS+QH LA  FGLLGNI+SF  +LAP+PTFY+IYK KS+ G+QS+PYVVALFSA L 
Sbjct  1    MAGLSLQHPLAFAFGLLGNIISFMTYLAPLPTFYRIYKNKSTQGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVII  621
            +YYA++K+N  L++ IN  GC IE ++I+MYL YA KK K+FT K LLLL++  FG +++
Sbjct  61   IYYALLKSNECLLITINAAGCVIETLYIAMYLTYAPKKAKLFTAKILLLLNVGVFGLILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++L L  G  R+ ++GW C   +V+VF APLSI+RQV+RTR+ +FMP +LS+ L   A  
Sbjct  121  LTLLLSAGQNRLVILGWVCVGFSVSVFVAPLSIIRQVVRTRSVEFMPFSLSLSLTVSAVV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKG-AEYKEGI  285
            WF YGL  KD Y+A PN+LGF FG+ Q+ LY +Y+++      K  A+ KE I
Sbjct  181  WFLYGLLIKDKYVALPNVLGFSFGVIQMGLYALYRNATPRVPAKEVADDKEDI  233



>ref|XP_009412768.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=284

 Score =   245 bits (625),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 167/219 (76%), Gaps = 2/219 (1%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA LS+QH L   FG+LGN++SF VFLAPIPTFY++Y++KS++G+ S+PYVVALFS  L 
Sbjct  1    MAGLSLQHPLPFAFGMLGNLISFMVFLAPIPTFYRVYRKKSTEGFHSVPYVVALFSCMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKL-LLLDILFFGAVII  621
            +YYA +KTN+ L++ IN FG  IE ++I++YL YA KK +IF I++ +LLD++ F A+++
Sbjct  61   IYYAFVKTNSMLLITINSFGLFIETIYITIYLIYAPKKARIFCIQIFVLLDVVAFAAIVL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++  +  GS R+ ++GW C   +++VFAAPLS++R VIRT++ +FMP  LS  L   A A
Sbjct  121  LTQLVFKGSNRVTVLGWICVGFSISVFAAPLSVIRLVIRTKSVEFMPFFLSFFLTLSAIA  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK  324
            WF YGLF+KD Y+  PN+LGF+FG+AQ++LY +YK  K 
Sbjct  181  WFGYGLFTKDIYVQLPNVLGFVFGIAQMLLYIIYKKKKN  219



>ref|XP_003531061.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
Length=274

 Score =   244 bits (624),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 168/238 (71%), Gaps = 2/238 (1%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MAL S  HLAL FG+LGN++SF V+LAP+PTFY+IYK+KS++G+QS+PY+VALFS+ L L
Sbjct  1    MALNSHNHLALAFGMLGNVISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLWL  60

Query  794  YYAVIK-TNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKL-LLLDILFFGAVII  621
            YYA +K  +A L++ IN  GC IE+V+I M+  YA K  +  T+KL +++++  F  + +
Sbjct  61   YYASLKPADATLLITINSLGCVIEIVYIVMFTIYATKDARNLTVKLFMVMNVGSFALIFL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            V+ F ++GS R+ +VGW C  I V VFAAPLSI+ QVIRT+N +FMP  LS+ L   A  
Sbjct  121  VTYFAIHGSLRVQVVGWVCVSIAVGVFAAPLSIVAQVIRTKNVEFMPFNLSLFLTLSAVM  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQVKN  267
            WFFYGL  KD  IA PNILGF  GL Q++LY +Y++ K        + ++ +E  +KN
Sbjct  181  WFFYGLLLKDICIAIPNILGFTLGLLQMLLYAIYRNGKTNNKEVATKEEKALEAIMKN  238



>ref|XP_009787633.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
sylvestris]
Length=295

 Score =   245 bits (625),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 162/213 (76%), Gaps = 3/213 (1%)
 Frame = -2

Query  953  HLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKT  774
            H A  FG+LGNIVSF VFL+P+PTFYKIYK+KS++GYQSIPYVVALFS+ L +YYA +KT
Sbjct  7    HWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYAFLKT  66

Query  773  NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDIL-FFGAVIIVSLFLVNG  597
            N  L++ IN FG  IE +++  YLFYA KK K+ T+K+LLL ++  FGA+++V+ FL  G
Sbjct  67   NTTLLITINSFGVFIETIYVGFYLFYAPKKAKVQTVKMLLLSVVGGFGAIVLVTQFLFKG  126

Query  596  SKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFS  417
            + R  +VGW C V ++ VF APL I+R+VI+T++ ++MPL LSV L   A  WFFYGL  
Sbjct  127  AVRGQVVGWICLVFSLCVFIAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLL  186

Query  416  KDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEE  318
            KD  IA PN+LGF+FG+ QIVLY +Y  SKKE+
Sbjct  187  KDINIAAPNVLGFIFGILQIVLYVIY--SKKEK  217



>ref|XP_009385515.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=282

 Score =   244 bits (623),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/230 (51%), Positives = 170/230 (74%), Gaps = 2/230 (1%)
 Frame = -2

Query  974  MALLSV-QHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA LS+ Q L  +FG+LGNI+SF VFL+P+PTFY+IY++KS++G+QS+PYVVAL S  LL
Sbjct  1    MAGLSLEQPLPFIFGILGNIISFMVFLSPLPTFYRIYRKKSTEGFQSVPYVVALSSCMLL  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKL-LLLDILFFGAVII  621
            +YYA++KTNA L++ IN FGC IE  +I++YL YA KK +IF I++ +LL+++ F A+++
Sbjct  61   IYYALVKTNAVLLITINSFGCFIETAYITIYLIYATKKARIFCIQIFVLLNVVAFAAIVL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++     G  R+ +VGW C   ++ VFAAPLSI+R VIRT++ +FMP  LS  L   A A
Sbjct  121  LTRLAFTGPDRVTVVGWICVGFSLCVFAAPLSIIRLVIRTKSVEFMPFYLSFFLTLNAIA  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKE  291
            WF YG F+KD Y+  PN+LGF+FG+ Q+V+Y +YK++  ++D   A   E
Sbjct  181  WFGYGFFTKDLYVELPNVLGFVFGVVQMVVYMLYKNNNNKKDAAVAAVPE  230



>ref|XP_010528779.1| PREDICTED: bidirectional sugar transporter SWEET9 [Tarenaya hassleriana]
Length=264

 Score =   243 bits (621),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 131/239 (55%), Positives = 169/239 (71%), Gaps = 3/239 (1%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M  LSV  LA LFG+LGNIVSF VFL+P+PTFY I KRKSS G+QSIPY+ AL SA LLL
Sbjct  1    MVFLSVHELAFLFGVLGNIVSFGVFLSPVPTFYGICKRKSSKGFQSIPYICALASATLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIV  618
             Y ++K NA LI+ IN FGC IE+ ++ +YL YA +  KIFT+KL+L+ ++   G +I++
Sbjct  61   CYGIMKGNALLIISINTFGCVIEISYLLIYLIYAPRDAKIFTLKLILIFNVGALGLLILL  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
                V   KR+  VGW CA  ++AVFAAPLSIMR+VIRT++ ++MP  LS  L   A  W
Sbjct  121  VDLFVPKLKRVTAVGWVCAAYSLAVFAAPLSIMRKVIRTKSVEYMPFLLSFSLTLNAVMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGK--GAEYKEGIEIQVKN  267
            F YGL  KD +IA PNILGFLFGL Q+VLY MYK+SKK E  K    E +E  ++++ +
Sbjct  181  FLYGLLIKDKFIAMPNILGFLFGLVQMVLYLMYKNSKKTEMPKPVPTENQETKDLELNS  239



>ref|XP_009794695.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
sylvestris]
Length=295

 Score =   244 bits (624),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 163/213 (77%), Gaps = 3/213 (1%)
 Frame = -2

Query  953  HLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKT  774
            H A  FG+LGNIVSF VFL+P+PTFY+IYK+KS++GYQSIPYVVALFS+ L +YYA +KT
Sbjct  7    HWAFAFGVLGNIVSFIVFLSPLPTFYRIYKKKSTEGYQSIPYVVALFSSMLWIYYAFLKT  66

Query  773  NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDIL-FFGAVIIVSLFLVNG  597
            N  L++ IN FG  IE +++ +YLFYA KK ++ T+K+LLL ++  FGA+++V+ FL  G
Sbjct  67   NTTLLITINSFGVFIETIYVGVYLFYAPKKARVQTVKMLLLSVVGGFGAIVLVTQFLFKG  126

Query  596  SKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFS  417
            + R  +VGW C V ++ VF APL I+R+VI+T++ ++MPL LSV L   A  WFFYGL  
Sbjct  127  AVRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLL  186

Query  416  KDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEE  318
            KD  IA PN+LGF+FG+ QIVLY +Y  SKKE+
Sbjct  187  KDINIAAPNVLGFIFGILQIVLYVIY--SKKEK  217



>ref|XP_009758166.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=296

 Score =   244 bits (623),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 121/237 (51%), Positives = 168/237 (71%), Gaps = 4/237 (2%)
 Frame = -2

Query  953  HLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKT  774
            H A  FG+LGNIVSF VFL+P+PTFYKIYK+KS++GYQSIPYVVALFS+ L +YYA +KT
Sbjct  7    HWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYAFLKT  66

Query  773  NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDIL-FFGAVIIVSLFLVNG  597
            N  LI+ IN FGC IE +++  YLFYA KK ++ T+K+LLL ++  FG +++V+ FL  G
Sbjct  67   NTTLIITINSFGCFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGVIVLVTQFLFKG  126

Query  596  SKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFS  417
            + R   VGW C V ++ VF APL I+R+VI+T++ ++MPL LSV L   A  WFFYGL  
Sbjct  127  AARGQAVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLV  186

Query  416  KDYYIAFPNILGFLFGLAQIVLYCMYKDSKK---EEDGKGAEYKEGIEIQVKNDGRR  255
            KD  IA PN+LGF+ G+ Q+VLY +Y   +K   +E     + +  + I  +N+ ++
Sbjct  187  KDINIAIPNVLGFILGIFQMVLYIIYNKKEKAILKEQKLSEKIQNHVIIVDENNNQK  243



>ref|XP_006347347.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Solanum 
tuberosum]
Length=289

 Score =   244 bits (623),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 126/229 (55%), Positives = 169/229 (74%), Gaps = 2/229 (1%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MA  SV H    FG+LGNIVSFFVFL+P+PTF K+YK+ S++GYQSIPYVVALFSA L +
Sbjct  1    MADFSV-HWVFAFGVLGNIVSFFVFLSPLPTFCKMYKKNSTEGYQSIPYVVALFSAMLWI  59

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVIIV  618
            YYA +KTN  L++ IN FGC +E++++  YLFYA+K+ ++ TIK LLLL +  FGA+++V
Sbjct  60   YYAFLKTNTTLLITINTFGCFVEIIYVGFYLFYASKEARVQTIKLLLLLVVGGFGAIVLV  119

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            S FL  G+ R+ +VGW C V ++ VF APL I++QVI+T++ ++MP  LSV L   A  W
Sbjct  120  SQFLFEGAVRVQVVGWICLVCSLCVFVAPLCIVKQVIKTKSVEYMPFLLSVFLTLSAVMW  179

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKE  291
            FFYGL  KD+ IA PN+LGF+FG+ Q+VLY MY + K+EE  K     E
Sbjct  180  FFYGLLLKDFNIAIPNVLGFIFGILQMVLYVMYYNKKEEEFVKEQNLPE  228



>ref|XP_002511128.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51730.1| conserved hypothetical protein [Ricinus communis]
Length=279

 Score =   243 bits (621),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 116/220 (53%), Positives = 165/220 (75%), Gaps = 3/220 (1%)
 Frame = -2

Query  950  LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKTN  771
            LA  FGLLGNI+SF V LAP+PTFY+I K+K+S+G+QSIPYV+ALFSA L L+YA+   +
Sbjct  7    LAFAFGLLGNIISFLVCLAPMPTFYQICKKKTSEGFQSIPYVIALFSATLWLFYAIFAND  66

Query  770  AYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVIIVSLFLVNGS  594
            A L++ IN F   +E  +I++YLFYA KKD++FT KL+L L+I  FG++ ++++FL +G 
Sbjct  67   ATLLITINSFAFFMETAYIAIYLFYAVKKDRLFTTKLVLSLNIFAFGSICVIAMFLTHGQ  126

Query  593  KRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFSK  414
            KR+ L+GW C V  + VF APL+I+R+VI+T++ +FMP +LS  L   A  WFFYG   K
Sbjct  127  KRVQLLGWICMVFALCVFVAPLAIVRKVIKTKSVEFMPFSLSFFLTLSAVMWFFYGFLKK  186

Query  413  DYYIAFPNILGFLFGLAQIVLYCMYKDSKK--EEDGKGAE  300
            D Y+A PNILGF+FG+ Q++LY +Y++ KK  ++D K  E
Sbjct  187  DLYVAVPNILGFMFGVLQMILYLIYRNPKKTGDDDQKANE  226



>ref|XP_009796436.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=297

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 162/213 (76%), Gaps = 3/213 (1%)
 Frame = -2

Query  953  HLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKT  774
            H A  FG+LGNIVSF VFL+P+PTFY I+K+KS++GYQSIPYVVALFS+ L +YYA++KT
Sbjct  7    HWAFAFGVLGNIVSFIVFLSPLPTFYSIFKKKSTEGYQSIPYVVALFSSMLWIYYALLKT  66

Query  773  NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDIL-FFGAVIIVSLFLVNG  597
            N  L++ IN FG  IE +++  YLFYA KK K+ T+K+LLL ++  FGA+++V+ FL  G
Sbjct  67   NTTLLITINSFGVFIETIYVGFYLFYAPKKAKVQTVKMLLLSVVGGFGAIVLVTQFLFKG  126

Query  596  SKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFS  417
            + R  +VGW C V ++ VF APL I+R+VI+T++ ++MPL LSV L   A  WFFYGL  
Sbjct  127  AVRGQIVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLL  186

Query  416  KDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEE  318
            KD  IA PN+LGF+FG+ QIVLY +Y  SKKE+
Sbjct  187  KDINIAAPNVLGFIFGILQIVLYAIY--SKKEK  217



>emb|CDP03543.1| unnamed protein product [Coffea canephora]
Length=267

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 160/218 (73%), Gaps = 1/218 (0%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MA  S   LA  FG+LGN+VSF V+LAP+PTFY+IYK+KS+ G+Q++PY VALFSA L L
Sbjct  1    MATFSTCQLAAAFGILGNVVSFLVYLAPLPTFYRIYKKKSTQGFQAVPYSVALFSAMLYL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDILFFGAVIIVS  615
            YYA +K N  ++  IN  GCAIE +++ +++ YA K  K+ T KLL++  +   A+I+ S
Sbjct  61   YYAYLKKNGIILATINSGGCAIETIYLVLFMIYATKDAKMRTAKLLVIFNVGAYALIVAS  120

Query  614  LFLVN-GSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
             FL++ G +R+ALVGW C+V +V VFAAPLSIM +VIRTR+ +FMP +LS  L  CA  W
Sbjct  121  TFLLSQGHRRVALVGWICSVFSVCVFAAPLSIMMKVIRTRSVEFMPFSLSCFLTLCAVMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK  324
            FFYG   KDYYIA PNILGF FG+AQ++LY +Y++   
Sbjct  181  FFYGFLIKDYYIATPNILGFAFGIAQMILYAIYRERDN  218



>ref|XP_009597195.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=291

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 162/213 (76%), Gaps = 3/213 (1%)
 Frame = -2

Query  953  HLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKT  774
            H A  FG+LGNIVSF VFL+P+PTFY+IYK+KS++GYQSIPYVVALFS+ L +YYA +KT
Sbjct  4    HWAFAFGVLGNIVSFIVFLSPLPTFYRIYKKKSTEGYQSIPYVVALFSSMLWIYYAFLKT  63

Query  773  NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDIL-FFGAVIIVSLFLVNG  597
            N  L++ IN FG  IE +++  YLFYA KK ++ T+K+LLL ++  FGA+++V+ FL  G
Sbjct  64   NTTLLITINSFGVFIETIYVGFYLFYAPKKARVQTMKMLLLSVVGGFGAIVLVTQFLFKG  123

Query  596  SKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFS  417
            + R  +VGW C V ++ VF APL I+R+VI+T++ ++MPL LSV L   A  WFFYGL  
Sbjct  124  AVRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLL  183

Query  416  KDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEE  318
            KD  IA PN+LGF+FG+ QIVLY +Y  SKKE+
Sbjct  184  KDINIAAPNVLGFIFGIVQIVLYVIY--SKKEK  214



>ref|XP_006347346.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Solanum 
tuberosum]
Length=287

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/239 (54%), Positives = 173/239 (72%), Gaps = 8/239 (3%)
 Frame = -2

Query  956  QHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIK  777
             H    FG+LGNI+SFFVFL+P+PTFY IYK+KS++GYQSIPYVVALFSA L +YYA +K
Sbjct  6    DHWTFAFGVLGNIISFFVFLSPLPTFYNIYKKKSTEGYQSIPYVVALFSAMLWIYYAFLK  65

Query  776  TNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVIIVSLFLVN  600
            TN  L+V IN FGC IE +++  YLFYA KK ++ TIK LLLL +  FGA+++V+ FL  
Sbjct  66   TNTTLLVTINTFGCFIETLYVGFYLFYAPKKARVQTIKLLLLLVVGGFGAIVLVTQFLFK  125

Query  599  GSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLF  420
            G+ R  +VGW C V ++ VF APL I+RQVI+T++ ++MP  LSV L   A  WFFYGL 
Sbjct  126  GAIRAQIVGWICLVFSLCVFVAPLCIVRQVIKTKSVEYMPFLLSVFLTLSAVMWFFYGLL  185

Query  419  SKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEE----DGKGAEYKEGIEIQVKNDGRR  255
             KD+ IA PN+LGF+FG+ Q++LY MY  +KKEE    +    E K+ + I +++D ++
Sbjct  186  LKDFNIAIPNVLGFIFGILQMILYVMY--NKKEEVVIKEQNLPELKDHV-IILEDDKKK  241



>gb|KFK36797.1| hypothetical protein AALP_AA4G172400 [Arabis alpina]
Length=267

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 168/220 (76%), Gaps = 1/220 (0%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M  L V  +A LFGL+GNIVSF VFL+P+PTFY IYK+K+S G+QSIPY+ AL SA LLL
Sbjct  1    MVSLKVHEIAFLFGLMGNIVSFGVFLSPVPTFYGIYKKKTSKGFQSIPYICALASATLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIV  618
            YY ++KT+AYLI+ IN FGC IE+ ++ +Y+FYA ++ KIFT+KL+++ +I   G +II+
Sbjct  61   YYGIMKTHAYLIISINTFGCFIEISYLFLYVFYAPREAKIFTLKLIVICNIGGLGLLIIL  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
               LV    R++ VGW CA  ++AVFA+PLS+MR+VIRT++ ++MP  LS+ L   A  W
Sbjct  121  VNLLVPKQHRVSTVGWVCAAYSLAVFASPLSVMRKVIRTKSVEYMPFLLSLSLTLNAVMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEE  318
            FFYGL  KD +IA PNILGF+FG++Q++LY MY++S K +
Sbjct  181  FFYGLLIKDKFIAMPNILGFMFGISQMILYMMYRNSNKTD  220



>gb|KHN39181.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=274

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/238 (50%), Positives = 168/238 (71%), Gaps = 2/238 (1%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MAL S  HLAL FG+LGN++SF V+LAP+PTFY+IYK+KS++G+QS+PY+VALFS+ L L
Sbjct  1    MALNSHNHLALAFGMLGNVISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLWL  60

Query  794  YYAVIK-TNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKL-LLLDILFFGAVII  621
            YYA +K  +A L++ IN  GC IE+V+I M+  YA K  +  T+KL +++++  F  + +
Sbjct  61   YYASLKPADATLLITINSLGCVIEIVYIVMFTIYATKDARNLTVKLFMVMNVGSFALIFL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            V+ F ++GS R+ +VGW C  I V VFAAPLSI+ QVIRT++ +FMP  LS+ L   A  
Sbjct  121  VTYFAIHGSLRVQVVGWVCVSIAVGVFAAPLSIVAQVIRTKDVEFMPFNLSLFLTLSAVM  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQVKN  267
            WFFYGL  KD  IA PNILGF  GL Q++LY +Y++ K        + ++ +E  +KN
Sbjct  181  WFFYGLLLKDICIAIPNILGFTLGLLQMLLYAIYRNGKTNNKEVATKEEKALEAIMKN  238



>ref|XP_006363981.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Solanum 
tuberosum]
Length=300

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/234 (52%), Positives = 170/234 (73%), Gaps = 4/234 (2%)
 Frame = -2

Query  953  HLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKT  774
            H A  FG+LGNIVSF VFL+PIPTFY IYK+KS++GYQSIPYVVALFS+ L +YYA++K+
Sbjct  7    HYAFAFGVLGNIVSFIVFLSPIPTFYNIYKKKSTEGYQSIPYVVALFSSMLWIYYALLKS  66

Query  773  NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDIL-FFGAVIIVSLFLVNG  597
            N  L++ IN FG  IE +++  YLFYA KK ++ TIK+L+L ++  FGA+++V+ FL  G
Sbjct  67   NMPLLITINSFGMFIETIYVGFYLFYAPKKARVHTIKMLMLSVVGGFGAIVLVTEFLFKG  126

Query  596  SKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFS  417
              R  +VGW C + ++ VF APL I+RQVI+T++ ++MPL LSV L   A  WFFYGL  
Sbjct  127  VVRGQIVGWVCLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLL  186

Query  416  KDYYIAFPNILGFLFGLAQIVLYCMYKDSKKE--EDGKGAEYKEGIEIQVKNDG  261
            KD  IA PN+LGF+FG+ QI+LY +Y   +K   ++ K  E ++  E+ VK++ 
Sbjct  187  KDINIAAPNVLGFIFGILQIILYAIYSKKEKSIIKEQKLPEMQKP-EVIVKDEN  239



>ref|NP_001131289.1| mtN3-like protein [Zea mays]
 gb|ACF79630.1| unknown [Zea mays]
 gb|ACG31892.1| mtN3-like protein [Zea mays]
 gb|AFW60846.1| mtN3-like protein [Zea mays]
Length=293

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/224 (53%), Positives = 166/224 (74%), Gaps = 2/224 (1%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA LS+ H +A  FGLLGNI+SF  +LAP+PTFY+IYK KS++G+QS+PYVVALFSA L 
Sbjct  1    MAGLSLLHPMAFAFGLLGNIISFMTYLAPLPTFYRIYKNKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVII  621
            +YYA++K+N  L++ IN  GC IE ++I+MYL YA KK K+FT K LLLL++  FG +++
Sbjct  61   IYYALLKSNELLLITINSAGCVIETLYIAMYLLYAPKKAKLFTAKILLLLNVGVFGLILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++L L  G +R+ ++GW C   +V+VF APLSI+RQV+RTR+ +FMP +LS+ L   A  
Sbjct  121  LTLLLSAGQRRVVVLGWVCVAFSVSVFVAPLSIIRQVVRTRSVEFMPFSLSLSLTVSAVV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGK  309
            WF YGL  KD Y+A PN++GF FG+ Q+ LY +Y+++      K
Sbjct  181  WFLYGLLIKDKYVALPNVIGFSFGVVQMGLYALYRNATPRVPAK  224



>gb|ACV71016.1| UPA16 [Capsicum annuum]
Length=301

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 161/213 (76%), Gaps = 3/213 (1%)
 Frame = -2

Query  953  HLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKT  774
            H A  FG+LGNI+SF VFL+PIPTFY IYK+K+++GYQSIPYV+ALFS+ L +YYA +KT
Sbjct  7    HWAFAFGVLGNIISFIVFLSPIPTFYTIYKKKTAEGYQSIPYVIALFSSMLWIYYAFLKT  66

Query  773  NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDIL-FFGAVIIVSLFLVNG  597
            N  L++ IN FG  IE +++ +YLFYA KK ++ T+K+LLL ++  FGA+++V+ FL  G
Sbjct  67   NVTLLITINSFGIFIETIYVGLYLFYAPKKARVHTVKMLLLTVVGGFGAIVLVTQFLFKG  126

Query  596  SKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFS  417
              R  +VGW C +  ++VF APL I+RQVI+T++ ++MPL LSV L   A  WFFYGL  
Sbjct  127  VVRGQIVGWICLIFALSVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLL  186

Query  416  KDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEE  318
            KD  IA PN+LGF+FG+ QIVLY +Y  SKKE+
Sbjct  187  KDINIAAPNVLGFIFGVLQIVLYAIY--SKKEK  217



>ref|XP_004241452.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Solanum 
lycopersicum]
Length=287

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 171/237 (72%), Gaps = 4/237 (2%)
 Frame = -2

Query  956  QHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIK  777
             H    FG+LGNI+SFFVFL+P+PTFY IYK+KS++GYQSIPYVVALFSA L +YYA +K
Sbjct  6    DHWTFAFGVLGNIISFFVFLSPLPTFYNIYKKKSTEGYQSIPYVVALFSAMLWIYYAFLK  65

Query  776  TNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVIIVSLFLVN  600
            TN  L+V IN FGC IE +++  YLFYA KK ++ TIK LLLL +  FGA+I+++ FL  
Sbjct  66   TNTTLLVTINTFGCFIETLYVGFYLFYAPKKARVQTIKLLLLLVVGGFGAIILITQFLFK  125

Query  599  GSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLF  420
            G+ R  +VGW C V ++ VF APL I+RQVI+T++ ++MP  LSV L   A  WFFYGL 
Sbjct  126  GAIRAQIVGWICLVFSLCVFVAPLCIVRQVIKTKSVEYMPFLLSVFLTLSAVMWFFYGLL  185

Query  419  SKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKE--EDGKGAEYKEGIEIQVKNDGRR  255
             KD+ IA PN+LGF+FG+ Q++LY MY   +K   ++    E K+ + I +++D ++
Sbjct  186  LKDFNIAIPNVLGFIFGILQMILYVMYNKKEKVVIKEQNLPELKDHV-IIIEDDKKK  241



>ref|XP_011079737.1| PREDICTED: bidirectional sugar transporter NEC1-like isoform 
X1 [Sesamum indicum]
Length=283

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 159/219 (73%), Gaps = 1/219 (0%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M +LS  H+A  FG+LGNIVSF V+LAP+PTFY+I+K+KS++G+Q+IPY VALFSA L L
Sbjct  1    MPILSTLHIANAFGILGNIVSFLVYLAPLPTFYRIWKKKSTEGFQAIPYSVALFSAMLYL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLL-LLDILFFGAVIIV  618
            YYA +K N+ +++ IN  GC  E+ ++++Y+ YA K  ++ T +LL L ++   G VI  
Sbjct  61   YYAFLKQNSIILITINTIGCVTEIAYLTVYMIYATKVSRVSTTRLLFLFNVSLLGVVIGA  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            +  L  G +R+  VGW CA  +V+VFAAPL+I+R+VIRT++ +FMP  LS  L  CA  W
Sbjct  121  TYLLARGHQRVTAVGWICAAFSVSVFAAPLAIIRRVIRTKSVEFMPFYLSFFLTICAVVW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKE  321
            F YG   KDY+IA PNILGF+FG+ Q+ LY +YKD K++
Sbjct  181  FLYGFLIKDYFIAGPNILGFIFGIMQMTLYVVYKDRKQQ  219



>ref|XP_009599477.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Nicotiana 
tomentosiformis]
Length=282

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 157/212 (74%), Gaps = 1/212 (0%)
 Frame = -2

Query  953  HLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKT  774
            H A  FG+LGNIVSF VFL+P+PTFYKIYK+KS++GYQSIPYV+ALFS+ L +YYA +KT
Sbjct  6    HWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVIALFSSMLWIYYAFLKT  65

Query  773  NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDILF-FGAVIIVSLFLVNG  597
            N  L++ IN FG  IE +++  YLFYA KK ++ T+K+LLL ++  FGA+I+++ FL  G
Sbjct  66   NTTLLITINSFGVFIETIYVGFYLFYAPKKARVQTVKMLLLTVVAGFGAIILIAQFLFKG  125

Query  596  SKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFS  417
              R  +VGW C V ++ VF APL I+R+VI+T++ +FMPL LSV L   A  WFFYGL  
Sbjct  126  VARGQVVGWVCLVFSLCVFVAPLCIVRKVIKTKSVEFMPLLLSVFLTLSAVMWFFYGLLL  185

Query  416  KDYYIAFPNILGFLFGLAQIVLYCMYKDSKKE  321
            KD  IA PNILG +FG+ QIVLY +Y   +K 
Sbjct  186  KDINIAAPNILGLIFGILQIVLYVIYNKKEKH  217



>ref|XP_002442119.1| hypothetical protein SORBIDRAFT_08g014040 [Sorghum bicolor]
 gb|EES15957.1| hypothetical protein SORBIDRAFT_08g014040 [Sorghum bicolor]
Length=302

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/239 (51%), Positives = 169/239 (71%), Gaps = 4/239 (2%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA LS+QH  A  FGLLGN++SF  FLAPIPTFY+IYK KS++G+QS+PYVVALFSA L 
Sbjct  1    MAGLSLQHPWAFAFGLLGNVISFLTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVII  621
            ++YA+IK+N   ++ IN  GC IE ++I MY  YA KK K+FT K +LLL++  FG +++
Sbjct  61   IFYALIKSNETFLITINAAGCVIETIYIVMYFVYAPKKAKLFTAKIMLLLNVGVFGVILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            V+L L  G KR+ ++GW C   +V+VF APLSIMR+VI+T++ ++MP +LS+ L   A  
Sbjct  121  VTLLLFKGDKRVVMLGWICVGFSVSVFVAPLSIMRRVIQTKSVEYMPFSLSLSLTLSAVV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQVKND  264
            WF YGL  KD Y+A PNILGF FG+ Q+VLY +Y +       +G +   G+++    D
Sbjct  181  WFLYGLLIKDKYVALPNILGFTFGVVQMVLYVLYMNKTPVAVAEGKD--AGVKLPSAAD  237



>ref|XP_004235326.1| PREDICTED: bidirectional sugar transporter N3 [Solanum lycopersicum]
Length=300

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 121/234 (52%), Positives = 170/234 (73%), Gaps = 4/234 (2%)
 Frame = -2

Query  953  HLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKT  774
            H A  FG+LGNI+SF VFL+PIPTFY IYK+KS++GYQSIPYVVALFS+ L +YYA++K+
Sbjct  7    HYAFAFGVLGNIISFIVFLSPIPTFYSIYKKKSTEGYQSIPYVVALFSSMLWIYYALLKS  66

Query  773  NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDIL-FFGAVIIVSLFLVNG  597
            N  L++ IN FG  IE +++  YLFYA KK ++ TIK+L+L ++  FGA+++V+ FL  G
Sbjct  67   NMPLLITINSFGMFIETIYVGFYLFYAPKKARVHTIKMLMLSVVGGFGAIVLVTEFLFKG  126

Query  596  SKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFS  417
              R  +VGW C + ++ VF APL I+RQVI+T++ ++MPL LSV L   A  WFFYGL  
Sbjct  127  VVRGQIVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLL  186

Query  416  KDYYIAFPNILGFLFGLAQIVLYCMYKDSKKE--EDGKGAEYKEGIEIQVKNDG  261
            KD  IA PN+LGF+FG+ QI+LY +Y   +K   ++ K  E ++  E+ VK++ 
Sbjct  187  KDINIAAPNVLGFIFGILQIILYAIYSKKEKSIIKEQKLPEIQK-TEVIVKDEN  239



>ref|XP_004235339.1| PREDICTED: bidirectional sugar transporter SWEET10 [Solanum lycopersicum]
Length=282

 Score =   242 bits (617),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 159/211 (75%), Gaps = 1/211 (0%)
 Frame = -2

Query  953  HLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKT  774
            H A +FG+LGNI+SF VFL+PIPTF KIYK+KS++GYQSIPYV+ALFS  L +YYA +KT
Sbjct  6    HWAFVFGVLGNIISFIVFLSPIPTFNKIYKKKSTEGYQSIPYVIALFSCMLWIYYAFLKT  65

Query  773  NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDIL-FFGAVIIVSLFLVNG  597
            N  L++ IN FG  IE +++S++L+YA KK ++ T+K+LLL ++  FGA+I+V+ FL  G
Sbjct  66   NTTLLITINSFGMLIETIYVSLFLYYAPKKARVNTVKMLLLTVVGGFGAIILVTQFLFKG  125

Query  596  SKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFS  417
              R  +VGW C + ++ VF APL I+RQVI+T++ ++MP+ LSV L   A  WFFYGL  
Sbjct  126  VVRGQIVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPILLSVFLTISAVMWFFYGLLL  185

Query  416  KDYYIAFPNILGFLFGLAQIVLYCMYKDSKK  324
            KD  IA PNILGF+FG+ Q++LY MY+   K
Sbjct  186  KDVNIAAPNILGFIFGILQMILYAMYRKKHK  216



>ref|XP_010243612.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Nelumbo 
nucifera]
Length=270

 Score =   241 bits (616),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/216 (54%), Positives = 166/216 (77%), Gaps = 1/216 (0%)
 Frame = -2

Query  965  LSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYA  786
            +++  LA  FGLLGNIVSF V+LAP+PTFY+IYK+KS++G+QSIPYVVAL SA L +YYA
Sbjct  5    ITIHTLAFAFGLLGNIVSFMVYLAPVPTFYRIYKKKSTEGFQSIPYVVALLSAMLWIYYA  64

Query  785  VIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFT-IKLLLLDILFFGAVIIVSLF  609
            ++K    ++  ING GC+IE ++I++YL YA K+ ++FT   LLLL++  +G +++++  
Sbjct  65   MLKNEGAMLETINGIGCSIEAIYITIYLVYAPKEARVFTLKLLLLLNVGAYGLILLLTFL  124

Query  608  LVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFY  429
            L NGS+++ +VGW CA  +++VFA+PLSIMRQVIRT++ +FMP  LS  L  CA  WF Y
Sbjct  125  LTNGSRQVMVVGWICAGFSISVFASPLSIMRQVIRTKSVEFMPFLLSFFLTLCAVLWFCY  184

Query  428  GLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKE  321
            GL   D YIA PN+LGF FG+ Q++LY +YKD+KK+
Sbjct  185  GLLKNDLYIAIPNVLGFAFGITQMILYMVYKDTKKD  220



>ref|XP_007050795.1| Medicago truncatula MTN3 [Theobroma cacao]
 gb|EOX94952.1| Medicago truncatula MTN3 [Theobroma cacao]
Length=306

 Score =   242 bits (618),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 120/271 (44%), Positives = 182/271 (67%), Gaps = 17/271 (6%)
 Frame = -2

Query  1019  QITHIE--RASPARKVKMALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDG  846
             ++ HI+  R S   ++ MA +     +++FGLLGNI+SF V+LAP+PTFY+I+K+KS++G
Sbjct  13    KLPHIQAKRKSFTPRI-MANIHDHGFSVVFGLLGNILSFLVYLAPLPTFYRIFKKKSTEG  71

Query  845   YQSIPYVVALFSAELLLYYAVIKT-NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFT  669
             +QSIPY VALFSA LLLYYA +K  +A++++ IN  GC IE +++ +Y+ YA K  +++T
Sbjct  72    FQSIPYSVALFSAMLLLYYAFLKKHDAFMLITINSIGCFIESIYLLLYMVYATKSARVYT  131

Query  668   IKLLLL-DILFFGAVIIVSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNT  492
              KLL+  ++   G++I+++     GS RI++VGW CAV +V VFAAPLSI+R VI+T+  
Sbjct  132   TKLLIFFNLGALGSIILLTFIFSKGSSRISVVGWICAVFSVCVFAAPLSIIRLVIKTKTV  191

Query  491   QFMPLTLSVCLVFCATAWFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEE--  318
             ++MP  LS  L  CA  WF YG   +DYYIA PNILGF+FG+ Q++LY +Y+  +KE+  
Sbjct  192   EYMPFPLSFFLTLCAVTWFLYGFSLRDYYIATPNILGFIFGITQMILYLLYRGGRKEQIL  251

Query  317   ----------DGKGAEYKEGIEIQVKNDGRR  255
                       + K  E   G+++   N  + 
Sbjct  252   PEIKAQETLPESKAKEQANGVQLSTLNQHQE  282



>ref|XP_006347633.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
tuberosum]
Length=296

 Score =   241 bits (616),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 120/214 (56%), Positives = 162/214 (76%), Gaps = 3/214 (1%)
 Frame = -2

Query  956  QHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIK  777
             H A  FG+LGNIVSF VFL+PIPTFY IYK+KS++GYQSIPYVVALFS+ L +YYA++K
Sbjct  6    NHWAFAFGVLGNIVSFIVFLSPIPTFYNIYKKKSTEGYQSIPYVVALFSSMLWIYYALLK  65

Query  776  TNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDIL-FFGAVIIVSLFLVN  600
            TN  L++ IN FG  IE +++ +YLFYA KK ++ T+K+L+L ++  FGA+I+V+  L  
Sbjct  66   TNMPLLITINSFGMFIETIYVGLYLFYAPKKARVQTVKMLMLSVVGGFGAIILVTELLFK  125

Query  599  GSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLF  420
            G+ R  +VGW C + ++ VF APL I+R+VI+T++ ++MPL LSV L   A  WFFYGL 
Sbjct  126  GAIRGQVVGWICLIFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLL  185

Query  419  SKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEE  318
             KD  IA PN+LGF+FG+ QIVLY +Y  SKKE+
Sbjct  186  LKDINIAAPNVLGFIFGILQIVLYAIY--SKKEK  217



>ref|XP_002443167.1| hypothetical protein SORBIDRAFT_08g013840 [Sorghum bicolor]
 gb|EES17005.1| hypothetical protein SORBIDRAFT_08g013840 [Sorghum bicolor]
Length=302

 Score =   242 bits (617),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/231 (54%), Positives = 166/231 (72%), Gaps = 4/231 (2%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA LS+QH  A  FGLLGN++SF  FLAPIPTFY+IYK KS++G+QS+PYVVALFSA L 
Sbjct  1    MAGLSLQHPWAFAFGLLGNLISFLTFLAPIPTFYRIYKTKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVII  621
            ++YA+IK+N   ++ IN  GC IE ++I MY  YA KK K+FT K +LLL++  FG +++
Sbjct  61   IFYALIKSNETFLITINAAGCVIETIYIVMYFVYAPKKAKLFTAKIMLLLNVGVFGVILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            V+L L  G KR+ ++GW C   +V+VF APLSIMR+VI+T++ ++MP +LS+ L   A  
Sbjct  121  VTLLLFKGDKRVVMLGWICVGFSVSVFVAPLSIMRRVIQTKSMEYMPFSLSLSLTLSAVV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMY--KDSKKEEDGKGAEYK  294
            WF YGL  KD Y+A PNILGF FG+ Q+VLY +Y  K      +GK A  K
Sbjct  181  WFLYGLLIKDKYVALPNILGFTFGMVQMVLYVLYMNKTPVAVAEGKDAGGK  231



>ref|XP_006444236.1| hypothetical protein CICLE_v10023774mg [Citrus clementina]
 gb|ESR57476.1| hypothetical protein CICLE_v10023774mg [Citrus clementina]
Length=275

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 163/222 (73%), Gaps = 4/222 (2%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MA+L   H  ++FGLLGNIVSF V+LAP+PTFY+I+K+KS+ G+QSIPY VALFSA LLL
Sbjct  1    MAILG-PHSVIIFGLLGNIVSFLVYLAPLPTFYRIFKKKSTQGFQSIPYSVALFSAMLLL  59

Query  794  YYAVIK-TNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVII  621
            YYA +K +NA++++ ING GC IE +++  ++ YA K  KI+T KLL+L +I   G +++
Sbjct  60   YYASLKGSNAFMLITINGIGCIIESLYLLFFMIYATKTAKIYTTKLLILFNIGALGLIVL  119

Query  620  VSLFLVNGS-KRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCAT  444
            ++  L   S +R+ +VGW CAV +V VFAAPLSI+RQVIRT++ ++MP +LS CL  CA 
Sbjct  120  LTYLLSKSSDQRLTIVGWICAVFSVCVFAAPLSIIRQVIRTKSVEYMPFSLSCCLTICAG  179

Query  443  AWFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEE  318
             W  YGL  KDYYIA PNILG  FG  Q++LY  Y+  +  E
Sbjct  180  MWLLYGLSIKDYYIATPNILGMAFGATQMILYLAYRTRRNSE  221



>gb|EMT22394.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=296

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/240 (50%), Positives = 170/240 (71%), Gaps = 8/240 (3%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            M  LSVQH  A  FGLLGN++SF  +LAP+PTFY+IYK KS+ G+QS+PYVVALFSA L 
Sbjct  1    MGGLSVQHPWAFTFGLLGNVISFMTYLAPLPTFYRIYKNKSTQGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVII  621
            +YYA++K++ YL++ IN  GC IE ++I +YL YA+K+ +IFT K LLLL++  FG +++
Sbjct  61   IYYALLKSDEYLLITINSAGCVIETIYIVLYLAYAHKQARIFTAKILLLLNVGVFGLILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++L L  G +RI ++GW C   +V+VF APLS++R V+RTR+ +FMP +LS+ L   A  
Sbjct  121  LTLLLTAGERRIVMLGWVCVGFSVSVFVAPLSVIRLVVRTRSVEFMPFSLSLSLTASAVV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQVKNDG  261
            WF YGL  KD Y+A PNILGF FG+ Q+ LY +Y+++      K       ++  V +DG
Sbjct  181  WFLYGLLIKDKYVALPNILGFAFGVIQMGLYALYRNATPRPAPK------EVDAPVSDDG  234



>ref|XP_009802194.1| PREDICTED: bidirectional sugar transporter SWEET12-like isoform 
X1 [Nicotiana sylvestris]
Length=298

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/213 (55%), Positives = 157/213 (74%), Gaps = 3/213 (1%)
 Frame = -2

Query  953  HLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKT  774
            H A  FG+LGNIVSFFVFL+P+PTFYKIYK+KS++ YQSIPYVVALFSA   +YYA +K+
Sbjct  7    HWAFTFGVLGNIVSFFVFLSPLPTFYKIYKKKSTEDYQSIPYVVALFSAMFWIYYAFLKS  66

Query  773  NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDIL-FFGAVIIVSLFLVNG  597
            N  L++ IN FGC IE +++  YLFYA KK ++ T+KLLLL +   FGA+++V+  L  G
Sbjct  67   NTTLLITINSFGCFIETIYVGFYLFYAPKKARVQTVKLLLLSVFGGFGAIVLVTQLLFKG  126

Query  596  SKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFS  417
              R+ +VGW C V ++ VF +PL IMRQVI+T++ ++MP  +SV L   A  WFFYGL  
Sbjct  127  VVRVQVVGWICLVFSLCVFVSPLCIMRQVIKTKSVEYMPFFISVFLTLSAVTWFFYGLLL  186

Query  416  KDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEE  318
            KD+ IA PN+LGF+ G+ Q+V Y +Y   KKEE
Sbjct  187  KDFNIAIPNVLGFIVGILQMVFYVIY--YKKEE  217



>ref|XP_003532478.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Glycine 
max]
 gb|KHN16865.1| Bidirectional sugar transporter SWEET13 [Glycine soja]
Length=254

 Score =   239 bits (611),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/262 (46%), Positives = 184/262 (70%), Gaps = 21/262 (8%)
 Frame = -2

Query  956  QHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIK  777
            +  A +FG++GNI+SF VFLAP+PTFY+IYK+KS++G+QS+PYVVALFSA L +YYA +K
Sbjct  6    ESWAFVFGVMGNIISFGVFLAPLPTFYQIYKKKSTEGFQSLPYVVALFSAMLWIYYAFVK  65

Query  776  -TNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIVSLFLV  603
               A L++ IN FG  +E +++S++L YA +K ++ TIKLLLL ++  FGA+++ +L+L 
Sbjct  66   RETALLLITINTFGIVVESIYLSIFLIYAPRKPRLTTIKLLLLLNVFGFGAMLLSTLYLS  125

Query  602  NGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGL  423
             G+KR+A++GW C V N++VFAAPL I+R+VI+TR+ ++MP TLS+ L   A  WFFYGL
Sbjct  126  KGAKRLAIIGWICLVFNISVFAAPLFIIRRVIKTRSVEYMPFTLSMFLTINAVMWFFYGL  185

Query  422  FSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQVKNDGRR*I*Q  243
              +DYY+A PN LGF+FG+ Q+V+Y MY+++           +E ++ Q           
Sbjct  186  LLRDYYVALPNTLGFVFGIIQMVMYLMYRNATP------VALEEPVKAQ-----------  228

Query  242  RIEVTGRRSDVLRTVLIKPHHA  177
              E+ G   DV++   ++P+H 
Sbjct  229  --ELNGHIIDVVKIGTMEPNHG  248



>gb|KDO87388.1| hypothetical protein CISIN_1g036251mg [Citrus sinensis]
Length=275

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 163/222 (73%), Gaps = 4/222 (2%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MA+L   H  ++FGLLGNIVSF V+LAP+PTFY+I+K+KS+ G+QSIPY VALFSA LLL
Sbjct  1    MAILG-PHSVIIFGLLGNIVSFLVYLAPLPTFYRIFKKKSTQGFQSIPYSVALFSAMLLL  59

Query  794  YYAVIK-TNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVII  621
            YYA +K +NA++++ ING GC IE +++  ++ YA K  KI+T KLL+L +I   G +++
Sbjct  60   YYASLKGSNAFMLITINGIGCIIESLYLLFFMIYATKTAKIYTTKLLILFNIGALGLIVL  119

Query  620  VSLFLVNGS-KRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCAT  444
            ++  L   S +R+ +VGW CAV +V VFAAPLSI+RQVIRT++ ++MP +LS CL  CA 
Sbjct  120  LTYLLSKSSDQRLTIVGWICAVFSVCVFAAPLSIIRQVIRTKSVEYMPFSLSCCLTICAG  179

Query  443  AWFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEE  318
             W  YGL  KDYYIA PNILG  FG  Q++LY  Y+  +  E
Sbjct  180  MWLLYGLSIKDYYIATPNILGMAFGATQMILYLAYRTRRNSE  221



>ref|XP_004297511.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Fragaria 
vesca subsp. vesca]
Length=310

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/224 (52%), Positives = 163/224 (73%), Gaps = 7/224 (3%)
 Frame = -2

Query  950  LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKTN  771
            LA  FG+LGNIVSF VFLAP+PTFY++YK+KS++G+QSIPY+ ALFSA + +YYA +K++
Sbjct  8    LAFAFGILGNIVSFIVFLAPVPTFYRVYKKKSTEGFQSIPYIFALFSATIWIYYASLKSD  67

Query  770  AYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDILFFGA---VIIVSLFLVN  600
              L++ INGFGC IE ++I+MY+ YA KK ++ T++LLLL  + FG    ++ +S FL  
Sbjct  68   EMLLITINGFGCVIETIYIAMYITYAPKKARVNTLRLLLL--VNFGGFCLILFLSHFLTQ  125

Query  599  GSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLF  420
            G  R+ ++GW C   +V+VFAAPLSIMR VIRT++ +FMP +LS  L   A  W FYGL 
Sbjct  126  GPTRVKVLGWVCVAFSVSVFAAPLSIMRLVIRTKSVEFMPFSLSFFLTLSAIMWLFYGLL  185

Query  419  SKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK--EEDGKGAEYK  294
             KD Y+A PNILGF FG+ Q++LY  Y++ K    ++ K  E+K
Sbjct  186  LKDLYVAAPNILGFSFGVVQMILYAAYRNKKTVLVDEEKVPEHK  229



>ref|XP_011020821.1| PREDICTED: bidirectional sugar transporter N3-like [Populus euphratica]
Length=285

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/223 (50%), Positives = 169/223 (76%), Gaps = 1/223 (0%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MA+ S+ HLA  FG+LGNI+S  VFLAP+PTF +I+K+KS++ +QS+PY++ALFS+ L L
Sbjct  1    MAVTSILHLAFTFGILGNIISTMVFLAPVPTFIRIFKKKSTEDFQSLPYLMALFSSMLWL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVIIV  618
            YYA++K +  L+V IN FGC IE  +I++Y+ YA ++ ++ TIKLL+ +++  F  ++++
Sbjct  61   YYAMLKKDTILLVTINSFGCLIETTYIAIYIVYATRESRVSTIKLLISMNMGLFSLILLL  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            + FLV+GS R+ ++GW C  ++V VFAAPL+I++QVIRT++ +FMP TLS  L   A  W
Sbjct  121  AHFLVSGSVRVKVLGWLCVALSVCVFAAPLNILKQVIRTKSVEFMPFTLSFFLTLSAVMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGK  309
            F YGL  KD  +A PNILGF+ GL Q+VLY +Y++++K E+ K
Sbjct  181  FAYGLLLKDLCVALPNILGFILGLLQMVLYGIYRNAQKVEEKK  223



>ref|XP_008464393.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Cucumis 
melo]
Length=296

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 162/212 (76%), Gaps = 1/212 (0%)
 Frame = -2

Query  965  LSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYA  786
            +S Q LA +FGLLGNI+SF VFLAP+PTFYKIYK+KS++GYQS+PYVVALFSA L +YYA
Sbjct  3    ISPQTLAFVFGLLGNIISFMVFLAPLPTFYKIYKKKSAEGYQSVPYVVALFSAMLWIYYA  62

Query  785  VIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLL-LLDILFFGAVIIVSLF  609
            ++KTNA  ++ IN FGC IE ++I +++ YA  K +  T K++ LL++L FG ++ ++L 
Sbjct  63   LLKTNATFLITINSFGCVIESLYILLFIIYAPTKLRFQTAKVIFLLNVLGFGLMLALTLV  122

Query  608  LVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFY  429
            L  G KR+ ++GW C V N++VFAAPL IM +VI+T++ ++MP  LS  L   A  WFFY
Sbjct  123  LAKGEKRLKVLGWICLVFNLSVFAAPLLIMGKVIKTKSVEYMPFALSFFLTLNAVMWFFY  182

Query  428  GLFSKDYYIAFPNILGFLFGLAQIVLYCMYKD  333
            GL  KDYYIA PN++GF+FG+ Q++LY + K+
Sbjct  183  GLLLKDYYIALPNVVGFVFGIIQMILYVIVKN  214



>ref|XP_002450786.1| hypothetical protein SORBIDRAFT_05g018110 [Sorghum bicolor]
 gb|EES09774.1| hypothetical protein SORBIDRAFT_05g018110 [Sorghum bicolor]
Length=291

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/242 (51%), Positives = 170/242 (70%), Gaps = 8/242 (3%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPI--PTFYKIYKRKSSDGYQSIPYVVALFSAE  804
            MA LS+QH +A  FGLLGNI+SF  +LAP+  PTFY+IYK KS+ G+QS+PYVVALFSA 
Sbjct  1    MAGLSLQHPMAFAFGLLGNIISFMTYLAPLYRPTFYRIYKSKSTQGFQSVPYVVALFSAM  60

Query  803  LLLYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAV  627
            L +YYA++K+N +L++ IN  GC IE ++I MYL YA KK K+FT K LLLL++  FG +
Sbjct  61   LWIYYALLKSNEFLLITINSAGCVIETLYIVMYLLYAPKKAKLFTAKILLLLNVGVFGLI  120

Query  626  IIVSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCA  447
            ++++L L  G  R+ ++GW C   +V+VF APLSI+RQV+RTR+ +FMP +LS+ L   A
Sbjct  121  LLLTLLLSAGQHRVVVLGWVCVAFSVSVFVAPLSIIRQVVRTRSVEFMPFSLSLSLTVSA  180

Query  446  TAWFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQVKN  267
              WF YGL  KD Y+A PN+LGF FG+ Q+ LY +Y+++      +    KE  +     
Sbjct  181  VVWFLYGLLIKDKYVALPNVLGFSFGVVQMGLYALYRNATP----RVPPAKEVTDDDAAA  236

Query  266  DG  261
            DG
Sbjct  237  DG  238



>ref|XP_007137870.1| hypothetical protein PHAVU_009G162700g [Phaseolus vulgaris]
 gb|ESW09864.1| hypothetical protein PHAVU_009G162700g [Phaseolus vulgaris]
Length=264

 Score =   239 bits (611),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/239 (51%), Positives = 178/239 (74%), Gaps = 7/239 (3%)
 Frame = -2

Query  965  LSVQH--LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLY  792
            +++ H   A +FGLLGN++SF VFLAP+PTFY+IYK+K+++G+QS+PYVVALFS+ L +Y
Sbjct  1    MAIHHETWAFVFGLLGNVISFMVFLAPLPTFYQIYKKKTAEGFQSLPYVVALFSSMLWIY  60

Query  791  YAVIKTNA-YLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDILF-FGAVIIV  618
            YA++K +A  L++ IN FGC IE ++++++L YA  K ++ TIKLLLL  +F FGA+++ 
Sbjct  61   YALVKKDASLLLITINSFGCVIESIYLAIFLLYAPSKTRLCTIKLLLLLNVFGFGAMLLS  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            +L+   GSKR++++GW C V N++VFAAPL IM++VI+T++ ++MP +LS  L   A  W
Sbjct  121  TLYFTTGSKRLSVIGWICLVFNISVFAAPLCIMKRVIKTKSVEYMPFSLSFFLTINAVMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK---EEDGKGAEYKEGIEIQVK  270
            FFYGL  KDYYIA PN LGFLFG+ Q++LY +Y+++K    EE  K  E    I   VK
Sbjct  181  FFYGLLLKDYYIALPNTLGFLFGIIQMMLYLVYRNAKPKTLEEPTKLQELNGHIVDVVK  239



>ref|XP_004980522.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Setaria 
italica]
Length=299

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/224 (52%), Positives = 165/224 (74%), Gaps = 2/224 (1%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA LS+ H LA  FGLLGNI+SF  +LAP+PTFY+IYK KS++G+QS+PYVVALFSA L 
Sbjct  1    MAGLSLDHPLAFTFGLLGNIISFMTYLAPLPTFYRIYKTKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFT-IKLLLLDILFFGAVII  621
            +YYA++K++ +L++ +N  GC IE ++I+MYL YA KK K+FT + LLLL++  FG +++
Sbjct  61   IYYALLKSDEFLLITVNAAGCVIETLYITMYLAYAPKKAKLFTAMILLLLNVGVFGLILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            +++ L  G KR+ L+GW C    V+VF APLSI+RQV+RTR+ +FMP  LS+ L   A  
Sbjct  121  LTMLLAAGEKRVVLLGWVCVGFAVSVFVAPLSIIRQVVRTRSVEFMPFFLSLSLTVSAVV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGK  309
            WF YGL  KD Y+A PN++GF FG+ Q+ LY +Y+++      K
Sbjct  181  WFLYGLLIKDKYVALPNVIGFTFGVIQMGLYALYRNATPRVPAK  224



>ref|XP_006296061.1| hypothetical protein CARUB_v10025211mg [Capsella rubella]
 gb|EOA28959.1| hypothetical protein CARUB_v10025211mg [Capsella rubella]
Length=260

 Score =   239 bits (609),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 166/220 (75%), Gaps = 1/220 (0%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M  + V  LA  FGL+GNIVSF VFL+P+PTFY IYK+KSS G+QSIPY+ AL SA LLL
Sbjct  1    MVFIKVHQLAFFFGLMGNIVSFGVFLSPVPTFYGIYKKKSSKGFQSIPYICALASATLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIV  618
            YY ++KT+AYLI+ IN FGC IE+ ++ +Y+FYA ++ +IFT+KL+++ +I   G +I++
Sbjct  61   YYGIMKTHAYLIISINTFGCFIEITYLFLYIFYAPREARIFTLKLIVICNIGGLGLLILL  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
               LV    R++ VGW CA  ++AVFA+PLS+MR+VI+T++ ++MP  LS+ L   A  W
Sbjct  121  VNLLVPKPHRVSTVGWVCAAYSLAVFASPLSVMRKVIKTKSVEYMPFLLSLSLTLNAVMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEE  318
            FFYGL  KD +IA PNILGFLFG+AQ++LY MY+ S K +
Sbjct  181  FFYGLLIKDKFIAMPNILGFLFGVAQMILYMMYQGSTKTD  220



>ref|XP_010045482.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Eucalyptus 
grandis]
 gb|KCW83109.1| hypothetical protein EUGRSUZ_B00063 [Eucalyptus grandis]
Length=279

 Score =   239 bits (610),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/232 (49%), Positives = 163/232 (70%), Gaps = 2/232 (1%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MA   V  +A  FGLLGNIVSF  FLAP+PTFY IYK K + G+QSIPYVV+L SA LLL
Sbjct  1    MATHHVPTVAFAFGLLGNIVSFMTFLAPLPTFYGIYKTKKTQGFQSIPYVVSLLSAMLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKL-LLLDILFFGAVIIV  618
            YY ++K +  L++ ING GC IE  +++ YL YA+K D++ T+KL L++++L +G V+  
Sbjct  61   YYGLVKKDT-LLITINGIGCVIETAYVAAYLIYASKNDRVLTLKLFLIMNVLGYGVVLST  119

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            + FL  G+KR  ++GW C   ++ VF APL I+++VI+TR+ +FMP+TLS+ L   A  W
Sbjct  120  TFFLSKGAKRAWIIGWICMTFSLGVFVAPLCILKKVIKTRSVEFMPITLSIFLTLGAIVW  179

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIE  282
            FFYG   KD++IA PN+LGF+ G+ Q+VLY  YK++   E  + ++ +E  E
Sbjct  180  FFYGFLLKDFFIAVPNVLGFVLGVIQMVLYATYKNANTVEVERNSQQQEPRE  231



>ref|XP_002453892.1| hypothetical protein SORBIDRAFT_04g021000 [Sorghum bicolor]
 gb|EES06868.1| hypothetical protein SORBIDRAFT_04g021000 [Sorghum bicolor]
Length=336

 Score =   241 bits (615),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 129/282 (46%), Positives = 179/282 (63%), Gaps = 15/282 (5%)
 Frame = -2

Query  974  MALLSV--QHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAEL  801
            MA L++  Q  A  FG+LGNI+S  VFL+P+PTFY++Y++KS++G+QS PYVV LFS  L
Sbjct  1    MAFLNMEQQTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCML  60

Query  800  LLYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVI  624
             ++YA++K+ A L+V ING GC IE V++ MYL YA K  ++ T K+LL L++  FG V 
Sbjct  61   WIFYALLKSGAELLVTINGVGCVIETVYLGMYLLYAPKAARVLTAKMLLGLNVGVFGLVA  120

Query  623  IVSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCAT  444
            +V++ L NG  R+ ++GW C  + ++VFAAPLSIMRQVIRT++ +FMP++LS  LV  A 
Sbjct  121  LVTMVLSNGGLRVKVLGWICVSVALSVFAAPLSIMRQVIRTKSVEFMPISLSFFLVLSAV  180

Query  443  AWFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK--------EEDGKGAEY---  297
             WF YG   KD ++A PN+LGF+FGLAQ+ LY  Y++ K         EE    AE    
Sbjct  181  IWFAYGALKKDVFVAAPNVLGFVFGLAQMALYMAYRNKKPAAAAVIMVEEVKLPAEQYAS  240

Query  296  KEGIEIQVKNDGRR*I*QRIEVTGRRSDVLRTVLIKPHHARQ  171
            KE       ++G R      EV     D L    +  HH  Q
Sbjct  241  KEVAPPAAAHEGSR-ASCGAEVHPIDIDTLPVADVGRHHDSQ  281



>ref|XP_004235342.2| PREDICTED: uncharacterized protein LOC101265905 [Solanum lycopersicum]
Length=599

 Score =   248 bits (634),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 160/211 (76%), Gaps = 1/211 (0%)
 Frame = -2

Query  953  HLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKT  774
            H A  FG+LGNI+SF VFL+PIPTFYKIYK+KS++GYQSIPYVVALFS+ L +YYA++KT
Sbjct  7    HWAFAFGILGNIISFIVFLSPIPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYALLKT  66

Query  773  NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDIL-FFGAVIIVSLFLVNG  597
            N  L++ IN FG  IE +++  YLFYA KKD++ TIK+L+L ++  FGA+++V+ FL  G
Sbjct  67   NTTLLITINSFGVFIETIYVGFYLFYAPKKDRVQTIKMLMLSVVGGFGAIVLVTEFLFKG  126

Query  596  SKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFS  417
              R  +VGW C + ++ VF APL I+RQVI+T++ ++MPL LS+ L   A  WFFYGL  
Sbjct  127  VVRGQVVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSIFLTLSAVVWFFYGLLL  186

Query  416  KDYYIAFPNILGFLFGLAQIVLYCMYKDSKK  324
            KD  IA PN+LGF+FG+ QIVLY +Y   +K
Sbjct  187  KDINIAAPNVLGFIFGILQIVLYVIYNKKEK  217


 Score =   246 bits (627),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 118/231 (51%), Positives = 167/231 (72%), Gaps = 2/231 (1%)
 Frame = -2

Query  1010  HIERASPARKVKMALLSVQ-HLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSI  834
             ++E     + V+ ++  +  H A  FG+LGNIVSF VFL+P+PTFYKIYK+KS+DGYQSI
Sbjct  289   NVENMPKLQTVEASMAGISGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTDGYQSI  348

Query  833   PYVVALFSAELLLYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL  654
             PYVVALFS+ L +YYA +KTN  L++ IN FG  IE +++  YLFYA KKD++ TIK+L+
Sbjct  349   PYVVALFSSMLWIYYAFLKTNTTLLITINSFGVFIETIYVGFYLFYAPKKDRVQTIKMLM  408

Query  653   LDIL-FFGAVIIVSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPL  477
             L ++  FGA+++++ FL  G  R  +VGW C + ++ VF APL I++QVI+T++ ++MPL
Sbjct  409   LSVVGGFGAIVLITEFLFKGVVRGQIVGWICLIFSLCVFVAPLGIVKQVIKTKSVEYMPL  468

Query  476   TLSVCLVFCATAWFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK  324
              LS+ L   A  WFFYGL  KD  IA PN+LGF+ G+ Q+VLY +Y   +K
Sbjct  469   LLSIFLTLSAVVWFFYGLLLKDINIAIPNVLGFILGILQMVLYVIYNKKEK  519



>ref|XP_004138032.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Cucumis 
sativus]
 ref|XP_004161361.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Cucumis 
sativus]
 gb|KGN63458.1| hypothetical protein Csa_1G001300 [Cucumis sativus]
Length=292

 Score =   239 bits (611),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 161/212 (76%), Gaps = 1/212 (0%)
 Frame = -2

Query  965  LSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYA  786
            +S Q LA +FGLLGNI+SF VFLAP+PTFYKIYK+KS++GYQS+PYVVALFSA L +YYA
Sbjct  3    ISPQTLAFVFGLLGNIISFMVFLAPLPTFYKIYKKKSAEGYQSVPYVVALFSAMLWIYYA  62

Query  785  VIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLL-LLDILFFGAVIIVSLF  609
            ++KTNA  ++ IN FGC IE ++I +++ YA  K +  T K++ LL++L FG ++ ++L 
Sbjct  63   LLKTNATFLITINSFGCVIESLYILLFIIYAPTKLRFQTAKVIFLLNVLGFGLMLALTLV  122

Query  608  LVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFY  429
            L  G KR+ ++GW C V N++VFAAPL IM +VI+T++ ++MP  LS  L   A  WFFY
Sbjct  123  LAKGEKRLKVLGWICLVFNLSVFAAPLFIMGKVIKTKSVEYMPFALSFFLTLNAVMWFFY  182

Query  428  GLFSKDYYIAFPNILGFLFGLAQIVLYCMYKD  333
            GL  KDYYIA PN++GF+FG+ Q++LY + K 
Sbjct  183  GLLLKDYYIALPNVVGFVFGIIQMILYVIVKH  214



>ref|XP_006347634.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
tuberosum]
Length=296

 Score =   239 bits (611),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 173/239 (72%), Gaps = 8/239 (3%)
 Frame = -2

Query  962  SVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAV  783
            S  H A +FG+LGNIVSF VFL+P+PTFY IYK+K+++GYQSIPYVVALFS+ L +YYA 
Sbjct  4    SADHWAFVFGVLGNIVSFIVFLSPLPTFYTIYKKKTAEGYQSIPYVVALFSSMLWIYYAF  63

Query  782  IKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDIL-FFGAVIIVSLFL  606
            +KTN  L++ IN FG  IE +++  YLFYA KK ++ TIK+L L ++  FGA+I+V+ FL
Sbjct  64   LKTNTTLLITINTFGVFIETIYVGFYLFYAPKKSRVQTIKMLSLFVVGGFGAIILVTEFL  123

Query  605  VNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYG  426
              G+ R  +VGW C + ++ VF APL I+R+VI+T++ ++MPL LSV L   A  WFFYG
Sbjct  124  FKGAIRGQVVGWICLIFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYG  183

Query  425  LFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKE----EDGKGAEYKEGIEIQVKNDG  261
            L  KD  IA PNILGF+FG+ Q++LY +Y  SKKE    ++ K  E ++  E+ VK++ 
Sbjct  184  LLLKDINIAAPNILGFIFGILQMILYVIY--SKKEKAILKEQKLPEIQKA-EVIVKDEN  239



>ref|XP_006347635.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
tuberosum]
Length=286

 Score =   239 bits (610),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 160/212 (75%), Gaps = 3/212 (1%)
 Frame = -2

Query  953  HLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKT  774
            H A +FG+LGNI+SF VFL+PIPTF KIYK+KS++GYQSIPYV+ALFS  L +YYA +KT
Sbjct  6    HWAFVFGVLGNIISFIVFLSPIPTFNKIYKKKSTEGYQSIPYVIALFSCMLWIYYAFLKT  65

Query  773  NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDIL-FFGAVIIVSLFLVNG  597
            N  L++ IN FG  IE +++ ++L+YA KK ++ T+K+LLL ++  FGA+I+V+ F+  G
Sbjct  66   NTTLLITINSFGMLIETIYVGLFLYYAPKKARVNTVKMLLLTVVGGFGAIIVVTQFVFKG  125

Query  596  SKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFS  417
              R  +VGW C + ++ VF APL I+RQVI+T++ ++MP+ LSV L   A  WFFYGL  
Sbjct  126  VVRGQIVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPILLSVFLTISAVMWFFYGLLL  185

Query  416  KDYYIAFPNILGFLFGLAQIVLYCMY--KDSK  327
            KD  IA PNILGF+FG+ Q++LY MY  KD+K
Sbjct  186  KDVNIAAPNILGFIFGILQMILYAMYRKKDNK  217



>ref|XP_006411131.1| hypothetical protein EUTSA_v10017080mg [Eutrema salsugineum]
 gb|ESQ52584.1| hypothetical protein EUTSA_v10017080mg [Eutrema salsugineum]
Length=269

 Score =   238 bits (608),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 163/219 (74%), Gaps = 1/219 (0%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M  + V  LA LFGLLGNIVSF VFL+P+PTFY IYK+KSS G+QSIPY+ AL SA LLL
Sbjct  1    MVFIKVHQLAFLFGLLGNIVSFGVFLSPVPTFYGIYKKKSSKGFQSIPYICALASATLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIV  618
            YY ++K +AYLI+ IN FGC IE+ ++ +Y+ YA ++ KIFT+KL+++ +I   G +I++
Sbjct  61   YYGIMKKHAYLIISINTFGCFIEISYLLIYIIYAPREAKIFTLKLIVICNIGGLGLLILL  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
               LV    R++ VGW CA  ++AVFA+PLS+MR+VIRT++ ++MP  LS+ L   A  W
Sbjct  121  VDLLVPKPNRVSTVGWVCAAYSLAVFASPLSVMRKVIRTKSVEYMPFLLSLSLTLNAVMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKE  321
            FFYGL  KD +IA PNILGFLFG+AQ++LY MY   K +
Sbjct  181  FFYGLLIKDKFIAMPNILGFLFGIAQMILYMMYHSRKTD  219



>ref|NP_001288941.1| bidirectional sugar transporter SWEET9 [Brassica rapa]
 ref|XP_009133337.1| PREDICTED: bidirectional sugar transporter SWEET9 isoform X2 
[Brassica rapa]
 gb|AGO61984.1| plasma membrane localized sucrose transporter [Brassica rapa]
Length=270

 Score =   238 bits (608),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 169/223 (76%), Gaps = 1/223 (0%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M  + V  LA LFGLLGNIVSF VFL+P+PTFY IYK+KSS G+QSIPY+ AL SA LLL
Sbjct  1    MVFIKVHQLAFLFGLLGNIVSFGVFLSPVPTFYGIYKKKSSKGFQSIPYICALASATLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIV  618
            +Y ++KT+AYLI+ IN FGC IE+ ++ +Y+ YA ++ +IFT+KL+L+ +I   G +I++
Sbjct  61   FYGIMKTHAYLIISINTFGCFIEISYLFLYIIYAPREARIFTLKLILICNIGGLGLLILL  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
               L+    R++ VGW CA  ++AVFA+PLS+MR+VIRT++ ++MPL LS+ L   A  W
Sbjct  121  VDLLIPKQHRVSTVGWVCAAYSLAVFASPLSVMRKVIRTKSVEYMPLLLSLSLTLNAVMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGK  309
            FFYGL  +D +IA PNILGFLFG+AQ++LY MY DSKK +  K
Sbjct  181  FFYGLLIEDKFIAMPNILGFLFGIAQMILYMMYHDSKKTDLPK  223



>ref|XP_008392727.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Malus 
domestica]
Length=295

 Score =   239 bits (610),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 115/235 (49%), Positives = 167/235 (71%), Gaps = 8/235 (3%)
 Frame = -2

Query  965  LSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYY  789
            +++ H L+L FGLLGNI+S  VFLAP+PTFY +YK+K+++G+Q++PYV+ L S+ + +YY
Sbjct  1    MALHHTLSLAFGLLGNIISLLVFLAPVPTFYTVYKKKTTEGFQALPYVIGLLSSMMYVYY  60

Query  788  AVIKT----NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLL-LLDILFFGAVI  624
            A++K     +A L++ IN  GC IE ++I ++LFYA KK +I T  LL LL++  +G ++
Sbjct  61   ALLKEELKEDATLVITINSVGCVIETIYIXLFLFYAPKKARISTATLLFLLNLFSYGMMV  120

Query  623  IVSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCAT  444
            +++ FL  G  R  +VGW C V +++VF APL ++RQVIRT++ +FMP  LS  L   A 
Sbjct  121  VLTRFLATGETRFKIVGWICLVFSLSVFVAPLGVLRQVIRTKSVEFMPFPLSFFLTLGAV  180

Query  443  AWFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK--EEDGKGAEYKEGI  285
            AWFFYG   KDYYIAFPNILGF FG+ Q+ +Y +YK++KK  E+  K  E  E I
Sbjct  181  AWFFYGFLIKDYYIAFPNILGFFFGVVQMAVYVVYKNAKKFLEDQPKVQELSEHI  235



>gb|KDP32879.1| hypothetical protein JCGZ_12171 [Jatropha curcas]
Length=265

 Score =   238 bits (607),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 131/222 (59%), Positives = 181/222 (82%), Gaps = 1/222 (0%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MA L+ + L+++FG+LGN++SF V LAP+PTF+KIYK+KSS+G+QSIPYVVAL SA LLL
Sbjct  1    MAFLTHEELSVIFGVLGNVISFMVILAPVPTFHKIYKKKSSEGFQSIPYVVALTSAMLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIV  618
            YYA++K +A+LIV IN FGC +E+ +I +YL YA KK+K+FT+KL+L+ +I  FG +I++
Sbjct  61   YYALLKKHAFLIVGINAFGCVLEVAYIILYLIYAPKKEKMFTLKLILVFNIGAFGLMILL  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            ++ L+ GS+R+  VGW CA  +VAVFAAPLSIM +V+RTR+ +FMP  LS+ L   AT W
Sbjct  121  TMLLIKGSQRVNTVGWICAAFSVAVFAAPLSIMMRVVRTRSVEFMPFPLSLFLTLSATTW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDG  312
            F YGLF KD++IA PN+LGFLFG+AQ+ LY +YK++KKE+ G
Sbjct  181  FLYGLFVKDFFIALPNVLGFLFGIAQMALYMIYKNAKKEDKG  222



>ref|XP_008392763.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Malus 
domestica]
Length=248

 Score =   237 bits (605),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 114/232 (49%), Positives = 163/232 (70%), Gaps = 1/232 (0%)
 Frame = -2

Query  962  SVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAV  783
            S   LA  FG+LGNIVSF VFLAP+PTF+++YK+KS++G+QS+PYV ALFSA + +YYA 
Sbjct  6    SHHPLAFAFGILGNIVSFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALFSAMIWIYYAF  65

Query  782  IKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIVSLFL  606
            +K++  L++ IN FGC IE ++I++YL YA K  ++ T++LLLL +   F  ++++S FL
Sbjct  66   LKSHVILLITINSFGCVIETIYIAIYLTYATKHARVSTLRLLLLVNFGGFCLILLLSHFL  125

Query  605  VNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYG  426
              G  R+ ++GW C   +V+VFAAPLS+MR VIRT++ +FMP  LS  L   A  W  YG
Sbjct  126  SQGPTRVEVLGWVCVTFSVSVFAAPLSVMRMVIRTKSVEFMPFNLSFFLTLSAVMWLCYG  185

Query  425  LFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQVK  270
            L  KD Y+A PNILGF FG+ Q+ LY  Y+++K   + K  E+K  +  Q+K
Sbjct  186  LLLKDLYVATPNILGFSFGVVQMALYAKYRNTKTIVEEKLPEHKADVVKQIK  237



>gb|EAY83053.1| hypothetical protein OsI_38270 [Oryza sativa Indica Group]
 gb|AGS56391.1| disease susceptible protein Xa25 [Oryza sativa Indica Group]
Length=293

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 122/236 (52%), Positives = 169/236 (72%), Gaps = 8/236 (3%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA LS+QH  A  FGLLGN++SF  +LAPIPTFY+IYK KS++G+QS+PYVVALFSA L 
Sbjct  1    MAGLSLQHPWAFAFGLLGNLISFTTYLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVII  621
            ++YA+IK+N  L++ IN  GC IE ++I MYL YA KK K+FT K LLLL++  FG +++
Sbjct  61   IFYALIKSNEALLITINAAGCVIETIYIVMYLAYAPKKAKVFTTKILLLLNVGVFGVILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++L L +G +R+  +GW C   +V+VF APLSI+++VI++R+ ++MP +LS+ L   A  
Sbjct  121  LTLLLSHGEQRVVSLGWVCVAFSVSVFVAPLSIIKRVIQSRSVEYMPFSLSLTLTLSAVV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSK------KEEDGKGAEYKE  291
            WF YGL  KD Y+A PNILGF FG+ Q+ LY  Y ++       KE  GK A  +E
Sbjct  181  WFLYGLLIKDKYVALPNILGFTFGVVQMGLYVFYMNATPVAGEGKEGKGKLAAAEE  236



>sp|Q2QR07.1|SWT13_ORYSJ RecName: Full=Bidirectional sugar transporter SWEET13; Short=OsSWEET13 
[Oryza sativa Japonica Group]
 gb|ABA98216.1| N3 like protein, putative, expressed [Oryza sativa Japonica Group]
 gb|EAZ20456.1| hypothetical protein OsJ_36063 [Oryza sativa Japonica Group]
 dbj|BAH01364.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGS56390.1| major disease resistance protein xa25 [Oryza sativa Indica Group]
Length=296

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/236 (52%), Positives = 169/236 (72%), Gaps = 8/236 (3%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA LS+QH  A  FGLLGN++SF  +LAPIPTFY+IYK KS++G+QS+PYVVALFSA L 
Sbjct  1    MAGLSLQHPWAFAFGLLGNLISFTTYLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVII  621
            ++YA+IK+N  L++ IN  GC IE ++I MYL YA KK K+FT K LLLL++  FG +++
Sbjct  61   IFYALIKSNEALLITINAAGCVIETIYIVMYLAYAPKKAKVFTTKILLLLNVGVFGVILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++L L +G +R+  +GW C   +V+VF APLSI+++VI++R+ ++MP +LS+ L   A  
Sbjct  121  LTLLLSHGEQRVVSLGWVCVAFSVSVFVAPLSIIKRVIQSRSVEYMPFSLSLTLTLSAVV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSK------KEEDGKGAEYKE  291
            WF YGL  KD Y+A PNILGF FG+ Q+ LY  Y ++       KE  GK A  +E
Sbjct  181  WFLYGLLIKDKYVALPNILGFTFGVVQMGLYVFYMNATPVAGEGKEGKGKLAAAEE  236



>ref|XP_008677256.1| PREDICTED: LOC100282648 isoform X1 [Zea mays]
 gb|AFW62434.1| MTN3 isoform 1 [Zea mays]
 gb|AFW62435.1| MTN3 isoform 2 [Zea mays]
Length=304

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/246 (48%), Positives = 166/246 (67%), Gaps = 13/246 (5%)
 Frame = -2

Query  974  MALLSV--QHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAEL  801
            MA L++  Q  A  FG+LGNIVS  VFL+P+PTFY++Y+ KS++G+QS PYVV LFS  L
Sbjct  1    MAFLNMEQQTWAFTFGILGNIVSLMVFLSPLPTFYRVYRNKSTEGFQSTPYVVTLFSCML  60

Query  800  LLYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVI  624
             + YA++K  A L+V ING GC +E V+++MYL YA K  ++   K+LL L++  FG V 
Sbjct  61   WILYALLKPGAELLVTINGVGCVVETVYLAMYLVYAPKAARVLAAKMLLGLNVAVFGLVA  120

Query  623  IVSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCAT  444
            +V++ L +   R+ ++GW C  ++++VFAAPLSIMRQVIRT++ +FMP++LS  LV  A 
Sbjct  121  LVTMLLSDAGLRVHVLGWICVSVSLSVFAAPLSIMRQVIRTKSVEFMPISLSFFLVLSAV  180

Query  443  AWFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYK----------DSKKEEDGKGAEYK  294
             WF YG   KD ++AFPN+LGF+FGLAQ+ LY  Y+          +  KEE  +G    
Sbjct  181  VWFAYGALKKDVFVAFPNVLGFVFGLAQMALYMAYRKPAAALVIIPEQSKEEVAEGKASC  240

Query  293  EGIEIQ  276
             G E+ 
Sbjct  241  GGAEVH  246



>ref|XP_010696414.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Beta 
vulgaris subsp. vulgaris]
Length=335

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/229 (53%), Positives = 162/229 (71%), Gaps = 12/229 (5%)
 Frame = -2

Query  965  LSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYA  786
            L +  L ++FG+LGNIVSF V+LAP+PTF++I+K+KS+ G+QSIPY VALFSA LLLYYA
Sbjct  6    LHLHELTVIFGILGNIVSFGVYLAPLPTFWRIFKKKSTQGFQSIPYSVALFSAMLLLYYA  65

Query  785  VIKT-NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLL-LLDILFFGAVIIVSL  612
             IK  N  +I+ IN  GCAIE  ++ +YL YA KK K++T KLL L ++ FFG +++ ++
Sbjct  66   FIKEKNGTMIITINTIGCAIEGSYLIVYLIYAPKKAKVYTAKLLGLFNVGFFGLIVLTTM  125

Query  611  FLV----------NGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVC  462
              V           G  R  +VGW C + +V VFAAPLS +R VIRT++ +FMP  LS+ 
Sbjct  126  LFVRGIDQHKMLSKGGMRENVVGWICGIFSVCVFAAPLSAIRMVIRTKSVEFMPFWLSLS  185

Query  461  LVFCATAWFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEED  315
            L  CA  WFFYG   KD+YIA PNILGF FG+AQ++LY +YKDS K++ 
Sbjct  186  LTLCAVMWFFYGFLIKDFYIALPNILGFGFGIAQMILYIIYKDSTKKKQ  234



>ref|XP_004962649.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Setaria 
italica]
Length=300

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/227 (52%), Positives = 163/227 (72%), Gaps = 3/227 (1%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA  S+QH  A  FGLLGN++SF  FLAPIPTFY+IYK KS++G+QS+PYVVALFSA L 
Sbjct  1    MAGFSLQHPWAFTFGLLGNVISFMTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVII  621
            ++YA+IK+N  L++ IN  G  IE +++ +Y  YA+KK + FT K++L L++ FFGA+++
Sbjct  61   IFYALIKSNEVLLITINVAGFVIESIYVILYFVYADKKARWFTAKIMLGLNVGFFGAILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
             +L + +G KRI  +GW C   +V VF APLSI+++VI+TR+ ++MP +LS+ L   A  
Sbjct  121  FTLLVFHGDKRIVTLGWICVAFSVGVFVAPLSIIKRVIQTRSVEYMPFSLSLTLTLSAVV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK-EEDGKGA  303
            WF YGL  KD Y+A PNILGF FG+ Q+VLY  Y +      DGK A
Sbjct  181  WFLYGLLIKDKYVALPNILGFTFGVVQMVLYVFYMNKTPVVADGKEA  227



>ref|XP_004235334.1| PREDICTED: bidirectional sugar transporter SWEET12 [Solanum lycopersicum]
Length=298

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 160/214 (75%), Gaps = 3/214 (1%)
 Frame = -2

Query  956  QHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIK  777
             H A  FG+LGNIVSF VFL+PIPTFY IYK+KS++GYQSIPYVVALFS+ L +YYA++K
Sbjct  4    NHWAFAFGVLGNIVSFIVFLSPIPTFYNIYKKKSTEGYQSIPYVVALFSSMLWIYYALLK  63

Query  776  TNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDIL-FFGAVIIVSLFLVN  600
            +N  L++ IN FG  IE +++ +YL YA  K ++ TIK+L+L ++  FGA+++++ FL  
Sbjct  64   SNMPLLITINSFGMFIETIYVGLYLLYAPNKARVHTIKMLMLSVVGGFGAIVLITEFLFK  123

Query  599  GSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLF  420
            G  R  +VGW C + ++ VF APL I+R+VI+T++ ++MPL LSV L   A  WFFYGL 
Sbjct  124  GVVRGQIVGWICLIFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLL  183

Query  419  SKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEE  318
             KD  IA PN+LGF+FG+ QIVLY +Y  SKKE+
Sbjct  184  LKDINIAAPNVLGFIFGILQIVLYAIY--SKKEK  215



>ref|XP_007159993.1| hypothetical protein PHAVU_002G283900g [Phaseolus vulgaris]
 gb|ESW31987.1| hypothetical protein PHAVU_002G283900g [Phaseolus vulgaris]
Length=258

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 173/234 (74%), Gaps = 5/234 (2%)
 Frame = -2

Query  956  QHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIK  777
            +  A +FGLLGNI+SF VFLAP+PTFY+IYK+KS++G+QS+PYVVALFSA L +YYA +K
Sbjct  6    ESWAFVFGLLGNIISFGVFLAPLPTFYQIYKKKSTEGFQSLPYVVALFSAMLWIYYAFVK  65

Query  776  TNA-YLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIVSLFLV  603
              A  L++ IN FG  +E ++++++L YA +K ++ TIKLLLL ++  FGA+++ +L+L 
Sbjct  66   REAALLLITINTFGIVVESIYLTIFLIYAPRKPRLTTIKLLLLLNVFGFGAMLLSTLYLT  125

Query  602  NGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGL  423
             G+KR+A++GW C V N++VFAAPL I+ +VI+TR+ ++MP TLS+ L   A  WFFYGL
Sbjct  126  KGAKRLAIIGWICLVFNISVFAAPLFIISRVIKTRSVEYMPFTLSMFLTINAVMWFFYGL  185

Query  422  FSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK---EEDGKGAEYKEGIEIQVK  270
              +DYY+A PN LGF+FG+ Q+ +Y MY+++     EE  KG E    I   VK
Sbjct  186  LLRDYYVALPNTLGFVFGIIQMGMYLMYRNATPVALEEPVKGQESNGHIVGAVK  239



>gb|AFK48645.1| unknown [Lotus japonicus]
Length=247

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/240 (49%), Positives = 174/240 (73%), Gaps = 5/240 (2%)
 Frame = -2

Query  965  LSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYA  786
            ++ +  A +FGL+GN++SF VFLAP+PTFY+IYK+K+++G+Q++PYVVALFSA L +YYA
Sbjct  3    MTRESWAFVFGLMGNVISFMVFLAPLPTFYQIYKKKTAEGFQALPYVVALFSAMLWIYYA  62

Query  785  VIK-TNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDILF-FGAVIIVSL  612
             +K  +A L++ IN FG  +E ++I+ +LFYA KK ++ TIKLLLL  +F FGA+++ +L
Sbjct  63   FVKRESALLLITINTFGIVVESIYIAFFLFYAPKKSRLSTIKLLLLLNVFGFGAMLLATL  122

Query  611  FLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFF  432
            +L  G+KR+ ++GW C V N++VFAAPL I+ +VIRTR+ ++MP  LS  L   A  WFF
Sbjct  123  YLSKGAKRLQIIGWICLVFNISVFAAPLFIISKVIRTRSVEYMPFFLSFSLTINAVMWFF  182

Query  431  YGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK---EEDGKGAEYKEGIEIQVKNDG  261
            YG+  +DYY+A PN LGF+FG+ Q+V+Y +Y+++     EE  KG E      I V   G
Sbjct  183  YGMLLRDYYVALPNTLGFVFGIIQMVVYLIYRNATPVVIEEKVKGQEMSGDHIIDVAKGG  242



>ref|XP_011023930.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Populus 
euphratica]
Length=276

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 160/205 (78%), Gaps = 1/205 (0%)
 Frame = -2

Query  938  FGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKTNAYLI  759
            FGLLGN VSF VFLAPIPTF +I ++KS++G+QS+PYVVALFSA + LYYA +K++A L+
Sbjct  14   FGLLGNFVSFVVFLAPIPTFSRICRKKSTEGFQSLPYVVALFSAMIWLYYASLKSDALLL  73

Query  758  VCINGFGCAIELVFISMYLFYANKKDKIFTIKLL-LLDILFFGAVIIVSLFLVNGSKRIA  582
            + IN  GC IE+++I++Y+ YA K+ +I T+++L LL+   F AV+++S F V GS R+ 
Sbjct  74   ITINSVGCFIEIIYIALYVAYAPKQARIATLRILILLNFGGFCAVLLLSHFFVKGSNRVK  133

Query  581  LVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFSKDYYI  402
            ++GW C + +V+VFAAPLSIMR VIRTR+ +FMP TLS  L   A  W FYG+  KD+YI
Sbjct  134  VLGWVCVIFSVSVFAAPLSIMRIVIRTRSVEFMPFTLSFFLTLSAIMWLFYGVLLKDFYI  193

Query  401  AFPNILGFLFGLAQIVLYCMYKDSK  327
            A PNILGF+FG+ Q+VLY +YK+SK
Sbjct  194  AIPNILGFIFGVLQMVLYVIYKNSK  218



>ref|XP_010509074.1| PREDICTED: bidirectional sugar transporter SWEET9 [Camelina sativa]
Length=256

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/255 (49%), Positives = 174/255 (68%), Gaps = 10/255 (4%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M  + V  LA  FGL+GNIVSF VFL+P+PTFY IYK KSS G+QSIPY+ AL SA LLL
Sbjct  1    MVFIKVHQLAFFFGLMGNIVSFGVFLSPVPTFYGIYKNKSSKGFQSIPYICALASATLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIV  618
            YY ++KT+AYLI+ IN FGC IE+ ++ +Y+ YA ++ KIFT+KL+++ +I   G +I++
Sbjct  61   YYGIMKTHAYLIISINTFGCFIEISYLFLYIIYAPREAKIFTLKLIVICNIGGLGLLILL  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
               LV    R++ VGW CA  ++AVFA+PLS+MR+VI+T++ ++MP  LS+ L   A  W
Sbjct  121  VNLLVPKQHRVSTVGWVCAAYSLAVFASPLSVMRKVIKTKSVEYMPFLLSLSLTLNAVMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQVKNDGR  258
            FFYGL  KD +IA PNILGFLFG+AQ++LY MY+ S K +     +     E+ +     
Sbjct  181  FFYGLLIKDKFIAMPNILGFLFGVAQMILYMMYQGSTKTDLPTENQLANKTEVPI-----  235

Query  257  R*I*QRIEVTGRRSD  213
                  +E+   RSD
Sbjct  236  ----VAVELPDVRSD  246



>ref|XP_010517242.1| PREDICTED: bidirectional sugar transporter SWEET9 [Camelina sativa]
Length=256

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 165/220 (75%), Gaps = 1/220 (0%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M  + V  LA  FGL+GNIVSF VFL+P+PTFY IYK+KSS G+QSIPY+ AL SA LLL
Sbjct  1    MVFIKVHQLAFFFGLMGNIVSFGVFLSPVPTFYGIYKKKSSKGFQSIPYICALASATLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIV  618
            YY ++KT+AYLI+ IN FGC IE+ ++ +Y+ YA ++ KIFT+KL+++ +I   G +I++
Sbjct  61   YYGIMKTHAYLIISINTFGCFIEISYLFLYIIYAPREAKIFTLKLIVICNIGGLGLLILL  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
               LV    R++ VGW CA  ++AVFA+PLS+MR+VI+T++ ++MP  LS+ L   A  W
Sbjct  121  VNLLVPKQHRVSTVGWVCAAYSLAVFASPLSVMRKVIKTKSVEYMPFLLSLSLTLNAVMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEE  318
            FFYGL  KD +IA PN+LGFLFG+AQ++LY MY+ S K +
Sbjct  181  FFYGLLIKDKFIAMPNVLGFLFGVAQMILYMMYQGSTKTD  220



>ref|XP_009393865.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=281

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 161/219 (74%), Gaps = 2/219 (1%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA LS+ H  A  FG+LGNI+SF V+LAP+PTFY++ +RKS++G+ S+PYVVALFSA L 
Sbjct  1    MAGLSLDHPWAFTFGILGNIISFMVYLAPLPTFYRVCRRKSTEGFHSVPYVVALFSATLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKL-LLLDILFFGAVII  621
            ++YA +KTNA L++ IN  GC IE  ++ +Y  YA K  K+FT KL LL+++  FG +++
Sbjct  61   IFYAFLKTNAGLLITINAVGCVIETAYVVVYFTYAPKAAKMFTAKLVLLVNVGMFGLILV  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++L    G+KR+ ++GW C   +V+VF APLSI+R VIRT++ +FMP +LS  L + A  
Sbjct  121  LTLLFARGAKRVEVLGWICMSFSVSVFVAPLSIIRLVIRTKSVEFMPFSLSFFLTWSAVV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK  324
            WF YGL +KD Y+A PN+LGF+FG+ Q+VLY  Y++  K
Sbjct  181  WFGYGLLTKDLYVALPNVLGFIFGVLQMVLYVAYRNKDK  219



>ref|XP_006663471.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Oryza 
brachyantha]
Length=310

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 164/222 (74%), Gaps = 2/222 (1%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA +S+QH  A  FGLLGNI+SF  +LAP+PTFY+IYK KS+ G+QSIPYVVALFSA L 
Sbjct  1    MAGMSLQHPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQGFQSIPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVII  621
            +YYA++K++  L++ IN  GC IE ++I++YL YA KK ++FT +LLLL ++  FG +++
Sbjct  61   IYYALLKSDECLLITINSAGCVIETLYIAVYLVYAPKKARVFTARLLLLVNVGVFGLILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++L L  G +R+ ++GW C   +V+VF APLSIMR V+RT++ +FMP +LS+ L   A  
Sbjct  121  LTLLLSAGPRRVVVLGWVCVGFSVSVFVAPLSIMRLVVRTKSVEFMPFSLSLSLTVSAVV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEED  315
            WF YGL  KD Y+A PN+LGF FG+ Q+ LY MY++S  +  
Sbjct  181  WFLYGLLIKDKYVALPNVLGFTFGVIQMGLYAMYRNSTPKRS  222



>ref|XP_006347632.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=294

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/224 (51%), Positives = 157/224 (70%), Gaps = 1/224 (0%)
 Frame = -2

Query  953  HLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKT  774
            HLA +FGLLGNIVSF V+LAP+PTFYKIYK+KS++G+QS+PYVV LFSA L +YYA +K 
Sbjct  4    HLAFVFGLLGNIVSFMVYLAPVPTFYKIYKKKSTEGFQSVPYVVGLFSAMLWIYYAFLKP  63

Query  773  NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVIIVSLFLVNG  597
            +  L++ IN  GC I+  +I  +LFYA KK K+ T+KLLL ++++  G +I+++ F   G
Sbjct  64   DTTLLITINSVGCFIQTFYICFFLFYATKKAKMDTVKLLLSMNVVGLGLIILLTQFFSKG  123

Query  596  SKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFS  417
            S R  +VGW C + +  VF APL ++RQVIR+++ ++MP  LS  L   A  WFFYGL  
Sbjct  124  SNRAQIVGWICLIFSFCVFVAPLGVLRQVIRSKSVEYMPFQLSFFLTLSAVMWFFYGLLR  183

Query  416  KDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGI  285
            KDY IA PN+LGF  G+ Q+ LY +YK++KK       E  E +
Sbjct  184  KDYNIAIPNVLGFSLGVIQMTLYLIYKNAKKVTKEVRLENTETV  227



>gb|EYU43032.1| hypothetical protein MIMGU_mgv1a010677mg [Erythranthe guttata]
Length=305

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/217 (53%), Positives = 157/217 (72%), Gaps = 1/217 (0%)
 Frame = -2

Query  980  VKMALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAEL  801
            ++  L  +  LA +FGLLGN++SF VFLAPIPTFY I+K+KS++G+QS+PYVV LFSA+L
Sbjct  23   LRNQLREMNQLAFVFGLLGNVISFMVFLAPIPTFYTIFKKKSTEGFQSVPYVVGLFSAQL  82

Query  800  LLYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKL-LLLDILFFGAVI  624
             +YYA +K    L++ IN  GC ++  +I  YLF+A K  +I T+KL LLL+++ FG +I
Sbjct  83   WIYYAFLKPETTLLITINTVGCFVQSAYICFYLFFATKNARIQTVKLILLLNVVGFGLII  142

Query  623  IVSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCAT  444
            +++ F  N S R  +VGW C V ++ VF APL ++RQVIRT++ ++MP  LS  L   A 
Sbjct  143  VLTHFWANDSNRDDIVGWICLVFSLCVFVAPLGVVRQVIRTKSVEYMPFLLSFFLTLSAV  202

Query  443  AWFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKD  333
             WFFYGL  KDY IA PN+LGFLFG+ Q+VLY MYK+
Sbjct  203  MWFFYGLLRKDYNIAIPNVLGFLFGVIQMVLYVMYKN  239



>ref|NP_001241307.1| uncharacterized protein LOC100810946 [Glycine max]
 gb|ACU19376.1| unknown [Glycine max]
 gb|KHN17481.1| Bidirectional sugar transporter SWEET13 [Glycine soja]
Length=257

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/262 (46%), Positives = 183/262 (70%), Gaps = 21/262 (8%)
 Frame = -2

Query  956  QHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIK  777
            +  A +FG++GNI+SF VFLAP+PTFY+IYK+KS++G+QS+PYVVALFSA L +YYA +K
Sbjct  6    ESWAFVFGVMGNIISFGVFLAPLPTFYQIYKKKSTEGFQSLPYVVALFSAMLWIYYAFVK  65

Query  776  TNA-YLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIVSLFLV  603
              A  L++ IN FG  +E ++++++L YA +K ++ TIKLLLL ++  FGA+++ +L+L 
Sbjct  66   REAALLLITINTFGIVVESIYLAIFLLYAPRKPRLTTIKLLLLLNVFGFGAMLLSTLYLS  125

Query  602  NGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGL  423
             G+KR+A++GW C V N++VFAAPL I+R+VI+TR+ ++MP TLS+ L   A  WFFYGL
Sbjct  126  KGAKRLAIIGWICLVFNISVFAAPLFIIRRVIKTRSVEYMPFTLSMFLTINAVMWFFYGL  185

Query  422  FSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQVKNDGRR*I*Q  243
              +DYY+A PN LGF+FG+ Q+ +Y MY+++           +E ++ Q           
Sbjct  186  LLRDYYVALPNTLGFVFGIIQMGMYLMYRNATP------VALEEPVKAQ-----------  228

Query  242  RIEVTGRRSDVLRTVLIKPHHA  177
              E+ G   DV +   ++P+HA
Sbjct  229  --ELNGHIIDVGKMGTMEPNHA  248



>ref|XP_006664549.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Oryza 
brachyantha]
Length=256

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 167/233 (72%), Gaps = 3/233 (1%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA LS+QH  A  FGLLGN++SF  +LAPIPTFY+IYK KS++G+QS+PYVVALFSA L 
Sbjct  1    MAGLSLQHPWAFAFGLLGNLISFTTYLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVII  621
            ++YA+IK+N  L++ IN  GC IE ++I +YL YA+KK K+FT K+LL L++  FG +++
Sbjct  61   IFYALIKSNEALLITINAAGCVIETIYIVIYLAYASKKAKVFTTKILLGLNVGVFGVILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++L L  G  R+  +GW C   +V+VF APLSI+R+V++TR+ ++MP +LS+ L   A  
Sbjct  121  LTLLLSKGENRVVSLGWVCVAFSVSVFVAPLSIIRRVVQTRSVEYMPFSLSLTLTLSAIV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIE  282
            WF YGL  KD Y+A PN+LGF FG+ Q+ LY  Y ++     G+G E K   E
Sbjct  181  WFLYGLLIKDKYVALPNVLGFTFGVVQMGLYVFYMNATPVA-GEGKEGKLAAE  232



>ref|XP_010505570.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Camelina 
sativa]
Length=255

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/235 (51%), Positives = 169/235 (72%), Gaps = 1/235 (0%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            M  + V  LA  FGL+GNIVSF VFL+P+PTFY IYK++SS G+QSIPY+ AL SA LLL
Sbjct  1    MVFIKVHQLAFFFGLMGNIVSFGVFLSPVPTFYGIYKKESSKGFQSIPYICALASATLLL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIV  618
            YY ++KT+AYLI+ IN FGC IE+ ++ +Y+ YA ++ KIFT+KL+++ +I   G +I++
Sbjct  61   YYGIMKTHAYLIISINTFGCFIEISYLFLYIIYAPREAKIFTLKLIVICNIGGLGLLILL  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
               LV    R++ VGW CA  ++AVFA+PLS+MR+VI+T++ ++MP  LS+ L   A  W
Sbjct  121  VNLLVPKQHRVSTVGWVCAAYSLAVFASPLSVMRKVIKTKSVEYMPFLLSLSLTLNAVMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQV  273
            FFYGL  KD +IA PNILGFLFG+AQ++LY MY+ S K +     +     E+ +
Sbjct  181  FFYGLLIKDKFIAMPNILGFLFGVAQMILYMMYQGSTKTDLPTENQLANKTEVPI  235



>ref|XP_004235333.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
lycopersicum]
Length=296

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 124/239 (52%), Positives = 172/239 (72%), Gaps = 8/239 (3%)
 Frame = -2

Query  962  SVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAV  783
            S  H A +FG+LGNIVSF VFL+P+PTFY IYK+K+++GYQSIPYVVALFS+ L +YYA 
Sbjct  4    SADHWAFVFGVLGNIVSFIVFLSPLPTFYTIYKKKTAEGYQSIPYVVALFSSMLWIYYAF  63

Query  782  IKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDIL-FFGAVIIVSLFL  606
            +KTN  L++ IN FG  +E +++  YL YA KK ++ TIK+L L ++  FGA+I+V+ FL
Sbjct  64   LKTNTTLLITINTFGVFVETIYVVFYLIYAPKKSRVQTIKMLSLFVVGGFGAIILVTQFL  123

Query  605  VNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYG  426
              G  R  +VGW C + ++ VF APL I+R+VI+T++ ++MPL LSV L   A  WFFYG
Sbjct  124  FKGVIRGQVVGWICLIFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYG  183

Query  425  LFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKE----EDGKGAEYKEGIEIQVKNDG  261
            L  KD  IA PNILGF+FG+ Q++LY +Y  SKKE    ++ K  E ++G E+ VK++ 
Sbjct  184  LLLKDINIAAPNILGFIFGVLQMILYVIY--SKKEKAILKEQKLPEIQKG-EVIVKDEN  239



>ref|NP_001141106.1| uncharacterized protein LOC100273190 [Zea mays]
 gb|ACF85414.1| unknown [Zea mays]
Length=295

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 166/228 (73%), Gaps = 4/228 (2%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA LS+QH  A  FGLLGN++SF  FLAPIPTFY+IYK KS++G+QS+PYVVALFSA L 
Sbjct  1    MAGLSLQHPWAFTFGLLGNVISFMTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVII  621
            ++YA+IK+N   ++ IN  GC IE V++ MY  YA KK ++FT K +LLL++  FGA+++
Sbjct  61   IFYALIKSNETFLITINAAGCVIETVYVVMYFVYATKKGRMFTAKIMLLLNVGAFGAILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++L L  G KR+ ++GW C   +V+VF APLSIMR+VI+T++ ++MP +LS+ L   A  
Sbjct  121  LTLLLFKGDKRVVMLGWICVGFSVSVFVAPLSIMRRVIQTKSVEYMPFSLSLSLTLSAVV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMY--KDSKKEEDGKGA  303
            WF YGL  KD Y+A PNILGF FG+ Q+VLY +Y  K      DGK A
Sbjct  181  WFLYGLLIKDKYVALPNILGFTFGVVQMVLYVVYMNKTPLPVADGKAA  228



>ref|XP_002881628.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57887.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=258

 Score =   235 bits (600),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 121/217 (56%), Positives = 164/217 (76%), Gaps = 1/217 (0%)
 Frame = -2

Query  965  LSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYA  786
            L V  LA LFGLLGNIVSF VFL+P+PTFY IYK+KSS G+QSIPY+ AL SA LLLYY 
Sbjct  3    LKVHELAFLFGLLGNIVSFGVFLSPVPTFYGIYKKKSSKGFQSIPYICALASATLLLYYG  62

Query  785  VIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIVSLF  609
            ++KT+AYLI+ IN FGC IE+ ++ +Y+ YA ++ KI T+KL+++ +I   G +I++   
Sbjct  63   IMKTHAYLIISINTFGCFIEISYLFLYIIYAPREAKISTLKLIVICNIGGLGLLILLVNL  122

Query  608  LVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFY  429
            LV    R++ VGW CA  ++AVFA+PLS+MR+VI+T++ ++MP  LS+ L   A  WFFY
Sbjct  123  LVPKQHRVSTVGWVCAAYSLAVFASPLSVMRKVIKTKSVEYMPFLLSLSLTLNAVMWFFY  182

Query  428  GLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEE  318
            GL  KD +IA PNILGFLFG+AQ++LY MY+ S K +
Sbjct  183  GLLIKDKFIAMPNILGFLFGVAQMILYMMYQGSTKTD  219



>gb|EYU43030.1| hypothetical protein MIMGU_mgv1a011435mg [Erythranthe guttata]
Length=282

 Score =   236 bits (602),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 114/213 (54%), Positives = 154/213 (72%), Gaps = 1/213 (0%)
 Frame = -2

Query  959  VQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVI  780
            +  LA +FGLLGN+VSF VFLAPIPTFY I+K+KS+ G+QS+PYVV LFSA L +YYA +
Sbjct  1    MNQLAFVFGLLGNVVSFMVFLAPIPTFYTIFKKKSTQGFQSVPYVVGLFSAMLWIYYAFL  60

Query  779  KTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKL-LLLDILFFGAVIIVSLFLV  603
            K    L++ IN  GC ++  +I  YLF+A+K  +I T+KL LLL+++ FG +I+++ F  
Sbjct  61   KPETTLLITINTVGCFVQSTYICFYLFFASKNARIQTVKLILLLNVVGFGLIIVLTHFWA  120

Query  602  NGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGL  423
            N S R  +VGW C V ++ VF APL ++RQVIRT++ ++MP  LS  L   A  WFFYGL
Sbjct  121  NDSNRDDIVGWICLVFSLCVFVAPLGVVRQVIRTKSVEYMPFLLSFFLTLSAVMWFFYGL  180

Query  422  FSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK  324
              KDY IA PN+LGFLFG+ Q+VLY MYK++  
Sbjct  181  LRKDYNIAIPNVLGFLFGVVQMVLYVMYKNTNS  213



>ref|XP_010112742.1| Bidirectional sugar transporter NEC1 [Morus notabilis]
 gb|EXC34700.1| Bidirectional sugar transporter NEC1 [Morus notabilis]
Length=254

 Score =   235 bits (600),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 161/207 (78%), Gaps = 3/207 (1%)
 Frame = -2

Query  932  LLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIK--TNAYLI  759
            +LGNIVSF V+LAP+PTFY+I+++KS++G+Q+IPY VALFSA L LYY ++K   N  +I
Sbjct  2    VLGNIVSFLVYLAPLPTFYRIFRKKSTEGFQAIPYSVALFSAMLTLYYGILKGLPNGVMI  61

Query  758  VCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIVSLFLVNGSKRIA  582
            + IN  GCAIE +++ ++L YA  K +I+TIKLL+L ++  +G +++ + F+   S+R+ 
Sbjct  62   ITINSIGCAIESIYLIVFLIYAPGKVRIYTIKLLVLFNMGAYGLILLSTSFVGKISQRVT  121

Query  581  LVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFSKDYYI  402
            +VGW CAV +V VFAAPLSI+R VI+TR+ ++MP  LS CL  CA  WFFYGL   D++I
Sbjct  122  VVGWICAVFSVCVFAAPLSIIRLVIKTRSVEYMPFALSFCLTLCAVMWFFYGLLVNDFFI  181

Query  401  AFPNILGFLFGLAQIVLYCMYKDSKKE  321
            A PNILGFLFG+AQ++LY ++K+SKKE
Sbjct  182  ASPNILGFLFGIAQMILYLVFKNSKKE  208



>ref|XP_011073105.1| PREDICTED: bidirectional sugar transporter NEC1-like [Sesamum 
indicum]
Length=290

 Score =   236 bits (603),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 122/230 (53%), Positives = 164/230 (71%), Gaps = 1/230 (0%)
 Frame = -2

Query  953  HLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKT  774
            +LA +FGLLGNI+SF VFLAPIPTFY+IYKRKS++G+QS+PYVV LFSA LL+YYA +  
Sbjct  4    NLAFVFGLLGNIISFMVFLAPIPTFYQIYKRKSTEGFQSLPYVVGLFSAMLLIYYAFLLP  63

Query  773  NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFT-IKLLLLDILFFGAVIIVSLFLVNG  597
            ++ L++ IN FGC IE ++I  YLFYA K  ++ T   LLLL+++  G +++++ FL   
Sbjct  64   DSTLLITINSFGCFIETLYICFYLFYAPKTARLQTATLLLLLNVVGMGLIVVLTHFLAKD  123

Query  596  SKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFS  417
            S R  +VGW C V +V+VF APL ++RQVIRT++ ++MP  LS  L   A  WFFYGL  
Sbjct  124  STRAHIVGWICLVFSVSVFVAPLCVVRQVIRTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  183

Query  416  KDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQVKN  267
            KDY IA PNILGF+FG+ Q+ LY +YK++KK    K  E  E  E +  N
Sbjct  184  KDYNIAIPNILGFIFGVLQMALYLVYKNAKKAIQEKLPEIIEMEEEKQNN  233



>ref|XP_009337539.1| PREDICTED: bidirectional sugar transporter N3 [Pyrus x bretschneideri]
Length=298

 Score =   236 bits (603),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 114/234 (49%), Positives = 163/234 (70%), Gaps = 1/234 (0%)
 Frame = -2

Query  971  ALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLY  792
            A  S   LA  FG+LGNIVSF VFLAP+PTF+++YKRKS++G+QS+PYV ALFSA + +Y
Sbjct  3    ASTSHHPLAFAFGILGNIVSFIVFLAPLPTFWRVYKRKSTEGFQSVPYVFALFSAMIWIY  62

Query  791  YAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIVS  615
            YA +K++  L++ IN FGC IE ++I++YL YA K+ ++ T++LLLL +   F  ++++S
Sbjct  63   YAFLKSHVILLITINSFGCVIETIYIAIYLTYATKQARVSTLRLLLLVNFGGFCLILLLS  122

Query  614  LFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWF  435
             FL  G  R+ ++GW C   +V VFAAPLS+MR VIRT++ +FMP  LS  L   A  W 
Sbjct  123  RFLSQGPTRVEVLGWVCVTFSVGVFAAPLSVMRMVIRTKSVEFMPFNLSFFLTLSAVMWL  182

Query  434  FYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQV  273
             YGL  KD Y+A PNI+GF FG+ Q+ LY  Y+++K   + K  E+K  +  Q+
Sbjct  183  CYGLLLKDLYVATPNIIGFSFGVVQMALYTKYRNTKTIGEEKLPEHKADVVKQI  236



>ref|NP_001046944.1| Os02g0513100 [Oryza sativa Japonica Group]
 sp|Q6K602.1|SWT15_ORYSJ RecName: Full=Bidirectional sugar transporter SWEET15; Short=OsSWEET15 
[Oryza sativa Japonica Group]
 dbj|BAD23245.1| putative nodulin 3 [Oryza sativa Japonica Group]
 dbj|BAF08858.1| Os02g0513100 [Oryza sativa Japonica Group]
 dbj|BAG95984.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57067.1| hypothetical protein OsJ_06889 [Oryza sativa Japonica Group]
Length=319

 Score =   237 bits (605),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 159/219 (73%), Gaps = 3/219 (1%)
 Frame = -2

Query  974  MALLSVQH--LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAEL  801
            MA +S++    A  FG+LGN++S  VFL+P+PTFY++Y++KS++G+QS PYVV LFS  L
Sbjct  1    MAFMSMERSTWAFTFGILGNLISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCML  60

Query  800  LLYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVI  624
             +YYA +K+ A L+V ING GC IE V+++MYL YA K  ++ T K+LL L+I  FG + 
Sbjct  61   WMYYAFVKSGAELLVTINGVGCVIETVYLAMYLAYAPKSARMLTAKMLLGLNIGLFGVIA  120

Query  623  IVSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCAT  444
            +V+L L  G  R+ ++GW C  ++++VFAAPLSI+R VIRT++ +FMP +LS  LV  A 
Sbjct  121  LVTLLLSRGELRVHVLGWICVAVSLSVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAV  180

Query  443  AWFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSK  327
             WF YGL  KD ++A PN+LGF+FG+AQ+ LY  Y+  K
Sbjct  181  IWFLYGLLKKDVFVALPNVLGFVFGVAQMALYMAYRSKK  219



>ref|NP_001149028.1| LOC100282648 [Zea mays]
 gb|ACG33879.1| MTN3 [Zea mays]
Length=307

 Score =   237 bits (604),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 114/241 (47%), Positives = 160/241 (66%), Gaps = 14/241 (6%)
 Frame = -2

Query  956  QHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIK  777
            Q  A  FG+LGNIVS  VFL+P+PTFY++Y+ KS++G+QS PYVV LFS  L + YA++K
Sbjct  9    QTWAFTFGILGNIVSLMVFLSPLPTFYRVYRNKSTEGFQSTPYVVTLFSCMLWILYALLK  68

Query  776  TNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVIIVSLFLVN  600
              A L+V ING GC +E V+++MYL YA K  ++   K+LL L++  FG V +V++ L +
Sbjct  69   PGAELLVTINGVGCVVETVYLAMYLVYAPKAARVLAAKMLLGLNVAVFGLVALVTMLLSD  128

Query  599  GSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLF  420
               R+ ++GW C  ++++VFAAPLSIMRQVIRT++ +FMP++LS  LV  A  WF YG  
Sbjct  129  AGLRVHVLGWICVSVSLSVFAAPLSIMRQVIRTKSVEFMPISLSFFLVLSAVVWFAYGAL  188

Query  419  SKDYYIAFPNILGFLFGLAQIVLYCMYK-------------DSKKEEDGKGAEYKEGIEI  279
             KD ++AFPN+LGF+FGLAQ+ LY  Y              +  KEE  +G     G E+
Sbjct  189  KKDVFVAFPNVLGFVFGLAQMALYMAYSRNRKPAAALVILPEQSKEEAAEGKASCGGAEV  248

Query  278  Q  276
             
Sbjct  249  H  249



>ref|XP_006480106.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Citrus 
sinensis]
Length=275

 Score =   236 bits (601),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 119/222 (54%), Positives = 162/222 (73%), Gaps = 4/222 (2%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MA+L   H  ++FGLLGNIVSF V+LAP+PTFY+I+K+KS+ G+QSIPY VALFSA LLL
Sbjct  1    MAILG-PHSVIIFGLLGNIVSFLVYLAPLPTFYRIFKKKSTQGFQSIPYSVALFSAMLLL  59

Query  794  YYAVIK-TNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVII  621
            YYA +K +NA++++ ING G  IE +++  ++ YA K  KI+T KLL+L +I   G +++
Sbjct  60   YYASLKGSNAFMLITINGIGYIIESLYLLFFMIYATKTAKIYTTKLLILFNIGALGLIVL  119

Query  620  VSLFLVNGS-KRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCAT  444
            ++  L   S +R+ +VGW CAV +V VFAAPLSI+RQVIRT++ ++MP +LS CL  CA 
Sbjct  120  LTYLLSKSSDQRLTIVGWICAVFSVCVFAAPLSIIRQVIRTKSVEYMPFSLSCCLTICAG  179

Query  443  AWFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEE  318
             W  YGL  KDYYIA PNILG  FG  Q++LY  Y+  +  E
Sbjct  180  MWLLYGLSIKDYYIATPNILGMAFGATQMILYLAYRTRRNSE  221



>ref|XP_006347652.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Solanum 
tuberosum]
Length=482

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 160/213 (75%), Gaps = 3/213 (1%)
 Frame = -2

Query  953  HLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKT  774
            H A  FG+LGNI+SF VFL+PIPTFYKIYK+KS++GYQSIPYVVALFS+ L +YYA +KT
Sbjct  7    HWAFAFGVLGNIISFIVFLSPIPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYAFLKT  66

Query  773  NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDIL-FFGAVIIVSLFLVNG  597
            N  L++ IN FG  IE +++  YLFYA KK ++ TIK+L L ++  FGA+I+V+ FL  G
Sbjct  67   NTTLLITINTFGVFIETIYVGFYLFYAPKKARVQTIKMLSLFVVGGFGAIIVVTQFLFKG  126

Query  596  SKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFS  417
            + R  +VGW C + ++ VF APL I+RQVI+T++ ++MPL LSV L   A  WFFYGL  
Sbjct  127  AIRGQVVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLL  186

Query  416  KDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEE  318
            KD  IA PN+LGF FG+ QIVLY +Y  SKKE+
Sbjct  187  KDINIAAPNVLGFFFGILQIVLYVIY--SKKEK  217


 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -2

Query  611  FLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFF  432
            FL  G+ R  +VGW C + ++ VF APL I RQVI+T++ ++MPL LS+ L   A  WFF
Sbjct  308  FLFKGAVRGQVVGWICLIFSLCVFVAPLGI-RQVIKTKSVEYMPLLLSIFLTLSAVVWFF  366

Query  431  YGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK  324
            YGL  KD  IA PN+LGF+ G+ Q+VLY +Y   +K
Sbjct  367  YGLLLKDINIAIPNVLGFILGILQMVLYVIYNKKEK  402



>gb|KHG20984.1| Bidirectional sugar transporter SWEET15 -like protein [Gossypium 
arboreum]
Length=289

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/243 (48%), Positives = 173/243 (71%), Gaps = 5/243 (2%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA+++  H LA++FG+LGNI+S  VFLAP+PTF +IYK+KS++ +QS+PY VALFS  L 
Sbjct  1    MAVMADHHSLAVVFGILGNIISVLVFLAPVPTFCRIYKKKSTESFQSLPYQVALFSCMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVII  621
            LYYA+IK  A+L++ IN FGC +E ++ISM+L YA+K  ++  +KL + +++  F  ++I
Sbjct  61   LYYALIKKGAFLLITINSFGCVVETIYISMFLAYASKNSRMSAMKLFISMNLGLFSFILI  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++ FL+  S RI ++GW C  I+V+VFAAPL+IM +VIRT++ +FMP TLS  L   A  
Sbjct  121  LTHFLLKSSIRIQVLGWICVAISVSVFAAPLNIMARVIRTKSVEFMPFTLSFFLTLSAVM  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK---EEDGKGAEYKEGIEIQVK  270
            WF YGLF KD  +A PN+LGF+ G+ Q++LY +Y+ S+K   EE    AE  + I + + 
Sbjct  181  WFAYGLFIKDLCVALPNVLGFILGMLQMLLYAIYRHSEKVNIEEKKLPAEQMKSINVVLT  240

Query  269  NDG  261
              G
Sbjct  241  TLG  243



>sp|A2X5B4.1|SWT15_ORYSI RecName: Full=Bidirectional sugar transporter SWEET15; Short=OsSWEET15 
[Oryza sativa Indica Group]
 gb|EAY86024.1| hypothetical protein OsI_07385 [Oryza sativa Indica Group]
Length=319

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 159/219 (73%), Gaps = 3/219 (1%)
 Frame = -2

Query  974  MALLSVQH--LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAEL  801
            MA +S++    A  FG+LGN++S  VFL+P+PTFY++Y++KS++G+QS PYVV LFS  L
Sbjct  1    MAFMSMERSTWAFTFGILGNLISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCML  60

Query  800  LLYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVI  624
             +YYA +K+ A L+V ING GC IE V+++MYL YA K  ++ T K+LL L+I  FG + 
Sbjct  61   WMYYAFVKSGAELLVTINGVGCVIETVYLAMYLAYAPKSARMLTAKMLLGLNIGLFGVIA  120

Query  623  IVSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCAT  444
            +V+L L  G  R+ ++GW C  ++++VFAAPLSI+R VIRT++ +FMP +LS  LV  A 
Sbjct  121  LVTLLLSRGELRVHVLGWICVAVSLSVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAV  180

Query  443  AWFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSK  327
             WF YGL  KD ++A PN+LGF+FG+AQ+ LY  Y+  K
Sbjct  181  IWFLYGLLKKDVFVALPNVLGFVFGVAQMALYMAYRSKK  219



>sp|B8BKP4.1|SWT14_ORYSI RecName: Full=Bidirectional sugar transporter SWEET14; Short=OsSWEET14 
[Oryza sativa Indica Group]
 gb|EEC68230.1| hypothetical protein OsI_36230 [Oryza sativa Indica Group]
Length=303

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 163/220 (74%), Gaps = 2/220 (1%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA +S+QH  A  FGLLGNI+SF  +LAP+PTFY+IYK KS+ G+QS+PYVVALFSA L 
Sbjct  1    MAGMSLQHPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVII  621
            +YYA++K++  L++ IN  GC IE ++I++YL YA KK K+FT KLLLL ++  FG +++
Sbjct  61   IYYALLKSDECLLITINSAGCVIETIYIAVYLVYAPKKAKMFTAKLLLLVNVGVFGLILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++L L  G +RI ++GW C   +V+VF APLSI+R V+RT++ +FMP +LS  L   A  
Sbjct  121  LTLLLSAGDRRIVVLGWVCVGFSVSVFVAPLSIIRLVVRTKSVEFMPFSLSFSLTISAVV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKE  321
            WF YGL  KD Y+A PN+LGF FG+ Q+ LY MY++S  +
Sbjct  181  WFLYGLLIKDKYVALPNVLGFSFGVIQMGLYAMYRNSTPK  220



>ref|NP_001067955.1| Os11g0508600 [Oryza sativa Japonica Group]
 sp|Q2R3P9.1|SWT14_ORYSJ RecName: Full=Bidirectional sugar transporter SWEET14; Short=OsSWEET14 
[Oryza sativa Japonica Group]
 gb|ABA93969.1| nodulin MtN3 family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF28318.1| Os11g0508600 [Oryza sativa Japonica Group]
 gb|EAZ18482.1| hypothetical protein OsJ_34008 [Oryza sativa Japonica Group]
 dbj|BAG95290.1| unnamed protein product [Oryza sativa Japonica Group]
Length=303

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 163/220 (74%), Gaps = 2/220 (1%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA +S+QH  A  FGLLGNI+SF  +LAP+PTFY+IYK KS+ G+QS+PYVVALFSA L 
Sbjct  1    MAGMSLQHPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVII  621
            +YYA++K++  L++ IN  GC IE ++I++YL YA KK K+FT KLLLL ++  FG +++
Sbjct  61   IYYALLKSDECLLITINSAGCVIETIYIAVYLVYAPKKAKMFTAKLLLLVNVGVFGLILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++L L  G +RI ++GW C   +V+VF APLSI+R V+RT++ +FMP +LS  L   A  
Sbjct  121  LTLLLSAGDRRIVVLGWVCVGFSVSVFVAPLSIIRLVVRTKSVEFMPFSLSFSLTISAVV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKE  321
            WF YGL  KD Y+A PN+LGF FG+ Q+ LY MY++S  +
Sbjct  181  WFLYGLLIKDKYVALPNVLGFSFGVIQMGLYAMYRNSTPK  220



>gb|AAM63257.1| similar to MtN3 protein [Arabidopsis thaliana]
Length=258

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 164/217 (76%), Gaps = 1/217 (0%)
 Frame = -2

Query  965  LSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYA  786
            L V  +A LFGLLGNIVSF VFL+P+PTFY IYK+KSS G+QSIPY+ AL SA LLLYY 
Sbjct  3    LQVHEIAFLFGLLGNIVSFGVFLSPVPTFYGIYKKKSSKGFQSIPYICALASATLLLYYG  62

Query  785  VIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIVSLF  609
            ++KT+AYLI+ IN FGC IE+ ++ +Y+ YA ++ KI T+KL+++ +I   G +I++   
Sbjct  63   IMKTHAYLIISINTFGCFIEISYLFLYILYAPREAKISTLKLIVICNIGGLGLLILLVNL  122

Query  608  LVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFY  429
            LV    R++ VGW CA  ++AVFA+PLS+MR+VI+T++ ++MP  LS+ L   A  WFFY
Sbjct  123  LVPKQHRVSTVGWVCAAYSLAVFASPLSVMRKVIKTKSVEYMPFLLSLSLTLNAVMWFFY  182

Query  428  GLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEE  318
            GL  KD +IA PNILGFLFG+AQ++LY MY+ S K +
Sbjct  183  GLLIKDKFIAMPNILGFLFGVAQMILYMMYQGSTKTD  219



>ref|XP_010442555.1| PREDICTED: bidirectional sugar transporter SWEET10-like isoform 
X1 [Camelina sativa]
 ref|XP_010442556.1| PREDICTED: bidirectional sugar transporter SWEET10-like isoform 
X2 [Camelina sativa]
Length=288

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 160/206 (78%), Gaps = 1/206 (0%)
 Frame = -2

Query  950  LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKTN  771
            LA +FG+LGNI+SFFV LAPIPTF +IYKRKSS+GYQS+PYV++LFSA L LYYA+IK +
Sbjct  8    LATVFGILGNIISFFVCLAPIPTFIRIYKRKSSEGYQSVPYVISLFSAMLWLYYAMIKKD  67

Query  770  AYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVIIVSLFLVNGS  594
            A +++ IN F   +++V+IS+Y FYA KK+KI T+K +L +D+  FG + +++ FL +G+
Sbjct  68   AMMLITINSFAFVVQIVYISLYFFYAPKKEKILTVKCVLFVDVFAFGLIFLLTYFLTHGN  127

Query  593  KRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFSK  414
            KR+ ++G+ C V +++VF APL I+R+VI+T++ +FMP  LS  L   A  WFFYGL  K
Sbjct  128  KRVQVLGYICMVFSLSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAIMWFFYGLLLK  187

Query  413  DYYIAFPNILGFLFGLAQIVLYCMYK  336
            D  IA PN+LGF+FG+ Q++L+ +YK
Sbjct  188  DKNIALPNVLGFIFGVLQMILFVIYK  213



>ref|XP_006647263.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Oryza 
brachyantha]
Length=319

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 160/219 (73%), Gaps = 3/219 (1%)
 Frame = -2

Query  974  MALLSVQH--LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAEL  801
            MA LS++    A  FG+LGNI+S  VFL+P+PTFY++Y++KS++G+QS PYVV LFS  L
Sbjct  1    MAFLSMERNTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCML  60

Query  800  LLYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVI  624
             +YYA +K+ A L+V ING GC IE V+++MYL YA K  ++ T ++LL L++  FG + 
Sbjct  61   WMYYAFVKSGAELLVTINGVGCVIETVYLAMYLAYAAKSTRMLTTRMLLGLNVGLFGLIA  120

Query  623  IVSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCAT  444
            +V+L L  G+ R+ ++GW C  ++++VFAAPLSI+R VIRT++ +FMP +LS  LV  A 
Sbjct  121  LVTLLLPQGALRVHVLGWVCVAVSLSVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAV  180

Query  443  AWFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSK  327
             WF YGL  KD ++A PN+LGF+FG+AQ+ LY  Y+  K
Sbjct  181  IWFGYGLLKKDVFVALPNVLGFVFGVAQMALYMAYRTKK  219



>gb|EYU43031.1| hypothetical protein MIMGU_mgv1a011488mg [Erythranthe guttata]
Length=280

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 153/211 (73%), Gaps = 1/211 (0%)
 Frame = -2

Query  959  VQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVI  780
            +  LA +FGLLGN+VSF VFLAPIPTFY+I+K+KS++G+QS+PY V LFSA L +YYA +
Sbjct  1    MNQLAFVFGLLGNVVSFMVFLAPIPTFYQIFKKKSTEGFQSVPYAVGLFSAMLWIYYAFL  60

Query  779  KTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKL-LLLDILFFGAVIIVSLFLV  603
            K    L++ IN  GC I+  +I  YLF+A K  +I T+KL LLL+++ FG +I+++ F  
Sbjct  61   KPETTLLITINSVGCVIQSAYICFYLFFATKNARIQTVKLILLLNVVGFGLIIVLTHFWA  120

Query  602  NGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGL  423
            N S R  +VGW C V ++ VF APL ++RQVIRT++ ++MP  LS  L   A  WFFYGL
Sbjct  121  NDSNRDDVVGWICLVFSLCVFVAPLGVVRQVIRTKSVEYMPFLLSFFLTLSAVMWFFYGL  180

Query  422  FSKDYYIAFPNILGFLFGLAQIVLYCMYKDS  330
              KDY IA PN+LGF+FG+ Q+VLY MYK+ 
Sbjct  181  LRKDYNIAIPNVLGFMFGVIQMVLYVMYKNP  211



>dbj|BAJ85621.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/239 (49%), Positives = 164/239 (69%), Gaps = 2/239 (1%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA LS++H  A  FGLLGNI+SF   LAPIPTFY+I+K KS++G+QS+PYVVALFSA L 
Sbjct  1    MAGLSMEHPWAFAFGLLGNIISFTSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKL-LLLDILFFGAVII  621
            ++YA++KT   L++ IN  GC IE V+I MYL YA +K KIFT K+ LLL++  FG + +
Sbjct  61   IFYALVKTGEGLLITINAAGCVIETVYIIMYLVYAPRKAKIFTAKIVLLLNVAGFGLIFL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++LF  +G  R+  +GW C   +V VF APLSI+ +VI+T++ ++MP +LS+ L   A  
Sbjct  121  LTLFAFHGETRVVSLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFSLSLTLTLSAVV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQVKND  264
            WF YGL  KD Y+A PNILGF FG+ Q+VLY  Y ++         E KE  ++  ++ 
Sbjct  181  WFLYGLLIKDKYVALPNILGFTFGMIQMVLYMFYMNATPVVASDAKEGKEAWKVPAEDH  239



>ref|NP_181439.1| bidirectional sugar transporter SWEET9 [Arabidopsis thaliana]
 sp|Q9ZV02.1|SWET9_ARATH RecName: Full=Bidirectional sugar transporter SWEET9; Short=AtSWEET9 
[Arabidopsis thaliana]
 gb|AAC79616.1| similar to MtN3 protein [Arabidopsis thaliana]
 gb|AEC09631.1| bidirectional sugar transporter SWEET9 [Arabidopsis thaliana]
Length=258

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 164/217 (76%), Gaps = 1/217 (0%)
 Frame = -2

Query  965  LSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYA  786
            L V  +A LFGLLGNIVSF VFL+P+PTFY IYK+KSS G+QSIPY+ AL SA LLLYY 
Sbjct  3    LKVHEIAFLFGLLGNIVSFGVFLSPVPTFYGIYKKKSSKGFQSIPYICALASATLLLYYG  62

Query  785  VIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIVSLF  609
            ++KT+AYLI+ IN FGC IE+ ++ +Y+ YA ++ KI T+KL+++ +I   G +I++   
Sbjct  63   IMKTHAYLIISINTFGCFIEISYLFLYILYAPREAKISTLKLIVICNIGGLGLLILLVNL  122

Query  608  LVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFY  429
            LV    R++ VGW CA  ++AVFA+PLS+MR+VI+T++ ++MP  LS+ L   A  WFFY
Sbjct  123  LVPKQHRVSTVGWVCAAYSLAVFASPLSVMRKVIKTKSVEYMPFLLSLSLTLNAVMWFFY  182

Query  428  GLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEE  318
            GL  KD +IA PNILGFLFG+AQ++LY MY+ S K +
Sbjct  183  GLLIKDKFIAMPNILGFLFGVAQMILYMMYQGSTKTD  219



>ref|XP_002865823.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42082.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=289

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/226 (51%), Positives = 166/226 (73%), Gaps = 6/226 (3%)
 Frame = -2

Query  950  LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKTN  771
            LA +FG+LGNI+SFFV LAPIPTF +IYKRKSS+GYQSIPYV++LFSA L +YYA+IK +
Sbjct  8    LATVFGILGNIISFFVCLAPIPTFVRIYKRKSSEGYQSIPYVISLFSAMLWMYYAMIKKD  67

Query  770  AYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVIIVSLFLVNGS  594
            A +++ IN F   I++V+IS+Y FYA KK+K  T+K +L +D+  FGA+ +++ FL++ +
Sbjct  68   AMMLITINSFAFVIQIVYISLYFFYAPKKEKTLTVKFVLFVDVFGFGAIFVLTYFLIHAN  127

Query  593  KRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFSK  414
            KR+ ++G+ C V  ++VF APL I+R+VI+T++ +FMP  LS  L   A  WFFYGL  K
Sbjct  128  KRVHVLGYICMVFALSVFLAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMWFFYGLLLK  187

Query  413  DYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQ  276
            D  IA PN+LGF+FG+ Q++L+ +YK     + G       GI++Q
Sbjct  188  DMNIALPNVLGFIFGVLQMILFLIYK-----KPGTKVLEPPGIKLQ  228



>gb|ACG28570.1| MTN3 [Zea mays]
Length=295

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 166/228 (73%), Gaps = 4/228 (2%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA LS+QH  A  FGLLGN++SF  FLAPIPTFY+IYK KS++G+QS+PYVVALFSA L 
Sbjct  1    MAGLSLQHPWAFTFGLLGNVISFMTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVII  621
            ++YA+IK+N   ++ IN  GC IE V++ MY  YA KK ++FT K +LLL++  FG++++
Sbjct  61   IFYALIKSNETFLITINAAGCVIETVYVVMYFVYATKKGRMFTAKIMLLLNVGAFGSILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++L L  G KR+ ++GW C   +V+VF APLSIMR+VI+T++ ++MP +LS+ L   A  
Sbjct  121  LTLLLFKGDKRVVMLGWICVGFSVSVFVAPLSIMRRVIQTKSVEYMPFSLSLSLTLSAVV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMY--KDSKKEEDGKGA  303
            WF YGL  KD Y+A PNILGF FG+ Q+VLY +Y  K      DGK A
Sbjct  181  WFLYGLLIKDKYVALPNILGFTFGVVQMVLYVVYMNKTPLPVADGKAA  228



>ref|XP_010442345.1| PREDICTED: bidirectional sugar transporter SWEET10 [Camelina 
sativa]
Length=289

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 159/206 (77%), Gaps = 1/206 (0%)
 Frame = -2

Query  950  LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKTN  771
            LA +FG+LGNI+SFFV LAPIPTF +IYKRKSS+GYQS+PYV++LFSA L LYYA+IK +
Sbjct  8    LATVFGILGNIISFFVCLAPIPTFIRIYKRKSSEGYQSVPYVISLFSAMLWLYYAMIKKD  67

Query  770  AYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVIIVSLFLVNGS  594
            A +++ IN F   +++V+IS+Y FYA KK+KI T+K +L +D+  FG + +++ FL +G+
Sbjct  68   AMMLITINSFAFVVQIVYISLYFFYAPKKEKILTVKFVLFVDVFAFGLIFLLTYFLTHGN  127

Query  593  KRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFSK  414
            KR+ ++G+ C V  ++VF APL I+R+VI+T++ +FMP  LS  L   A  WFFYGL  K
Sbjct  128  KRVQVLGYICMVFALSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAIMWFFYGLLLK  187

Query  413  DYYIAFPNILGFLFGLAQIVLYCMYK  336
            D  IA PN+LGF+FG+ Q++L+ +YK
Sbjct  188  DKNIALPNVLGFIFGVLQMILFVIYK  213



>ref|XP_004235340.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
lycopersicum]
Length=295

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 152/211 (72%), Gaps = 1/211 (0%)
 Frame = -2

Query  953  HLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKT  774
            HLA +FGLLGNIVSF V+LAP+PTFYKIYK+KS++G+QS+PYVV LFSA L +YYA +K 
Sbjct  4    HLAFVFGLLGNIVSFMVYLAPVPTFYKIYKKKSTEGFQSVPYVVGLFSAMLWIYYAFLKP  63

Query  773  NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVIIVSLFLVNG  597
            +  L++ IN  GC I+  +I  +LFYA KK K+ T+KLLL ++++  G +I ++ F   G
Sbjct  64   DTTLLITINSVGCFIQTFYICFFLFYATKKAKMDTMKLLLSMNVVGLGLIIFLTQFFAKG  123

Query  596  SKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFS  417
            S R  +VGW C + +  VF APL ++RQVIRT++ ++MP  LS  L   A  WF YGL  
Sbjct  124  SNRAQIVGWICLIFSFCVFVAPLGVLRQVIRTKSVEYMPFQLSFFLTLSAVMWFLYGLLR  183

Query  416  KDYYIAFPNILGFLFGLAQIVLYCMYKDSKK  324
            KDY IA PN+LGF  G+ Q+ LY +YK++KK
Sbjct  184  KDYNIAIPNVLGFSLGVIQMTLYLIYKNAKK  214



>gb|EMT11081.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=285

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/240 (50%), Positives = 168/240 (70%), Gaps = 5/240 (2%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA LS++H  A  FGLLGNI+SF   LAPIPTFY+I+K KS++G+QS+PYVVALFSA L 
Sbjct  1    MAGLSLEHPWAFAFGLLGNIISFTSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKL-LLLDILFFGAVII  621
            ++YA++KT   L++ IN  GC IE V+I MYL YA +K KIFT K+ +LL++  FG +++
Sbjct  61   IFYALVKTGEGLLISINAAGCVIETVYIVMYLVYAPRKAKIFTAKIVVLLNVAGFGLILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++LF  +G  R+  +GW C   +V VF APLSI+ +VI+T++ ++MP +LS+ L   A  
Sbjct  121  LTLFAFHGETRVISLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFSLSLTLTLSAVV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK-EEDGKGAEYKEGIEIQVKND  264
            WF YGL  KD Y+A PNILGF FG+ Q+VLY  Y ++     D K  E KEG+++  +  
Sbjct  181  WFLYGLLIKDKYVALPNILGFTFGMIQMVLYMFYMNATPVVSDLK--EGKEGLKMSAEEH  238



>dbj|BAJ94651.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=292

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 167/241 (69%), Gaps = 15/241 (6%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            M  LS QH  A  FGLLGN++SF  +LAP+PTFY+IYK KS+ G+QS+PYVVALFSA L 
Sbjct  1    MGGLSAQHPWAFTFGLLGNVISFMTYLAPLPTFYRIYKNKSTQGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVII  621
            +YYA++K++ YL++ IN  GC IE ++I +YL YA K+ ++FT K LLLL++  FG +++
Sbjct  61   IYYALLKSDEYLLITINTAGCVIETIYIVLYLAYAPKQARLFTAKILLLLNVGVFGLILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++L L  G +R+ ++GW C   +V VF APLS++R V+RTR+ +FMP +LS+ L   A  
Sbjct  121  LTLLLTAGERRVVMLGWVCVGFSVCVFVAPLSVIRLVVRTRSVEFMPFSLSLSLTASAVV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYK-----------DSKKEEDG--KGAE  300
            WF YGL  KD Y+A PNILGF FG+ Q+ LY +Y+           D+ + EDG  K  E
Sbjct  181  WFLYGLLIKDKYVALPNILGFAFGVIQMGLYALYRNATPIPAPKEMDAPESEDGAVKAPE  240

Query  299  Y  297
            +
Sbjct  241  H  241



>ref|NP_199892.1| bidirectional sugar transporter SWEET10 [Arabidopsis thaliana]
 sp|Q9LUE3.1|SWT10_ARATH RecName: Full=Bidirectional sugar transporter SWEET10; Short=AtSWEET10 
[Arabidopsis thaliana]
 dbj|BAA96992.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AAK96739.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AAL47380.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AAM61234.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AED95992.1| bidirectional sugar transporter SWEET10 [Arabidopsis thaliana]
Length=289

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 167/226 (74%), Gaps = 6/226 (3%)
 Frame = -2

Query  950  LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKTN  771
            LA +FG+LGNI+SFFV LAPIPTF +IYKRKSS+GYQSIPYV++LFSA L +YYA+IK +
Sbjct  8    LATVFGILGNIISFFVCLAPIPTFVRIYKRKSSEGYQSIPYVISLFSAMLWMYYAMIKKD  67

Query  770  AYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVIIVSLFLVNGS  594
            A +++ IN F   +++V+IS++ FYA KK+K  T+K +L +D+L FGA+ +++ F+++ +
Sbjct  68   AMMLITINSFAFVVQIVYISLFFFYAPKKEKTLTVKFVLFVDVLGFGAIFVLTYFIIHAN  127

Query  593  KRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFSK  414
            KR+ ++G+ C V  ++VF APL I+R+VI+T++ +FMP  LS  L   A  WFFYGL  K
Sbjct  128  KRVQVLGYICMVFALSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMWFFYGLLLK  187

Query  413  DYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQ  276
            D  IA PN+LGF+FG+ Q++L+ +YK     + G       GI++Q
Sbjct  188  DMNIALPNVLGFIFGVLQMILFLIYK-----KPGTKVLEPPGIKLQ  228



>ref|XP_004491680.1| PREDICTED: bidirectional sugar transporter N3-like [Cicer arietinum]
Length=257

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/250 (46%), Positives = 175/250 (70%), Gaps = 13/250 (5%)
 Frame = -2

Query  965  LSVQH--LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLY  792
            +++ H  LA  FG+LGN++SF VFLAP+ TFY+IYK+KS++ +QS+PY+VALFS+ L LY
Sbjct  1    MAISHATLAFGFGMLGNVISFMVFLAPMTTFYRIYKKKSTEQFQSLPYLVALFSSMLWLY  60

Query  791  YAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVIIVS  615
            YA++KTN +L++ IN FGC +E+++I +Y+ YA K  +  T+KLLL +++  FG ++ V+
Sbjct  61   YALVKTNEFLLITINSFGCLVEIIYILLYITYAPKDARKLTLKLLLAMNMGSFGLILSVT  120

Query  614  LFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWF  435
             + ++G+ R+ ++GW C  I+V+VFAAPL+I+ QV+RT++ +FMP  LS  L   A  WF
Sbjct  121  HYAMHGALRVQVLGWICVSISVSVFAAPLTIVAQVVRTKSVEFMPFNLSFTLTLSAIMWF  180

Query  434  FYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKE----------EDGKGAEYKEGI  285
             YGLF KD  IA PN+LGF+ GL Q++LY +Y++  K+          E+G+    +E  
Sbjct  181  GYGLFLKDICIALPNVLGFVLGLVQMILYGIYRNGNKKATLKTVVSSLENGEVFPVQEDH  240

Query  284  EIQVKNDGRR  255
            EI  KN   +
Sbjct  241  EIGNKNKEEK  250



>ref|XP_003576036.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Brachypodium 
distachyon]
Length=300

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 122/244 (50%), Positives = 169/244 (69%), Gaps = 10/244 (4%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA LS+QH  A  FGLLGN++SF  +LAP+ TFY+IYK KS+ G+QS+PYVVALFSA L 
Sbjct  1    MAGLSLQHPWAFAFGLLGNVISFMTYLAPLSTFYRIYKNKSTQGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVII  621
            +YYA++K++  L++ IN  GC IE ++I +YL YA K+ K+FT K LLLL++  FG +++
Sbjct  61   IYYALLKSDGCLLITINTAGCVIETIYIVVYLAYAPKQAKLFTAKILLLLNVGVFGMILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++L L  G KR+ ++GW C   +V+VF APLS++R V+RTR+ +FMP  LS+ L   A  
Sbjct  121  LTLLLSEGEKRVVMLGWVCVGFSVSVFVAPLSVIRLVVRTRSVEFMPFNLSLSLTLSAVV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDS-----KKEEDGKGAEYKEGIEIQ  276
            WF YGL  KD Y+A PNILGF FG+ Q+ LY +Y++S      KE D   AE  +G   +
Sbjct  181  WFLYGLLIKDKYVALPNILGFAFGVIQMGLYALYRNSTPRPVTKEVD---AESHDGAAPK  237

Query  275  VKND  264
            V   
Sbjct  238  VPEH  241



>gb|EMT20481.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=293

 Score =   234 bits (597),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 117/238 (49%), Positives = 168/238 (71%), Gaps = 7/238 (3%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            M  LS++H  A  FGLLGNI+SF  +LAP+PTFY+IY+ KS+ G+QS+PYVVALFSA L 
Sbjct  1    MGGLSLEHPWAFAFGLLGNIISFMTYLAPLPTFYRIYRSKSTQGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVII  621
            +YYA++K++  L++ IN  GC IE ++I MYL YA K+ K+FT K LLLL++  FG +++
Sbjct  61   IYYALLKSDELLLITINSAGCVIETIYIIMYLTYAPKQAKLFTAKILLLLNVGVFGLILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++L L  G KR+ ++GW C   +V+VF APLS++R V+RTR+ +FMP +LS+ L   A  
Sbjct  121  LTLLLAGGEKRVVMLGWVCVGFSVSVFVAPLSVIRLVVRTRSVEFMPFSLSLSLTVSAVV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMY-----KDSKKEEDGKGAEYKEGIE  282
            WF YGL  KD Y+A PNILGF FG+ Q+ LY +Y     + + KE D   +++   ++
Sbjct  181  WFLYGLLIKDKYVALPNILGFAFGVIQMGLYALYCNAMPRQAPKEVDDPMSDHGAAVK  238



>ref|XP_008239523.1| PREDICTED: bidirectional sugar transporter N3 [Prunus mume]
Length=296

 Score =   234 bits (597),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 166/230 (72%), Gaps = 6/230 (3%)
 Frame = -2

Query  950  LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKTN  771
            L + FG+LGN+VSF VFLAP+PTF++IYK+KS++G+QS+PYV ALFSA + +YYA +K++
Sbjct  10   LVIAFGILGNVVSFVVFLAPVPTFWRIYKKKSTEGFQSVPYVFALFSAMIWIYYAFLKSD  69

Query  770  AYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIVSLFLVNGS  594
             +L++ IN FGC IE ++ISMY+ YA K+ ++F ++LLLL +   F  ++++S FL  G 
Sbjct  70   EFLLITINAFGCIIETIYISMYITYAPKQARVFALRLLLLVNFGGFCLILLLSHFLAQGP  129

Query  593  KRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFSK  414
             R+ ++GW C   +V+VFAAPLSIMR VIRT++   MP +LS  L   A  W FYGL  K
Sbjct  130  TRVEVLGWVCVAFSVSVFAAPLSIMRVVIRTKS---MPFSLSFFLTLSAVMWLFYGLLLK  186

Query  413  DYYIAFPNILGFLFGLAQIVLYCMYKDSKK--EEDGKGAEYKEGIEIQVK  270
            D Y+A PNILGF FG+AQ++LY +Y++ K    ED K   +K  +  Q++
Sbjct  187  DLYVACPNILGFTFGVAQMILYAIYRNKKTVLVEDQKLPVHKGDVVKQIQ  236



>ref|XP_009802608.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Nicotiana 
sylvestris]
 ref|XP_009792803.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Nicotiana 
sylvestris]
Length=293

 Score =   234 bits (597),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 119/223 (53%), Positives = 157/223 (70%), Gaps = 12/223 (5%)
 Frame = -2

Query  953  HLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKT  774
            H A  FG+LGNIVSF VFL+P+PTFYKIYK+KS++GYQSIPYV+ALFS+ L +YYA +KT
Sbjct  6    HWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVIALFSSMLWIYYAFLKT  65

Query  773  NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDIL-FFGAVIIVSLFLVNG  597
            N  L++ IN FG  IE +++  YLFYA KK +I T+K+L L ++  FGA+I+++ FL  G
Sbjct  66   NTTLLITINSFGVFIETIYVGFYLFYAPKKARIQTVKMLFLTVVGGFGAIILIAQFLFKG  125

Query  596  SKRIALVGWTCAVINVAVFAAPLSIM-----------RQVIRTRNTQFMPLTLSVCLVFC  450
              R  +VGW C V ++ VF APL I+           R+VI+T++ ++MPL LSV L   
Sbjct  126  VARGQVVGWVCLVFSLCVFVAPLCIVTALLLVDHFMQRKVIKTKSVEYMPLLLSVFLTLS  185

Query  449  ATAWFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKE  321
            A  WFFYGL  KD  IA PNILGF+FG+ QIVLY +Y   +K 
Sbjct  186  AVMWFFYGLLLKDINIAAPNILGFIFGILQIVLYVIYNKKEKH  228



>ref|XP_004501816.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Cicer 
arietinum]
Length=262

 Score =   233 bits (594),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 164/221 (74%), Gaps = 2/221 (1%)
 Frame = -2

Query  956  QHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIK  777
            + LA +FG+LGN +SF VFLAP+PTFY+IYK+KS++G+QSIPYVVAL SA L +YYA+ K
Sbjct  6    ESLAFIFGILGNAISFMVFLAPVPTFYQIYKKKSTEGFQSIPYVVALLSAMLWIYYALAK  65

Query  776  -TNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIVSLFLV  603
              +++L++ IN FG  +E ++I+++L  A+ K ++ TIKLL+L ++  FG +++ +L+L 
Sbjct  66   REHSFLLLTINTFGVGVESLYIAIFLVCASHKARLSTIKLLVLCNVFGFGGMVVSTLYLT  125

Query  602  NGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGL  423
              S+RI+++GW C V N+ VFA+PL I+++VI TR+  FMPL+LS  L   A  WFFYG 
Sbjct  126  KASERISIIGWVCLVFNIGVFASPLGIIKKVIETRSVAFMPLSLSFFLSLNAIMWFFYGF  185

Query  422  FSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAE  300
               DYYIA PN LGFLFG+ Q+V+Y +YK+S + +  K  E
Sbjct  186  LLNDYYIALPNTLGFLFGIVQMVIYLIYKNSNEVDPKKLQE  226



>gb|EMT20480.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=287

 Score =   234 bits (596),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 120/233 (52%), Positives = 165/233 (71%), Gaps = 7/233 (3%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            M  LS+QH  A  FGLLGN++SF  +LAP+PTFY+IY+ KS+ G+QS+PYVVALFSA L 
Sbjct  1    MGGLSLQHPWAFAFGLLGNVISFMTYLAPLPTFYRIYRSKSTQGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVII  621
            +YYA++K++  L++ IN  GC IE ++I MYL YA K+ KIFT K LLLL++  FG +++
Sbjct  61   IYYALLKSDELLLITINSAGCIIETIYIVMYLAYAPKQAKIFTAKILLLLNVGVFGLILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++L L  G KR+ ++GW C   +V+VF APLSI+R V+RTR+ +FMP +LS+ L   A  
Sbjct  121  LTLLLAGGEKRVVMLGWVCVGFSVSVFVAPLSIIRLVVRTRSVEFMPFSLSLSLTVSAVV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKD-----SKKEEDGKGAEY  297
            WF YGL  KD Y+A PNILGF FG+ Q+ LY +Y +     + KE D    E+
Sbjct  181  WFLYGLLIKDKYVALPNILGFAFGVIQMGLYAIYCNATPTLAPKEVDRPLPEH  233



>ref|XP_008464392.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
melo]
Length=297

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/238 (49%), Positives = 173/238 (73%), Gaps = 4/238 (2%)
 Frame = -2

Query  974  MALLSVQHLALLF--GLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAEL  801
            MAL  + H   +F  GLLGNI SF VFLAP+PTF ++ ++KS++G+QSIPYVVALFSA L
Sbjct  1    MALSFMNHNPWIFAFGLLGNIFSFIVFLAPVPTFIRVCRKKSTEGFQSIPYVVALFSALL  60

Query  800  LLYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVI  624
            L+YY+ +  + + ++ IN  GC IE V+I++Y+ YA KK +IFT++ +LLLD++ F +++
Sbjct  61   LIYYSTLNADEFFLMTINSVGCFIETVYIALYIAYAPKKARIFTVRFVLLLDVVGFCSIL  120

Query  623  IVSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCAT  444
            +V+ FLV  + R  ++G+ C  ++V+VFAAPLSIM++VIRTR+ ++MP +LS  L   A 
Sbjct  121  VVTQFLVKRAYRARVIGFICGGLSVSVFAAPLSIMKKVIRTRSVEYMPFSLSFFLTLSAV  180

Query  443  AWFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK-EEDGKGAEYKEGIEIQV  273
             W  YGLF KD Y+A PN LGF FG+AQ++LY +Y+++K    + K  ++K  IE Q+
Sbjct  181  MWLCYGLFLKDLYVALPNTLGFTFGMAQMILYAIYRNAKPLPNEEKLPQHKADIETQI  238



>ref|XP_009411801.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=281

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 162/211 (77%), Gaps = 2/211 (1%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA LS+QH L   FG+LGN++SF VFLAPIPTFY++Y++KS++G+ S+PYVVA+FS  L 
Sbjct  1    MAGLSLQHPLPFTFGMLGNLISFMVFLAPIPTFYRVYRKKSTEGFHSLPYVVAVFSCMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKL-LLLDILFFGAVII  621
            +YYA +KT++ L++ IN FG  IE  +I++YL YA KK +I ++++ +LL+++ F A+I+
Sbjct  61   IYYAYVKTDSILLITINSFGVFIETAYITIYLIYAPKKTRIMSMRIFVLLNVVVFAAIIL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++  L  GS R+ ++GW C   +V+VFAAPLS++R VIRT++ +F+P  LS  L   A A
Sbjct  121  LTQLLFTGSIRLKVLGWICVGFSVSVFAAPLSVIRLVIRTKSVEFLPFYLSFFLTLSAIA  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLY  348
            WF YGLF+KD Y+  PN+LGFLFG+AQ+VLY
Sbjct  181  WFGYGLFTKDIYVQLPNVLGFLFGVAQMVLY  211



>emb|CDY69440.1| BnaCnng63490D, partial [Brassica napus]
Length=214

 Score =   231 bits (588),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/212 (53%), Positives = 156/212 (74%), Gaps = 1/212 (0%)
 Frame = -2

Query  965  LSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYA  786
            +S+  L  +FG+LGNI+SF V LAPIPTF +IYKRKSS+GYQSIPYV+ALFSA L +YYA
Sbjct  3    VSIDVLRTVFGILGNIISFLVCLAPIPTFIRIYKRKSSEGYQSIPYVIALFSAMLWIYYA  62

Query  785  VIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVIIVSLF  609
            +IKTN  +++ IN     I++ +IS YLFYA KK+K  T+K +L +D+  FG +  ++ F
Sbjct  63   MIKTNVVIMITINAVSLVIQIFYISFYLFYAPKKEKTLTVKFVLFVDVFAFGFIFFLTYF  122

Query  608  LVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFY  429
            L++G KR+ ++G+ C V ++ VF APL I+R+VI+TR+ +FMP  LS  L   A  WFFY
Sbjct  123  LLHGQKRVQILGYICMVFSLCVFVAPLGIIRKVIKTRSAEFMPFGLSFFLTLSAVMWFFY  182

Query  428  GLFSKDYYIAFPNILGFLFGLAQIVLYCMYKD  333
            GL  KD  IA PN+LGF+FG+ Q++LY +YK 
Sbjct  183  GLLLKDMNIALPNVLGFIFGVLQMILYMIYKK  214



>ref|XP_010482380.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Camelina 
sativa]
Length=288

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 158/206 (77%), Gaps = 1/206 (0%)
 Frame = -2

Query  950  LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKTN  771
            LA +FG+LGNI+SFFV LAPIPTF +IYKRKSS+GYQS+PYV++LFSA L LYYA+IK +
Sbjct  8    LATVFGILGNIISFFVCLAPIPTFIRIYKRKSSEGYQSVPYVISLFSAMLWLYYAMIKKD  67

Query  770  AYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVIIVSLFLVNGS  594
            A +++ IN F   +++V+IS+Y FYA KK+KI T+K +L +D+  FG + +++ FL +G+
Sbjct  68   AMMLITINSFAFVVQIVYISLYFFYAPKKEKILTVKFVLFVDVFAFGLIFLLTYFLTHGN  127

Query  593  KRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFSK  414
            KR  ++G+ C V  ++VF APL I+R+VI+T++ +FMP  LS  L   A  WFFYGL  K
Sbjct  128  KRGQVLGYICMVFALSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAIMWFFYGLLLK  187

Query  413  DYYIAFPNILGFLFGLAQIVLYCMYK  336
            D  IA PNILGF+FG+ Q++L+ +YK
Sbjct  188  DMNIALPNILGFIFGVLQMILFVIYK  213



>ref|XP_004138250.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=302

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/238 (48%), Positives = 173/238 (73%), Gaps = 4/238 (2%)
 Frame = -2

Query  974  MALLSVQHLALLF--GLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAEL  801
            MAL  + H   +F  GLLGNI SF VFLAP+PTF ++ ++KS++G+QSIPYVVALFSA L
Sbjct  1    MALSFMNHNPWIFAFGLLGNIFSFIVFLAPVPTFIRVCRKKSTEGFQSIPYVVALFSALL  60

Query  800  LLYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVI  624
            L+YY+ +  + + ++ IN  GC IE ++I++Y+ YA KK +IFT++ +LLLD++ F +++
Sbjct  61   LIYYSTLNADEFFLMTINSVGCFIETIYIALYIAYAPKKARIFTVRFVLLLDVVGFCSIL  120

Query  623  IVSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCAT  444
            +V+ FLV  + R  ++G+ C  ++V+VFAAPLSIM++VIRTR+ ++MP +LS  L   A 
Sbjct  121  VVTQFLVKRAYRARVIGFICGGLSVSVFAAPLSIMKRVIRTRSVEYMPFSLSFFLTLSAV  180

Query  443  AWFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK-EEDGKGAEYKEGIEIQV  273
             W  YGLF KD Y+A PN LGF FG+AQ++LY +Y+++K    + K  ++K  IE Q+
Sbjct  181  MWLCYGLFLKDLYVALPNTLGFTFGMAQMILYAIYRNAKPLPSEEKLPQHKADIETQI  238



>ref|XP_010249453.1| PREDICTED: bidirectional sugar transporter SWEET12 [Nelumbo nucifera]
Length=292

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/232 (51%), Positives = 167/232 (72%), Gaps = 6/232 (3%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA+  V H     FGLLGNI+S  V+LAP+PTF +IYK+KS++G+QS+PYVVALFSA L 
Sbjct  1    MAMFDVHHPWTFAFGLLGNIISLMVYLAPVPTFIRIYKKKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVII  621
            +YY ++K +A+L++ IN  GC IE  +I+M++ YA KK ++  IKLLLL ++  F ++++
Sbjct  61   IYYGLLKPDAHLLITINSVGCVIETSYITMFMVYAPKKARVLAIKLLLLLNVGTFCSILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
             +LFL  GS R+ ++G  C   +V+VFAAPLSIMR VIR+++ +FMP +LS  L   A  
Sbjct  121  FTLFLAKGSNRVRVLGSICVAFSVSVFAAPLSIMRLVIRSKSVEFMPFSLSFFLTLSAVM  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK----EEDGKGAEY  297
            WF YG   KD+YIA PNILGF+FG+AQ+VLY +YKD+ +    E+  K  E+
Sbjct  181  WFSYGFLLKDFYIALPNILGFIFGVAQMVLYAIYKDANRSNIEEQQQKVNEH  232



>ref|XP_011073577.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Sesamum 
indicum]
 ref|XP_011073579.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Sesamum 
indicum]
Length=270

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 160/221 (72%), Gaps = 3/221 (1%)
 Frame = -2

Query  953  HLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKT  774
            H A  FGLLGNIVSF VFL+PIPTFY+IYK+K+S+G+QS+PYVVALFSA L +YYA +K+
Sbjct  7    HWAFAFGLLGNIVSFMVFLSPIPTFYQIYKKKTSEGFQSVPYVVALFSAMLWIYYAFLKS  66

Query  773  NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLL-LLDILFFGAVIIVSLFLVNG  597
            N  LI+ IN  GC I+ ++I  YLFYA KK ++ T+KLL LL +  FG +++ + FLV  
Sbjct  67   NTTLIITINSVGCFIQTIYICFYLFYAPKKQRVQTLKLLFLLIVCGFGFILVSTHFLVKA  126

Query  596  SKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFS  417
            S +  +VGW C V ++ VF APL I+R+VIRT++ ++MP  LS+ L   A  WFFYG   
Sbjct  127  SLQANVVGWICLVFSLCVFIAPLCIVRKVIRTKSVEYMPFLLSLFLTLSAVMWFFYGFLI  186

Query  416  KDYYIAFPNILGFLFGLAQIVLYCMYKDSKKE--EDGKGAE  300
            KDY IA PN+LGF FG+ Q+ LY  YK++ K   EDGK +E
Sbjct  187  KDYNIAIPNVLGFSFGVLQMALYVKYKNAAKMILEDGKISE  227



>ref|XP_010090683.1| Bidirectional sugar transporter N3 [Morus notabilis]
 gb|EXB40347.1| Bidirectional sugar transporter N3 [Morus notabilis]
Length=286

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 161/224 (72%), Gaps = 2/224 (1%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA+ ++QH     FG+LGNI+S  V+LAP+ TFY++Y++KS++ + S+PY+VALFS+ L 
Sbjct  1    MAIFNIQHPWTFTFGILGNIISVLVYLAPVTTFYRVYRKKSTEDFHSLPYLVALFSSMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLL-LLDILFFGAVII  621
            LYYA++KT+A L++ IN FGC IE+++I+M++ YA    K  TIK   L+++  F  + +
Sbjct  61   LYYALLKTDAMLLITINSFGCVIEMIYITMFIVYAPSHAKKLTIKFFALMNVGMFSLIFL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            V+ F V  S R+ ++GW C  I+V+VFAAPLSI+ QVIRTR+ +FMP TLS  L   A  
Sbjct  121  VTQFAVGHSYRVQVLGWICVAISVSVFAAPLSIVAQVIRTRSVEFMPFTLSFFLTLSAIT  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGK  309
            WF YGL  KD  IA PN+LGF+ GL Q++LY +Y++ K EED +
Sbjct  181  WFAYGLLLKDICIAVPNVLGFVLGLLQMLLYAIYRNYKTEEDQE  224



>ref|XP_003524088.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
 gb|KHN22921.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=283

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/227 (50%), Positives = 160/227 (70%), Gaps = 2/227 (1%)
 Frame = -2

Query  956  QHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIK  777
             HLAL FG+LGN++SF V+LAP+PTFY+IYK+KS++G+QS+PY+VALFS+ L LYYA +K
Sbjct  8    NHLALGFGMLGNVISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYASLK  67

Query  776  -TNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKL-LLLDILFFGAVIIVSLFLV  603
              +A L++ IN  GC IE+V+I M+  YA K  +  T+KL +++++  F  + +V+ F +
Sbjct  68   PADATLLITINSLGCVIEIVYIIMFTIYATKDARNLTVKLFMVMNVGSFALIFLVTYFAM  127

Query  602  NGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGL  423
            +GS R+ +VGW C  I V VFAAPLSI+ QVIRT+N +FMP  LS+ L   A  WFFYGL
Sbjct  128  HGSLRVQVVGWVCVSIAVGVFAAPLSIVAQVIRTKNVEFMPFNLSLFLTISAVMWFFYGL  187

Query  422  FSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIE  282
              KD  IA PNILGF  GL Q++LY +Y++ K        + +  +E
Sbjct  188  LLKDICIAIPNILGFTLGLLQMLLYAIYRNGKTNNKEVVTKEEHALE  234



>ref|XP_006281748.1| hypothetical protein CARUB_v10027907mg [Capsella rubella]
 gb|EOA14646.1| hypothetical protein CARUB_v10027907mg [Capsella rubella]
Length=290

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 157/206 (76%), Gaps = 1/206 (0%)
 Frame = -2

Query  950  LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKTN  771
            LA +FG+LGN++SFFV LAPIPTF +IYKRKSS+GYQS+PYV++LFSA L LYYA+IK +
Sbjct  8    LATVFGILGNVISFFVCLAPIPTFIRIYKRKSSEGYQSVPYVISLFSAMLWLYYAMIKKD  67

Query  770  AYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVIIVSLFLVNGS  594
            A +++ IN F   I++V+IS++ FYA KKDKI T+K +L +D+  FG +   + F ++G+
Sbjct  68   AVMLITINSFAFVIQIVYISLFFFYAPKKDKILTVKFVLFVDVFAFGLIFFSTYFPIHGN  127

Query  593  KRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFSK  414
            KR+ ++G+ C V  ++VF APL I+R+VI+T++ +FMP  LS  L   A  WFFYGL  K
Sbjct  128  KRVQVLGYICMVFALSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMWFFYGLLLK  187

Query  413  DYYIAFPNILGFLFGLAQIVLYCMYK  336
            D  IA PN+LGF+FG+ Q+VL+ +YK
Sbjct  188  DKNIALPNVLGFIFGVLQMVLFVIYK  213



>ref|XP_004242139.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Solanum 
lycopersicum]
Length=289

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/213 (55%), Positives = 163/213 (77%), Gaps = 2/213 (1%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MA  SV H    FG+LGNI+SFFVFL+P+PTFYK+YK+KS++GYQSIPY+VALFSA L +
Sbjct  1    MADFSV-HWVFAFGVLGNIISFFVFLSPLPTFYKMYKKKSTEGYQSIPYIVALFSAMLWI  59

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVIIV  618
            YYA +KTN  L++ IN FGC +E+++I  YLFYA+K+ ++ T+K LLLL +  FGA+++V
Sbjct  60   YYAFLKTNTTLLITINTFGCFVEIMYIGFYLFYASKEARVQTVKLLLLLVVGGFGAIVLV  119

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            S FL  G+ R+ +VG  C + ++ VF APL I+RQVI+T++ ++MP  LSV L   A  W
Sbjct  120  SQFLFEGAVRVQVVGCICLICSLCVFVAPLCIVRQVIKTKSVEYMPFLLSVFLTLSAVMW  179

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMY  339
            FFYG+  +D+ IA PN+LGF+FG+ Q+VLY MY
Sbjct  180  FFYGILLEDFNIAIPNVLGFIFGILQMVLYVMY  212



>ref|XP_008791098.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Phoenix 
dactylifera]
Length=296

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/231 (52%), Positives = 171/231 (74%), Gaps = 5/231 (2%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA LS+ H  A  FG+LGNI+SF V++AP+PTFY++Y +KS++G+QS+PYVVALFSA L 
Sbjct  1    MAGLSLDHPWAFTFGILGNIISFMVYVAPLPTFYRVYIKKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVII  621
            +YYA+IKT++YL+V IN  GC IE ++I MYL YA KK +IFT + LLLL++  FG +++
Sbjct  61   IYYALIKTDSYLLVTINSIGCIIETMYIIMYLSYAPKKARIFTAQILLLLNVGLFGLIVL  120

Query  620  VSLFLVNGSK-RIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCAT  444
            ++L L  G + ++ ++GW C   +++VF APLSI+R VIRT++ +FMP  LS  L   A 
Sbjct  121  LTLLLAKGPREQVRVLGWVCVSFSISVFVAPLSIIRLVIRTKSVEFMPFWLSFFLTLSAI  180

Query  443  AWFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKE--EDGKGAEY  297
            AWF YGL +KD Y+A PNILGF+FG+ Q+ +Y  YK +K+   +  K AE+
Sbjct  181  AWFSYGLLTKDIYVALPNILGFIFGVVQMGIYIAYKGAKRAAYDQNKVAEH  231



>ref|XP_002511127.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51729.1| conserved hypothetical protein [Ricinus communis]
Length=277

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/227 (49%), Positives = 162/227 (71%), Gaps = 4/227 (2%)
 Frame = -2

Query  953  HLAL--LFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVI  780
            HL+L  LFG+L NI+S  V LAP+PTFY+I K+K+S+G+QS+PYV+ALFSA L L+YA  
Sbjct  4    HLSLEFLFGVLANIISSMVCLAPLPTFYQICKKKTSEGFQSVPYVIALFSAMLWLFYATF  63

Query  779  KTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIVSLFLV  603
              NA L++ IN F   +E+ ++S+YLFY  +KD++ T KL+L  ++  FG + I++LFL 
Sbjct  64   DDNATLLITINSFTFFMEVGYLSVYLFYGTRKDRMLTTKLVLFFNVFGFGMIAILTLFLT  123

Query  602  NGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGL  423
            +G KR+ ++GW C +  + VF APL IMR+VI+T++ +FMP +LS  L   A  WFFYG 
Sbjct  124  HGRKRVDVLGWICMIFALCVFVAPLGIMRKVIKTKSVEFMPFSLSFFLTLSAVMWFFYGF  183

Query  422  FSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKE-EDGKGAEYKEGI  285
              KD Y+  PN+LGF FG+ Q++LY +Y++SKK  E+ K  E+ E I
Sbjct  184  LKKDIYVYIPNVLGFFFGIVQMILYLIYRNSKKPVEEPKSQEFSEHI  230



>ref|XP_002303766.2| hypothetical protein POPTR_0003s16520g [Populus trichocarpa]
 gb|EEE78745.2| hypothetical protein POPTR_0003s16520g [Populus trichocarpa]
Length=287

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/223 (50%), Positives = 169/223 (76%), Gaps = 1/223 (0%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MA+ S+ HLA  FG+LGNI+S  V+LAP+PTF +I+K+KS++ +QS+PY++ALFS+ L L
Sbjct  1    MAVTSILHLAFTFGILGNIISTMVYLAPVPTFIRIFKKKSTEDFQSLPYLMALFSSMLWL  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVIIV  618
            YYA++K +  L+V IN FGC IE  +I++Y+ YA ++ ++ TIKLL+ +++  F  ++++
Sbjct  61   YYAMLKKDTILLVTINSFGCVIETTYIAIYIVYATRESRVSTIKLLISMNLGLFSLILLL  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            + FLV+GS R+ ++GW C  ++V VFAAPL+I++QVIRT++ +FMP TLS  L   A  W
Sbjct  121  AHFLVSGSVRVKVLGWLCVALSVCVFAAPLNILKQVIRTKSVEFMPFTLSFFLTLSAVMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGK  309
            F YGL  KD  IA PNILGF+ GL Q++LY +Y++++K E+ K
Sbjct  181  FAYGLLLKDLCIALPNILGFILGLLQMLLYGIYRNAQKVEEKK  223



>gb|KDP26857.1| hypothetical protein JCGZ_18015 [Jatropha curcas]
Length=293

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 166/218 (76%), Gaps = 2/218 (1%)
 Frame = -2

Query  974  MALLSV-QHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA+LS  Q LA  FGLLGNI+S  V+LAP+PTF +IY++KS++G+ S+PY+VALFS+ L 
Sbjct  1    MAVLSTHQPLAFAFGLLGNIISVLVYLAPVPTFLRIYRKKSTEGFHSLPYLVALFSSMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVII  621
            L+YA++K + +L+V IN FGCAIE ++I +Y+FYA+K+ ++ T +LL+ ++I  F ++++
Sbjct  61   LHYAMLKKDVFLLVTINVFGCAIETIYIFLYMFYASKEIRVSTFRLLVSMNIALFSSIVL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
             + FL+ GS R+ ++GW C  ++V+VFA+PLSI+ QV+RTR+ +FMP TLS  L   A  
Sbjct  121  FTHFLMKGSIRVQVLGWICVAVSVSVFASPLSIVAQVVRTRSVEFMPFTLSFFLTLSAVM  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSK  327
            WF YG  +K+  +A PNILGF+ GL Q++LY +Y+ +K
Sbjct  181  WFAYGFTTKNMCVALPNILGFILGLLQMLLYAIYRKAK  218



>ref|NP_001132836.1| hypothetical protein [Zea mays]
 gb|ACF81848.1| unknown [Zea mays]
 tpg|DAA42015.1| TPA: hypothetical protein ZEAMMB73_422539 [Zea mays]
Length=344

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 162/220 (74%), Gaps = 2/220 (1%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA LS+QH +A  FGLLGNI+SF  +LAP+PTF +IY+ KS++G+QS+PYVVALFSA L 
Sbjct  1    MAGLSLQHPMAFAFGLLGNIISFMTYLAPLPTFCRIYRNKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVII  621
            +YYA++K+N +L++ IN  GC IE ++I+ YL YA  K K+FT K LLLL++  FG +++
Sbjct  61   IYYALLKSNEFLLITINSAGCVIETLYIATYLLYAPNKAKLFTAKILLLLNVGVFGLILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++L L  G  R+ ++GW C   +V+VF APLSI+RQV+RTR+ +FMP +LS  L   A  
Sbjct  121  LTLLLSAGPHRVVVLGWVCVAFSVSVFVAPLSIIRQVVRTRSVEFMPFSLSFSLTASAVV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKE  321
            WF YGL  KD Y+A PN+LGF FG+ Q+ +Y +Y+++   
Sbjct  181  WFLYGLLIKDKYVALPNVLGFTFGVVQMGMYALYRNATPR  220



>ref|XP_008356571.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Malus 
domestica]
Length=295

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/235 (49%), Positives = 165/235 (70%), Gaps = 8/235 (3%)
 Frame = -2

Query  965  LSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYY  789
            +++QH L+L FGLLGNI+S  VFLAP+PTFY IYK+K+++G+Q++PYV+ L S+ L +YY
Sbjct  1    MALQHTLSLAFGLLGNIISLLVFLAPVPTFYTIYKKKTTEGFQALPYVIGLLSSMLYIYY  60

Query  788  AV----IKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLL-LLDILFFGAVI  624
            A+    IK +A L++ IN  G  IE ++IS++LFYA KK +I    LL LL+   +  ++
Sbjct  61   ALLKEEIKYDATLLITINSVGSVIETLYISLFLFYAPKKARISNATLLFLLNGFSYAVMV  120

Query  623  IVSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCAT  444
            +++ FL  G  RI +VGW C V +++VF APL ++RQV RT++ +FMP  LS  L   A 
Sbjct  121  VLTRFLATGEMRIKIVGWICLVFSISVFVAPLGVLRQVXRTKSVEFMPFPLSFFLTLGAV  180

Query  443  AWFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK--EEDGKGAEYKEGI  285
            AWFFYG   KD+YIA PNILGF  G+ Q+V+Y +YK++K+  E+  KG E  E I
Sbjct  181  AWFFYGFLIKDFYIALPNILGFFLGVVQMVVYIVYKNAKEVLEDQPKGQELSEHI  235



>ref|NP_001149087.1| MTN3 [Zea mays]
 gb|ACF85462.1| unknown [Zea mays]
 gb|ACG34136.1| MTN3 [Zea mays]
 gb|AFW56330.1| MTN3 [Zea mays]
Length=302

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/239 (51%), Positives = 169/239 (71%), Gaps = 4/239 (2%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA +S+QH  A  FGLLGN++SF  FLAPIPTFY+IYK KS++G+QS+PYVVALFSA L 
Sbjct  1    MAGMSLQHPWAFAFGLLGNVISFMTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLL-LLDILFFGAVII  621
            ++YA+IK+N   ++ IN  GC IE +++ MY  YA KK K+FT K++ LL+   FG +++
Sbjct  61   IFYALIKSNETFLITINAAGCVIETIYVVMYFVYAPKKAKLFTAKIMVLLNGGVFGVILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++L L  GSKR+ L+GW C   +V+VF APLSIMR+VI+T++ ++MP +LS+ L   A  
Sbjct  121  LTLLLFKGSKRVVLLGWICVGFSVSVFVAPLSIMRRVIQTKSVEYMPFSLSLSLTLSAVV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQVKND  264
            WF YGL  KD Y+A PNILGF FG+ Q+VLY +Y +  K      AE K+  ++    D
Sbjct  181  WFLYGLLIKDKYVALPNILGFTFGVVQMVLYVLYMN--KTPVAATAEGKDAGKLSSAAD  237



>ref|XP_010235464.1| PREDICTED: bidirectional sugar transporter SWEET15 [Brachypodium 
distachyon]
Length=309

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/246 (47%), Positives = 168/246 (68%), Gaps = 8/246 (3%)
 Frame = -2

Query  974  MALLSV-QHL-ALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAEL  801
            MA L++ QH  A  FG+LGNI+S  VFL+P+PTFY++Y++KS++G+QS PYVV LFS  L
Sbjct  1    MAFLNMEQHTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCLL  60

Query  800  LLYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVI  624
             +YYA +K+ A L++ ING GC IE ++I+MYL YA K  ++ T KL L LD+  FG + 
Sbjct  61   WMYYAFLKSGAELLLTINGVGCGIETLYIAMYLIYAPKSARLLTAKLFLGLDVGLFGLIA  120

Query  623  IVSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCAT  444
            +V++ +  G+ R+ +VGW C  + + VFAAPLSI+R VIRT++ +FMP++LS  LV  A 
Sbjct  121  LVTMLVSAGTLRVQIVGWICVAVALGVFAAPLSIIRLVIRTKSVEFMPISLSFFLVLSAV  180

Query  443  AWFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK-----EEDGKGAEYKEGIEI  279
             WF YGL  KD ++A PN+LGF+FG+AQ+ LY  Y++         ++ K  E+ + +  
Sbjct  181  IWFAYGLLKKDVFVAVPNVLGFVFGVAQMALYMAYRNKSPAITVVHQEMKLPEHVKEVTT  240

Query  278  QVKNDG  261
              K  G
Sbjct  241  NTKLGG  246



>ref|XP_007159040.1| hypothetical protein PHAVU_002G203600g [Phaseolus vulgaris]
 gb|ESW31034.1| hypothetical protein PHAVU_002G203600g [Phaseolus vulgaris]
Length=273

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/254 (48%), Positives = 171/254 (67%), Gaps = 14/254 (6%)
 Frame = -2

Query  974  MALLSVQ-HLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA+L+   HLAL FGLLGNI+SF V+LAP+PTFY+IYK+KS++G+QS+PY+VALFS+ L 
Sbjct  1    MAILNTHNHLALAFGLLGNIISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLW  60

Query  797  LYYAVIK-TNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKL-LLLDILFFGAVI  624
            LYYAV+K  +A L++ IN  G  IE V+I ++  YA    +  T+KL +++++  F  + 
Sbjct  61   LYYAVLKPADATLLITINSVGTVIETVYIVLFTVYATTDARKLTVKLFVVMNVGSFALIF  120

Query  623  IVSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCAT  444
            +V+ F ++G+ RI +VGW C  I+V VFAAPLSI+ QVIRT+N +FMP  LS+ L   A 
Sbjct  121  LVTFFTMHGALRIQVVGWVCVAISVGVFAAPLSIVTQVIRTKNVEFMPFNLSLFLTLSAI  180

Query  443  AWFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSK-----KEEDGKGA------EY  297
             WF YG F KD  IA PN+LGF  GL Q++LY MY++ K     +EE  K          
Sbjct  181  TWFSYGFFLKDICIAIPNVLGFTLGLVQMLLYAMYRNGKSKIVTEEEAMKNVVVVSPLGT  240

Query  296  KEGIEIQVKNDGRR  255
             EG  +Q+ ++ + 
Sbjct  241  CEGYPVQIMDEEKE  254



>emb|CDX84877.1| BnaA03g13530D [Brassica napus]
Length=272

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/212 (53%), Positives = 156/212 (74%), Gaps = 1/212 (0%)
 Frame = -2

Query  965  LSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYA  786
            +S+  L  +FG+LGNI+SF V LAPIPTF +IYKRKSS+GYQSIPYV+ALFSA L +YYA
Sbjct  3    VSIVVLRTVFGILGNIISFLVCLAPIPTFIRIYKRKSSEGYQSIPYVIALFSAMLWIYYA  62

Query  785  VIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVIIVSLF  609
            +IKTN  +++ IN     I++ +IS YLFYA KK+K  T+K +L +D+  FG +  ++ F
Sbjct  63   MIKTNVVIMITINAVSLVIQIFYISFYLFYAPKKEKTLTVKFVLFVDVFAFGFIFFLTYF  122

Query  608  LVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFY  429
            L++G KR+ ++G+ C V ++ VF APL I+R+VI+TR+ +FMP  LS  L   A  WFFY
Sbjct  123  LLHGQKRVQILGYICMVFSLCVFVAPLGIIRKVIKTRSAEFMPFGLSFFLTLSAVMWFFY  182

Query  428  GLFSKDYYIAFPNILGFLFGLAQIVLYCMYKD  333
            GL  KD  IA PN+LGF+FG+ Q++LY +YK 
Sbjct  183  GLLLKDMNIALPNVLGFIFGVLQMILYMIYKK  214



>gb|EMT20808.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=290

 Score =   232 bits (591),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 162/233 (70%), Gaps = 6/233 (3%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            M  LS++H  A  FGLLGN++SF   LAPIPTFY+I+K KS++G+QS+PYVVALFSA L 
Sbjct  1    MGGLSMEHPWAFAFGLLGNVISFSSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKL-LLLDILFFGAVII  621
            ++YA++KT   L++ IN  GC IE V+I MYL YA++K KIFT K+ +LL+I  FG + +
Sbjct  61   IFYALVKTGEGLLISINAAGCVIETVYIVMYLVYADRKAKIFTAKIVVLLNIAGFGLIFL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++LF  +G  R+  +GW C   +V VF APLSI+ +VI+T++ ++MP TLS+ L   A  
Sbjct  121  LTLFAFHGETRVVTLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFTLSLTLTLSAIV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIE  282
            WF YGL  KD Y+A PNILGF FG+ Q+VLY  Y +         ++ KEG E
Sbjct  181  WFLYGLLIKDKYVALPNILGFTFGVIQMVLYVFYMNKTP----VASQVKEGKE  229



>ref|XP_010556111.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Tarenaya 
hassleriana]
Length=307

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/225 (50%), Positives = 165/225 (73%), Gaps = 3/225 (1%)
 Frame = -2

Query  974  MALLSVQHL-ALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA++  QHL A+ FG+LGN +SF VFLAP+PTFY+IYK+KS++ ++S+PY V+LFS  L 
Sbjct  1    MAVMINQHLLAVTFGILGNAISFLVFLAPVPTFYRIYKKKSTESFRSLPYQVSLFSCMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVII  621
            LYYA++K NA+L++ IN FGC +E  +I+M++ YA K  +I  +KL + +++ FF  ++I
Sbjct  61   LYYALLKQNAFLLITINSFGCVVETFYIAMFIAYAAKDKRISAMKLFMAMNVTFFSLILI  120

Query  620  VSLFLV-NGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCAT  444
            V+ FLV N S +I ++GW C  I+V+VFAAPLS++ +VIRT++ +FMP TLS  L   A 
Sbjct  121  VTHFLVKNSSHQIVILGWICVAISVSVFAAPLSVVARVIRTKSVEFMPFTLSFFLTISAV  180

Query  443  AWFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGK  309
             WF YGLF  D  IA PN+LGF  G+ Q++LY +Y++S+K    K
Sbjct  181  MWFAYGLFLHDICIAIPNVLGFALGMVQMILYGIYRNSEKSNLEK  225



>gb|EMS51422.1| Bidirectional sugar transporter SWEET13 [Triticum urartu]
Length=290

 Score =   232 bits (591),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 161/233 (69%), Gaps = 6/233 (3%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            M  LS++H  A  FGLLGN++SF   LAPIPTFY+I+K KS++G+QS+PYVVALFSA L 
Sbjct  1    MGGLSMEHPWAFAFGLLGNVISFSSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKL-LLLDILFFGAVII  621
            ++YA++KT   L++ IN  GC IE V+I MYL YA +K KIFT K+ +LL+I  FG + +
Sbjct  61   IFYALVKTGEGLLISINAAGCVIETVYIVMYLVYAPRKAKIFTAKIVVLLNITGFGLIFL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++LF  +G  R+  +GW C   +V VF APLSI+ +VI+T++ ++MP TLS+ L   A  
Sbjct  121  LTLFAFHGETRVVSLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFTLSLTLTLSAIV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIE  282
            WF YGL  KD Y+A PNILGF FG+ Q+VLY  Y +         +E KEG E
Sbjct  181  WFLYGLLIKDKYVALPNILGFTFGVIQMVLYVFYMNKTP----VASEVKEGKE  229



>ref|XP_010093935.1| Bidirectional sugar transporter SWEET12 [Morus notabilis]
 gb|EXB54898.1| Bidirectional sugar transporter SWEET12 [Morus notabilis]
Length=304

 Score =   232 bits (592),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/238 (49%), Positives = 166/238 (70%), Gaps = 9/238 (4%)
 Frame = -2

Query  974  MALLSVQHLAL-LFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA  +  +L + +FGLLGN+ S  VFLAP+PTFY++YK+KS++G+QS+PYVVALFSA + 
Sbjct  1    MAAFATDNLGVFIFGLLGNVTSLIVFLAPVPTFYRVYKKKSTEGFQSVPYVVALFSAMMW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDILFFGA---V  627
            LYYA +K++  L++ IN  GC IE ++I++Y+ YA K+ +IFT++L+LL  L FG    +
Sbjct  61   LYYATLKSDLILLITINSVGCVIETIYIALYIAYATKQARIFTLRLILL--LNFGGFCLI  118

Query  626  IIVSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCA  447
            +++S FL  GS R  ++GW C    V+VFAAPLSI+R VIRT++ +FMPL LS  L   A
Sbjct  119  LLLSHFLAKGSLRATVLGWVCTSFAVSVFAAPLSIIRVVIRTKSVEFMPLPLSFFLTLSA  178

Query  446  TAWFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK---EEDGKGAEYKEGIE  282
            T W  YGL  KD  +A PN++G +FG+ Q+VLY +Y+ +K    EE     + K  IE
Sbjct  179  TMWLMYGLMLKDLCVAIPNVMGLIFGVLQMVLYVIYRKNKTVLVEEQKVQEQIKADIE  236



>gb|KFK26707.1| hypothetical protein AALP_AA8G282900 [Arabis alpina]
Length=281

 Score =   231 bits (590),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 115/226 (51%), Positives = 162/226 (72%), Gaps = 6/226 (3%)
 Frame = -2

Query  950  LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKTN  771
            L  +FGLLG+I+SFFV LAPIPTF +IYKRKSS+GYQSIPYV+ALFSA L +YYA+++ +
Sbjct  8    LVTVFGLLGDIISFFVCLAPIPTFVRIYKRKSSEGYQSIPYVIALFSAMLWIYYALVRKH  67

Query  770  AYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVIIVSLFLVNGS  594
            A L++ IN F C I++ +IS YLFYA KK+K  T+K +L +D+  FG + +++ FL +G 
Sbjct  68   AVLLITINTFCCVIQIFYISFYLFYAPKKEKTLTVKFVLFVDVFAFGLIFLLTYFLTHGI  127

Query  593  KRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFSK  414
            KR+ ++G+ C V  + VF APL I+R+VI+T++ +FMP  LS  L   A  WFFYGL  K
Sbjct  128  KRVQVLGYICMVFALCVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMWFFYGLLLK  187

Query  413  DYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQ  276
            D  +A PN+LGF+FG+ Q++LY +YK     + G       GI++Q
Sbjct  188  DMNVALPNVLGFIFGVLQMILYMIYK-----KPGTKVLEPSGIKLQ  228



>gb|EMT03611.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=294

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 161/233 (69%), Gaps = 6/233 (3%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            M  LS++H  A  FGLLGN++SF   LAPIPTFY+I+K KS++G+QS+PYVVALFSA L 
Sbjct  1    MGGLSMEHPWAFAFGLLGNVISFSSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKL-LLLDILFFGAVII  621
            ++YA++KT   L++ IN  GC IE V+I MYL YA +K KIFT K+ +LL+I  FG + +
Sbjct  61   IFYALVKTGEGLLISINAAGCVIETVYIVMYLVYAPRKAKIFTAKIVVLLNIAGFGLIFL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++LF  +G  R+  +GW C   +V VF APLSI+ +VI+T++ ++MP TLS+ L   A  
Sbjct  121  LTLFAFHGETRVVTLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFTLSLTLTLSAIV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIE  282
            WF YGL  KD Y+A PNILGF FG+ Q+VLY  Y +         ++ KEG E
Sbjct  181  WFLYGLLIKDKYVALPNILGFTFGVIQMVLYVFYMNKTP----MASQVKEGKE  229



>ref|XP_002443163.1| hypothetical protein SORBIDRAFT_08g013620 [Sorghum bicolor]
 gb|EES17001.1| hypothetical protein SORBIDRAFT_08g013620 [Sorghum bicolor]
Length=304

 Score =   232 bits (591),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 122/231 (53%), Positives = 166/231 (72%), Gaps = 4/231 (2%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA LS+QH  A  FGLLGN++SF  FLAPIPTFY+IYK KS++G+QS+PYVVALFSA L 
Sbjct  1    MAGLSLQHPWAFAFGLLGNVISFMTFLAPIPTFYRIYKTKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVII  621
            ++YA+IK+N   ++ IN  GC IE ++I MY  YA KK K+FT K +LLL++  FG +++
Sbjct  61   IFYALIKSNETFLITINAAGCVIETIYIIMYFVYAPKKGKMFTAKIMLLLNVGIFGVILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++L L  G KR+ ++GW C   +V+VF APLSIM++VI+T++ ++MP +LS+ L   A  
Sbjct  121  LTLLLFKGDKRVVMLGWICVGFSVSVFVAPLSIMKRVIQTKSVEYMPFSLSLSLTLSAVV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMY--KDSKKEEDGKGAEYK  294
            WF YGL  KD Y+A PNILGF FG+ Q+VLY +Y  K      +GK A  K
Sbjct  181  WFLYGLLIKDKYVALPNILGFTFGVVQMVLYVLYMNKTPVAVAEGKDAGGK  231



>gb|AHL43546.1| nodule-specific sucrose transporter [Medicago truncatula]
Length=270

 Score =   231 bits (588),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/223 (50%), Positives = 162/223 (73%), Gaps = 1/223 (0%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MAL   ++ A +FG++GN++S   FLAP+PTFY+IYK+KS++G+QS+PYV ALFSA L +
Sbjct  1    MALFYSEYWAFVFGVIGNVISCMTFLAPLPTFYRIYKKKSTEGFQSVPYVTALFSAMLWI  60

Query  794  YYAVIKTNAYLIV-CINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDILFFGAVIIV  618
            YYA +K  A L++  IN +G  IE ++I ++L YA+ K ++ TIKLL L +  +G ++I+
Sbjct  61   YYAHVKNKATLLLLTINIYGFGIEAIYIIIFLLYASNKARLSTIKLLFLTVCGYGTMVIL  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            + +L  GSKR++++GW C V N+ VFA+PL I++QVI+T++  FMPL LS  L   A  W
Sbjct  121  TTYLTKGSKRLSIIGWICMVFNICVFASPLFILKQVIKTKSVAFMPLNLSFFLTLNAIVW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGK  309
            FFYGL   D+YIA PN LGF+FG+ Q+V+Y +YKD+   E  K
Sbjct  181  FFYGLLIDDFYIAIPNTLGFVFGIVQMVIYLIYKDAIPLESTK  223



>ref|XP_009132693.1| PREDICTED: bidirectional sugar transporter SWEET10 [Brassica 
rapa]
Length=289

 Score =   231 bits (590),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 156/211 (74%), Gaps = 1/211 (0%)
 Frame = -2

Query  965  LSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYA  786
            +S+  L  +FG+LGNI+SF V LAPIPTF +IYKRKSS+GYQSIPYV+ALFSA L +YYA
Sbjct  3    VSIVVLRTVFGILGNIISFLVCLAPIPTFIRIYKRKSSEGYQSIPYVIALFSAMLWIYYA  62

Query  785  VIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVIIVSLF  609
            +IKTN  +++ IN     I++ +IS YLFYA KK+K  T+K +L +D+  FG +  ++ F
Sbjct  63   MIKTNVVIMITINAVSLVIQIFYISFYLFYAPKKEKTLTVKFVLFVDVFAFGFIFFLTYF  122

Query  608  LVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFY  429
            L++G KR+ ++G+ C V ++ VF APL I+R+VI+TR+ +FMP  LS  L   A  WFFY
Sbjct  123  LLHGQKRVQILGYICMVFSLCVFVAPLGIIRKVIKTRSAEFMPFGLSFFLTLSAVMWFFY  182

Query  428  GLFSKDYYIAFPNILGFLFGLAQIVLYCMYK  336
            GL  KD  IA PN+LGF+FG+ Q++LY +YK
Sbjct  183  GLLLKDMNIALPNVLGFIFGVLQMILYMIYK  213



>ref|XP_011083538.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Sesamum 
indicum]
Length=278

 Score =   231 bits (589),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 154/212 (73%), Gaps = 1/212 (0%)
 Frame = -2

Query  959  VQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVI  780
            +  LA +FGLLGN+VSF VFLAPIPTFY+IYK+KS++G+QS+PYVV LFSA L +YYA +
Sbjct  1    MNQLAFVFGLLGNVVSFMVFLAPIPTFYQIYKKKSTEGFQSVPYVVGLFSAMLWIYYAFL  60

Query  779  KTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVIIVSLFLV  603
            K +  L++ IN  GC I+  +I  YLF+A +  ++ T+K LLLL+ + FG +++++ FL 
Sbjct  61   KPDTTLLITINSVGCFIQSAYICFYLFFAPRNARVQTVKLLLLLNTVGFGLIMVLTYFLA  120

Query  602  NGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGL  423
             GS R   VGW C V ++ VF APL ++RQV+RT++ ++MP  LS  L   A  WFFYG 
Sbjct  121  KGSNRANFVGWICLVFSLCVFVAPLCVVRQVLRTKSAEYMPFLLSFFLTISAIVWFFYGF  180

Query  422  FSKDYYIAFPNILGFLFGLAQIVLYCMYKDSK  327
              KDY IA PN+LGF+FG+ Q+VLY +Y++ K
Sbjct  181  LRKDYNIAIPNVLGFIFGVLQMVLYLIYRNGK  212



>ref|XP_004145146.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
 ref|XP_004153502.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=291

 Score =   231 bits (589),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 110/216 (51%), Positives = 160/216 (74%), Gaps = 2/216 (1%)
 Frame = -2

Query  974  MALLSVQHLALL-FGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MAL    H  +  FGLLGNI+SF VFLAP+PTF +IYK+KS++G+QS+PYVVALFSA L 
Sbjct  1    MALFDTHHPGVFAFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVII  621
            LYYA   +N  L++ IN  GC IE ++I++++ +A K+ ++ T++ +LLL+   F  +++
Sbjct  61   LYYASFNSNETLLITINSVGCLIETLYIAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            V+ FLV+GS ++ +VGW C   +V+VFAAPL+IMR VIRT++ +FMP +LS  L   A  
Sbjct  121  VTHFLVHGSNQVKVVGWICVAFSVSVFAAPLTIMRLVIRTKSVEFMPFSLSFFLTLSAIT  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKD  333
            W  YG+F KD Y+A PN+LGF+FG+AQ++LY +Y+ 
Sbjct  181  WLLYGVFLKDIYVALPNVLGFIFGVAQMILYLIYRK  216



>ref|XP_011071246.1| PREDICTED: bidirectional sugar transporter N3 [Sesamum indicum]
Length=297

 Score =   231 bits (590),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 115/229 (50%), Positives = 163/229 (71%), Gaps = 3/229 (1%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA+  + H  A  FG+LGNI+S FV+LAP+PTF++IYK +S+ G+ S+PYVVALFSA L 
Sbjct  1    MAVFDIHHPWAFTFGVLGNIISVFVYLAPLPTFFRIYKERSTMGFDSLPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLL-LLDILFFGAVII  621
            +YYA +KTNA L++ IN FGC IE ++I +YLFYA+KK +  T KLL L+++     + +
Sbjct  61   MYYAFLKTNAILLISINLFGCVIEAIYIFIYLFYASKKARTHTAKLLSLINVGLLALIFL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++ F+  G  R+ +VGW C  ++V+VFAAPL+I+ QV+RTR+ +FMP  LS  L   A  
Sbjct  121  LTFFIFKGPIRVHVVGWICVAVSVSVFAAPLTIVFQVVRTRSVEFMPFPLSFFLTLSAVM  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKE-EDGKGAEY  297
            WF YGLF KD  +A PN+LGF  GL Q++LY ++++ K E ED K  E+
Sbjct  181  WFAYGLFQKDLCVALPNVLGFFLGLLQMLLYGIFRNVKPENEDKKLPEH  229



>ref|XP_008374287.1| PREDICTED: bidirectional sugar transporter N3-like [Malus domestica]
Length=298

 Score =   231 bits (589),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/234 (47%), Positives = 161/234 (69%), Gaps = 1/234 (0%)
 Frame = -2

Query  971  ALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLY  792
            A  S   LA  FG+LGNI SF VFLAP+PTF+++YK+KS++G+QS+PYV ALF+A + +Y
Sbjct  3    ASTSHHPLAFAFGVLGNIASFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALFTATIWIY  62

Query  791  YAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLL-LLDILFFGAVIIVS  615
            YA +K+N  L++ IN FGC IE ++I++YL YA K+ ++ T+ LL L++   F  +++++
Sbjct  63   YAFLKSNEILLITINSFGCVIETIYIAIYLTYATKQARVSTLTLLFLVNFGGFCLILLLA  122

Query  614  LFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWF  435
             FL  G  R+A++GW C   +V+VFAAPLS M+ VIRT++ +FMP  LS  L   A  W 
Sbjct  123  HFLSQGPTRVAVLGWVCVTFSVSVFAAPLSAMKMVIRTKSVEFMPFNLSFFLTLSAVMWL  182

Query  434  FYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQV  273
             YGL  KD Y+A PNI+GF FGL Q+ LY  Y+++K   + K  E K  +  Q+
Sbjct  183  SYGLLLKDLYVATPNIVGFSFGLVQMALYAKYRNNKTNVEEKLPEQKADVVKQM  236



>ref|XP_010926783.1| PREDICTED: bidirectional sugar transporter SWEET14-like isoform 
X2 [Elaeis guineensis]
Length=277

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/258 (46%), Positives = 177/258 (69%), Gaps = 14/258 (5%)
 Frame = -2

Query  953  HLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKT  774
            H A + G++GN+ SF V+LAP+PTFY++Y+++++ G+QS+PY VALFSA L ++YA +KT
Sbjct  4    HWAFIVGIIGNVSSFLVYLAPVPTFYQVYRKRTTGGFQSVPYSVALFSAMLWIFYAFVKT  63

Query  773  NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKL-LLLDILFFGAVIIVSLFLVNG  597
            N+ L++ IN  GCAIE+++I MYL YA +  +IFT K+ LLL++  F  +++ +L L  G
Sbjct  64   NSILLITINSTGCAIEMIYIIMYLVYAPRSARIFTAKIILLLNVGLFSLILLSTLLLSKG  123

Query  596  SKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFS  417
            SKR+ ++GW C   + +VFAAPLSI+RQV+RTR+ ++MP TLS+ L   A AWF YGL +
Sbjct  124  SKRVKVLGWICMCFSASVFAAPLSIIRQVVRTRSVEYMPFTLSLFLTISAVAWFGYGLLT  183

Query  416  KDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGA--EY-------KEGIEIQVK--  270
             D+Y+ FPN+LGF FG  Q++LY +YK   K+   + A  E+       K G+E+QV   
Sbjct  184  NDFYVMFPNVLGFAFGAVQMLLYVVYKYMVKKVVVEPAVLEHIVAIDVQKAGVELQVPAE  243

Query  269  --NDGRR*I*QRIEVTGR  222
              +D +  +    E  GR
Sbjct  244  AISDSKEAVKANEETNGR  261



>ref|XP_009802195.1| PREDICTED: bidirectional sugar transporter SWEET9-like isoform 
X2 [Nicotiana sylvestris]
Length=297

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/208 (55%), Positives = 152/208 (73%), Gaps = 3/208 (1%)
 Frame = -2

Query  938  FGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKTNAYLI  759
            F   GNIVSFFVFL+P+PTFYKIYK+KS++ YQSIPYVVALFSA   +YYA +K+N  L+
Sbjct  11   FPFAGNIVSFFVFLSPLPTFYKIYKKKSTEDYQSIPYVVALFSAMFWIYYAFLKSNTTLL  70

Query  758  VCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDIL-FFGAVIIVSLFLVNGSKRIA  582
            + IN FGC IE +++  YLFYA KK ++ T+KLLLL +   FGA+++V+  L  G  R+ 
Sbjct  71   ITINSFGCFIETIYVGFYLFYAPKKARVQTVKLLLLSVFGGFGAIVLVTQLLFKGVVRVQ  130

Query  581  LVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFSKDYYI  402
            +VGW C V ++ VF +PL IMRQVI+T++ ++MP  +SV L   A  WFFYGL  KD+ I
Sbjct  131  VVGWICLVFSLCVFVSPLCIMRQVIKTKSVEYMPFFISVFLTLSAVTWFFYGLLLKDFNI  190

Query  401  AFPNILGFLFGLAQIVLYCMYKDSKKEE  318
            A PN+LGF+ G+ Q+V Y +Y   KKEE
Sbjct  191  AIPNVLGFIVGILQMVFYVIY--YKKEE  216



>ref|XP_009421186.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=288

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 159/219 (73%), Gaps = 2/219 (1%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA LS+ H  A   G+LGNI+S  VFLAP+PTFY++Y RKS++G+QS+PYVVALFS  L 
Sbjct  1    MAGLSLDHPWAFTIGILGNIISLMVFLAPLPTFYRVYTRKSTEGFQSVPYVVALFSCMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKL-LLLDILFFGAVII  621
              YA +KT+AYL++ IN  GCAIE V+I +YL YA K  KIFT KL L++++  FG +++
Sbjct  61   FCYAFLKTDAYLLITINSIGCAIETVYIVIYLTYAPKVAKIFTAKLVLVVNVGMFGLILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++L L  GSKR+   GW C   +V+VF APLS++R V+RT++ +FMP++LS  L   A  
Sbjct  121  LTLLLAEGSKRVGAFGWICVSFSVSVFVAPLSVIRLVMRTKSVEFMPVSLSFFLTLSAIV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK  324
            WF YGL +KD Y+  PN++GF+FG+ Q+VLY  Y+D  +
Sbjct  181  WFAYGLLTKDIYVGLPNVVGFIFGILQMVLYVAYRDKNR  219



>ref|XP_002264875.1| PREDICTED: bidirectional sugar transporter N3 [Vitis vinifera]
 emb|CBI38167.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 160/220 (73%), Gaps = 1/220 (0%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MA+ +   L L+FG+LGNI+SF V+ AP PTFY+IYKRKS++G+ S+PY+VALFSA L L
Sbjct  3    MAMANHHTLGLIFGILGNIISFLVYFAPAPTFYRIYKRKSAEGFHSLPYIVALFSAMLWL  62

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVIIV  618
            YYA++K +A+L++ IN FGCAIE  +I +Y FYA  + K  T+K+++ L++  F  ++++
Sbjct  63   YYALLKKDAFLLITINSFGCAIESFYILLYFFYAPMQAKKQTLKVVISLNVGVFSILVVL  122

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
              FL+ GS RI + GW CA  +VAVFAAPLSI+ +VIRT++ +FMP +LS  L   A  W
Sbjct  123  IQFLLKGSNRINVFGWICASFSVAVFAAPLSIVAKVIRTKSVEFMPFSLSFFLTLSAIMW  182

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEE  318
            F YGL   D  +A PNILG + GL Q+VLY  Y+++ KE+
Sbjct  183  FAYGLLKNDPCVAIPNILGVILGLVQMVLYGFYRNAGKEK  222



>ref|XP_002321730.2| N3 like family protein [Populus trichocarpa]
 gb|EEF05857.2| N3 like family protein [Populus trichocarpa]
Length=269

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/208 (55%), Positives = 151/208 (73%), Gaps = 1/208 (0%)
 Frame = -2

Query  938  FGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKTNAYLI  759
            FGLLGNI+S  V LAP+PTFY+I K+K+S G+QSIPYV+ALFSA L L+YA    NA L+
Sbjct  11   FGLLGNIISCLVCLAPLPTFYQICKKKTSQGFQSIPYVIALFSAMLWLFYASFSENAMLL  70

Query  758  VCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIVSLFLVNGSKRIA  582
            + IN F   +E+ +I++YLFYA KKDKI T KLLLL +I  FG +  +SL L  G+KR+ 
Sbjct  71   ITINSFAFFMEIGYIAVYLFYATKKDKILTFKLLLLFNIFGFGLICALSLLLTEGTKRVH  130

Query  581  LVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFSKDYYI  402
            ++GW C V  + VF APL ++R+VIRT++ +FMP  LS  L   A  WFFYG   KD ++
Sbjct  131  VLGWICMVFALCVFVAPLGVVRKVIRTKSVEFMPFALSFFLTLSAVMWFFYGYLKKDKFV  190

Query  401  AFPNILGFLFGLAQIVLYCMYKDSKKEE  318
            A PNILGF+FG+ Q+VLY +Y++ KK E
Sbjct  191  AIPNILGFIFGILQMVLYLIYRNPKKNE  218



>gb|KHN24976.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=272

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 161/220 (73%), Gaps = 3/220 (1%)
 Frame = -2

Query  965  LSVQH--LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLY  792
            +++ H  LA  FG+LGN++SF VFLAP+PTFY+IYK+KS++ +QS+PY+VALFS+ L LY
Sbjct  1    MAITHHTLAFTFGMLGNVISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLY  60

Query  791  YAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLL-LLDILFFGAVIIVS  615
            YA++K +A L++ IN FGC IE+++I +Y+ YA +  +  TIKL   +++  F  +++V+
Sbjct  61   YALLKRDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIKLFSAMNMTSFAVILLVT  120

Query  614  LFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWF  435
             F V+G  R+ ++GW C  I+V+VFAAPLSI+ QV+RT++ +FMP  LS  L   A  WF
Sbjct  121  HFGVHGPLRVQVLGWICVSISVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWF  180

Query  434  FYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEED  315
             YGLF KD  IA PN+LGF+ GL Q++LY +Y+   K+ +
Sbjct  181  GYGLFLKDICIALPNVLGFVLGLLQMLLYTIYRKGNKKTN  220



>ref|XP_003530901.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
Length=272

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 157/215 (73%), Gaps = 1/215 (0%)
 Frame = -2

Query  956  QHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIK  777
              LA  FG+LGN++SF VFLAP+PTFY+IYK+KS++ +QS+PY+VALFS+ L LYYA++K
Sbjct  6    HTLAFTFGMLGNVISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLYYALLK  65

Query  776  TNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLL-LLDILFFGAVIIVSLFLVN  600
             +A L++ IN FGC IE+++I +Y+ YA +  +  TIKL   +++  F  +++V+ F V+
Sbjct  66   RDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIKLFSAMNMTSFAVILLVTHFGVH  125

Query  599  GSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLF  420
            G  R+ ++GW C  I+V+VFAAPLSI+ QV+RT++ +FMP  LS  L   A  WF YGLF
Sbjct  126  GPLRVQVLGWICVSISVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYGLF  185

Query  419  SKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEED  315
             KD  IA PN+LGF+ GL Q++LY +Y+   K+ +
Sbjct  186  LKDICIALPNVLGFVLGLLQMLLYTIYRKGNKKTN  220



>ref|XP_006402062.1| hypothetical protein EUTSA_v10014273mg [Eutrema salsugineum]
 gb|ESQ43515.1| hypothetical protein EUTSA_v10014273mg [Eutrema salsugineum]
Length=289

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 165/230 (72%), Gaps = 6/230 (3%)
 Frame = -2

Query  950  LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKTN  771
            LA +FG+LGNI+SF V LAPIPTF +IYKRKSS+GYQSIPYV+ LFSA L +YYA+IK N
Sbjct  8    LATVFGILGNIISFLVCLAPIPTFIRIYKRKSSEGYQSIPYVIGLFSAMLWIYYAMIKKN  67

Query  770  AYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVIIVSLFLVNGS  594
              +++ IN     I++ +I++YLFYA KK+K  T+KL+L +++  FG + +++ FL++G+
Sbjct  68   VMILITINAVSFVIQIFYIAVYLFYAPKKEKTLTVKLVLFVNVFAFGLIFVLTYFLLHGN  127

Query  593  KRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFSK  414
            KR+ ++G+ C V  + VF APL I+R+VI+T++ +FMP  LS  L   A  WFFYGL +K
Sbjct  128  KRVTVLGYVCMVFALCVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMWFFYGLLNK  187

Query  413  DYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQVKND  264
            D  +A PN+LGF+FG+ Q+VLY +YK     + G       GI++Q  +D
Sbjct  188  DMNVALPNVLGFVFGVLQMVLYLIYK-----KPGTKVLEPPGIKLQDISD  232



>ref|XP_006436900.1| hypothetical protein CICLE_v10033645mg [Citrus clementina]
 ref|XP_006493251.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Citrus 
sinensis]
 gb|ESR50140.1| hypothetical protein CICLE_v10033645mg [Citrus clementina]
Length=271

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/236 (49%), Positives = 170/236 (72%), Gaps = 4/236 (2%)
 Frame = -2

Query  965  LSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYY  789
            +++ H  A  FGLLGNI SF V LAP+PTFYKIYK+KS++G+QS+PYV++LFSA + +YY
Sbjct  1    MAIHHSWATAFGLLGNITSFLVCLAPMPTFYKIYKKKSTEGFQSVPYVISLFSAMIWIYY  60

Query  788  AVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVIIVSL  612
            A++K NA  ++ IN F C ++ ++I++Y+FYA KK +I T+K LLLL+I  FGA+ +++ 
Sbjct  61   ALLKQNAIFLMTINTFCCVMQTIYIAVYVFYAPKKVRIQTVKLLLLLNIFGFGAICLLTF  120

Query  611  FLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFF  432
            FL  G+ R  ++G+ C    ++VFAAPL I+R+VI+T++ ++MP TLS  L   A AWFF
Sbjct  121  FLSKGAIREKILGYICMTFALSVFAAPLFIVRKVIKTKSVEYMPFTLSFFLTIGAVAWFF  180

Query  431  YGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKE--EDGKGAEYKEGIEIQVK  270
            YGL  KD  +A PN+LGF+FG+ Q++LY +YK+  K+  E  K  E  E +   VK
Sbjct  181  YGLLIKDLNVAIPNVLGFIFGVLQMILYVIYKNPNKKIVEQTKLQELSEHVVDVVK  236



>ref|XP_003551863.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
Length=271

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 159/217 (73%), Gaps = 1/217 (0%)
 Frame = -2

Query  968  LLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYY  789
            ++S   LA  FG+LGN++SF VFLAP+PTFY+IYK+KS++ +QS+PY+VALFS+ L LYY
Sbjct  2    VISHHTLAFTFGMLGNLISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLYY  61

Query  788  AVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLL-LLDILFFGAVIIVSL  612
            A++K +A L++ IN FGC IE+++I +Y+ YA +  +  TIKL   +++  F  +++V+ 
Sbjct  62   AMLKRDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIKLFSAMNMSSFALILLVTH  121

Query  611  FLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFF  432
            F V+G  R+ ++GW C  I+V+VFAAPLSI+ QV+RT++ +FMP  LS  L   A  WF 
Sbjct  122  FAVHGPLRVQVLGWICVSISVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFG  181

Query  431  YGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKE  321
            YGLF KD  IA PN+LGF+ GL Q++LY +Y+   K+
Sbjct  182  YGLFLKDICIALPNVLGFVLGLLQMLLYTIYRKGNKK  218



>ref|NP_001239695.1| uncharacterized protein LOC100777741 [Glycine max]
 gb|ACU24541.1| unknown [Glycine max]
 gb|KHN03191.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=268

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/261 (44%), Positives = 172/261 (66%), Gaps = 27/261 (10%)
 Frame = -2

Query  965  LSVQH--LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLY  792
            +++ H  LA  FG+LGN++SF VFLAPI TFY+I+K+KS++G+QS+PY+VALFS+ L LY
Sbjct  1    MAISHSTLAFAFGMLGNVISFLVFLAPITTFYRIFKKKSTEGFQSLPYLVALFSSMLWLY  60

Query  791  YAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVIIVS  615
            YA++K +A L++ IN FGC IE+++I +Y+ YA +  +  T+KL   +++  F  +++V+
Sbjct  61   YALLKKDAMLLLTINSFGCVIEVIYIILYITYATRDARNLTLKLFFAMNVGAFALILLVT  120

Query  614  LFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWF  435
             F V+GS R+ ++GW C  ++++VFAAPLSI+ QV+RT++ +FMP  LS  L   A  WF
Sbjct  121  HFAVHGSLRVQVLGWICVSLSISVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWF  180

Query  434  FYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK-----------------------  324
             YGLF KD  IA PN+LGF  GL Q++LY +Y++  K                       
Sbjct  181  GYGLFLKDICIALPNVLGFALGLLQMLLYAIYRNGNKKVDKIMEKKAPLEPLKTVVIETG  240

Query  323  -EEDGKGAEYKEGIEIQVKND  264
             EE  +G + KE  E + K+D
Sbjct  241  LEEKQQGKKSKENSEEKEKSD  261



>ref|XP_008386620.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Malus 
domestica]
Length=300

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/252 (47%), Positives = 168/252 (67%), Gaps = 14/252 (6%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MA      LA +FG+LGNIVSF V LAP+PTFY+I+K+KS++G+QSIPY VALFSA L+L
Sbjct  1    MAAPDAPLLASVFGILGNIVSFMVLLAPLPTFYRIFKKKSTEGFQSIPYAVALFSAMLML  60

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLL-LLDILFFGAVIIV  618
            YYA +K +A++++ IN   C IE  ++ +Y+ YA  K +I+T KLL L ++  +G ++  
Sbjct  61   YYAFLKGHAFMLITINSIACVIETSYLVIYMIYAPAKIRIYTAKLLTLFNVGAYGVILFA  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            +  + +   RI +VGWT  V +V VFAAPLSIMR VI+TR+ ++M   LS CL  CA  W
Sbjct  121  TSLITDPYLRIKIVGWTNVVFSVCVFAAPLSIMRLVIKTRSVEYMSFPLSFCLTLCAVMW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK------------EEDGKGAEYK  294
            FFYGL  +D ++A PNILGF FG+AQ+++Y ++K SKK             E+G  AE  
Sbjct  181  FFYGLLLRDLFVAAPNILGFGFGIAQMIMYLVFKKSKKAVLPQYILKEIPNENGV-AEND  239

Query  293  EGIEIQVKNDGR  258
              ++ +  ND +
Sbjct  240  NQLKEEDTNDSK  251



>ref|XP_003576225.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Brachypodium 
distachyon]
Length=292

 Score =   229 bits (585),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/229 (51%), Positives = 160/229 (70%), Gaps = 2/229 (1%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA LS++H  A  FGLLGN++SF  +LAPIPTF +IYK KS++G+QS+PYVVALFSA L 
Sbjct  1    MAGLSLEHPWAFAFGLLGNVISFMSYLAPIPTFIRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVII  621
            +YYA++K+N  L++ IN  GC IE +++ MY  YA +K K+FT K +LLL+   FG ++ 
Sbjct  61   IYYALVKSNESLLITINAAGCVIETIYVVMYFVYAPRKAKLFTAKIMLLLNGGVFGVILF  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
             +LFL +G KR+  +GW C   +V+VF APLSI+ +VI+TR+ ++MP +LS+ L   A  
Sbjct  121  CTLFLAHGEKRVVSLGWICVAFSVSVFVAPLSIIGRVIKTRSVEYMPFSLSLSLTLSAVV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYK  294
            WF YGL  KD Y+A PNILGF FG+ Q+ LY  Y +      G G E K
Sbjct  181  WFLYGLLIKDKYVALPNILGFSFGVVQMALYMFYMNKTPIVRGDGKEGK  229



>gb|KHN03192.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=271

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 159/217 (73%), Gaps = 1/217 (0%)
 Frame = -2

Query  968  LLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYY  789
            ++S   LA  FG+LGN++SF VFLAP+PTFY+IYK+KS++ +QS+PY+VALFS+ L LYY
Sbjct  2    VISHHTLAFTFGMLGNLISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLYY  61

Query  788  AVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLL-LLDILFFGAVIIVSL  612
            A++K +A L++ IN FGC IE+++I +Y+ YA +  +  TIKL   +++  F  +++V+ 
Sbjct  62   AMLKRDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIKLFSAMNMSSFALILLVTH  121

Query  611  FLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFF  432
            F V+G  R+ ++GW C  I+V+VFAAPLSI+ QV+RT++ +FMP  LS  L   A  WF 
Sbjct  122  FAVHGPLRVQVLGWICVSISVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFG  181

Query  431  YGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKE  321
            YGLF KD  IA PN+LGF+ GL Q++LY +Y+   K+
Sbjct  182  YGLFLKDICIALPNVLGFVLGLLQMLLYTIYRKGNKK  218



>ref|XP_003602780.1| Protein RUPTURED POLLEN GRAIN [Medicago truncatula]
Length=270

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/223 (49%), Positives = 161/223 (72%), Gaps = 1/223 (0%)
 Frame = -2

Query  974  MALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            MAL   ++ A +FG++GN++S   FLAP+PTFY+IYK+KS++G+QS+PYV AL SA L +
Sbjct  1    MALFYSEYWAFVFGVIGNVISCMTFLAPLPTFYRIYKKKSTEGFQSVPYVTALLSAMLWI  60

Query  794  YYAVIKTNAYLIV-CINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDILFFGAVIIV  618
            YYA +K  A L++  IN +G  IE ++I ++L YA+ K ++ TIKLL L +  +G ++I+
Sbjct  61   YYAHVKNKATLLLLTINIYGFGIEAIYIIIFLLYASNKARLSTIKLLFLTVCGYGTMVIL  120

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            + +L  GSKR++++GW C V N+ VFA+PL I++QVI+T++  FMPL LS  L   A  W
Sbjct  121  TTYLTKGSKRLSIIGWICMVFNICVFASPLFILKQVIKTKSVAFMPLNLSFFLTLNAIVW  180

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGK  309
            FFYGL   D+YIA PN LGF+FG+ Q+V+Y +YKD+   E  K
Sbjct  181  FFYGLLIDDFYIAIPNTLGFVFGIVQMVIYLIYKDAIPLESTK  223



>gb|EYU42078.1| hypothetical protein MIMGU_mgv1a010705mg [Erythranthe guttata]
Length=304

 Score =   230 bits (586),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/239 (48%), Positives = 163/239 (68%), Gaps = 2/239 (1%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA+  + H  A  FG+LGNI+S FV+LAP+PTF +I+K KS+ G+ S+PY VALFSA L 
Sbjct  1    MAIFDIHHPWAFTFGVLGNIISIFVYLAPLPTFRRIFKEKSTMGFDSLPYAVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLL-LLDILFFGAVII  621
            LYYA +KTNA L++ IN FGC +E ++ISM+LFYA+KK +  T KLL ++++     + +
Sbjct  61   LYYAFLKTNAVLLISINTFGCIVETIYISMFLFYASKKARGRTAKLLGVVNVGVLSLIFV  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            V+ F+  G  R+ +VGW C  ++V VFAAPLSI+ QV+RTR+ +FMP  LS  L   A  
Sbjct  121  VTFFIFKGQNRVHVVGWICVAVSVCVFAAPLSIVFQVVRTRSVEFMPFPLSFFLTLSAVM  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQVKND  264
            WF YGLF KD  +A PN+LGF+ G+ Q+VLY ++++ K E      + K+   I   +D
Sbjct  181  WFGYGLFEKDLCVAVPNVLGFILGVLQMVLYGIFRNVKAEAINDVDDEKKMGVITTDHD  239



>ref|NP_001141654.1| hypothetical protein [Zea mays]
 gb|ACF86797.1| unknown [Zea mays]
 gb|AFW56326.1| hypothetical protein ZEAMMB73_553683 [Zea mays]
Length=301

 Score =   229 bits (585),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 118/227 (52%), Positives = 163/227 (72%), Gaps = 2/227 (1%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA LS++H  A  FGLLGN++SF  FLAPIPTFY+IYK KS++G+QS+PYVVALFSA L 
Sbjct  1    MAGLSLEHPWAFAFGLLGNVISFMTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLL-LLDILFFGAVII  621
            ++YA+IK+N   ++ IN  GC IE ++I MY  YA KK K+FT K++ LL+   FG +++
Sbjct  61   IFYALIKSNETFLITINAAGCVIETIYIVMYFVYAPKKAKLFTAKIMALLNGGVFGVILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++L L  GSKR+ L+GW C   +V+VF APLSIMR+VI+T++ ++MP +LS+ L   A  
Sbjct  121  LTLLLFKGSKRVVLLGWICVGFSVSVFVAPLSIMRRVIQTKSVEYMPFSLSLSLTLSAVV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAE  300
            WF YGL  KD Y+A PN+LGF+FG+ Q+VLY  Y +        G +
Sbjct  181  WFLYGLLIKDKYVALPNVLGFIFGVVQMVLYVFYMNKTPVAAAVGKD  227



>ref|XP_009347840.1| PREDICTED: bidirectional sugar transporter N3-like [Pyrus x bretschneideri]
Length=327

 Score =   230 bits (587),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/236 (47%), Positives = 162/236 (69%), Gaps = 5/236 (2%)
 Frame = -2

Query  971  ALLSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLY  792
            A  S   LA  FG+LGNI SF VFLAP+PTF+++YK+KS++G+QS+PYV ALF+A + +Y
Sbjct  3    ASTSHHPLAFAFGVLGNIASFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALFTATIWIY  62

Query  791  YAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDILFFGA---VII  621
            YA +K+N  L++ IN FGC IE ++I++YL YA K+ ++ T++LL L  + FG    +++
Sbjct  63   YAFLKSNEILLITINSFGCVIETIYIAIYLTYATKQARVSTLRLLFL--VNFGGFCFILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            ++ FL  G  R+A++GW C   +V+VFAAPLS+M+ VI T++ +FMP  LS  L   A  
Sbjct  121  LAHFLSQGPTRVAVLGWVCVTFSVSVFAAPLSVMKMVIHTKSVEFMPFNLSFFLTLSAVM  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQV  273
            W  YGL  KD Y+A PNI+GF FGL Q+ LY  Y+++K   + K  E K  +  Q+
Sbjct  181  WLSYGLLLKDLYVATPNIVGFSFGLVQMALYAKYRNNKTNVEKKLPEQKADVVKQM  236



>gb|EPS64389.1| hypothetical protein M569_10392, partial [Genlisea aurea]
Length=248

 Score =   228 bits (580),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/223 (49%), Positives = 156/223 (70%), Gaps = 1/223 (0%)
 Frame = -2

Query  956  QHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIK  777
              LA +FGLLGN +SF VFLAPIPTFYKIYK+KS++G+Q +PY+V LFSA L +YYA +K
Sbjct  1    SQLAFVFGLLGNAISFMVFLAPIPTFYKIYKKKSTEGFQCVPYIVGLFSAMLWIYYAFLK  60

Query  776  TNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVIIVSLFLVN  600
             +  L+V IN  GC  + ++I  YL++++KK ++ T K L +L++  FG +I V+ F+V+
Sbjct  61   PDTTLLVTINSVGCFFQSIYIGFYLYFSSKKTRVVTTKQLFVLNVASFGVIIAVTRFVVS  120

Query  599  GSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLF  420
             S++ ++VGW C V ++ VF APL ++RQVIRT++ + MP  LS  L   A  WFFYGL 
Sbjct  121  PSQQASVVGWICLVFSLCVFVAPLCVVRQVIRTKSVECMPFLLSFFLTLSAVMWFFYGLL  180

Query  419  SKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKE  291
             KDY IA PN+LGF+FG+ Q++LY MY+   ++   K     E
Sbjct  181  RKDYNIALPNVLGFIFGVLQMLLYMMYRKVDEDSAKKKLPLPE  223



>ref|XP_010943754.1| PREDICTED: bidirectional sugar transporter SWEET13-like isoform 
X1 [Elaeis guineensis]
Length=281

 Score =   229 bits (583),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 119/245 (49%), Positives = 170/245 (69%), Gaps = 14/245 (6%)
 Frame = -2

Query  947  ALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKTNA  768
            A + G+LGN++SF V+LAP+PTFYK+Y+++S+ G+QS+PY+VALFSA L ++YA +KTN+
Sbjct  10   AFIIGVLGNVISFLVYLAPVPTFYKVYRKRSTGGFQSVPYLVALFSAMLWIFYAFVKTNS  69

Query  767  YLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVIIVSLFLVNGSK  591
             L+V IN  GCAIE ++I MYL YA +  +IFT K +LLL++  F  +++ +L L  GS 
Sbjct  70   VLLVTINLIGCAIETIYIVMYLAYAPRPARIFTAKIILLLNVGLFSLILLSTLLLPKGSN  129

Query  590  RIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFSKD  411
            R+ ++GW C   + +VFAAPLSI+RQVIRTR+ ++MP  LS  L   A  WFFYGL +KD
Sbjct  130  RLKVLGWICMCFSASVFAAPLSIIRQVIRTRSVEYMPFMLSFFLTISAVVWFFYGLLTKD  189

Query  410  YYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKE---------GIEIQVK----  270
             Y+ FPN+LGF FG+ Q+VLY +YK   ++   + A  K+         G+E+QV     
Sbjct  190  PYVMFPNVLGFTFGVVQMVLYVIYKYMVRKVVVEPAVAKDVLVINLEKAGVELQVTAEEI  249

Query  269  NDGRR  255
             DG R
Sbjct  250  GDGER  254



>ref|XP_009801964.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=294

 Score =   229 bits (583),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 128/272 (47%), Positives = 178/272 (65%), Gaps = 4/272 (1%)
 Frame = -2

Query  953  HLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKT  774
            HLA  FGLLGNIVSF V+LAP+PTFYKI+K+KS++G+QS+PYVV LFSA L +YYA +K 
Sbjct  3    HLAFTFGLLGNIVSFMVYLAPVPTFYKIHKKKSTEGFQSVPYVVGLFSAMLWIYYAFLKP  62

Query  773  NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVIIVSLFLVNG  597
            +  L++ IN  GC I+  +I  +LFYA KK K+ T+K LLLL+    G +I+++ FL   
Sbjct  63   DTTLLITINSVGCCIQSFYICFFLFYATKKAKMDTVKLLLLLNFFGLGLIILLTQFLAKS  122

Query  596  SKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFS  417
            S R  +VGW C + ++ VF APL I+RQVI+TR+ ++MP  LS  L   A  WFFYGL  
Sbjct  123  SNRAQIVGWICLIFSLCVFVAPLGIVRQVIKTRSVEYMPFLLSFFLTLSAVMWFFYGLLR  182

Query  416  KDYYIAFPNILGFLFGLAQIVLYCMYKDSKK-EEDGKGAEYKEGIEI--QVKNDGRR*I*  246
            KDY IA PN+LGF  G+ Q+VLY +YK++KK  ++ K AE +  + I  + K    +   
Sbjct  183  KDYNIAIPNVLGFTLGVLQMVLYVIYKNAKKVTKEVKIAEKENTVTIVEEHKLSEDKLKE  242

Query  245  QRIEVTGRRSDVLRTVLIKPHHARQLMMFQLN  150
            Q I+V    + V   ++       ++ M QLN
Sbjct  243  QIIDVVKLSAMVCSEIIPMVPELNEINMPQLN  274



>ref|XP_008392764.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Malus 
domestica]
Length=283

 Score =   228 bits (582),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 109/224 (49%), Positives = 158/224 (71%), Gaps = 5/224 (2%)
 Frame = -2

Query  932  LLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKTNAYLIVC  753
            + GNIVSF VFLAP+PTF+++YK+KS++G+QS+PYV ALFSA + +YYA +K++  L++ 
Sbjct  1    MAGNIVSFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALFSAMIWIYYAFLKSHVILLIT  60

Query  752  INGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDILFFGA---VIIVSLFLVNGSKRIA  582
            IN FGC IE ++I++YL YA K  ++ T++LLLL  + FG    ++++S FL  G  R+ 
Sbjct  61   INSFGCVIETIYIAIYLTYATKHARVSTLRLLLL--VNFGGFCLILLLSHFLSQGPTRVE  118

Query  581  LVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFSKDYYI  402
            ++GW C   +V+VFAAPLS+MR VIRT++ +FMP  LS  L   A  W  YGL  KD Y+
Sbjct  119  VLGWVCVTFSVSVFAAPLSVMRMVIRTKSVEFMPFNLSFFLTLSAVMWLCYGLLLKDLYV  178

Query  401  AFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQVK  270
            A PNILGF FG+ Q+ LY  Y+++K   + K  E+K  +  Q+K
Sbjct  179  ATPNILGFSFGVVQMALYAKYRNTKTIVEEKLPEHKADVVKQIK  222



>ref|XP_004503778.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Cicer 
arietinum]
Length=255

 Score =   227 bits (579),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 121/240 (50%), Positives = 171/240 (71%), Gaps = 5/240 (2%)
 Frame = -2

Query  965  LSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYA  786
            ++ +  A +FGLLGNI+SF VFL+P+PTFY I+K+KS++G+QS+PYVVALFSA L +YYA
Sbjct  3    MTRESWAFVFGLLGNIISFAVFLSPLPTFYLIFKKKSTEGFQSLPYVVALFSAMLWIYYA  62

Query  785  VIKTNA-YLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDILF-FGAVIIVSL  612
             +K  A  L++ IN FG  +E  ++ ++L YA KK ++ TIKLLLL  +F FGA+++ +L
Sbjct  63   FVKREAALLLITINTFGIVVESCYLIVFLIYATKKSRLSTIKLLLLLNVFGFGAMLLSTL  122

Query  611  FLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFF  432
            +L  G+KR+A++GW C V N+ VFAAPL I+ +VIRTR+ ++MP  LS  L   A  WFF
Sbjct  123  YLAKGAKRLAIIGWICLVFNITVFAAPLFIISRVIRTRSVEYMPFFLSFFLTINAVMWFF  182

Query  431  YGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEE-DG--KGAEYKEGIEIQVKNDG  261
            YGL  KDYY+A PN LGF+FG+ Q+V+Y +Y+++     DG  KG E   G  + V   G
Sbjct  183  YGLLLKDYYVALPNTLGFVFGIIQMVMYLIYRNATPVPLDGPVKGQELSGGHIVDVVKIG  242



>ref|XP_008222221.1| PREDICTED: bidirectional sugar transporter N3 [Prunus mume]
Length=282

 Score =   228 bits (581),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 115/240 (48%), Positives = 162/240 (68%), Gaps = 5/240 (2%)
 Frame = -2

Query  971  ALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLL  795
            AL    H  A  FG+LGN++SF V+LAP+PTFY IYK+KS+ G+QS+PY+VALFS  L  
Sbjct  3    ALADSHHPWAFTFGILGNVISFLVYLAPMPTFYGIYKKKSTQGFQSVPYLVALFSGMLWF  62

Query  794  YYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLL-LLDILFFGAVIIV  618
            YYA++K NA L++ IN FG  IE ++I M++FYA K  + FT+KL   +++  F +++++
Sbjct  63   YYALLKKNAMLLITINSFGTVIETIYIVMFIFYAPKDARKFTLKLFGFMNVGLFCSILVL  122

Query  617  SLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAW  438
            S F V    R+ ++GW    I+V VFAAPLSI+ QVIRTR+ +FMP +LS  L   A  W
Sbjct  123  SHFAVRSEYRVPVLGWINVAISVIVFAAPLSIVAQVIRTRSVEFMPFSLSFFLTLSAVMW  182

Query  437  FFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK---EEDGKGAEYKEGIEIQVKN  267
            F YGLF KD  IA PN+LGF+ GL Q++LY +Y++ ++   E+D K        +  VKN
Sbjct  183  FSYGLFLKDICIAIPNVLGFILGLLQMLLYAIYRNREQVIIEDDEKKIPAAAAADQHVKN  242



>ref|XP_009405955.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=275

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 155/209 (74%), Gaps = 5/209 (2%)
 Frame = -2

Query  947  ALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKTNA  768
            A  FG+LGNI+SF V+LAP+PTFY++YKRKS++G+QS+PYVVALFSA L + YA +KT+A
Sbjct  12   AFTFGILGNIISFMVYLAPLPTFYRVYKRKSTEGFQSVPYVVALFSAMLWISYAFLKTDA  71

Query  767  YLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDIL-FFGAVIIVSLFLVNGSK  591
             L++ IN  GCAIE V    Y+ YA K  KIFT KL+LL I+  FG +++++L L  G+K
Sbjct  72   CLLITINSVGCAIETV----YIVYAPKATKIFTAKLVLLVIVAMFGLILLLTLLLSEGAK  127

Query  590  RIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFSKD  411
            R+ ++GW C   +V+VF APLS++R VIRT++ +FMP +LS  L   A  WF YGL  +D
Sbjct  128  RVEILGWICVSFSVSVFVAPLSVIRLVIRTKSVEFMPFSLSFFLTLSAVVWFAYGLLIRD  187

Query  410  YYIAFPNILGFLFGLAQIVLYCMYKDSKK  324
             Y++ PN+LGF+FG+ Q+ LY  YKD KK
Sbjct  188  LYVSLPNVLGFIFGILQMALYVAYKDRKK  216



>gb|EMS48886.1| Bidirectional sugar transporter SWEET13 [Triticum urartu]
Length=395

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/239 (49%), Positives = 163/239 (68%), Gaps = 2/239 (1%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA LS++H  A  FGLLGNI+SF   LAPIPTFY+I+K KS++G+QS+PYVVALFSA L 
Sbjct  1    MAGLSMEHPWAFAFGLLGNIISFTSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKL-LLLDILFFGAVII  621
            ++YA++KT   L++ IN  GC IE ++I MYL YA +K KIFT K+ LLL+I  FG + +
Sbjct  61   IFYALVKTGEGLLITINAAGCVIETIYIVMYLVYAPRKAKIFTAKIVLLLNIAGFGLIFL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            +++F   G  R+  +GW C   +V VF APLSI+ +VI+T++ ++MP +LS+ L   A  
Sbjct  121  LTVFAFQGETRVVSLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFSLSLTLTLSAIV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKEGIEIQVKND  264
            WF YGL  KD Y+A PNILGF FG+ Q+VLY  Y ++         E KE  ++  ++ 
Sbjct  181  WFLYGLLIKDKYVALPNILGFTFGMIQMVLYMFYMNATPVVTSDVKEVKEAWKVPAEDQ  239



>ref|XP_003620983.1| Protein RUPTURED POLLEN GRAIN [Medicago truncatula]
Length=268

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/247 (49%), Positives = 171/247 (69%), Gaps = 12/247 (5%)
 Frame = -2

Query  965  LSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYA  786
            +S   LA  FG+LGN++SF VFLAP+ TFY+IYK+KS++G+QS+PY+VALFS+ L LYYA
Sbjct  3    ISHNTLAFAFGMLGNVISFMVFLAPMTTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYA  62

Query  785  VIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVIIVSLF  609
             +K + +L++ IN FGC +EL++I +Y+ YA K  +  TIKLLL ++I  FG +++V+ +
Sbjct  63   FLKKDEFLLITINSFGCVVELIYIILYIIYATKDARKLTIKLLLAMNIGSFGLILLVTKY  122

Query  608  LVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFY  429
             V+G  R+ ++GW C  I+V+VFAAPL+I+ QV+RT++ +FMP  LS  L   A  WF Y
Sbjct  123  AVHGPIRVQVLGWICVSISVSVFAAPLTIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGY  182

Query  428  GLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKE----------GIEI  279
            GLF KD  IA PN+LGF  GL Q++LYC+Y++  K++    A  K           G   
Sbjct  183  GLFLKDICIALPNVLGFALGLVQMILYCIYRNGDKKKANSKAALKSVVIESSLGGTGEVF  242

Query  278  QV-KNDG  261
            QV KNDG
Sbjct  243  QVEKNDG  249



>ref|XP_004153501.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
 gb|KGN64433.1| hypothetical protein Csa_1G051710 [Cucumis sativus]
Length=295

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/219 (50%), Positives = 160/219 (73%), Gaps = 1/219 (0%)
 Frame = -2

Query  947  ALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKTNA  768
            A  FGLLGNI+SF VFLAP+PTF +IYK+KS++G+QSIPYVVALFSA L LYYA    N 
Sbjct  12   AFTFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSIPYVVALFSAMLWLYYASFNPNE  71

Query  767  YLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVIIVSLFLVNGSK  591
             L++ IN  GC IE +++++++ +A K+ ++ T++ +LLL+   F  +++V+ FLV+GS 
Sbjct  72   TLLITINSVGCLIETIYLAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHFLVHGSN  131

Query  590  RIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFSKD  411
            R+ +VGW C   +++VFAAPL+I+R VIRT++ +FMP  LS  L   AT+W  YG+F KD
Sbjct  132  RVKVVGWICVAFSISVFAAPLTIIRLVIRTKSVEFMPFYLSFFLTLSATSWLLYGVFLKD  191

Query  410  YYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYK  294
             YIA PNI GF+FG+AQ++LY +YK  +   + +  ++ 
Sbjct  192  IYIAVPNIPGFMFGIAQMILYLIYKKRETAMEMQLPQHS  230



>ref|XP_004161952.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=294

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 158/210 (75%), Gaps = 3/210 (1%)
 Frame = -2

Query  947  ALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKTNA  768
            A  FGLLGNI+SF VFLAP+PTF +IYK+KS++G+QSIPYVVALFSA L LYYA    N 
Sbjct  12   AFTFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSIPYVVALFSAMLWLYYASFNPNE  71

Query  767  YLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVIIVSLFLVNGSK  591
             L++ IN  GC IE +++++++ +A K+ ++ T++ +LLL+   F  +++V+ FLV+GS 
Sbjct  72   TLLITINSVGCLIETIYLAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHFLVHGSN  131

Query  590  RIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFSKD  411
            R+ +VGW C   +++VFAAPL+I+R VIRT++ +FMP  LS  L   AT+W  YG+F KD
Sbjct  132  RVKVVGWICVAFSISVFAAPLTIIRLVIRTKSVEFMPFYLSFFLTLSATSWLLYGVFLKD  191

Query  410  YYIAFPNILGFLFGLAQIVLYCMYKDSKKE  321
             YIA PNI GF+FG+AQ++LY +YK  K+E
Sbjct  192  IYIAVPNIPGFMFGIAQMILYLIYK--KRE  219



>ref|XP_004962650.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Setaria 
italica]
Length=269

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 162/230 (70%), Gaps = 3/230 (1%)
 Frame = -2

Query  974  MALLSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MA  S+QH  A  FGLLGNI+SF  FLAPIPTFY+IYK KS++G+QS+PYVVALFSA L 
Sbjct  1    MAGFSLQHPWAFTFGLLGNIISFMTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVII  621
            ++YA+IKTN  L++ IN  G  IE +++ +Y  YA+KK + FT K++L L++ FFGA+++
Sbjct  61   IFYALIKTNEILLITINVAGFVIESIYVILYFVYADKKARWFTAKIMLGLNVGFFGAILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
             +L +  G KRI  +GW C   +V VF APLSI+R+VI+TR+ ++MP +LS+ L   A  
Sbjct  121  FTLLVFKGDKRIVTLGWICVGFSVGVFVAPLSIIRRVIKTRSVEYMPFSLSLSLTLSAVV  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK-EEDGKGAEYK  294
            WF YGL  KD Y+A PN+LGF FG+ Q+ LY  Y +      +GK A  K
Sbjct  181  WFLYGLLIKDKYVALPNVLGFAFGIVQMGLYMFYMNKTPLVPEGKVAAGK  230



>emb|CAC44123.1| N3 like protein [Medicago truncatula]
Length=255

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/239 (49%), Positives = 172/239 (72%), Gaps = 4/239 (2%)
 Frame = -2

Query  965  LSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYA  786
            ++ +  A +FG++GNI+SF VFL+P+PTFY I+K+KS++G+Q++PYVVALFSA L +YYA
Sbjct  3    MTRESWAFVFGIIGNIISFAVFLSPLPTFYVIFKKKSAEGFQALPYVVALFSAMLWIYYA  62

Query  785  VIK-TNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDILF-FGAVIIVSL  612
             +K  +A L++ IN FG  +E  +I M+L YA KK ++ TIKLLLL  +F FGA+++ +L
Sbjct  63   FVKRESALLLITINTFGIVVESAYIIMFLIYAPKKQRLSTIKLLLLLNVFGFGAMLLSTL  122

Query  611  FLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFF  432
            +L  G+KR+A++GW C V N++VFAAPL ++ +VIR+R+ ++MP  LS  L   A  WFF
Sbjct  123  YLSKGAKRLAIIGWICLVFNISVFAAPLFVISKVIRSRSVEYMPFFLSFFLTINAVMWFF  182

Query  431  YGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK--EEDGKGAEYKEGIEIQVKNDG  261
            YGL  +DYY+A PN LGF+FG+ Q+V+Y +Y+++    E   KG E   G  I V   G
Sbjct  183  YGLLLRDYYVALPNTLGFVFGIIQMVVYLIYRNATPVVEAPMKGQELSGGHIIDVVKIG  241



>gb|KEH20983.1| bidirectional sugar transporter [Medicago truncatula]
Length=255

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/239 (49%), Positives = 172/239 (72%), Gaps = 4/239 (2%)
 Frame = -2

Query  965  LSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYA  786
            ++ +  A +FG++GNI+SF VFL+P+PTFY I+K+KS++G+Q++PYVVALFSA L +YYA
Sbjct  3    MTRESWAFVFGIIGNIISFAVFLSPLPTFYVIFKKKSAEGFQALPYVVALFSAMLWIYYA  62

Query  785  VIK-TNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLLDILF-FGAVIIVSL  612
             +K  +A L++ IN FG  +E  +I M+L YA KK ++ TIKLLLL  +F FGA+++ +L
Sbjct  63   FVKRESALLLITINTFGIVVESAYIIMFLIYAPKKQRLSTIKLLLLLNVFGFGAMLLSTL  122

Query  611  FLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFF  432
            +L  G+KR+A++GW C V N++VFAAPL ++ +VIR+R+ ++MP  LS  L   A  WFF
Sbjct  123  YLSKGAKRLAIIGWICLVFNISVFAAPLFVISKVIRSRSVEYMPFFLSFFLTINAVMWFF  182

Query  431  YGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK--EEDGKGAEYKEGIEIQVKNDG  261
            YGL  +DYY+A PN LGF+FG+ Q+V+Y +Y+++    E   KG E   G  I V   G
Sbjct  183  YGLLLRDYYVALPNTLGFVFGIIQMVVYLIYRNATPVVEAPMKGQELSGGHIIDVVKIG  241



>ref|XP_006371147.1| hypothetical protein POPTR_0019s04590g, partial [Populus trichocarpa]
 gb|ERP48944.1| hypothetical protein POPTR_0019s04590g, partial [Populus trichocarpa]
Length=230

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 159/210 (76%), Gaps = 2/210 (1%)
 Frame = -2

Query  887  PTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKTNAYLIVCINGFGCAIELVFISM  708
            PTFY I+KRKSS+G+QSIPY VAL SA LLLYY ++KTNAYL++ IN  GCA E+ ++ +
Sbjct  1    PTFYTIFKRKSSEGFQSIPYSVALMSASLLLYYGLLKTNAYLLISINSIGCAFEVTYLII  60

Query  707  YLFYANKKDKIFTIKLLLL-DILFFGAVIIVSLFLVNGSKRIALVGWTCAVINVAVFAAP  531
            YL YA K++K+ T+KLLL+ ++  FG V+++++ L+ G  R+++VGW CAV +VAV AAP
Sbjct  61   YLIYAPKQEKMHTMKLLLIFNMGSFGVVLLLTMLLMKGKPRLSVVGWICAVFSVAVCAAP  120

Query  530  LSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFSKDYYIAFPNILGFLFGLAQIVL  351
            LSIMR+V+RT++ +++P TLS  +   A  WFFYGL   DYYIA PN+LGFLFG+AQ++L
Sbjct  121  LSIMRRVVRTKSVEYLPFTLSASITLNAVMWFFYGLLQHDYYIALPNVLGFLFGIAQMIL  180

Query  350  YCMYKDSKKEEDGKGAEYKEGIE-IQVKND  264
            Y +YK++K+  + K  +     E +Q+ N+
Sbjct  181  YMVYKNAKRNVEEKLEQLAGNKEVVQMTNE  210



>gb|KEH21447.1| sugar efflux transporter for intercellular exchange protein [Medicago 
truncatula]
Length=279

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/247 (49%), Positives = 171/247 (69%), Gaps = 12/247 (5%)
 Frame = -2

Query  965  LSVQHLALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYA  786
            +S   LA  FG+LGN++SF VFLAP+ TFY+IYK+KS++G+QS+PY+VALFS+ L LYYA
Sbjct  3    ISHNTLAFAFGMLGNVISFMVFLAPMTTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYA  62

Query  785  VIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLL-LDILFFGAVIIVSLF  609
             +K + +L++ IN FGC +EL++I +Y+ YA K  +  TIKLLL ++I  FG +++V+ +
Sbjct  63   FLKKDEFLLITINSFGCVVELIYIILYIIYATKDARKLTIKLLLAMNIGSFGLILLVTKY  122

Query  608  LVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFY  429
             V+G  R+ ++GW C  I+V+VFAAPL+I+ QV+RT++ +FMP  LS  L   A  WF Y
Sbjct  123  AVHGPIRVQVLGWICVSISVSVFAAPLTIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGY  182

Query  428  GLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAEYKE----------GIEI  279
            GLF KD  IA PN+LGF  GL Q++LYC+Y++  K++    A  K           G   
Sbjct  183  GLFLKDICIALPNVLGFALGLVQMILYCIYRNGDKKKANSKAALKSVVIESSLGGTGEVF  242

Query  278  QV-KNDG  261
            QV KNDG
Sbjct  243  QVEKNDG  249



>ref|XP_002321731.1| N3 like family protein [Populus trichocarpa]
 gb|EEF05858.1| N3 like family protein [Populus trichocarpa]
Length=283

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 155/213 (73%), Gaps = 3/213 (1%)
 Frame = -2

Query  953  HLA--LLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVI  780
            HL   L FGLLGN++S  V LAP+PTFY+IYK+K+S+G+QSIPYV+ALFSA L L+YA+ 
Sbjct  4    HLTWMLAFGLLGNLISCLVCLAPLPTFYQIYKKKTSEGFQSIPYVIALFSAMLWLFYAIF  63

Query  779  KTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIVSLFLV  603
              +A L++ IN F   +E  +I++YL YA KKDKI T KLLLL +   FG + +++LFL 
Sbjct  64   SEDAILLITINTFAFFMEFGYITVYLLYATKKDKILTFKLLLLFNSFGFGLICVLTLFLT  123

Query  602  NGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGL  423
             G KR+ ++GW C + ++ VF APL I+R+VI+T++ +FMP +LS  L   A  WFFYG 
Sbjct  124  QGQKRVQVLGWICMIFSLCVFVAPLFIVREVIKTKSVEFMPFSLSFFLTLSAVMWFFYGY  183

Query  422  FSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK  324
              KD ++A PNILGFLFG+ Q+VLY +Y++  K
Sbjct  184  LKKDQFVAVPNILGFLFGIIQMVLYVIYRNPMK  216



>ref|XP_004161953.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
 gb|KGN64434.1| hypothetical protein Csa_1G051720 [Cucumis sativus]
Length=291

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 159/216 (74%), Gaps = 2/216 (1%)
 Frame = -2

Query  974  MALLSVQHLALL-FGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELL  798
            MAL    H  +  FGLLGNI+SF VFLAP+PTF +I K+KS++G+QS+PYVVALFSA L 
Sbjct  1    MALFDTHHPGVFAFGLLGNIISFIVFLAPVPTFMRICKKKSTEGFQSVPYVVALFSAMLW  60

Query  797  LYYAVIKTNAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIK-LLLLDILFFGAVII  621
            LYYA   +N  L++ IN  GC IE ++I++++ +A K+ ++ T++ +LLL+   F  +++
Sbjct  61   LYYASFNSNETLLITINSVGCLIETLYIAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILL  120

Query  620  VSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATA  441
            V+ FLV+GS ++ +VGW C   +V+VFAAPL+IMR VIRT++ +FMP +LS  L   A  
Sbjct  121  VTHFLVHGSNQVKVVGWICVAFSVSVFAAPLTIMRLVIRTKSVEFMPFSLSFFLTLSAIT  180

Query  440  WFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKD  333
            W  YG+F KD Y+A PN+LGF+FG+AQ++LY +Y+ 
Sbjct  181  WLLYGVFLKDIYVALPNVLGFIFGVAQMILYLIYRK  216



>gb|EYU23059.1| hypothetical protein MIMGU_mgv1a019104mg [Erythranthe guttata]
Length=278

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 153/210 (73%), Gaps = 1/210 (0%)
 Frame = -2

Query  926  GNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKTNAYLIVCIN  747
            GNIVSF VFLAP+PTF++IYKRKSS+G+QS+PYVV LFSA L +YYA++K +  L++ IN
Sbjct  5    GNIVSFMVFLAPLPTFHQIYKRKSSEGFQSVPYVVGLFSAMLWIYYALLKPDTTLLITIN  64

Query  746  GFGCAIELVFISMYLFYANKKDKIFTIKLL-LLDILFFGAVIIVSLFLVNGSKRIALVGW  570
              GC I+  +I  YLFYA K  ++ T+ L+ LL+++  G +++++ F+  G  R A+VGW
Sbjct  65   SVGCFIQTTYICFYLFYAPKSARLQTLALVFLLNVVGMGLIVVLTQFVAKGYNRAAIVGW  124

Query  569  TCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFSKDYYIAFPN  390
             C V ++ VF APL ++RQV+RT++ ++MP  LS  L   A  WFFYGL  KDY IA PN
Sbjct  125  ICLVFSLCVFIAPLCVVRQVVRTKSVEYMPFLLSFFLTLSAVMWFFYGLIRKDYNIAIPN  184

Query  389  ILGFLFGLAQIVLYCMYKDSKKEEDGKGAE  300
            +LGF+FG+ Q++LY MYK++KK  + K  E
Sbjct  185  VLGFIFGVIQMMLYVMYKNTKKVVEEKLQE  214



>ref|XP_003617528.1| Protein RUPTURED POLLEN GRAIN [Medicago truncatula]
 gb|AET00487.1| bidirectional sugar transporter [Medicago truncatula]
Length=252

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 153/218 (70%), Gaps = 2/218 (1%)
 Frame = -2

Query  950  LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYYAVIKTN  771
            + LLFG LG IV+F  FLAP+PTFY IYK+KSS+G+ SIPYVV L S  L +YY  +KTN
Sbjct  9    MVLLFGFLG-IVTFMSFLAPLPTFYSIYKKKSSEGFHSIPYVVTLLSTLLFVYYGFLKTN  67

Query  770  AYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLLLL-DILFFGAVIIVSLFLVNGS  594
            A  ++ IN  GC +E+ ++ MY+ YA KK KI T+ L+L+ D+  FG  +I++ F+V GS
Sbjct  68   AIFLITINSIGCVMEVAYLIMYITYAPKKLKISTLVLILIVDMGGFGLTMIITTFIVKGS  127

Query  593  KRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCATAWFFYGLFSK  414
              + +VG  C + N+ +FAAPLSIM++VI+TR+ ++MP  LS+ L  CAT WFFYG F K
Sbjct  128  FHVQVVGMICTIFNIGMFAAPLSIMKKVIKTRSVEYMPFPLSLFLTICATMWFFYGFFDK  187

Query  413  DYYIAFPNILGFLFGLAQIVLYCMYKDSKKEEDGKGAE  300
            D YI  PN LGFL G++Q++LY +YK++K   +     
Sbjct  188  DKYIMLPNGLGFLLGVSQMILYLIYKNAKNNVEASSTN  225



>ref|XP_009337540.1| PREDICTED: bidirectional sugar transporter NEC1 [Pyrus x bretschneideri]
Length=295

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/235 (49%), Positives = 168/235 (71%), Gaps = 8/235 (3%)
 Frame = -2

Query  965  LSVQH-LALLFGLLGNIVSFFVFLAPIPTFYKIYKRKSSDGYQSIPYVVALFSAELLLYY  789
            +++ H L L FGLLGNI+S  VFLAP+PTFY +YK+K+++G+Q++PYV+ L S+ + +YY
Sbjct  1    MALHHTLTLAFGLLGNIISLLVFLAPVPTFYTVYKKKTTEGFQALPYVIGLLSSMMYIYY  60

Query  788  AVIKT----NAYLIVCINGFGCAIELVFISMYLFYANKKDKIFTIKLL-LLDILFFGAVI  624
            A++K     +A L++ IN  GC IE ++IS++LFYA KK +I T  LL LL++  +G ++
Sbjct  61   ALLKEELKEDATLVITINSVGCVIETIYISLFLFYAPKKARISTAMLLFLLNLFSYGMMV  120

Query  623  IVSLFLVNGSKRIALVGWTCAVINVAVFAAPLSIMRQVIRTRNTQFMPLTLSVCLVFCAT  444
            +++ FL  G  R  +V W C V +++VF APL ++RQVIRT++ +FMP  LS  L   A 
Sbjct  121  VLTRFLATGETRFKIVAWICLVFSLSVFVAPLGVLRQVIRTKSVEFMPFPLSFFLTLGAV  180

Query  443  AWFFYGLFSKDYYIAFPNILGFLFGLAQIVLYCMYKDSKK--EEDGKGAEYKEGI  285
            AWFFYG   KDYYIAFPN+LGFLFG+ Q+V+Y +YK++KK  E+  K  E  E I
Sbjct  181  AWFFYGFLIKDYYIAFPNMLGFLFGVVQMVVYVVYKNAKKLLEDQPKVQELSEHI  235



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2314958397494