BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19116_g1_i1 len=1732 path=[139:0-1646 138:1647-1731]

Length=1732
                                                                      Score     E

ref|XP_006338921.1|  PREDICTED: major facilitator superfamily dom...    626   0.0      
ref|XP_006359138.1|  PREDICTED: major facilitator superfamily dom...    548   0.0      
ref|XP_004229334.1|  PREDICTED: major facilitator superfamily dom...    537   0.0      
ref|XP_011086870.1|  PREDICTED: major facilitator superfamily dom...    526   6e-179   
ref|XP_002270525.2|  PREDICTED: major facilitator superfamily dom...    518   5e-176   Vitis vinifera
ref|XP_010691839.1|  PREDICTED: major facilitator superfamily dom...    517   1e-175   
ref|XP_009620863.1|  PREDICTED: major facilitator superfamily dom...    512   1e-173   
gb|EYU27165.1|  hypothetical protein MIMGU_mgv1a025947mg                512   1e-173   
ref|XP_006359134.1|  PREDICTED: major facilitator superfamily dom...    512   2e-173   
emb|CDP07662.1|  unnamed protein product                                511   2e-173   
ref|XP_004229333.1|  PREDICTED: major facilitator superfamily dom...    510   7e-173   
gb|KDP20374.1|  hypothetical protein JCGZ_05257                         501   2e-169   
ref|XP_009782042.1|  PREDICTED: major facilitator superfamily dom...    501   3e-169   
ref|XP_002512200.1|  conserved hypothetical protein                     500   4e-169   Ricinus communis
ref|XP_008231393.1|  PREDICTED: major facilitator superfamily dom...    497   1e-167   
ref|XP_004306481.1|  PREDICTED: major facilitator superfamily dom...    497   1e-167   
ref|XP_007217988.1|  hypothetical protein PRUPE_ppa005566mg             496   3e-167   
ref|XP_010243432.1|  PREDICTED: major facilitator superfamily dom...    495   5e-167   
ref|XP_009365055.1|  PREDICTED: major facilitator superfamily dom...    494   1e-166   
ref|XP_010257578.1|  PREDICTED: major facilitator superfamily dom...    493   8e-166   
ref|XP_008350284.1|  PREDICTED: major facilitator superfamily dom...    491   2e-165   
ref|XP_006402627.1|  hypothetical protein EUTSA_v10005961mg             488   3e-164   
emb|CDX89045.1|  BnaA04g01410D                                          485   6e-163   
ref|XP_002881956.1|  hypothetical protein ARALYDRAFT_903845             484   9e-163   
ref|XP_008788956.1|  PREDICTED: major facilitator superfamily dom...    484   1e-162   
ref|XP_010508312.1|  PREDICTED: major facilitator superfamily dom...    484   2e-162   
ref|XP_006294173.1|  hypothetical protein CARUB_v10023168mg             484   2e-162   
ref|XP_011009643.1|  PREDICTED: major facilitator superfamily dom...    483   3e-162   
gb|KDO46026.1|  hypothetical protein CISIN_1g011925mg                   484   3e-162   
ref|XP_006482796.1|  PREDICTED: major facilitator superfamily dom...    483   4e-162   
ref|XP_009408462.1|  PREDICTED: major facilitator superfamily dom...    482   5e-162   
ref|XP_010934426.1|  PREDICTED: major facilitator superfamily dom...    482   9e-162   
ref|XP_008788963.1|  PREDICTED: major facilitator superfamily dom...    481   2e-161   
ref|XP_009138879.1|  PREDICTED: major facilitator superfamily dom...    480   5e-161   
emb|CDY42660.1|  BnaC04g22460D                                          480   5e-161   
ref|XP_010518025.1|  PREDICTED: major facilitator superfamily dom...    480   7e-161   
ref|NP_191566.5|  major facilitator protein                             479   8e-161   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006369484.1|  hypothetical protein POPTR_0001s23860g             479   1e-160   
ref|XP_006438994.1|  hypothetical protein CICLE_v10031412mg             479   2e-160   
ref|NP_001132176.1|  hypothetical protein                               478   2e-160   Zea mays [maize]
ref|NP_001060093.1|  Os07g0578200                                       478   3e-160   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002314218.1|  hypothetical protein POPTR_0009s02950g             477   5e-160   Populus trichocarpa [western balsam poplar]
gb|ACG29601.1|  hypothetical protein                                    477   5e-160   Zea mays [maize]
ref|XP_006657882.1|  PREDICTED: major facilitator superfamily dom...    477   5e-160   
ref|XP_010469236.1|  PREDICTED: major facilitator superfamily dom...    477   6e-160   
ref|XP_007020146.1|  Major facilitator superfamily protein isoform 2    476   1e-159   
ref|XP_010506343.1|  PREDICTED: major facilitator superfamily dom...    476   1e-159   
ref|XP_010512308.1|  PREDICTED: major facilitator superfamily dom...    476   2e-159   
ref|XP_010058084.1|  PREDICTED: major facilitator superfamily dom...    476   2e-159   
ref|XP_002878316.1|  AT3g60070/T2O9_50                                  476   3e-159   
ref|XP_010413606.1|  PREDICTED: major facilitator superfamily dom...    475   3e-159   
gb|AGT16117.1|  sugar transport protein-like protein                    475   4e-159   
ref|NP_001078055.1|  major facilitator protein                          475   4e-159   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC83077.1|  sugar transport protein-like                           475   4e-159   Oryza sativa Japonica Group [Japonica rice]
gb|AAY78728.1|  hypothetical protein At2g44280                          474   6e-159   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009400849.1|  PREDICTED: major facilitator superfamily dom...    474   7e-159   
ref|XP_003562831.1|  PREDICTED: major facilitator superfamily dom...    474   1e-158   
gb|KHG04911.1|  Major facilitator superfamily domain-containing p...    477   1e-158   
emb|CDY64360.1|  BnaAnng19280D                                          473   2e-158   
ref|XP_007020145.1|  Major facilitator superfamily protein isoform 1    476   3e-158   
ref|XP_003595827.1|  MFS-type transporter, putative                     472   4e-158   
ref|XP_006397605.1|  hypothetical protein EUTSA_v10001436mg             472   6e-158   
ref|XP_007149118.1|  hypothetical protein PHAVU_005G042600g             471   1e-157   
ref|XP_011041985.1|  PREDICTED: major facilitator superfamily dom...    471   2e-157   
emb|CDY17860.1|  BnaC04g03590D                                          470   3e-157   
ref|XP_003531460.1|  PREDICTED: major facilitator superfamily dom...    470   3e-157   
ref|XP_010544514.1|  PREDICTED: major facilitator superfamily dom...    469   7e-157   
ref|XP_009143013.1|  PREDICTED: major facilitator superfamily dom...    469   9e-157   
ref|XP_009143012.1|  PREDICTED: major facilitator superfamily dom...    468   3e-156   
gb|AAM77646.1|AF517847_1  hypothetical protein                          467   4e-156   Arabidopsis thaliana [mouse-ear cress]
emb|CDY30463.1|  BnaA04g25640D                                          465   4e-155   
ref|XP_004135898.1|  PREDICTED: major facilitator superfamily dom...    464   7e-155   
ref|XP_003546851.1|  PREDICTED: major facilitator superfamily dom...    463   1e-154   
gb|KGN45180.1|  hypothetical protein Csa_7G430150                       464   2e-154   
ref|XP_009142254.1|  PREDICTED: major facilitator superfamily dom...    462   7e-154   
emb|CDY23426.1|  BnaC04g49540D                                          461   9e-154   
gb|ACU23744.1|  unknown                                                 461   1e-153   Glycine max [soybeans]
ref|XP_010243428.1|  PREDICTED: major facilitator superfamily dom...    459   5e-153   
gb|EMT13240.1|  hypothetical protein F775_06308                         462   5e-153   
ref|XP_004488576.1|  PREDICTED: major facilitator superfamily dom...    458   1e-152   
gb|KCW75596.1|  hypothetical protein EUGRSUZ_E04336                     453   2e-151   
ref|XP_010506347.1|  PREDICTED: major facilitator superfamily dom...    454   3e-151   
ref|XP_010512310.1|  PREDICTED: major facilitator superfamily dom...    450   1e-149   
ref|XP_010257579.1|  PREDICTED: major facilitator superfamily dom...    450   4e-149   
ref|XP_010098646.1|  hypothetical protein L484_002669                   447   1e-148   
ref|XP_010257577.1|  PREDICTED: major facilitator superfamily dom...    449   2e-148   
gb|KDO46032.1|  hypothetical protein CISIN_1g011925mg                   445   4e-148   
ref|NP_001049086.1|  Os03g0168000                                       446   6e-148   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004985573.1|  PREDICTED: major facilitator superfamily dom...    445   3e-147   
ref|XP_006649460.1|  PREDICTED: major facilitator superfamily dom...    442   2e-146   
gb|KDO46024.1|  hypothetical protein CISIN_1g011925mg                   441   6e-146   
gb|ACN27923.1|  unknown                                                 440   2e-145   Zea mays [maize]
ref|XP_002468443.1|  hypothetical protein SORBIDRAFT_01g046010          439   3e-145   Sorghum bicolor [broomcorn]
ref|XP_006842769.1|  hypothetical protein AMTR_s00133p00099940          436   2e-144   
ref|NP_001142591.1|  hypothetical protein                               437   2e-144   Zea mays [maize]
gb|EAY88695.1|  hypothetical protein OsI_10171                          436   1e-143   Oryza sativa Indica Group [Indian rice]
ref|XP_010243429.1|  PREDICTED: major facilitator superfamily dom...    434   1e-143   
gb|ACF84597.1|  unknown                                                 435   2e-143   Zea mays [maize]
dbj|BAJ97104.1|  predicted protein                                      433   1e-142   
ref|XP_007020148.1|  Major facilitator superfamily protein isoform 4    427   4e-141   
gb|EMT11520.1|  hypothetical protein F775_17916                         427   3e-140   
ref|XP_006438996.1|  hypothetical protein CICLE_v10031412mg             425   4e-140   
ref|XP_003558731.1|  PREDICTED: major facilitator superfamily dom...    424   3e-139   
ref|XP_011009644.1|  PREDICTED: major facilitator superfamily dom...    417   6e-137   
gb|EAZ25722.1|  hypothetical protein OsJ_09556                          416   3e-136   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006598240.1|  PREDICTED: major facilitator superfamily dom...    413   1e-135   
ref|XP_006291309.1|  hypothetical protein CARUB_v10017443mg             406   3e-133   
emb|CAB75922.1|  putative protein                                       406   1e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006438997.1|  hypothetical protein CICLE_v10031412mg             403   2e-132   
ref|XP_010691842.1|  PREDICTED: major facilitator superfamily dom...    384   3e-125   
gb|KDO46025.1|  hypothetical protein CISIN_1g011925mg                   387   4e-125   
ref|XP_006482798.1|  PREDICTED: major facilitator superfamily dom...    386   6e-125   
ref|XP_010243431.1|  PREDICTED: major facilitator superfamily dom...    384   6e-125   
ref|XP_006439001.1|  hypothetical protein CICLE_v10031412mg             381   5e-124   
ref|XP_001768698.1|  predicted protein                                  386   6e-123   
ref|XP_007020149.1|  Major facilitator superfamily protein isoform 5    372   2e-120   
ref|XP_009620866.1|  PREDICTED: major facilitator superfamily dom...    365   6e-118   
ref|XP_006359136.1|  PREDICTED: major facilitator superfamily dom...    364   1e-117   
gb|KFK35213.1|  hypothetical protein AALP_AA5G255200                    364   9e-117   
ref|XP_002977174.1|  hypothetical protein SELMODRAFT_33300              363   2e-116   
ref|XP_002965330.1|  hypothetical protein SELMODRAFT_230598             363   2e-116   
ref|XP_009782044.1|  PREDICTED: major facilitator superfamily dom...    356   3e-114   
gb|EPS59948.1|  hypothetical protein M569_14857                         351   3e-113   
ref|XP_006439000.1|  hypothetical protein CICLE_v10031412mg             348   9e-112   
gb|EMS59777.1|  hypothetical protein TRIUR3_17345                       350   2e-111   
gb|EMS58773.1|  hypothetical protein TRIUR3_19915                       348   4e-110   
ref|XP_008350292.1|  PREDICTED: major facilitator superfamily dom...    343   1e-109   
gb|AFW89569.1|  hypothetical protein ZEAMMB73_523053                    341   3e-107   
ref|XP_006585376.1|  PREDICTED: major facilitator superfamily dom...    335   2e-106   
ref|NP_001154579.1|  major facilitator protein                          332   2e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006438999.1|  hypothetical protein CICLE_v10031412mg             331   5e-105   
ref|XP_010506348.1|  PREDICTED: major facilitator superfamily dom...    330   1e-104   
gb|AAM97768.1|  hypothetical protein                                    328   7e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006438998.1|  hypothetical protein CICLE_v10031412mg             326   2e-103   
gb|KDO46028.1|  hypothetical protein CISIN_1g011925mg                   321   6e-101   
ref|XP_006438995.1|  hypothetical protein CICLE_v10031412mg             317   3e-99    
gb|KCW75597.1|  hypothetical protein EUGRSUZ_E04336                     315   3e-99    
ref|XP_010257582.1|  PREDICTED: major facilitator superfamily dom...    300   1e-91    
ref|NP_001167750.1|  hypothetical protein                               230   6e-68    Zea mays [maize]
emb|CAN59826.1|  hypothetical protein VITISV_016657                     228   1e-62    Vitis vinifera
ref|XP_008461432.1|  PREDICTED: major facilitator superfamily dom...    201   1e-55    
ref|XP_006639984.1|  PREDICTED: major facilitator superfamily dom...    203   2e-54    
ref|XP_008621163.1|  hypothetical protein SDRG_16723                    188   5e-49    
ref|NP_001011396.1|  major facilitator superfamily domain contain...    187   1e-48    Xenopus tropicalis [western clawed frog]
gb|KDO20875.1|  hypothetical protein SPRG_14106                         187   2e-48    
ref|XP_003459227.1|  PREDICTED: major facilitator superfamily dom...    186   3e-48    
ref|NP_001084594.1|  major facilitator superfamily domain contain...    186   3e-48    Xenopus laevis [clawed frog]
ref|XP_006105991.1|  PREDICTED: major facilitator superfamily dom...    185   4e-48    
ref|XP_001924045.3|  PREDICTED: LOW QUALITY PROTEIN: major facili...    183   2e-47    Danio rerio [leopard danio]
ref|XP_009832599.1|  hypothetical protein H257_08432                    182   8e-47    
ref|XP_005313865.1|  PREDICTED: major facilitator superfamily dom...    182   9e-47    
ref|XP_008149020.1|  PREDICTED: major facilitator superfamily dom...    181   1e-46    
ref|XP_009832597.1|  hypothetical protein H257_08431                    180   5e-46    
ref|XP_005813830.1|  PREDICTED: major facilitator superfamily dom...    178   2e-45    
ref|XP_008332994.1|  PREDICTED: major facilitator superfamily dom...    178   2e-45    
ref|XP_002116430.1|  hypothetical protein TRIADDRAFT_30948              177   2e-45    Trichoplax adhaerens
ref|XP_008872640.1|  hypothetical protein H310_08595                    178   3e-45    
gb|AAH68439.1|  Chromosome 19 open reading frame 28                     177   4e-45    Homo sapiens [man]
ref|XP_008431821.1|  PREDICTED: major facilitator superfamily dom...    177   4e-45    
ref|NP_778148.2|  major facilitator superfamily domain-containing...    176   5e-45    Homo sapiens [man]
ref|XP_005999123.1|  PREDICTED: major facilitator superfamily dom...    176   1e-44    
ref|XP_002159338.2|  PREDICTED: major facilitator superfamily dom...    176   1e-44    
ref|XP_004078977.1|  PREDICTED: major facilitator superfamily dom...    175   1e-44    
ref|XP_004865894.1|  PREDICTED: major facilitator superfamily dom...    175   1e-44    
ref|XP_005098266.1|  PREDICTED: major facilitator superfamily dom...    176   1e-44    
ref|XP_004576190.1|  PREDICTED: major facilitator superfamily dom...    175   1e-44    
ref|XP_007440721.1|  PREDICTED: major facilitator superfamily dom...    175   2e-44    
ref|XP_007578421.1|  PREDICTED: major facilitator superfamily dom...    175   2e-44    
ref|XP_010365588.1|  PREDICTED: major facilitator superfamily dom...    175   2e-44    
ref|XP_005098265.1|  PREDICTED: major facilitator superfamily dom...    177   2e-44    
ref|XP_004865893.1|  PREDICTED: major facilitator superfamily dom...    175   2e-44    
ref|XP_007992976.1|  PREDICTED: major facilitator superfamily dom...    175   2e-44    
ref|XP_003779074.1|  PREDICTED: LOW QUALITY PROTEIN: major facili...    174   2e-44    
ref|XP_006722709.1|  PREDICTED: major facilitator superfamily dom...    175   3e-44    
ref|XP_007245843.1|  PREDICTED: major facilitator superfamily dom...    173   4e-44    
ref|XP_005098264.1|  PREDICTED: major facilitator superfamily dom...    175   6e-44    
ref|XP_005587567.1|  PREDICTED: major facilitator superfamily dom...    173   6e-44    
tpg|DAA27823.1|  TPA: hypothetical protein BOS_7721                     173   7e-44    
ref|XP_010766473.1|  PREDICTED: major facilitator superfamily dom...    172   8e-44    
emb|CDQ71408.1|  unnamed protein product                                174   9e-44    
ref|XP_005654765.1|  PREDICTED: major facilitator superfamily dom...    172   1e-43    
ref|XP_007908362.1|  PREDICTED: major facilitator superfamily dom...    172   1e-43    
emb|CAJ81767.1|  chromosome 19 open reading frame 28                    172   1e-43    Xenopus tropicalis [western clawed frog]
ref|XP_004865892.1|  PREDICTED: major facilitator superfamily dom...    174   2e-43    
ref|XP_002898143.1|  Glycoside-Pentoside-Hexuronide (GPH):Cation ...    172   2e-43    
ref|XP_010745276.1|  PREDICTED: major facilitator superfamily dom...    172   2e-43    
ref|XP_006047941.1|  PREDICTED: major facilitator superfamily dom...    172   2e-43    
ref|XP_006738796.1|  PREDICTED: major facilitator superfamily dom...    171   3e-43    
ref|XP_004008662.1|  PREDICTED: LOW QUALITY PROTEIN: major facili...    171   5e-43    
ref|XP_009525330.1|  hypothetical protein PHYSODRAFT_558093             171   6e-43    
ref|XP_005171266.1|  PREDICTED: major facilitator superfamily dom...    171   6e-43    
ref|NP_001038437.1|  major facilitator superfamily domain contain...    171   7e-43    Danio rerio [leopard danio]
ref|XP_004654770.1|  PREDICTED: major facilitator superfamily dom...    171   8e-43    
gb|AAI28827.1|  Si:dkey-218h11.4 protein                                171   8e-43    Danio rerio [leopard danio]
ref|XP_001626723.1|  predicted protein                                  168   9e-43    Nematostella vectensis
ref|XP_003914705.1|  PREDICTED: major facilitator superfamily dom...    170   9e-43    
ref|XP_006047939.1|  PREDICTED: major facilitator superfamily dom...    171   1e-42    
ref|XP_004633000.1|  PREDICTED: major facilitator superfamily dom...    170   1e-42    
ref|XP_005754451.1|  PREDICTED: major facilitator superfamily dom...    168   2e-42    
ref|XP_005954279.1|  PREDICTED: major facilitator superfamily dom...    170   2e-42    
ref|XP_006267441.1|  PREDICTED: major facilitator superfamily dom...    169   3e-42    
ref|NP_001274458.1|  major facilitator superfamily domain-contain...    168   3e-42    
ref|XP_010964996.1|  PREDICTED: major facilitator superfamily dom...    169   3e-42    
ref|XP_006267440.1|  PREDICTED: major facilitator superfamily dom...    169   3e-42    
ref|XP_004378702.1|  PREDICTED: major facilitator superfamily dom...    169   3e-42    
gb|ETL89732.1|  hypothetical protein L917_11381                         169   4e-42    
ref|XP_010866675.1|  PREDICTED: major facilitator superfamily dom...    169   4e-42    
gb|ETP40937.1|  hypothetical protein F442_11806                         169   4e-42    
ref|XP_010870147.1|  PREDICTED: major facilitator superfamily dom...    168   4e-42    
gb|ETO71726.1|  hypothetical protein F444_11977                         169   4e-42    
ref|XP_008908125.1|  hypothetical protein PPTG_12703                    169   4e-42    
ref|XP_008835254.1|  PREDICTED: major facilitator superfamily dom...    168   5e-42    
ref|XP_004688956.1|  PREDICTED: major facilitator superfamily dom...    168   5e-42    
gb|ETP12844.1|  hypothetical protein F441_11845                         169   5e-42    
gb|ETL36514.1|  hypothetical protein L916_11516                         169   6e-42    
gb|ETI43084.1|  hypothetical protein F443_11886                         169   6e-42    
gb|ELK37475.1|  hypothetical protein MDA_GLEAN10011135                  167   6e-42    
ref|XP_006514282.1|  PREDICTED: major facilitator superfamily dom...    167   7e-42    
ref|XP_003975549.1|  PREDICTED: major facilitator superfamily dom...    167   7e-42    
ref|XP_009013147.1|  hypothetical protein HELRODRAFT_110029             167   8e-42    
ref|XP_006206624.1|  PREDICTED: major facilitator superfamily dom...    168   9e-42    
ref|XP_007176611.1|  PREDICTED: major facilitator superfamily dom...    166   9e-42    
ref|XP_004395407.1|  PREDICTED: major facilitator superfamily dom...    167   1e-41    
ref|XP_624057.2|  PREDICTED: major facilitator superfamily domain...    167   1e-41    Apis mellifera [bee]
ref|XP_007489237.1|  PREDICTED: major facilitator superfamily dom...    167   1e-41    
ref|XP_001364611.2|  PREDICTED: major facilitator superfamily dom...    167   1e-41    Monodelphis domestica
ref|XP_010599581.1|  PREDICTED: major facilitator superfamily dom...    167   1e-41    
ref|XP_418193.3|  PREDICTED: major facilitator superfamily domain...    167   2e-41    Gallus gallus [bantam]
ref|XP_007104297.1|  PREDICTED: major facilitator superfamily dom...    166   2e-41    
ref|NP_082933.2|  major facilitator superfamily domain-containing...    166   2e-41    Mus musculus [mouse]
ref|XP_004948760.1|  PREDICTED: major facilitator superfamily dom...    167   2e-41    
ref|XP_007176609.1|  PREDICTED: major facilitator superfamily dom...    166   2e-41    
ref|XP_005332265.1|  PREDICTED: major facilitator superfamily dom...    166   2e-41    
ref|NP_001102200.1|  major facilitator superfamily domain-contain...    166   2e-41    Rattus norvegicus [brown rat]
ref|XP_007176610.1|  PREDICTED: major facilitator superfamily dom...    166   2e-41    
ref|XP_007460404.1|  PREDICTED: LOW QUALITY PROTEIN: major facili...    166   2e-41    
ref|XP_007176608.1|  PREDICTED: major facilitator superfamily dom...    166   3e-41    
ref|XP_004615067.1|  PREDICTED: major facilitator superfamily dom...    166   3e-41    
ref|XP_003760775.1|  PREDICTED: major facilitator superfamily dom...    166   4e-41    
ref|XP_005359045.1|  PREDICTED: major facilitator superfamily dom...    165   4e-41    
ref|XP_004714442.1|  PREDICTED: major facilitator superfamily dom...    165   5e-41    
dbj|BAE32913.1|  unnamed protein product                                165   6e-41    Mus musculus [mouse]
gb|KDR13311.1|  putative MFS-type transporter C19orf28                  164   7e-41    
ref|XP_004948759.1|  PREDICTED: major facilitator superfamily dom...    166   7e-41    
gb|ELU08281.1|  hypothetical protein CAPTEDRAFT_96409                   164   1e-40    
ref|XP_009562409.1|  PREDICTED: major facilitator superfamily dom...    164   1e-40    
ref|XP_007524968.1|  PREDICTED: major facilitator superfamily dom...    164   1e-40    
ref|XP_001605086.1|  PREDICTED: major facilitator superfamily dom...    164   1e-40    Nasonia vitripennis
ref|XP_003213238.2|  PREDICTED: major facilitator superfamily dom...    164   1e-40    
ref|XP_003494067.1|  PREDICTED: uncharacterized MFS-type transpor...    164   1e-40    
ref|XP_006869107.1|  PREDICTED: major facilitator superfamily dom...    165   1e-40    
ref|XP_003703798.1|  PREDICTED: major facilitator superfamily dom...    164   1e-40    
ref|XP_003393270.1|  PREDICTED: uncharacterized MFS-type transpor...    163   3e-40    
ref|XP_008551681.1|  PREDICTED: major facilitator superfamily dom...    162   4e-40    
ref|XP_003697072.1|  PREDICTED: major facilitator superfamily dom...    162   7e-40    
ref|XP_006978192.1|  PREDICTED: major facilitator superfamily dom...    161   7e-40    
ref|XP_009048796.1|  hypothetical protein LOTGIDRAFT_177990             161   9e-40    
ref|XP_002923621.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    162   1e-39    
ref|XP_005405930.1|  PREDICTED: major facilitator superfamily dom...    161   1e-39    
ref|XP_972510.2|  PREDICTED: major facilitator superfamily domain...    160   1e-39    Tribolium castaneum [rust-red flour beetle]
ref|XP_005405931.1|  PREDICTED: major facilitator superfamily dom...    160   2e-39    
ref|XP_005083314.1|  PREDICTED: major facilitator superfamily dom...    160   2e-39    
ref|XP_005405929.1|  PREDICTED: major facilitator superfamily dom...    161   2e-39    
ref|XP_008200731.1|  PREDICTED: major facilitator superfamily dom...    160   2e-39    
ref|XP_008200730.1|  PREDICTED: major facilitator superfamily dom...    160   2e-39    
ref|XP_512270.2|  PREDICTED: major facilitator superfamily domain...    160   2e-39    Pan troglodytes
ref|XP_004059782.1|  PREDICTED: major facilitator superfamily dom...    160   3e-39    
ref|XP_004286410.1|  PREDICTED: major facilitator superfamily dom...    159   3e-39    
ref|XP_005888444.1|  PREDICTED: major facilitator superfamily dom...    159   3e-39    
ref|XP_005141343.1|  PREDICTED: major facilitator superfamily dom...    159   3e-39    
gb|EFN71460.1|  Uncharacterized MFS-type transporter C19orf28           159   4e-39    
ref|XP_004876300.1|  PREDICTED: major facilitator superfamily dom...    156   1e-38    
gb|EYB95330.1|  hypothetical protein Y032_0161g3371                     158   2e-38    
ref|XP_004441467.1|  PREDICTED: major facilitator superfamily dom...    160   2e-38    
ref|XP_006568930.1|  PREDICTED: major facilitator superfamily dom...    157   2e-38    
gb|EFN85217.1|  Uncharacterized MFS-type transporter C19orf28-lik...    157   2e-38    
ref|XP_001633889.1|  predicted protein                                  156   2e-38    Nematostella vectensis
gb|EFN66493.1|  Uncharacterized MFS-type transporter C19orf28-lik...    157   2e-38    
gb|EHH29465.1|  hypothetical protein EGK_09905                          156   3e-38    
ref|XP_005682718.1|  PREDICTED: major facilitator superfamily dom...    156   4e-38    
ref|XP_004596001.1|  PREDICTED: major facilitator superfamily dom...    156   6e-38    
ref|XP_005531446.1|  PREDICTED: major facilitator superfamily dom...    159   7e-38    
ref|XP_010826745.1|  PREDICTED: major facilitator superfamily dom...    154   8e-38    
ref|XP_002190267.1|  PREDICTED: major facilitator superfamily dom...    155   1e-37    
ref|XP_002124684.1|  PREDICTED: major facilitator superfamily dom...    155   1e-37    
ref|XP_003117596.1|  hypothetical protein CRE_00796                     155   2e-37    
ref|XP_003788915.1|  PREDICTED: major facilitator superfamily dom...    154   2e-37    
ref|XP_007992977.1|  PREDICTED: major facilitator superfamily dom...    153   2e-37    
ref|XP_007440722.1|  PREDICTED: major facilitator superfamily dom...    152   3e-37    
ref|XP_006904268.1|  PREDICTED: major facilitator superfamily dom...    152   3e-37    
ref|XP_010766474.1|  PREDICTED: major facilitator superfamily dom...    151   6e-37    
ref|XP_006047940.1|  PREDICTED: major facilitator superfamily dom...    153   6e-37    
ref|XP_006027261.1|  PREDICTED: major facilitator superfamily dom...    152   7e-37    
gb|KHJ98311.1|  transporter, major facilitator family protein           153   8e-37    
ref|XP_002644575.1|  Hypothetical protein CBG14518                      153   8e-37    
ref|XP_010732816.1|  PREDICTED: major facilitator superfamily dom...    151   1e-36    
ref|XP_005060023.1|  PREDICTED: major facilitator superfamily dom...    154   1e-36    
ref|NP_508799.1|  Protein F16H11.1                                      152   2e-36    
ref|XP_001626721.1|  predicted protein                                  150   2e-36    
gb|EGT30562.1|  hypothetical protein CAEBREN_04487                      151   2e-36    
ref|XP_003701555.1|  PREDICTED: major facilitator superfamily dom...    150   3e-36    
ref|XP_010365590.1|  PREDICTED: major facilitator superfamily dom...    150   3e-36    
ref|XP_005633291.1|  PREDICTED: major facilitator superfamily dom...    149   5e-36    
ref|XP_003739746.1|  PREDICTED: LOW QUALITY PROTEIN: major facili...    150   6e-36    
emb|CCI10446.1|  unnamed protein product                                150   8e-36    
ref|XP_003945320.2|  PREDICTED: major facilitator superfamily dom...    148   1e-35    
ref|XP_006754181.1|  PREDICTED: major facilitator superfamily dom...    150   1e-35    
ref|XP_002428423.1|  conserved hypothetical protein                     149   1e-35    
gb|ELK19378.1|  hypothetical protein PAL_GLEAN10006030                  147   2e-35    
gb|EFX89093.1|  hypothetical protein DAPPUDRAFT_304667                  148   3e-35    
ref|XP_005654766.1|  PREDICTED: major facilitator superfamily dom...    147   3e-35    
emb|CDW56513.1|  MFS 2 domain containing protein                        148   3e-35    
ref|XP_009275360.1|  PREDICTED: major facilitator superfamily dom...    147   3e-35    
ref|XP_605041.6|  PREDICTED: major facilitator superfamily domain...    146   4e-35    
ref|XP_010994367.1|  PREDICTED: LOW QUALITY PROTEIN: major facili...    147   4e-35    
gb|AEE62599.1|  unknown                                                 147   6e-35    
gb|KFO53561.1|  Major facilitator superfamily domain-containing p...    144   7e-35    
gb|EPQ03104.1|  hypothetical protein D623_10016322                      145   7e-35    
gb|KFM83111.1|  Major facilitator superfamily domain-containing p...    146   8e-35    
ref|XP_006612438.1|  PREDICTED: major facilitator superfamily dom...    146   1e-34    
ref|XP_008637817.1|  PREDICTED: major facilitator superfamily dom...    145   1e-34    
ref|XP_003393809.1|  PREDICTED: uncharacterized MFS-type transpor...    145   1e-34    
gb|KFM06024.1|  Major facilitator superfamily domain-containing p...    144   1e-34    
ref|XP_005858917.1|  PREDICTED: major facilitator superfamily dom...    145   1e-34    
ref|XP_003490626.1|  PREDICTED: uncharacterized MFS-type transpor...    145   2e-34    
gb|ERL86416.1|  hypothetical protein D910_03823                         145   2e-34    
gb|KFO13838.1|  Major facilitator superfamily domain-containing p...    143   2e-34    
gb|ENN79329.1|  hypothetical protein YQE_04238                          145   2e-34    
gb|EMP26111.1|  Putative MFS-type transporter C19orf28 like protein     143   2e-34    
ref|XP_001898485.1|  C19orf28 protein                                   145   2e-34    
gb|ERL85998.1|  hypothetical protein D910_03412                         145   2e-34    
gb|ENN73125.1|  hypothetical protein YQE_10266                          144   3e-34    
ref|XP_007176612.1|  PREDICTED: major facilitator superfamily dom...    144   4e-34    
gb|KFD68349.1|  hypothetical protein M514_07333                         145   4e-34    
ref|XP_009668179.1|  PREDICTED: major facilitator superfamily dom...    143   4e-34    
gb|KFV62391.1|  Major facilitator superfamily domain-containing p...    142   4e-34    
ref|XP_003460868.1|  PREDICTED: LOW QUALITY PROTEIN: major facili...    145   5e-34    
gb|KHJ47745.1|  transporter, major facilitator family protein           145   6e-34    
gb|KFQ33728.1|  Major facilitator superfamily domain-containing p...    142   6e-34    
ref|XP_010180803.1|  PREDICTED: major facilitator superfamily dom...    143   6e-34    
gb|KFU93976.1|  Major facilitator superfamily domain-containing p...    142   6e-34    
gb|ERE72326.1|  putative uncharacterized MFS-type transporter C19...    142   6e-34    
gb|KFD51806.1|  hypothetical protein M513_07333                         145   9e-34    
gb|KGL89678.1|  Major facilitator superfamily domain-containing p...    141   1e-33    
ref|XP_008178307.1|  PREDICTED: major facilitator superfamily dom...    143   1e-33    
gb|EJW88644.1|  hypothetical protein WUBG_00448                         143   1e-33    
ref|XP_007645153.1|  PREDICTED: major facilitator superfamily dom...    142   1e-33    
ref|XP_010001719.1|  PREDICTED: major facilitator superfamily dom...    144   1e-33    
ref|XP_008970944.1|  PREDICTED: major facilitator superfamily dom...    142   1e-33    
gb|EHJ77994.1|  hypothetical protein KGM_17386                          142   1e-33    
ref|XP_008178306.1|  PREDICTED: major facilitator superfamily dom...    143   2e-33    
gb|KFV78722.1|  Major facilitator superfamily domain-containing p...    140   2e-33    
gb|EHA97613.1|  hypothetical protein GW7_11314                          142   2e-33    
ref|XP_010306721.1|  PREDICTED: LOW QUALITY PROTEIN: major facili...    140   2e-33    
gb|KFQ87043.1|  Major facilitator superfamily domain-containing p...    140   2e-33    
ref|XP_008298189.1|  PREDICTED: major facilitator superfamily dom...    140   2e-33    
emb|CDJ90863.1|  Major facilitator superfamily MFS-1 domain conta...    143   3e-33    
ref|XP_010220088.1|  PREDICTED: LOW QUALITY PROTEIN: major facili...    140   3e-33    
ref|XP_008985249.1|  PREDICTED: major facilitator superfamily dom...    140   3e-33    
gb|KFP14796.1|  Major facilitator superfamily domain-containing p...    140   3e-33    
ref|XP_010580135.1|  PREDICTED: major facilitator superfamily dom...    141   4e-33    
ref|XP_004932328.1|  PREDICTED: major facilitator superfamily dom...    141   4e-33    
ref|XP_009486029.1|  PREDICTED: major facilitator superfamily dom...    139   5e-33    
gb|KFQ12651.1|  Major facilitator superfamily domain-containing p...    139   5e-33    
ref|XP_009471186.1|  PREDICTED: LOW QUALITY PROTEIN: major facili...    141   5e-33    
ref|XP_009095186.1|  PREDICTED: major facilitator superfamily dom...    140   5e-33    
ref|XP_009908098.1|  PREDICTED: major facilitator superfamily dom...    143   6e-33    
gb|KFW10780.1|  Major facilitator superfamily domain-containing p...    139   6e-33    
ref|XP_011054843.1|  PREDICTED: LOW QUALITY PROTEIN: major facili...    140   8e-33    
ref|XP_004948762.1|  PREDICTED: major facilitator superfamily dom...    140   9e-33    
ref|XP_007070093.1|  PREDICTED: major facilitator superfamily dom...    139   9e-33    
ref|XP_004771443.1|  PREDICTED: major facilitator superfamily dom...    140   1e-32    
gb|ELR61739.1|  hypothetical protein M91_18634                          139   1e-32    
ref|XP_004809331.1|  PREDICTED: major facilitator superfamily dom...    139   1e-32    
ref|XP_006928312.1|  PREDICTED: major facilitator superfamily dom...    139   1e-32    
ref|XP_009635738.1|  PREDICTED: major facilitator superfamily dom...    139   1e-32    
ref|XP_010155912.1|  PREDICTED: major facilitator superfamily dom...    138   3e-32    
ref|XP_009951047.1|  PREDICTED: major facilitator superfamily dom...    137   4e-32    
ref|XP_004948761.1|  PREDICTED: major facilitator superfamily dom...    138   4e-32    
gb|KFP54787.1|  Major facilitator superfamily domain-containing p...    136   6e-32    
ref|XP_003141002.1|  hypothetical protein LOAG_05415                    138   7e-32    
ref|XP_003428890.1|  PREDICTED: major facilitator superfamily dom...    136   7e-32    
gb|ETN87250.1|  transporter, major facilitator family protein           138   8e-32    
ref|XP_006623213.1|  PREDICTED: major facilitator superfamily dom...    136   1e-31    
emb|CDP97002.1|  Protein Bm3411                                         137   1e-31    
ref|XP_009878931.1|  PREDICTED: major facilitator superfamily dom...    139   2e-31    
ref|XP_010176660.1|  PREDICTED: major facilitator superfamily dom...    134   3e-31    
ref|XP_007104298.1|  PREDICTED: major facilitator superfamily dom...    134   4e-31    
ref|XP_005514173.1|  PREDICTED: major facilitator superfamily dom...    134   7e-31    
ref|XP_005240901.1|  PREDICTED: major facilitator superfamily dom...    134   7e-31    
gb|EAR84718.2|  MFS transporter                                         136   8e-31    
ref|XP_003386774.1|  PREDICTED: uncharacterized MFS-type transpor...    132   1e-30    
gb|KFO28859.1|  hypothetical protein H920_09801                         133   1e-30    
gb|EFZ13257.1|  hypothetical protein SINV_10626                         134   1e-30    
ref|XP_008581114.1|  PREDICTED: major facilitator superfamily dom...    133   1e-30    
ref|XP_005999124.1|  PREDICTED: major facilitator superfamily dom...    132   1e-30    
ref|XP_003391618.1|  PREDICTED: uncharacterized MFS-type transpor...    130   3e-30    
ref|XP_001632829.1|  predicted protein                                  132   4e-30    
emb|CDW80446.1|  UNKNOWN                                                133   4e-30    
ref|XP_006898024.1|  PREDICTED: major facilitator superfamily dom...    133   5e-30    
ref|XP_010633408.1|  PREDICTED: major facilitator superfamily dom...    133   5e-30    
ref|XP_008922527.1|  PREDICTED: major facilitator superfamily dom...    134   7e-30    
ref|XP_009986248.1|  PREDICTED: major facilitator superfamily dom...    129   2e-29    
gb|EHH59065.1|  hypothetical protein EGM_09078                          129   2e-29    
ref|XP_005950571.1|  PREDICTED: major facilitator superfamily dom...    129   2e-29    
gb|KFW81256.1|  Major facilitator superfamily domain-containing p...    129   2e-29    
gb|KFP04412.1|  Major facilitator superfamily domain-containing p...    129   3e-29    
ref|XP_002425200.1|  conserved hypothetical protein                     129   4e-29    
ref|XP_010365589.1|  PREDICTED: major facilitator superfamily dom...    129   4e-29    
ref|XP_001640411.1|  predicted protein                                  128   8e-29    
ref|XP_005587568.1|  PREDICTED: major facilitator superfamily dom...    128   9e-29    
ref|XP_001032381.1|  Major Facilitator Superfamily protein              130   1e-28    
emb|CEF59702.1|  Major facilitator superfamily domain, general su...    129   1e-28    
gb|KFV05728.1|  Major facilitator superfamily domain-containing p...    126   2e-28    
ref|XP_008496642.1|  PREDICTED: major facilitator superfamily dom...    127   2e-28    
ref|XP_009072855.1|  PREDICTED: LOW QUALITY PROTEIN: major facili...    126   2e-28    
ref|NP_001266428.1|  uncharacterized protein LOC101741261               127   3e-28    
ref|XP_003243797.2|  PREDICTED: major facilitator superfamily dom...    127   3e-28    
ref|XP_003696874.1|  PREDICTED: major facilitator superfamily dom...    126   3e-28    
ref|XP_005259547.1|  PREDICTED: major facilitator superfamily dom...    127   3e-28    
ref|XP_008763329.1|  PREDICTED: major facilitator superfamily dom...    125   5e-28    
ref|XP_001606193.2|  PREDICTED: major facilitator superfamily dom...    126   6e-28    
ref|XP_010086255.1|  PREDICTED: major facilitator superfamily dom...    125   7e-28    
gb|ERG82049.1|  major facilitator superfamily domain-containing p...    125   1e-27    
ref|XP_008558786.1|  PREDICTED: major facilitator superfamily dom...    125   1e-27    
ref|XP_008835255.1|  PREDICTED: major facilitator superfamily dom...    124   2e-27    
gb|KFP80102.1|  Major facilitator superfamily domain-containing p...    123   2e-27    
ref|XP_011051140.1|  PREDICTED: major facilitator superfamily dom...    124   2e-27    
gb|EJY68006.1|  Major Facilitator Superfamily protein                   125   3e-27    
ref|XP_001636563.1|  predicted protein                                  123   3e-27    
emb|CBY24921.1|  unnamed protein product                                124   4e-27    
ref|XP_001641726.1|  predicted protein                                  122   6e-27    
ref|XP_002601624.1|  hypothetical protein BRAFLDRAFT_85807              122   8e-27    
gb|KFB47490.1|  AGAP011492-PA-like protein                              123   2e-26    
ref|XP_006814602.1|  PREDICTED: major facilitator superfamily dom...    119   5e-26    
gb|EFX79741.1|  hypothetical protein DAPPUDRAFT_319148                  121   5e-26    
gb|KFZ52697.1|  Major facilitator superfamily domain-containing p...    119   5e-26    
ref|XP_005434455.1|  PREDICTED: major facilitator superfamily dom...    119   9e-26    
gb|KFQ23295.1|  Major facilitator superfamily domain-containing p...    117   9e-26    
ref|XP_006114863.1|  PREDICTED: major facilitator superfamily dom...    118   1e-25    
ref|NP_001280547.1|  uncharacterized protein LOC655856                  119   2e-25    
emb|CDW85081.1|  UNKNOWN                                                119   3e-25    
ref|XP_008193388.1|  PREDICTED: major facilitator superfamily dom...    118   3e-25    
gb|EJY78306.1|  Major Facilitator Superfamily protein                   119   4e-25    
ref|XP_008946957.1|  PREDICTED: major facilitator superfamily dom...    115   5e-25    
emb|CAG12356.1|  unnamed protein product                                117   5e-25    
dbj|BAD37394.1|  sugar transport protein-like                           111   1e-24    
gb|EEE66052.1|  hypothetical protein OsJ_22043                          112   1e-24    
gb|EGI65182.1|  Uncharacterized MFS-type transporter C19orf28           116   2e-24    
ref|XP_008467014.1|  PREDICTED: major facilitator superfamily dom...    109   3e-24    
emb|CDW90654.1|  UNKNOWN                                                116   4e-24    
ref|XP_005494316.1|  PREDICTED: major facilitator superfamily dom...    113   5e-24    
gb|EHJ63438.1|  hypothetical protein KGM_16599                          115   5e-24    
gb|ERL89193.1|  hypothetical protein D910_06567                         113   7e-24    
ref|XP_009513230.1|  PREDICTED: LOW QUALITY PROTEIN: major facili...    113   8e-24    
gb|KFW86029.1|  Major facilitator superfamily domain-containing p...    113   1e-23    
ref|XP_007949278.1|  PREDICTED: major facilitator superfamily dom...    114   1e-23    
gb|EFN89248.1|  Uncharacterized MFS-type transporter C19orf28           113   1e-23    
ref|XP_005427399.1|  PREDICTED: LOW QUALITY PROTEIN: major facili...    111   1e-23    
emb|CDW73895.1|  UNKNOWN                                                114   2e-23    
ref|XP_001631616.1|  predicted protein                                  111   5e-23    
ref|XP_009579957.1|  PREDICTED: LOW QUALITY PROTEIN: major facili...    110   6e-23    
ref|XP_008479618.1|  PREDICTED: major facilitator superfamily dom...    109   2e-22    
ref|XP_004331886.1|  PREDICTED: major facilitator superfamily dom...    107   2e-22    
ref|XP_010291119.1|  PREDICTED: major facilitator superfamily dom...    108   2e-22    
gb|EYB95329.1|  hypothetical protein Y032_0161g3371                     108   3e-22    
ref|XP_003276993.2|  PREDICTED: uncharacterized protein LOC100586780    110   3e-22    
gb|EQB77595.1|  hypothetical protein CB1_000413020                      107   9e-22    
ref|XP_317809.4|  AGAP011492-PA                                         108   1e-21    
ref|XP_009832598.1|  hypothetical protein, variant                      106   1e-21    
ref|XP_009832600.1|  hypothetical protein, variant                      106   1e-21    
gb|KFQ48172.1|  Major facilitator superfamily domain-containing p...    105   1e-21    
ref|XP_010011394.1|  PREDICTED: major facilitator superfamily dom...    104   2e-21    
ref|XP_001652284.1|  hypothetical protein AaeL_AAEL006862               107   3e-21    
gb|EFA11449.1|  hypothetical protein TcasGA2_TC013631                   107   3e-21    
emb|CCA24639.1|  GlycosidePentosideHexuronide (GPH):Cation Sympor...    107   3e-21    
ref|XP_004029854.1|  major facilitator superfamily protein, putative    106   4e-21    
emb|CBY13110.1|  unnamed protein product                                106   6e-21    
gb|ETN62993.1|  hypothetical protein AND_005309                         106   6e-21    
gb|EEC81018.1|  hypothetical protein OsI_23785                        98.6    1e-20    
ref|XP_008709625.1|  PREDICTED: LOW QUALITY PROTEIN: major facili...    103   3e-20    
ref|XP_008872639.1|  hypothetical protein H310_08594                    103   5e-20    
gb|EZA52900.1|  hypothetical protein X777_07725                         102   7e-20    
ref|XP_004447565.1|  PREDICTED: major facilitator superfamily dom...    101   9e-20    
ref|XP_009321279.1|  PREDICTED: major facilitator superfamily dom...    101   9e-20    
ref|XP_004035636.1|  major facilitator superfamily protein, putative    102   1e-19    
gb|KFW66351.1|  Major facilitator superfamily domain-containing p...  99.8    2e-19    
ref|XP_010409792.1|  PREDICTED: major facilitator superfamily dom...    100   7e-19    
gb|KFP68013.1|  Major facilitator superfamily domain-containing p...  94.7    2e-18    
gb|ETE65866.1|  hypothetical protein L345_08364                       97.1    3e-18    
gb|AAC16078.1|  hypothetical protein                                  93.6    5e-18    
ref|XP_006171897.1|  PREDICTED: major facilitator superfamily dom...  95.9    9e-18    
ref|XP_009704503.1|  PREDICTED: major facilitator superfamily dom...  92.8    1e-17    
emb|CCD79094.1|  hypothetical protein Smp_149880                      94.0    2e-17    
gb|KIH57462.1|  hypothetical protein ANCDUO_12347                     92.8    3e-17    
ref|XP_003388124.1|  PREDICTED: uncharacterized MFS-type transpor...  92.4    1e-16    
ref|XP_007245221.1|  PREDICTED: major facilitator superfamily dom...  88.6    4e-16    
ref|XP_004210539.1|  PREDICTED: major facilitator superfamily dom...  87.0    9e-16    
gb|KHJ98312.1|  hypothetical protein OESDEN_01715                     87.8    1e-15    
tpg|DAA41217.1|  TPA: hypothetical protein ZEAMMB73_846771            83.6    1e-15    



>ref|XP_006338921.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Solanum tuberosum]
Length=451

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/456 (72%), Positives = 376/456 (82%), Gaps = 9/456 (2%)
 Frame = -2

Query  1626  MGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLV  1447
             M  +   ++E K LGRCSV TY VGHMLNDIT  CWYTYLLLYLTDIGLSPS+AA VTL 
Sbjct  1     MMVNEMVDDEPKSLGRCSVFTYAVGHMLNDITSSCWYTYLLLYLTDIGLSPSNAATVTLT  60

Query  1446  GQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
             GQFADAFTTIIAGELIDRFG FKIWHG GC++V +SF SLFGG C+PCKILGSDSP VQT
Sbjct  61    GQFADAFTTIIAGELIDRFGHFKIWHGMGCLLVALSFTSLFGG-CLPCKILGSDSPVVQT  119

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
              GYCIS+V+FCSGWSCTQISHMSMVN +TLN +SR+ACVSCRNAFTM+ASL+LY + FFV
Sbjct  120   AGYCISSVIFCSGWSCTQISHMSMVNGVTLNPTSRVACVSCRNAFTMIASLILYVIVFFV  179

Query  1086  FTNNAE----DIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTY  919
             F         DIK QY+ M +ISIFIG VFVIIF LG KEP  K +   ++  +   WTY
Sbjct  180   FNKETSSSQVDIKNQYQLMVYISIFIGAVFVIIFQLGTKEPSLKQESNGKR--ATASWTY  237

Query  918   WLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVL  739
             WLK+VLYYQV SIYV TRVVTNVSQTFLAVYVINDLRMS S+K+L+PAIIYL SF+ SVL
Sbjct  238   WLKKVLYYQVLSIYVLTRVVTNVSQTFLAVYVINDLRMSPSSKALIPAIIYLSSFVASVL  297

Query  738   LQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIG  559
             LQEL+WSG+RLK FF+ GG+LWL CGAVV+ LPI M++FMY LS+LIGIANALMMVT+IG
Sbjct  298   LQELKWSGERLKAFFSAGGLLWLFCGAVVIFLPINMHAFMYVLSILIGIANALMMVTAIG  357

Query  558   MESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRFSL  379
             MES LVD+ LDGSAFVYGS+GFIDKVLCGV LYFLES+E ADPV C+    CFSVTRFSL
Sbjct  358   MESELVDEDLDGSAFVYGSLGFIDKVLCGVFLYFLESYESADPVPCDLTYPCFSVTRFSL  417

Query  378   GFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
             GFIPGI+AL GV+V+F ++  HT + K  L EP LA
Sbjct  418   GFIPGISALIGVVVAFFIR-FHTPNPKT-LREPFLA  451



>ref|XP_006359138.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Solanum tuberosum]
Length=451

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/451 (64%), Positives = 345/451 (76%), Gaps = 5/451 (1%)
 Frame = -2

Query  1617  DNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQF  1438
              N E EE KPLGR SVL YGVGH+LNDIT   WYTYLLLYLT IG+ P   A + +  QF
Sbjct  4     SNVENEEAKPLGRWSVLAYGVGHVLNDITSTYWYTYLLLYLTSIGMPPKQVAALAITAQF  63

Query  1437  ADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGY  1258
              DA  TIIAGELIDRFG FKIWH  G ++V  +F S + G C+PCKI+G D+P VQ +GY
Sbjct  64    TDATMTIIAGELIDRFGHFKIWHAVGTVLVSAAFSSFYWGVCVPCKIIGIDTPLVQMIGY  123

Query  1257  CISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTN  1078
              +  ++F  GWSCTQ+SHM+MVN +TL+++SR+ACVSCRNAFTMVASL++Y + FF+F +
Sbjct  124   YMFDIIFSGGWSCTQVSHMAMVNGLTLDQTSRVACVSCRNAFTMVASLIVYGIGFFIFNS  183

Query  1077  NAE--DIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRV  904
             + +  +IK QY  +A I++ IG  FVI+FHLG KEPR K    H      + W  WLK  
Sbjct  184   SVKQVEIKEQYHLLATITVLIGCFFVILFHLGTKEPRVKQVS-HTTNPRGSSWKRWLKNG  242

Query  903   LYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELE  724
             LYY+VASIYV TRVVTN+SQ FLA+YVI+DL MSQS+K+LVPAIIYLCSFITS+LLQELE
Sbjct  243   LYYRVASIYVLTRVVTNISQVFLALYVISDLHMSQSSKALVPAIIYLCSFITSILLQELE  302

Query  723   WSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESAL  544
             WS  RLK  F+ GG LWL C AVV+ LPI MN FMY LSV+IGIANA MMVTS+GMES L
Sbjct  303   WSSHRLKAIFSVGGFLWLFCSAVVLSLPINMNIFMYILSVVIGIANAFMMVTSVGMESEL  362

Query  543   VDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRFSLGFIPG  364
             VDK ++GSAFVYGS+GF++KVLCGV LY LES+E   P ACNPA  CF+VTRFSLGFIPG
Sbjct  363   VDKEVEGSAFVYGSLGFVEKVLCGVMLYILESYESVTPAACNPAYPCFTVTRFSLGFIPG  422

Query  363   IAALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
             +AAL GVIV+   K   TSH   PLAEPLLA
Sbjct  423   VAALAGVIVTCFTK-FRTSH-PDPLAEPLLA  451



>ref|XP_004229334.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Solanum lycopersicum]
Length=451

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/450 (62%), Positives = 341/450 (76%), Gaps = 5/450 (1%)
 Frame = -2

Query  1617  DNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQF  1438
              N E EE KPLGR SVL YGVGH+LNDIT   WYTYLLLYLT +G+ P   A + +  QF
Sbjct  4     SNVENEEAKPLGRWSVLAYGVGHVLNDITSTYWYTYLLLYLTSMGMPPKQVAALAITAQF  63

Query  1437  ADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGY  1258
              DA  TIIAGELIDRFG FKIWH  G ++V  +F S F G C+PCKI+G D+P VQ +GY
Sbjct  64    TDATMTIIAGELIDRFGHFKIWHAVGTVLVSAAFYSFFWGVCVPCKIIGIDTPLVQMIGY  123

Query  1257  CISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTN  1078
              +  ++F  GWSCTQ+SHM+MVN +TL+++SR+ACVSCRNAFTMVASL++Y + FF+F +
Sbjct  124   YMFDILFSGGWSCTQVSHMAMVNGLTLDQTSRVACVSCRNAFTMVASLIVYGIGFFIFNS  183

Query  1077  NAE--DIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRV  904
             + +  +IK QY  +A I++ IG  FVI+FHLG KEP  K    H+     + W  WLK  
Sbjct  184   SVKQVEIKEQYHLLATITVLIGCFFVILFHLGTKEPSVKQVS-HQTNRRGSSWKRWLKNG  242

Query  903   LYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELE  724
             LYY+VASIYV TRVVTN+SQ FLA+YVI+DL MSQS+K+LVPAIIYLCSFITS+ LQELE
Sbjct  243   LYYRVASIYVLTRVVTNISQVFLALYVISDLHMSQSSKALVPAIIYLCSFITSIFLQELE  302

Query  723   WSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESAL  544
             W+  RLK  F+ GG+LWL C AVV+ LPI MN FMY LSV+IGIANA MMVTS+GMES L
Sbjct  303   WNNHRLKAIFSVGGLLWLFCSAVVLSLPINMNVFMYILSVVIGIANAFMMVTSVGMESEL  362

Query  543   VDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRFSLGFIPG  364
             VDK ++GSAFVYGS+GF++KVLCGV LY LES+E   P +CNPA  CF+VTRFSLGFIPG
Sbjct  363   VDKEVEGSAFVYGSLGFVEKVLCGVMLYILESYESVTPASCNPAYPCFTVTRFSLGFIPG  422

Query  363   IAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             +AAL GVIV+   K    +   +P  EPLL
Sbjct  423   VAALVGVIVTCFTKF--RTSLPEPFTEPLL  450



>ref|XP_011086870.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Sesamum indicum]
Length=455

 Score =   526 bits (1354),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 272/457 (60%), Positives = 344/457 (75%), Gaps = 10/457 (2%)
 Frame = -2

Query  1623  GRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVG  1444
             G  + +E   KPLGRCSV  YGVGHMLNDIT  CW+TYLL++LTDIGL+PS AAIV L G
Sbjct  3     GDTSNDESCTKPLGRCSVFYYGVGHMLNDITSACWFTYLLVFLTDIGLAPSDAAIVMLSG  62

Query  1443  QFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTV  1264
             Q AD FTT+ AGELIDR+G FKIWHGAG ++V +SF S+FGG C+PCKI+GS+S ++QT+
Sbjct  63    QIADGFTTVFAGELIDRYGHFKIWHGAGSLLVAISFSSVFGG-CLPCKIIGSNSSSMQTI  121

Query  1263  GYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF  1084
             GY   A +F  GW+ TQ+SHMSMVNCITLN +SR+   SCRNAFTMVA+L LYAV F VF
Sbjct  122   GYSFFAAIFNVGWAATQVSHMSMVNCITLNSTSRVVLASCRNAFTMVANLSLYAVAFVVF  181

Query  1083  TNNAE----DIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYW  916
               N      D++ QYRW+A+ SIFIG  FV +FHLG +EPR K +  HEK  +   WTYW
Sbjct  182   NINTAGSVIDVENQYRWIAYTSIFIGCCFVGVFHLGTEEPRLKRE-AHEKGHARISWTYW  240

Query  915   LKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLL  736
               ++LYYQVA +YV TR+VTNVSQ FLA YVINDL M+QS+K+LVPA+IY+CSFI S+LL
Sbjct  241   FNKLLYYQVALVYVLTRLVTNVSQAFLAFYVINDLHMTQSSKALVPAVIYICSFIISILL  300

Query  735   QELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGM  556
             QE+ W+G+RLK F++ GG+LW++ GA ++ LP  M +FMY LS+ IGIANALMMV+ I M
Sbjct  301   QEVTWTGQRLKAFYSAGGLLWIISGAAILFLPSSMKAFMYILSIAIGIANALMMVSGISM  360

Query  555   ESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACF--SVTRFS  382
             +S LV   L+G AFVYGS+ F+DK+LCG+AL  LES++ + P   N   + F  SVTR+ 
Sbjct  361   QSFLVGDDLNGCAFVYGSLSFLDKILCGLALSVLESYQSSTPEVRNCPHSSFHLSVTRYG  420

Query  381   LGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
             LG +P I AL GV+V+ +MKL   +    PL +PLLA
Sbjct  421   LGLVPAICALVGVLVTLSMKLPEPT--LTPLTDPLLA  455



>ref|XP_002270525.2| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Vitis vinifera]
 ref|XP_010659542.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Vitis vinifera]
 ref|XP_010659543.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Vitis vinifera]
 ref|XP_010659544.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Vitis vinifera]
 ref|XP_010659545.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Vitis vinifera]
 ref|XP_010659546.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Vitis vinifera]
 emb|CBI32155.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   518 bits (1334),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 275/455 (60%), Positives = 343/455 (75%), Gaps = 10/455 (2%)
 Frame = -2

Query  1617  DNREEEEE--KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVG  1444
             D  E+++   KPLGR +V  YGVGHMLNDIT  CW+TYLL++LTDIGL    AA V L G
Sbjct  3     DGMEDDDAFTKPLGRQAVFYYGVGHMLNDITSACWFTYLLVFLTDIGLPSRDAATVMLSG  62

Query  1443  QFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTV  1264
             Q AD FTTI AGELIDRFG FKIWHGAG I+V VSF S+FGG C+PCKI GS+S T+QTV
Sbjct  63    QIADGFTTIFAGELIDRFGHFKIWHGAGSILVAVSFSSVFGG-CLPCKIFGSNSSTLQTV  121

Query  1263  GYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF  1084
             GY + A +F  GW+ TQ+SHMSMVNCITLN +SR+   SCRNAFTMVA+L LYAV F VF
Sbjct  122   GYSMFAAIFNVGWAATQVSHMSMVNCITLNSTSRVVLASCRNAFTMVANLSLYAVAFVVF  181

Query  1083  TNNAE----DIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYW  916
              ++      DI+ QYRW+A++SI IG  FV IF LG KEPR K    H K  +   W++W
Sbjct  182   NSSKPHTLVDIENQYRWIAYLSIAIGCCFVAIFLLGTKEPRLKKG-AHGKGYARILWSHW  240

Query  915   LKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLL  736
              ++VLYYQVA +YV TR+VTNVSQ FLA YVINDL+MSQS+K+LVPAIIY+CSFI S++L
Sbjct  241   FRKVLYYQVALVYVLTRLVTNVSQAFLAFYVINDLQMSQSSKALVPAIIYICSFIVSIIL  300

Query  735   QELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGM  556
             QE  WSG+RLK F++ GGILW++CGA ++ LP  MN+FMY LS++IGIANALMMVT + M
Sbjct  301   QEFTWSGQRLKAFYSAGGILWIICGAGILFLPRNMNAFMYILSIIIGIANALMMVTGVSM  360

Query  555   ESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRFSLG  376
             +S LV + L G AFVYGS+ F+DK+ CG+AL+ LES+ ++ P       + FSV+R+ LG
Sbjct  361   QSFLVGEDLHGCAFVYGSLSFLDKISCGLALFVLESYGNSSPDLQGSVISRFSVSRYGLG  420

Query  375   FIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
              +P + AL GV+V++TM  LHT   K P+ EPLLA
Sbjct  421   VVPAVCALVGVVVTYTMN-LHTPVPK-PIMEPLLA  453



>ref|XP_010691839.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010691840.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Beta vulgaris subsp. vulgaris]
Length=455

 Score =   517 bits (1332),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 271/453 (60%), Positives = 344/453 (76%), Gaps = 12/453 (3%)
 Frame = -2

Query  1608  EEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQFADA  1429
             EE   +P+GR  V  YGVGHMLNDIT  CW+TYLL++LTDIGLSP  AAIV L GQ AD 
Sbjct  8     EESFNRPIGRWPVFVYGVGHMLNDITSACWFTYLLVFLTDIGLSPGDAAIVMLSGQVADG  67

Query  1428  FTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCIS  1249
             F T  +GELIDRFG+FK+WHGAG ++V VSF S+FGG CIPCKI+G+DS T+QT+GY I 
Sbjct  68    FMTAFSGELIDRFGRFKVWHGAGSLLVAVSFSSVFGG-CIPCKIMGTDSSTLQTIGYSIF  126

Query  1248  AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF----T  1081
             A +F  GW+ TQ+SHMSMVNC+TLN +SR+   SCRNAFTMVA+L LYAV F VF    +
Sbjct  127   AAIFNIGWAATQVSHMSMVNCMTLNPTSRVVLASCRNAFTMVANLSLYAVAFAVFGLSKS  186

Query  1080  NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVL  901
                 DI+ QYRW+A+ SIFIG  FV IF +G KEPR KD     K+ +   WTYW  +VL
Sbjct  187   RTHADIEYQYRWIAYSSIFIGCCFVCIFLIGTKEPRLKDCF-PGKVYARIEWTYWFHKVL  245

Query  900   YYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEW  721
             YYQVA +YV TR+VTNVSQ+FLA YVINDL+M+QS+K+LVPAIIY+CSFI S++LQE+ W
Sbjct  246   YYQVALVYVLTRLVTNVSQSFLAFYVINDLQMAQSSKALVPAIIYICSFIISLILQEMPW  305

Query  720   SGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALV  541
              G RLK+F++ GG+LW+ CGA V+ LP  M+ +MY +S++IGIANALMMVT +GM+SALV
Sbjct  306   PGHRLKLFYSIGGVLWIFCGAAVLFLPQAMSGYMYIISIVIGIANALMMVTGVGMQSALV  365

Query  540   DKHLDGSAFVYGSMGFIDKVLCGVALYFLESFE---DADPVACNPAQACFSVTRFSLGFI  370
              + L+G AFVYGS+ F+DK+ CGV LYFLESF+    ++    + +   FS+TR++LGF+
Sbjct  366   GQDLNGCAFVYGSLSFMDKMACGVVLYFLESFQSNVSSNTTVLHSSTLSFSITRYALGFV  425

Query  369   PGIAALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
             P I+AL GV V+++M L        PLA+PLLA
Sbjct  426   PAISALIGVAVTYSMNL---ETPLTPLAQPLLA  455



>ref|XP_009620863.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009620864.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009620865.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Nicotiana tomentosiformis]
Length=455

 Score =   512 bits (1319),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 271/462 (59%), Positives = 347/462 (75%), Gaps = 17/462 (4%)
 Frame = -2

Query  1626  MGRDNREEEE-EKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTL  1450
             M   N+++E   KPLGRCSV  YGVGHMLNDIT  CW+TYLL++LTDIGLSPS AA+V L
Sbjct  1     MVNHNQDDESCTKPLGRCSVFYYGVGHMLNDITSACWFTYLLVFLTDIGLSPSDAAVVML  60

Query  1449  VGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQ  1270
              GQ AD  TT+ AGELIDRFG FK+WH AG ++VGVSF S+FGG C+PCK++GSDS  +Q
Sbjct  61    SGQVADGLTTVFAGELIDRFGHFKVWHLAGSVLVGVSFSSVFGG-CLPCKLIGSDSVMLQ  119

Query  1269  TVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFF  1090
             T+GY + A +F  GW+ TQ+SHMSMVNCITLN +SR+   SCRNAFTM+A+L LYAV F 
Sbjct  120   TIGYSVFAAIFNVGWAATQVSHMSMVNCITLNSTSRVVLASCRNAFTMIANLSLYAVAFA  179

Query  1089  VFT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDD---DGHEKIGSNT  931
             VF          I+ QYRW+A+ISIFIG  FV +FHLG +EPR   +    G+ +I    
Sbjct  180   VFNVVGAGTPAAIENQYRWIAYISIFIGSCFVGVFHLGTREPRLNLEARVKGYVRIS---  236

Query  930   PWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFI  751
              W YW K++LY+QVA +Y+ TR+VTNVSQ FLA YVINDL+MSQS+K+LVPAIIY+CSF+
Sbjct  237   -WMYWFKKILYHQVALVYLLTRLVTNVSQAFLAFYVINDLQMSQSSKALVPAIIYICSFV  295

Query  750   TSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMV  571
              SVLLQE+ W+ +RLK F+  GG+LW+LCG  ++LLP  MN+ MY LSVLIGIANAL+MV
Sbjct  296   VSVLLQEITWTSQRLKGFYTVGGLLWVLCGTGILLLPRNMNALMYILSVLIGIANALIMV  355

Query  570   TSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQAC--FS  397
             T +GM+S LV + L+G AFVYGS+ F+DK++CG+AL+ LES++ + P   N +  C  FS
Sbjct  356   TGVGMQSVLVGRDLNGCAFVYGSLSFLDKMICGLALFILESYQRSSPELHNCSTRCPYFS  415

Query  396   VTRFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
             + R++LG +P + AL GVIV+ +M L   + K  PL EPLL 
Sbjct  416   LNRYALGLVPAVCALLGVIVTCSMDLQTPTLK--PLEEPLLG  455



>gb|EYU27165.1| hypothetical protein MIMGU_mgv1a025947mg [Erythranthe guttata]
Length=452

 Score =   512 bits (1318),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 270/458 (59%), Positives = 341/458 (74%), Gaps = 12/458 (3%)
 Frame = -2

Query  1626  MGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLV  1447
             M R  R +E   PLGRCSVL YGVGHMLNDIT  CW+TYLL++LTDIGL P  AAIV L 
Sbjct  1     MTRSRRGDES--PLGRCSVLYYGVGHMLNDITSACWFTYLLVFLTDIGLPPRDAAIVMLA  58

Query  1446  GQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
             GQ AD FTT+ AGELIDR+G+FK+WHGAG ++V VSF S+FGG C+PCKILGS S +++T
Sbjct  59    GQVADGFTTVFAGELIDRYGRFKVWHGAGSVLVAVSFSSVFGG-CLPCKILGSYSSSMRT  117

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
             V Y   A VF  GW+ TQ+SHMSMVNCITLN +SR+   SCRNAFTM+A+L +YAV F V
Sbjct  118   VSYSFFAAVFNIGWAATQVSHMSMVNCITLNSTSRVVLASCRNAFTMIANLSVYAVAFVV  177

Query  1086  FTNNAE----DIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTY  919
             F  N +    D++ QYRW+A+ SI IG  FV+IFHLG  EPR K +   EK  +   WTY
Sbjct  178   FNINTKGSVIDVENQYRWIAYSSILIGCCFVVIFHLGTAEPRLKRE-AREKGHARISWTY  236

Query  918   WLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVL  739
             W  ++LYYQVA +YV TR+VTNVSQ FLA Y INDL+M+QS+K+LVPA+IY+CSFI SVL
Sbjct  237   WFNKLLYYQVAIVYVLTRLVTNVSQAFLAFYTINDLQMTQSSKALVPAVIYICSFIVSVL  296

Query  738   LQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIG  559
             LQE+ W+  R+K F++ GG+LW++ GA ++ LPI MN FMY LS++IG+ANAL+MV+ + 
Sbjct  297   LQEITWNRNRVKAFYSCGGLLWMISGAGILFLPISMNYFMYVLSIVIGVANALIMVSGVS  356

Query  558   MESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDA--DPVACNPAQACFSVTRF  385
             M+S LV   L+G AFVYGS+ F+DK+LCG+AL  LES++ +  +   C+     FSVTRF
Sbjct  357   MQSFLVGDDLNGCAFVYGSLSFMDKILCGLALSVLESYQSSTEEVRNCHRPNFSFSVTRF  416

Query  384   SLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
              LG +P I AL GV+V+ TMKL   +    PL EPLLA
Sbjct  417   GLGLVPAICALIGVLVTLTMKLPEPA--LMPLMEPLLA  452



>ref|XP_006359134.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Solanum tuberosum]
 ref|XP_006359135.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X2 [Solanum tuberosum]
 ref|XP_006359137.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X4 [Solanum tuberosum]
Length=457

 Score =   512 bits (1318),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 267/461 (58%), Positives = 346/461 (75%), Gaps = 13/461 (3%)
 Frame = -2

Query  1626  MGRDNREEEEE---KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIV  1456
             M   N  E++E   KPLGRCSV  YG+GHMLNDIT  CW+TYLL++LTDIGLSPS AA+V
Sbjct  1     MTMINHSEDDESLTKPLGRCSVFYYGIGHMLNDITSACWFTYLLVFLTDIGLSPSDAAVV  60

Query  1455  TLVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT  1276
              L GQ AD  TTI AGELIDRFG FK+WH AG ++V VSF S+FGG C+PCK++GSDS  
Sbjct  61    MLSGQVADGLTTIFAGELIDRFGHFKVWHIAGSLLVAVSFSSVFGG-CLPCKLIGSDSAM  119

Query  1275  VQTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVT  1096
             +QT+GY + A +F  GW+ TQ+SHMSMVNCITLN +SR+   SCRNAFTMVA+L LYAV 
Sbjct  120   LQTIGYSVFAAIFNVGWAATQVSHMSMVNCITLNSTSRVVLASCRNAFTMVANLSLYAVA  179

Query  1095  FFVFTN----NAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTP  928
             F VF N        ++ QYRW+A+ISIFIG  FV++F +G +EPR K +  H K      
Sbjct  180   FVVFNNVGAGTPAAVENQYRWIAYISIFIGSCFVVVFAIGTREPRLKLE-AHVKGYVRIS  238

Query  927   WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFIT  748
             W YW K++LY+QVA +YV TR+VTNVSQ FLA YVINDL+MS S+K+LVPAII++CSF+ 
Sbjct  239   WMYWFKKILYHQVALVYVLTRLVTNVSQAFLAFYVINDLQMSLSSKALVPAIIFVCSFVV  298

Query  747   SVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVT  568
             S+LLQE++W+ +RLK F+  GG+LW+LCG  ++LLP  MN++MY LS+ IGIANAL+MVT
Sbjct  299   SILLQEIKWTSQRLKGFYTAGGLLWVLCGIGILLLPRNMNAYMYILSIFIGIANALIMVT  358

Query  567   SIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPV--ACNPAQACFSV  394
              +GM+S LV + L+G AFVYGS+ F+DK++CGVAL+ LES++ + P    C+P+   FS+
Sbjct  359   GVGMQSVLVGRDLNGCAFVYGSLSFMDKMICGVALFILESYQRSTPELHNCSPSYHFFSL  418

Query  393   TRFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
              R++LG +P + AL GVIV+ +M L   +    PL EPLL 
Sbjct  419   NRYALGLVPAVCALLGVIVTCSMNL--QTPILVPLEEPLLG  457



>emb|CDP07662.1| unnamed protein product [Coffea canephora]
Length=455

 Score =   511 bits (1317),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 272/457 (60%), Positives = 341/457 (75%), Gaps = 12/457 (3%)
 Frame = -2

Query  1617  DNREEEE--EKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVG  1444
              N E+EE   KPL R SV  YGVGHMLNDIT  CW+TYLL++LTDIGLSPS AA+V L G
Sbjct  3     SNTEDEELGTKPLRRLSVFYYGVGHMLNDITSACWFTYLLVFLTDIGLSPSDAAVVMLSG  62

Query  1443  QFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTV  1264
             Q AD FTTI AGELIDRFG FKIWH AG ++V +SF S+FGG C+PCK+LGS S T++TV
Sbjct  63    QIADGFTTIFAGELIDRFGHFKIWHAAGSLLVAISFSSVFGG-CLPCKVLGSSSSTLKTV  121

Query  1263  GYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF  1084
             GY   A +F  GW+ TQ+SHMSMVNCITLN +SR+   SCRNAFTMVA+L LYAV FFVF
Sbjct  122   GYSTFAAIFNVGWAATQVSHMSMVNCITLNSTSRVVLASCRNAFTMVANLSLYAVAFFVF  181

Query  1083  ----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYW  916
                 +     ++ QYRW+A+ISI IG  FV++FHLG +EPR K    H K  +   WTYW
Sbjct  182   KVKTSGTPISVENQYRWIAYISIAIGCCFVVVFHLGTQEPRLKQAV-HRKGYARIYWTYW  240

Query  915   LKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLL  736
              K++LYYQVA +YV TR+VTNVSQ +LA YVI+DL+MSQ +K+ VPA+IY+CSFI SVLL
Sbjct  241   FKKILYYQVALVYVLTRLVTNVSQAYLAFYVIDDLQMSQFSKASVPAVIYICSFIVSVLL  300

Query  735   QELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGM  556
             QE+ W+G RLK +++ GG+LWL CGA +  LP  ++  MY LS +IGIANAL+MVT + M
Sbjct  301   QEMTWTGPRLKSYYSAGGLLWLFCGAGIFFLPRSLSYLMYFLSTVIGIANALIMVTGVSM  360

Query  555   ESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPV--ACNPAQACFSVTRFS  382
             +S LV + + G AFVYGS+ F+DK+ CGVAL  LES++++     +C+P  +CFSV+RF 
Sbjct  361   QSFLVGEDVHGCAFVYGSLSFLDKISCGVALCILESYQNSSTQVHSCSPTNSCFSVSRFG  420

Query  381   LGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
             LGF+P   ALFGV V+ +MKL   + K  PL EPLLA
Sbjct  421   LGFVPAACALFGVAVTCSMKLQPPTPK--PLMEPLLA  455



>ref|XP_004229333.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Solanum lycopersicum]
 ref|XP_010321996.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Solanum lycopersicum]
 ref|XP_010321998.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Solanum lycopersicum]
Length=455

 Score =   510 bits (1313),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 264/457 (58%), Positives = 343/457 (75%), Gaps = 13/457 (3%)
 Frame = -2

Query  1614  NREEEEE---KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVG  1444
             N  E++E   KPLGRCSV  YG+GHMLNDIT  CW+TYLL++LTDIGLSPS AA+V L G
Sbjct  3     NHSEDDESLTKPLGRCSVFYYGIGHMLNDITSACWFTYLLVFLTDIGLSPSDAAVVMLSG  62

Query  1443  QFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTV  1264
             Q AD  TTI AGELIDRFG FK+WH AG ++V VSF S+FGG C+PCK++GSDS  +QT+
Sbjct  63    QVADGLTTIFAGELIDRFGHFKVWHIAGSLLVAVSFSSVFGG-CLPCKLIGSDSAMLQTI  121

Query  1263  GYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF  1084
             GY + A +F  GW+ TQ+SHMSMVNCITLN +SR+   SCRNAFTMVA+L LYAV F VF
Sbjct  122   GYSVFAAIFNVGWAATQVSHMSMVNCITLNSTSRVVLASCRNAFTMVANLSLYAVAFVVF  181

Query  1083  T----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYW  916
                       ++ QYRW+A+ SIFIG  FV++F +G +EPR K +  H K      W YW
Sbjct  182   NMVGAGTPAAVENQYRWIAYTSIFIGSCFVVVFAIGTREPRLKLE-AHVKGYVRISWMYW  240

Query  915   LKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLL  736
              K++LY+QVA +YV TR+VTNVSQ FLA YVINDL+MS S+K+LVPAII++CSF+ S+LL
Sbjct  241   FKKILYHQVALVYVLTRLVTNVSQAFLAFYVINDLQMSLSSKALVPAIIFVCSFVVSILL  300

Query  735   QELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGM  556
             QE++W+ +RLK F+  GG+LW+LCG  ++LLP  MN+FMY LS+ IGIANAL+MVT +GM
Sbjct  301   QEIKWTSQRLKGFYTAGGLLWVLCGIGILLLPRNMNAFMYILSIFIGIANALIMVTGVGM  360

Query  555   ESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPV--ACNPAQACFSVTRFS  382
             +S LV + L+G AFVYGS+ F+DK++CGVAL+ LES++ + P    C+P+   FS+ R++
Sbjct  361   QSVLVGRDLNGCAFVYGSLSFMDKMICGVALFILESYQRSTPELHNCSPSYHFFSLNRYA  420

Query  381   LGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
             LG +P + AL GVI++ +M L   +    PL EPLL 
Sbjct  421   LGLVPAVCALLGVIITCSMNL--QTPILVPLEEPLLG  455



>gb|KDP20374.1| hypothetical protein JCGZ_05257 [Jatropha curcas]
Length=454

 Score =   501 bits (1291),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 265/457 (58%), Positives = 334/457 (73%), Gaps = 10/457 (2%)
 Frame = -2

Query  1626  MGRDNREEEEE-KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTL  1450
             MG D  E+    KP+GR +V  YGVGHMLNDIT  CW+TYLLL+LTDIGLSP  AAIV L
Sbjct  1     MGDDIEEDSSYLKPVGRWAVFYYGVGHMLNDITSACWFTYLLLFLTDIGLSPRDAAIVML  60

Query  1449  VGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQ  1270
              GQ AD F TI  GELIDRFG FKIWHGAG ++V +SF S+FGG C PCKI  ++S T++
Sbjct  61    SGQIADGFATIFTGELIDRFGHFKIWHGAGSVLVAISFSSVFGG-CWPCKIFSTNSWTIE  119

Query  1269  TVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFF  1090
             T+ Y + A +F  GW+ TQ+SHMSMVNCI+LN +SR+   SCRNAFTMVA+L LYAV   
Sbjct  120   TISYSVFAAIFNVGWAATQVSHMSMVNCISLNSTSRVVMASCRNAFTMVANLSLYAVALT  179

Query  1089  VFT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWT  922
             VF        +DI+ QYRW+A++SIFIG  FV IFHLG KEPR +    H    +   WT
Sbjct  180   VFNVSEAKTHDDIENQYRWIAYVSIFIGCCFVGIFHLGTKEPRLRISL-HGNRYARISWT  238

Query  921   YWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSV  742
             YW K++LYYQV  +YV TR+V NVSQ +LA YVINDLRM+QSAK+LVPAIIY+ SF+ SV
Sbjct  239   YWFKKILYYQVGLVYVLTRLVQNVSQAYLAFYVINDLRMTQSAKALVPAIIYISSFVISV  298

Query  741   LLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSI  562
             ++QE+ W+G+RLK +++ GGILW+ CGA ++LLP  +++FM+ +S+ IGIANALMMVT I
Sbjct  299   IMQEISWTGQRLKAYYSAGGILWMFCGASILLLPRSLSAFMFVISIFIGIANALMMVTGI  358

Query  561   GMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACF-SVTRF  385
              MES LV   L+G AFVYGS+ F+DK+ CG+ALY L+SF+   P   N   A + SVTR+
Sbjct  359   SMESVLVGSDLNGCAFVYGSLSFLDKISCGLALYALQSFQSISPKVQNTLLADYISVTRY  418

Query  384   SLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
              LG +P   +L GV V++TMKL    +K  PL EPLL
Sbjct  419   GLGLVPAFCSLLGVAVTYTMKLHAPQYK--PLMEPLL  453



>ref|XP_009782042.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009782043.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Nicotiana sylvestris]
Length=455

 Score =   501 bits (1290),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 265/462 (57%), Positives = 343/462 (74%), Gaps = 17/462 (4%)
 Frame = -2

Query  1626  MGRDNREEEE-EKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTL  1450
             M   N+++E   KP+GRCSV  YGVGHMLNDIT  CW+TYLL++LTDIGLSPS AA+V L
Sbjct  1     MVNHNQDDESCTKPIGRCSVFYYGVGHMLNDITSACWFTYLLVFLTDIGLSPSDAAVVML  60

Query  1449  VGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQ  1270
              GQ AD  TT+ AGELIDRFG FK+WH AG ++VGVSF S+FGG C+PCK++GS+S  +Q
Sbjct  61    SGQVADGLTTVFAGELIDRFGHFKVWHLAGSVLVGVSFSSVFGG-CLPCKLIGSNSAMLQ  119

Query  1269  TVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFF  1090
             T+GY + A +F  GW+ TQ+SHMSMVNCITLN +SR+   SCRNAFTM+A+L LYAV F 
Sbjct  120   TIGYSVFAAIFNVGWAATQVSHMSMVNCITLNSTSRVVLASCRNAFTMIANLSLYAVAFA  179

Query  1089  VFT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDD---DGHEKIGSNT  931
             VF          I+ QYRW+A+ISIFIG  FV +FHLG +EP    +    G+ +I    
Sbjct  180   VFNVVGAGTPAAIENQYRWIAYISIFIGSCFVGVFHLGTREPSLNLEARVKGYVRIS---  236

Query  930   PWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFI  751
              W YW K+ LY+QVA +Y+ TR+VTNVSQ FLA YVI DL+MSQS+K+LVPAII++CSF+
Sbjct  237   -WMYWFKKTLYHQVALVYLLTRLVTNVSQAFLAFYVIYDLQMSQSSKALVPAIIFICSFV  295

Query  750   TSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMV  571
              SVLLQE+ W+ +RLK F+  GG+LW+LCG  ++LLP  MN  MY LSVLIGIANAL+MV
Sbjct  296   VSVLLQEITWTSQRLKGFYTAGGLLWVLCGTGILLLPRNMNVLMYILSVLIGIANALIMV  355

Query  570   TSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQAC--FS  397
             T +GM+S LV + L+G AFVYGS+ F+DK++CG+AL+ LES++ + P   N + +C  FS
Sbjct  356   TGVGMQSVLVGRDLNGCAFVYGSLSFLDKMICGLALFILESYQRSSPELHNCSTSCPFFS  415

Query  396   VTRFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
             + R++LG +P + AL GVIV+ +M L   +    PL EPLL 
Sbjct  416   LNRYALGLVPAVCALLGVIVTCSMDL--QTPTLGPLQEPLLG  455



>ref|XP_002512200.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50234.1| conserved hypothetical protein [Ricinus communis]
Length=454

 Score =   500 bits (1288),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 268/457 (59%), Positives = 337/457 (74%), Gaps = 10/457 (2%)
 Frame = -2

Query  1626  MGRDNREEEE-EKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTL  1450
             MG D  ++    KP+GR  V  YGVGHMLNDIT  CW+TYLLL+LTDIGLSP  AA V L
Sbjct  1     MGDDIEDDNSYPKPVGRWPVFYYGVGHMLNDITAACWFTYLLLFLTDIGLSPRDAATVML  60

Query  1449  VGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQ  1270
              GQ AD F TI AGELIDRFG FK+WHGAG ++V +SF S+FGG C PCKILG++S T++
Sbjct  61    SGQIADGFATIFAGELIDRFGHFKVWHGAGSVLVAISFSSVFGG-CFPCKILGTNSSTIE  119

Query  1269  TVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFF  1090
             TV Y I A +F  GW+ TQ+SHMSMVNCI+LN +SR+   SCRNAFTMVA+L LYA+   
Sbjct  120   TVSYSIFAAIFNVGWAATQVSHMSMVNCISLNSTSRVVMASCRNAFTMVANLSLYAIALT  179

Query  1089  VFT-NNAE---DIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWT  922
             +F  + AE   DI+ QYRW+A++SI  G  FV IFHLG KEPR K    HE   +   WT
Sbjct  180   IFNVSKAETHADIQNQYRWIAYLSICFGCCFVGIFHLGTKEPRLKISL-HEISCARISWT  238

Query  921   YWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSV  742
             YW K++LYYQV  +YV TR+V NVSQ +LA YVINDLRM+QSAK+LVPAIIY+ SF+ SV
Sbjct  239   YWFKKILYYQVGLVYVLTRLVQNVSQAYLAFYVINDLRMAQSAKALVPAIIYISSFVISV  298

Query  741   LLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSI  562
             ++QE+ W+G+RLK +++ GGILW+ CGA ++LLP  M++FMY +S+ IGI NALM VT +
Sbjct  299   IMQEISWTGQRLKAYYSAGGILWMFCGASILLLPRSMSAFMYIISIFIGIGNALMTVTGV  358

Query  561   GMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP-VACNPAQACFSVTRF  385
              MES LV   L+G AFV GS+GF+DK+ CG+ALY L+SF+   P V  N +    SVTRF
Sbjct  359   SMESVLVGSDLNGCAFVCGSLGFLDKISCGLALYALQSFQTISPKVQDNLSIEHISVTRF  418

Query  384   SLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
              LG +P   +L GV V+++MK LHT++ K PL EPLL
Sbjct  419   GLGLVPAFCSLVGVGVTYSMK-LHTAYPK-PLIEPLL  453



>ref|XP_008231393.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Prunus mume]
Length=454

 Score =   497 bits (1279),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 267/458 (58%), Positives = 338/458 (74%), Gaps = 17/458 (4%)
 Frame = -2

Query  1617  DNREEEEE--KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVG  1444
             D+ EE++   KPLGRC+V  YGVGHMLNDIT  CW+TYLLLYLTDIGLSP  AA V L G
Sbjct  3     DSTEEDDSFTKPLGRCTVTYYGVGHMLNDITASCWFTYLLLYLTDIGLSPRDAATVMLSG  62

Query  1443  QFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTV  1264
             Q AD F TI AGELIDRFG FK+WHGAG ++V +SF S+FGG C+PCKI G+ S T++TV
Sbjct  63    QIADGFATIFAGELIDRFGHFKLWHGAGSVLVAISFSSVFGG-CMPCKIFGTSSSTLRTV  121

Query  1263  GYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF  1084
             GY + A +F  GW+  Q+SHMSM+NCITLN +SR+   SCRNAFTMVA+L LYAV F VF
Sbjct  122   GYSMFAAIFNVGWAAAQVSHMSMLNCITLNSTSRVILASCRNAFTMVANLSLYAVAFIVF  181

Query  1083  ----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKK---DDDGHEKIGSNTPW  925
                  +   DI+ QYRW+A++SIFIG  FV IFHLG KEPR K     + H +I     W
Sbjct  182   GVTMASTHADIENQYRWIAYLSIFIGCCFVGIFHLGTKEPRLKVSLQGNNHSRIS----W  237

Query  924   TYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITS  745
             TYW KRVLYYQVA +YV TR+V NVSQ +LA YVI+DL M+QSAK+LVPAIIY+ SF+ S
Sbjct  238   TYWFKRVLYYQVALVYVLTRLVVNVSQAYLAFYVIDDLHMAQSAKALVPAIIYISSFLVS  297

Query  744   VLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTS  565
             ++LQE+ W+G+ LK  ++ G I+W+ CGA ++ LP  M++FMY +SV IGIANALMMVT 
Sbjct  298   IILQEISWTGQCLKACYSAGAIVWIFCGAGILFLPGSMSAFMYLISVSIGIANALMMVTG  357

Query  564   IGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQAC-FSVTR  388
             + M+S L+D+ L+G AFV GS+ F+DK+ CG+AL+ L+S++    +  N +    FSVTR
Sbjct  358   VSMQSVLIDRDLNGCAFVCGSLSFMDKISCGLALFVLQSYQSTRVIQENHSNDVYFSVTR  417

Query  387   FSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             F LGF+P + +L  VIV++TMKL     K  PL EPLL
Sbjct  418   FGLGFVPAVCSLISVIVTYTMKLQPAPCK--PLMEPLL  453



>ref|XP_004306481.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Fragaria vesca subsp. vesca]
Length=456

 Score =   497 bits (1279),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 266/455 (58%), Positives = 332/455 (73%), Gaps = 11/455 (2%)
 Frame = -2

Query  1620  RDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQ  1441
              D+ ++   KPLGRCSV+ YGVGHMLNDIT  CW+TYLLL+LTDIGLSP  AA V L GQ
Sbjct  6     EDDDDDSVTKPLGRCSVMYYGVGHMLNDITASCWFTYLLLFLTDIGLSPRDAATVMLSGQ  65

Query  1440  FADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVG  1261
              AD F TI AGELIDRFG FK+WHGAG ++V VSF S+FGG CIPCKI G+ SP ++TVG
Sbjct  66    IADGFATISAGELIDRFGHFKLWHGAGSVLVAVSFSSVFGG-CIPCKIFGTSSPALRTVG  124

Query  1260  YCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF-  1084
             Y I A +F  GW+ TQ+SHMSM+NCITLN +SR+   SCRNAFTMVA+L LYAV F +F 
Sbjct  125   YSIFAAIFNVGWAATQVSHMSMLNCITLNSTSRVVLASCRNAFTMVANLGLYAVAFIIFG  184

Query  1083  ---TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWL  913
                     DI+ QYRW+A++SIFIG  FV IF  G KEPR K         S   WTYW 
Sbjct  185   VTIARTHADIENQYRWIAYLSIFIGCCFVGIFQFGTKEPRLKVGVQGSN-SSRIAWTYWF  243

Query  912   KRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQ  733
             KRVLYYQVA +YV TR+V NVSQ +LA YVI+DL+M+QSAK+LVPAIIY+ SF+ SV+LQ
Sbjct  244   KRVLYYQVALVYVLTRLVVNVSQAYLAFYVIDDLQMAQSAKALVPAIIYISSFLVSVILQ  303

Query  732   ELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGME  553
             E++W+G+ LK +++ G I+W+ CGA ++LLP  M++FMY +S+ IGIANALMMVT + M+
Sbjct  304   EIQWTGRFLKAYYSAGAIIWIFCGAGILLLPRSMSAFMYIISIFIGIANALMMVTGVSMQ  363

Query  552   SALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQAC--FSVTRFSL  379
             S L+D  L+G AFV GS  F+DK+ CGVAL+ L+S++ +D V  N        SVTRF L
Sbjct  364   SVLIDTDLNGCAFVCGSFSFLDKISCGVALFVLQSYQ-SDSVIQNSHSNLVHISVTRFGL  422

Query  378   GFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             G +P   AL  V V++TMKL     + +PL EPLL
Sbjct  423   GLVPAFCALVSVAVTYTMKL--QPARCKPLMEPLL  455



>ref|XP_007217988.1| hypothetical protein PRUPE_ppa005566mg [Prunus persica]
 gb|EMJ19187.1| hypothetical protein PRUPE_ppa005566mg [Prunus persica]
Length=454

 Score =   496 bits (1276),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 267/456 (59%), Positives = 337/456 (74%), Gaps = 13/456 (3%)
 Frame = -2

Query  1617  DNREEEEE--KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVG  1444
             D+ EE++   KPLGRC+V  YGVGHMLNDIT  CW+TYLLLYLTDIGLSP  AA V L G
Sbjct  3     DSTEEDDSFTKPLGRCTVTYYGVGHMLNDITASCWFTYLLLYLTDIGLSPRDAATVMLSG  62

Query  1443  QFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTV  1264
             Q AD F TI AGELIDRFG FK+WHGAG ++V +SF S+FGG C+PCKI G+ S T++TV
Sbjct  63    QIADGFATIFAGELIDRFGHFKLWHGAGSVLVAISFSSVFGG-CMPCKIFGTSSSTLRTV  121

Query  1263  GYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF  1084
             GY + A +F  GW+ TQ+SHMSM+NCITLN +SR+   SCRNAF MVA+L LYAV F VF
Sbjct  122   GYSMFAAIFNVGWAATQVSHMSMLNCITLNSTSRVVLASCRNAFNMVANLSLYAVAFIVF  181

Query  1083  ----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDD-DGHEKIGSNTPWTY  919
                  +   DI+ QYRW+A++SIFIG  FV IFHLG KEPR K    G+ +  S   WTY
Sbjct  182   GVTIASTHADIENQYRWIAYLSIFIGCCFVGIFHLGTKEPRLKVSLQGNNR--SRISWTY  239

Query  918   WLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVL  739
             W KRVLYYQVA +YV TR+V NVSQ +LA YVI+DLRM+QSAK+LVPAIIY+ SF+ S++
Sbjct  240   WFKRVLYYQVALVYVLTRLVVNVSQAYLAFYVIDDLRMAQSAKALVPAIIYISSFLVSII  299

Query  738   LQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIG  559
             LQE+ W+G+ LK  ++ G I+W+ CGA ++ LP  M++ MY +SV IGIANALMMVT + 
Sbjct  300   LQEISWTGQCLKACYSAGAIVWIFCGAGILFLPGSMSALMYIISVSIGIANALMMVTGVS  359

Query  558   MESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQAC-FSVTRFS  382
             M+S L+D+ L+G AFV GS+ F+DK+ CG+AL+ L+S++    +  N +    FSVTRF 
Sbjct  360   MQSVLIDRDLNGCAFVCGSLSFMDKISCGLALFVLQSYQSTRVIQENHSNDVYFSVTRFG  419

Query  381   LGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             LGF+P   +L  VIV++TMKL     K  PL EPLL
Sbjct  420   LGFVPAFCSLISVIVTYTMKLQPAPCK--PLMEPLL  453



>ref|XP_010243432.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Nelumbo nucifera]
Length=451

 Score =   495 bits (1274),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 265/454 (58%), Positives = 333/454 (73%), Gaps = 16/454 (4%)
 Frame = -2

Query  1608  EEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQFADA  1429
             EE   KPLGR SV  YGVGHMLNDIT  CW+TYLL++LTDIGLSP +AA V L GQ AD 
Sbjct  4     EESCNKPLGRASVFYYGVGHMLNDITSACWFTYLLVFLTDIGLSPRNAATVMLSGQIADG  63

Query  1428  FTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCIS  1249
             FTTI AGELIDRFG FK WHGAG ++V +SF S+FG  C+PCKI  ++S  VQT+ Y I 
Sbjct  64    FTTIFAGELIDRFGHFKRWHGAGSVLVAISFSSVFG-VCLPCKIFATNSSIVQTISYSIF  122

Query  1248  AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTNNAE  1069
             A +F  GW+ TQ+SHMSMVNCITLN +SR+   SCRNAFTMVA+L LYAV   VF  +  
Sbjct  123   AAIFNVGWAATQVSHMSMVNCITLNPTSRVVLASCRNAFTMVANLSLYAVALAVFYVSKP  182

Query  1068  ----DIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSN---TPWTYWLK  910
                 DI+ QYRW+A++SIFIG  FV IF +G KEPR K    H   G++     W YW K
Sbjct  183   RAHIDIENQYRWIAYLSIFIGCCFVSIFQIGTKEPRLK----HRSQGASYQRISWAYWFK  238

Query  909   RVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQE  730
             +VLY+QVA +YV TR++TNVSQ FLA YVINDL+M+QS+K+LVPAIIY+CSF  SV+LQ 
Sbjct  239   KVLYHQVAIVYVLTRLITNVSQAFLAFYVINDLQMAQSSKALVPAIIYICSFAVSVVLQG  298

Query  729   LEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMES  550
             + W+G+RLK FF  G +LW+  GA +++LP  M++FMY LSV+IGI+NAL+MVT + M+S
Sbjct  299   ITWTGQRLKAFFTAGAVLWIFSGAGILILPSSMHNFMYLLSVIIGISNALIMVTGVSMQS  358

Query  549   ALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFED--ADPVACNPAQACFSVTRFSLG  376
              LV + L+G AFVYGS+ F+DK+ CG+ALY LES++   A    C+    C SVTR+ LG
Sbjct  359   FLVGEDLNGCAFVYGSLSFLDKISCGLALYVLESYQSSAASLKGCHRIMGCLSVTRYGLG  418

Query  375   FIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
              +P   AL G++V++TM  LHT H K P+ EPLL
Sbjct  419   LVPASCALLGLVVTYTMD-LHTPHLK-PIMEPLL  450



>ref|XP_009365055.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Pyrus x bretschneideri]
Length=453

 Score =   494 bits (1272),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 263/457 (58%), Positives = 331/457 (72%), Gaps = 9/457 (2%)
 Frame = -2

Query  1626  MGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLV  1447
             M     + +    LGR +V  YGVGHMLNDIT  CW+TYLLL+LTDIGLSP  AA V L 
Sbjct  1     MANATDDVDSFTTLGRSTVSYYGVGHMLNDITASCWFTYLLLFLTDIGLSPRDAATVMLS  60

Query  1446  GQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
             GQ AD F TI AGELIDRFG FK+WHGAG ++V +SF S+FG  CIPCKI G+ S T++T
Sbjct  61    GQIADGFATIFAGELIDRFGHFKLWHGAGSVLVAISFSSVFGA-CIPCKIFGTSSSTLRT  119

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
             VGY I A +F  GW+ TQ+SHMSM+NCITLN +SR+   SCRNAFTMVA+L LYAV F V
Sbjct  120   VGYSIFAAIFNVGWAATQVSHMSMLNCITLNSNSRVVLASCRNAFTMVANLSLYAVAFVV  179

Query  1086  F----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTY  919
             F     N   DI+ QYRW+A++SIFIG  FV IFHLG KEPR K      +  S   WTY
Sbjct  180   FGVTRANTHADIEIQYRWIAYLSIFIGCCFVGIFHLGTKEPRLKVSAQGNR-SSRISWTY  238

Query  918   WLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVL  739
             W K+VLYYQVA +YV TR+V NVSQ +LA YVI+DLRM+QSAK+LVPAIIY+ SF+ SVL
Sbjct  239   WFKKVLYYQVAIVYVLTRLVVNVSQAYLAFYVIDDLRMAQSAKALVPAIIYISSFLVSVL  298

Query  738   LQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIG  559
             LQE+ W+G  LK FF+ G I+W+ CGA ++ LP  M++FM+ +S+ IGIANALMMVT + 
Sbjct  299   LQEISWNGHSLKTFFSAGAIMWIFCGAGILFLPSNMSAFMFLISIFIGIANALMMVTGVS  358

Query  558   MESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPA-QACFSVTRFS  382
             M+S L+D  L+G AFV GS+ F+DK+ CG+AL+ L+S++    +  N +     SVTRF 
Sbjct  359   MQSFLIDTDLNGCAFVCGSLSFLDKISCGLALFVLQSYQSNRFIQENHSNHVNISVTRFG  418

Query  381   LGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
             LG +P + AL  V+V++TMKL   + + +PL EPLLA
Sbjct  419   LGLVPALCALVSVVVTYTMKL--QTARCKPLMEPLLA  453



>ref|XP_010257578.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X2 [Nelumbo nucifera]
Length=484

 Score =   493 bits (1269),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 263/452 (58%), Positives = 326/452 (72%), Gaps = 10/452 (2%)
 Frame = -2

Query  1608  EEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQFADA  1429
             EE   KPLGR SV  YGVGHMLNDIT  CW+TYLL++LTDIGL+P + A V L GQ AD 
Sbjct  37    EESWSKPLGRASVFYYGVGHMLNDITSACWFTYLLVFLTDIGLTPRNTATVMLSGQIADG  96

Query  1428  FTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCIS  1249
             FTTI AGELIDRFG FKIWHGAG ++V VSF S+FG  C+PCKI  ++S  + T+ Y   
Sbjct  97    FTTIFAGELIDRFGHFKIWHGAGSVLVAVSFSSVFG-ICLPCKIFRTNSSAILTISYSTF  155

Query  1248  AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTNNAE  1069
             A +F  GW+ TQ+SHMSMVNCITLN ++R+   SCRNAFTMVA+L LYAV   VF  +  
Sbjct  156   AAIFNVGWAATQVSHMSMVNCITLNPTTRVVLASCRNAFTMVANLSLYAVALTVFNVSKP  215

Query  1068  ----DIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVL  901
                 DI+ QYRW+A++SIFIG  FV IF +G KEPR K    H        W +W K+VL
Sbjct  216   RTPIDIENQYRWIAYLSIFIGCCFVSIFLIGTKEPRLKQGI-HGTSNHRISWAHWFKKVL  274

Query  900   YYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEW  721
             YYQVA +YV TR+VTNVSQ FLA YVINDL+M+QS+K+LVPAIIY+CS + SV+LQE+ W
Sbjct  275   YYQVAIVYVLTRLVTNVSQAFLAFYVINDLQMAQSSKALVPAIIYICSIVVSVILQEITW  334

Query  720   SGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALV  541
             +G+RLK FF  GG+LW+  GA ++ LP  M + MY LSV IG+ANALM VT + M+S LV
Sbjct  335   TGQRLKAFFTAGGVLWIFSGAGILFLPSTMQNLMYLLSVAIGVANALMTVTGVSMQSVLV  394

Query  540   DKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPV--ACNPAQACFSVTRFSLGFIP  367
              + L+G AFVYGS+ F+DK+ CG+ALY LES +D   +   C+    CFSVTR+ LG +P
Sbjct  395   GEDLNGCAFVYGSLSFLDKISCGLALYILESNQDTASILKGCHSIMGCFSVTRYGLGLVP  454

Query  366   GIAALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
                AL G++V++TM  LHT   K PL EPLLA
Sbjct  455   ASCALLGLVVTYTMN-LHTPDSK-PLLEPLLA  484



>ref|XP_008350284.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Malus domestica]
Length=453

 Score =   491 bits (1263),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 263/458 (57%), Positives = 331/458 (72%), Gaps = 11/458 (2%)
 Frame = -2

Query  1626  MGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLV  1447
             M     + +    LGR +V  YGVGHMLNDIT  CW+TYLLL+LTDIGLSP  AA V L 
Sbjct  1     MANATDDVDSFTTLGRSTVSYYGVGHMLNDITASCWFTYLLLFLTDIGLSPRDAATVMLS  60

Query  1446  GQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
             GQ AD F TI AGELIDRFG FK+WHGAG ++V +SF S+FGG CIPCKI G+ S T++T
Sbjct  61    GQIADGFATIFAGELIDRFGHFKLWHGAGSVLVAISFSSVFGG-CIPCKIFGTSSSTLRT  119

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
             VGY I A +F  GW+ TQ+SHMSM+NCITLN +SR+   SCRNAFTMVA+L LYAV F V
Sbjct  120   VGYSIFAAIFNVGWAATQVSHMSMLNCITLNSNSRVVLASCRNAFTMVANLSLYAVAFVV  179

Query  1086  F----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDD-DGHEKIGSNTPWT  922
             F     +   DI+ QYRW+A++SIFIG  FV IFHLG KEPR K    G+    S   WT
Sbjct  180   FGVTRASTHADIENQYRWIAYLSIFIGCCFVGIFHLGTKEPRLKISVQGNSS--SRISWT  237

Query  921   YWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSV  742
             YW K+VLYYQVA +YV TR+V NVSQ +LA YVI+DLRM+QSAK+LVPAIIY+ SF+ S+
Sbjct  238   YWFKKVLYYQVAIVYVLTRLVVNVSQAYLAFYVIDDLRMAQSAKALVPAIIYISSFLVSI  297

Query  741   LLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSI  562
             LLQE+ W+G  LK FF+ G I+W+ CGA ++ LP  M++FMY +S+ IGIANALMMVT +
Sbjct  298   LLQEISWNGHSLKTFFSAGAIMWIFCGAGILFLPSNMSAFMYLISIFIGIANALMMVTGV  357

Query  561   GMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPA-QACFSVTRF  385
              M+S L+D  L+G AFV GS+ F+DK+ CG+AL+ L+S++    +  N +     SVTRF
Sbjct  358   SMQSFLIDTDLNGCAFVCGSLSFLDKISCGLALFVLQSYQSNRFIQENHSNHVNISVTRF  417

Query  384   SLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
              LG +P + AL   +V++TMKL     + +PL EPLLA
Sbjct  418   GLGLVPALCALVSXVVTYTMKL--QPARCKPLMEPLLA  453



>ref|XP_006402627.1| hypothetical protein EUTSA_v10005961mg [Eutrema salsugineum]
 gb|ESQ44080.1| hypothetical protein EUTSA_v10005961mg [Eutrema salsugineum]
Length=457

 Score =   488 bits (1256),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 257/458 (56%), Positives = 330/458 (72%), Gaps = 9/458 (2%)
 Frame = -2

Query  1626  MGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLV  1447
             M   + E+   KP+GR SV  YGVGHMLNDIT  CW+TYLLL+LT IGLSP  AAIV L 
Sbjct  1     MAGGSEEDPFTKPIGRLSVFFYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAIVMLS  60

Query  1446  GQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
             GQ AD F TI AGELIDRFG FKIWH AG I+V +SF S+FGG C+PC IL +DS T++T
Sbjct  61    GQVADGFATIFAGELIDRFGHFKIWHAAGSILVAISFSSVFGG-CLPCSILHNDSLTLET  119

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
               Y + A +F  GW+ TQ+SHM+MVNCI+LN +SR+A  SCRNAFTMVA+L LYA+   V
Sbjct  120   FSYSMFAAIFNIGWAATQVSHMAMVNCISLNSTSRVALTSCRNAFTMVANLGLYAIALVV  179

Query  1086  F----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTY  919
             F      + E+ +TQYRW+A+ SI IG  FV+IF +G KEPR + D   E   +  PW Y
Sbjct  180   FGVIKAGSKENTETQYRWIAYSSITIGCCFVVIFLMGTKEPRLRIDL-RETSRARIPWVY  238

Query  918   WLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVL  739
             W +++LYYQVA +Y+ TR+V NVSQ +LA +VI+DL+M QSAK+LVPAIIY+CSF+ SVL
Sbjct  239   WFRKLLYYQVAMVYLLTRLVLNVSQAYLAFFVIDDLQMDQSAKALVPAIIYICSFVVSVL  298

Query  738   LQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIG  559
             LQE+ W+GKRLK +++ GGI+W+ CGA ++LLP  ++SFMYA+SV IGIANALMMVT+I 
Sbjct  299   LQEIPWNGKRLKAYYSAGGIIWIFCGAAILLLPRDISSFMYAISVFIGIANALMMVTAIS  358

Query  558   MESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP---VACNPAQACFSVTR  388
             M+S LV   + G AFV GS+ F+DK+ CG+ALY L+S +   P   +  N      SVTR
Sbjct  359   MQSVLVGAEVGGCAFVCGSLSFLDKMSCGLALYVLQSHQSTSPRTQLNNNQQSVYLSVTR  418

Query  387   FSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             + LG +P + +  GV V+F M+L       +PL EPLL
Sbjct  419   YGLGLVPALCSFVGVAVTFFMELEAAGSLSKPLLEPLL  456



>emb|CDX89045.1| BnaA04g01410D [Brassica napus]
Length=458

 Score =   485 bits (1248),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 253/458 (55%), Positives = 330/458 (72%), Gaps = 8/458 (2%)
 Frame = -2

Query  1626  MGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLV  1447
             M   + E+   KP+GR +V  YGVGHMLNDIT  CW+TYLLL+LT IGLSP  AAIV L 
Sbjct  1     MAGGSEEDPYTKPIGRWAVFFYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAIVMLS  60

Query  1446  GQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
             GQ AD F TI  GELIDRFG FKIWH AG ++V +SF S+FGG C+PC IL +DS +++T
Sbjct  61    GQVADGFATIFTGELIDRFGHFKIWHAAGSVLVAISFSSVFGG-CLPCSILHNDSLSLET  119

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
               Y + A +F  GW+ TQ+SHM+MVNCI+LN +SR+A  SCRNAFTMVA+L LYA+   V
Sbjct  120   FSYSMFAAIFNIGWAATQVSHMAMVNCISLNSTSRVALTSCRNAFTMVANLSLYAIALVV  179

Query  1086  F----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTY  919
             F      + E+ +TQYRW+A+ SI +G  FV+IF +G KEPR + D          PW Y
Sbjct  180   FGVIKAGSKENTETQYRWIAYSSITVGCCFVVIFLMGTKEPRLRMDLKETSRRVRIPWVY  239

Query  918   WLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVL  739
             W K++LYYQVA +Y+ TR+V NVSQ +LA +VI+DL+M QSAK+LVPAIIY+ SF+ SVL
Sbjct  240   WFKKLLYYQVAMVYLLTRLVLNVSQAYLAFFVIDDLQMDQSAKALVPAIIYIGSFVVSVL  299

Query  738   LQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIG  559
             LQE+ W+G+RLK +++ GGI+W+ CGA ++LLP  ++SFMYA+SV IGIANALMMVT+I 
Sbjct  300   LQEIPWNGRRLKAYYSAGGIIWMFCGAAILLLPRDISSFMYAISVFIGIANALMMVTAIS  359

Query  558   MESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP-VACNPAQ--ACFSVTR  388
             M+S LV   + G AFV GS+ F+DK+ CG+ALY L+S +   P +  N  Q  A  SVTR
Sbjct  360   MQSVLVGSEVGGCAFVCGSLSFLDKMSCGLALYVLQSHQSTSPRIQLNNGQQSAYLSVTR  419

Query  387   FSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             + LG +P + +L GV+V+F M+L       +PL EPLL
Sbjct  420   YGLGLVPALCSLVGVVVTFFMELEAAGSLSKPLLEPLL  457



>ref|XP_002881956.1| hypothetical protein ARALYDRAFT_903845 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58215.1| hypothetical protein ARALYDRAFT_903845 [Arabidopsis lyrata subsp. 
lyrata]
Length=461

 Score =   484 bits (1247),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 255/457 (56%), Positives = 334/457 (73%), Gaps = 10/457 (2%)
 Frame = -2

Query  1626  MGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLV  1447
             +G +  E+   KPLGR SV  YGVGHMLNDIT  CW+TYLLL+LT IGLSP  AAIV L 
Sbjct  7     VGMEEEEDPSTKPLGRLSVFYYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAIVMLS  66

Query  1446  GQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
             GQ AD F TI  GELIDRFG FKIWH AG ++V +SF S+FGG C PC +L S+S TV+T
Sbjct  67    GQVADGFATIFIGELIDRFGHFKIWHAAGSLLVAISFSSVFGG-CFPCSLLHSNSSTVET  125

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
             + YC+ A +F  GW+ TQ+SHM+MVNCITLN +SR+A  S RNAF+MVA+L LYA+   V
Sbjct  126   LSYCMFAAIFNVGWAATQVSHMAMVNCITLNSTSRVALTSSRNAFSMVANLGLYAIALVV  185

Query  1086  F----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTY  919
             F        E+ +TQYRW+A+ SI +G  FV+IF +G KEPR K +   E   S  PW+Y
Sbjct  186   FGVSKAVTKENTETQYRWIAYSSITVGCCFVVIFLMGTKEPRMKINL-RETSRSRIPWSY  244

Query  918   WLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVL  739
             W +++LYYQVA +Y+ TR+V NVSQ +LA +VI+DL+M+QSAK+L+PAIIY+CSF+ SV+
Sbjct  245   WFRKILYYQVAMVYLLTRLVLNVSQAYLAFFVIDDLQMAQSAKALIPAIIYICSFVVSVM  304

Query  738   LQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIG  559
             LQE+ W+GKRLK ++  GGI+W+ CG  ++LLP  +NS+MYA+SV IGIANALM+VT+I 
Sbjct  305   LQEIPWNGKRLKAYYCAGGIIWIFCGISILLLPRSINSYMYAISVFIGIANALMLVTAIS  364

Query  558   MESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP-VACNPAQA-CFSVTRF  385
             M+S L+   L G AFV GS+ F+DK+ CG+ALY L+S +   P V  N  +   FSVTR+
Sbjct  365   MQSVLIGSELGGCAFVCGSLSFLDKMSCGLALYVLQSHQGTSPKVDVNIKEYFYFSVTRY  424

Query  384   SLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
              LG +P + +L GV+V++ M+L  T  K  PL +PLL
Sbjct  425   GLGLVPAVCSLVGVVVTYFMELDSTILK--PLCQPLL  459



>ref|XP_008788956.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Phoenix dactylifera]
Length=463

 Score =   484 bits (1247),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 256/465 (55%), Positives = 336/465 (72%), Gaps = 12/465 (3%)
 Frame = -2

Query  1647  ISVYRRIMGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSS  1468
             +++   I+   + E +  +PLGR S+L+YGVGHMLNDIT  CW+TYLLL+LTD+GLSP  
Sbjct  1     MTMVNSIIVESSTELQNAEPLGRLSILSYGVGHMLNDITSACWFTYLLLFLTDMGLSPRD  60

Query  1467  AAIVTLVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGS  1288
             AAIV L GQ ADAF T+ AGELIDRFG FK+WH  G  +V +SF S+FGG C+PCKILG+
Sbjct  61    AAIVMLSGQIADAFATVFAGELIDRFGHFKLWHAGGSFLVAISFSSVFGG-CLPCKILGT  119

Query  1287  DSPTVQTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLML  1108
             +S TVQT+GY   A +F  GW+ TQ+SHMSMVNCITLN +SR+A  SCRNAFTMV++L L
Sbjct  120   NSSTVQTIGYSTFAAIFNVGWAATQVSHMSMVNCITLNPTSRVALASCRNAFTMVSNLSL  179

Query  1107  YAVTFFVFT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIG  940
             YA+   VF+      + D+K +YRW+A++SIFIG  FV+IF +G KEP  K     + + 
Sbjct  180   YAIALAVFSVYDAKQSADVKIEYRWIAYLSIFIGCCFVVIFLIGTKEPELKLQVQCKDL-  238

Query  939   SNTPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLC  760
             S   W +W K+VLYYQVA +Y+ TR+ TNVSQ  LA YVI+DL+M+ S+K+LVPAIIY+C
Sbjct  239   SRISWAHWFKKVLYYQVALVYMLTRLATNVSQALLAFYVIDDLKMNHSSKALVPAIIYIC  298

Query  759   SFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANAL  580
             SF+ SV+LQE+ W+G RLK FF GG I W+  GA + +LP K+ SFMY LS+ IG+ANAL
Sbjct  299   SFMVSVMLQEIRWTGWRLKAFFTGGAIFWIFSGAGIFVLPSKLQSFMYILSITIGVANAL  358

Query  579   MMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNP---AQ  409
             MMVT+I MES LV + L+G AFVYGS+ F+DK+ CG+ALY LES++   P A +      
Sbjct  359   MMVTAISMESVLVGEDLNGCAFVYGSLSFLDKLSCGLALYVLESYQAGVPAAMDNHVVTA  418

Query  408   ACFSVTRFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
               FS++R  LG IP   AL   I+++T++L     + + L EPLL
Sbjct  419   GHFSISRCGLGLIPATCALLSAIITYTIRL---PDRSRTLMEPLL  460



>ref|XP_010508312.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Camelina sativa]
 ref|XP_010508313.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Camelina sativa]
 ref|XP_010508314.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Camelina sativa]
Length=463

 Score =   484 bits (1245),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 255/460 (55%), Positives = 337/460 (73%), Gaps = 12/460 (3%)
 Frame = -2

Query  1629  IMGRDNREEEE--EKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIV  1456
             I+GR++ EEE+   KPLGR SV  YGVGHMLNDIT  CW+TYLLL+LT IGLSP  AAIV
Sbjct  6     IVGRNDEEEEDPSTKPLGRLSVFYYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAIV  65

Query  1455  TLVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT  1276
              L GQ AD F T+  GELIDRFG FKIWH AG ++V VSF S+FGG C+PC +L S+S T
Sbjct  66    MLSGQVADGFATVFVGELIDRFGHFKIWHAAGSLLVAVSFSSVFGG-CLPCTLLNSNSLT  124

Query  1275  VQTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVT  1096
             V+T+ Y + A +F  GW+ TQ+SHM+MVNCITLN +SR+A  S RNAF+MVA+L LYA+ 
Sbjct  125   VETLSYSMFAAIFNIGWAATQVSHMAMVNCITLNSTSRVALTSSRNAFSMVANLGLYAIA  184

Query  1095  FFVF----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTP  928
               VF        E+ +TQYRW+A+ SI +G  FV+IF +G KEPR + D   E   +  P
Sbjct  185   LVVFGVSEAGTKENTETQYRWIAYSSITVGCCFVVIFLMGTKEPRLRIDL-RETSRARIP  243

Query  927   WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFIT  748
             W+YW +++LYYQVA +Y+ TR+V NVSQ +LA +VI+DL+M+QSAK+L+PAIIY+CSF+ 
Sbjct  244   WSYWFRKILYYQVAMVYLLTRLVLNVSQAYLAFFVIDDLQMAQSAKALIPAIIYICSFVV  303

Query  747   SVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVT  568
             SV+LQE+ W+GKRLK ++  GGI+W+ CG  ++LL   +N +MYA+S+ IGIANALM+VT
Sbjct  304   SVMLQEIPWNGKRLKAYYCAGGIIWIFCGVAILLLSRSINIYMYAISIFIGIANALMLVT  363

Query  567   SIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP-VACNPAQA-CFSV  394
             +I M+S L+   L G AFV GS+ F+DK+ CG+ALY L+S +   P V  N  Q   FSV
Sbjct  364   AISMQSVLIGSELGGCAFVCGSLSFLDKMSCGLALYVLQSHQSTSPKVDVNINQHFYFSV  423

Query  393   TRFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             TR+ LG +P + +L GV+V++ M+L  T  K  PL +PLL
Sbjct  424   TRYGLGLVPAVCSLIGVVVTYFMELDSTILK--PLRQPLL  461



>ref|XP_006294173.1| hypothetical protein CARUB_v10023168mg [Capsella rubella]
 ref|XP_006294174.1| hypothetical protein CARUB_v10023168mg [Capsella rubella]
 gb|EOA27071.1| hypothetical protein CARUB_v10023168mg [Capsella rubella]
 gb|EOA27072.1| hypothetical protein CARUB_v10023168mg [Capsella rubella]
Length=461

 Score =   484 bits (1245),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 257/458 (56%), Positives = 335/458 (73%), Gaps = 10/458 (2%)
 Frame = -2

Query  1629  IMGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTL  1450
             I+GR++ E+   KPLGR SV  YGVGHMLNDIT  CW+TYLLL+LT IGLSP  AAIV L
Sbjct  6     IVGRNDDEDPSTKPLGRLSVFYYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAIVML  65

Query  1449  VGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQ  1270
              GQ AD F TI  GELIDRFG FKIWH  G ++V VSF S+FGG C+PC +L S+S TV+
Sbjct  66    SGQVADGFATIFIGELIDRFGHFKIWHAGGSLLVAVSFSSVFGG-CLPCSLLHSNSSTVE  124

Query  1269  TVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFF  1090
             T+ Y + A +F  GW+ TQ+SHM+MVNCITLN SSR+A  S RNAF+MVA+L LYA+   
Sbjct  125   TLSYSMFAAIFNIGWAATQVSHMAMVNCITLNSSSRVALTSSRNAFSMVANLGLYAIALV  184

Query  1089  VF----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWT  922
             VF        E+ +TQYRW+A+ SI +G  FV+IF +G KEPR + D   E   +  PW+
Sbjct  185   VFGVSEAVTKENTETQYRWIAYSSITVGCCFVVIFLMGTKEPRLRIDL-RETSRARIPWS  243

Query  921   YWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSV  742
             YW  ++LYYQVA +Y+ TR+V NVSQ +LA +VI+DL+M+QSAK+L+PAIIY+CSF+ SV
Sbjct  244   YWFHKILYYQVAMVYLLTRLVLNVSQAYLAFFVIDDLQMAQSAKALIPAIIYICSFVVSV  303

Query  741   LLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSI  562
             +LQE+ W+GKRLK ++  GGI+W+ CG  V+LL   +NS+MYA+SV IGIANALM+VT+I
Sbjct  304   MLQEIPWNGKRLKAYYCAGGIIWIFCGVSVLLLSRTINSYMYAISVFIGIANALMLVTAI  363

Query  561   GMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP-VACNPAQA-CFSVTR  388
              M+S L+   L G AFV GS+ F+DK+ CG+ALY L+S +   P V  N +Q   FSVTR
Sbjct  364   SMQSVLIGSELGGCAFVCGSLSFLDKMSCGLALYVLQSHQSTSPKVDVNISQNFYFSVTR  423

Query  387   FSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             + LG +P + +L GV+V++ M+L  T  K  PL +PLL
Sbjct  424   YGLGLVPAVCSLVGVVVTYFMELDSTILK--PLRQPLL  459



>ref|XP_011009643.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Populus euphratica]
Length=456

 Score =   483 bits (1243),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 256/458 (56%), Positives = 332/458 (72%), Gaps = 13/458 (3%)
 Frame = -2

Query  1620  RDNREEEEE----KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVT  1453
             R++ E +++    KP+GR SV  YGVGHMLNDIT  CW+TYLLL+LT+IGLSP  AAI  
Sbjct  2     RNDVENDDDDSYPKPVGRRSVFYYGVGHMLNDITAACWFTYLLLFLTEIGLSPRDAAIAM  61

Query  1452  LVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTV  1273
             L GQ AD F T+ AGELIDRFG FK+WHGAG I+V +SF S+FGG C+PCKIL S S  V
Sbjct  62    LAGQIADGFATVFAGELIDRFGHFKVWHGAGSILVAISFSSVFGG-CLPCKILASCSSVV  120

Query  1272  QTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
             +TV Y  SA +F  GW+ TQ+SHMSMVNCI+LN SSR+   SCRNAFTMVA+L LYAV  
Sbjct  121   ETVSYSTSAAIFNVGWAATQVSHMSMVNCISLNSSSRVVMTSCRNAFTMVANLSLYAVAL  180

Query  1092  FVFTN----NAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPW  925
              VF++       DI+ QYRW+A+ SIFIG  FV IFHLG KEPR K    H    +   W
Sbjct  181   VVFSSIKATTHADIENQYRWIAYTSIFIGCCFVGIFHLGTKEPRLKICV-HGTSNARISW  239

Query  924   TYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITS  745
              YW K+VLYYQV  +Y+ TR+V NVSQ +LA YV++DL+M++SAK+LVPAIIY+ SF  S
Sbjct  240   AYWFKKVLYYQVGLVYMLTRLVQNVSQAYLAFYVMDDLQMAKSAKALVPAIIYMSSFFVS  299

Query  744   VLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTS  565
             V++QE+ W+G+RLK +++ GGILW+ CGA ++ LP  M++FMY +SVLIGIANALM VT 
Sbjct  300   VIMQEMSWTGQRLKAYYSAGGILWVFCGAGILFLPRNMSAFMYVISVLIGIANALMTVTG  359

Query  564   IGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNP-AQACFSVTR  388
             + M+S LV   L+G AFVYGS+ F+DK+ CG+A++ L+SF+ + P      +    SVTR
Sbjct  360   VSMQSILVGSDLNGCAFVYGSLSFLDKISCGLAVFALQSFQSSSPKTEEALSTDNISVTR  419

Query  387   FSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             + LG +P + +L GV +++TMKL   +   + L EPLL
Sbjct  420   YGLGLLPAVCSLAGVAITYTMKL--QTQDSKSLMEPLL  455



>gb|KDO46026.1| hypothetical protein CISIN_1g011925mg [Citrus sinensis]
 gb|KDO46027.1| hypothetical protein CISIN_1g011925mg [Citrus sinensis]
Length=475

 Score =   484 bits (1245),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 258/476 (54%), Positives = 335/476 (70%), Gaps = 31/476 (7%)
 Frame = -2

Query  1629  IMGRDNREEEE-EKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVT  1453
             +M  D   ++   +P+GR SVL YG GHMLNDIT  CW+TYLLL+LTDIGLSP  AA V 
Sbjct  6     VMNYDIENDDSFTQPVGRWSVLYYGSGHMLNDITAACWFTYLLLFLTDIGLSPRGAAAVM  65

Query  1452  LVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTV  1273
             L GQ AD F TI  GELIDRFG FKIWHGAG ++V VSF S+FGG C+PC+IL + +  V
Sbjct  66    LSGQIADGFATIFIGELIDRFGHFKIWHGAGSVLVAVSFSSVFGG-CMPCRILSTSTLKV  124

Query  1272  QTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
             +T+ YC+ A +F  GW+ TQ++HMSMVNCITLN +SR+   SCRNAFTMVA+L LYA+ F
Sbjct  125   ETISYCVFAAIFNVGWAATQVAHMSMVNCITLNSTSRVVLTSCRNAFTMVANLSLYAIAF  184

Query  1092  FVFT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKK---DDDGHEKIGSN  934
              VF+        D++ QYRW+A+ SIFIG  FV IF    +EPR K     + H +I   
Sbjct  185   IVFSVSTAKTHADLENQYRWIAYSSIFIGCCFVGIFLSRTEEPRLKMGLRGNSHARIS--  242

Query  933   TPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSF  754
               W YW K++LYYQVA +Y+ TR+V NVSQ +LA YVINDLRM QSAK+LVPAIIY+CSF
Sbjct  243   --WAYWFKKILYYQVALVYMLTRLVVNVSQAYLAFYVINDLRMGQSAKALVPAIIYICSF  300

Query  753   ITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMM  574
             I S+LLQE+ W+G+RLK +++ GG+LW+ CGA +++LP+ M++FMY L++ +GIANALMM
Sbjct  301   IVSILLQEMAWTGQRLKAYYSAGGVLWVFCGAGILILPMNMSAFMYVLAIFVGIANALMM  360

Query  573   VTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNP-------  415
             VT I M++ LV + L G AFV G++ F+DK+ CG+A+Y L+S++   P   +        
Sbjct  361   VTGISMQNVLVGEDLSGCAFVCGTLSFLDKMSCGIAVYVLQSYQSMSPTVLDNNSSITSL  420

Query  414   ---------AQACFSVTRFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
                      + +  SVTRF LG IP I +L  V V+FTMK LHT + K PL EPLL
Sbjct  421   TVLDNNSLISTSYISVTRFGLGLIPAICSLVSVAVTFTMK-LHTPYSK-PLVEPLL  474



>ref|XP_006482796.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Citrus sinensis]
 ref|XP_006482797.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X2 [Citrus sinensis]
Length=475

 Score =   483 bits (1244),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 257/476 (54%), Positives = 335/476 (70%), Gaps = 31/476 (7%)
 Frame = -2

Query  1629  IMGRDNREEEE-EKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVT  1453
             +M  D   ++   +P+GR SVL YG GHMLNDIT  CW+TYLLL+LTDIGLSP  AA V 
Sbjct  6     VMNYDIENDDSFTQPVGRWSVLYYGSGHMLNDITAACWFTYLLLFLTDIGLSPRGAAAVM  65

Query  1452  LVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTV  1273
             L GQ AD F TI  GELIDRFG FKIWHGAG ++V VSF S+FGG C+PC+IL + +  V
Sbjct  66    LSGQIADGFATIFIGELIDRFGHFKIWHGAGSVLVAVSFSSVFGG-CMPCRILSTSTLKV  124

Query  1272  QTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
             +T+ YC+ A +F  GW+ TQ++HMSMVNCITLN +SR+   SCRNAFTMVA+L LYA+ F
Sbjct  125   ETISYCVFAAIFNVGWAATQVAHMSMVNCITLNSTSRVVLTSCRNAFTMVANLSLYAIAF  184

Query  1092  FVFT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKK---DDDGHEKIGSN  934
              VF+        D++ QYRW+A+ SIFIG  FV IF    +EPR K     + H +I   
Sbjct  185   IVFSVSTAKTHADLENQYRWIAYSSIFIGCCFVGIFLSRTEEPRLKMGLRGNSHARIS--  242

Query  933   TPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSF  754
               W YW K++LYYQVA +Y+ TR+V NVSQ +LA YVINDLRM QSAK+LVPAIIY+CSF
Sbjct  243   --WAYWFKKILYYQVALVYMLTRLVVNVSQAYLAFYVINDLRMGQSAKALVPAIIYICSF  300

Query  753   ITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMM  574
             I S+LLQE+ W+G+RLK +++ GG+LW+ CGA +++LP+ M++FMY L++ +GIANALMM
Sbjct  301   IVSILLQEMAWTGQRLKAYYSAGGVLWVFCGAGILILPMNMSAFMYVLAIFVGIANALMM  360

Query  573   VTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNP-------  415
             VT I M++ L+ + L G AFV G++ F+DK+ CG+A+Y L+S++   P   +        
Sbjct  361   VTGISMQNVLIGEDLSGCAFVCGTLSFLDKMSCGIAVYVLQSYQSMSPTVLDNNSSITSL  420

Query  414   ---------AQACFSVTRFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
                      + +  SVTRF LG IP I +L  V V+FTMK LHT + K PL EPLL
Sbjct  421   TVLDNNSLISTSYISVTRFGLGLIPAICSLVSVAVTFTMK-LHTPYSK-PLVEPLL  474



>ref|XP_009408462.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Musa acuminata subsp. malaccensis]
 ref|XP_009408463.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Musa acuminata subsp. malaccensis]
Length=453

 Score =   482 bits (1241),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 259/460 (56%), Positives = 335/460 (73%), Gaps = 14/460 (3%)
 Frame = -2

Query  1635  RRIMGRDNREEEEE-KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAI  1459
             R ++G  + EE +   P+GR + L+YG GHMLNDIT  CW+TYLLL+LTDIGLSP  AAI
Sbjct  3     RHLVGDASSEEAQNGTPVGRLTALSYGAGHMLNDITSACWFTYLLLFLTDIGLSPRDAAI  62

Query  1458  VTLVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSP  1279
             V L GQ ADAFTT+ AGELID FG FK+WH  G  +V VSF S+FG +C+ CKI+GS+SP
Sbjct  63    VMLSGQIADAFTTVFAGELIDCFGHFKLWHAGGSFLVAVSFSSVFG-SCLFCKIIGSNSP  121

Query  1278  TVQTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAV  1099
             T+QT+GY I A +F  GW+ TQ+SHMSMVNCITL+ +SR+A  SCRNAFTMVA+L LYAV
Sbjct  122   TLQTIGYSIFAAIFNVGWAVTQVSHMSMVNCITLDPTSRVALASCRNAFTMVANLSLYAV  181

Query  1098  TFFVFT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNT  931
                VF+      + DIK QYRW+A++SIFIG  FV++F +GVKEPR K +   +KI S  
Sbjct  182   ALCVFSVYNSRASADIKIQYRWIAYLSIFIGCFFVVLFLVGVKEPRLKQEIQCKKI-SRI  240

Query  930   PWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFI  751
              W +W K++LYYQVA +Y  TR+VTNVSQ  LA YV N+L MS S+K+LVPAIIY+CS +
Sbjct  241   SWAHWFKKILYYQVALVYTLTRLVTNVSQALLAFYVTNELGMSDSSKALVPAIIYICSLL  300

Query  750   TSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMV  571
              SV+LQE+ WSG RLK FF  G ILW+  GA + +LP   ++++Y LS+++G ANALM V
Sbjct  301   VSVILQEIRWSGWRLKFFFTAGAILWVFSGAGIFVLPPSKHNYIYVLSIIVGAANALMTV  360

Query  570   TSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVT  391
             T I MES LV + L+G AFVYGS+ F+DK+ CG+ALY LES+E +  V+ N     +S+T
Sbjct  361   TGISMESTLVGEDLNGCAFVYGSLSFLDKLSCGLALYALESYEGSSDVSVN-----YSIT  415

Query  390   RFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
             R+ +G +P   AL   +V++TMKL  T     PL EPL+A
Sbjct  416   RYGIGAVPAACALLSAVVTYTMKL--TDSSSIPLVEPLIA  453



>ref|XP_010934426.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Elaeis guineensis]
 ref|XP_010934434.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Elaeis guineensis]
Length=458

 Score =   482 bits (1240),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 258/453 (57%), Positives = 330/453 (73%), Gaps = 11/453 (2%)
 Frame = -2

Query  1614  NREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQFA  1435
             + E +  +PLGR S+L+YG GHMLNDIT  CW+TYLLL+LTDIGLSP  AAIV L GQ A
Sbjct  10    STELQNAEPLGRLSILSYGAGHMLNDITSACWFTYLLLFLTDIGLSPRDAAIVMLSGQIA  69

Query  1434  DAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYC  1255
             DAF T+ AGELIDRFG FK+WH  G  +V +SF S+FGG C+PCKILG++S TVQT+GY 
Sbjct  70    DAFVTVFAGELIDRFGHFKLWHAGGSFLVAISFSSVFGG-CLPCKILGTNSSTVQTIGYS  128

Query  1254  ISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFT--  1081
               A +F  GW+ TQ+SHMSMVNCITLN +SR+A  SCRNAFTMV++L LYAV   VF+  
Sbjct  129   TFAAIFNVGWAATQVSHMSMVNCITLNPTSRVALASCRNAFTMVSNLSLYAVALAVFSVY  188

Query  1080  --NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKR  907
                 + D+K QYRW+A++SIF+G  FV IF +G KEP  K     + + S   W +W K+
Sbjct  189   NAKQSADVKIQYRWIAYLSIFMGCCFVGIFLIGTKEPELKLQVQCKDL-SRISWAHWFKK  247

Query  906   VLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQEL  727
             VLYYQVA +Y+ TR+VTNVSQ  LA YVI+DL+M+ S+K+LVPAIIY+CSF+ SV+LQE+
Sbjct  248   VLYYQVALVYMLTRLVTNVSQALLAFYVIDDLKMNHSSKALVPAIIYICSFMVSVILQEI  307

Query  726   EWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESA  547
              W+G RLK FF GG I W+  GA + +LP  + SFMY LS+ IG+ANALM VT+I MES 
Sbjct  308   RWTGWRLKAFFIGGAIFWIFSGAGIFILPSNLQSFMYILSITIGVANALMTVTAISMESV  367

Query  546   LVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFED-ADPVACNPAQAC-FSVTRFSLGF  373
             LV + L+G AFVYGS+ F+DK+ CG+ALY LES++   D +  +   A  +S+ R  LG 
Sbjct  368   LVGEDLNGCAFVYGSLSFLDKLSCGLALYVLESYQGLPDAMDHHVVTAGHYSIIRCGLGL  427

Query  372   IPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             IP I AL   I+++TMKL     + +PL EPLL
Sbjct  428   IPAICALLSAIITYTMKL---PDRSRPLVEPLL  457



>ref|XP_008788963.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X2 [Phoenix dactylifera]
Length=462

 Score =   481 bits (1239),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 255/464 (55%), Positives = 334/464 (72%), Gaps = 11/464 (2%)
 Frame = -2

Query  1647  ISVYRRIMGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSS  1468
             +++   I+   + E +  +PLGR S+L+YGVGHMLNDIT  CW+TYLLL+LTD+GLSP  
Sbjct  1     MTMVNSIIVESSTELQNAEPLGRLSILSYGVGHMLNDITSACWFTYLLLFLTDMGLSPRD  60

Query  1467  AAIVTLVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGS  1288
             AAIV L GQ ADAF T+ AGELIDRFG FK+WH  G  +V +SF S+FGG C+PCKILG+
Sbjct  61    AAIVMLSGQIADAFATVFAGELIDRFGHFKLWHAGGSFLVAISFSSVFGG-CLPCKILGT  119

Query  1287  DSPTVQTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLML  1108
             +S TVQT+GY   A +F  GW+ TQ+SHMSMVNCITLN +SR+A  SCRNAFTMV++L L
Sbjct  120   NSSTVQTIGYSTFAAIFNVGWAATQVSHMSMVNCITLNPTSRVALASCRNAFTMVSNLSL  179

Query  1107  YAVTFFVFT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIG  940
             YA+   VF+      + D+K +YRW+A++SIFIG  FV+IF +G KEP  K     + + 
Sbjct  180   YAIALAVFSVYDAKQSADVKIEYRWIAYLSIFIGCCFVVIFLIGTKEPELKLQVQCKDL-  238

Query  939   SNTPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLC  760
             S   W +W K+VLYYQVA +Y+ TR+ TNVSQ  LA YVI+DL+M+ S+K+LVPAIIY+C
Sbjct  239   SRISWAHWFKKVLYYQVALVYMLTRLATNVSQALLAFYVIDDLKMNHSSKALVPAIIYIC  298

Query  759   SFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANAL  580
             SF+ SV+LQE+ W+G RLK FF GG I W+  GA + +LP K+ SFMY LS+ IG+ANAL
Sbjct  299   SFMVSVMLQEIRWTGWRLKAFFTGGAIFWIFSGAGIFVLPSKLQSFMYILSITIGVANAL  358

Query  579   MMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQAC-  403
             MMVT+I MES LV + L+G AFVYGS+ F+DK+ CG+ALY LES++       N      
Sbjct  359   MMVTAISMESVLVGEDLNGCAFVYGSLSFLDKLSCGLALYVLESYQGVPAAMDNHVVTAG  418

Query  402   -FSVTRFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
              FS++R  LG IP   AL   I+++T++L     + + L EPLL
Sbjct  419   HFSISRCGLGLIPATCALLSAIITYTIRL---PDRSRTLMEPLL  459



>ref|XP_009138879.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Brassica rapa]
 ref|XP_009138880.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Brassica rapa]
 ref|XP_009138881.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Brassica rapa]
Length=459

 Score =   480 bits (1235),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 253/459 (55%), Positives = 330/459 (72%), Gaps = 9/459 (2%)
 Frame = -2

Query  1626  MGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLV  1447
             M   + E+   KP+GR +V  YGVGHMLNDIT  CW+TYLLL+LT IGLSP  AAIV L 
Sbjct  1     MAGGSEEDPYTKPIGRWAVFFYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAIVMLS  60

Query  1446  GQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
             GQ AD F TI  GELIDRFG FKIWH AG ++V +SF S+FGG C+PC IL +DS +++T
Sbjct  61    GQVADGFATIFTGELIDRFGHFKIWHAAGSVLVAISFSSVFGG-CLPCSILHNDSLSLET  119

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
               Y + A +F  GW+ TQ+SHM+MVNCI+LN +SR+A  SCRNAFTMVA+L LYA+   V
Sbjct  120   FSYSMFAAIFNIGWAATQVSHMAMVNCISLNSTSRVALTSCRNAFTMVANLSLYAIALVV  179

Query  1086  F----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTY  919
             F      + E+ +TQYRW+A+ SI +G  FV+IF +G KEPR + D          PW Y
Sbjct  180   FGVIKAGSKENTETQYRWIAYSSITVGCCFVVIFLMGTKEPRLRMDLKETSRRVRIPWVY  239

Query  918   WLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVL  739
             W K++LYYQVA +Y+ TR+V NVSQ +LA +VI+DL+M QSAK+LVPAIIY+ SF+ SVL
Sbjct  240   WFKKLLYYQVAMVYLLTRLVLNVSQAYLAFFVIDDLQMDQSAKALVPAIIYIGSFVVSVL  299

Query  738   LQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIG  559
             LQE+ W+G+RLK +++ GGI+W+ CGA ++LLP  ++SFMYA+SV IGIANALMMVT+I 
Sbjct  300   LQEIPWNGRRLKAYYSAGGIIWMFCGAAILLLPRDISSFMYAISVFIGIANALMMVTAIS  359

Query  558   MESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP-VACNPAQ--ACFSVTR  388
             M+S LV   + G AFV GS+ F+DK+ CG+ALY L+S +   P +  N  Q  A  SVTR
Sbjct  360   MQSVLVGSEVGGCAFVCGSLSFLDKMSCGLALYVLQSHQSTSPRIQLNNGQQSAYLSVTR  419

Query  387   FSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLA-EPLL  274
             + LG +P + +L GV+V+F M+L       +PL  EPLL
Sbjct  420   YGLGLVPALCSLVGVVVTFFMELEAAGSLSKPLLDEPLL  458



>emb|CDY42660.1| BnaC04g22460D [Brassica napus]
Length=459

 Score =   480 bits (1235),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 250/458 (55%), Positives = 328/458 (72%), Gaps = 8/458 (2%)
 Frame = -2

Query  1626  MGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLV  1447
             M   + E+   KP+GR +V  YGVGHMLNDIT  CW+TYLLL+LT IGLSP  AAIV L 
Sbjct  1     MAGGSEEDPYTKPIGRWAVFFYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAIVMLS  60

Query  1446  GQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
             GQ AD F TI  GELIDRFG FKIWH AG ++V +SF S+FGG C+PC IL +DS +++T
Sbjct  61    GQVADGFATIFTGELIDRFGHFKIWHAAGSVLVAISFSSVFGG-CLPCSILHNDSLSLET  119

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
               Y + A +F  GW+ TQ+SHM+MVNCI+LN +SR+A  SCRNAFTMVA+L LYA+   V
Sbjct  120   FSYSMFAAIFNIGWAATQVSHMAMVNCISLNSTSRVALTSCRNAFTMVANLSLYAIALVV  179

Query  1086  F----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTY  919
             F      + E+ +TQYRW+A+ SI +G  FV+IF +G KEPR + D          PW Y
Sbjct  180   FGVIKAGSKENTETQYRWIAYSSITVGCCFVVIFLMGTKEPRLRMDLKETSRRVRIPWVY  239

Query  918   WLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVL  739
             W K++LYYQVA +Y+ TR+V NVSQ +LA +VI+DL+M QSAK+LVPAIIY+ SF+ SVL
Sbjct  240   WFKKLLYYQVAMVYLLTRLVLNVSQAYLAFFVIDDLQMDQSAKALVPAIIYIGSFVVSVL  299

Query  738   LQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIG  559
             LQE+ W+G+RLK +++ GGI+W+ CGA ++LLP  ++SFMYA+SV IGIANALMMVT+I 
Sbjct  300   LQEIPWNGRRLKAYYSAGGIIWMFCGAAILLLPRDISSFMYAISVFIGIANALMMVTAIS  359

Query  558   MESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP-VACNPAQAC--FSVTR  388
             M+S LV   + G AFV GS+ F+DK+ CG+ALY L+S +   P +  N  Q    FSVTR
Sbjct  360   MQSVLVGAEVGGCAFVCGSLSFLDKMSCGIALYVLQSHQSTSPRIQLNNGQQSVYFSVTR  419

Query  387   FSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             + LG +P + +  GV+V+F M+L       +PL + LL
Sbjct  420   YGLGLVPALCSFVGVVVTFFMELEAAGSLSKPLLDELL  457



>ref|XP_010518025.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Camelina sativa]
 ref|XP_010518026.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Camelina sativa]
Length=462

 Score =   480 bits (1235),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 255/459 (56%), Positives = 336/459 (73%), Gaps = 11/459 (2%)
 Frame = -2

Query  1629  IMGRDNREEE-EEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVT  1453
             I+GR++ EE+   KPLGR SV  YGVGHMLNDIT  CW+TYLLL+LT IGLSP  AAIV 
Sbjct  6     IVGRNDDEEDPSTKPLGRLSVFYYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAIVM  65

Query  1452  LVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTV  1273
             L GQ AD F T+  GELIDRFG FKIWH AG ++V VSF S+FGG C+PC +L S+S TV
Sbjct  66    LSGQVADGFATVFVGELIDRFGHFKIWHAAGSLLVAVSFSSVFGG-CLPCTLLNSNSLTV  124

Query  1272  QTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
             +T+ Y + A +F  GW+ TQ+SHM+MVNCITLN +SR+A  S RNAF+MVA+L LYA+  
Sbjct  125   ETLSYSMFAAIFNIGWAATQVSHMAMVNCITLNSTSRVALTSSRNAFSMVANLGLYAIAL  184

Query  1092  FVF----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPW  925
              VF        ++ +TQYRW+A+ SI +G  FV+IF +G KEPR + D   E   +  PW
Sbjct  185   VVFGVSEAVTKKNTETQYRWIAYSSITVGCCFVVIFLMGTKEPRLRIDL-RETSRARIPW  243

Query  924   TYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITS  745
              YW ++VLYYQVA +Y+ TR+V NVSQ +LA +VI++L+M+QSAK+L+PAIIY+CSF+ S
Sbjct  244   AYWFRKVLYYQVAMVYLLTRLVLNVSQAYLAFFVIDELQMAQSAKALIPAIIYICSFVVS  303

Query  744   VLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTS  565
             V+LQE+ W+GKRLK ++  GGI+W+ CG  ++LL   +NS+MYA+SV IGIANALM+VT+
Sbjct  304   VMLQEIPWNGKRLKAYYCAGGIIWIFCGVAILLLSRSINSYMYAISVFIGIANALMLVTA  363

Query  564   IGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP-VACNPAQA-CFSVT  391
             I M+S L+   L G AFV GS+ F+DK+ CG+ALY L+S +   P V  N  Q   FSVT
Sbjct  364   ISMQSVLIGSELGGCAFVCGSLSFLDKMSCGLALYVLQSHQSTSPKVDVNINQHFYFSVT  423

Query  390   RFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             R+ LG +P + +L GV+V++ M+L  T  K  PL +PLL
Sbjct  424   RYGLGLVPAVCSLIGVVVTYFMELDSTILK--PLRQPLL  460



>ref|NP_191566.5| major facilitator protein [Arabidopsis thaliana]
 gb|AAM74491.1| AT3g60070/T2O9_50 [Arabidopsis thaliana]
 gb|AEE80008.1| major facilitator protein [Arabidopsis thaliana]
Length=458

 Score =   479 bits (1234),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 256/459 (56%), Positives = 328/459 (71%), Gaps = 10/459 (2%)
 Frame = -2

Query  1626  MGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLV  1447
             M   + E+   KP+GR SV  YGVGHMLNDIT  CW+TYLLL+LT IGLSP  AAIV L 
Sbjct  1     MTGGSEEDPFTKPIGRWSVFFYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAIVMLS  60

Query  1446  GQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
             GQ ADAF TI  GELIDRFG FKIWH AG ++V +SF S+FGG C+PC IL +DS T++T
Sbjct  61    GQVADAFATIFTGELIDRFGHFKIWHAAGSLLVAISFSSVFGG-CLPCSILHNDSLTLET  119

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
               Y + A +F  GW+ TQ+SHM+MVNCI+LN +SR+A  S RNAFTMVA+L LYA+   V
Sbjct  120   FSYSMFAAIFNIGWAATQVSHMAMVNCISLNSTSRVALTSSRNAFTMVANLGLYAIALVV  179

Query  1086  F----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTY  919
             F      + ED +TQYRW+A+ SI IG  FV+IF +G KEPR + D   E   +  PW Y
Sbjct  180   FGVIKAGSKEDTETQYRWIAYSSITIGCCFVVIFLMGTKEPRLRIDL-KETSRARIPWVY  238

Query  918   WLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVL  739
             W +++LYYQVA +Y+ TR+V NVSQ +LA +VI+DL+M QSAK+LVPAIIY+CSF+ SVL
Sbjct  239   WFRKILYYQVAMVYLLTRLVLNVSQAYLAFFVIDDLQMDQSAKALVPAIIYICSFVVSVL  298

Query  738   LQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIG  559
             LQE+ W+GKRLK ++  GGI+W+ CGA ++LLP  ++SFMYA+SV IGIANALMMVT+I 
Sbjct  299   LQEIPWNGKRLKAYYTAGGIIWIFCGAAILLLPRDISSFMYAISVFIGIANALMMVTAIS  358

Query  558   MESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP---VACNPAQACFSVTR  388
             M+S LV   + G AFV GS+ F+DK+ CG+ALY L+S +   P   +  N      SVTR
Sbjct  359   MQSVLVGAEVGGCAFVCGSLSFLDKMSCGLALYVLQSHQTTSPRGQLNNNQQSVYLSVTR  418

Query  387   FSLGFIPGIAALFGVIVSFTMKLLHTSHKKQP-LAEPLL  274
             + LG +P + +  GV V+F M+L       +P L EPLL
Sbjct  419   YGLGLVPALCSFVGVAVTFFMELEAAGSLSKPLLREPLL  457



>ref|XP_006369484.1| hypothetical protein POPTR_0001s23860g [Populus trichocarpa]
 gb|ERP66053.1| hypothetical protein POPTR_0001s23860g [Populus trichocarpa]
Length=457

 Score =   479 bits (1233),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 253/445 (57%), Positives = 325/445 (73%), Gaps = 9/445 (2%)
 Frame = -2

Query  1593  KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQFADAFTTII  1414
             KP+GR  V  YGVGHMLNDIT  CW+TYLLL+LT+IGLSP  AAI  L GQ AD F T+ 
Sbjct  16    KPVGRRCVFYYGVGHMLNDITAACWFTYLLLFLTEIGLSPRDAAIAMLAGQIADGFATVF  75

Query  1413  AGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAVVFC  1234
             AGELIDRFG FK+WHGAG I+V +SF S+FGG C+PCKIL S S  V+TV Y  SA +F 
Sbjct  76    AGELIDRFGHFKVWHGAGSILVAISFSSVFGG-CLPCKILASCSSVVETVSYSTSAAIFN  134

Query  1233  SGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTN----NAED  1066
              GW+ TQ+SHMSMVNCI+LN SSR+   SCRNAFTMVA+L LYAV   VF++       D
Sbjct  135   VGWAATQVSHMSMVNCISLNSSSRVVMTSCRNAFTMVANLSLYAVALVVFSSIKATTHAD  194

Query  1065  IKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVLYYQVA  886
             I+ QYRW+A+ SIFIG  FV IFHLG KEPR K    H    +   W YW K+VLYYQV 
Sbjct  195   IENQYRWIAYTSIFIGCCFVGIFHLGTKEPRLKICV-HGTSNARISWAYWFKKVLYYQVG  253

Query  885   SIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRL  706
              +Y+ TR+V NVSQ +LA YV++DL+M++SAK+LVPA+IY+ SF  SV++QE+ W+G+RL
Sbjct  254   LVYMLTRLVQNVSQVYLAFYVMDDLQMAKSAKALVPAMIYMSSFFVSVIMQEMSWTGQRL  313

Query  705   KIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLD  526
             K +++ GGILW+ CGA ++ LP  M++FMY +SVLIGIANALM VT + M+S LV   L+
Sbjct  314   KAYYSAGGILWVFCGAGILFLPRNMSAFMYVISVLIGIANALMTVTGVSMQSILVGSDLN  373

Query  525   GSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNP-AQACFSVTRFSLGFIPGIAALF  349
             G AFVYGS+ F+DK+ CG+A++ L+SF+ + P      +   FSVTR+ LG +P + +L 
Sbjct  374   GCAFVYGSLSFLDKISCGLAVFALQSFQSSSPKTEEALSTDYFSVTRYGLGLLPAVCSLA  433

Query  348   GVIVSFTMKLLHTSHKKQPLAEPLL  274
             GV +++TMKL   +   + L EPLL
Sbjct  434   GVAITYTMKL--QTQDSKSLMEPLL  456



>ref|XP_006438994.1| hypothetical protein CICLE_v10031412mg [Citrus clementina]
 ref|XP_006439003.1| hypothetical protein CICLE_v10031412mg [Citrus clementina]
 gb|ESR52234.1| hypothetical protein CICLE_v10031412mg [Citrus clementina]
 gb|ESR52243.1| hypothetical protein CICLE_v10031412mg [Citrus clementina]
Length=475

 Score =   479 bits (1233),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 256/476 (54%), Positives = 334/476 (70%), Gaps = 31/476 (7%)
 Frame = -2

Query  1629  IMGRDNREEEE-EKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVT  1453
             +M  D   ++   +P+GR SVL YG GHMLNDIT  CW+TYLLL+LTDIGLSP  AA V 
Sbjct  6     VMNYDIENDDSFTQPVGRWSVLYYGSGHMLNDITAACWFTYLLLFLTDIGLSPRGAAAVM  65

Query  1452  LVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTV  1273
             L GQ AD F TI  GELIDRFG FKIWHGAG ++V VSF S+FGG C+PC+IL + +  V
Sbjct  66    LSGQIADGFATIFIGELIDRFGHFKIWHGAGSVLVAVSFSSVFGG-CMPCRILSTSTLKV  124

Query  1272  QTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
             +T+ YC+ A +F  GW+ TQ++HMSMVNCITLN +SR+   SCRNAFTMVA+L LYA+ F
Sbjct  125   ETISYCVFAAIFNVGWAATQVAHMSMVNCITLNSTSRVVLTSCRNAFTMVANLSLYAIAF  184

Query  1092  FVFT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKK---DDDGHEKIGSN  934
              VF+        D++ QYRW+A+ SIFIG  FV IF    +EPR K     + H +I   
Sbjct  185   IVFSVSTAKTHADLENQYRWIAYSSIFIGCCFVGIFLSRTEEPRLKMGLRGNSHARIS--  242

Query  933   TPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSF  754
               W YW K++LYYQVA +Y+ TR+V NVSQ +LA YVINDLRM QSAK+LVPAIIY+CSF
Sbjct  243   --WAYWFKKILYYQVALVYMLTRLVVNVSQAYLAFYVINDLRMGQSAKALVPAIIYICSF  300

Query  753   ITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMM  574
             I S+LLQE+ W+G+RLK +++ GG+LW+ CGA +++LP+ M++FMY L++ +GIANALMM
Sbjct  301   IVSILLQEMAWTGQRLKAYYSAGGVLWVFCGAGILILPMNMSAFMYVLAIFVGIANALMM  360

Query  573   VTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNP-------  415
             VT I M++ L+ + L G AFV G++ F+DK+ CG+A+Y L+S++   P   +        
Sbjct  361   VTGISMQNVLIGEDLSGCAFVCGTLSFLDKMSCGIAVYVLQSYQSMSPTVLDNNSSITSL  420

Query  414   ---------AQACFSVTRFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
                      + +  SVTRF LG IP I +L  V V+ TMK LHT + K PL EPLL
Sbjct  421   TVLDNNSLISTSYISVTRFGLGLIPAICSLVSVAVTCTMK-LHTPYSK-PLVEPLL  474



>ref|NP_001132176.1| hypothetical protein [Zea mays]
 ref|XP_008650910.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF80917.1| unknown [Zea mays]
 tpg|DAA63308.1| TPA: hypothetical protein ZEAMMB73_685269 [Zea mays]
Length=457

 Score =   478 bits (1231),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 246/452 (54%), Positives = 330/452 (73%), Gaps = 10/452 (2%)
 Frame = -2

Query  1614  NREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQFA  1435
             + + + ++PLGR S+++YG GHMLNDIT  CW+TYLL++LTD+GLSP  AAIV L GQ A
Sbjct  10    SNDGQLDEPLGRVSIISYGSGHMLNDITSSCWFTYLLVFLTDVGLSPGDAAIVMLSGQLA  69

Query  1434  DAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYC  1255
             D FTTI  GEL+DRFG FK+WH  G I+V +SF S+FG +C+PCK++G++S T++TVGY 
Sbjct  70    DGFTTIFVGELMDRFGHFKLWHAGGSILVAISFSSVFG-SCVPCKLMGTNSSTLETVGYS  128

Query  1254  ISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTN-  1078
               A +F  GW+ TQ++HMSMVNC++ N +SR++ VSCRNAFTMVA+L LY +   +FT  
Sbjct  129   TFATIFNVGWAVTQVAHMSMVNCMSSNPTSRVSLVSCRNAFTMVANLSLYGIALLIFTIL  188

Query  1077  NAEDIKTQYRWMAfisifiggvfviiFHLGVKEP---RKKDDDGHEKIGSNTPWTYWLKR  907
              + ++  QYRW+A++SI IG  FV+IF +G KEP   R   D    +I     WTYW K+
Sbjct  189   QSVNVMFQYRWIAYVSISIGSCFVVIFLVGTKEPGSIRHCVDKSLSRIS----WTYWFKK  244

Query  906   VLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQEL  727
             VLYYQVA +Y  TR+VTNVSQ FLA YVINDL MSQS+K+LVPAIIY+CS I SV+LQE 
Sbjct  245   VLYYQVALVYTLTRLVTNVSQAFLAFYVINDLEMSQSSKALVPAIIYICSLIVSVILQET  304

Query  726   EWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESA  547
              WS  RLK++F+ G +LW+L G  ++ LP +M++ MYA+S++IG ANALM VTSI ME  
Sbjct  305   RWSSWRLKLYFSAGAVLWILSGLGIVFLPSRMHNLMYAISIIIGAANALMTVTSISMEGV  364

Query  546   LVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQA-CFSVTRFSLGFI  370
             LV + L+G AFVYGS+ F+DKV CGV LY LES++ +  +  N   A  +S+TR  LG +
Sbjct  365   LVGEDLNGCAFVYGSLSFVDKVSCGVVLYILESYQGSTEIRSNLGTAFGYSITRLGLGLV  424

Query  369   PGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             P + +L   IV++TM L     +++PL EPLL
Sbjct  425   PAVCSLLSSIVAYTMDLPDPDTRRRPLVEPLL  456



>ref|NP_001060093.1| Os07g0578200 [Oryza sativa Japonica Group]
 dbj|BAF22007.1| Os07g0578200 [Oryza sativa Japonica Group]
 dbj|BAG92223.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC82325.1| hypothetical protein OsI_26604 [Oryza sativa Indica Group]
Length=454

 Score =   478 bits (1230),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 249/456 (55%), Positives = 331/456 (73%), Gaps = 6/456 (1%)
 Frame = -2

Query  1632  RIMGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVT  1453
             +IM   +  EE ++PLGR  +L+YG GHMLNDIT  CW+TYLL++LTDIGLSPS AA+V 
Sbjct  3     KIMDNQSSIEELDEPLGRVPILSYGSGHMLNDITSSCWFTYLLVFLTDIGLSPSDAAVVM  62

Query  1452  LVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTV  1273
             L GQ AD F TI  GELIDRFG FK+WH  G I+V +SF S+FG +C+PCK+ G+ S T+
Sbjct  63    LSGQLADGFATIFVGELIDRFGHFKLWHAGGSILVAISFSSVFG-SCLPCKLTGTISSTM  121

Query  1272  QTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
             +TVGY   A +F  GW+ TQ+SHMSMVNC+T N +SR+A VSCRNAFTM+A+L LY +  
Sbjct  122   ETVGYSTFAAIFNVGWAVTQVSHMSMVNCMTSNPTSRVALVSCRNAFTMIANLSLYGIAL  181

Query  1092  FVFT-NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYW  916
              +F+   +  +  QYRW+A++SI +G  FV++F +G +EP       ++++ S   WT+W
Sbjct  182   LIFSLRQSVSVIVQYRWIAYVSIALGSCFVVVFLIGTEEPGLNQHCQNKRL-SRISWTHW  240

Query  915   LKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLL  736
              K+VLYYQVA +Y+FTR+VTNVSQ  LA YVINDL M QS+K+LVPAIIY+CS I SV+L
Sbjct  241   FKKVLYYQVALVYMFTRLVTNVSQALLAFYVINDLEMPQSSKALVPAIIYVCSLIVSVIL  300

Query  735   QELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGM  556
             QE  WS  RLK +F+ G +LW+L G  +++LP  M++FMYALS+ IG+ANALM VTSI M
Sbjct  301   QETRWSSWRLKNYFSAGAMLWILSGVGIVVLPSGMHNFMYALSITIGVANALMTVTSISM  360

Query  555   ESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQA-CFSVTRFSL  379
             E  LV + L+G AFVYGS+ F+DKV CG+ALY LES++ +     N   A  +SVTR  L
Sbjct  361   EGILVGEDLNGCAFVYGSLSFVDKVSCGLALYILESYQGSTNTRQNLELAFGYSVTRLGL  420

Query  378   GFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
             G +P   +L   I+++TM L  T  +++PL EPLLA
Sbjct  421   GLVPAACSLLSAIIAYTMDLPDT--RRRPLVEPLLA  454



>ref|XP_002314218.1| hypothetical protein POPTR_0009s02950g [Populus trichocarpa]
 gb|EEE88173.1| hypothetical protein POPTR_0009s02950g [Populus trichocarpa]
Length=442

 Score =   477 bits (1227),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 252/454 (56%), Positives = 323/454 (71%), Gaps = 22/454 (5%)
 Frame = -2

Query  1614  NREEEEE---KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVG  1444
             N  E+++   KP+GR SV  YGVGHMLNDIT  CW+TYLLL+LT+IGLSP  AAIV L G
Sbjct  3     NDVEDDDSCPKPVGRSSVFYYGVGHMLNDITAACWFTYLLLFLTEIGLSPRDAAIVMLAG  62

Query  1443  QFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTV  1264
             Q AD F T+ AGELIDRFG FKIWHGAG I+  +SF S+FGG C+PCKIL S SP ++T+
Sbjct  63    QIADGFATVFAGELIDRFGHFKIWHGAGSILAAISFSSVFGG-CLPCKILASSSPIIETI  121

Query  1263  GYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF  1084
              Y  SA +F  GW+ TQ+SHMSMVNCI+LN +SR+   SCRNAFTMVA+L LYAV   VF
Sbjct  122   SYSTSAAIFNVGWAATQVSHMSMVNCISLNSTSRVVMTSCRNAFTMVANLSLYAVALVVF  181

Query  1083  TNNA----EDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYW  916
             +        DI+ QY W+A+ SIFIG  FV IFHLG KEPR K    H    +   W YW
Sbjct  182   STTKATTHSDIENQYHWIAYTSIFIGCCFVGIFHLGTKEPRLKIRV-HGTSYARISWAYW  240

Query  915   LKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLL  736
              K+VLYYQV  +Y+ TR+  NVSQ +LA YVI D+RM++SAK+LVPAIIY+ SFI S+++
Sbjct  241   FKKVLYYQVGLVYMLTRLAQNVSQAYLAFYVIEDMRMAKSAKALVPAIIYISSFIVSIIM  300

Query  735   QELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGM  556
             QE+ W+G+RLK ++  GG+LW+ CGA ++ LP  +++FMY +SV IG+AN LM +T + M
Sbjct  301   QEMYWTGQRLKAYYCAGGVLWVFCGASILFLPRSLSAFMYVISVFIGVANTLMTITGVSM  360

Query  555   ESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRFSLG  376
             +S LV   LDG AFVYGS+ F+DKV CG+A++ L+SF           Q   SVTR+ LG
Sbjct  361   QSVLVGSDLDGCAFVYGSLSFLDKVSCGLAVFVLQSF-----------QKYISVTRYGLG  409

Query  375   FIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
              +P + +L G+ +++TMK L T H K  L EPLL
Sbjct  410   LLPAVCSLTGMAITYTMK-LQTPHSKS-LMEPLL  441



>gb|ACG29601.1| hypothetical protein [Zea mays]
Length=457

 Score =   477 bits (1228),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 248/457 (54%), Positives = 330/457 (72%), Gaps = 13/457 (3%)
 Frame = -2

Query  1620  RDNREEEE---EKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTL  1450
             RD     +   ++PLGR S+++YG GHMLNDIT  CW+TYLL++LTD+GLSP  AAIV L
Sbjct  5     RDIETSNDGLLDEPLGRVSIISYGSGHMLNDITSSCWFTYLLVFLTDVGLSPGDAAIVML  64

Query  1449  VGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQ  1270
              GQ AD FTTI  GEL+DRFG FK+WH  G I+V +SF S+FG +C+PCK++G++S T++
Sbjct  65    SGQLADGFTTIFVGELMDRFGHFKLWHAGGSILVAISFSSVFG-SCVPCKLMGTNSSTLE  123

Query  1269  TVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFF  1090
             TVGY   A +F  GW+ TQ++HMSMVNC++ N +SR++ VSCRNAFTMVA+L LY +   
Sbjct  124   TVGYSTFAAIFNVGWAVTQVAHMSMVNCMSSNPTSRVSLVSCRNAFTMVANLSLYGIALL  183

Query  1089  VFTN-NAEDIKTQYRWMAfisifiggvfviiFHLGVKEP---RKKDDDGHEKIGSNTPWT  922
             +FT   + ++  QYRW+A++SI IG  FV+IF +G KEP   R   D    +I     WT
Sbjct  184   IFTILQSVNVMFQYRWIAYVSISIGSCFVVIFLVGTKEPGSIRHCVDKSLSRIS----WT  239

Query  921   YWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSV  742
             YW K+VLYYQVA +Y  TR+VTNVSQ FLA YVINDL MSQS+K+LVPAIIY+CS I SV
Sbjct  240   YWFKKVLYYQVALVYTLTRLVTNVSQAFLAFYVINDLEMSQSSKALVPAIIYICSLIVSV  299

Query  741   LLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSI  562
             +LQE  WS  RLK++F+ G +LW+L G  ++ LP +M++ MYA+S++IG ANALM VTSI
Sbjct  300   ILQETRWSSWRLKLYFSAGAVLWILSGLGIVFLPSRMHNLMYAISIIIGAANALMTVTSI  359

Query  561   GMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQA-CFSVTRF  385
              ME  LV + L+G AFVYGS+ F+DKV CGV LY LES++ +  +  N   A  +S+TR 
Sbjct  360   SMEGVLVGEDLNGCAFVYGSLSFVDKVSCGVVLYILESYQGSTEIRSNLGTAFGYSITRL  419

Query  384   SLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
              LG +P + +L   IV++TM L     +++PL EPLL
Sbjct  420   GLGLVPAVCSLLSSIVAYTMDLPDPDTRRRPLVEPLL  456



>ref|XP_006657882.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Oryza brachyantha]
Length=455

 Score =   477 bits (1228),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 249/454 (55%), Positives = 331/454 (73%), Gaps = 9/454 (2%)
 Frame = -2

Query  1617  DNR---EEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLV  1447
             DN+   EE+ ++PLGR ++L+YG GHMLNDIT  CW+TYLL +LTDIGLSPS AA+V L 
Sbjct  6     DNQSSIEEQLDEPLGRVTILSYGSGHMLNDITSSCWFTYLLFFLTDIGLSPSDAAVVMLS  65

Query  1446  GQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
             GQ AD FTTI  GELIDRFG FK+WH  G I+V VSF S+FG +C+PCK+ G+ S T++T
Sbjct  66    GQLADGFTTIFVGELIDRFGHFKLWHAGGSILVAVSFSSVFG-SCLPCKLTGTISSTMET  124

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
             VGY   A +F  GW+ TQ+SHMSMVNC+T N +SR++ +SCRNAFTM+A+L LY +   +
Sbjct  125   VGYSTFAAIFNVGWAVTQVSHMSMVNCMTSNPTSRVSLISCRNAFTMIANLSLYGIALLI  184

Query  1086  FTN-NAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLK  910
             F+   +  +  QYRW+A++SI +G  FV++F +G KEP       ++++ S   WT+W K
Sbjct  185   FSLLQSVSVIVQYRWIAYVSIALGSCFVVVFLIGTKEPGLNQHCQNKRV-SRISWTHWFK  243

Query  909   RVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQE  730
             +VLYYQVA +Y+ TR+VTNVSQ  LA YVINDL M QS+K+LVPAIIY+CS I SV+LQE
Sbjct  244   KVLYYQVALVYMLTRLVTNVSQALLAFYVINDLEMPQSSKALVPAIIYVCSLIVSVILQE  303

Query  729   LEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMES  550
               WS  RLK +F+ G ILW+L G  ++ LP +M++FMYALS+ IG+ NALM VTSI ME 
Sbjct  304   TRWSSWRLKKYFSVGAILWILSGVGIIALPSRMHNFMYALSITIGVGNALMTVTSISMEG  363

Query  549   ALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQAC-FSVTRFSLGF  373
              LV + L+G AFVYGS+ F+DKV CG+ALY LES++ +     +   A  +SVTR  LG 
Sbjct  364   VLVGEDLNGCAFVYGSLSFVDKVSCGLALYILESYQGSTSTRKSLESASGYSVTRLGLGL  423

Query  372   IPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
             +P   +L   I+++TM L  T  +++PLAEPLLA
Sbjct  424   VPAACSLLSAIIAYTMDLPDT--RRRPLAEPLLA  455



>ref|XP_010469236.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Camelina sativa]
Length=457

 Score =   477 bits (1228),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 254/456 (56%), Positives = 326/456 (71%), Gaps = 11/456 (2%)
 Frame = -2

Query  1614  NREEEE--EKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQ  1441
              R EE+   KP+GR SV  YGVGHMLNDIT  CW+TYLLL+LT IGLSP  AAIV L GQ
Sbjct  3     GRSEEDPFTKPIGRWSVFFYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAIVMLSGQ  62

Query  1440  FADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVG  1261
              AD F TI  GELIDRFG FKIWH AG ++V +SF S+FGG C+PC IL +DS T++T  
Sbjct  63    VADGFATIFTGELIDRFGHFKIWHAAGSLLVAISFSSVFGG-CLPCSILHNDSLTLETFS  121

Query  1260  YCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF-  1084
             Y + A +F  GW+ TQ+SHM+MVNCI+LN +SR+A  SCRNAFTMVA+L LYA+   VF 
Sbjct  122   YSMFAAIFNIGWAATQVSHMAMVNCISLNSTSRVALTSCRNAFTMVANLGLYAIALVVFG  181

Query  1083  ---TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWL  913
                  + ED +TQYRW+A+ SI IG  FVIIF +G KEPR + D   E      PW YW 
Sbjct  182   VIKAGSKEDTETQYRWIAYSSISIGCCFVIIFLMGTKEPRLRLDL-KETCRVRIPWVYWF  240

Query  912   KRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQ  733
             +++LYYQVA +Y+ TR+V NVSQ +LA +VI+DL+M QSAK+LVPAIIY+CSF+ SVLLQ
Sbjct  241   RKLLYYQVAMVYLLTRLVLNVSQAYLAFFVIDDLQMDQSAKALVPAIIYICSFVVSVLLQ  300

Query  732   ELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGME  553
             E+ W+G+RLK ++  GG++W+ CGA ++LLP  ++ FMYA+SV IGIANALMMVT+I M+
Sbjct  301   EIPWNGRRLKAYYTAGGVIWIFCGAAILLLPRNISFFMYAISVFIGIANALMMVTAISMQ  360

Query  552   SALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP---VACNPAQACFSVTRFS  382
             S L+   + G AFV GS+ F+DK+ CG+ALY L+S +   P   +  +   A  SVTR+ 
Sbjct  361   SVLIGAEVGGCAFVCGSLSFLDKMSCGLALYVLQSHQSTSPRTQLNNHQQSAYLSVTRYG  420

Query  381   LGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             LG +P   +  GV V+F M+L       +PL EPLL
Sbjct  421   LGLVPAFCSFVGVTVTFFMELGADGSLSKPLREPLL  456



>ref|XP_007020146.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
 ref|XP_007020147.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY17371.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY17372.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
Length=454

 Score =   476 bits (1226),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 256/456 (56%), Positives = 323/456 (71%), Gaps = 12/456 (3%)
 Frame = -2

Query  1617  DNREEEEE--KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVG  1444
              NR E++   KP+GR SV  YGVGHMLNDIT  CW+TYLLL+LTDIGLS   AA V L G
Sbjct  2     SNRIEDDSFSKPVGRWSVFYYGVGHMLNDITAACWFTYLLLFLTDIGLSQRDAATVMLSG  61

Query  1443  QFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTV  1264
             Q AD   TI  GELIDRFG FKIWHGAG ++V VSF S+FGG C+PCK L + S TV+T+
Sbjct  62    QIADGLATIFVGELIDRFGHFKIWHGAGSMLVAVSFSSVFGG-CLPCKALATFSSTVETI  120

Query  1263  GYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF  1084
              Y   A +F  GW+ TQ+SHMSMVNCI+LN +SR+   SCRNAFTMVA+L LY +   VF
Sbjct  121   SYSTFAAIFNVGWAATQVSHMSMVNCISLNSTSRVVLASCRNAFTMVANLSLYGIALIVF  180

Query  1083  ----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYW  916
                      DI+ QYRW+A++SIFIG  FV IFH G  EPR K    H  I +   WTYW
Sbjct  181   DISIAKTYADIENQYRWIAYLSIFIGCCFVGIFHFGTNEPRSKKGI-HGNIHARISWTYW  239

Query  915   LKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLL  736
              +++LYYQVA +YV TR+V NVSQ +LA YVINDL M+QSAK+LVPAIIY+CSFI SVLL
Sbjct  240   FRKILYYQVALVYVLTRLVLNVSQAYLAFYVINDLLMAQSAKALVPAIIYICSFIVSVLL  299

Query  735   QELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGM  556
             QE+ W+G+RLK ++A GGILW+ CG  ++LLP  M+ FMYA+SV IGIANALM VT++ M
Sbjct  300   QEIAWNGQRLKAYYAAGGILWMFCGVGILLLPRSMSLFMYAISVFIGIANALMTVTAVSM  359

Query  555   ESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACN--PAQACFSVTRFS  382
             +S ++ + L+G AFV GS+ F+DK+ CG+AL+ L+S++   P+          FSVTR+ 
Sbjct  360   QSIVIGEDLNGCAFVCGSLSFLDKISCGLALFVLQSYQSNSPIIVGNYSTNFNFSVTRYG  419

Query  381   LGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             LG +P   +   V V+ TM+L   +   +PL EPLL
Sbjct  420   LGLVPAFCSALAVAVTCTMEL--QTPLSKPLMEPLL  453



>ref|XP_010506343.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Camelina sativa]
 ref|XP_010506344.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Camelina sativa]
 ref|XP_010506345.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Camelina sativa]
 ref|XP_010506346.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Camelina sativa]
Length=462

 Score =   476 bits (1226),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 252/459 (55%), Positives = 335/459 (73%), Gaps = 11/459 (2%)
 Frame = -2

Query  1629  IMGRDNREEE-EEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVT  1453
             I+GR++ EE+   KPLGR SV  YGVGHMLNDIT  CW+TYLLL+LT IGLSP  AA+V 
Sbjct  6     IVGRNDEEEDPSTKPLGRLSVFYYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAVVM  65

Query  1452  LVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTV  1273
             L GQ AD F T+  GELIDRFG FKIWH AG ++V VSF S+FGG C+PC +L S+S TV
Sbjct  66    LSGQVADGFATVFVGELIDRFGHFKIWHAAGSLLVAVSFSSVFGG-CLPCTLLNSNSLTV  124

Query  1272  QTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
             +T+ Y + A +F  GW+ TQ+SHM+MVNCITLN +SR+A  S RNAF+MVA+L LYA+  
Sbjct  125   ETLSYSMFAAIFNIGWAATQVSHMAMVNCITLNSTSRVALTSSRNAFSMVANLGLYAIAL  184

Query  1092  FVF----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPW  925
              VF        E  + QYRW+A+ SI +G  FV+IF +G KEPR + D   E   +  PW
Sbjct  185   VVFGVSEAVTKESTECQYRWIAYSSITVGCCFVVIFLMGTKEPRLRIDL-KESCRARIPW  243

Query  924   TYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITS  745
             ++W +++LYYQVA +Y+ TR+V NVSQ +LA +VI+DL+M+QSAK+L+PAIIY+CSF+ S
Sbjct  244   SHWFRKILYYQVAMVYLLTRLVLNVSQAYLAFFVIDDLQMAQSAKALIPAIIYICSFVVS  303

Query  744   VLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTS  565
             V+LQE+ W+GKRLK ++  GGI+W+ CG  ++LL   +NS+MYA+S+ IGIANALM+VT+
Sbjct  304   VMLQEIPWNGKRLKAYYCAGGIIWIFCGVAILLLSRSINSYMYAISIFIGIANALMLVTA  363

Query  564   IGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP-VACNPAQA-CFSVT  391
             I M+S L+   L G AFV GS+ F+DK+ CG+ALY L+S +   P V  N  Q   FSVT
Sbjct  364   ISMQSVLIGSELGGCAFVCGSLSFLDKMSCGLALYVLQSHQSTSPKVDVNINQHFYFSVT  423

Query  390   RFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             R+ LG +P + +L GV+V++ M+L  T  K  PL +PLL
Sbjct  424   RYGLGLVPAVCSLIGVVVTYFMELDSTILK--PLRQPLL  460



>ref|XP_010512308.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Camelina sativa]
 ref|XP_010512309.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Camelina sativa]
Length=457

 Score =   476 bits (1225),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 253/455 (56%), Positives = 325/455 (71%), Gaps = 11/455 (2%)
 Frame = -2

Query  1611  REEEE--EKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQF  1438
             R EE+   KP+GR SV  YGVGHMLNDIT  CW+TYLLL+LT IGLSP  AAIV L GQ 
Sbjct  4     RSEEDPFTKPIGRWSVFFYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAIVMLSGQV  63

Query  1437  ADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGY  1258
             AD F TI  GELIDRFG FKIWH AG ++V +SF S+FGG C+PC IL +DS T++T  Y
Sbjct  64    ADGFATIFTGELIDRFGHFKIWHAAGSLLVAISFSSVFGG-CLPCSILHNDSLTLETFSY  122

Query  1257  CISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF--  1084
              + A +F  GW+ TQ+SHM+MVNCI+LN +SR+A  SCRNAFTMV++L LYA+   VF  
Sbjct  123   SMFAAIFNIGWAATQVSHMAMVNCISLNSTSRVALTSCRNAFTMVSNLGLYAIALVVFGV  182

Query  1083  --TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLK  910
                 + ED +TQYRW+A  SI IG  FVIIF +G KEPR + D   E      PW YW +
Sbjct  183   IKAGSKEDTETQYRWIANSSISIGCCFVIIFLMGTKEPRLRLDL-KETSRVRIPWVYWFR  241

Query  909   RVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQE  730
             ++LYYQVA +Y+ TR+V NVSQ +LA +VI+DL+M QSAK+LVPAIIY+CSF+ SVLLQE
Sbjct  242   KLLYYQVAMVYLLTRLVLNVSQAYLAFFVIDDLQMDQSAKALVPAIIYICSFVVSVLLQE  301

Query  729   LEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMES  550
             + W+G+RLK ++  GG++W+ CGA ++LLP  ++ FMYA+SV IGIANALMMVT+I M+S
Sbjct  302   IPWNGRRLKAYYTAGGVIWIFCGAAILLLPRNISFFMYAISVFIGIANALMMVTAISMQS  361

Query  549   ALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP---VACNPAQACFSVTRFSL  379
              L+   + G AFV GS+ F+DK+ CG+ALY L+S +   P   +  +   A  SVTR+ L
Sbjct  362   VLIGAEVGGCAFVCGSLSFLDKMSCGLALYVLQSHQSTSPRTQLNNHQQSAYLSVTRYGL  421

Query  378   GFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             G +P   +  GV V+F M+L       +PL EPLL
Sbjct  422   GLVPAFCSFVGVTVTFFMELGADGSLSKPLREPLL  456



>ref|XP_010058084.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Eucalyptus grandis]
 ref|XP_010058085.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Eucalyptus grandis]
 ref|XP_010058086.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Eucalyptus grandis]
 gb|KCW75595.1| hypothetical protein EUGRSUZ_E04336 [Eucalyptus grandis]
Length=455

 Score =   476 bits (1224),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 257/459 (56%), Positives = 326/459 (71%), Gaps = 17/459 (4%)
 Frame = -2

Query  1626  MGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLV  1447
             MG D   +   K +GR SV  YG GHMLNDIT  CW+TYLLL+LTDIGLSP  AA+V L 
Sbjct  5     MGDD---DSYSKSVGRWSVFYYGAGHMLNDITSACWFTYLLLFLTDIGLSPRDAAVVMLS  61

Query  1446  GQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
             GQ AD   TI +GELIDRFG FK+WH AG I+V +SF S+FGG CIPC I GSDS T++T
Sbjct  62    GQVADGLATIFSGELIDRFGHFKVWHLAGSILVAISFSSVFGG-CIPCNIFGSDSLTMET  120

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
             +GY + A +F  GW+ TQ+SHMSM+NCITLN +SR+   SCRNAFTMVA+L LYAV   V
Sbjct  121   IGYSVFAAIFNVGWAATQVSHMSMINCITLNSTSRVVLASCRNAFTMVANLSLYAVAGIV  180

Query  1086  FT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDD--GHEKIGSNTPW  925
             FT    N  +DI+ QYRW+A++SI +G  FV IFHLG +EPR K +   G++   +   W
Sbjct  181   FTTTSSNTHDDIENQYRWIAYLSIAVGCCFVGIFHLGTREPRLKANACVGNQ---ARISW  237

Query  924   TYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITS  745
              YW K+VLYYQVA +YV TR+V NVSQ +LA YVINDLRM QSAK+LVPA+IY+CSF  S
Sbjct  238   DYWFKKVLYYQVALVYVLTRLVVNVSQAYLAFYVINDLRMIQSAKALVPAVIYVCSFFVS  297

Query  744   VLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTS  565
             V+LQE+ W+G+RLK +++ GGILW+ CGA + LLP  M+ F+Y LS+ IG+ANALMMVT 
Sbjct  298   VMLQEVAWTGQRLKAYYSTGGILWVFCGAAIFLLPRNMSWFVYVLSIFIGVANALMMVTG  357

Query  564   IGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACN--PAQACFSVT  391
             I M+S LV + L+G AFV GS+ F+DK+ CG+ LY L+S++     A          SV+
Sbjct  358   ISMQSVLVGEDLNGCAFVCGSLSFLDKMACGLTLYILQSYQTTSKQAQGHLATDVYVSVS  417

Query  390   RFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             RF LG +P   +L GV ++++M  LH    K  L  PLL
Sbjct  418   RFGLGLVPAFCSLVGVAITYSMN-LHPQTLKHTLV-PLL  454



>ref|XP_002878316.1| AT3g60070/T2O9_50 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54575.1| AT3g60070/T2O9_50 [Arabidopsis lyrata subsp. lyrata]
Length=459

 Score =   476 bits (1224),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 255/460 (55%), Positives = 331/460 (72%), Gaps = 11/460 (2%)
 Frame = -2

Query  1626  MGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLV  1447
             M   + E+   KP+GR SV  YGVGHMLNDIT  CW+TYLLL+LT IGLSP  AAIV L 
Sbjct  1     MTGGSEEDPFTKPIGRWSVFFYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAIVMLS  60

Query  1446  GQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
             GQ ADAF TI  GELIDRFG FKIWH AG ++V +SF S+FGG C+PC IL +DS T++T
Sbjct  61    GQVADAFATIFTGELIDRFGHFKIWHAAGSLLVAISFSSVFGG-CLPCSILHNDSLTLET  119

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
               Y + A +F  GW+ TQ+SHM+MVNCI+LN +SR+A  S RNAFTMVA+L LYA+   V
Sbjct  120   FSYSMFAAIFNIGWAATQVSHMAMVNCISLNSTSRVALTSSRNAFTMVANLGLYAIALVV  179

Query  1086  F----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTY  919
             F      + ED +TQYRW+A+ SI IG  FV+IF +G KEPR + D   +   +  PW Y
Sbjct  180   FGVIKAGSKEDTETQYRWIAYSSITIGCCFVVIFLMGTKEPRLRIDL-KQTSRARIPWVY  238

Query  918   WLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVL  739
             W +++LYYQVA +Y+ TR+V NVSQ +LA +VI+DL+M QSAK+LVPAIIY+CSF+ SVL
Sbjct  239   WFRKLLYYQVAMVYLLTRLVLNVSQAYLAFFVIDDLQMGQSAKALVPAIIYICSFVVSVL  298

Query  738   LQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIG  559
             LQE+ W+G+RLK ++  GGI+W+ CGA ++LLP  ++SFMYA+SV IGIANALMMVT+I 
Sbjct  299   LQEIPWNGRRLKAYYTAGGIIWIFCGAAILLLPRDISSFMYAISVFIGIANALMMVTAIS  358

Query  558   MESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP---VACNPAQACF-SVT  391
             M+S LV   + G AFV GS+ F+DK+ CG+ALY L+S +   P   +  N  Q+ + SVT
Sbjct  359   MQSVLVGAEVGGCAFVCGSLSFLDKMSCGLALYVLQSHQTTSPRGQLNNNNQQSVYLSVT  418

Query  390   RFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQP-LAEPLL  274
             R+ LG +P + +  GV V+F M+L       +P L EPLL
Sbjct  419   RYGLGLVPALCSFVGVAVTFFMELEAAGSLSKPLLREPLL  458



>ref|XP_010413606.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Camelina sativa]
Length=457

 Score =   475 bits (1223),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 254/458 (55%), Positives = 326/458 (71%), Gaps = 9/458 (2%)
 Frame = -2

Query  1626  MGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLV  1447
             M   + E+   KP+GR SV  YGVGHMLNDIT  CW+TYLLL+LT IGLSP  AAIV L 
Sbjct  1     MTGGSEEDPFTKPIGRWSVFFYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAIVMLS  60

Query  1446  GQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
             GQ AD F TI  GELIDRFG FKIWH AG ++V +SF S+FGG C+PC IL +DS T++T
Sbjct  61    GQVADGFATIFTGELIDRFGHFKIWHAAGSLLVAISFSSVFGG-CLPCSILHNDSLTLET  119

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
               Y + A +F  GW+ TQ+SHM+MVNCI+LN +SR+A  SCRNAFTMVA+L LYA+   V
Sbjct  120   FSYSMFAAIFNIGWAATQVSHMAMVNCISLNSTSRVALASCRNAFTMVANLGLYAIALVV  179

Query  1086  F----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTY  919
             F      + ED +TQYRW+A+ SI IG  FVIIF +G KEPR + D   E      PW Y
Sbjct  180   FGVIKAGSKEDTETQYRWIAYSSISIGCCFVIIFLMGTKEPRLRLDV-KETSRVRVPWVY  238

Query  918   WLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVL  739
             W +++LYYQVA +Y+ TR+V NVSQ +LA +VI+DL+M QSAK+LVPAIIY+CSF+ SVL
Sbjct  239   WFRKLLYYQVAMVYLLTRLVLNVSQAYLAFFVIDDLQMDQSAKALVPAIIYICSFVVSVL  298

Query  738   LQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIG  559
             LQE+ W+G+RLK ++  GG++W+ CGA ++LLP  ++ FMYA+SV IGIANALMMVT+I 
Sbjct  299   LQEIPWNGRRLKAYYTAGGVIWIFCGAAILLLPRNISFFMYAISVFIGIANALMMVTAIS  358

Query  558   MESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP-VACNPAQ--ACFSVTR  388
             M+S L+   + G AFV GS+ F+DK+ CG+ALY L+S +   P    N  Q  A  SVTR
Sbjct  359   MQSVLIGAEVGGCAFVCGSLSFLDKMSCGLALYVLQSHQSTSPRTQLNNHQQSAYLSVTR  418

Query  387   FSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             + LG +P   +  GV V+F M+L       +PL +PLL
Sbjct  419   YGLGLVPAFCSFVGVTVTFFMELGADGSLSKPLLDPLL  456



>gb|AGT16117.1| sugar transport protein-like protein [Saccharum hybrid cultivar 
R570]
Length=455

 Score =   475 bits (1223),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 249/458 (54%), Positives = 329/458 (72%), Gaps = 15/458 (3%)
 Frame = -2

Query  1620  RDNREEEE---EKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTL  1450
             RDN    +   ++PLGR S+L+YG GHMLNDIT  CW+TYLL++LTD+GLSP  AA V L
Sbjct  5     RDNESSNDAQLDEPLGRVSILSYGSGHMLNDITSSCWFTYLLVFLTDLGLSPGDAATVML  64

Query  1449  VGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQ  1270
              GQ AD FTTI  GEL+DRFG FK+WH  G I+V +SF S+FG +C+PCK++G++S T++
Sbjct  65    SGQLADGFTTIFVGELMDRFGHFKLWHAGGSILVAISFSSVFG-SCVPCKLMGTNSSTLE  123

Query  1269  TVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFF  1090
             TVGY   A +F  GW+ TQ++HMSMVNC++ N +SR++ VSCRNAFTMVA+L LY +   
Sbjct  124   TVGYSTFAAIFNVGWAVTQVAHMSMVNCMSSNPTSRVSLVSCRNAFTMVANLSLYGIALL  183

Query  1089  VFTN-NAEDIKTQYRWMAfisifiggvfviiFHLGVKEP---RKKDDDGHEKIGSNTPWT  922
             +FT   + ++  QYRW+A++SI +G  FV+IF +G KEP   R   D    +I     W 
Sbjct  184   IFTLLQSVNVLVQYRWIAYVSISLGCCFVVIFLVGTKEPGSIRHCMDKSLSRI----SWA  239

Query  921   YWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSV  742
             YW K+VLYYQVA +Y  TR+VTNVSQ FLA YVINDL M+Q +K+LVPAIIY+CS I SV
Sbjct  240   YWFKKVLYYQVALVYTLTRLVTNVSQAFLAFYVINDLEMNQYSKALVPAIIYICSLIVSV  299

Query  741   LLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSI  562
             +LQE  WS  RLK++F  G +LW+L G  ++ LP +M++ MYA+S +IG ANALM VTSI
Sbjct  300   ILQETRWSSWRLKLYFTAGAVLWILSGLGIVFLPSRMHNLMYAISTIIGAANALMTVTSI  359

Query  561   GMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQA-CFSVTRF  385
              ME  LV + L+G AFVYGS+ F+DKV CGVALY LES++ +  +  N   A  +SVTR 
Sbjct  360   SMEGVLVGEDLNGCAFVYGSLSFVDKVSCGVALYVLESYQGSRKIRSNLGTAFGYSVTRL  419

Query  384   SLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
              LG +P + +L   IV++TM L  T  +++PL EPLLA
Sbjct  420   GLGLVPAVCSLLSAIVAYTMDLPDT--RRRPLVEPLLA  455



>ref|NP_001078055.1| major facilitator protein [Arabidopsis thaliana]
 ref|NP_181957.2| major facilitator protein [Arabidopsis thaliana]
 gb|AAM91098.1| AT3g60070/T2O9_50 [Arabidopsis thaliana]
 gb|AAO11569.1| At3g60070/T2O9_50 [Arabidopsis thaliana]
 gb|AEC10401.1| major facilitator protein [Arabidopsis thaliana]
 gb|AEC10402.1| major facilitator protein [Arabidopsis thaliana]
Length=462

 Score =   475 bits (1223),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 251/459 (55%), Positives = 336/459 (73%), Gaps = 11/459 (2%)
 Frame = -2

Query  1629  IMGRDNREEE-EEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVT  1453
             I+G +  EE+   KPLGR SV  YGVGHMLNDIT  CW+TYLLL+LT IGLSP  AAIV 
Sbjct  6     IVGMEEEEEDPSTKPLGRLSVFYYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAIVM  65

Query  1452  LVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTV  1273
             L GQ AD F TI  GELIDRFG FKIWH AG ++V +SF S+FGG C+PC +L ++S T+
Sbjct  66    LSGQVADGFATIFIGELIDRFGHFKIWHAAGSLLVAISFSSVFGG-CLPCSLLHNNSSTI  124

Query  1272  QTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
             +T+ Y + A +F  GW+ TQ+SHM+MVNCITLN +SR+A  S RNAF+MVA+L LYA+  
Sbjct  125   ETLSYSMFAAIFNIGWAATQVSHMAMVNCITLNSTSRVALTSSRNAFSMVANLGLYAIAL  184

Query  1092  FVF----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPW  925
              VF        E+ ++QYRW+A+ SI +G  FV+IF +G KEPR + +   E   +  PW
Sbjct  185   VVFGVSEAVTKENTESQYRWIAYSSITVGCCFVVIFLMGTKEPRLRINL-RETSRARIPW  243

Query  924   TYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITS  745
             +YW +++LYYQVA +Y+ TR+V NVSQ +LA +VI+DL+M+QSAK+L+PAIIY+CSF+ S
Sbjct  244   SYWFRKILYYQVAMVYLLTRLVLNVSQAYLAFFVIDDLQMAQSAKALIPAIIYVCSFVVS  303

Query  744   VLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTS  565
             V+LQE+ W+GKRLK ++  GGI+W+ CG  ++LLP  +NS+MYA+SV IGIANA+M+VTS
Sbjct  304   VMLQEIPWNGKRLKAYYCAGGIIWIFCGISILLLPRSINSYMYAISVFIGIANAVMLVTS  363

Query  564   IGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP-VACNPAQA-CFSVT  391
             I M+S L+   L G AFV GS+ F+DK+ CG+ALY L+S +   P V  N  +   FSVT
Sbjct  364   ISMQSVLIGSKLGGCAFVCGSLSFLDKMSCGLALYVLQSHQGTSPKVDVNIKEYFYFSVT  423

Query  390   RFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             R+ LG +P + +L GV+V++ M+L  T  K  PL +PLL
Sbjct  424   RYGLGLVPAVCSLVGVVVTYFMELDSTILK--PLCQPLL  460



>dbj|BAC83077.1| sugar transport protein-like [Oryza sativa Japonica Group]
 dbj|BAD30471.1| sugar transport protein-like [Oryza sativa Japonica Group]
 gb|EEE67466.1| hypothetical protein OsJ_24864 [Oryza sativa Japonica Group]
Length=450

 Score =   475 bits (1222),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 249/453 (55%), Positives = 330/453 (73%), Gaps = 8/453 (2%)
 Frame = -2

Query  1617  DNRE--EEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVG  1444
             DN+   EE ++PLGR  +L+YG GHMLNDIT  CW+TYLL++LTDIGLSPS AA+V L G
Sbjct  2     DNQSSIEELDEPLGRVPILSYGSGHMLNDITSSCWFTYLLVFLTDIGLSPSDAAVVMLSG  61

Query  1443  QFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTV  1264
             Q AD F TI  GELIDRFG FK+WH  G I+V +SF S+FG +C+PCK+ G+ S T++TV
Sbjct  62    QLADGFATIFVGELIDRFGHFKLWHAGGSILVAISFSSVFG-SCLPCKLTGTISSTMETV  120

Query  1263  GYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF  1084
             GY   A +F  GW+ TQ+SHMSMVNC+T N +SR+A VSCRNAFTM+A+L LY +   +F
Sbjct  121   GYSTFAAIFNVGWAVTQVSHMSMVNCMTSNPTSRVALVSCRNAFTMIANLSLYGIALLIF  180

Query  1083  T-NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKR  907
             +   +  +  QYRW+A++SI +G  FV++F +G +EP       ++++ S   WT+W K+
Sbjct  181   SLRQSVSVIVQYRWIAYVSIALGSCFVVVFLIGTEEPGLNQHCQNKRL-SRISWTHWFKK  239

Query  906   VLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQEL  727
             VLYYQVA +Y+FTR+VTNVSQ  LA YVINDL M QS+K+LVPAIIY+CS I SV+LQE 
Sbjct  240   VLYYQVALVYMFTRLVTNVSQALLAFYVINDLEMPQSSKALVPAIIYVCSLIVSVILQET  299

Query  726   EWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESA  547
              WS  RLK +F+ G +LW+L G  +++LP  M++FMYALS+ IG+ANALM VTSI ME  
Sbjct  300   RWSSWRLKNYFSAGAMLWILSGVGIVVLPSGMHNFMYALSITIGVANALMTVTSISMEGI  359

Query  546   LVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQA-CFSVTRFSLGFI  370
             LV + L+G AFVYGS+ F+DKV CG+ALY LES++ +     N   A  +SVTR  LG +
Sbjct  360   LVGEDLNGCAFVYGSLSFVDKVSCGLALYILESYQGSTNTRQNLELAFGYSVTRLGLGLV  419

Query  369   PGIAALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
             P   +L   I+++TM L  T  +++PL EPLLA
Sbjct  420   PAACSLLSAIIAYTMDLPDT--RRRPLVEPLLA  450



>gb|AAY78728.1| hypothetical protein At2g44280 [Arabidopsis thaliana]
Length=454

 Score =   474 bits (1221),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 252/455 (55%), Positives = 334/455 (73%), Gaps = 14/455 (3%)
 Frame = -2

Query  1608  EEEEE----KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQ  1441
             EEEEE    KPLGR SV  YGVGHMLNDIT  CW+TYLLL+LT IGLSP  AAIV L GQ
Sbjct  2     EEEEEDPSTKPLGRLSVFYYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAIVMLSGQ  61

Query  1440  FADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVG  1261
              AD F TI  GELIDRFG FKIWH AG ++V +SF S+FGG C+PC +L ++S T++T+ 
Sbjct  62    VADGFATIFIGELIDRFGHFKIWHAAGSLLVAISFSSVFGG-CLPCSLLHNNSSTIETLS  120

Query  1260  YCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF-  1084
             Y + A +F  GW+ TQ+SHM+MVNCITLN +SR+A  S RNAF+MVA+L LYA+   VF 
Sbjct  121   YSMFAAIFNIGWAATQVSHMAMVNCITLNSTSRVALTSSRNAFSMVANLGLYAIALVVFG  180

Query  1083  ---TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWL  913
                    E+ ++QYRW+A+ SI +G  FV+IF +G KEPR + +   E   +  PW+YW 
Sbjct  181   VSEAVTKENTESQYRWIAYSSITVGCCFVVIFLMGTKEPRLRINL-RETSRARIPWSYWF  239

Query  912   KRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQ  733
             +++LYYQVA +Y+ TR+V NVSQ +LA +VI+DL+M+QSAK+L+PAIIY+CSF+ SV+LQ
Sbjct  240   RKILYYQVAMVYLLTRLVLNVSQAYLAFFVIDDLQMAQSAKALIPAIIYVCSFVVSVMLQ  299

Query  732   ELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGME  553
             E+ W+GKRLK ++  GGI+W+ CG  ++LLP  +NS+MYA+SV IGIANA+M+VTSI M+
Sbjct  300   EIPWNGKRLKAYYCAGGIIWIFCGISILLLPRSINSYMYAISVFIGIANAVMLVTSISMQ  359

Query  552   SALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP-VACNPAQA-CFSVTRFSL  379
             S L+   L G AFV GS+ F+DK+ CG+ALY L+S +   P V  N  +   FSVTR+ L
Sbjct  360   SVLIGSKLGGCAFVCGSLSFLDKMSCGLALYVLQSHQGTSPKVDVNIKEYFYFSVTRYGL  419

Query  378   GFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             G +P + +L GV+V++ M+L  T  K  PL +PLL
Sbjct  420   GLVPAVCSLVGVVVTYFMELDSTILK--PLCQPLL  452



>ref|XP_009400849.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Musa acuminata subsp. malaccensis]
Length=460

 Score =   474 bits (1221),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 256/462 (55%), Positives = 328/462 (71%), Gaps = 8/462 (2%)
 Frame = -2

Query  1641  VYRRIMGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAA  1462
             V+  +    + E +   PLGR + L+YG GHMLNDIT  CW+TYLLL+LTDIGLSP  AA
Sbjct  2     VHHSVGDESSSEAQYAGPLGRLATLSYGAGHMLNDITSACWFTYLLLFLTDIGLSPRDAA  61

Query  1461  IVTLVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDS  1282
             IV L GQ AD FTTI  GELIDRFG FK+WH  G  +V VSF S+FG +C+PCK++GS+S
Sbjct  62    IVMLSGQVADGFTTIFVGELIDRFGHFKLWHAGGSFLVAVSFSSVFG-SCLPCKVMGSNS  120

Query  1281  PTVQTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYA  1102
              T+QT+GY   A +F  GW+ TQ+SHMSMVNCITLN +SR+A  SCRNAFTMVA+L LYA
Sbjct  121   LTLQTIGYSAFAAIFNVGWAVTQVSHMSMVNCITLNPTSRVALASCRNAFTMVANLSLYA  180

Query  1101  VTFFVFT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSN  934
             V   VF+     +  DIK QYRW+A++SIF+G  FV++F +G KEP+ K     + + S+
Sbjct  181   VALCVFSLYSSKDTVDIKIQYRWIAYLSIFMGCCFVVLFLVGTKEPQLKLQIQCKNV-SS  239

Query  933   TPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSF  754
               WT+W K++LYYQVA +Y  TR+VTNVSQ  LA +V N+L M QS+K+LVPAIIY+CSF
Sbjct  240   ISWTHWFKKILYYQVALVYTLTRLVTNVSQALLAFFVTNELGMGQSSKALVPAIIYICSF  299

Query  753   ITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMM  574
             + SV+LQE+ WSG RLK FF  G ILW+  GA V +LP  M++ MY LS+ IG ANALM 
Sbjct  300   LVSVILQEIRWSGWRLKAFFNAGAILWMFSGAGVSVLPDSMHNLMYILSIAIGAANALMT  359

Query  573   VTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACN-PAQACFS  397
             VT I MES LV ++L+G AFVYGS+ F+DK+ CG+ALY LES++ +  V  N  +    S
Sbjct  360   VTGISMESMLVGENLNGCAFVYGSLSFVDKLSCGLALYVLESYQGSPDVMGNLGSNVSHS  419

Query  396   VTRFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
             V R+ LG IP   A    ++++TMKL  T+     L EPLLA
Sbjct  420   VNRYGLGVIPATCAFLSAVITYTMKLPDTTSSSN-LVEPLLA  460



>ref|XP_003562831.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Brachypodium distachyon]
Length=455

 Score =   474 bits (1219),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 245/454 (54%), Positives = 327/454 (72%), Gaps = 9/454 (2%)
 Frame = -2

Query  1617  DNR---EEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLV  1447
             DN    E E ++PLGR  +L+YG GHMLNDIT  CW+TYLL++LTD+GLSPS AA+V L 
Sbjct  6     DNEPSSELELDEPLGRVPILSYGSGHMLNDITSSCWFTYLLVFLTDVGLSPSDAAVVMLS  65

Query  1446  GQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
             GQ AD F TI  GELIDRFG FK+WH  G I+V +SF S+FG +C+PCK++G++S T++T
Sbjct  66    GQLADGFATIFVGELIDRFGHFKLWHAGGSILVAISFSSVFG-SCLPCKLMGTNSSTLET  124

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
             VGY   A +F  GW+  Q+SHMSMVNC+T N +SR+A VSCRNAFTM+A+L LY +   +
Sbjct  125   VGYSTFASIFNVGWAVAQVSHMSMVNCMTSNPTSRVALVSCRNAFTMIANLSLYGIALLI  184

Query  1086  FTN-NAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLK  910
             F+   +  +  QYRW+A++SI IG  FV  F +G KEP       ++ + S   W +W K
Sbjct  185   FSLLQSVSVIVQYRWIAYVSISIGSCFVAAFLIGTKEPVLNQPSQNKSL-SRISWAHWFK  243

Query  909   RVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQE  730
             +VLYYQVA +Y+FTR+VTNVSQ FLA YVINDL M QS+K+LVPAIIY+CS I SV+LQE
Sbjct  244   KVLYYQVALVYMFTRLVTNVSQAFLAFYVINDLGMHQSSKALVPAIIYVCSLIVSVMLQE  303

Query  729   LEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMES  550
               WS +RLK +F+ G +LW+L G  ++ LP +M++FMYALS+ IG ANALM VTSI ME 
Sbjct  304   TRWSSRRLKCYFSAGAMLWILSGVGIVFLPSRMHNFMYALSITIGAANALMTVTSISMEG  363

Query  549   ALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQAC-FSVTRFSLGF  373
              LV   L+G AFVYGS+ F+DKV CG+ALY LES++ +  ++ N   +  +S+TR  LG 
Sbjct  364   VLVGADLNGCAFVYGSLSFLDKVSCGIALYILESYQGSTKISTNHESSVGYSLTRLGLGL  423

Query  372   IPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
             +P + +L   +V++TM L  T  +++ L EPLL 
Sbjct  424   VPAVCSLLSAMVAYTMDLPDT--RRRLLVEPLLG  455



>gb|KHG04911.1| Major facilitator superfamily domain-containing protein 12 [Gossypium 
arboreum]
Length=557

 Score =   477 bits (1228),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 255/457 (56%), Positives = 329/457 (72%), Gaps = 9/457 (2%)
 Frame = -2

Query  1629  IMGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTL  1450
             +M     ++   KP+GR SV  YGVGHMLNDIT  CW+TYLLL+LT+IGLS   AAIV L
Sbjct  104   VMSNSIEDDSFSKPVGRWSVYCYGVGHMLNDITSACWFTYLLLFLTEIGLSSRDAAIVML  163

Query  1449  VGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQ  1270
              GQ AD   TI  GELIDRFG FKIWHGAG I+V VSF S+FGG CIPCK+L S S  V+
Sbjct  164   SGQIADGLATIFFGELIDRFGHFKIWHGAGAILVAVSFSSVFGG-CIPCKLLSSFSTIVE  222

Query  1269  TVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFF  1090
             TV Y   A +F  GW+ TQ+SHMSMV+CITLN +SR+   SCRNAFTMVA+L LY + F 
Sbjct  223   TVSYSTFAAIFNVGWAATQVSHMSMVSCITLNSTSRVVLASCRNAFTMVANLSLYGIAFI  282

Query  1089  VF----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWT  922
             VF         DI+ QYRW+A++SIFIG  FV IFHLG KEPR K    H  I +   WT
Sbjct  283   VFEVIRAETRADIENQYRWIAYLSIFIGCCFVGIFHLGTKEPRSKTGI-HGNIHARISWT  341

Query  921   YWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSV  742
             YW  ++LYYQVA +Y+ TR+V NVSQ +LA YVI+DL+M+QS+K+LVPAIIY+CSF+ S+
Sbjct  342   YWFLKILYYQVAIVYMLTRLVLNVSQAYLAFYVIDDLQMAQSSKALVPAIIYICSFVVSI  401

Query  741   LLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSI  562
             LLQE+ W+ +RLK ++  GGILW+ CG  ++LLP  M+ F+YA+S+ IGIANALM VT++
Sbjct  402   LLQEIAWNEQRLKAYYTAGGILWIFCGIAIILLPQSMSLFVYAISIFIGIANALMTVTAV  461

Query  561   GMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP-VACNPAQACFSVTRF  385
              M++ L+ + L+G AFV GS+ F+DK+ CG+ L+ L+SF  + P VA N +   FS+TR+
Sbjct  462   SMQNVLIGQDLNGCAFVCGSLSFLDKISCGLTLFVLQSFHSSSPIVAGNYSTGNFSITRY  521

Query  384   SLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
              LG +P   +L GV+V++TM+L    +K  PL E LL
Sbjct  522   GLGLVPAFCSLVGVVVTWTMELRVPLYK--PLTETLL  556



>emb|CDY64360.1| BnaAnng19280D [Brassica napus]
Length=461

 Score =   473 bits (1218),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 254/459 (55%), Positives = 331/459 (72%), Gaps = 12/459 (3%)
 Frame = -2

Query  1629  IMGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTL  1450
             I+G D  E+   KPLGR SV  YGVGHMLNDIT  CW+TYLLL+LT IGLSP  AAIV L
Sbjct  6     IVGED-EEDSFTKPLGRLSVFYYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAIVML  64

Query  1449  VGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQ  1270
              GQ AD F TI  GELIDRFG FKIWH AG ++V VSF S+FGG C+PC IL S S T++
Sbjct  65    SGQVADGFATIFIGELIDRFGHFKIWHAAGSLLVAVSFSSVFGG-CLPCSILHSTSLTIE  123

Query  1269  TVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFF  1090
             T+ Y   A +F  GW+ TQ+SHM+MVNCITLN +SR+A  S RNAF+MVA+L LYA+   
Sbjct  124   TLSYSTFAAIFNIGWAATQVSHMAMVNCITLNSTSRVALTSSRNAFSMVANLGLYAIALV  183

Query  1089  VF----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWT  922
             VF     +  E+ ++QYRW+A+  I +G  FVIIF +G KEPR + +   E   +  PW 
Sbjct  184   VFGVSKADTKENTESQYRWIAYSCITVGCCFVIIFLMGTKEPRLRINL-RESNRTRIPWA  242

Query  921   YWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSV  742
             YW K++LYYQVA +Y+ TR+V NVSQ +LA +VI+DL+M+QSAK+L+PAIIY+CSF+ SV
Sbjct  243   YWFKKILYYQVAVVYLLTRLVLNVSQAYLAFFVIDDLQMAQSAKALIPAIIYICSFVVSV  302

Query  741   LLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSI  562
             +LQE+ W+GKRLK ++  GGI+W+ CG  ++LLP  +NSFMYA+SV IGIANAL++VT+I
Sbjct  303   MLQEIPWNGKRLKAYYCAGGIIWMFCGVSILLLPRSINSFMYAISVFIGIANALILVTAI  362

Query  561   GMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP--VACNPAQAC-FSVT  391
              M+S L+   L G AFV GS+ F+DK+ CG+ALY L+S + A    V  N   +  FSVT
Sbjct  363   SMQSVLIGSELGGCAFVCGSLSFLDKMSCGLALYVLQSHQSATSPQVDVNIQHSFNFSVT  422

Query  390   RFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             R+ LG +P + +  GV+V++ M+L  T  K  PL +PLL
Sbjct  423   RYGLGLVPAVCSFIGVVVTYFMELDSTILK--PLCQPLL  459



>ref|XP_007020145.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY17370.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=535

 Score =   476 bits (1224),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 256/456 (56%), Positives = 323/456 (71%), Gaps = 12/456 (3%)
 Frame = -2

Query  1617  DNREEEEE--KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVG  1444
              NR E++   KP+GR SV  YGVGHMLNDIT  CW+TYLLL+LTDIGLS   AA V L G
Sbjct  83    SNRIEDDSFSKPVGRWSVFYYGVGHMLNDITAACWFTYLLLFLTDIGLSQRDAATVMLSG  142

Query  1443  QFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTV  1264
             Q AD   TI  GELIDRFG FKIWHGAG ++V VSF S+FGG C+PCK L + S TV+T+
Sbjct  143   QIADGLATIFVGELIDRFGHFKIWHGAGSMLVAVSFSSVFGG-CLPCKALATFSSTVETI  201

Query  1263  GYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF  1084
              Y   A +F  GW+ TQ+SHMSMVNCI+LN +SR+   SCRNAFTMVA+L LY +   VF
Sbjct  202   SYSTFAAIFNVGWAATQVSHMSMVNCISLNSTSRVVLASCRNAFTMVANLSLYGIALIVF  261

Query  1083  ----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYW  916
                      DI+ QYRW+A++SIFIG  FV IFH G  EPR K    H  I +   WTYW
Sbjct  262   DISIAKTYADIENQYRWIAYLSIFIGCCFVGIFHFGTNEPRSKKGI-HGNIHARISWTYW  320

Query  915   LKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLL  736
              +++LYYQVA +YV TR+V NVSQ +LA YVINDL M+QSAK+LVPAIIY+CSFI SVLL
Sbjct  321   FRKILYYQVALVYVLTRLVLNVSQAYLAFYVINDLLMAQSAKALVPAIIYICSFIVSVLL  380

Query  735   QELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGM  556
             QE+ W+G+RLK ++A GGILW+ CG  ++LLP  M+ FMYA+SV IGIANALM VT++ M
Sbjct  381   QEIAWNGQRLKAYYAAGGILWMFCGVGILLLPRSMSLFMYAISVFIGIANALMTVTAVSM  440

Query  555   ESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACN--PAQACFSVTRFS  382
             +S ++ + L+G AFV GS+ F+DK+ CG+AL+ L+S++   P+          FSVTR+ 
Sbjct  441   QSIVIGEDLNGCAFVCGSLSFLDKISCGLALFVLQSYQSNSPIIVGNYSTNFNFSVTRYG  500

Query  381   LGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             LG +P   +   V V+ TM+L   +   +PL EPLL
Sbjct  501   LGLVPAFCSALAVAVTCTMEL--QTPLSKPLMEPLL  534



>ref|XP_003595827.1| MFS-type transporter, putative [Medicago truncatula]
 gb|ABN08122.1| C19orf28 protein, related [Medicago truncatula]
 gb|AES66078.1| MFS transporter [Medicago truncatula]
Length=453

 Score =   472 bits (1215),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 256/457 (56%), Positives = 325/457 (71%), Gaps = 10/457 (2%)
 Frame = -2

Query  1629  IMGRDNREEEE-EKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVT  1453
             +MG    E++   K LGR  +  YG+GHMLNDIT  CW+TYLLL+LTDIG SP +AAIV 
Sbjct  1     MMGTVIEEDDTFTKALGRGPIFYYGMGHMLNDITSACWFTYLLLFLTDIGFSPRNAAIVM  60

Query  1452  LVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTV  1273
             L GQ ADAF T+  GELIDRFG FKIWHGAG ++V +SF S+FGG C+PC I  SDS T 
Sbjct  61    LSGQVADAFATVFVGELIDRFGHFKIWHGAGSLLVAISFSSVFGG-CLPCTIFTSDSITF  119

Query  1272  QTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
             +TV Y + A +F  GW+ TQ+SHMSMV+CITLN +SR+A  SCRNAFTMVA+L LYA+  
Sbjct  120   ETVSYSVFAAIFNVGWAATQVSHMSMVSCITLNSTSRVALASCRNAFTMVANLSLYAIAL  179

Query  1092  FVFT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPW  925
              VF+        +++ QYRW+A++SIFIG  FV IF L  KEPR + D  H K      W
Sbjct  180   IVFSVVNGKTYANVENQYRWIAYVSIFIGCCFVGIFLLATKEPRLQMDV-HGKARGRISW  238

Query  924   TYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITS  745
              YW KRVLYYQVA IYV TR++ N+SQ +LA YVINDL+M+QSAK+LVPAIIY+ SFI S
Sbjct  239   AYWFKRVLYYQVALIYVLTRLIVNISQAYLAFYVINDLQMAQSAKALVPAIIYISSFIVS  298

Query  744   VLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTS  565
             + LQE+ W+GK LK +F+ G ILW+ CGAV+MLL   M+  MY +SV IGIANALMMVT 
Sbjct  299   IALQEIAWTGKLLKAYFSAGSILWIFCGAVIMLLTDHMSYAMYIVSVFIGIANALMMVTG  358

Query  564   IGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRF  385
             I M++ L+ ++L+G AFV GS+ F+DK+ CG+ALY L+S+++  P      Q   S+TR 
Sbjct  359   ISMQNFLIGENLNGCAFVVGSLSFLDKMSCGIALYILQSYQNISPQLQAINQFPPSITRL  418

Query  384   SLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
              LG +P + AL GV+V+ TM   H S+    L  PLL
Sbjct  419   GLGLVPAVCALLGVVVACTMDFHHPSNS---LTAPLL  452



>ref|XP_006397605.1| hypothetical protein EUTSA_v10001436mg [Eutrema salsugineum]
 gb|ESQ39058.1| hypothetical protein EUTSA_v10001436mg [Eutrema salsugineum]
Length=461

 Score =   472 bits (1215),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 251/459 (55%), Positives = 333/459 (73%), Gaps = 12/459 (3%)
 Frame = -2

Query  1629  IMGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTL  1450
             I+G D  E++  KPLGR SV  YGVGHMLNDIT  CW+TYLLL+LT IGLSP  AAIV L
Sbjct  6     IVGED-EEDQFTKPLGRLSVFFYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAIVML  64

Query  1449  VGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQ  1270
              GQ AD F TI  GELIDRFG FKIWH AG ++V +SF S+FGG C+PC IL ++S  V+
Sbjct  65    SGQVADGFATIFIGELIDRFGHFKIWHAAGSLLVAISFSSVFGG-CLPCSILHNNSLMVE  123

Query  1269  TVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFF  1090
             T  Y + A +F  GW+ TQ+SHM+MVNCITLN +SR+A  S RNAF+MVA+L LYA+   
Sbjct  124   TFSYSMFAAIFNIGWAATQVSHMAMVNCITLNSTSRVALTSSRNAFSMVANLGLYAIALV  183

Query  1089  VF----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWT  922
             VF     +  E+ + QYRW+A+  I +G +FV+IF +G KEPR + +   E   +  PW 
Sbjct  184   VFGVSKADTKENTEIQYRWIAYSCITVGCLFVVIFLMGTKEPRLRINL-RETSRARIPWA  242

Query  921   YWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSV  742
             YW +++LYYQVA +Y+ TR+V NVSQ +LA +VI+DL+M+QSAK+L+PAIIY+CSFI SV
Sbjct  243   YWFRKILYYQVAMVYLLTRLVLNVSQAYLAFFVIDDLQMAQSAKALIPAIIYICSFIVSV  302

Query  741   LLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSI  562
             +LQE+ W+GKRLK ++  GG +W+ CG  VMLLP  +NSFMYA+SV IGIANAL++VT+I
Sbjct  303   MLQEIPWNGKRLKAYYCAGGFIWIFCGVSVMLLPRGINSFMYAISVFIGIANALILVTAI  362

Query  561   GMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFED--ADPVACNPAQA-CFSVT  391
              M+S L+   L G AFV GS+ F+DK+ CG+ALY L+S +   +  V  N  Q+  FSVT
Sbjct  363   SMQSVLIGSELGGCAFVCGSLSFLDKMSCGLALYVLQSHQSGTSPQVDVNMEQSFYFSVT  422

Query  390   RFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             R+ LG +P + +  GV+V++ M+L   S  ++PL +PLL
Sbjct  423   RYGLGLVPAVCSFIGVVVTYFMEL--DSTIRKPLCQPLL  459



>ref|XP_007149118.1| hypothetical protein PHAVU_005G042600g [Phaseolus vulgaris]
 ref|XP_007149119.1| hypothetical protein PHAVU_005G042600g [Phaseolus vulgaris]
 gb|ESW21112.1| hypothetical protein PHAVU_005G042600g [Phaseolus vulgaris]
 gb|ESW21113.1| hypothetical protein PHAVU_005G042600g [Phaseolus vulgaris]
Length=451

 Score =   471 bits (1211),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 250/449 (56%), Positives = 325/449 (72%), Gaps = 10/449 (2%)
 Frame = -2

Query  1608  EEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQFADA  1429
             ++   + LGR  +  YG+GHMLNDIT  CW+TYLLL+LTDIGLSP +AA V L GQ AD 
Sbjct  8     DDTYTRILGRWPIFYYGMGHMLNDITAACWFTYLLLFLTDIGLSPRNAAAVMLSGQVADG  67

Query  1428  FTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCIS  1249
             F TI  GELIDRFG FKIWHGAG ++V +SF S+FG  C+PCK+  S+SPT +TV Y I 
Sbjct  68    FATIFIGELIDRFGHFKIWHGAGSVLVAISFSSVFG-VCLPCKMFSSNSPTFETVSYSIF  126

Query  1248  AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFT----  1081
             A +F  GW+ TQ+SHMSMV+CITLN +SR+A  SCRNAFTMVA+L LYAV   VF+    
Sbjct  127   AAIFNVGWAATQVSHMSMVSCITLNSTSRVALASCRNAFTMVANLSLYAVALIVFSVIDG  186

Query  1080  NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVL  901
                 D++ QYRW+A++SIFIG  F  IFHL  KEPR K    H K+ +   W YW KR+L
Sbjct  187   KTPTDVQNQYRWIAYLSIFIGCCFASIFHLATKEPRLKVGV-HGKVHARISWDYWFKRIL  245

Query  900   YYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEW  721
             YYQVA IYV TR+V NVSQ +LA +VINDL+M+QSAK+LVPA+IY+CSF+ S+LLQE+ W
Sbjct  246   YYQVALIYVITRLVLNVSQAYLAFFVINDLQMAQSAKALVPALIYICSFVVSLLLQEIAW  305

Query  720   SGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALV  541
             +G+ LK++++ G ILW  CGAV++LL   M+  MY +SV IGIANALMMVT + M++ L+
Sbjct  306   TGRMLKVYYSAGCILWTFCGAVILLLSANMSYVMYIVSVFIGIANALMMVTGVSMQNFLI  365

Query  540   DKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRFSLGFIPGI  361
              ++L+G AFV GS+ F+DK+ CG+ALY L+S ++         Q  FSVTR+ LG +P I
Sbjct  366   GENLNGCAFVVGSLSFLDKISCGLALYVLQSNQNISS-ELEGTQFPFSVTRYGLGLVPAI  424

Query  360   AALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
              ++ GVIV++TM   + S   + L  PLL
Sbjct  425   CSVTGVIVTYTMDFHNPS---KSLTAPLL  450



>ref|XP_011041985.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Populus euphratica]
 ref|XP_011041986.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Populus euphratica]
Length=454

 Score =   471 bits (1211),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 253/455 (56%), Positives = 328/455 (72%), Gaps = 12/455 (3%)
 Frame = -2

Query  1614  NREEEEE---KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVG  1444
             N  E+++   KP+GR SV  YGVGHMLNDIT  CW+TYLLL+LT+IGLSP  AAIV L G
Sbjct  3     NDVEDDDSCPKPVGRSSVFYYGVGHMLNDITAACWFTYLLLFLTEIGLSPRDAAIVMLAG  62

Query  1443  QFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTV  1264
             Q AD F T+ AGELIDRFG FKIWHGAG I+  +SF S+FGG C+PCKIL S SP ++T+
Sbjct  63    QIADGFATVFAGELIDRFGHFKIWHGAGSILAAISFSSVFGG-CLPCKILASCSPIIETI  121

Query  1263  GYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF  1084
              Y   A +F  GW+ TQ+SHMSMVNCI+LN +SR+   SCRNAFTMVA+L LYAV   VF
Sbjct  122   SYSTFAAIFNVGWAATQVSHMSMVNCISLNSTSRVVMTSCRNAFTMVANLSLYAVALVVF  181

Query  1083  TNNA----EDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYW  916
             +        DI+ QYRW+A+ SIFIG  FV IFHLG KEPR K    H    +   W YW
Sbjct  182   STTKATTHSDIENQYRWIAYTSIFIGCCFVGIFHLGTKEPRLKIRV-HGTSYARISWAYW  240

Query  915   LKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLL  736
              K+VLYYQV  +Y+ TR+V NVSQ +LA YVI D+RM++SAK+LVPAIIY+ SFI S+++
Sbjct  241   FKKVLYYQVGLVYMLTRLVQNVSQAYLAFYVIEDMRMAKSAKALVPAIIYISSFIVSIIM  300

Query  735   QELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGM  556
             QE+ W+G+RLK ++  GG+LW+ CG  ++ LP  +++FMY +SV IG+AN LM VT + M
Sbjct  301   QEMYWTGQRLKAYYCAGGVLWVFCGTSILFLPRSLSAFMYVISVFIGVANTLMTVTGVSM  360

Query  555   ESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVAC-NPAQACFSVTRFSL  379
             +S LV   L+G AFVYGS+ F+DKV CG+A++ L+SF+ +   +  N +    SVTR+ L
Sbjct  361   QSVLVGSDLNGCAFVYGSLSFLDKVSCGLAVFVLQSFQSSSRRSQENLSTEYISVTRYGL  420

Query  378   GFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             G +P + +L G+ +++TMK L T H K PL EPLL
Sbjct  421   GLLPAVCSLTGMAITYTMK-LQTPHSK-PLMEPLL  453



>emb|CDY17860.1| BnaC04g03590D [Brassica napus]
Length=461

 Score =   470 bits (1210),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 252/459 (55%), Positives = 330/459 (72%), Gaps = 12/459 (3%)
 Frame = -2

Query  1629  IMGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTL  1450
             I+G D  E+   KPLGR SV  YGVGHMLNDIT  CW+TYLLL+LT IGLSP  AAIV L
Sbjct  6     IVGED-EEDSFTKPLGRLSVFYYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAIVML  64

Query  1449  VGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQ  1270
              GQ AD F TI  GELIDRFG FKIWH AG ++V +SF S+FGG C+PC IL S S T++
Sbjct  65    SGQVADGFATIFIGELIDRFGHFKIWHAAGSLLVAISFSSVFGG-CLPCSILHSTSLTIE  123

Query  1269  TVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFF  1090
             T+ Y   A +F  GW+ TQ+SHM+MVNCITLN +SR+A  S RNAF+MVA+L LYA+   
Sbjct  124   TLSYSTFAAIFNIGWAATQVSHMAMVNCITLNSTSRVALTSSRNAFSMVANLGLYAIALV  183

Query  1089  VF----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWT  922
             VF     +  E+ ++QYRW+A+  I +G  FVIIF +G KEPR + +   E   +  PW 
Sbjct  184   VFGVSKADTKENTESQYRWIAYSCITVGCGFVIIFLMGTKEPRLRINL-RESNRTRIPWA  242

Query  921   YWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSV  742
             YW +++LYYQVA +Y+ TR+V NVSQ +LA +VI+DL+M+QSAK+L+PAIIY+CSF+ SV
Sbjct  243   YWFRKILYYQVAVVYLLTRLVLNVSQAYLAFFVIDDLQMAQSAKALIPAIIYICSFVVSV  302

Query  741   LLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSI  562
             +LQE+ W+GKRLK ++  GGI+W+ CG  ++LLP  +NSFMYA+SV IGIANAL++VT+I
Sbjct  303   MLQEIPWNGKRLKAYYCAGGIIWMFCGVSILLLPRSINSFMYAISVFIGIANALILVTAI  362

Query  561   GMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP--VACNPAQAC-FSVT  391
              M+S L+   L G AFV GS+ F+DK+ CG+ALY L+S + A    V  N   +  FSVT
Sbjct  363   SMQSVLIGSELGGCAFVCGSLSFLDKMSCGLALYVLQSHQSATSPQVDVNIQHSFNFSVT  422

Query  390   RFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             R+ LG +P + +  GV V++ M+L  T  K  PL +PLL
Sbjct  423   RYGLGLVPAVCSFIGVAVTYFMELDSTILK--PLCQPLL  459



>ref|XP_003531460.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Glycine max]
 ref|XP_006585374.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X2 [Glycine max]
 ref|XP_006585375.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X3 [Glycine max]
 gb|KHN21335.1| Major facilitator superfamily domain-containing protein 12 [Glycine 
soja]
Length=452

 Score =   470 bits (1209),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 249/450 (55%), Positives = 324/450 (72%), Gaps = 9/450 (2%)
 Frame = -2

Query  1608  EEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQFADA  1429
             +    K LGR  V  YG+GHMLNDIT  CW+TYLLL+LTDIGLSP +AA+V L GQ AD 
Sbjct  8     DNTYTKILGRWPVFYYGMGHMLNDITAACWFTYLLLFLTDIGLSPRNAAVVMLSGQVADG  67

Query  1428  FTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCIS  1249
             F TI  GELIDRFG FKIWHGAG ++V +SF S+FGG C+PCK+  S+S T +T+ Y + 
Sbjct  68    FVTIFVGELIDRFGHFKIWHGAGSLLVAISFSSVFGG-CLPCKLFSSNSGTFETLSYSMY  126

Query  1248  AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFT----  1081
             A +F  GW+ TQ+SHMSMV+CITLN +SR+A  SCRNAFTMVA+L LYAV   VF+    
Sbjct  127   AAIFNVGWAATQVSHMSMVSCITLNSTSRVALASCRNAFTMVANLSLYAVALIVFSVING  186

Query  1080  NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVL  901
                +D++ QYRW+A++SIFIG  FV +FHL  KEPR K    H  + +   W YW KR+L
Sbjct  187   KTHDDVENQYRWIAYLSIFIGCCFVGVFHLATKEPRLKVGV-HGMVHARISWDYWFKRIL  245

Query  900   YYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEW  721
             YYQVA +YV TR+V NVSQ +LA +VINDL+M+QSAK+LVPA+IY+CSF+ S+ LQE+ W
Sbjct  246   YYQVALVYVLTRLVLNVSQAYLAFFVINDLQMAQSAKALVPALIYICSFVVSIALQEIAW  305

Query  720   SGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALV  541
             +G+ LK +++ G ILW+ CGAV++LL   M+  MY +SV IGIANALMMVT + M++ L+
Sbjct  306   TGRMLKAYYSAGCILWIFCGAVILLLTTNMSYVMYIVSVFIGIANALMMVTGVSMQNFLI  365

Query  540   DKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRFSLGFIPGI  361
              ++L+G AFV GS+ F+DK+ CG+ALY L+S ++  P      Q  FSVTR  LG +P  
Sbjct  366   GENLNGCAFVVGSLSFLDKISCGLALYVLQSNQNLSPQLQATTQFPFSVTRIGLGLVPAF  425

Query  360   AALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
              AL GV+V+ TM   + S   + L  PLLA
Sbjct  426   CALVGVVVTCTMDFHNPS---KSLTAPLLA  452



>ref|XP_010544514.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Tarenaya hassleriana]
 ref|XP_010544515.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Tarenaya hassleriana]
 ref|XP_010544516.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Tarenaya hassleriana]
Length=461

 Score =   469 bits (1208),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 253/456 (55%), Positives = 326/456 (71%), Gaps = 10/456 (2%)
 Frame = -2

Query  1620  RDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQ  1441
             R+  E+   KP+GR  V  YGVGHMLNDIT  CW+TYLLL+LT IGLSP+ AAIV L GQ
Sbjct  8     REIGEDPFTKPIGRWPVFFYGVGHMLNDITASCWFTYLLLFLTQIGLSPTDAAIVMLSGQ  67

Query  1440  FADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVG  1261
              AD F TI  GELIDRFG FKIWHGAG  +V +SF S+FGG C+PC IL S S  V+T  
Sbjct  68    IADGFATIFTGELIDRFGHFKIWHGAGSALVAISFSSVFGG-CMPCSILHSTSSMVKTFS  126

Query  1260  YCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFT  1081
             Y + A +F  GW+ TQ+SHM+MVNCI+LN +SR+A  SCRNAFTMVA+L LYA+   VF 
Sbjct  127   YSVFAAIFNVGWAATQVSHMAMVNCISLNSTSRVALTSCRNAFTMVANLSLYAIALVVFG  186

Query  1080  ----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKD-DDGHEKIGSNTPWTYW  916
                    E+ ++QYRW+A+ SI +G  FV+IF +G KEP  +     +  I +   W YW
Sbjct  187   LVKGQTLENTESQYRWIAYSSITLGCCFVVIFLMGTKEPGLRICLRENSNIQARISWVYW  246

Query  915   LKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLL  736
              +++LYYQVA +YV TR+V NVSQ +LA +VI+DL+M QSAK+LVPAIIY+ SF+ SVLL
Sbjct  247   FRKILYYQVAVVYVLTRLVLNVSQAYLAFFVIDDLQMVQSAKALVPAIIYISSFVVSVLL  306

Query  735   QELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGM  556
             QE+ W+GKRLK ++  GGILW+ CGA ++LLP  + SFMYA+SV IGIANALM VT++ M
Sbjct  307   QEIPWNGKRLKAYYCTGGILWIFCGAAILLLPKSIKSFMYAISVFIGIANALMTVTAVSM  366

Query  555   ESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP-VACNPAQ-ACFSVTRFS  382
             +S L+   L G AFV GS+ F+DK+ CG+ALY L+S +   P +  N  +   FSVTR+ 
Sbjct  367   QSVLIGADLSGCAFVCGSLSFLDKISCGIALYVLQSHQSTAPRIQLNGDKLQYFSVTRYG  426

Query  381   LGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             LG +P + +L GV V++TM+L +T  K  PL EPLL
Sbjct  427   LGLVPALCSLLGVAVTWTMELQNTIPK--PLVEPLL  460



>ref|XP_009143013.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X2 [Brassica rapa]
Length=461

 Score =   469 bits (1207),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 252/459 (55%), Positives = 330/459 (72%), Gaps = 12/459 (3%)
 Frame = -2

Query  1629  IMGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTL  1450
             I+G D  E+   KPLGR SV  YGVGHMLNDIT  CW+TYLLL+LT IGLSP  AAIV L
Sbjct  6     IVGED-EEDSFTKPLGRLSVFYYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAIVML  64

Query  1449  VGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQ  1270
              GQ AD F TI  GELIDRFG FKIWH AG ++V +SF S+FGG C+PC IL S S T++
Sbjct  65    SGQVADGFATIFIGELIDRFGHFKIWHAAGSLLVAISFSSVFGG-CLPCSILHSTSLTIE  123

Query  1269  TVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFF  1090
             T+ Y   A +F  GW+ TQ+SHM+MVNCITLN +SR+A  S RNAF+MVA+L LYA+   
Sbjct  124   TLSYSTFAAIFNIGWAATQVSHMAMVNCITLNSTSRVALTSSRNAFSMVANLGLYAIALV  183

Query  1089  VF----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWT  922
             VF     +  E+ ++QYRW+A+  I +G  FVIIF +G KEPR + +   E   +  PW 
Sbjct  184   VFGVSKADTKENTESQYRWIAYSCITVGCCFVIIFLMGTKEPRLRINL-RESNRTRIPWA  242

Query  921   YWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSV  742
             YW K++LYYQVA +Y+ TR+V NVSQ +LA +VI+DL+M+QSAK+L+PAIIY+CSF+ SV
Sbjct  243   YWFKKILYYQVAVVYLLTRLVLNVSQAYLAFFVIDDLQMAQSAKALIPAIIYICSFVVSV  302

Query  741   LLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSI  562
             +LQE+ W+GKRLK ++  GGI+W+ CG  ++LLP  +NSFMYA+SV IGIANAL++VT+I
Sbjct  303   MLQEIPWNGKRLKAYYCAGGIIWMFCGVSILLLPRSINSFMYAISVFIGIANALILVTAI  362

Query  561   GMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP--VACNPAQAC-FSVT  391
              M+S L+   L G AFV GS+ F+DK+ CG+ALY L+S + A    V  N   +  FSVT
Sbjct  363   SMQSVLIGSELGGCAFVCGSLSFLDKMSCGLALYVLQSHQSATSPQVDVNIQHSFNFSVT  422

Query  390   RFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             R+ LG +P + +  GV V++ M+L  T  K+  L +PLL
Sbjct  423   RYGLGLVPAVCSFIGVAVTYFMELDSTILKR--LCQPLL  459



>ref|XP_009143012.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X1 [Brassica rapa]
Length=466

 Score =   468 bits (1204),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 250/464 (54%), Positives = 328/464 (71%), Gaps = 17/464 (4%)
 Frame = -2

Query  1629  IMGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTL  1450
             I+G D  E+   KPLGR SV  YGVGHMLNDIT  CW+TYLLL+LT IGLSP  AAIV L
Sbjct  6     IVGED-EEDSFTKPLGRLSVFYYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAIVML  64

Query  1449  VGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQ  1270
              GQ AD F TI  GELIDRFG FKIWH AG ++V +SF S+FGG C+PC IL S S T++
Sbjct  65    SGQVADGFATIFIGELIDRFGHFKIWHAAGSLLVAISFSSVFGG-CLPCSILHSTSLTIE  123

Query  1269  TVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFF  1090
             T+ Y   A +F  GW+ TQ+SHM+MVNCITLN +SR+A  S RNAF+MVA+L LYA+   
Sbjct  124   TLSYSTFAAIFNIGWAATQVSHMAMVNCITLNSTSRVALTSSRNAFSMVANLGLYAIALV  183

Query  1089  VF----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWT  922
             VF     +  E+ ++QYRW+A+  I +G  FVIIF +G KEPR + +   E   +  PW 
Sbjct  184   VFGVSKADTKENTESQYRWIAYSCITVGCCFVIIFLMGTKEPRLRINL-RESNRTRIPWA  242

Query  921   YWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSV  742
             YW K++LYYQVA +Y+ TR+V NVSQ +LA +VI+DL+M+QSAK+L+PAIIY+CSF+ SV
Sbjct  243   YWFKKILYYQVAVVYLLTRLVLNVSQAYLAFFVIDDLQMAQSAKALIPAIIYICSFVVSV  302

Query  741   LLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSI  562
             +LQE+ W+GKRLK ++  GGI+W+ CG  ++LLP  +NSFMYA+SV IGIANAL++VT+I
Sbjct  303   MLQEIPWNGKRLKAYYCAGGIIWMFCGVSILLLPRSINSFMYAISVFIGIANALILVTAI  362

Query  561   GMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQA--------  406
              M+S L+   L G AFV GS+ F+DK+ CG+ALY L+S +  +       Q         
Sbjct  363   SMQSVLIGSELGGCAFVCGSLSFLDKMSCGLALYVLQSHQKNNGAGATSPQVDVNIQHSF  422

Query  405   CFSVTRFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
              FSVTR+ LG +P + +  GV V++ M+L  T  K+  L +PLL
Sbjct  423   NFSVTRYGLGLVPAVCSFIGVAVTYFMELDSTILKR--LCQPLL  464



>gb|AAM77646.1|AF517847_1 hypothetical protein [Arabidopsis thaliana]
Length=454

 Score =   467 bits (1202),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 248/455 (55%), Positives = 330/455 (73%), Gaps = 14/455 (3%)
 Frame = -2

Query  1608  EEEEE----KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQ  1441
             EEEEE    KP GR SV  YGVGHMLNDIT  CW+TYLL +LT IGLSP  AAIV L GQ
Sbjct  2     EEEEEDPSAKPPGRLSVFYYGVGHMLNDITASCWFTYLLSFLTQIGLSPRDAAIVMLSGQ  61

Query  1440  FADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVG  1261
              AD F TI  GELIDRFG FKIWH AG ++V +SF S+FGG C+PC +L ++S T++T+ 
Sbjct  62    VADGFATIFIGELIDRFGHFKIWHAAGSLLVAISFSSVFGG-CLPCSLLHNNSSTIETLS  120

Query  1260  YCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF-  1084
             Y + A +F  GW+ TQ+SHM+MVNCITLN +SR+A  S RNAF+MVA+L LYA+   VF 
Sbjct  121   YSMFAAIFNIGWAATQVSHMAMVNCITLNSTSRVALTSSRNAFSMVANLGLYAIALVVFG  180

Query  1083  ---TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWL  913
                    E+ ++QYRW+A+ SI +G  FV+IF +G KEPR + +   E   +  PW+YW 
Sbjct  181   VSEAVTKENTESQYRWIAYSSITVGCCFVVIFLMGTKEPRLRINL-RETSRARIPWSYWF  239

Query  912   KRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQ  733
             +++LYYQVA +Y+ TR+V NVSQ +LA +VI+DL+M+QSA +L+PAIIY+CSF+ SV+LQ
Sbjct  240   RKILYYQVAMVYLLTRLVLNVSQAYLAFFVIDDLQMAQSAXALIPAIIYVCSFVVSVMLQ  299

Query  732   ELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGME  553
             E+ W+GKRLK ++  GGI+W+ CG  ++LLP  +NS+MYA+SV  GIANA+M+VTSI M+
Sbjct  300   EIPWNGKRLKTYYCAGGIIWIFCGISILLLPRSINSYMYAISVFXGIANAVMLVTSISMQ  359

Query  552   SALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP-VACNPAQA-CFSVTRFSL  379
             S L+   L G AFV GS+ F+DK+ CG+ALY L+S +   P V  N  +   FSVTR+ L
Sbjct  360   SVLIGSKLGGCAFVCGSLSFLDKMSCGLALYVLQSHQGTSPKVDVNIKEYFYFSVTRYGL  419

Query  378   GFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             G +P + +L GV+V++ M+L  T  K  PL +PLL
Sbjct  420   GLVPAVCSLVGVVVTYFMELDSTILK--PLCQPLL  452



>emb|CDY30463.1| BnaA04g25640D [Brassica napus]
Length=461

 Score =   465 bits (1196),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 244/455 (54%), Positives = 327/455 (72%), Gaps = 11/455 (2%)
 Frame = -2

Query  1617  DNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQF  1438
             ++ E    KPLGR SV  YGVGHMLNDIT  CW+TYLLL+LT IGLSP  AAIV L GQ 
Sbjct  9     ESEEVSFTKPLGRLSVFYYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAIVMLSGQV  68

Query  1437  ADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGY  1258
             AD F T+  GE IDRFG FKIWH AG ++V +SF S+FGG C+PC IL S+S T++T+ Y
Sbjct  69    ADGFATVFVGESIDRFGHFKIWHAAGSLLVAISFSSVFGG-CLPCTILHSNSLTLETLSY  127

Query  1257  CISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF--  1084
              + A +F  GW+ TQ+SHM+MVN ITLN +SR+A  S RNAF+MVA+L LYA+   VF  
Sbjct  128   SMFAAIFNIGWAATQVSHMAMVNYITLNSTSRVALTSSRNAFSMVANLALYAIALVVFGV  187

Query  1083  --TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLK  910
                +  E+ ++QYRW+A+  I +G  FV++F +G KEPR +     E   +  PW YW +
Sbjct  188   SKADTKENTESQYRWIAYSCITVGCCFVVVFLMGTKEPRLRITL-RETNRARIPWAYWFR  246

Query  909   RVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQE  730
             ++LYYQVA +Y+ TR+V NVSQ +LA +VI+DL+M+QSAK+L+PAIIY+CSF+ SV+LQE
Sbjct  247   KILYYQVAMVYLLTRLVLNVSQAYLAFFVIDDLQMAQSAKALIPAIIYICSFVVSVMLQE  306

Query  729   LEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMES  550
             + W+GKRLK ++  GGI+W+ CG  V+ LP  +NSFMYA+SVLIGIANAL++VT+I M+S
Sbjct  307   IPWNGKRLKAYYCAGGIIWMFCGVSVLFLPRSINSFMYAISVLIGIANALILVTAISMQS  366

Query  549   ALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDA---DPVACNPAQACFSVTRFSL  379
              LV   L G AFV GS+ F+DK+ CG+ALY L+S ++    + V  +     FSVTR+ L
Sbjct  367   VLVGSELGGCAFVCGSLSFLDKMSCGIALYVLQSHKNGTSPEDVVTSTHSFDFSVTRYGL  426

Query  378   GFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             G +P + +  GV+V++ M+L  T  K  PL +PLL
Sbjct  427   GLVPAVCSFIGVVVTYFMELDGTILK--PLCQPLL  459



>ref|XP_004135898.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Cucumis sativus]
 ref|XP_004158215.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Cucumis sativus]
Length=457

 Score =   464 bits (1194),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 254/456 (56%), Positives = 324/456 (71%), Gaps = 12/456 (3%)
 Frame = -2

Query  1617  DNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQF  1438
             D       +P+GR S+  +G+GHMLNDIT  CW+TYLLL+LTDIGLSP +AA V L GQ 
Sbjct  5     DESSLSYTQPIGRWSIFCFGLGHMLNDITAACWFTYLLLFLTDIGLSPGNAATVMLSGQV  64

Query  1437  ADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGY  1258
             AD  TTI AGELIDRFG  KIWHGAG ++V VSF S+FGG C+PC +    S T+QTVGY
Sbjct  65    ADGVTTIFAGELIDRFGHLKIWHGAGSVLVAVSFSSVFGG-CLPCILFSRSSSTLQTVGY  123

Query  1257  CISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFT-  1081
                A +F  GW+ TQ+SHMSMVNCITLN +SR+A  SCRNAF M+A+L LYAV   VF+ 
Sbjct  124   SFFAAIFNVGWAATQVSHMSMVNCITLNSTSRVALASCRNAFNMIANLSLYAVALLVFSI  183

Query  1080  ---NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLK  910
                 +  DI+ QYR +A+ISIFIG  FV+IF +G KEP  K      + GS   W+YW K
Sbjct  184   IKAKSHADIEYQYRVIAYISIFIGCCFVVIFLVGTKEPSLKVAVQGNR-GSRISWSYWFK  242

Query  909   RVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQE  730
             +VLYYQVA  YV TR++ NVSQ FLA YVINDL M+QSA +LVPAIIY+ SFI SV+LQE
Sbjct  243   KVLYYQVALAYVLTRLIVNVSQAFLAYYVINDLHMAQSATALVPAIIYVFSFIISVVLQE  302

Query  729   LEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMES  550
             + W+G+RLKI+++ GGI+W+ CGAV+++LP  +++FMY +S  IGIANALMMVT + M+S
Sbjct  303   VVWTGQRLKIYYSAGGIIWMFCGAVILILPSSLSTFMYVMSTFIGIANALMMVTGVSMQS  362

Query  549   ALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACN---PAQACF-SVTRFS  382
              LV   L+G AFV GS+ F+DK+ CG+ALYFLESF+    +  +   P  A + SVTR+ 
Sbjct  363   VLVGTDLNGCAFVCGSLSFLDKISCGLALYFLESFQSISALHVSENTPLDATYISVTRYG  422

Query  381   LGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             LG +P + A  GV V+ +M L   +   + L E LL
Sbjct  423   LGLVPAVCAFLGVAVTISMNL--GAPYAKYLTESLL  456



>ref|XP_003546851.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Glycine max]
 ref|XP_006598239.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X2 [Glycine max]
 gb|KHN49059.1| Major facilitator superfamily domain-containing protein 12 [Glycine 
soja]
Length=452

 Score =   463 bits (1192),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 247/450 (55%), Positives = 322/450 (72%), Gaps = 9/450 (2%)
 Frame = -2

Query  1608  EEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQFADA  1429
             ++   K LGR  V  YG+GHMLNDIT  CW+TYLLL+LTDIGLSP +AA V L GQ AD 
Sbjct  8     DDTYTKILGRWPVFYYGMGHMLNDITAACWFTYLLLFLTDIGLSPRNAAAVMLSGQVADG  67

Query  1428  FTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCIS  1249
             F TI+ GELIDRFG FKIWHGAG ++V +SF S+FGG C+PCK+  S+S T +TV Y + 
Sbjct  68    FATILVGELIDRFGHFKIWHGAGSLLVAISFSSVFGG-CLPCKLFSSNSCTFETVSYSVF  126

Query  1248  AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFT----  1081
             A +F  GW+ TQ+SHMSMV+CITLN +SR+A  SCRNAFTMVA+L LYAV   VF+    
Sbjct  127   AAIFNLGWAATQVSHMSMVSCITLNSTSRVALASCRNAFTMVANLSLYAVALIVFSVING  186

Query  1080  NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVL  901
                +D++ QYRW+A+ SIFIG  FV +F L  KEPR K    H  + +   W YW KR+L
Sbjct  187   KTHDDVENQYRWIAYFSIFIGCCFVGVFLLATKEPRLKLGV-HGMVHARISWDYWFKRIL  245

Query  900   YYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEW  721
             YYQVA +YV TR+V N+SQ +LA +VINDL+M+QSAK+LVPA+IY+CSF+ S+ LQE+ W
Sbjct  246   YYQVALVYVLTRLVLNISQAYLAFFVINDLQMAQSAKALVPALIYICSFVVSIALQEIAW  305

Query  720   SGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALV  541
             +G+ LK +++ G ILW+ CGAV++LL   M+  MY +SV IGIANALMMVT + M++ L+
Sbjct  306   TGRMLKAYYSAGCILWIFCGAVILLLTTNMSYVMYIVSVFIGIANALMMVTGVSMQNFLI  365

Query  540   DKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRFSLGFIPGI  361
               +L+G AFV GS+ F+DK+ CG+ALY L+S ++  P      Q  FSVTR  LG +P  
Sbjct  366   GGNLNGCAFVVGSLSFLDKISCGIALYVLQSNQNLSPQLQATTQFPFSVTRVGLGLVPAF  425

Query  360   AALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
              AL GV+V+ TM   + S   + +  PLLA
Sbjct  426   CALVGVVVTCTMDFHNPS---KSMTAPLLA  452



>gb|KGN45180.1| hypothetical protein Csa_7G430150 [Cucumis sativus]
Length=486

 Score =   464 bits (1194),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 252/446 (57%), Positives = 321/446 (72%), Gaps = 11/446 (2%)
 Frame = -2

Query  1629  IMGRDNREE-EEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVT  1453
             IM  D+       +P+GR S+  +G+GHMLNDIT  CW+TYLLL+LTDIGLSP +AA V 
Sbjct  29    IMSNDDESSLSYTQPIGRWSIFCFGLGHMLNDITAACWFTYLLLFLTDIGLSPGNAATVM  88

Query  1452  LVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTV  1273
             L GQ AD  TTI AGELIDRFG  KIWHGAG ++V VSF S+FGG C+PC +    S T+
Sbjct  89    LSGQVADGVTTIFAGELIDRFGHLKIWHGAGSVLVAVSFSSVFGG-CLPCILFSRSSSTL  147

Query  1272  QTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
             QTVGY   A +F  GW+ TQ+SHMSMVNCITLN +SR+A  SCRNAF M+A+L LYAV  
Sbjct  148   QTVGYSFFAAIFNVGWAATQVSHMSMVNCITLNSTSRVALASCRNAFNMIANLSLYAVAL  207

Query  1092  FVFT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPW  925
              VF+     +  DI+ QYR +A+ISIFIG  FV+IF +G KEP  K      + GS   W
Sbjct  208   LVFSIIKAKSHADIEYQYRVIAYISIFIGCCFVVIFLVGTKEPSLKVAVQGNR-GSRISW  266

Query  924   TYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITS  745
             +YW K+VLYYQVA  YV TR++ NVSQ FLA YVINDL M+QSA +LVPAIIY+ SFI S
Sbjct  267   SYWFKKVLYYQVALAYVLTRLIVNVSQAFLAYYVINDLHMAQSATALVPAIIYVFSFIIS  326

Query  744   VLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTS  565
             V+LQE+ W+G+RLKI+++ GGI+W+ CGAV+++LP  +++FMY +S  IGIANALMMVT 
Sbjct  327   VVLQEVVWTGQRLKIYYSAGGIIWMFCGAVILILPSSLSTFMYVMSTFIGIANALMMVTG  386

Query  564   IGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACN---PAQACF-S  397
             + M+S LV   L+G AFV GS+ F+DK+ CG+ALYFLESF+    +  +   P  A + S
Sbjct  387   VSMQSVLVGTDLNGCAFVCGSLSFLDKISCGLALYFLESFQSISALHVSENTPLDATYIS  446

Query  396   VTRFSLGFIPGIAALFGVIVSFTMKL  319
             VTR+ LG +P + A  GV V+ +M L
Sbjct  447   VTRYGLGLVPAVCAFLGVAVTISMNL  472



>ref|XP_009142254.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Brassica rapa]
Length=461

 Score =   462 bits (1188),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 243/455 (53%), Positives = 326/455 (72%), Gaps = 11/455 (2%)
 Frame = -2

Query  1617  DNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQF  1438
             ++ E    KPLGR SV  YGVGHMLNDIT  CW+TYLLL+LT IGLSP  AAIV L GQ 
Sbjct  9     ESEEVSFTKPLGRLSVFYYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAIVMLSGQV  68

Query  1437  ADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGY  1258
             AD F T+  GE IDRFG FKIWH AG ++V +SF S+FGG C+PC IL S+S T++T+ Y
Sbjct  69    ADGFATVFVGESIDRFGHFKIWHAAGSLLVAISFSSVFGG-CLPCTILHSNSLTLETLSY  127

Query  1257  CISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF--  1084
              + A +F  GW+ TQ+SHM+MVN ITLN +SR+A  S RNAF+MVA+L LYA+   VF  
Sbjct  128   SMFAAIFNIGWAATQVSHMAMVNYITLNSTSRVALTSSRNAFSMVANLALYAIALVVFGV  187

Query  1083  --TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLK  910
                +  E+ ++QYRW+A+  I +G  FV++F +G KEPR +     E   +  PW YW +
Sbjct  188   SKADTKENTESQYRWIAYSCITVGCCFVVVFLMGTKEPRLRITL-RETNRARIPWAYWFR  246

Query  909   RVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQE  730
             ++LYYQVA +Y+ TR+V NVSQ +LA +VI+DL+M+QSAK+L+PAIIY+CSF+ SV+LQE
Sbjct  247   KILYYQVAMVYLLTRLVLNVSQAYLAFFVIDDLQMAQSAKALIPAIIYICSFVVSVMLQE  306

Query  729   LEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMES  550
             + W+GK LK ++  GGI+W+ CG  V+ LP  +NSFMYA+SVLIGIANAL++VT+I M+S
Sbjct  307   IPWNGKGLKAYYCAGGIIWMFCGVSVLFLPRSINSFMYAISVLIGIANALILVTAISMQS  366

Query  549   ALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDA---DPVACNPAQACFSVTRFSL  379
              LV   L G AFV GS+ F+DK+ CG+ALY L+S ++    + V  +     FSVTR+ L
Sbjct  367   VLVGSELGGCAFVCGSLSFLDKMSCGIALYVLQSHKNGTSPEDVVTSTHSFDFSVTRYGL  426

Query  378   GFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             G +P + +  GV+V++ M+L  T  K  PL +PLL
Sbjct  427   GLVPAVCSFIGVVVTYFMELDGTILK--PLCQPLL  459



>emb|CDY23426.1| BnaC04g49540D [Brassica napus]
Length=461

 Score =   461 bits (1187),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 244/455 (54%), Positives = 327/455 (72%), Gaps = 11/455 (2%)
 Frame = -2

Query  1617  DNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQF  1438
             ++ +    KPLGR SV  YGVGHMLNDIT  CW+TYLLL+LT IGLSP  AAIV L GQ 
Sbjct  9     ESEDVSFTKPLGRLSVFYYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAIVMLSGQV  68

Query  1437  ADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGY  1258
             AD F T+  GELIDRFG FKIWH AG ++V +SF S+FGG C+PC IL S+S T++T+ Y
Sbjct  69    ADGFATVFVGELIDRFGHFKIWHTAGSLLVAISFSSVFGG-CLPCTILHSNSLTLETLSY  127

Query  1257  CISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF--  1084
              + A +F  GW+ TQ+SHM+MVN ITLN +SR+A  S RNAF+MVA+L LYA+   VF  
Sbjct  128   SMFAAIFNIGWAATQVSHMAMVNYITLNSTSRVALTSSRNAFSMVANLALYAIALVVFGV  187

Query  1083  --TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLK  910
                +  E+ ++QYRW+A+  I +G  FV++F +G KEPR +     E   +  PW YW +
Sbjct  188   SKADTKENTESQYRWIAYSCITVGCCFVVVFLMGTKEPRLRITL-RETNRARIPWAYWFR  246

Query  909   RVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQE  730
             ++LYYQVA +Y+ TR+V NVSQ +LA +VI+DL+M+QSAK+L+PAIIY+CSF+ SV+LQE
Sbjct  247   KILYYQVAMVYLLTRLVLNVSQAYLAFFVIDDLQMAQSAKALIPAIIYICSFVVSVMLQE  306

Query  729   LEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMES  550
             + W+GKRLK ++  GGI+W+ CG  V+ LP  +NSFMYA+SV IGIANAL++VT+I M+S
Sbjct  307   IPWNGKRLKAYYCAGGIIWMFCGVSVLFLPRSINSFMYAVSVFIGIANALILVTAISMQS  366

Query  549   ALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFED--ADPVACNPAQAC-FSVTRFSL  379
              LV   L G AFV GS+ F+DK+ CG+ALY L+S +   +  V  N   +  FSVTR+ L
Sbjct  367   VLVGSVLGGCAFVCGSLSFLDKMSCGIALYVLQSHKSGTSPEVVVNSTHSFDFSVTRYGL  426

Query  378   GFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             G +P + +  GV+V++ M+L  T  K  PL +PLL
Sbjct  427   GLVPAVCSFIGVVVTYFMELDGTIVK--PLCQPLL  459



>gb|ACU23744.1| unknown [Glycine max]
Length=452

 Score =   461 bits (1186),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 246/450 (55%), Positives = 321/450 (71%), Gaps = 9/450 (2%)
 Frame = -2

Query  1608  EEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQFADA  1429
             +    K LGR  V  YG+GHMLNDIT  CW+TYLLL+LTDIGLSP +AA+V L GQ AD 
Sbjct  8     DNTYTKILGRWPVFYYGMGHMLNDITAACWFTYLLLFLTDIGLSPRNAAVVMLSGQVADG  67

Query  1428  FTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCIS  1249
             F TI  GELI RFG FKIWHGAG ++V +SF S+FGG C+PCK+  S+S T +T+ Y + 
Sbjct  68    FVTIFVGELIGRFGHFKIWHGAGSLLVAISFSSVFGG-CLPCKLFSSNSGTFETLSYSMY  126

Query  1248  AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFT----  1081
             A +F  GW+ TQ+SHMSMV+CITLN +SR+A  SCRNAFTMVA+L LYAV   VF+    
Sbjct  127   AAIFNVGWAATQVSHMSMVSCITLNSTSRVALASCRNAFTMVANLSLYAVALIVFSVIIG  186

Query  1080  NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVL  901
                +D++ QYRW+A++SIFIG  FV +F L  KEPR K    H  + +   W YW KR+L
Sbjct  187   KTHDDVENQYRWIAYLSIFIGCCFVGVFRLATKEPRLKVGV-HGMVHARISWGYWFKRIL  245

Query  900   YYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEW  721
             YYQVA +YV TR+V NVSQ +LA +VINDL+M+QSAK+LVPA+IY+CSF+ S+ LQE+ W
Sbjct  246   YYQVALVYVLTRLVLNVSQAYLAFFVINDLQMAQSAKALVPALIYICSFVVSIALQEIAW  305

Query  720   SGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALV  541
             +G+ LK +++ G ILW+ CGAV++LL   M+  MY +SV IGIANALMMVT + M++ L+
Sbjct  306   TGRMLKAYYSAGCILWIFCGAVILLLTTNMSYVMYIVSVFIGIANALMMVTGVSMQNFLI  365

Query  540   DKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRFSLGFIPGI  361
              ++L+G AFV GS+ F+DK+ CG+ALY  +S ++  P      Q  FSVTR  LG +P  
Sbjct  366   GENLNGCAFVVGSLSFLDKISCGLALYVFQSNQNLFPQLQATTQFPFSVTRIGLGLVPAF  425

Query  360   AALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
              AL GV+V+ TM   + S   + L  PLLA
Sbjct  426   CALVGVVVTCTMDFHNPS---KSLTAPLLA  452



>ref|XP_010243428.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Nelumbo nucifera]
Length=443

 Score =   459 bits (1180),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 248/449 (55%), Positives = 322/449 (72%), Gaps = 14/449 (3%)
 Frame = -2

Query  1605  EEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQFADAF  1426
             E   +PLGR SV  YGVGHMLND+T  CW+TYLL++LTDIGL P  AA + L GQ AD F
Sbjct  5     ESCTRPLGRGSVFCYGVGHMLNDVTAACWFTYLLVFLTDIGLPPRDAATIMLSGQIADGF  64

Query  1425  TTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISA  1246
              TI +GELIDRFG FKI H AG ++V +SF S+FG  C+PCKI  +DS T++TVGY I A
Sbjct  65    ATIFSGELIDRFGHFKICHIAGSVLVAISFSSVFG-VCVPCKIFKTDSATMETVGYSIFA  123

Query  1245  VVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFT----N  1078
              +F  GW+ TQ+SHMSMVNC+TLN +SR+A  SCRNAFTMVA+L L+AV   VF      
Sbjct  124   AIFNVGWAATQVSHMSMVNCMTLNPTSRVALASCRNAFTMVANLSLFAVALAVFNLSKPK  183

Query  1077  NAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVLY  898
                DI+ QYRW+A++SI IG  FV IF +G KEPR + +   + +     W  W K+VLY
Sbjct  184   TPVDIENQYRWIAYLSILIGCCFVGIFLVGTKEPRLRQEIEGKSL-HRISWKDWFKKVLY  242

Query  897   YQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEWS  718
             YQVA +Y+ TR+VTNVSQ  LA YVINDL+M+QS+K++VPAIIY+ SF+ SV+LQE++W+
Sbjct  243   YQVALVYMLTRLVTNVSQALLAFYVINDLQMAQSSKAIVPAIIYIFSFVVSVILQEMKWT  302

Query  717   GKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALVD  538
             G+R+K FF  GGILW+  GA + LLP  +++ MY LSV+IG+ANALM VT I M+S LV 
Sbjct  303   GQRIKAFFTAGGILWIFSGAGIFLLPSSLHNLMYLLSVIIGVANALMTVTGISMQSVLVG  362

Query  537   KHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRFSLGFIPGIA  358
             + ++GSAFVYGS+ F+DKV CG+ALY +ES++D   +         S+TR+ L  I    
Sbjct  363   EDINGSAFVYGSLSFLDKVSCGIALYVIESYQDFSSI------GSLSITRYGLSLITASC  416

Query  357   ALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
             AL GV+V++T+  L T + K  L EPLLA
Sbjct  417   ALLGVLVTYTIN-LETPNLKH-LTEPLLA  443



>gb|EMT13240.1| hypothetical protein F775_06308 [Aegilops tauschii]
Length=539

 Score =   462 bits (1189),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 251/487 (52%), Positives = 330/487 (68%), Gaps = 36/487 (7%)
 Frame = -2

Query  1635  RRIMGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIV  1456
             + I    + E E ++PLGR  + +YG GHMLNDIT  CW+TYLL++LTD+GLSPS AAIV
Sbjct  57    KMIGNEPSSELEWDEPLGRVPIFSYGSGHMLNDITSSCWFTYLLVFLTDVGLSPSDAAIV  116

Query  1455  TLVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT  1276
              L GQ AD FTTI  GELIDRFG FK+WH  G I+V +SF S+F G+C+PCK+ G++S T
Sbjct  117   MLSGQLADGFTTIFVGELIDRFGHFKLWHAGGSILVAISFSSVF-GSCLPCKLTGTNSST  175

Query  1275  VQTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVT  1096
             ++TVGY I A +F  GW+ TQ++HMSMVNC+T N +SR+A VSCRNAFTMVA+L LY + 
Sbjct  176   LETVGYSIFASIFNVGWAVTQVAHMSMVNCMTSNPTSRVALVSCRNAFTMVANLSLYGIA  235

Query  1095  FFVFT-NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTY  919
               +FT  ++  +  QYRW+A+ +I IG  FV+ F +G KEP   +    +K  S   W +
Sbjct  236   LLIFTLMHSVSVLVQYRWIAYTAISIGCCFVVAFLIGTKEP-GLNQPSQDKSLSRISWAH  294

Query  918   WLKRVLYYQVASIYVFTRVVTNVSQ------------------------------TFLAV  829
             W K+VLYYQVA +Y+ TR+VTNVSQ                               FLA 
Sbjct  295   WFKKVLYYQVALVYMCTRLVTNVSQFATCTLLTLFQALDYLMNAMYGKGHLLRIKAFLAF  354

Query  828   YVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVM  649
             YVINDL M QS+K+LVPAIIY+CS + SV+LQE  WSG RLK +F+ G ++W+L G  ++
Sbjct  355   YVINDLGMHQSSKALVPAIIYVCSLVVSVMLQETRWSGWRLKNYFSAGAMIWILSGIGIV  414

Query  648   LLPIKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGV  469
             LLP +M++FMY LS+ IG ANALM VTSI ME  LV + L+G AFVYGS+ FIDKV CG+
Sbjct  415   LLPSRMHNFMYVLSITIGAANALMTVTSISMEGVLVGEDLNGCAFVYGSLSFIDKVSCGI  474

Query  468   ALYFLESFEDADPVACNPAQAC-FSVTRFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQP  292
             ALY LES++ +  ++ N   A  +SVTR  LG +P + +L   IV+ TM L     +++P
Sbjct  475   ALYILESYQGSTKISENQELAYGYSVTRLGLGLVPAVFSLLSAIVAHTMDL--PEARRRP  532

Query  291   LAEPLLA  271
             L EPLLA
Sbjct  533   LVEPLLA  539



>ref|XP_004488576.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Cicer arietinum]
 ref|XP_004488577.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X2 [Cicer arietinum]
 ref|XP_004488578.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X3 [Cicer arietinum]
 ref|XP_004488579.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X4 [Cicer arietinum]
 ref|XP_004488580.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X5 [Cicer arietinum]
Length=451

 Score =   458 bits (1179),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 248/453 (55%), Positives = 321/453 (71%), Gaps = 18/453 (4%)
 Frame = -2

Query  1608  EEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQFADA  1429
             ++   KPLGR  V  YG+GHMLNDIT  CW+TYLLL+L+DIGLSP +AAIV L GQ AD 
Sbjct  8     DDTFTKPLGRWPVFYYGMGHMLNDITAACWFTYLLLFLSDIGLSPRNAAIVMLSGQVADG  67

Query  1428  FTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCIS  1249
             F T+  GELIDRFG FKIWHGAG I+V +SF S+FGG C+PC +  S+S   +TV Y + 
Sbjct  68    FATVFVGELIDRFGHFKIWHGAGSILVAISFSSVFGG-CLPCTVFTSNSIIFETVSYSVF  126

Query  1248  AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFT----  1081
             A +F  GW+ TQ+SHMSMV+CITLN +SR+A  SCRNAF+MVA+L LYAV   VF+    
Sbjct  127   AAIFNVGWAATQVSHMSMVSCITLNSTSRVALGSCRNAFSMVANLSLYAVALVVFSVVNG  186

Query  1080  NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVL  901
                 +++ QYRW+A++SIFIG  FV IFHL +KEPR K D  H K  +   W YW K VL
Sbjct  187   KTYANVENQYRWLAYVSIFIGCCFVGIFHLAIKEPRLKLDI-HGKARARISWAYWFKSVL  245

Query  900   YYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEW  721
             YYQVA IYV TR++ N+SQ +LA YVINDL M  S K+LVPA+IY+CSFI S+ LQE+ W
Sbjct  246   YYQVALIYVLTRLILNISQAYLAFYVINDLNMVPSTKALVPAMIYICSFIVSIALQEIAW  305

Query  720   SGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALV  541
             +GK LK+++  G I+W+ CGA ++LL   M+  MY  SV IGIANALM+VT +GM++ L+
Sbjct  306   TGKLLKVYYCVGCIIWIFCGAAILLLTKDMSYVMYIASVFIGIANALMLVTGVGMQNFLI  365

Query  540   DKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP----VACNPAQACFSVTRFSLGF  373
              ++L+G AFV GS+ F+DK+ CG+ALY L+S+++  P    V   P     S+TR  LG 
Sbjct  366   GENLNGCAFVVGSLSFLDKMSCGIALYVLQSYQNVSPQLKLVLFPP-----SITRLGLGL  420

Query  372   IPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             +P I AL GV+V+ TM   + S+   PL  PLL
Sbjct  421   VPAICALLGVVVTCTMDFHNPSN---PLTAPLL  450



>gb|KCW75596.1| hypothetical protein EUGRSUZ_E04336 [Eucalyptus grandis]
Length=401

 Score =   453 bits (1166),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 238/401 (59%), Positives = 300/401 (75%), Gaps = 13/401 (3%)
 Frame = -2

Query  1626  MGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLV  1447
             MG D   +   K +GR SV  YG GHMLNDIT  CW+TYLLL+LTDIGLSP  AA+V L 
Sbjct  5     MGDD---DSYSKSVGRWSVFYYGAGHMLNDITSACWFTYLLLFLTDIGLSPRDAAVVMLS  61

Query  1446  GQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
             GQ AD   TI +GELIDRFG FK+WH AG I+V +SF S+FGG CIPC I GSDS T++T
Sbjct  62    GQVADGLATIFSGELIDRFGHFKVWHLAGSILVAISFSSVFGG-CIPCNIFGSDSLTMET  120

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
             +GY + A +F  GW+ TQ+SHMSM+NCITLN +SR+   SCRNAFTMVA+L LYAV   V
Sbjct  121   IGYSVFAAIFNVGWAATQVSHMSMINCITLNSTSRVVLASCRNAFTMVANLSLYAVAGIV  180

Query  1086  FT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDD--GHEKIGSNTPW  925
             FT    N  +DI+ QYRW+A++SI +G  FV IFHLG +EPR K +   G++   +   W
Sbjct  181   FTTTSSNTHDDIENQYRWIAYLSIAVGCCFVGIFHLGTREPRLKANACVGNQ---ARISW  237

Query  924   TYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITS  745
              YW K+VLYYQVA +YV TR+V NVSQ +LA YVINDLRM QSAK+LVPA+IY+CSF  S
Sbjct  238   DYWFKKVLYYQVALVYVLTRLVVNVSQAYLAFYVINDLRMIQSAKALVPAVIYVCSFFVS  297

Query  744   VLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTS  565
             V+LQE+ W+G+RLK +++ GGILW+ CGA + LLP  M+ F+Y LS+ IG+ANALMMVT 
Sbjct  298   VMLQEVAWTGQRLKAYYSTGGILWVFCGAAIFLLPRNMSWFVYVLSIFIGVANALMMVTG  357

Query  564   IGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFE  442
             I M+S LV + L+G AFV GS+ F+DK+ CG+ LY L+S++
Sbjct  358   ISMQSVLVGEDLNGCAFVCGSLSFLDKMACGLTLYILQSYQ  398



>ref|XP_010506347.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X2 [Camelina sativa]
Length=450

 Score =   454 bits (1169),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 246/459 (54%), Positives = 325/459 (71%), Gaps = 23/459 (5%)
 Frame = -2

Query  1629  IMGRDNREEE-EEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVT  1453
             I+GR++ EE+   KPLGR SV  YGVGHMLNDIT  CW+TYLLL+LT IGLSP  AA+V 
Sbjct  6     IVGRNDEEEDPSTKPLGRLSVFYYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAVVM  65

Query  1452  LVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTV  1273
             L GQ AD F T+  GELIDRFG FKIWH AG ++V VSF S+FGG C+PC +L S+S TV
Sbjct  66    LSGQVADGFATVFVGELIDRFGHFKIWHAAGSLLVAVSFSSVFGG-CLPCTLLNSNSLTV  124

Query  1272  QTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
             +T+ Y + A +F  GW+ TQ+SHM+MVNCITLN +SR+A  S RNAF+MVA+L LYA+  
Sbjct  125   ETLSYSMFAAIFNIGWAATQVSHMAMVNCITLNSTSRVALTSSRNAFSMVANLGLYAIAL  184

Query  1092  FVF----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPW  925
              VF        E  + QYRW+A+ SI +G  FV+IF +G KEPR + D   E   +  PW
Sbjct  185   VVFGVSEAVTKESTECQYRWIAYSSITVGCCFVVIFLMGTKEPRLRIDL-KESCRARIPW  243

Query  924   TYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITS  745
             ++W +++LYYQVA +Y+ TR+V NVSQ            M+QSAK+L+PAIIY+CSF+ S
Sbjct  244   SHWFRKILYYQVAMVYLLTRLVLNVSQ------------MAQSAKALIPAIIYICSFVVS  291

Query  744   VLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTS  565
             V+LQE+ W+GKRLK ++  GGI+W+ CG  ++LL   +NS+MYA+S+ IGIANALM+VT+
Sbjct  292   VMLQEIPWNGKRLKAYYCAGGIIWIFCGVAILLLSRSINSYMYAISIFIGIANALMLVTA  351

Query  564   IGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP-VACNPAQA-CFSVT  391
             I M+S L+   L G AFV GS+ F+DK+ CG+ALY L+S +   P V  N  Q   FSVT
Sbjct  352   ISMQSVLIGSELGGCAFVCGSLSFLDKMSCGLALYVLQSHQSTSPKVDVNINQHFYFSVT  411

Query  390   RFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             R+ LG +P + +L GV+V++ M+L  T  K  PL +PLL
Sbjct  412   RYGLGLVPAVCSLIGVVVTYFMELDSTILK--PLRQPLL  448



>ref|XP_010512310.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X2 [Camelina sativa]
Length=444

 Score =   450 bits (1158),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 246/455 (54%), Positives = 314/455 (69%), Gaps = 24/455 (5%)
 Frame = -2

Query  1611  REEEE--EKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQF  1438
             R EE+   KP+GR SV  YGVGHMLNDIT  CW+TYLLL+LT IGLSP  AAIV L GQ 
Sbjct  4     RSEEDPFTKPIGRWSVFFYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAIVMLSGQV  63

Query  1437  ADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGY  1258
             AD F TI  GELIDRFG FKIWH AG ++V +SF S+FGG C+PC IL +DS T++T  Y
Sbjct  64    ADGFATIFTGELIDRFGHFKIWHAAGSLLVAISFSSVFGG-CLPCSILHNDSLTLETFSY  122

Query  1257  CISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF--  1084
              + A +F  GW+ TQ+SHM+MVNCI+LN +SR+A  SCRNAFTMV++L LYA+   VF  
Sbjct  123   SMFAAIFNIGWAATQVSHMAMVNCISLNSTSRVALTSCRNAFTMVSNLGLYAIALVVFGV  182

Query  1083  --TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLK  910
                 + ED +TQYRW+A  SI IG  FVIIF +G KEPR + D   E      PW YW +
Sbjct  183   IKAGSKEDTETQYRWIANSSISIGCCFVIIFLMGTKEPRLRLDL-KETSRVRIPWVYWFR  241

Query  909   RVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQE  730
             ++LYYQVA  Y             LA +VI+DL+M QSAK+LVPAIIY+CSF+ SVLLQE
Sbjct  242   KLLYYQVAMAY-------------LAFFVIDDLQMDQSAKALVPAIIYICSFVVSVLLQE  288

Query  729   LEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMES  550
             + W+G+RLK ++  GG++W+ CGA ++LLP  ++ FMYA+SV IGIANALMMVT+I M+S
Sbjct  289   IPWNGRRLKAYYTAGGVIWIFCGAAILLLPRNISFFMYAISVFIGIANALMMVTAISMQS  348

Query  549   ALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP---VACNPAQACFSVTRFSL  379
              L+   + G AFV GS+ F+DK+ CG+ALY L+S +   P   +  +   A  SVTR+ L
Sbjct  349   VLIGAEVGGCAFVCGSLSFLDKMSCGLALYVLQSHQSTSPRTQLNNHQQSAYLSVTRYGL  408

Query  378   GFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             G +P   +  GV V+F M+L       +PL EPLL
Sbjct  409   GLVPAFCSFVGVTVTFFMELGADGSLSKPLREPLL  443



>ref|XP_010257579.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X3 [Nelumbo nucifera]
 ref|XP_010257580.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X3 [Nelumbo nucifera]
 ref|XP_010257581.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X3 [Nelumbo nucifera]
Length=474

 Score =   450 bits (1157),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 236/396 (60%), Positives = 292/396 (74%), Gaps = 6/396 (2%)
 Frame = -2

Query  1608  EEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQFADA  1429
             EE   KPLGR SV  YGVGHMLNDIT  CW+TYLL++LTDIGL+P + A V L GQ AD 
Sbjct  8     EESWSKPLGRASVFYYGVGHMLNDITSACWFTYLLVFLTDIGLTPRNTATVMLSGQIADG  67

Query  1428  FTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCIS  1249
             FTTI AGELIDRFG FKIWHGAG ++V VSF S+FG  C+PCKI  ++S  + T+ Y   
Sbjct  68    FTTIFAGELIDRFGHFKIWHGAGSVLVAVSFSSVFG-ICLPCKIFRTNSSAILTISYSTF  126

Query  1248  AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTNNAE  1069
             A +F  GW+ TQ+SHMSMVNCITLN ++R+   SCRNAFTMVA+L LYAV   VF  +  
Sbjct  127   AAIFNVGWAATQVSHMSMVNCITLNPTTRVVLASCRNAFTMVANLSLYAVALTVFNVSKP  186

Query  1068  ----DIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVL  901
                 DI+ QYRW+A++SIFIG  FV IF +G KEPR K    H        W +W K+VL
Sbjct  187   RTPIDIENQYRWIAYLSIFIGCCFVSIFLIGTKEPRLKQGI-HGTSNHRISWAHWFKKVL  245

Query  900   YYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEW  721
             YYQVA +YV TR+VTNVSQ FLA YVINDL+M+QS+K+LVPAIIY+CS + SV+LQE+ W
Sbjct  246   YYQVAIVYVLTRLVTNVSQAFLAFYVINDLQMAQSSKALVPAIIYICSIVVSVILQEITW  305

Query  720   SGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALV  541
             +G+RLK FF  GG+LW+  GA ++ LP  M + MY LSV IG+ANALM VT + M+S LV
Sbjct  306   TGQRLKAFFTAGGVLWIFSGAGILFLPSTMQNLMYLLSVAIGVANALMTVTGVSMQSVLV  365

Query  540   DKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDAD  433
              + L+G AFVYGS+ F+DK+ CG+ALY LES +D +
Sbjct  366   GEDLNGCAFVYGSLSFLDKISCGLALYILESNQDIN  401



>ref|XP_010098646.1| hypothetical protein L484_002669 [Morus notabilis]
 gb|EXB75447.1| hypothetical protein L484_002669 [Morus notabilis]
Length=444

 Score =   447 bits (1151),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 244/458 (53%), Positives = 311/458 (68%), Gaps = 22/458 (5%)
 Frame = -2

Query  1626  MGRDNREEEE-EKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTL  1450
             MG ++ +++   KPLGR SV  YGVGHMLNDIT  CW+TYLL++LTDIGLSP  AA V L
Sbjct  1     MGNNSDDDDSFTKPLGRWSVFYYGVGHMLNDITASCWFTYLLIFLTDIGLSPRDAATVML  60

Query  1449  VGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQ  1270
              GQ AD F TI  GELIDRFG FK+WHGAG I+V +SF S+FGG C+PC + G+ S T++
Sbjct  61    SGQIADGFATIFTGELIDRFGHFKVWHGAGSILVAISFSSVFGG-CLPCTLFGTSSSTME  119

Query  1269  TVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFF  1090
             T+ Y   A +F  GW+ TQ+SHMSMVNCITLN +SR+   SCRNAFTMVA+L LYAV   
Sbjct  120   TISYSTFAAIFNVGWAATQVSHMSMVNCITLNSTSRVVLASCRNAFTMVANLSLYAVALV  179

Query  1089  VFTNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLK  910
             VF  N    KT               F     +GV+         H +I     W+YW K
Sbjct  180   VF--NVTTAKTHNNIENQFDQNNRFHFANRLKIGVQ------GSSHARIS----WSYWFK  227

Query  909   RVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQE  730
             R LYYQVA +Y+ TR+V NVSQ +LA YVINDLRM+QSAK+LVPAIIY+ SFI SV LQE
Sbjct  228   RALYYQVALVYMLTRLVVNVSQAYLAFYVINDLRMAQSAKALVPAIIYISSFIISVTLQE  287

Query  729   LEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMES  550
             + W+G RLK +F+ GG++W+ CG V+++LP  M+ FMY LS+ IG+ANALMMVT + M+S
Sbjct  288   VSWTGPRLKGYFSAGGMVWVFCGVVILILPKSMSGFMYILSIFIGVANALMMVTGVSMQS  347

Query  549   ALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP------VACNPAQACFSVTR  388
              L+D  L+G AFV GS+ F+DK+ CGVAL+ L+S+++ +        A N      S+TR
Sbjct  348   VLIDTDLNGCAFVCGSLSFLDKISCGVALFILQSYQNIERDVSSSMEAANSKPYHISITR  407

Query  387   FSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             F LG +P I +L  V V++TMKL H   K  PL +PLL
Sbjct  408   FGLGVVPAICSLVAVAVTYTMKLNHPLSK--PLVQPLL  443



>ref|XP_010257577.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Nelumbo nucifera]
Length=503

 Score =   449 bits (1156),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 236/396 (60%), Positives = 292/396 (74%), Gaps = 6/396 (2%)
 Frame = -2

Query  1608  EEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQFADA  1429
             EE   KPLGR SV  YGVGHMLNDIT  CW+TYLL++LTDIGL+P + A V L GQ AD 
Sbjct  37    EESWSKPLGRASVFYYGVGHMLNDITSACWFTYLLVFLTDIGLTPRNTATVMLSGQIADG  96

Query  1428  FTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCIS  1249
             FTTI AGELIDRFG FKIWHGAG ++V VSF S+FG  C+PCKI  ++S  + T+ Y   
Sbjct  97    FTTIFAGELIDRFGHFKIWHGAGSVLVAVSFSSVFG-ICLPCKIFRTNSSAILTISYSTF  155

Query  1248  AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTNNAE  1069
             A +F  GW+ TQ+SHMSMVNCITLN ++R+   SCRNAFTMVA+L LYAV   VF  +  
Sbjct  156   AAIFNVGWAATQVSHMSMVNCITLNPTTRVVLASCRNAFTMVANLSLYAVALTVFNVSKP  215

Query  1068  ----DIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVL  901
                 DI+ QYRW+A++SIFIG  FV IF +G KEPR K    H        W +W K+VL
Sbjct  216   RTPIDIENQYRWIAYLSIFIGCCFVSIFLIGTKEPRLKQGI-HGTSNHRISWAHWFKKVL  274

Query  900   YYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEW  721
             YYQVA +YV TR+VTNVSQ FLA YVINDL+M+QS+K+LVPAIIY+CS + SV+LQE+ W
Sbjct  275   YYQVAIVYVLTRLVTNVSQAFLAFYVINDLQMAQSSKALVPAIIYICSIVVSVILQEITW  334

Query  720   SGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALV  541
             +G+RLK FF  GG+LW+  GA ++ LP  M + MY LSV IG+ANALM VT + M+S LV
Sbjct  335   TGQRLKAFFTAGGVLWIFSGAGILFLPSTMQNLMYLLSVAIGVANALMTVTGVSMQSVLV  394

Query  540   DKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDAD  433
              + L+G AFVYGS+ F+DK+ CG+ALY LES +D +
Sbjct  395   GEDLNGCAFVYGSLSFLDKISCGLALYILESNQDIN  430



>gb|KDO46032.1| hypothetical protein CISIN_1g011925mg [Citrus sinensis]
Length=416

 Score =   445 bits (1145),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 230/405 (57%), Positives = 301/405 (74%), Gaps = 13/405 (3%)
 Frame = -2

Query  1629  IMGRDNREEEE-EKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVT  1453
             +M  D   ++   +P+GR SVL YG GHMLNDIT  CW+TYLLL+LTDIGLSP  AA V 
Sbjct  6     VMNYDIENDDSFTQPVGRWSVLYYGSGHMLNDITAACWFTYLLLFLTDIGLSPRGAAAVM  65

Query  1452  LVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTV  1273
             L GQ AD F TI  GELIDRFG FKIWHGAG ++V VSF S+FGG C+PC+IL + +  V
Sbjct  66    LSGQIADGFATIFIGELIDRFGHFKIWHGAGSVLVAVSFSSVFGG-CMPCRILSTSTLKV  124

Query  1272  QTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
             +T+ YC+ A +F  GW+ TQ++HMSMVNCITLN +SR+   SCRNAFTMVA+L LYA+ F
Sbjct  125   ETISYCVFAAIFNVGWAATQVAHMSMVNCITLNSTSRVVLTSCRNAFTMVANLSLYAIAF  184

Query  1092  FVFT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKK---DDDGHEKIGSN  934
              VF+        D++ QYRW+A+ SIFIG  FV IF    +EPR K     + H +I   
Sbjct  185   IVFSVSTAKTHADLENQYRWIAYSSIFIGCCFVGIFLSRTEEPRLKMGLRGNSHARI---  241

Query  933   TPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSF  754
               W YW K++LYYQVA +Y+ TR+V NVSQ +LA YVINDLRM QSAK+LVPAIIY+CSF
Sbjct  242   -SWAYWFKKILYYQVALVYMLTRLVVNVSQAYLAFYVINDLRMGQSAKALVPAIIYICSF  300

Query  753   ITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMM  574
             I S+LLQE+ W+G+RLK +++ GG+LW+ CGA +++LP+ M++FMY L++ +GIANALMM
Sbjct  301   IVSILLQEMAWTGQRLKAYYSAGGVLWVFCGAGILILPMNMSAFMYVLAIFVGIANALMM  360

Query  573   VTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFED  439
             VT I M++ LV + L G AFV G++ F+DK+ CG+A+Y L+S++ 
Sbjct  361   VTGISMQNVLVGEDLSGCAFVCGTLSFLDKMSCGIAVYVLQSYQS  405



>ref|NP_001049086.1| Os03g0168000 [Oryza sativa Japonica Group]
 gb|AAL84289.1|AC073556_6 putative sugar transport protein [Oryza sativa Japonica Group]
 gb|ABF94177.1| lactose permease, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11000.1| Os03g0168000 [Oryza sativa Japonica Group]
 dbj|BAG93194.1| unnamed protein product [Oryza sativa Japonica Group]
Length=457

 Score =   446 bits (1148),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 231/443 (52%), Positives = 321/443 (72%), Gaps = 8/443 (2%)
 Frame = -2

Query  1617  DNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQF  1438
             D    E + PLGR  +L+YGVGHMLNDIT  CW+TYLLL+L +IGL+P  AAIV L GQ 
Sbjct  7     DEVLAEGQMPLGRWPILSYGVGHMLNDITSACWFTYLLLFLQEIGLAPRDAAIVMLSGQV  66

Query  1437  ADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGY  1258
             AD   TI+AGE+IDRFG FK+WH  G I+VG+SF S+FGG C+ C +LG+DS  V+T+GY
Sbjct  67    ADGLMTILAGEMIDRFGHFKLWHIGGSILVGISFSSVFGG-CLLCTVLGTDSYLVRTIGY  125

Query  1257  CISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFT-  1081
                A VF  GW+ TQ+SHMSMVNC+TLN +SR+A  SCRNAFTMVA+L LYA+   VF  
Sbjct  126   SFFAAVFNIGWAATQVSHMSMVNCMTLNSTSRVALASCRNAFTMVANLGLYAIALVVFAL  185

Query  1080  ---NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLK  910
                    DI  QYRW+A++SIF+G  F+++F+ G KEP  +     +K  +   W YW K
Sbjct  186   VSAKACSDIVLQYRWIAYVSIFVGCCFLVVFYAGTKEPTLQSGSDCKK-SARISWGYWFK  244

Query  909   RVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQE  730
             + LYYQVA +Y+  R++TNVSQ+ +A YV  DL+M++ +K+++PAII+ CSF+ SV+LQE
Sbjct  245   KALYYQVALLYMLARLITNVSQSLIAFYVTRDLKMNEYSKAIIPAIIFCCSFLVSVVLQE  304

Query  729   LEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMES  550
             ++W+ +RLK     G ILW++ GA V +LP +M++ MY L+++IG ANAL+MVT+IG+ES
Sbjct  305   IKWNSRRLKSLLTIGAILWVIAGAAVFVLPSQMHNLMYPLAMVIGAANALVMVTTIGLES  364

Query  549   ALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRFSLGFI  370
             ALV   L+G AFVYGS+ F+DK+ CG+AL+ LES+ED+  ++C   +  ++V+RF  G I
Sbjct  365   ALVGDDLNGCAFVYGSLSFLDKMSCGIALFVLESYEDS--ISCGETRGLYTVSRFGTGLI  422

Query  369   PGIAALFGVIVSFTMKLLHTSHK  301
             P   A+F ++V+ T+KL  T+ +
Sbjct  423   PSCFAVFALLVTSTLKLQDTNPR  445



>ref|XP_004985573.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Setaria italica]
Length=458

 Score =   445 bits (1144),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 231/450 (51%), Positives = 321/450 (71%), Gaps = 9/450 (2%)
 Frame = -2

Query  1608  EEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQFADA  1429
             E +  +PLGR  +L+YGVGHMLNDIT  CW+TYLLL+L  IGL+P  AA+V L GQ AD 
Sbjct  12    EAQVAQPLGRWPILSYGVGHMLNDITSACWFTYLLLFLQQIGLAPRDAAVVMLSGQVADG  71

Query  1428  FTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCIS  1249
               TI+AGE+IDRFG+FK+WH  G ++VGVSF S+FGG C+ C ILG+DS  V+TVGY   
Sbjct  72    LMTILAGEMIDRFGRFKLWHIGGSVLVGVSFSSVFGG-CLLCTILGTDSYLVRTVGYSFF  130

Query  1248  AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF----T  1081
             A VF  GW+ TQ+SHMSMVNC+TLN +SR+A  SCRNAFTMVA+L LYA+   VF     
Sbjct  131   AAVFNIGWAATQVSHMSMVNCMTLNPTSRVALASCRNAFTMVANLGLYAIALGVFGVIKA  190

Query  1080  NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVL  901
                 DI  QYRW+A++SIF+G  F+++FH+G KEP  K +   +K  +   W YW K+ L
Sbjct  191   KECSDIVLQYRWIAYLSIFLGCCFLVVFHIGTKEPTLKSESNCKK-NARISWGYWFKKTL  249

Query  900   YYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEW  721
             YYQVA +Y+  R++TNVSQ+ +A YV  DLRM++ +K+ +PAII+ CSF+ S++LQE++W
Sbjct  250   YYQVALLYMLARLITNVSQSLIAFYVTRDLRMNEYSKATIPAIIFCCSFVVSIVLQEIKW  309

Query  720   SGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALV  541
             + +RLK     G  LW++ G  V +LP +M++ MY L+++IG+ANAL+MVT++G+ESALV
Sbjct  310   NSRRLKSLLTVGATLWVISGVAVFVLPSQMHNLMYPLAMVIGVANALLMVTTVGLESALV  369

Query  540   DKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRFSLGFIPGI  361
              + L+G AFVYGS+ F+DK+ CG+AL+ LES+ED   ++C   +   +V+R+  G IP  
Sbjct  370   GEDLNGCAFVYGSLSFLDKISCGIALFVLESYEDT--MSCGETRGLNTVSRYGTGLIPSC  427

Query  360   AALFGVIVSFTMKLLHTSH-KKQPLAEPLL  274
              AL  ++V+ T++L   +      L  PLL
Sbjct  428   FALLSLVVTSTLRLQDAATPTAAALEAPLL  457



>ref|XP_006649460.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Oryza brachyantha]
Length=459

 Score =   442 bits (1138),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 235/456 (52%), Positives = 320/456 (70%), Gaps = 12/456 (3%)
 Frame = -2

Query  1617  DNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQF  1438
             D    E + PLGR  +L+YGVGHMLNDIT  CW+TYLLL+L +IGL+P  AAIV L GQ 
Sbjct  7     DEVLAETQMPLGRWPILSYGVGHMLNDITSACWFTYLLLFLQEIGLAPRDAAIVMLSGQA  66

Query  1437  ADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGY  1258
             AD   TI+AGE+IDRFG FK+WH  G ++VG+SF S+FGG C+ C ILG+DS  V+TVGY
Sbjct  67    ADGLMTILAGEMIDRFGHFKLWHIGGSVLVGISFSSVFGG-CLLCTILGTDSYLVRTVGY  125

Query  1257  CISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFT-  1081
                A VF  GW+ TQ+SHMSMVNC+TLN +SR+A  SCRNAFTMVA+L LY +   VF  
Sbjct  126   SFFAAVFNIGWAATQVSHMSMVNCMTLNSTSRVALASCRNAFTMVANLGLYGIALTVFAL  185

Query  1080  ---NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLK  910
                    DI  QYRW+A++SIF+G  F+++F+ G KEP  +     +K  S   W YW K
Sbjct  186   VSAKACSDIVLQYRWIAYVSIFVGCCFLVVFYAGTKEPTLQSGTDCKK-SSRISWGYWFK  244

Query  909   RVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQE  730
             + LYYQVA +Y+  R++TNVSQ+ +A YV  DLRM++ +K+++PAII+ CSF+ SV+LQE
Sbjct  245   KTLYYQVALLYMLARLITNVSQSLIAFYVTRDLRMNEYSKAIIPAIIFCCSFLVSVVLQE  304

Query  729   LEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMES  550
             ++W+ +RLK     G ILW++ G  V +LP + N+ MY L+++IG ANAL+MVT+IG+ES
Sbjct  305   IKWNSRRLKSLLTIGAILWVISGVAVFVLPSQRNNLMYPLAMVIGAANALVMVTTIGLES  364

Query  549   ALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRFSLGFI  370
             +LV   L+GSAFVYGS+ F+DK+ CG+AL+ LES+E++  ++C   +   +V+R+  G I
Sbjct  365   SLVGDDLNGSAFVYGSLSFLDKMSCGIALFVLESYEES--ISCGETRGLNTVSRYGTGLI  422

Query  369   PGIAALFGVIVSFTMKLLHT----SHKKQPLAEPLL  274
             P   A+  +IV+ T+KL  T     H    L  PLL
Sbjct  423   PSCFAVVALIVTSTLKLQDTPTRRPHSSAALEAPLL  458



>gb|KDO46024.1| hypothetical protein CISIN_1g011925mg [Citrus sinensis]
Length=445

 Score =   441 bits (1134),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 245/476 (51%), Positives = 314/476 (66%), Gaps = 61/476 (13%)
 Frame = -2

Query  1629  IMGRDNREEEE-EKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVT  1453
             +M  D   ++   +P+GR SVL YG GHMLNDIT  CW+TYLLL+LTDIGLSP  AA V 
Sbjct  6     VMNYDIENDDSFTQPVGRWSVLYYGSGHMLNDITAACWFTYLLLFLTDIGLSPRGAAAVM  65

Query  1452  LVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTV  1273
             L GQ AD F TI  GELIDRFG FKIWHGAG ++V VSF S+FG                
Sbjct  66    LSGQIADGFATIFIGELIDRFGHFKIWHGAGSVLVAVSFSSVFG----------------  109

Query  1272  QTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
                            W+ TQ++HMSMVNCITLN +SR+   SCRNAFTMVA+L LYA+ F
Sbjct  110   ---------------WAATQVAHMSMVNCITLNSTSRVVLTSCRNAFTMVANLSLYAIAF  154

Query  1092  FVFT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKK---DDDGHEKIGSN  934
              VF+        D++ QYRW+A+ SIFIG  FV IF    +EPR K     + H +I   
Sbjct  155   IVFSVSTAKTHADLENQYRWIAYSSIFIGCCFVGIFLSRTEEPRLKMGLRGNSHARI---  211

Query  933   TPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSF  754
               W YW K++LYYQVA +Y+ TR+V NVSQ +LA YVINDLRM QSAK+LVPAIIY+CSF
Sbjct  212   -SWAYWFKKILYYQVALVYMLTRLVVNVSQAYLAFYVINDLRMGQSAKALVPAIIYICSF  270

Query  753   ITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMM  574
             I S+LLQE+ W+G+RLK +++ GG+LW+ CGA +++LP+ M++FMY L++ +GIANALMM
Sbjct  271   IVSILLQEMAWTGQRLKAYYSAGGVLWVFCGAGILILPMNMSAFMYVLAIFVGIANALMM  330

Query  573   VTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNP-------  415
             VT I M++ LV + L G AFV G++ F+DK+ CG+A+Y L+S++   P   +        
Sbjct  331   VTGISMQNVLVGEDLSGCAFVCGTLSFLDKMSCGIAVYVLQSYQSMSPTVLDNNSSITSL  390

Query  414   ---------AQACFSVTRFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
                      + +  SVTRF LG IP I +L  V V+FTMK LHT + K PL EPLL
Sbjct  391   TVLDNNSLISTSYISVTRFGLGLIPAICSLVSVAVTFTMK-LHTPYSK-PLVEPLL  444



>gb|ACN27923.1| unknown [Zea mays]
Length=446

 Score =   440 bits (1131),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 232/446 (52%), Positives = 316/446 (71%), Gaps = 7/446 (2%)
 Frame = -2

Query  1599  EEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQFADAFTT  1420
             E +PLGR  VL+YGVGHMLNDIT  CW+TYLLL+L  IGL+P +AA+V L GQ AD   T
Sbjct  3     EAQPLGRWPVLSYGVGHMLNDITSACWFTYLLLFLQQIGLAPRAAAVVMLSGQVADGLMT  62

Query  1419  IIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAVV  1240
             I+AGE+IDRFG+FK+WH  G ++VG SF S+FGG C+ C ILG+DS  V+TVGY   A V
Sbjct  63    ILAGEMIDRFGRFKLWHIGGSVLVGFSFSSVFGG-CLLCTILGTDSYLVRTVGYSFFAAV  121

Query  1239  FCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF----TNNA  1072
             F  GW+ TQ+SHMSMVNC+TLN +SR+A  SCRNA TMVA+L LY +   VF        
Sbjct  122   FNVGWAATQVSHMSMVNCMTLNPTSRVALASCRNASTMVANLGLYGIALGVFGAIKAKEY  181

Query  1071  EDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVLYYQ  892
              DI TQYRW+A++SIFIG  F+++FH G KEP  K +   +K  +   W YW K+ LYYQ
Sbjct  182   SDIVTQYRWIAYLSIFIGCCFLVVFHAGTKEPTLKSEPSCKK-AARISWGYWFKKTLYYQ  240

Query  891   VASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGK  712
             VA +Y+  R++TNVSQ+ +A YV  DLRM++ +K+++PAII+ CSF  S++LQE++W+ +
Sbjct  241   VALLYMLARLITNVSQSLIAFYVTRDLRMNEYSKAIIPAIIFCCSFFVSIVLQEIKWTSR  300

Query  711   RLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALVDKH  532
             RLK     G  LW++ G  V +LP +MNS MY L+++IG ANAL+MVT+IG+E ALV + 
Sbjct  301   RLKSLLTVGATLWVISGVAVFVLPSQMNSLMYPLAMVIGAANALVMVTTIGLEGALVGED  360

Query  531   LDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRFSLGFIPGIAAL  352
             L+G AFVYGS+ F+DK+ CG+AL+ LES+ED   V+    +   +V+R+  G IP   A+
Sbjct  361   LNGCAFVYGSLSFLDKISCGIALFALESYEDT-MVSYGETRGLNTVSRYGTGLIPSCFAV  419

Query  351   FGVIVSFTMKLLHTSHKKQPLAEPLL  274
               ++V+ T++L   + +   L  PLL
Sbjct  420   LSLVVTSTLRLQDDTPRAAALDAPLL  445



>ref|XP_002468443.1| hypothetical protein SORBIDRAFT_01g046010 [Sorghum bicolor]
 gb|EER95441.1| hypothetical protein SORBIDRAFT_01g046010 [Sorghum bicolor]
Length=455

 Score =   439 bits (1130),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 230/444 (52%), Positives = 316/444 (71%), Gaps = 8/444 (2%)
 Frame = -2

Query  1593  KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQFADAFTTII  1414
             +PLGR  VL+YGVGHMLNDIT  CW+TYLLL+L  IGL+P  AA+V L GQ AD   TI+
Sbjct  15    QPLGRWPVLSYGVGHMLNDITSACWFTYLLLFLQQIGLAPRDAAVVMLSGQVADGLMTIL  74

Query  1413  AGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAVVFC  1234
             AGE+IDRFG+FK+WH  G ++VG SF S+FGG C+ C ILG+DS  V+TVGY   A VF 
Sbjct  75    AGEMIDRFGRFKLWHIGGSVLVGFSFSSVFGG-CLLCTILGTDSYLVRTVGYSFFAAVFN  133

Query  1233  SGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF----TNNAED  1066
              GW+ TQ+SHMSMVNC+TLN +SR+A  SCRNAFTMVA+L LY +   VF         D
Sbjct  134   IGWAATQVSHMSMVNCMTLNPTSRVALASCRNAFTMVANLGLYGIALAVFGAIKAKECSD  193

Query  1065  IKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVLYYQVA  886
             I  QYRW+A++SIFIG  F+++FH+G KEP  K +   +K  +   W YW K+ LYYQVA
Sbjct  194   IVIQYRWIAYLSIFIGCCFLVVFHVGTKEPTLKSEPNCKK-KARISWGYWFKKTLYYQVA  252

Query  885   SIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRL  706
              +Y+  R++TNVSQ+ +A YV  DLRM++ +K+++PAII+ CSF  S++LQE++W+ +RL
Sbjct  253   LLYMLARLITNVSQSLIAFYVTRDLRMNEYSKAIIPAIIFCCSFFVSIVLQEIKWNSRRL  312

Query  705   KIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLD  526
             K     G  LW++ G  V +LP +M++ MY L+++IG ANAL+MVT++G+ESALV + L+
Sbjct  313   KSLLTVGATLWVISGVAVFVLPSEMHNLMYPLAMVIGAANALVMVTTVGLESALVGEDLN  372

Query  525   GSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRFSLGFIPGIAALFG  346
             G AFVYGS+ F+DK+ CG+AL+ LES+ED   ++C   +   +V+R+  G IP   A+  
Sbjct  373   GCAFVYGSLSFLDKISCGIALFVLESYEDT--MSCGEKRGLNTVSRYGTGLIPSCFAVIS  430

Query  345   VIVSFTMKLLHTSHKKQPLAEPLL  274
             ++V+ T++L   S     L  PLL
Sbjct  431   LVVASTLRLQDASPTAAALEAPLL  454



>ref|XP_006842769.1| hypothetical protein AMTR_s00133p00099940 [Amborella trichopoda]
 gb|ERN04444.1| hypothetical protein AMTR_s00133p00099940 [Amborella trichopoda]
Length=410

 Score =   436 bits (1120),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 225/404 (56%), Positives = 293/404 (73%), Gaps = 17/404 (4%)
 Frame = -2

Query  1617  DNRE-----EEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVT  1453
             DN E     +   +PLGRCS   YGVGHMLNDIT  CW+TY+LL+LT+IGLSP  AA V 
Sbjct  4     DNEETCSADDVGNRPLGRCSAFYYGVGHMLNDITSSCWFTYILLFLTEIGLSPRDAATVM  63

Query  1452  LVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTV  1273
             L GQ AD  TTI  GELIDRFG+FK+WH  G I+V +SF S+FG  C+ C++LG DSPT+
Sbjct  64    LSGQVADGVTTIFVGELIDRFGRFKLWHAGGSILVAISFSSVFGD-CLSCEVLGIDSPTL  122

Query  1272  QTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
             +T+GY I A +F  GW+ TQ+SHMSMVNCITLN +SR+A  SCRNAFTMVA+L LY + F
Sbjct  123   RTIGYSIFAAIFNVGWAATQVSHMSMVNCITLNSTSRVALTSCRNAFTMVANLSLYTIAF  182

Query  1092  FVFT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDD---GHEKIGSN  934
              VF       ++ I+ QYRW+A+ SIF+G  FV +F  G KEPR K       H+++   
Sbjct  183   VVFKVINGTTSDGIEKQYRWIAYFSIFVGSCFVCLFLFGTKEPRLKQHSPRRSHQRV---  239

Query  933   TPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSF  754
               W YW +++LYYQVA +YV TR+ TNVSQ  LA YVI+DL M+QS+K+ +PAIIY+CSF
Sbjct  240   -LWNYWFQKILYYQVALVYVLTRLATNVSQALLAFYVIDDLHMTQSSKASIPAIIYICSF  298

Query  753   ITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMM  574
             + SV LQE EW+G+RLK  F  G ILW+  GA +++LP KM +F+Y +++ IG++NA M 
Sbjct  299   MASVTLQEFEWTGRRLKSIFTAGAILWIFSGAGILILPSKMCNFLYIIAIFIGVSNAFMT  358

Query  573   VTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFE  442
             VT++GMES LV + L+G AFVYGS+ F+DK+ CG+ALY LE + 
Sbjct  359   VTAVGMESFLVGRDLNGCAFVYGSLSFLDKISCGIALYTLELYH  402



>ref|NP_001142591.1| hypothetical protein [Zea mays]
 ref|XP_008658341.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF84927.1| unknown [Zea mays]
 gb|ACG25362.1| hypothetical protein [Zea mays]
 gb|AFW89570.1| hypothetical protein ZEAMMB73_523053 [Zea mays]
 gb|AFW89571.1| hypothetical protein ZEAMMB73_523053 [Zea mays]
 gb|AFW89572.1| hypothetical protein ZEAMMB73_523053 [Zea mays]
Length=457

 Score =   437 bits (1124),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 231/444 (52%), Positives = 315/444 (71%), Gaps = 7/444 (2%)
 Frame = -2

Query  1593  KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQFADAFTTII  1414
             +PLGR  VL+YGVGHMLNDIT  CW+TYLLL+L  IGL+P +AA+V L GQ AD   TI+
Sbjct  16    QPLGRWPVLSYGVGHMLNDITSACWFTYLLLFLQQIGLAPRAAAVVMLSGQVADGLMTIL  75

Query  1413  AGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAVVFC  1234
             AGE+IDRFG+FK+WH  G ++VG SF S+FGG C+ C ILG+DS  V+TVGY   A VF 
Sbjct  76    AGEMIDRFGRFKLWHIGGSVLVGFSFSSVFGG-CLLCTILGTDSYLVRTVGYSFFAAVFN  134

Query  1233  SGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF----TNNAED  1066
              GW+ TQ+SHMSMVNC+TLN +SR+A  SCRNA TMVA+L LY +   VF         D
Sbjct  135   VGWAATQVSHMSMVNCMTLNPTSRVALASCRNASTMVANLGLYGIALGVFGAIKAKEYSD  194

Query  1065  IKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVLYYQVA  886
             I TQYRW+A++SIFIG  F+++FH G KEP  K +   +K  +   W YW K+ LYYQVA
Sbjct  195   IVTQYRWIAYLSIFIGCCFLVVFHAGTKEPTLKSEPSCKK-AARISWGYWFKKTLYYQVA  253

Query  885   SIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRL  706
              +Y+  R++TNVSQ+ +A YV  DLRM++ +K+++PAII+ CSF  S++LQE++W+ +RL
Sbjct  254   LLYMLARLITNVSQSLIAFYVTRDLRMNEYSKAIIPAIIFCCSFFVSIVLQEIKWTSRRL  313

Query  705   KIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLD  526
             K     G  LW++ G  V +LP +MNS MY L+++IG ANAL+MVT+IG+E ALV + L+
Sbjct  314   KSLLTVGATLWVISGVAVFVLPSQMNSLMYPLAMVIGAANALVMVTTIGLEGALVGEDLN  373

Query  525   GSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRFSLGFIPGIAALFG  346
             G AFVYGS+ F+DK+ CG+AL+ LES+ED   V+    +   +V+R+  G IP   A+  
Sbjct  374   GCAFVYGSLSFLDKISCGIALFALESYEDT-MVSYGETRGLNTVSRYGTGLIPSCFAVLS  432

Query  345   VIVSFTMKLLHTSHKKQPLAEPLL  274
             ++V+ T++L   + +   L  PLL
Sbjct  433   LVVTSTLRLQDDTPRAAALDAPLL  456



>gb|EAY88695.1| hypothetical protein OsI_10171 [Oryza sativa Indica Group]
Length=472

 Score =   436 bits (1121),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 232/458 (51%), Positives = 323/458 (71%), Gaps = 23/458 (5%)
 Frame = -2

Query  1617  DNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQF  1438
             D    E + PLGR  +L+YGVGHMLNDIT  CW+TYLLL+L +IGL+P  AAIV L GQ 
Sbjct  7     DEVLAEGQMPLGRWPILSYGVGHMLNDITSACWFTYLLLFLQEIGLAPRDAAIVMLSGQV  66

Query  1437  ADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGY  1258
             AD   TI+AGE+IDRFG FK+WH  G I+VG+SF S+FGG C+ C +LG+DS  V+T+GY
Sbjct  67    ADGLMTILAGEMIDRFGHFKLWHIGGSILVGISFSSVFGG-CLLCTVLGTDSYLVRTIGY  125

Query  1257  CISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFT-  1081
                A VF  GW+ TQ+SHMSMVNC+TLN +SR+A  SCRNAFTMVA+L LYA+   VF  
Sbjct  126   SFFAAVFNIGWAATQVSHMSMVNCMTLNSTSRVALASCRNAFTMVANLGLYAIALVVFAL  185

Query  1080  ---NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLK  910
                    DI  QYRW+A++SIF+G  F+++F+ G +EP  +     +K  +   W YW K
Sbjct  186   VSAKACSDIVLQYRWIAYVSIFVGCCFLVVFYAGTREPTLQSGSDCKK-SARISWGYWFK  244

Query  909   RVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQE  730
             + LYYQVA +Y+  R++TNVSQ+ +A YV  DL+M++ +K+++PAII+ CSF+ SV+LQE
Sbjct  245   KALYYQVALLYMLARLITNVSQSLIAFYVTRDLKMNEYSKAIIPAIIFCCSFLVSVVLQE  304

Query  729   LEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMES  550
             ++W+ +RLK     G ILW++ GA V +LP +M++ MY L+++IG ANAL+MVT+IG+ES
Sbjct  305   IKWNSRRLKSLLTIGAILWVIAGAAVFVLPSQMHNLMYPLAMVIGAANALVMVTTIGLES  364

Query  549   ALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQ-------------  409
             ALV   L+G AFVYGS+ F+DK+ CG+AL+ LES+ED+  ++C   +             
Sbjct  365   ALVGDDLNGCAFVYGSLSFLDKMSCGIALFVLESYEDS--ISCGETRGLYTVSRFGTGLI  422

Query  408   -ACF-SVTRFSLGFIPGIAALFGVIVSFTMKLLHTSHK  301
              +CF +V+RF  G IP   A+F ++V+ T+KL  T+ +
Sbjct  423   PSCFATVSRFGTGLIPSCFAVFALLVTSTLKLQDTNPR  460



>ref|XP_010243429.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X2 [Nelumbo nucifera]
Length=406

 Score =   434 bits (1115),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 227/392 (58%), Positives = 293/392 (75%), Gaps = 6/392 (2%)
 Frame = -2

Query  1605  EEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQFADAF  1426
             E   +PLGR SV  YGVGHMLND+T  CW+TYLL++LTDIGL P  AA + L GQ AD F
Sbjct  5     ESCTRPLGRGSVFCYGVGHMLNDVTAACWFTYLLVFLTDIGLPPRDAATIMLSGQIADGF  64

Query  1425  TTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISA  1246
              TI +GELIDRFG FKI H AG ++V +SF S+FG  C+PCKI  +DS T++TVGY I A
Sbjct  65    ATIFSGELIDRFGHFKICHIAGSVLVAISFSSVFG-VCVPCKIFKTDSATMETVGYSIFA  123

Query  1245  VVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFT----N  1078
              +F  GW+ TQ+SHMSMVNC+TLN +SR+A  SCRNAFTMVA+L L+AV   VF      
Sbjct  124   AIFNVGWAATQVSHMSMVNCMTLNPTSRVALASCRNAFTMVANLSLFAVALAVFNLSKPK  183

Query  1077  NAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVLY  898
                DI+ QYRW+A++SI IG  FV IF +G KEPR + +   + +     W  W K+VLY
Sbjct  184   TPVDIENQYRWIAYLSILIGCCFVGIFLVGTKEPRLRQEIEGKSL-HRISWKDWFKKVLY  242

Query  897   YQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEWS  718
             YQVA +Y+ TR+VTNVSQ  LA YVINDL+M+QS+K++VPAIIY+ SF+ SV+LQE++W+
Sbjct  243   YQVALVYMLTRLVTNVSQALLAFYVINDLQMAQSSKAIVPAIIYIFSFVVSVILQEMKWT  302

Query  717   GKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALVD  538
             G+R+K FF  GGILW+  GA + LLP  +++ MY LSV+IG+ANALM VT I M+S LV 
Sbjct  303   GQRIKAFFTAGGILWIFSGAGIFLLPSSLHNLMYLLSVIIGVANALMTVTGISMQSVLVG  362

Query  537   KHLDGSAFVYGSMGFIDKVLCGVALYFLESFE  442
             + ++GSAFVYGS+ F+DKV CG+ALY +ES++
Sbjct  363   EDINGSAFVYGSLSFLDKVSCGIALYVIESYQ  394



>gb|ACF84597.1| unknown [Zea mays]
Length=457

 Score =   435 bits (1118),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 230/444 (52%), Positives = 314/444 (71%), Gaps = 7/444 (2%)
 Frame = -2

Query  1593  KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQFADAFTTII  1414
             +PLGR  VL+YGVGHMLNDIT  CW+TYLLL+L  IGL+P +AA+V L GQ AD   TI+
Sbjct  16    QPLGRWPVLSYGVGHMLNDITSACWFTYLLLFLQQIGLAPRAAAVVMLSGQVADGLMTIL  75

Query  1413  AGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAVVFC  1234
             AGE+IDRFG+FK+WH  G ++VG SF S+FGG C+ C ILG+DS  V+TVGY   A VF 
Sbjct  76    AGEMIDRFGRFKLWHIGGSVLVGFSFSSVFGG-CLLCTILGTDSYLVRTVGYSFFAAVFN  134

Query  1233  SGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF----TNNAED  1066
              GW+ TQ+SHMSMVNC+TLN +SR+A  SCRNA TMVA+L LY +   VF         D
Sbjct  135   VGWAATQVSHMSMVNCMTLNPTSRVALASCRNASTMVANLGLYGIALGVFGAIKAKEYSD  194

Query  1065  IKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVLYYQVA  886
             I TQYRW+A++SIFIG  F+++FH G KEP  K +   +K  +   W YW K+ LYYQVA
Sbjct  195   IVTQYRWIAYLSIFIGCCFLVVFHAGTKEPTLKSEPSCKK-AARISWGYWFKKTLYYQVA  253

Query  885   SIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRL  706
              +Y+  R++TNVSQ+ +A YV  DLRM++ +K+++PAII+ CSF  S++LQE++W+ +RL
Sbjct  254   LLYMLARLITNVSQSLIAFYVTRDLRMNEYSKAIIPAIIFCCSFFVSIVLQEIKWTSRRL  313

Query  705   KIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLD  526
             K     G  LW++ G  V +LP +MNS MY L+++IG ANA +MVT+IG+E ALV + L+
Sbjct  314   KSLLTVGATLWVISGVAVFVLPSQMNSLMYPLAMVIGAANAPVMVTTIGLEGALVGEDLN  373

Query  525   GSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRFSLGFIPGIAALFG  346
             G AFVYGS+ F+DK+ CG+AL+ LES+ED   V+    +   +V+R+  G IP   A+  
Sbjct  374   GCAFVYGSLSFLDKISCGIALFALESYEDT-MVSYGETRGLNTVSRYGTGLIPSCFAVLS  432

Query  345   VIVSFTMKLLHTSHKKQPLAEPLL  274
             ++V+ T++L   + +   L  PLL
Sbjct  433   LVVTSTLRLQDDTPRAAALDAPLL  456



>dbj|BAJ97104.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=461

 Score =   433 bits (1113),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 227/439 (52%), Positives = 314/439 (72%), Gaps = 8/439 (2%)
 Frame = -2

Query  1623  GRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVG  1444
             G+   E E   PLGR  VL+YGVGHMLNDIT  CW+TYLLL+L +IGL+P  AAIV L G
Sbjct  4     GKCGEEVEVAAPLGRWPVLSYGVGHMLNDITSACWFTYLLLFLQEIGLAPRDAAIVMLSG  63

Query  1443  QFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTV  1264
             Q AD   TI+AGE+IDRFG+FK+WH  G ++VG+SF S+FGG C+ C ILG+DS  V+T+
Sbjct  64    QVADGLMTIVAGEMIDRFGRFKLWHIGGSVLVGISFSSVFGG-CLLCTILGTDSYLVRTI  122

Query  1263  GYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF  1084
             GY   A VF  GW+ TQ+SHMSMVNC+T N +SR+A  SCRNA TMVA+L LY +   VF
Sbjct  123   GYSFFAAVFNIGWAATQVSHMSMVNCMTSNPTSRVALASCRNASTMVANLGLYGIALAVF  182

Query  1083  ----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYW  916
                      DI  QY+W+A++SIF+G  F+++FH G +EP  K +   +K  +   W+YW
Sbjct  183   GIVKAKTCADIVVQYKWIAYVSIFVGCCFLVLFHAGTEEPTLKSEPNCKK-RARIAWSYW  241

Query  915   LKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLL  736
              K+ LYYQVA +Y+  R++TNVSQ+ +A YV  DL+M++ +K+ +PAII+ CSF+ SV+L
Sbjct  242   FKKTLYYQVALLYMLARLITNVSQSLIAFYVTRDLKMNEYSKATIPAIIFCCSFLVSVVL  301

Query  735   QELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGM  556
             QE+ W+ +RLK     G  LW++ GA V LLP +M++ MY L+V+IG ANAL+MVT+IG+
Sbjct  302   QEMRWNSRRLKSLLTIGATLWVISGAAVFLLPSQMHNLMYPLAVVIGAANALVMVTTIGL  361

Query  555   ESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRFSLG  376
             ESALV + L+G AFVYGS+ F+DK+ CG+AL+ LES++ A   +C  A+   +V+R+  G
Sbjct  362   ESALVGEDLNGCAFVYGSLSFLDKMSCGLALFVLESYDVAS--SCGEARGLNTVSRYGTG  419

Query  375   FIPGIAALFGVIVSFTMKL  319
              IP   A+  ++V+ T++L
Sbjct  420   LIPACFAVLAIVVASTLRL  438



>ref|XP_007020148.1| Major facilitator superfamily protein isoform 4 [Theobroma cacao]
 gb|EOY17373.1| Major facilitator superfamily protein isoform 4 [Theobroma cacao]
Length=425

 Score =   427 bits (1099),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 238/456 (52%), Positives = 301/456 (66%), Gaps = 41/456 (9%)
 Frame = -2

Query  1617  DNREEEEE--KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVG  1444
              NR E++   KP+GR SV  YGVGHMLNDIT  CW+TYLLL+LTDIGLS   AA V L G
Sbjct  2     SNRIEDDSFSKPVGRWSVFYYGVGHMLNDITAACWFTYLLLFLTDIGLSQRDAATVMLSG  61

Query  1443  QFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTV  1264
             Q AD   TI  GELIDRFG FKIWHGAG ++V VSF S+FGG C+PCK L + S TV+T+
Sbjct  62    QIADGLATIFVGELIDRFGHFKIWHGAGSMLVAVSFSSVFGG-CLPCKALATFSSTVETI  120

Query  1263  GYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF  1084
              Y   A +F  GW+ TQ+SHMSMVNCI+LN +SR+   SCRNAFTMVA+L LY +   VF
Sbjct  121   SYSTFAAIFNVGWAATQVSHMSMVNCISLNSTSRVVLASCRNAFTMVANLSLYGIALIVF  180

Query  1083  ----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYW  916
                      DI+ QYRW+A++SIFIG  FV IFH G  EPR K    H  I +   WTYW
Sbjct  181   DISIAKTYADIENQYRWIAYLSIFIGCCFVGIFHFGTNEPRSKKGI-HGNIHARISWTYW  239

Query  915   LKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLL  736
              +++LYYQVA +YV TR+V NVSQ +LA YVINDL M+QSAK+LVPAIIY+CSFI SVLL
Sbjct  240   FRKILYYQVALVYVLTRLVLNVSQAYLAFYVINDLLMAQSAKALVPAIIYICSFIVSVLL  299

Query  735   QELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGM  556
             QE+ W+G+RLK ++A GGILW+ CG                             VT++ M
Sbjct  300   QEIAWNGQRLKAYYAAGGILWMFCG-----------------------------VTAVSM  330

Query  555   ESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACN--PAQACFSVTRFS  382
             +S ++ + L+G AFV GS+ F+DK+ CG+AL+ L+S++   P+          FSVTR+ 
Sbjct  331   QSIVIGEDLNGCAFVCGSLSFLDKISCGLALFVLQSYQSNSPIIVGNYSTNFNFSVTRYG  390

Query  381   LGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             LG +P   +   V V+ TM+L   +   +PL EPLL
Sbjct  391   LGLVPAFCSALAVAVTCTMEL--QTPLSKPLMEPLL  424



>gb|EMT11520.1| hypothetical protein F775_17916 [Aegilops tauschii]
Length=465

 Score =   427 bits (1097),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 228/440 (52%), Positives = 314/440 (71%), Gaps = 9/440 (2%)
 Frame = -2

Query  1623  GRDNREE-EEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLV  1447
             G+   EE E  +PLGR  VL+YGVGHMLNDIT  CW+TYLLL+L +IGL+P  AAIV L 
Sbjct  3     GKCGEEELEVAEPLGRWPVLSYGVGHMLNDITSACWFTYLLLFLQEIGLAPRDAAIVMLS  62

Query  1446  GQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
             GQ AD   TI+AGE+IDRFG+FK+WH  G + VG+SF S+FGG  + C ILG+DS  V+T
Sbjct  63    GQVADGLMTIVAGEMIDRFGRFKLWHIGGSVFVGISFSSVFGGGLL-CTILGTDSYLVRT  121

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
             +GY   A VF  GW+ TQ+SHMSMVNC+T N +SR+A  SCRNA TMVA+L LY +   V
Sbjct  122   IGYSFFAAVFNIGWAATQVSHMSMVNCMTSNPTSRVALASCRNASTMVANLGLYGIALAV  181

Query  1086  F----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTY  919
             F         DI  QY+W+A++SIF+G  F+++FH G +EP  K +   +K  +   W+Y
Sbjct  182   FGIVKAKTCADIVVQYKWIAYVSIFVGCCFLVLFHAGTEEPTLKCEPNCKK-RARIAWSY  240

Query  918   WLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVL  739
             W K+ LYYQVA +Y+  R++TNVSQ+ +A YV  DLRM++ +K+ +PAII+ CSF+ SV+
Sbjct  241   WFKKTLYYQVALLYMLARLITNVSQSLIAFYVTRDLRMNEYSKATIPAIIFCCSFLVSVV  300

Query  738   LQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIG  559
             LQE+ W+ +RLK     G  LW++ GA V LLP +M++ MY L+V+IG ANAL+MVT+IG
Sbjct  301   LQEMRWNSRRLKSLLTIGATLWVISGAAVFLLPSQMHNLMYPLAVVIGAANALVMVTTIG  360

Query  558   MESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRFSL  379
             +ESALV + L+G AFVYGS+ F+DK+ CG+AL+ LES++ A   +C  A+   +V+R+  
Sbjct  361   LESALVGEDLNGCAFVYGSLSFLDKMSCGLALFVLESYDVAS--SCGDARGLNTVSRYGT  418

Query  378   GFIPGIAALFGVIVSFTMKL  319
             G IP   A+  ++V+ T++L
Sbjct  419   GLIPACFAVLAIVVASTLRL  438



>ref|XP_006438996.1| hypothetical protein CICLE_v10031412mg [Citrus clementina]
 gb|ESR52236.1| hypothetical protein CICLE_v10031412mg [Citrus clementina]
Length=411

 Score =   425 bits (1092),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 220/416 (53%), Positives = 291/416 (70%), Gaps = 30/416 (7%)
 Frame = -2

Query  1452  LVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTV  1273
             L GQ AD F TI  GELIDRFG FKIWHGAG ++V VSF S+FGG C+PC+IL + +  V
Sbjct  2     LSGQIADGFATIFIGELIDRFGHFKIWHGAGSVLVAVSFSSVFGG-CMPCRILSTSTLKV  60

Query  1272  QTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
             +T+ YC+ A +F  GW+ TQ++HMSMVNCITLN +SR+   SCRNAFTMVA+L LYA+ F
Sbjct  61    ETISYCVFAAIFNVGWAATQVAHMSMVNCITLNSTSRVVLTSCRNAFTMVANLSLYAIAF  120

Query  1092  FVFT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKK---DDDGHEKIGSN  934
              VF+        D++ QYRW+A+ SIFIG  FV IF    +EPR K     + H +I   
Sbjct  121   IVFSVSTAKTHADLENQYRWIAYSSIFIGCCFVGIFLSRTEEPRLKMGLRGNSHARI---  177

Query  933   TPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSF  754
               W YW K++LYYQVA +Y+ TR+V NVSQ +LA YVINDLRM QSAK+LVPAIIY+CSF
Sbjct  178   -SWAYWFKKILYYQVALVYMLTRLVVNVSQAYLAFYVINDLRMGQSAKALVPAIIYICSF  236

Query  753   ITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMM  574
             I S+LLQE+ W+G+RLK +++ GG+LW+ CGA +++LP+ M++FMY L++ +GIANALMM
Sbjct  237   IVSILLQEMAWTGQRLKAYYSAGGVLWVFCGAGILILPMNMSAFMYVLAIFVGIANALMM  296

Query  573   VTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNP-------  415
             VT I M++ L+ + L G AFV G++ F+DK+ CG+A+Y L+S++   P   +        
Sbjct  297   VTGISMQNVLIGEDLSGCAFVCGTLSFLDKMSCGIAVYVLQSYQSMSPTVLDNNSSITSL  356

Query  414   ---------AQACFSVTRFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
                      + +  SVTRF LG IP I +L  V V+ TMK LHT + K PL EPLL
Sbjct  357   TVLDNNSLISTSYISVTRFGLGLIPAICSLVSVAVTCTMK-LHTPYSK-PLVEPLL  410



>ref|XP_003558731.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Brachypodium distachyon]
Length=468

 Score =   424 bits (1091),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 225/439 (51%), Positives = 312/439 (71%), Gaps = 7/439 (2%)
 Frame = -2

Query  1623  GRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVG  1444
             G +   E   +PLGR  VL+YGVGHMLNDIT  CW+TYLLL+L +IGL+P  AAIV L G
Sbjct  8     GVEQLAEVAARPLGRWPVLSYGVGHMLNDITSACWFTYLLLFLQEIGLAPRDAAIVMLSG  67

Query  1443  QFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTV  1264
             Q AD   TI+AGE+IDRFG+FK+WH  G ++VGVSF S+FGG C+ C ILG+DS  ++T+
Sbjct  68    QVADGLMTIVAGEMIDRFGRFKLWHIGGSVLVGVSFSSVFGG-CLLCTILGTDSYLLKTI  126

Query  1263  GYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF  1084
             GY   A VF  GW+ TQ+SHMSMVNC+T N +SR+A  SCRNA TMVA+L LY +   VF
Sbjct  127   GYSFFAAVFNVGWAATQVSHMSMVNCMTSNPTSRVALASCRNASTMVANLGLYGIALAVF  186

Query  1083  ----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYW  916
                   +  DI  QYRW+A++SIF+G  F+++FH+G KEP  K +   +K  +   W+YW
Sbjct  187   GAVKAKSCTDIVLQYRWIAYVSIFVGCCFLVLFHVGTKEPTLKSEPNCKK-RARIAWSYW  245

Query  915   LKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLL  736
              K+ LYYQVA +Y+  R++TNVSQ+ +A YV  DL+M++ +K+++P II+ CSF  S++L
Sbjct  246   FKKTLYYQVALLYMLARLITNVSQSLIAFYVTRDLKMNEYSKAIIPGIIFCCSFFVSIVL  305

Query  735   QELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGM  556
             QE++W+ +RLK   A G  LW++ GA V +LP +M + MY L+++IG ANAL+MVT+IG+
Sbjct  306   QEMKWNSRRLKSLLAIGATLWVISGAAVFVLPGEMRNLMYPLAMVIGAANALVMVTTIGL  365

Query  555   ESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRFSLG  376
             ESALV + L+G AFVYGS+ F+DK+ CGVAL+ LES+ D  P     A+   + +R+  G
Sbjct  366   ESALVGEDLNGCAFVYGSLSFLDKMSCGVALFVLESY-DVGPGCGAGARGLNTASRYGAG  424

Query  375   FIPGIAALFGVIVSFTMKL  319
              IP   A+  ++V  T++L
Sbjct  425   LIPSCWAVLTLVVVSTLRL  443



>ref|XP_011009644.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X2 [Populus euphratica]
Length=419

 Score =   417 bits (1071),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 234/458 (51%), Positives = 300/458 (66%), Gaps = 50/458 (11%)
 Frame = -2

Query  1620  RDNREEEEE----KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVT  1453
             R++ E +++    KP+GR SV  YGVGHMLNDIT  CW+TYLLL+LT+IGLSP  AAI  
Sbjct  2     RNDVENDDDDSYPKPVGRRSVFYYGVGHMLNDITAACWFTYLLLFLTEIGLSPRDAAIAM  61

Query  1452  LVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTV  1273
             L GQ AD F T+ AGELIDRFG FK+WHGAG I+V +SF S+FGG C+PCKIL S S  V
Sbjct  62    LAGQIADGFATVFAGELIDRFGHFKVWHGAGSILVAISFSSVFGG-CLPCKILASCSSVV  120

Query  1272  QTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
             +TV Y  SA +F  GW+ TQ+SHMSMVNCI+LN SSR+   SCRNAFTMVA+L LYAV  
Sbjct  121   ETVSYSTSAAIFNVGWAATQVSHMSMVNCISLNSSSRVVMTSCRNAFTMVANLSLYAVAL  180

Query  1092  FVFTN----NAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPW  925
              VF++       DI+ QYRW+A+ SIFIG  FV IFHLG KEPR K    H    +   W
Sbjct  181   VVFSSIKATTHADIENQYRWIAYTSIFIGCCFVGIFHLGTKEPRLKICV-HGTSNARISW  239

Query  924   TYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITS  745
              YW K+VLYYQV  +Y+ TR+V NVS                                  
Sbjct  240   AYWFKKVLYYQVGLVYMLTRLVQNVS----------------------------------  265

Query  744   VLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTS  565
                QE+ W+G+RLK +++ GGILW+ CGA ++ LP  M++FMY +SVLIGIANALM VT 
Sbjct  266   ---QEMSWTGQRLKAYYSAGGILWVFCGAGILFLPRNMSAFMYVISVLIGIANALMTVTG  322

Query  564   IGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNP-AQACFSVTR  388
             + M+S LV   L+G AFVYGS+ F+DK+ CG+A++ L+SF+ + P      +    SVTR
Sbjct  323   VSMQSILVGSDLNGCAFVYGSLSFLDKISCGLAVFALQSFQSSSPKTEEALSTDNISVTR  382

Query  387   FSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             + LG +P + +L GV +++TMKL   +   + L EPLL
Sbjct  383   YGLGLLPAVCSLAGVAITYTMKL--QTQDSKSLMEPLL  418



>gb|EAZ25722.1| hypothetical protein OsJ_09556 [Oryza sativa Japonica Group]
Length=444

 Score =   416 bits (1069),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 220/443 (50%), Positives = 306/443 (69%), Gaps = 21/443 (5%)
 Frame = -2

Query  1617  DNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQF  1438
             D    E + PLGR  +L+YGVGHMLNDIT  CW+TYLLL+L +IGL+P  AAIV L GQ 
Sbjct  7     DEVLAEGQMPLGRWPILSYGVGHMLNDITSACWFTYLLLFLQEIGLAPRDAAIVMLSGQV  66

Query  1437  ADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGY  1258
             AD   TI+AGE+IDRFG FK+WH  G I+VG+SF S+FGG C+ C +LG+DS  V+T+GY
Sbjct  67    ADGLMTILAGEMIDRFGHFKLWHIGGSILVGISFSSVFGG-CLLCTVLGTDSYLVRTIGY  125

Query  1257  CISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFT-  1081
                A VF  GW+ TQ+SHMSMVNC+TLN +SR+A  SCRNAFTMVA+L LYA+   VF  
Sbjct  126   SFFAAVFNIGWAATQVSHMSMVNCMTLNSTSRVALASCRNAFTMVANLGLYAIALVVFAL  185

Query  1080  ---NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLK  910
                    DI  QYRW+A++SIF+G  F+++F+ G KEP  +     +K  +   W YW K
Sbjct  186   VSAKACSDIVLQYRWIAYVSIFVGCCFLVVFYAGTKEPTLQSGSDCKK-SARISWGYWFK  244

Query  909   RVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQE  730
             + LYYQVA +Y+  R++TNVSQ+ +A YV  DL+M++ +K+++PAII+ CSF+ SV+LQE
Sbjct  245   KALYYQVALLYMLARLITNVSQSLIAFYVTRDLKMNEYSKAIIPAIIFCCSFLVSVVLQE  304

Query  729   LEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMES  550
             ++W+ +RLK     G ILW++ GA V +LP +M++ MY L+++IG ANAL+MVT+IG+ES
Sbjct  305   IKWNSRRLKSLLTIGAILWVIAGAAVFVLPSQMHNLMYPLAMVIGAANALVMVTTIGLES  364

Query  549   ALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRFSLGFI  370
             ALV   L+G AFVYGS+ F+ +                  ++C   +  ++V+RF  G I
Sbjct  365   ALVGDDLNGCAFVYGSLSFLTR---------------CHSISCGETRGLYTVSRFGTGLI  409

Query  369   PGIAALFGVIVSFTMKLLHTSHK  301
             P   A+F ++V+ T+KL  T+ +
Sbjct  410   PSCFAVFALLVTSTLKLQDTNPR  432



>ref|XP_006598240.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X3 [Glycine max]
Length=394

 Score =   413 bits (1061),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 214/398 (54%), Positives = 283/398 (71%), Gaps = 9/398 (2%)
 Frame = -2

Query  1452  LVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTV  1273
             L GQ AD F TI+ GELIDRFG FKIWHGAG ++V +SF S+FGG C+PCK+  S+S T 
Sbjct  2     LSGQVADGFATILVGELIDRFGHFKIWHGAGSLLVAISFSSVFGG-CLPCKLFSSNSCTF  60

Query  1272  QTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
             +TV Y + A +F  GW+ TQ+SHMSMV+CITLN +SR+A  SCRNAFTMVA+L LYAV  
Sbjct  61    ETVSYSVFAAIFNLGWAATQVSHMSMVSCITLNSTSRVALASCRNAFTMVANLSLYAVAL  120

Query  1092  FVFT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPW  925
              VF+       +D++ QYRW+A+ SIFIG  FV +F L  KEPR K    H  + +   W
Sbjct  121   IVFSVINGKTHDDVENQYRWIAYFSIFIGCCFVGVFLLATKEPRLKLGV-HGMVHARISW  179

Query  924   TYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITS  745
              YW KR+LYYQVA +YV TR+V N+SQ +LA +VINDL+M+QSAK+LVPA+IY+CSF+ S
Sbjct  180   DYWFKRILYYQVALVYVLTRLVLNISQAYLAFFVINDLQMAQSAKALVPALIYICSFVVS  239

Query  744   VLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTS  565
             + LQE+ W+G+ LK +++ G ILW+ CGAV++LL   M+  MY +SV IGIANALMMVT 
Sbjct  240   IALQEIAWTGRMLKAYYSAGCILWIFCGAVILLLTTNMSYVMYIVSVFIGIANALMMVTG  299

Query  564   IGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRF  385
             + M++ L+  +L+G AFV GS+ F+DK+ CG+ALY L+S ++  P      Q  FSVTR 
Sbjct  300   VSMQNFLIGGNLNGCAFVVGSLSFLDKISCGIALYVLQSNQNLSPQLQATTQFPFSVTRV  359

Query  384   SLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
              LG +P   AL GV+V+ TM   + S   + +  PLLA
Sbjct  360   GLGLVPAFCALVGVVVTCTMDFHNPS---KSMTAPLLA  394



>ref|XP_006291309.1| hypothetical protein CARUB_v10017443mg [Capsella rubella]
 gb|EOA24207.1| hypothetical protein CARUB_v10017443mg [Capsella rubella]
Length=376

 Score =   406 bits (1043),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 212/356 (60%), Positives = 268/356 (75%), Gaps = 6/356 (2%)
 Frame = -2

Query  1626  MGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLV  1447
             M   + E+   KP+GR SV  YGVGHMLNDIT  CW+TYLLL+LT IGLSP  AAIV L 
Sbjct  1     MTGGSEEDPFTKPIGRWSVFFYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAIVMLS  60

Query  1446  GQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
             GQ AD F TI  GELIDRFG FK+WH AG ++V +SF S+FGG C+PC IL +DS T++T
Sbjct  61    GQVADGFATIFTGELIDRFGHFKVWHAAGSLLVAISFSSVFGG-CLPCSILHNDSLTLET  119

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
               Y + A +F  GW+ TQ+SHM+MVNCI+LN +SR+A  SCRNAFTMVA+L LYA+   V
Sbjct  120   FSYSMFAAIFNIGWAATQVSHMAMVNCISLNSTSRVALTSCRNAFTMVANLGLYAIALVV  179

Query  1086  F----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTY  919
             F      + ED +TQYRW+A+ SI IG  FVIIF +G KEPR + D   E   +  PW Y
Sbjct  180   FGVIKAGSKEDTETQYRWIAYSSITIGCCFVIIFLMGTKEPRLRLDL-RETSRARIPWVY  238

Query  918   WLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVL  739
             W +++LYYQVA +Y+ TR+V NVSQ +LA +VI+DL+M QSAK+LVPAIIY+CSF+ SVL
Sbjct  239   WFRKLLYYQVAMVYLLTRLVLNVSQAYLAFFVIDDLQMDQSAKALVPAIIYICSFVVSVL  298

Query  738   LQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMV  571
             LQE+ W+G+RLK ++  GGI+W+ CGA ++LLP  ++SFMYA+SV IGIANALMMV
Sbjct  299   LQEIPWNGRRLKAYYTAGGIIWIFCGAAILLLPRNISSFMYAISVFIGIANALMMV  354



>emb|CAB75922.1| putative protein [Arabidopsis thaliana]
Length=437

 Score =   406 bits (1044),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 232/463 (50%), Positives = 299/463 (65%), Gaps = 48/463 (10%)
 Frame = -2

Query  1626  MGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLV  1447
             M   + E+   KP+GR SV  YGVGHMLNDIT  CW+TYLLL+LT IGLSP  AAIV L 
Sbjct  1     MTGGSEEDPFTKPIGRWSVFFYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAIVMLS  60

Query  1446  GQFADAFTTIIAGEL----------IDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKI  1297
             GQ ADAF TI  GEL          IDRFG FKIWH AG ++V +SF S+FGG C+PC I
Sbjct  61    GQVADAFATIFTGELVDEYGLLLWQIDRFGHFKIWHAAGSLLVAISFSSVFGG-CLPCSI  119

Query  1296  LGSDSPTVQTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVAS  1117
             L +DS T++T  Y + A +F  GW+ TQ                             VA+
Sbjct  120   LHNDSLTLETFSYSMFAAIFNIGWAATQ-----------------------------VAN  150

Query  1116  LMLYAVTFFVF----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHE  949
             L LYA+   VF      + ED +TQYRW+A+ SI IG  FV+IF +G KEPR + D   E
Sbjct  151   LGLYAIALVVFGVIKAGSKEDTETQYRWIAYSSITIGCCFVVIFLMGTKEPRLRIDL-KE  209

Query  948   KIGSNTPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAII  769
                +  PW YW +++LYYQVA +Y+ TR+V NVSQ +LA +VI+DL+M QSAK+LVPAII
Sbjct  210   TSRARIPWVYWFRKILYYQVAMVYLLTRLVLNVSQAYLAFFVIDDLQMDQSAKALVPAII  269

Query  768   YLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIA  589
             Y+CSF+ SVLLQE+ W+GKRLK ++  GGI+W+ CGA ++LLP  ++SFMYA+SV IGIA
Sbjct  270   YICSFVVSVLLQEIPWNGKRLKAYYTAGGIIWIFCGAAILLLPRDISSFMYAISVFIGIA  329

Query  588   NALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP---VACN  418
             NALMMVT+I M+S LV   + G AFV GS+ F+DK+ CG+ALY L+S +   P   +  N
Sbjct  330   NALMMVTAISMQSVLVGAEVGGCAFVCGSLSFLDKMSCGLALYVLQSHQTTSPRGQLNNN  389

Query  417   PAQACFSVTRFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPL  289
                   SVTR+ LG +P + +  GV V+F M+L       +PL
Sbjct  390   QQSVYLSVTRYGLGLVPALCSFVGVAVTFFMELEAAGSLSKPL  432



>ref|XP_006438997.1| hypothetical protein CICLE_v10031412mg [Citrus clementina]
 gb|ESR52237.1| hypothetical protein CICLE_v10031412mg [Citrus clementina]
Length=374

 Score =   403 bits (1036),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 210/361 (58%), Positives = 269/361 (75%), Gaps = 13/361 (4%)
 Frame = -2

Query  1629  IMGRDNREEEE-EKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVT  1453
             +M  D   ++   +P+GR SVL YG GHMLNDIT  CW+TYLLL+LTDIGLSP  AA V 
Sbjct  6     VMNYDIENDDSFTQPVGRWSVLYYGSGHMLNDITAACWFTYLLLFLTDIGLSPRGAAAVM  65

Query  1452  LVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTV  1273
             L GQ AD F TI  GELIDRFG FKIWHGAG ++V VSF S+FGG C+PC+IL + +  V
Sbjct  66    LSGQIADGFATIFIGELIDRFGHFKIWHGAGSVLVAVSFSSVFGG-CMPCRILSTSTLKV  124

Query  1272  QTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
             +T+ YC+ A +F  GW+ TQ++HMSMVNCITLN +SR+   SCRNAFTMVA+L LYA+ F
Sbjct  125   ETISYCVFAAIFNVGWAATQVAHMSMVNCITLNSTSRVVLTSCRNAFTMVANLSLYAIAF  184

Query  1092  FVFT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKK---DDDGHEKIGSN  934
              VF+        D++ QYRW+A+ SIFIG  FV IF    +EPR K     + H +I   
Sbjct  185   IVFSVSTAKTHADLENQYRWIAYSSIFIGCCFVGIFLSRTEEPRLKMGLRGNSHARI---  241

Query  933   TPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSF  754
               W YW K++LYYQVA +Y+ TR+V NVSQ +LA YVINDLRM QSAK+LVPAIIY+CSF
Sbjct  242   -SWAYWFKKILYYQVALVYMLTRLVVNVSQAYLAFYVINDLRMGQSAKALVPAIIYICSF  300

Query  753   ITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMM  574
             I S+LLQE+ W+G+RLK +++ GG+LW+ CGA +++LP+ M++FMY L++ +GIANALMM
Sbjct  301   IVSILLQEMAWTGQRLKAYYSAGGVLWVFCGAGILILPMNMSAFMYVLAIFVGIANALMM  360

Query  573   V  571
             V
Sbjct  361   V  361



>ref|XP_010691842.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X2 [Beta vulgaris subsp. vulgaris]
Length=345

 Score =   384 bits (986),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 200/349 (57%), Positives = 262/349 (75%), Gaps = 11/349 (3%)
 Frame = -2

Query  1296  LGSDSPTVQTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVAS  1117
             +G+DS T+QT+GY I A +F  GW+ TQ+SHMSMVNC+TLN +SR+   SCRNAFTMVA+
Sbjct  1     MGTDSSTLQTIGYSIFAAIFNIGWAATQVSHMSMVNCMTLNPTSRVVLASCRNAFTMVAN  60

Query  1116  LMLYAVTFFVF----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHE  949
             L LYAV F VF    +    DI+ QYRW+A+ SIFIG  FV IF +G KEPR KD     
Sbjct  61    LSLYAVAFAVFGLSKSRTHADIEYQYRWIAYSSIFIGCCFVCIFLIGTKEPRLKDCF-PG  119

Query  948   KIGSNTPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAII  769
             K+ +   WTYW  +VLYYQVA +YV TR+VTNVSQ+FLA YVINDL+M+QS+K+LVPAII
Sbjct  120   KVYARIEWTYWFHKVLYYQVALVYVLTRLVTNVSQSFLAFYVINDLQMAQSSKALVPAII  179

Query  768   YLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIA  589
             Y+CSFI S++LQE+ W G RLK+F++ GG+LW+ CGA V+ LP  M+ +MY +S++IGIA
Sbjct  180   YICSFIISLILQEMPWPGHRLKLFYSIGGVLWIFCGAAVLFLPQAMSGYMYIISIVIGIA  239

Query  588   NALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFE---DADPVACN  418
             NALMMVT +GM+SALV + L+G AFVYGS+ F+DK+ CGV LYFLESF+    ++    +
Sbjct  240   NALMMVTGVGMQSALVGQDLNGCAFVYGSLSFMDKMACGVVLYFLESFQSNVSSNTTVLH  299

Query  417   PAQACFSVTRFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
              +   FS+TR++LGF+P I+AL GV V+++M L        PLA+PLLA
Sbjct  300   SSTLSFSITRYALGFVPAISALIGVAVTYSMNL---ETPLTPLAQPLLA  345



>gb|KDO46025.1| hypothetical protein CISIN_1g011925mg [Citrus sinensis]
Length=422

 Score =   387 bits (993),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 230/476 (48%), Positives = 290/476 (61%), Gaps = 84/476 (18%)
 Frame = -2

Query  1629  IMGRDNREEEE-EKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVT  1453
             +M  D   ++   +P+GR SVL YG GHMLNDIT  CW+TYLLL+LTDIGLSP  AA V 
Sbjct  6     VMNYDIENDDSFTQPVGRWSVLYYGSGHMLNDITAACWFTYLLLFLTDIGLSPRGAAAVM  65

Query  1452  LVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTV  1273
             L GQ AD F TI  GELIDRFG FKIWHGAG ++V VSF S+FGG C+PC+IL + +  V
Sbjct  66    LSGQIADGFATIFIGELIDRFGHFKIWHGAGSVLVAVSFSSVFGG-CMPCRILSTSTLKV  124

Query  1272  QTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
             +T+ YC+ A +F  GW+ TQ++HMSMVNCITLN +SR+   SCRNAFTMVA+L LYA+ F
Sbjct  125   ETISYCVFAAIFNVGWAATQVAHMSMVNCITLNSTSRVVLTSCRNAFTMVANLSLYAIAF  184

Query  1092  FVFT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKK---DDDGHEKIGSN  934
              VF+        D++ QYRW+A+ SIFIG  FV IF    +EPR K     + H +I   
Sbjct  185   IVFSVSTAKTHADLENQYRWIAYSSIFIGCCFVGIFLSRTEEPRLKMGLRGNSHARIS--  242

Query  933   TPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSF  754
               W YW K++LYYQVA +Y+ TR+V NVSQ +LA YVINDLRM QSAK+LVPAIIY+CSF
Sbjct  243   --WAYWFKKILYYQVALVYMLTRLVVNVSQAYLAFYVINDLRMGQSAKALVPAIIYICSF  300

Query  753   ITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMM  574
             I S+LLQ                                                     
Sbjct  301   IVSILLQ-----------------------------------------------------  307

Query  573   VTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNP-------  415
             VT I M++ LV + L G AFV G++ F+DK+ CG+A+Y L+S++   P   +        
Sbjct  308   VTGISMQNVLVGEDLSGCAFVCGTLSFLDKMSCGIAVYVLQSYQSMSPTVLDNNSSITSL  367

Query  414   ---------AQACFSVTRFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
                      + +  SVTRF LG IP I +L  V V+FTMK LHT + K PL EPLL
Sbjct  368   TVLDNNSLISTSYISVTRFGLGLIPAICSLVSVAVTFTMK-LHTPYSK-PLVEPLL  421



>ref|XP_006482798.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X3 [Citrus sinensis]
Length=422

 Score =   386 bits (991),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 229/476 (48%), Positives = 290/476 (61%), Gaps = 84/476 (18%)
 Frame = -2

Query  1629  IMGRDNREEEE-EKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVT  1453
             +M  D   ++   +P+GR SVL YG GHMLNDIT  CW+TYLLL+LTDIGLSP  AA V 
Sbjct  6     VMNYDIENDDSFTQPVGRWSVLYYGSGHMLNDITAACWFTYLLLFLTDIGLSPRGAAAVM  65

Query  1452  LVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTV  1273
             L GQ AD F TI  GELIDRFG FKIWHGAG ++V VSF S+FGG C+PC+IL + +  V
Sbjct  66    LSGQIADGFATIFIGELIDRFGHFKIWHGAGSVLVAVSFSSVFGG-CMPCRILSTSTLKV  124

Query  1272  QTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
             +T+ YC+ A +F  GW+ TQ++HMSMVNCITLN +SR+   SCRNAFTMVA+L LYA+ F
Sbjct  125   ETISYCVFAAIFNVGWAATQVAHMSMVNCITLNSTSRVVLTSCRNAFTMVANLSLYAIAF  184

Query  1092  FVFT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKK---DDDGHEKIGSN  934
              VF+        D++ QYRW+A+ SIFIG  FV IF    +EPR K     + H +I   
Sbjct  185   IVFSVSTAKTHADLENQYRWIAYSSIFIGCCFVGIFLSRTEEPRLKMGLRGNSHARIS--  242

Query  933   TPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSF  754
               W YW K++LYYQVA +Y+ TR+V NVSQ +LA YVINDLRM QSAK+LVPAIIY+CSF
Sbjct  243   --WAYWFKKILYYQVALVYMLTRLVVNVSQAYLAFYVINDLRMGQSAKALVPAIIYICSF  300

Query  753   ITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMM  574
             I S+LLQ                                                     
Sbjct  301   IVSILLQ-----------------------------------------------------  307

Query  573   VTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNP-------  415
             VT I M++ L+ + L G AFV G++ F+DK+ CG+A+Y L+S++   P   +        
Sbjct  308   VTGISMQNVLIGEDLSGCAFVCGTLSFLDKMSCGIAVYVLQSYQSMSPTVLDNNSSITSL  367

Query  414   ---------AQACFSVTRFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
                      + +  SVTRF LG IP I +L  V V+FTMK LHT + K PL EPLL
Sbjct  368   TVLDNNSLISTSYISVTRFGLGLIPAICSLVSVAVTFTMK-LHTPYSK-PLVEPLL  421



>ref|XP_010243431.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X3 [Nelumbo nucifera]
Length=379

 Score =   384 bits (987),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 205/381 (54%), Positives = 272/381 (71%), Gaps = 14/381 (4%)
 Frame = -2

Query  1401  IDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAVVFCSGWS  1222
             IDRFG FKI H AG ++V +SF S+FG  C+PCKI  +DS T++TVGY I A +F  GW+
Sbjct  9     IDRFGHFKICHIAGSVLVAISFSSVFG-VCVPCKIFKTDSATMETVGYSIFAAIFNVGWA  67

Query  1221  CTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFT----NNAEDIKTQ  1054
              TQ+SHMSMVNC+TLN +SR+A  SCRNAFTMVA+L L+AV   VF         DI+ Q
Sbjct  68    ATQVSHMSMVNCMTLNPTSRVALASCRNAFTMVANLSLFAVALAVFNLSKPKTPVDIENQ  127

Query  1053  YRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVLYYQVASIYV  874
             YRW+A++SI IG  FV IF +G KEPR + +   + +     W  W K+VLYYQVA +Y+
Sbjct  128   YRWIAYLSILIGCCFVGIFLVGTKEPRLRQEIEGKSL-HRISWKDWFKKVLYYQVALVYM  186

Query  873   FTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFF  694
              TR+VTNVSQ  LA YVINDL+M+QS+K++VPAIIY+ SF+ SV+LQE++W+G+R+K FF
Sbjct  187   LTRLVTNVSQALLAFYVINDLQMAQSSKAIVPAIIYIFSFVVSVILQEMKWTGQRIKAFF  246

Query  693   AGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAF  514
               GGILW+  GA + LLP  +++ MY LSV+IG+ANALM VT I M+S LV + ++GSAF
Sbjct  247   TAGGILWIFSGAGIFLLPSSLHNLMYLLSVIIGVANALMTVTGISMQSVLVGEDINGSAF  306

Query  513   VYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRFSLGFIPGIAALFGVIVS  334
             VYGS+ F+DKV CG+ALY +ES++D   +         S+TR+ L  I    AL GV+V+
Sbjct  307   VYGSLSFLDKVSCGIALYVIESYQDFSSI------GSLSITRYGLSLITASCALLGVLVT  360

Query  333   FTMKLLHTSHKKQPLAEPLLA  271
             +T+  L T + K  L EPLLA
Sbjct  361   YTIN-LETPNLKH-LTEPLLA  379



>ref|XP_006439001.1| hypothetical protein CICLE_v10031412mg [Citrus clementina]
 gb|ESR52241.1| hypothetical protein CICLE_v10031412mg [Citrus clementina]
 gb|KDO46033.1| hypothetical protein CISIN_1g011925mg [Citrus sinensis]
Length=348

 Score =   381 bits (978),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 199/345 (58%), Positives = 255/345 (74%), Gaps = 13/345 (4%)
 Frame = -2

Query  1629  IMGRDNREEEE-EKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVT  1453
             +M  D   ++   +P+GR SVL YG GHMLNDIT  CW+TYLLL+LTDIGLSP  AA V 
Sbjct  6     VMNYDIENDDSFTQPVGRWSVLYYGSGHMLNDITAACWFTYLLLFLTDIGLSPRGAAAVM  65

Query  1452  LVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTV  1273
             L GQ AD F TI  GELIDRFG FKIWHGAG ++V VSF S+FGG C+PC+IL + +  V
Sbjct  66    LSGQIADGFATIFIGELIDRFGHFKIWHGAGSVLVAVSFSSVFGG-CMPCRILSTSTLKV  124

Query  1272  QTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
             +T+ YC+ A +F  GW+ TQ++HMSMVNCITLN +SR+   SCRNAFTMVA+L LYA+ F
Sbjct  125   ETISYCVFAAIFNVGWAATQVAHMSMVNCITLNSTSRVVLTSCRNAFTMVANLSLYAIAF  184

Query  1092  FVFT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKK---DDDGHEKIGSN  934
              VF+        D++ QYRW+A+ SIFIG  FV IF    +EPR K     + H +I   
Sbjct  185   IVFSVSTAKTHADLENQYRWIAYSSIFIGCCFVGIFLSRTEEPRLKMGLRGNSHARI---  241

Query  933   TPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSF  754
               W YW K++LYYQVA +Y+ TR+V NVSQ +LA YVINDLRM QSAK+LVPAIIY+CSF
Sbjct  242   -SWAYWFKKILYYQVALVYMLTRLVVNVSQAYLAFYVINDLRMGQSAKALVPAIIYICSF  300

Query  753   ITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFM  619
             I S+LLQE+ W+G+RLK +++ GG+LW+ CGA +++LP+ M++FM
Sbjct  301   IVSILLQEMAWTGQRLKAYYSAGGVLWVFCGAGILILPMNMSAFM  345



>ref|XP_001768698.1| predicted protein [Physcomitrella patens]
 gb|EDQ66430.1| predicted protein [Physcomitrella patens]
Length=582

 Score =   386 bits (992),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 203/437 (46%), Positives = 288/437 (66%), Gaps = 19/437 (4%)
 Frame = -2

Query  1593  KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQFADAFTTII  1414
             +PL R +++ YG GHMLND+T  CW+TYLL++LTDIGLSP  AA V L GQ ADA  T++
Sbjct  31    EPLPRKAIVCYGTGHMLNDLTAACWFTYLLIFLTDIGLSPREAATVMLSGQIADAIATVV  90

Query  1413  AGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAVVFC  1234
              G++ID FG FKIWH  G ++V VSF S+FGG C+ C +LG++     T+GY   A +F 
Sbjct  91    VGQMIDTFGHFKIWHAGGSLLVAVSFSSVFGG-CMACALLGNNYAVAHTIGYSAFAAIFN  149

Query  1233  SGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF----TNNAED  1066
              GW+ TQ+SHMS+VNCIT N+SS+++  SCRNAFTM A+L LY + + VF    +    D
Sbjct  150   VGWAATQVSHMSLVNCITSNQSSQVSLNSCRNAFTMAANLGLYVIAYLVFRILPSKQVCD  209

Query  1065  IKTQYRWMAfisifiggvfviiFHLGVKEPR-KKDDDGHEKIGSNTPWTYWLKRVLYYQV  889
             ++TQ++W+A  +I +G  FV++F +GVKEP      +G ++  S T +  W  ++LYYQV
Sbjct  210   VETQFKWIAGSAIAVGICFVVVFQIGVKEPSLSHHKEGSQECNSRTSFKVWFGKLLYYQV  269

Query  888   ASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKR  709
             A++Y+ TR+ TNVSQ  L  Y+I+DL M +S+K++VPA+IY CSF+ S++LQEL W+  +
Sbjct  270   AAVYMLTRLTTNVSQALLPFYLIDDLLMEESSKAVVPALIYACSFLASIVLQELRWTSFQ  329

Query  708   LKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHL  529
             LK  F  G  LW+L GA  +LLP  ++  +Y L+VLIG+ NA M+VT+  ME  LV  +L
Sbjct  330   LKSVFTMGAALWVLSGATFLLLPQSLHGPVYVLAVLIGVGNAFMLVTATSMEGVLVSTNL  389

Query  528   DGSAFVYGSMGFIDKVLCGVALYFLESFEDAD--------PVACNPAQACFSVTRFSLGF  373
              G  FVYGS+ F+DK  CG+ALY +E              P  C+     +S+ R +L  
Sbjct  390   SGCGFVYGSLSFLDKFACGIALYLIEGMNGNRFQIILLSFPPICH-----YSLIRVALAL  444

Query  372   IPGIAALFGVIVSFTMK  322
             +P   A    I++ TMK
Sbjct  445   VPSGCAFLAWIITTTMK  461



>ref|XP_007020149.1| Major facilitator superfamily protein isoform 5 [Theobroma cacao]
 gb|EOY17374.1| Major facilitator superfamily protein isoform 5 [Theobroma cacao]
Length=364

 Score =   372 bits (956),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 196/367 (53%), Positives = 258/367 (70%), Gaps = 10/367 (3%)
 Frame = -2

Query  1356  IMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAVVFCSGWSCTQISHMSMVNCITL  1177
             ++V VSF S+FGG C+PCK L + S TV+T+ Y   A +F  GW+ TQ+SHMSMVNCI+L
Sbjct  1     MLVAVSFSSVFGG-CLPCKALATFSSTVETISYSTFAAIFNVGWAATQVSHMSMVNCISL  59

Query  1176  NESSRIACVSCRNAFTMVASLMLYAVTFFVF----TNNAEDIKTQYRWMAfisifiggvf  1009
             N +SR+   SCRNAFTMVA+L LY +   VF         DI+ QYRW+A++SIFIG  F
Sbjct  60    NSTSRVVLASCRNAFTMVANLSLYGIALIVFDISIAKTYADIENQYRWIAYLSIFIGCCF  119

Query  1008  viiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAV  829
             V IFH G  EPR K    H  I +   WTYW +++LYYQVA +YV TR+V NVSQ +LA 
Sbjct  120   VGIFHFGTNEPRSKKGI-HGNIHARISWTYWFRKILYYQVALVYVLTRLVLNVSQAYLAF  178

Query  828   YVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVM  649
             YVINDL M+QSAK+LVPAIIY+CSFI SVLLQE+ W+G+RLK ++A GGILW+ CG  ++
Sbjct  179   YVINDLLMAQSAKALVPAIIYICSFIVSVLLQEIAWNGQRLKAYYAAGGILWMFCGVGIL  238

Query  648   LLPIKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGV  469
             LLP  M+ FMYA+SV IGIANALM VT++ M+S ++ + L+G AFV GS+ F+DK+ CG+
Sbjct  239   LLPRSMSLFMYAISVFIGIANALMTVTAVSMQSIVIGEDLNGCAFVCGSLSFLDKISCGL  298

Query  468   ALYFLESFEDADPVACN--PAQACFSVTRFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQ  295
             AL+ L+S++   P+          FSVTR+ LG +P   +   V V+ TM+L   +   +
Sbjct  299   ALFVLQSYQSNSPIIVGNYSTNFNFSVTRYGLGLVPAFCSALAVAVTCTMEL--QTPLSK  356

Query  294   PLAEPLL  274
             PL EPLL
Sbjct  357   PLMEPLL  363



>ref|XP_009620866.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X2 [Nicotiana tomentosiformis]
Length=339

 Score =   365 bits (937),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 192/343 (56%), Positives = 253/343 (74%), Gaps = 15/343 (4%)
 Frame = -2

Query  1275  VQTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVT  1096
             +QT+GY + A +F  GW+ TQ+SHMSMVNCITLN +SR+   SCRNAFTM+A+L LYAV 
Sbjct  2     LQTIGYSVFAAIFNVGWAATQVSHMSMVNCITLNSTSRVVLASCRNAFTMIANLSLYAVA  61

Query  1095  FFVFT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDD---DGHEKIGS  937
             F VF          I+ QYRW+A+ISIFIG  FV +FHLG +EPR   +    G+ +I  
Sbjct  62    FAVFNVVGAGTPAAIENQYRWIAYISIFIGSCFVGVFHLGTREPRLNLEARVKGYVRIS-  120

Query  936   NTPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCS  757
                W YW K++LY+QVA +Y+ TR+VTNVSQ FLA YVINDL+MSQS+K+LVPAIIY+CS
Sbjct  121   ---WMYWFKKILYHQVALVYLLTRLVTNVSQAFLAFYVINDLQMSQSSKALVPAIIYICS  177

Query  756   FITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALM  577
             F+ SVLLQE+ W+ +RLK F+  GG+LW+LCG  ++LLP  MN+ MY LSVLIGIANAL+
Sbjct  178   FVVSVLLQEITWTSQRLKGFYTVGGLLWVLCGTGILLLPRNMNALMYILSVLIGIANALI  237

Query  576   MVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQAC--  403
             MVT +GM+S LV + L+G AFVYGS+ F+DK++CG+AL+ LES++ + P   N +  C  
Sbjct  238   MVTGVGMQSVLVGRDLNGCAFVYGSLSFLDKMICGLALFILESYQRSSPELHNCSTRCPY  297

Query  402   FSVTRFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             FS+ R++LG +P + AL GVIV+ +M L   + K  PL EPLL
Sbjct  298   FSLNRYALGLVPAVCALLGVIVTCSMDLQTPTLK--PLEEPLL  338



>ref|XP_006359136.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X3 [Solanum tuberosum]
Length=339

 Score =   364 bits (935),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 188/340 (55%), Positives = 253/340 (74%), Gaps = 9/340 (3%)
 Frame = -2

Query  1275  VQTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVT  1096
             +QT+GY + A +F  GW+ TQ+SHMSMVNCITLN +SR+   SCRNAFTMVA+L LYAV 
Sbjct  2     LQTIGYSVFAAIFNVGWAATQVSHMSMVNCITLNSTSRVVLASCRNAFTMVANLSLYAVA  61

Query  1095  FFVFTN----NAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTP  928
             F VF N        ++ QYRW+A+ISIFIG  FV++F +G +EPR K +  H K      
Sbjct  62    FVVFNNVGAGTPAAVENQYRWIAYISIFIGSCFVVVFAIGTREPRLKLE-AHVKGYVRIS  120

Query  927   WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFIT  748
             W YW K++LY+QVA +YV TR+VTNVSQ FLA YVINDL+MS S+K+LVPAII++CSF+ 
Sbjct  121   WMYWFKKILYHQVALVYVLTRLVTNVSQAFLAFYVINDLQMSLSSKALVPAIIFVCSFVV  180

Query  747   SVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVT  568
             S+LLQE++W+ +RLK F+  GG+LW+LCG  ++LLP  MN++MY LS+ IGIANAL+MVT
Sbjct  181   SILLQEIKWTSQRLKGFYTAGGLLWVLCGIGILLLPRNMNAYMYILSIFIGIANALIMVT  240

Query  567   SIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVA--CNPAQACFSV  394
              +GM+S LV + L+G AFVYGS+ F+DK++CGVAL+ LES++ + P    C+P+   FS+
Sbjct  241   GVGMQSVLVGRDLNGCAFVYGSLSFMDKMICGVALFILESYQRSTPELHNCSPSYHFFSL  300

Query  393   TRFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
              R++LG +P + AL GVIV+ +M L   +    PL EPLL
Sbjct  301   NRYALGLVPAVCALLGVIVTCSMNL--QTPILVPLEEPLL  338



>gb|KFK35213.1| hypothetical protein AALP_AA5G255200 [Arabis alpina]
Length=403

 Score =   364 bits (935),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 213/453 (47%), Positives = 275/453 (61%), Gaps = 61/453 (13%)
 Frame = -2

Query  1614  NREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQFA  1435
             + E+   KP+GR +VL YGVGHMLNDIT  CW+TYLLL+LT IGL P  AAI+ L GQ A
Sbjct  5     SEEDPFTKPIGRWTVLFYGVGHMLNDITASCWFTYLLLFLTQIGLDPRDAAIIMLSGQVA  64

Query  1434  DAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYC  1255
             D F TI  GELIDRFG FKIWH AG  +V +SF S+FGG C+ C IL +DS  ++T  Y 
Sbjct  65    DGFATIFVGELIDRFGHFKIWHAAGSALVALSFSSVFGG-CLACSILHNDSLGLETFSYS  123

Query  1254  ISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF---  1084
             + A++F  GW+ TQ+SHM+MVN I+ N +SR+A  SCRNAF+MVA+L LYA+   VF   
Sbjct  124   MFAIIFNIGWAATQVSHMAMVNYISFNSTSRVALTSCRNAFSMVANLGLYAIALVVFGVI  183

Query  1083  -TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKR  907
                + ED + QYRW+A+ SI IG  FV+IF +G KEP    D   E   +  PW YW ++
Sbjct  184   KAGSKEDTEIQYRWIAYSSITIGCCFVVIFLMGTKEPSLTIDL-RETSRARIPWAYWFRK  242

Query  906   VLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQEL  727
             +LYYQVA +Y+ TR+V NVSQ +LA +VI+DL+M QSAK+LVPAIIY+CSF+ SV+LQ  
Sbjct  243   LLYYQVAMVYLLTRLVLNVSQAYLAFFVIDDLQMDQSAKALVPAIIYICSFVVSVMLQ--  300

Query  726   EWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESA  547
                                                                VTSI M+S 
Sbjct  301   ---------------------------------------------------VTSISMQSV  309

Query  546   LVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQAC--FSVTRFSLGF  373
             LV   + G AFV GS+ F+DK+ CG+ALY L+S +   P   N  Q     SV R+ LG 
Sbjct  310   LVGAKVGGCAFVCGSLSFLDKMSCGIALYVLQSHQSTSPRELNNVQQSVYLSVARYGLGL  369

Query  372   IPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             +P + +  GV V+F M+L       +PL EPLL
Sbjct  370   VPVLCSFVGVTVTFFMELEDAGSLLKPLGEPLL  402



>ref|XP_002977174.1| hypothetical protein SELMODRAFT_33300, partial [Selaginella moellendorffii]
 gb|EFJ21783.1| hypothetical protein SELMODRAFT_33300, partial [Selaginella moellendorffii]
Length=382

 Score =   363 bits (931),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 193/383 (50%), Positives = 262/383 (68%), Gaps = 3/383 (1%)
 Frame = -2

Query  1587  LGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQFADAFTTIIAG  1408
             L R  ++ YG+GHMLND+T  CW+TYLL+YLTD+GL+P  AA+V L GQ +D   T+ AG
Sbjct  1     LARKEIVAYGIGHMLNDLTAACWFTYLLIYLTDVGLTPREAALVMLCGQVSDGLATVAAG  60

Query  1407  ELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAVVFCSG  1228
              +ID FG FKIWHG G ++V +SF S+FGG C  C I G+ +  V+T+GY + A +F  G
Sbjct  61    YMIDLFGGFKIWHGGGSLLVSISFSSVFGG-CSVCVITGNKTLLVETLGYSVFAAIFNIG  119

Query  1227  WSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTNNAED-IKTQY  1051
             W+ TQ+SHMS+VNCIT N +SR+A  SCRNAFTMVA+L+LY + F VFT  + D ++ QY
Sbjct  120   WAATQVSHMSLVNCITANPTSRVALNSCRNAFTMVANLLLYGIAFLVFTFKSNDNVERQY  179

Query  1050  RWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVLYYQVASIYVF  871
             RW+A  ++ IGG FV+IF L VKEPR +      K+ +   +  W +++LYYQVA +Y  
Sbjct  180   RWIASANVAIGGFFVLIFLLSVKEPRLQHHF-QPKLYTKISFVSWFRKILYYQVALVYTL  238

Query  870   TRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFA  691
             TR+ TNVSQ  LA Y+I+DL M +S+K++VPA+IY+ SF TS+ LQE  W+  RLK+ F 
Sbjct  239   TRLTTNVSQALLAFYLIDDLYMVESSKAVVPAVIYMSSFFTSIWLQECHWTSFRLKVAFT  298

Query  690   GGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFV  511
              G  LWL CG     L      ++Y L++++G  NALM+VT+  ME  LV   L G AFV
Sbjct  299   TGASLWLFCGVGFFYLSSSFQLYIYPLALVVGTGNALMLVTATSMEGLLVGHSLSGCAFV  358

Query  510   YGSMGFIDKVLCGVALYFLESFE  442
             YGS+   DK+ CG ALY +E+  
Sbjct  359   YGSLSLCDKLACGFALYAIEALH  381



>ref|XP_002965330.1| hypothetical protein SELMODRAFT_230598 [Selaginella moellendorffii]
 gb|EFJ34168.1| hypothetical protein SELMODRAFT_230598 [Selaginella moellendorffii]
Length=409

 Score =   363 bits (933),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 194/390 (50%), Positives = 263/390 (67%), Gaps = 3/390 (1%)
 Frame = -2

Query  1608  EEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQFADA  1429
             +    K L R  ++ YG+GHMLND+T  CW+TYLL+YLTD+GL+P  AA+V L GQ +D 
Sbjct  14    DAPSSKALARKEIVAYGIGHMLNDLTAACWFTYLLIYLTDVGLTPREAALVMLCGQVSDG  73

Query  1428  FTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCIS  1249
               T+ AG +ID FG FKIWHG G ++V +SF S+FGG C  C I G+ +  V+T+GY + 
Sbjct  74    LATVAAGYMIDLFGGFKIWHGGGSLLVSISFSSVFGG-CSVCVITGNKTLLVETLGYSVF  132

Query  1248  AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTNNAE  1069
             A +F  GW+ TQ+SHMS+VNCIT N +SR+A  SCRNAFTMVA+L+LY + F VFT  + 
Sbjct  133   AAIFNIGWAATQVSHMSLVNCITANPTSRVALNSCRNAFTMVANLLLYGIAFLVFTFKSN  192

Query  1068  D-IKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVLYYQ  892
             D ++ QYRW+A  ++ IGG FV+IF L VKEPR +      K+ +   +  W +++LYYQ
Sbjct  193   DNVERQYRWIASANVAIGGFFVLIFLLSVKEPRLQHHF-QPKLYTKISFVSWFRKILYYQ  251

Query  891   VASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGK  712
             VA +Y  TR+ TNVSQ  LA Y+I+DL M +S+K++VPA+IY+ SF TS+ LQE  W+  
Sbjct  252   VALVYTLTRLTTNVSQALLAFYLIDDLYMVESSKAVVPAVIYMSSFFTSIWLQECHWTSF  311

Query  711   RLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALVDKH  532
             RLK  F  G  LWL CG     L      ++Y L++++G  NALM+VT+  ME  LV   
Sbjct  312   RLKAAFTTGASLWLFCGVGFFYLSSSFQLYIYPLALVVGTGNALMLVTATSMEGLLVGHS  371

Query  531   LDGSAFVYGSMGFIDKVLCGVALYFLESFE  442
             L G AFVYGS+   DK+ CG ALY +E+  
Sbjct  372   LSGCAFVYGSLSLCDKLACGFALYAIEALH  401



>ref|XP_009782044.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X2 [Nicotiana sylvestris]
Length=339

 Score =   356 bits (913),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 188/343 (55%), Positives = 249/343 (73%), Gaps = 15/343 (4%)
 Frame = -2

Query  1275  VQTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVT  1096
             +QT+GY + A +F  GW+ TQ+SHMSMVNCITLN +SR+   SCRNAFTM+A+L LYAV 
Sbjct  2     LQTIGYSVFAAIFNVGWAATQVSHMSMVNCITLNSTSRVVLASCRNAFTMIANLSLYAVA  61

Query  1095  FFVFT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDD---DGHEKIGS  937
             F VF          I+ QYRW+A+ISIFIG  FV +FHLG +EP    +    G+ +I  
Sbjct  62    FAVFNVVGAGTPAAIENQYRWIAYISIFIGSCFVGVFHLGTREPSLNLEARVKGYVRIS-  120

Query  936   NTPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCS  757
                W YW K+ LY+QVA +Y+ TR+VTNVSQ FLA YVI DL+MSQS+K+LVPAII++CS
Sbjct  121   ---WMYWFKKTLYHQVALVYLLTRLVTNVSQAFLAFYVIYDLQMSQSSKALVPAIIFICS  177

Query  756   FITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALM  577
             F+ SVLLQE+ W+ +RLK F+  GG+LW+LCG  ++LLP  MN  MY LSVLIGIANAL+
Sbjct  178   FVVSVLLQEITWTSQRLKGFYTAGGLLWVLCGTGILLLPRNMNVLMYILSVLIGIANALI  237

Query  576   MVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQAC--  403
             MVT +GM+S LV + L+G AFVYGS+ F+DK++CG+AL+ LES++ + P   N + +C  
Sbjct  238   MVTGVGMQSVLVGRDLNGCAFVYGSLSFLDKMICGLALFILESYQRSSPELHNCSTSCPF  297

Query  402   FSVTRFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
             FS+ R++LG +P + AL GVIV+ +M L   +    PL EPLL
Sbjct  298   FSLNRYALGLVPAVCALLGVIVTCSMDL--QTPTLGPLQEPLL  338



>gb|EPS59948.1| hypothetical protein M569_14857, partial [Genlisea aurea]
Length=301

 Score =   351 bits (901),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 185/303 (61%), Positives = 234/303 (77%), Gaps = 6/303 (2%)
 Frame = -2

Query  1590  PLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQFADAFTTIIA  1411
             PLGR  ++ YG+GHMLNDIT  CW+TYLL++LT IGL  S AA++ L GQ AD  TTI  
Sbjct  1     PLGRFPIICYGLGHMLNDITSACWFTYLLVFLTGIGLPSSDAAVILLSGQIADGLTTIFV  60

Query  1410  GELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAVVFCS  1231
             GELIDR+G FKIWHGAG ++V VSF S+FGG C+PCKI+ S SP ++T GY   A VF  
Sbjct  61    GELIDRYGHFKIWHGAGSVLVAVSFSSVFGG-CLPCKIIRSYSPVIRTFGYSFFAAVFNI  119

Query  1230  GWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFT----NNAEDI  1063
             GW+ TQ+SHMSMVNCITLN SSR+   SCRNAFTMVA+L LYA+ F VF     ++  ++
Sbjct  120   GWAATQVSHMSMVNCITLNSSSRVVLASCRNAFTMVANLSLYAIAFLVFNTVKGSSIANV  179

Query  1062  KTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVLYYQVAS  883
             ++QYRW+AF SIFIG  FV++FHLG +EPR   +  HEK      WTYW  ++LYYQVA+
Sbjct  180   ESQYRWIAFSSIFIGCCFVMLFHLGTEEPRLIREV-HEKGHVRLSWTYWFNKLLYYQVAT  238

Query  882   IYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLK  703
             +YV TR+VTNVSQ FLA +VINDL+M+QS+K+LVPA+IY+CSFI SVLLQE+ W+G+RLK
Sbjct  239   VYVVTRLVTNVSQAFLAFFVINDLKMAQSSKALVPAVIYICSFIVSVLLQEMNWTGQRLK  298

Query  702   IFF  694
              ++
Sbjct  299   TWY  301



>ref|XP_006439000.1| hypothetical protein CICLE_v10031412mg [Citrus clementina]
 gb|ESR52240.1| hypothetical protein CICLE_v10031412mg [Citrus clementina]
Length=310

 Score =   348 bits (893),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 174/301 (58%), Positives = 226/301 (75%), Gaps = 12/301 (4%)
 Frame = -2

Query  1452  LVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTV  1273
             L GQ AD F TI  GELIDRFG FKIWHGAG ++V VSF S+FGG C+PC+IL + +  V
Sbjct  2     LSGQIADGFATIFIGELIDRFGHFKIWHGAGSVLVAVSFSSVFGG-CMPCRILSTSTLKV  60

Query  1272  QTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
             +T+ YC+ A +F  GW+ TQ++HMSMVNCITLN +SR+   SCRNAFTMVA+L LYA+ F
Sbjct  61    ETISYCVFAAIFNVGWAATQVAHMSMVNCITLNSTSRVVLTSCRNAFTMVANLSLYAIAF  120

Query  1092  FVFT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKK---DDDGHEKIGSN  934
              VF+        D++ QYRW+A+ SIFIG  FV IF    +EPR K     + H +I   
Sbjct  121   IVFSVSTAKTHADLENQYRWIAYSSIFIGCCFVGIFLSRTEEPRLKMGLRGNSHARI---  177

Query  933   TPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSF  754
               W YW K++LYYQVA +Y+ TR+V NVSQ +LA YVINDLRM QSAK+LVPAIIY+CSF
Sbjct  178   -SWAYWFKKILYYQVALVYMLTRLVVNVSQAYLAFYVINDLRMGQSAKALVPAIIYICSF  236

Query  753   ITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMM  574
             I S+LLQE+ W+G+RLK +++ GG+LW+ CGA +++LP+ M++FMY L++ +GIANALMM
Sbjct  237   IVSILLQEMAWTGQRLKAYYSAGGVLWVFCGAGILILPMNMSAFMYVLAIFVGIANALMM  296

Query  573   V  571
             V
Sbjct  297   V  297



>gb|EMS59777.1| hypothetical protein TRIUR3_17345 [Triticum urartu]
Length=370

 Score =   350 bits (897),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 189/368 (51%), Positives = 252/368 (68%), Gaps = 17/368 (5%)
 Frame = -2

Query  1332  SLFGGTCIPCKILGSDSPTVQTVGYCISAVVFCSGWSCTQISHM------------SMVN  1189
             SL    C+PCK+ G++S T++TVGY I A +F  GW+ TQ++H+            SMVN
Sbjct  6     SLLVSCCLPCKLTGTNSSTLETVGYSIFASIFNVGWAVTQVAHIISFVYIFYIFPRSMVN  65

Query  1188  CITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFT-NNAEDIKTQYRWMAfisifiggv  1012
             C+T N +SR+A VSCRNAFTMVA+L LY +   +FT   +  +  QYRW+A+ +I IG  
Sbjct  66    CMTSNPTSRVALVSCRNAFTMVANLSLYGIALLIFTLMRSVSVLVQYRWIAYTAISIGCC  125

Query  1011  fviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLA  832
             FV+ F +G KEP   +    +K  S   W +W K+VLYYQVA +Y+ TR+VTNVSQ FLA
Sbjct  126   FVVAFLIGTKEP-GLNQPSQDKSLSRISWAHWFKKVLYYQVALVYMCTRLVTNVSQAFLA  184

Query  831   VYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVV  652
              YVINDL M QS+K+LVPAIIY+CS + SV+LQE  WSG RLK +F+ G ++W+L G  +
Sbjct  185   FYVINDLGMHQSSKALVPAIIYVCSLVVSVMLQETRWSGWRLKNYFSAGAMIWILSGIGI  244

Query  651   MLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCG  472
             +LLP  M++FMYALS+ IG ANALM VTSI ME  LV + L+G AFVYGS+ FIDKV CG
Sbjct  245   VLLPSSMHNFMYALSITIGAANALMTVTSISMEGVLVGEDLNGCAFVYGSLSFIDKVSCG  304

Query  471   VALYFLESFEDADPVACNPAQAC-FSVTRFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQ  295
             +ALY LES++ +  ++ N   A  +SVTR  LG +P + +L   IV+ TM L     +++
Sbjct  305   IALYILESYQGSTKISENQELAYGYSVTRLGLGLVPAVFSLLSAIVAHTMDL--PEARRR  362

Query  294   PLAEPLLA  271
             PL EPLLA
Sbjct  363   PLVEPLLA  370



>gb|EMS58773.1| hypothetical protein TRIUR3_19915 [Triticum urartu]
Length=426

 Score =   348 bits (893),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 194/428 (45%), Positives = 273/428 (64%), Gaps = 49/428 (11%)
 Frame = -2

Query  1590  PLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQFADAFTTIIA  1411
             PLGR  VL+YGVGHMLNDIT  CW+TYLLL+L +IGL+P  AAIV L GQ AD   TI+A
Sbjct  17    PLGRWPVLSYGVGHMLNDITSACWFTYLLLFLQEIGLAPRDAAIVMLSGQVADGLMTIVA  76

Query  1410  GELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAVVFCS  1231
             GE+IDRFG+FK+WH  G ++VG+SF S+FGG C+ C ILG+DS  V+T+GY   A VF  
Sbjct  77    GEMIDRFGRFKLWHIGGSVLVGISFSSVFGG-CLLCTILGTDSYLVRTIGYSFFAAVFNI  135

Query  1230  GWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF----TNNAEDI  1063
             GW+ TQ+SHMSMVNC+T N +SR+A  SCRNA TMVA+L LY +   VF         DI
Sbjct  136   GWAATQVSHMSMVNCMTSNPTSRVAMASCRNASTMVANLGLYGIALAVFGIVKAKTCADI  195

Query  1062  KTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVLYYQVAS  883
               QY+W+A++SIF+G  F+++FH G +EP  K +   +K  +   W+YW  + LYYQVA 
Sbjct  196   VVQYKWIAYVSIFVGCCFLVLFHAGTEEPTLKCEPNCKK-RARIAWSYWFNKTLYYQVAL  254

Query  882   IYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLK  703
             +Y+  R++TNVSQ+ +A YV  DL+M++ +K+ +PAII+ CSF+ SV+LQE+ W+ +RLK
Sbjct  255   LYMLARLITNVSQSLIAFYVTRDLKMNEYSKATIPAIIFCCSFLVSVVLQEMRWNSRRLK  314

Query  702   IFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDG  523
                  G  LW++ GA V LLP +M++ +                                
Sbjct  315   SLLTIGATLWVISGAAVFLLPSQMHNLI--------------------------------  342

Query  522   SAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRFSLGFIPGIAALFGV  343
                      F+DK+ CG+AL+ LES++ A   +C   +   +V+R+  G IP   A+  +
Sbjct  343   ---------FLDKMSCGLALFVLESYDVAS--SCGEERGLNTVSRYGTGLIPACFAILAI  391

Query  342   IVSFTMKL  319
             +V+ T++L
Sbjct  392   VVASTLRL  399



>ref|XP_008350292.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X2 [Malus domestica]
Length=311

 Score =   343 bits (879),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 189/303 (62%), Positives = 225/303 (74%), Gaps = 8/303 (3%)
 Frame = -2

Query  1626  MGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLV  1447
             M     + +    LGR +V  YGVGHMLNDIT  CW+TYLLL+LTDIGLSP  AA V L 
Sbjct  1     MANATDDVDSFTTLGRSTVSYYGVGHMLNDITASCWFTYLLLFLTDIGLSPRDAATVMLS  60

Query  1446  GQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
             GQ AD F TI AGELIDRFG FK+WHGAG ++V +SF S+FGG CIPCKI G+ S T++T
Sbjct  61    GQIADGFATIFAGELIDRFGHFKLWHGAGSVLVAISFSSVFGG-CIPCKIFGTSSSTLRT  119

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
             VGY I A +F  GW+ TQ+SHMSM+NCITLN +SR+   SCRNAFTMVA+L LYAV F V
Sbjct  120   VGYSIFAAIFNVGWAATQVSHMSMLNCITLNSNSRVVLASCRNAFTMVANLSLYAVAFVV  179

Query  1086  F----TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDD-DGHEKIGSNTPWT  922
             F     +   DI+ QYRW+A++SIFIG  FV IFHLG KEPR K    G+    S   WT
Sbjct  180   FGVTRASTHADIENQYRWIAYLSIFIGCCFVGIFHLGTKEPRLKISVQGNSS--SRISWT  237

Query  921   YWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSV  742
             YW K+VLYYQVA +YV TR+V NVSQ +LA YVI+DLRM+QSAK+LVPAIIY+ SF+ S+
Sbjct  238   YWFKKVLYYQVAIVYVLTRLVVNVSQAYLAFYVIDDLRMAQSAKALVPAIIYISSFLVSI  297

Query  741   LLQ  733
             LLQ
Sbjct  298   LLQ  300



>gb|AFW89569.1| hypothetical protein ZEAMMB73_523053, partial [Zea mays]
Length=434

 Score =   341 bits (874),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 193/395 (49%), Positives = 256/395 (65%), Gaps = 43/395 (11%)
 Frame = -2

Query  1593  KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQFADAFTTII  1414
             +PLGR  VL+YGVGHMLNDIT  CW+TYLLL+L  IGL+P +AA+V L GQ AD   TI+
Sbjct  16    QPLGRWPVLSYGVGHMLNDITSACWFTYLLLFLQQIGLAPRAAAVVMLSGQVADGLMTIL  75

Query  1413  AGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAVVFC  1234
             AGE+IDRFG+FK+WH  G ++VG SF S+FGG C+ C ILG+DS  V+TVGY   A VF 
Sbjct  76    AGEMIDRFGRFKLWHIGGSVLVGFSFSSVFGG-CLLCTILGTDSYLVRTVGYSFFAAVFN  134

Query  1233  SGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF----TNNAED  1066
              GW+ TQ+SHMSMVNC+TLN +SR+A  SCRNA TMVA+L LY +   VF         D
Sbjct  135   VGWAATQVSHMSMVNCMTLNPTSRVALASCRNASTMVANLGLYGIALGVFGAIKAKEYSD  194

Query  1065  IKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVLYYQVA  886
             I TQYRW+A++SIFIG  F+++FH G KEP  K +   +K  +   W YW K+ LYYQVA
Sbjct  195   IVTQYRWIAYLSIFIGCCFLVVFHAGTKEPTLKSEPSCKK-AARISWGYWFKKTLYYQVA  253

Query  885   SIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLL----------  736
              +Y+  R++TNVSQ+ +A YV  DLRM++ +K+++PAII+ CSF  S++L          
Sbjct  254   LLYMLARLITNVSQSLIAFYVTRDLRMNEYSKAIIPAIIFCCSFFVSIVLQVQTQHLTNV  313

Query  735   --------------------------QELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIK  634
                                       QE++W+ +RLK     G  LW++ G  V +LP +
Sbjct  314   ILYCTAKLSISLRSPIYATACCCATTQEIKWTSRRLKSLLTVGATLWVISGVAVFVLPSQ  373

Query  633   MNSFMYALSVLIGIANALMMVTSIGM-ESALVDKH  532
             MNS MY L+++IG ANAL+MV+     E A   +H
Sbjct  374   MNSLMYPLAMVIGAANALVMVSKTHTAEPAPTAEH  408



>ref|XP_006585376.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X4 [Glycine max]
Length=328

 Score =   335 bits (858),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 176/330 (53%), Positives = 235/330 (71%), Gaps = 8/330 (2%)
 Frame = -2

Query  1248  AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFT----  1081
             A +F  GW+ TQ+SHMSMV+CITLN +SR+A  SCRNAFTMVA+L LYAV   VF+    
Sbjct  3     AAIFNVGWAATQVSHMSMVSCITLNSTSRVALASCRNAFTMVANLSLYAVALIVFSVING  62

Query  1080  NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVL  901
                +D++ QYRW+A++SIFIG  FV +FHL  KEPR K    H  + +   W YW KR+L
Sbjct  63    KTHDDVENQYRWIAYLSIFIGCCFVGVFHLATKEPRLKVGV-HGMVHARISWDYWFKRIL  121

Query  900   YYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEW  721
             YYQVA +YV TR+V NVSQ +LA +VINDL+M+QSAK+LVPA+IY+CSF+ S+ LQE+ W
Sbjct  122   YYQVALVYVLTRLVLNVSQAYLAFFVINDLQMAQSAKALVPALIYICSFVVSIALQEIAW  181

Query  720   SGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALV  541
             +G+ LK +++ G ILW+ CGAV++LL   M+  MY +SV IGIANALMMVT + M++ L+
Sbjct  182   TGRMLKAYYSAGCILWIFCGAVILLLTTNMSYVMYIVSVFIGIANALMMVTGVSMQNFLI  241

Query  540   DKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRFSLGFIPGI  361
              ++L+G AFV GS+ F+DK+ CG+ALY L+S ++  P      Q  FSVTR  LG +P  
Sbjct  242   GENLNGCAFVVGSLSFLDKISCGLALYVLQSNQNLSPQLQATTQFPFSVTRIGLGLVPAF  301

Query  360   AALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
              AL GV+V+ TM   + S   + L  PLLA
Sbjct  302   CALVGVVVTCTMDFHNPS---KSLTAPLLA  328



>ref|NP_001154579.1| major facilitator protein [Arabidopsis thaliana]
 gb|AEC10403.1| major facilitator protein [Arabidopsis thaliana]
Length=332

 Score =   332 bits (852),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 173/331 (52%), Positives = 241/331 (73%), Gaps = 9/331 (3%)
 Frame = -2

Query  1248  AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF----T  1081
             A +F  GW+ TQ+SHM+MVNCITLN +SR+A  S RNAF+MVA+L LYA+   VF     
Sbjct  3     AAIFNIGWAATQVSHMAMVNCITLNSTSRVALTSSRNAFSMVANLGLYAIALVVFGVSEA  62

Query  1080  NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVL  901
                E+ ++QYRW+A+ SI +G  FV+IF +G KEPR + +   E   +  PW+YW +++L
Sbjct  63    VTKENTESQYRWIAYSSITVGCCFVVIFLMGTKEPRLRINL-RETSRARIPWSYWFRKIL  121

Query  900   YYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEW  721
             YYQVA +Y+ TR+V NVSQ +LA +VI+DL+M+QSAK+L+PAIIY+CSF+ SV+LQE+ W
Sbjct  122   YYQVAMVYLLTRLVLNVSQAYLAFFVIDDLQMAQSAKALIPAIIYVCSFVVSVMLQEIPW  181

Query  720   SGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALV  541
             +GKRLK ++  GGI+W+ CG  ++LLP  +NS+MYA+SV IGIANA+M+VTSI M+S L+
Sbjct  182   NGKRLKAYYCAGGIIWIFCGISILLLPRSINSYMYAISVFIGIANAVMLVTSISMQSVLI  241

Query  540   DKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP-VACNPAQA-CFSVTRFSLGFIP  367
                L G AFV GS+ F+DK+ CG+ALY L+S +   P V  N  +   FSVTR+ LG +P
Sbjct  242   GSKLGGCAFVCGSLSFLDKMSCGLALYVLQSHQGTSPKVDVNIKEYFYFSVTRYGLGLVP  301

Query  366   GIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
              + +L GV+V++ M+L  T  K  PL +PLL
Sbjct  302   AVCSLVGVVVTYFMELDSTILK--PLCQPLL  330



>ref|XP_006438999.1| hypothetical protein CICLE_v10031412mg [Citrus clementina]
 ref|XP_006439002.1| hypothetical protein CICLE_v10031412mg [Citrus clementina]
 ref|XP_006439004.1| hypothetical protein CICLE_v10031412mg [Citrus clementina]
 gb|ESR52239.1| hypothetical protein CICLE_v10031412mg [Citrus clementina]
 gb|ESR52242.1| hypothetical protein CICLE_v10031412mg [Citrus clementina]
 gb|ESR52244.1| hypothetical protein CICLE_v10031412mg [Citrus clementina]
 gb|KDO46034.1| hypothetical protein CISIN_1g011925mg [Citrus sinensis]
Length=318

 Score =   331 bits (848),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 181/307 (59%), Positives = 223/307 (73%), Gaps = 13/307 (4%)
 Frame = -2

Query  1629  IMGRDNREEEE-EKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVT  1453
             +M  D   ++   +P+GR SVL YG GHMLNDIT  CW+TYLLL+LTDIGLSP  AA V 
Sbjct  6     VMNYDIENDDSFTQPVGRWSVLYYGSGHMLNDITAACWFTYLLLFLTDIGLSPRGAAAVM  65

Query  1452  LVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTV  1273
             L GQ AD F TI  GELIDRFG FKIWHGAG ++V VSF S+FGG C+PC+IL + +  V
Sbjct  66    LSGQIADGFATIFIGELIDRFGHFKIWHGAGSVLVAVSFSSVFGG-CMPCRILSTSTLKV  124

Query  1272  QTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
             +T+ YC+ A +F  GW+ TQ++HMSMVNCITLN +SR+   SCRNAFTMVA+L LYA+ F
Sbjct  125   ETISYCVFAAIFNVGWAATQVAHMSMVNCITLNSTSRVVLTSCRNAFTMVANLSLYAIAF  184

Query  1092  FVFT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKK---DDDGHEKIGSN  934
              VF+        D++ QYRW+A+ SIFIG  FV IF    +EPR K     + H +I   
Sbjct  185   IVFSVSTAKTHADLENQYRWIAYSSIFIGCCFVGIFLSRTEEPRLKMGLRGNSHARI---  241

Query  933   TPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSF  754
               W YW K++LYYQVA +Y+ TR+V NVSQ +LA YVINDLRM QSAK+LVPAIIY+CSF
Sbjct  242   -SWAYWFKKILYYQVALVYMLTRLVVNVSQAYLAFYVINDLRMGQSAKALVPAIIYICSF  300

Query  753   ITSVLLQ  733
             I S+LLQ
Sbjct  301   IVSILLQ  307



>ref|XP_010506348.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X3 [Camelina sativa]
Length=332

 Score =   330 bits (847),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 172/331 (52%), Positives = 238/331 (72%), Gaps = 9/331 (3%)
 Frame = -2

Query  1248  AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF----T  1081
             A +F  GW+ TQ+SHM+MVNCITLN +SR+A  S RNAF+MVA+L LYA+   VF     
Sbjct  3     AAIFNIGWAATQVSHMAMVNCITLNSTSRVALTSSRNAFSMVANLGLYAIALVVFGVSEA  62

Query  1080  NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVL  901
                E  + QYRW+A+ SI +G  FV+IF +G KEPR + D   E   +  PW++W +++L
Sbjct  63    VTKESTECQYRWIAYSSITVGCCFVVIFLMGTKEPRLRIDL-KESCRARIPWSHWFRKIL  121

Query  900   YYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEW  721
             YYQVA +Y+ TR+V NVSQ +LA +VI+DL+M+QSAK+L+PAIIY+CSF+ SV+LQE+ W
Sbjct  122   YYQVAMVYLLTRLVLNVSQAYLAFFVIDDLQMAQSAKALIPAIIYICSFVVSVMLQEIPW  181

Query  720   SGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALV  541
             +GKRLK ++  GGI+W+ CG  ++LL   +NS+MYA+S+ IGIANALM+VT+I M+S L+
Sbjct  182   NGKRLKAYYCAGGIIWIFCGVAILLLSRSINSYMYAISIFIGIANALMLVTAISMQSVLI  241

Query  540   DKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP-VACNPAQA-CFSVTRFSLGFIP  367
                L G AFV GS+ F+DK+ CG+ALY L+S +   P V  N  Q   FSVTR+ LG +P
Sbjct  242   GSELGGCAFVCGSLSFLDKMSCGLALYVLQSHQSTSPKVDVNINQHFYFSVTRYGLGLVP  301

Query  366   GIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
              + +L GV+V++ M+L  T  K  PL +PLL
Sbjct  302   AVCSLIGVVVTYFMELDSTILK--PLRQPLL  330



>gb|AAM97768.1| hypothetical protein [Arabidopsis thaliana]
Length=332

 Score =   328 bits (842),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 171/331 (52%), Positives = 239/331 (72%), Gaps = 9/331 (3%)
 Frame = -2

Query  1248  AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF----T  1081
             A +F  GW+ TQ+SHM+MVNCITLN +SR+A  S RNAF+MVA+L LYA+   VF     
Sbjct  3     AAIFNIGWAATQVSHMAMVNCITLNSTSRVALTSSRNAFSMVANLGLYAIALVVFGVSEA  62

Query  1080  NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVL  901
                E+ ++QYRW+A+ SI +G  FV+IF +G KEPR + +   E   +  PW+YW +++L
Sbjct  63    VTKENTESQYRWIAYSSITVGCCFVVIFLMGTKEPRLRINL-RETSRARIPWSYWFRKIL  121

Query  900   YYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEW  721
             YYQVA +Y+ TR+V NVSQ +LA +VI+DL+M+QSA +L+PAIIY+CSF+ SV+LQE+ W
Sbjct  122   YYQVAMVYLLTRLVLNVSQAYLAFFVIDDLQMAQSAXALIPAIIYVCSFVVSVMLQEIPW  181

Query  720   SGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALV  541
             +GKRLK ++  GGI+W+ CG  ++LLP  +NS+MYA+SV  GIANA+M+VTSI M+S L+
Sbjct  182   NGKRLKTYYCAGGIIWIFCGISILLLPRSINSYMYAISVFXGIANAVMLVTSISMQSVLI  241

Query  540   DKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP-VACNPAQA-CFSVTRFSLGFIP  367
                L G AFV GS+ F+DK+ CG+ALY L+S +   P V  N  +   FSVTR+ LG +P
Sbjct  242   GSKLGGCAFVCGSLSFLDKMSCGLALYVLQSHQGTSPKVDVNIKEYFYFSVTRYGLGLVP  301

Query  366   GIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
              + +L GV+V++ M+L  T  K  PL +PLL
Sbjct  302   AVCSLVGVVVTYFMELDSTILK--PLCQPLL  330



>ref|XP_006438998.1| hypothetical protein CICLE_v10031412mg [Citrus clementina]
 gb|ESR52238.1| hypothetical protein CICLE_v10031412mg [Citrus clementina]
Length=284

 Score =   326 bits (835),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/285 (57%), Positives = 212/285 (74%), Gaps = 12/285 (4%)
 Frame = -2

Query  1452  LVGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTV  1273
             L GQ AD F TI  GELIDRFG FKIWHGAG ++V VSF S+FGG C+PC+IL + +  V
Sbjct  2     LSGQIADGFATIFIGELIDRFGHFKIWHGAGSVLVAVSFSSVFGG-CMPCRILSTSTLKV  60

Query  1272  QTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
             +T+ YC+ A +F  GW+ TQ++HMSMVNCITLN +SR+   SCRNAFTMVA+L LYA+ F
Sbjct  61    ETISYCVFAAIFNVGWAATQVAHMSMVNCITLNSTSRVVLTSCRNAFTMVANLSLYAIAF  120

Query  1092  FVFT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKK---DDDGHEKIGSN  934
              VF+        D++ QYRW+A+ SIFIG  FV IF    +EPR K     + H +I   
Sbjct  121   IVFSVSTAKTHADLENQYRWIAYSSIFIGCCFVGIFLSRTEEPRLKMGLRGNSHARI---  177

Query  933   TPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSF  754
               W YW K++LYYQVA +Y+ TR+V NVSQ +LA YVINDLRM QSAK+LVPAIIY+CSF
Sbjct  178   -SWAYWFKKILYYQVALVYMLTRLVVNVSQAYLAFYVINDLRMGQSAKALVPAIIYICSF  236

Query  753   ITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFM  619
             I S+LLQE+ W+G+RLK +++ GG+LW+ CGA +++LP+ M++FM
Sbjct  237   IVSILLQEMAWTGQRLKAYYSAGGVLWVFCGAGILILPMNMSAFM  281



>gb|KDO46028.1| hypothetical protein CISIN_1g011925mg [Citrus sinensis]
 gb|KDO46029.1| hypothetical protein CISIN_1g011925mg [Citrus sinensis]
 gb|KDO46030.1| hypothetical protein CISIN_1g011925mg [Citrus sinensis]
 gb|KDO46031.1| hypothetical protein CISIN_1g011925mg [Citrus sinensis]
Length=326

 Score =   321 bits (822),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 172/331 (52%), Positives = 228/331 (69%), Gaps = 29/331 (9%)
 Frame = -2

Query  1197  MVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFT----NNAEDIKTQYRWMAfis  1030
             MVNCITLN +SR+   SCRNAFTMVA+L LYA+ F VF+        D++ QYRW+A+ S
Sbjct  1     MVNCITLNSTSRVVLTSCRNAFTMVANLSLYAIAFIVFSVSTAKTHADLENQYRWIAYSS  60

Query  1029  ifiggvfviiFHLGVKEPRKK---DDDGHEKIGSNTPWTYWLKRVLYYQVASIYVFTRVV  859
             IFIG  FV IF    +EPR K     + H +I     W YW K++LYYQVA +Y+ TR+V
Sbjct  61    IFIGCCFVGIFLSRTEEPRLKMGLRGNSHARIS----WAYWFKKILYYQVALVYMLTRLV  116

Query  858   TNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGI  679
              NVSQ +LA YVINDLRM QSAK+LVPAIIY+CSFI S+LLQE+ W+G+RLK +++ GG+
Sbjct  117   VNVSQAYLAFYVINDLRMGQSAKALVPAIIYICSFIVSILLQEMAWTGQRLKAYYSAGGV  176

Query  678   LWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSM  499
             LW+ CGA +++LP+ M++FMY L++ +GIANALMMVT I M++ LV + L G AFV G++
Sbjct  177   LWVFCGAGILILPMNMSAFMYVLAIFVGIANALMMVTGISMQNVLVGEDLSGCAFVCGTL  236

Query  498   GFIDKVLCGVALYFLESFEDADPVACNP----------------AQACFSVTRFSLGFIP  367
              F+DK+ CG+A+Y L+S++   P   +                 + +  SVTRF LG IP
Sbjct  237   SFLDKMSCGIAVYVLQSYQSMSPTVLDNNSSITSLTVLDNNSLISTSYISVTRFGLGLIP  296

Query  366   GIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
              I +L  V V+FTMK LHT + K PL EPLL
Sbjct  297   AICSLVSVAVTFTMK-LHTPYSK-PLVEPLL  325



>ref|XP_006438995.1| hypothetical protein CICLE_v10031412mg [Citrus clementina]
 ref|XP_006439005.1| hypothetical protein CICLE_v10031412mg [Citrus clementina]
 gb|ESR52235.1| hypothetical protein CICLE_v10031412mg [Citrus clementina]
 gb|ESR52245.1| hypothetical protein CICLE_v10031412mg [Citrus clementina]
Length=326

 Score =   317 bits (811),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 170/331 (51%), Positives = 227/331 (69%), Gaps = 29/331 (9%)
 Frame = -2

Query  1197  MVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFT----NNAEDIKTQYRWMAfis  1030
             MVNCITLN +SR+   SCRNAFTMVA+L LYA+ F VF+        D++ QYRW+A+ S
Sbjct  1     MVNCITLNSTSRVVLTSCRNAFTMVANLSLYAIAFIVFSVSTAKTHADLENQYRWIAYSS  60

Query  1029  ifiggvfviiFHLGVKEPRKK---DDDGHEKIGSNTPWTYWLKRVLYYQVASIYVFTRVV  859
             IFIG  FV IF    +EPR K     + H +I     W YW K++LYYQVA +Y+ TR+V
Sbjct  61    IFIGCCFVGIFLSRTEEPRLKMGLRGNSHARIS----WAYWFKKILYYQVALVYMLTRLV  116

Query  858   TNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGI  679
              NVSQ +LA YVINDLRM QSAK+LVPAIIY+CSFI S+LLQE+ W+G+RLK +++ GG+
Sbjct  117   VNVSQAYLAFYVINDLRMGQSAKALVPAIIYICSFIVSILLQEMAWTGQRLKAYYSAGGV  176

Query  678   LWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSM  499
             LW+ CGA +++LP+ M++FMY L++ +GIANALMMVT I M++ L+ + L G AFV G++
Sbjct  177   LWVFCGAGILILPMNMSAFMYVLAIFVGIANALMMVTGISMQNVLIGEDLSGCAFVCGTL  236

Query  498   GFIDKVLCGVALYFLESFEDADPVACNP----------------AQACFSVTRFSLGFIP  367
              F+DK+ CG+A+Y L+S++   P   +                 + +  SVTRF LG IP
Sbjct  237   SFLDKMSCGIAVYVLQSYQSMSPTVLDNNSSITSLTVLDNNSLISTSYISVTRFGLGLIP  296

Query  366   GIAALFGVIVSFTMKLLHTSHKKQPLAEPLL  274
              I +L  V V+ TMK LHT + K PL EPLL
Sbjct  297   AICSLVSVAVTCTMK-LHTPYSK-PLVEPLL  325



>gb|KCW75597.1| hypothetical protein EUGRSUZ_E04336 [Eucalyptus grandis]
Length=290

 Score =   315 bits (807),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 175/293 (60%), Positives = 214/293 (73%), Gaps = 13/293 (4%)
 Frame = -2

Query  1626  MGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLV  1447
             MG D   +   K +GR SV  YG GHMLNDIT  CW+TYLLL+LTDIGLSP  AA+V L 
Sbjct  5     MGDD---DSYSKSVGRWSVFYYGAGHMLNDITSACWFTYLLLFLTDIGLSPRDAAVVMLS  61

Query  1446  GQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
             GQ AD   TI +GELIDRFG FK+WH AG I+V +SF S+FGG CIPC I GSDS T++T
Sbjct  62    GQVADGLATIFSGELIDRFGHFKVWHLAGSILVAISFSSVFGG-CIPCNIFGSDSLTMET  120

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
             +GY + A +F  GW+ TQ+SHMSM+NCITLN +SR+   SCRNAFTMVA+L LYAV   V
Sbjct  121   IGYSVFAAIFNVGWAATQVSHMSMINCITLNSTSRVVLASCRNAFTMVANLSLYAVAGIV  180

Query  1086  FT----NNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDD--GHEKIGSNTPW  925
             FT    N  +DI+ QYRW+A++SI +G  FV IFHLG +EPR K +   G++   +   W
Sbjct  181   FTTTSSNTHDDIENQYRWIAYLSIAVGCCFVGIFHLGTREPRLKANACVGNQ---ARISW  237

Query  924   TYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIY  766
              YW K+VLYYQVA +YV TR+V NVSQ +LA YVINDLRM QSAK+LV + I+
Sbjct  238   DYWFKKVLYYQVALVYVLTRLVVNVSQAYLAFYVINDLRMIQSAKALVYSEIF  290



>ref|XP_010257582.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X4 [Nelumbo nucifera]
 ref|XP_010257583.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X4 [Nelumbo nucifera]
Length=414

 Score =   300 bits (767),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 169/279 (61%), Positives = 203/279 (73%), Gaps = 6/279 (2%)
 Frame = -2

Query  1608  EEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQFADA  1429
             EE   KPLGR SV  YGVGHMLNDIT  CW+TYLL++LTDIGL+P + A V L GQ AD 
Sbjct  37    EESWSKPLGRASVFYYGVGHMLNDITSACWFTYLLVFLTDIGLTPRNTATVMLSGQIADG  96

Query  1428  FTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCIS  1249
             FTTI AGELIDRFG FKIWHGAG ++V VSF S+F G C+PCKI  ++S  + T+ Y   
Sbjct  97    FTTIFAGELIDRFGHFKIWHGAGSVLVAVSFSSVF-GICLPCKIFRTNSSAILTISYSTF  155

Query  1248  AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTNNAE  1069
             A +F  GW+ TQ+SHMSMVNCITLN ++R+   SCRNAFTMVA+L LYAV   VF  +  
Sbjct  156   AAIFNVGWAATQVSHMSMVNCITLNPTTRVVLASCRNAFTMVANLSLYAVALTVFNVSKP  215

Query  1068  ----DIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTPWTYWLKRVL  901
                 DI+ QYRW+A++SIFIG  FV IF +G KEPR K    H        W +W K+VL
Sbjct  216   RTPIDIENQYRWIAYLSIFIGCCFVSIFLIGTKEPRLKQGI-HGTSNHRISWAHWFKKVL  274

Query  900   YYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSL  784
             YYQVA +YV TR+VTNVSQ FLA YVINDL+M+QS+K+L
Sbjct  275   YYQVAIVYVLTRLVTNVSQAFLAFYVINDLQMAQSSKAL  313



>ref|NP_001167750.1| hypothetical protein [Zea mays]
 gb|ACN25959.1| unknown [Zea mays]
 tpg|DAA41218.1| TPA: hypothetical protein ZEAMMB73_846771 [Zea mays]
Length=201

 Score =   230 bits (587),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 149/198 (75%), Gaps = 5/198 (3%)
 Frame = -2

Query  1620  RDNREEEE---EKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTL  1450
             RDN    +   ++PLGR S+L+YG GHMLNDIT  CW+TYLL++LTD+GLSP  AAIV L
Sbjct  5     RDNDSSSDAQLDEPLGRVSILSYGSGHMLNDITSSCWFTYLLVFLTDLGLSPGDAAIVML  64

Query  1449  VGQFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQ  1270
              GQ AD FTTI  GEL+DRFG FK+WH  G I+V +SF S+F G+C+PCK++G ++ T++
Sbjct  65    SGQLADGFTTIFVGELMDRFGHFKLWHAGGSILVAISFSSVF-GSCVPCKLMGINTSTLE  123

Query  1269  TVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFF  1090
             TVGY   A +F  GW+ TQ++HMSMVNCIT N +SR++ VSCRNAFTMVA+L LY V   
Sbjct  124   TVGYSTFAAIFNVGWAVTQVAHMSMVNCITSNPTSRVSLVSCRNAFTMVANLSLYGVALV  183

Query  1089  VFT-NNAEDIKTQYRWMA  1039
             +FT   + ++  QYRW+A
Sbjct  184   IFTLLQSVNVLVQYRWIA  201



>emb|CAN59826.1| hypothetical protein VITISV_016657 [Vitis vinifera]
Length=595

 Score =   228 bits (581),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 145/194 (75%), Gaps = 7/194 (4%)
 Frame = -2

Query  1617  DNREEEEE--KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVG  1444
             D  E+++   KPLGR +V  YGVGHMLNDIT  CW+TYLL++LTDIGL    AA V L G
Sbjct  231   DGMEDDDAFTKPLGRQAVFYYGVGHMLNDITSACWFTYLLVFLTDIGLPSRDAATVMLSG  290

Query  1443  QFADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTV  1264
             Q AD FTTI AGELIDRFG FKIWHGA  I+V VSF S+FGG C+PCKI GS+S T+QTV
Sbjct  291   QIADGFTTIFAGELIDRFGHFKIWHGAXSILVAVSFSSVFGG-CLPCKIFGSNSSTLQTV  349

Query  1263  GYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF  1084
             GY + A +F  GW+ TQ+SHMSMVNCITLN +SR+   SCRNAFTMVA+L LYAV F VF
Sbjct  350   GYSMFAAIFNVGWAATQVSHMSMVNCITLNSTSRVVLASCRNAFTMVANLSLYAVAFVVF  409

Query  1083  TNNAE----DIKTQ  1054
              ++      DI+ Q
Sbjct  410   NSSKPHTLVDIENQ  423


 Score =   150 bits (378),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 97/135 (72%), Gaps = 17/135 (13%)
 Frame = -2

Query  849  SQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWL  670
            +Q FLA YVINDL+MSQS+K+L                 E  WSG+RLK F++ GGILW+
Sbjct  422  NQAFLAFYVINDLQMSQSSKAL-----------------EFTWSGQRLKAFYSAGGILWI  464

Query  669  LCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFI  490
            +CGA ++ LP  MN+FMY LS++IGIANALMMVT + M+S LV + L G AFVYGS+ F+
Sbjct  465  ICGAGILFLPRNMNAFMYILSIIIGIANALMMVTGVSMQSFLVGEDLHGCAFVYGSLSFL  524

Query  489  DKVLCGVALYFLESF  445
            DK+ CG+AL+ LES+
Sbjct  525  DKISCGLALFVLESY  539



>ref|XP_008461432.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Cucumis melo]
Length=313

 Score =   201 bits (511),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 141/197 (72%), Gaps = 6/197 (3%)
 Frame = -2

Query  852  VSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILW  673
            + Q FLA YVINDL M+QSA +LVPAIIY+ SFI SV+LQE+ W+G+RLKI+++ GGI+W
Sbjct  118  IDQAFLAYYVINDLHMAQSATALVPAIIYVFSFIISVVLQEVVWTGQRLKIYYSAGGIIW  177

Query  672  LLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGF  493
            + CGA +++LP  +++FMY +S  IGIANALMMVT + M+S LV   L+G AFV GS+ F
Sbjct  178  MFCGAAILILPSSLSAFMYVMSTFIGIANALMMVTGVSMQSVLVGTDLNGCAFVCGSLSF  237

Query  492  IDKVLCGVALYFLESFEDADPVACN---PAQACF-SVTRFSLGFIPGIAALFGVIVSFTM  325
            +DK+ CG+ALYFLESF+ +  +  +   P  A + SVTR+ LG +P + A  GV V+ +M
Sbjct  238  LDKISCGLALYFLESFQSSTALHVSGNTPLNATYISVTRYGLGLVPAVCAFLGVAVTISM  297

Query  324  KLLHTSHKKQPLAEPLL  274
             L   +   + L E LL
Sbjct  298  NL--GAPYAKYLTESLL  312


 Score =   129 bits (325),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 79/105 (75%), Gaps = 1/105 (1%)
 Frame = -2

Query  1617  DNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSSAAIVTLVGQF  1438
             D       +P+GR S+  +G+GHMLNDIT  CW+TYLLL+LTDIGLSP +AA V L GQ 
Sbjct  5     DESSLSHTQPIGRWSIFCFGLGHMLNDITAACWFTYLLLFLTDIGLSPGNAATVMLSGQV  64

Query  1437  ADAFTTIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPC  1303
             AD  TTI AGELIDRFG  KIWHGAG ++V VSF S+FGG C+PC
Sbjct  65    ADGVTTIFAGELIDRFGHLKIWHGAGSVLVAVSFSSVFGG-CLPC  108



>ref|XP_006639984.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Lepisosteus oculatus]
Length=484

 Score =   203 bits (516),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 137/429 (32%), Positives = 232/429 (54%), Gaps = 39/429 (9%)
 Frame = -2

Query  1599  EEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFT  1423
             +E+ +  CS L+Y VGH LND+    W+TYLL+Y   + G   + A I+ LVGQ AD   
Sbjct  3     DERSMPLCSRLSYSVGHFLNDLCASMWFTYLLVYYHSVLGFQNTCAGILLLVGQIADGVC  62

Query  1422  TIIAGELIDR------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVG  1261
             T + G   DR      +G+ K WH  G + V +SF  +F     PC   G ++P    + 
Sbjct  63    TPLIGYESDRTPGCGRYGKRKSWHLVGTVSVLLSFPFIFN----PCIGCGQETPQWVGLT  118

Query  1260  YCIS-AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF  1084
             Y I   V+F  GW+ TQISH+S++  +  N+  ++   + R AFT++A++ +YAV + +F
Sbjct  119   YFIPFIVIFQFGWAATQISHLSLIPELVTNDHEKVELTAYRYAFTVIANITVYAVAWLLF  178

Query  1083  TNNAEDIK-------------TQYRWMAfisifiggvfviiFHLGVKE-----PRKKDDD  958
                A  +              + +R +A I + +G VF ++FH+G KE     P+  D+D
Sbjct  179   KFQAGQVDDPAMTDSLGWQDVSVFRNLALIVVGLGAVFSLLFHVGTKEKGLVLPKPADED  238

Query  957   GH-EKIGSNTP------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQ  799
             G  + +    P      W +WLK   +YQVA +Y+ TR++ N+SQT++++Y+ N L + +
Sbjct  239   GERQPVLQRAPPHSLMQWKHWLKEPAFYQVAMLYMCTRLIVNMSQTYISMYLTNSLMLPK  298

Query  798   SAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFM  619
             +  + +P ++Y+  F++S+ ++ +     R   +F   G+L +L  A  +++ +KM   +
Sbjct  299   NYIATIPLVMYVSGFVSSLFMKPVSRLIGRYMTYFV--GLLLILAFAYWVMVDVKMGKAV  356

Query  618   YALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFED  439
             Y  +VL+G  +A ++V S+ M + L+       AFVYG+M F DKV  GV +  ++S   
Sbjct  357   YGAAVLLGAGSATILVMSLSMTADLIGNQTQSGAFVYGAMSFTDKVANGVGVVIIQSLHP  416

Query  438   ADPVACNPA  412
                  C PA
Sbjct  417   CHTQICCPA  425



>ref|XP_008621163.1| hypothetical protein SDRG_16723 [Saprolegnia diclina VS20]
 gb|EQC25396.1| hypothetical protein SDRG_16723 [Saprolegnia diclina VS20]
Length=506

 Score =   188 bits (478),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 142/494 (29%), Positives = 247/494 (50%), Gaps = 59/494 (12%)
 Frame = -2

Query  1605  EEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIG-LSPSSAAIVTLVGQFADA  1429
              +  K      +L+YGVG++LND+    W++YLL++L D+  LSP   AIV   GQ AD 
Sbjct  3     SKSSKQWTTAKILSYGVGNVLNDMCASSWFSYLLVFLNDVAKLSPVDGAIVMFSGQIADG  62

Query  1428  FTTIIAGELIDR--------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTV  1273
               T + G L DR        FG+ K W+  GC++V + F  +FG  C+P     + S TV
Sbjct  63    IATPLVGVLSDRSTGFPSIGFGRRKTWNAGGCVLVMLCFFFVFGA-CLPRWFTDAPSSTV  121

Query  1272  QTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
               + YC +A +F  GW+  Q+SHM+MV  ++ N++ R+   S R AFT+++++M++   F
Sbjct  122   LVLYYCTAASLFNVGWAAVQVSHMAMVPELSSNDNIRVILNSVRYAFTILSNVMVFIAFF  181

Query  1092  FVFTN----NAEDIKTQYRWMAfisifiggvfviiFHLGVKEP--------------RKK  967
             F+  +    N  D + ++  +   ++ +GG+    F +G +E               R+ 
Sbjct  182   FLLHDVSPYNVPD-QLKFTLLTIFTMVVGGLCTFYFLIGTEEKCGPTNVAEIQSLRARRN  240

Query  966   D----DDGHE---------KIGSNTP---------WTYWLKRVLYYQVASIYVFTRVVTN  853
                  D GH           +   TP         W  W K  ++Y+V  +Y+ TR+  N
Sbjct  241   SPAVLDHGHRGPADMPFEADLAPMTPVFATATAMTWKCWFKVCMFYEVGMVYMCTRLSVN  300

Query  852   VSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILW  673
             V+Q ++  ++   L M+ ++ ++VP ++YL  F+ +  ++ +     R   F  G G++ 
Sbjct  301   VTQVYIPFFLTISLHMNAASMAIVPLLVYLSGFVATFGMRYMNDRMGREGTFAFGTGLM-  359

Query  672   LLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGF  493
             +L       L I+ + ++Y LS L+G   +++MVTS+ +E  LV    +  AFVYG+M F
Sbjct  360   VLSLIASWYLTIETSHWIYPLSTLLGFGQSVVMVTSVCLEGDLVGDQNESGAFVYGAMSF  419

Query  492   IDKVLCGVALYFLESFEDADPVACNPAQACFSVTRFSLGFIPGIAALFGVIVSFTMKL--  319
              DK+  G+A+  +   ++A     N A A     R     +PG+A + G I  + M+   
Sbjct  420   TDKISNGIAVLLI---QNARQALTNDALADAYFVRQIYCLVPGLAVVLGAITLYWMRYGS  476

Query  318   --LHTSHKKQPLAE  283
               L+   ++Q + E
Sbjct  477   GTLNLKPRRQSVHE  490



>ref|NP_001011396.1| major facilitator superfamily domain containing 12 [Xenopus (Silurana) 
tropicalis]
 gb|AAH88599.1| hypothetical LOC496869 [Xenopus (Silurana) tropicalis]
Length=493

 Score =   187 bits (474),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 142/451 (31%), Positives = 234/451 (52%), Gaps = 50/451 (11%)
 Frame = -2

Query  1587  LGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTIIA  1411
             L  C  L+Y  GH LND+    W+TY L+Y   + G     A I+ L+GQ AD   T + 
Sbjct  7     LPLCQRLSYATGHFLNDLCASMWFTYFLVYFHSVLGFDSFYAGILLLIGQIADGICTPLV  66

Query  1410  GELIDR------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVG--YC  1255
             G   DR      +G+ K WH  G I V +SF  +F       + LG    T Q VG  Y 
Sbjct  67    GYESDRHPGLLSYGRRKSWHLVGTISVVLSFPFIFN------QCLGCTQNTPQWVGLIYF  120

Query  1254  IS-AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF--  1084
             I   V+F  GW+ TQISH+S++  ++ N+  ++   + R AFT++A++ +YAV + +   
Sbjct  121   IPFIVIFQFGWAATQISHLSLIPELSQNDHDKVELTAFRYAFTVMANITVYAVAWLLLHF  180

Query  1083  ------TNNAEDIKTQ----YRWMAfisifiggvfviiFHLGVKEP-----RKKDDDGHE  949
                   T N E++  Q    +R +A I + +G +F ++FH+G KE      R  + D  +
Sbjct  181   HMGEDKTENMENLSRQDIPIFRALALIMVGVGSLFSLLFHIGTKEKPQTFHRLLETDDPD  240

Query  948   KIGSNTP-----------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMS  802
                S  P           W  WL    +YQVA +Y+ TR++ N+SQTF+AVY+ N L + 
Sbjct  241   SPHSEEPRLSEPPVPLMVWKRWLMEPSFYQVAVLYMCTRLIVNLSQTFIAVYLTNSLHLP  300

Query  801   QSAKSLVPAIIYLCSFITSVLLQEL-EWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNS  625
             ++  + +P ++Y+  F++S L++ + +W G+ L  F    G++ +   A  + L   +  
Sbjct  301   KNYIATIPLVMYVSGFVSSFLMKPINKWIGRNLTYFL---GLIAIAAFAAWVALDPGLGV  357

Query  624   FMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESF  445
              +Y  +V++G  +A ++VTS+ M + L+  H   +AFVYG+M F DKV  G+A+  ++S 
Sbjct  358   AVYGAAVILGTGSATILVTSLSMTADLIGTHSRSAAFVYGAMSFTDKVANGLAVVAIQSL  417

Query  444   EDADPVACNPAQACFSVTRFSLGFIPGIAAL  352
                    C P  AC     + +  + G+ A+
Sbjct  418   HPCRTQVCCP--ACIPFYHWVMVTVTGVVAI  446



>gb|KDO20875.1| hypothetical protein SPRG_14106 [Saprolegnia parasitica CBS 223.65]
Length=495

 Score =   187 bits (474),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 140/483 (29%), Positives = 246/483 (51%), Gaps = 48/483 (10%)
 Frame = -2

Query  1605  EEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIG-LSPSSAAIVTLVGQFADA  1429
              +  K      +L+YGVG++LND+    W++YLL++L D+  LSP   AIV   GQ AD 
Sbjct  3     SKSSKQWTTAKILSYGVGNVLNDMCASSWFSYLLVFLNDVAKLSPVDGAIVMFSGQIADG  62

Query  1428  FTTIIAGELIDR--------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTV  1273
               T + G L DR        FG+ K W+  GC++V + F  +FG  C+P     + S TV
Sbjct  63    IATPLVGVLSDRSTGFPSIGFGRRKTWNAGGCVLVMLCFFFVFGA-CLPRWFTDAPSSTV  121

Query  1272  QTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
               + YC +A +F  GW+  Q+SHM+MV  ++ N++ R+   S R AFT+++++M++   F
Sbjct  122   LVLYYCTAASLFNVGWAAVQVSHMAMVPELSSNDNIRVILNSVRYAFTILSNVMVFIAFF  181

Query  1092  FVFTN----NAEDIKTQYRWMAfisifiggvfviiFHLGVKEP--------------RKK  967
             F+  +    N  D + ++  +   ++ +GG+    F +G +E               R+ 
Sbjct  182   FLLHDVSPYNVPD-QLKFTLLTIFTMVVGGLCTFYFLIGTEEKCGPTTVAEIQSLRARRN  240

Query  966   D----DDGHEKIGSN------TPWTY-WLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVI  820
                  D GH            TP T  W K  ++Y+V  +Y+ TR+  NV+Q ++  ++ 
Sbjct  241   SPAVLDHGHRGPADMPFEADLTPMTPCWFKVCMFYEVGMVYMCTRLSVNVTQVYIPFFLT  300

Query  819   NDLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLP  640
               L M+ ++ ++VP ++YL  F+ +  ++ +     R   F  G G++ +L       L 
Sbjct  301   ISLHMNAASMAIVPLLVYLSGFVATFGMRYMNDRMGREGTFAFGTGLM-VLSLVACWYLT  359

Query  639   IKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALY  460
             ++ + ++Y LS ++G   +++MVTS+ +E  LV    +  AFVYG+M F DK+  G+A+ 
Sbjct  360   VETSHWIYPLSTMLGFGQSVVMVTSVCLEGDLVGDQNESGAFVYGAMSFTDKISNGIAVL  419

Query  459   FLESFEDADPVACNPAQACFSVTRFSLGFIPGIAALFGVIVSFTMKL----LHTSHKKQP  292
              +   ++A     N A A     R     +PG+A + G I  + M+     L+   ++Q 
Sbjct  420   LI---QNARQALTNDALADAYFVRQIYCLVPGLAVVLGAITLYWMRYGSGTLNLKPRRQS  476

Query  291   LAE  283
             + E
Sbjct  477   VHE  479



>ref|XP_003459227.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Oreochromis niloticus]
 ref|XP_005464586.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X2 [Oreochromis niloticus]
Length=474

 Score =   186 bits (471),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 132/418 (32%), Positives = 227/418 (54%), Gaps = 39/418 (9%)
 Frame = -2

Query  1569  LTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTIIAGELIDR  1393
             L+Y VGH LND+    W+TYLL++   + G   +SA ++ LVGQ AD   T + G   DR
Sbjct  14    LSYAVGHFLNDLCASMWFTYLLVFYHSVLGFQNTSAGVLLLVGQIADGICTPLIGYESDR  73

Query  1392  ------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCIS-AVVFC  1234
                   +G+ K WH  G + V +SF  +F   C+ C    S +P   ++ Y +   ++F 
Sbjct  74    SPGCRNYGKRKTWHLVGTLSVVLSFAFIFN-QCVGCS---SLTPQWASLIYFVPFIIIFQ  129

Query  1233  SGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF---TNNAEDI  1063
              GW+ TQISH+S++  +   E +++   + R AFT++A++ +Y V + +F      AED 
Sbjct  130   FGWAATQISHLSLIPELVTCEHAKVELTAYRYAFTVIANITVYGVAYLLFHVQAGAAEDP  189

Query  1062  KTQ-------YRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTP--------  928
              +        +R ++ I + IG VF ++FH+G KE     ++  E  G   P        
Sbjct  190   DSLGPADIIIFRNLSLIVLGIGVVFSVVFHVGTKENNGTSEESVEAEGERRPLLPRSNTF  249

Query  927   -----WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYL  763
                  W  WL++  +YQVA +Y+ TR++ N+SQT++++Y+IN L + +   + +P ++Y+
Sbjct  250   SSLLQWKCWLRQPSFYQVAVLYMSTRLIVNLSQTYISMYLINTLGLPKKFIATIPLVMYV  309

Query  762   CSFITSVLLQEL-EWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIAN  586
               F++S +++ + +  GK L  F    G+L ++  +  +LL I M   +Y  +VL+G  +
Sbjct  310   SGFLSSFIMKPVSKLIGKCLTYFV---GLLLIMAFSYWVLLDITMGQQVYGAAVLLGAGS  366

Query  585   ALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPA  412
             A ++V S+ M + L+       AFVYG+M F DKV  G+A+  +++      V C PA
Sbjct  367   ATILVISLAMTAELIADQTQSGAFVYGAMSFTDKVANGLAVMIIQALHPCHTVVCCPA  424



>ref|NP_001084594.1| major facilitator superfamily domain containing 12 [Xenopus laevis]
 gb|AAH68677.1| MGC81076 protein [Xenopus laevis]
Length=494

 Score =   186 bits (471),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 138/432 (32%), Positives = 230/432 (53%), Gaps = 49/432 (11%)
 Frame = -2

Query  1587  LGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTIIA  1411
             L  C  L++  GH LND+    W+TY L+Y   + G     A ++ LVGQ AD   T + 
Sbjct  7     LPLCQRLSFATGHFLNDLCASMWFTYFLVYFHSVLGFDSFYAGVLLLVGQIADGICTPLV  66

Query  1410  GELIDR------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVG--YC  1255
             G   DR      +G+ K WH  G + V +SF  +F     PC  LG    T Q VG  Y 
Sbjct  67    GYESDRHASLMAYGRRKSWHVVGTLSVVLSFPFIFN----PC--LGCTQNTPQWVGLLYF  120

Query  1254  IS-AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF--  1084
             I   V+F  GW+ TQISH+S++  ++ N+  ++   + R AFT++A++ +YAV + +   
Sbjct  121   IPFIVIFQFGWAATQISHLSLIPELSQNDHDKVELTAFRYAFTVMANITVYAVAWLLLHF  180

Query  1083  ------TNNAEDIKTQ----YRWMAfisifiggvfviiFHLGVKE-PRK-----KDDDGH  952
                     N E++  Q    +R +A I++ +G VF ++FH+G KE P++     + +D  
Sbjct  181   HTGEDKPENMENLSRQDIPIFRTLALITVGLGTVFSLLFHIGTKEKPQRFHLLLETEDPD  240

Query  951   EKIGSNTP-----------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRM  805
                 S  P           W +WLK   +YQVA +Y+ TR++ N+SQTF+A+Y+ N L +
Sbjct  241   SPHPSEDPRLSEPPKSFMVWKHWLKEPSFYQVAVLYMCTRLIVNLSQTFIALYLTNSLHL  300

Query  804   SQSAKSLVPAIIYLCSFITSVLLQEL-EWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMN  628
              ++  + +P ++Y+  F+++ L++ + +W G+    F    G+L +   A  + L   + 
Sbjct  301   PKNYIATIPLVMYVSGFVSTFLMKPINKWIGRNFTYFV---GLLAIATFAAWVALDPGLG  357

Query  627   SFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLES  448
               +Y  +V++G  +A ++VTS+ M + L+  H   +AFVYG+M F DKV  G+A+  ++S
Sbjct  358   VAVYGAAVVLGTGSATILVTSLSMTADLIGTHSRSAAFVYGAMSFTDKVANGLAVVAIQS  417

Query  447   FEDADPVACNPA  412
                     C PA
Sbjct  418   LHPCRTQVCCPA  429



>ref|XP_006105991.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Myotis lucifugus]
Length=471

 Score =   185 bits (469),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 132/419 (32%), Positives = 222/419 (53%), Gaps = 41/419 (10%)
 Frame = -2

Query  1599  EEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFT  1423
               +PL   + L+Y VGH LND+    W+TYLL+YL  +   S   A I+ L+GQ AD   
Sbjct  13    PPRPLSLTARLSYAVGHFLNDLCASMWFTYLLVYLHSVRAYSSRGAGILLLLGQVADGLC  72

Query  1422  TIIAGELIDRF-------GQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQT  1267
             T + G   DR        G  K WH  G I V +SF  +F     PC   G+ +P     
Sbjct  73    TPLVGYEADRAAGRCARCGPRKAWHLVGTICVLLSFPFIFS----PCLGCGASTPEWAAL  128

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
             + Y    V+F  GW+ TQI+H+S++  +  N+  ++   + R AFT+VA++ +Y   + +
Sbjct  129   LYYGPFIVIFQFGWAATQIAHLSLIPELVTNDHEKVELTALRYAFTVVANITVYGAAWLL  188

Query  1086  F-------TNNAEDIKTQ--------YRWMAfisifiggvfviiFHLGVKEPRKK---DD  961
                     T    D+  Q        +R ++ + + +G +F ++FHLG +E RK+   + 
Sbjct  189   LHLQASADTGPTPDVSDQLGVQDVPVFRNLSLLVVGVGAIFSLLFHLGTREGRKQLVEEP  248

Query  960   DGHEKIGSNTP------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQ  799
             D H  + + T       W +WL++  +YQV  +Y+ TR++ N+SQT++A+Y+   L + +
Sbjct  249   DEHSPLLAPTTARPLLLWKHWLRQPAFYQVGFLYMSTRLIVNLSQTYMAMYLTYSLNLPK  308

Query  798   SAKSLVPAIIYLCSFITSVLLQEL-EWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSF  622
                + +P ++YL  F +S L+  + +W G+ +  F    G+L +L  A  + L   +   
Sbjct  309   KFIATIPLVMYLSGFFSSFLMNPINKWIGRNMTYFV---GLLVILAFAAWVALADGLGVA  365

Query  621   MYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESF  445
             +YA +VL+G+  A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  ++S 
Sbjct  366   VYAAAVLLGMGCATILVTSLAMTADLIGPHTHSGAFVYGAMSFSDKVANGLAVMVIQSL  424



>ref|XP_001924045.3| PREDICTED: LOW QUALITY PROTEIN: major facilitator superfamily 
domain-containing protein 12 [Danio rerio]
Length=484

 Score =   183 bits (465),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 130/421 (31%), Positives = 225/421 (53%), Gaps = 43/421 (10%)
 Frame = -2

Query  1602  EEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAF  1426
             ++   L  C  LTY VGH  ND+    W+TYLL++   + G   ++A  + LVGQ AD  
Sbjct  3     DQPVTLPVCRRLTYAVGHFFNDLCASMWFTYLLVFYHSVLGFKDTNAGALLLVGQIADGI  62

Query  1425  TTIIAGELIDR------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTV  1264
              T + G   DR      +G+ K WH  G + V  SF  +F     PC  +G D  T Q +
Sbjct  63    CTPLVGYESDRTSGCGKYGKRKTWHLVGTLSVFASFPFIFN----PC--IGCDEKTSQIL  116

Query  1263  GYCISAVVFCS--GWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFF  1090
             G            GW+ TQISH+S++  +   E +++   S R AFT+VA++ +YAV + 
Sbjct  117   GIIYIIPFIIIFXGWAATQISHLSLIPELVNCEHAKVELTSYRYAFTVVANITVYAVAWL  176

Query  1089  VF---TNNAEDIK-TQ---------YRWMAfisifiggvfviiFHLGVKE---PRKKDDD  958
             +F   +   ED   TQ         +R++A     IG V  +IFHLG KE   P++ ++ 
Sbjct  177   LFHFQSQQTEDPSITQNLSWADVPTFRYLALTVWGIGTVTSVIFHLGTKEAVQPQEGEET  236

Query  957   GHEKI--------GSNTPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMS  802
             G  ++        G+   W +WL    +YQVA +Y+ TR++ N+SQT++ +Y+ N L + 
Sbjct  237   GKSEVSNCSSQTSGALLRWKHWLVEPAFYQVALLYMCTRLIVNMSQTYIPMYLTNSLLLP  296

Query  801   QSAKSLVPAIIYLCSFITSVLLQEL-EWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNS  625
             ++  + +P ++Y+  F++S++++ + +W G  +  F    G++ ++  +  +L+ + M S
Sbjct  297   KNYIATIPLVMYVSGFVSSLVMKPVSKWIGTSMTYF---AGLVPIMAFSFWVLVDLNMGS  353

Query  624   FMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESF  445
              +Y  +VL+G  +A+++V S+ M + L+       AFVYG+M F DKV  G+ +  +++ 
Sbjct  354   RVYGAAVLLGAGSAVILVMSLSMTANLIGDQTQSGAFVYGAMSFTDKVANGLGVMIIQAL  413

Query  444   E  442
              
Sbjct  414   H  414



>ref|XP_009832599.1| hypothetical protein H257_08432 [Aphanomyces astaci]
 gb|ETV78262.1| hypothetical protein H257_08432 [Aphanomyces astaci]
Length=510

 Score =   182 bits (462),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 143/480 (30%), Positives = 246/480 (51%), Gaps = 53/480 (11%)
 Frame = -2

Query  1608  EEEEEKPLG-----RCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLV  1447
             +E E  P G        +L Y VGH+LND+    W++YLL++L  + GLSP  +A+V   
Sbjct  2     KETEGSPRGMNHWPSTKILAYAVGHVLNDMCASSWFSYLLVFLNAVAGLSPVDSALVMFS  61

Query  1446  GQFADAFTTIIAGELIDR--------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILG  1291
             GQ AD   T + G L D+        FG+ K W   G ++V V F  +FG TC+P     
Sbjct  62    GQIADGLATPLVGVLSDKSTGFPSIGFGRRKTWLTGGSVLVVVCFYGVFG-TCVPQLFDA  120

Query  1290  SDSPTVQTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLM  1111
             S S     V YC+SA +F  GW+  Q+SHM+MV  +T N++ R    S R AFT++++++
Sbjct  121   SPSRLTLVVYYCVSASLFNVGWAAVQVSHMAMVPELTTNDNVRCVLNSTRYAFTILSNVL  180

Query  1110  LYAVTFFVFTNNAE-DIKTQYRW--MAfisifiggvfviiFHLGVKEPRKKDDDGHEKIG  940
             ++ V  F+  + A  ++   Y++  +  +S+ +GG+    F LG  E  KK       +G
Sbjct  181   VFVVFLFLLHDVAPLEVPDAYKFTLLTTVSLVVGGICTAWFLLGTDEVVKKVTTPPSSVG  240

Query  939   -----------------------SNTP----------WTYWLKRVLYYQVASIYVFTRVV  859
                                    ++ P          W+ W    ++Y+V  +Y+ TR+ 
Sbjct  241   RRRGSSPSAAEAMNRGPNALSFEADLPIVPLDTTALTWSDWFHVGMFYEVGMVYMCTRLT  300

Query  858   TNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGI  679
              NV+Q ++   +   L M+ ++ ++VP ++Y+  F+ + LL+ +     R   F AG  +
Sbjct  301   VNVTQVYIPFLLTVTLHMTATSIAIVPLLVYVSGFLATFLLRWMNEKMGREGTFAAGAAL  360

Query  678   LWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSM  499
             + +  G   +L P + + ++Y LSVL+G+ N+++MVTS+ +E  LV    +  AFVYG+M
Sbjct  361   VSVSLGLTWLLTP-ETSGWIYLLSVLLGLGNSIVMVTSVCLEGDLVGDSCESGAFVYGAM  419

Query  498   GFIDKVLCGVALYFLESFEDADPVACNPAQA-CFSVTRFSLGFIPGIAALFGVIVSFTMK  322
              F DK+  G+A+ ++++  +A  V    + A      R +   +P ++A+ G I  + MK
Sbjct  420   SFTDKISNGIAVLWIQNQREAIQVQFPSSTAEDGEFVRLAYCVVPAVSAILGAITLYYMK  479



>ref|XP_005313865.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Chrysemys picta bellii]
Length=490

 Score =   182 bits (461),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 136/435 (31%), Positives = 226/435 (52%), Gaps = 50/435 (11%)
 Frame = -2

Query  1602  EEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAF  1426
             E   PL   + L+Y +GH LND+    W+TYLL+Y   + G S + A  + LVGQ AD  
Sbjct  3     EPPPPLSGPARLSYALGHFLNDLCASMWFTYLLVYFHAVLGYSTTHAGTLLLVGQVADGV  62

Query  1425  TTIIAGELIDR------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTV  1264
              T + G   DR      +G+ K WH  G + V +SF  +F     PC  LG    T Q V
Sbjct  63    CTPLVGYESDRSAGCGRYGRRKTWHLVGTVCVLLSFPFIFN----PC--LGCTEATPQWV  116

Query  1263  GYCISA---VVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
              +       V+F  GW+ TQISH+S++  +   +  ++   + R AFT+ A++ +Y V +
Sbjct  117   AFIYFIPFIVIFQFGWAATQISHLSLIPELVTTDHEKVELTALRYAFTVAANITVYGVAW  176

Query  1092  FVF------TNNAEDIKTQ----YRWMAfisifiggvfviiFHLGVKEPRKK-----DDD  958
              +       +   E +       +R ++ I + +G VF ++FHLG KE R       + +
Sbjct  177   LLLHFQLRHSGPTEQLGKPDIHIFRNLSLIVVAVGAVFSLLFHLGTKERRHPQARLLEPE  236

Query  957   GHEKI---GSNTP------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRM  805
              H  +   G   P      W +WL+   +YQVA +Y+ TR++ N+SQT++A+Y+ N L +
Sbjct  237   EHTPLLQKGHKIPPRPLLLWKHWLQEPAFYQVAMLYMATRLIVNLSQTYIAMYLTNSLML  296

Query  804   SQSAKSLVPAIIYLCSFITSVLLQEL-EWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMN  628
              +   + +P ++Y+  F++S L++ +  W G+ L  F    G+L +L  A  + L  ++ 
Sbjct  297   PKKFIATIPLVMYISGFLSSFLMKPVNRWIGRNLTYFM---GLLIILAFASWVALDSRLG  353

Query  627   SFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLES  448
             + +Y  +VL+G  +A ++VTS+ M + L+  +    AFVYG+M F DKV  GVA+  +++
Sbjct  354   AEVYGAAVLLGAGSATILVTSLSMTADLIGSNTHSGAFVYGAMSFTDKVANGVAVMAIQN  413

Query  447   FEDADPVACNPAQAC  403
                       P Q C
Sbjct  414   LHPC------PTQLC  422



>ref|XP_008149020.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Eptesicus fuscus]
Length=493

 Score =   181 bits (460),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 132/419 (32%), Positives = 222/419 (53%), Gaps = 41/419 (10%)
 Frame = -2

Query  1599  EEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFT  1423
               +PL   + L+Y VGH LND+    W+TYLL+YL  +   S   A ++ L+GQ AD   
Sbjct  13    PPRPLSLTARLSYAVGHFLNDLCASMWFTYLLVYLHSVRAYSSRGAGVLLLLGQVADGLC  72

Query  1422  TIIAGELIDRF-------GQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQT  1267
             T + G   DR        G  K WH  G I V +SF  +F     PC   G+ +P     
Sbjct  73    TPLVGYEADRAAGRCARCGPRKSWHLVGTICVLLSFPFIFS----PCLGCGASTPEWAAL  128

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
             + Y    V+F  GW+ TQI+H+S++  +  N+  ++   + R AFT+VA++ +Y   + +
Sbjct  129   LYYGPFIVIFQFGWAATQIAHLSLIPELVTNDHEKVELTALRYAFTVVANITVYGAAWLL  188

Query  1086  FTNNA-------EDIKTQ--------YRWMAfisifiggvfviiFHLGVKEPRKK---DD  961
                 A        D+  Q        +R ++ + + IG +F ++FHLG +E RK+   + 
Sbjct  189   LHLQASSHMGPTPDVSDQLGVQDVPVFRNLSLLVVGIGAIFSLLFHLGTREGRKQLVEEP  248

Query  960   DGHEKIGSNTP------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQ  799
             D H  + + T       W +WL++  +YQV  +Y+ TR++ N+SQT++A+Y+   L + +
Sbjct  249   DEHSPLLAPTTARPLLLWKHWLRQPAFYQVGFLYMSTRLIVNLSQTYMAMYLTYSLNLPK  308

Query  798   SAKSLVPAIIYLCSFITSVLLQEL-EWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSF  622
                + +P ++YL  F +S L+  + +W G+ +  F    G+L +L  A  + L   +   
Sbjct  309   KFIATIPLVMYLSGFFSSFLMNPVNKWIGRNMTYFV---GLLVILAFAAWVALADGLGVA  365

Query  621   MYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESF  445
             +YA +VL+G+  A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  ++S 
Sbjct  366   VYAAAVLLGMGCATILVTSLAMTADLIGPHTHSGAFVYGAMSFSDKVANGLAVMVIQSL  424



>ref|XP_009832597.1| hypothetical protein H257_08431 [Aphanomyces astaci]
 gb|ETV78260.1| hypothetical protein H257_08431 [Aphanomyces astaci]
Length=528

 Score =   180 bits (457),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 142/476 (30%), Positives = 245/476 (51%), Gaps = 53/476 (11%)
 Frame = -2

Query  1572  VLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTIIAGELID  1396
             +L Y VGH+LND+    W++YLL++L  + GLSP  +A+V   GQ AD   T + G L D
Sbjct  28    ILAYAVGHVLNDMCASSWFSYLLVFLNAVAGLSPVDSALVMFSGQIADGLATPLVGVLSD  87

Query  1395  R--------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAVV  1240
             +        FG+ K W   G ++V V F  +FG TC+P     S S     V YC+SA +
Sbjct  88    KSTGFPSIGFGRRKTWLTGGSVLVVVCFYGVFG-TCVPQLFDASPSRLTLVVYYCVSASL  146

Query  1239  FCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTNNAE-DI  1063
             F  GW+  Q+SHM+MV  +T N++ R    S R AFT++++++++ V  F+  + A  ++
Sbjct  147   FNVGWAAVQVSHMAMVPELTTNDNVRCVLNSTRYAFTILSNVLVFVVFLFLLHDVAPLEV  206

Query  1062  KTQYRW--MAfisifiggvfviiFHLGVKEPRKKDDDGHEKIG-----------------  940
                Y++  +  +S+ +GG+    F LG  E  KK       +G                 
Sbjct  207   PDAYKFTLLTTVSLVVGGICTAWFLLGTDEVVKKVTTPPSSVGRRRGSSPSAAEAMNRGP  266

Query  939   ------SNTP----------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLR  808
                   ++ P          W+ W    ++Y+V  +Y+ TR+  NV+Q ++   +   L 
Sbjct  267   NALSFEADLPIVPLDTTALTWSDWFHVGMFYEVGMVYMCTRLTVNVTQVYIPFLLTVTLH  326

Query  807   MSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMN  628
             M+ ++ ++VP ++Y+  F+ + LL+ +     R   F AG  ++ +  G   +L P + +
Sbjct  327   MTATSIAIVPLLVYVSGFLATFLLRWMNEKMGREGTFAAGAALVSVSLGLTWLLTP-ETS  385

Query  627   SFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLES  448
              ++Y LSVL+G+ N+++MVTS+ +E  LV    +  AFVYG+M F DK+  G+A+ ++++
Sbjct  386   GWIYLLSVLLGLGNSIVMVTSVCLEGDLVGDSCESGAFVYGAMSFTDKISNGIAVLWIQN  445

Query  447   FEDADPVACNPAQA-CFSVTRFSLGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAE  283
               +A  V    + A      R +   +P ++A+ G I  + MK     H  + L E
Sbjct  446   QREAIQVQFPSSTAEDGEFVRLAYCVVPAVSAILGAITLYYMK-----HGSKTLVE  496



>ref|XP_005813830.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Xiphophorus maculatus]
Length=479

 Score =   178 bits (451),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 134/437 (31%), Positives = 225/437 (51%), Gaps = 48/437 (11%)
 Frame = -2

Query  1605  EEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADA  1429
              + E+ L   + L+Y  GH LND+    W+TYLL++   + G   + A I+ LVGQ ADA
Sbjct  2     SDTERSLAAVTKLSYAAGHFLNDLCASMWFTYLLVFYHSVLGFQNTDAGILLLVGQIADA  61

Query  1428  FTTIIAGELIDR------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
               T + G   D+      +G+ K WH  G + V VSF  +F       + LG D  T Q 
Sbjct  62    ICTPLVGYESDQTSGCGNYGKRKTWHLVGTLSVVVSFAFVFN------QCLGCDPNTPQW  115

Query  1266  VGYCISA---VVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVT  1096
                   A   ++F  GW+ TQISH+S++  +   E +++   + R AFT++A++ +YA+ 
Sbjct  116   ASLIYFAPFIIIFQFGWAATQISHLSLIPELVTCEHAKVELTAYRYAFTVIANITVYALA  175

Query  1095  FFVFTNNAEDIKTQ--------YRWMAfisifiggvfviiFHLGVKE-PRKKDDDG----  955
             + +F   A + +          +R ++ I + IG +F   FHLG  E P  K        
Sbjct  176   YLLFHGQAGEDEDSLGPADTNVFRNLSLIVLGIGALFAAFFHLGTTESPNHKASRDSGGE  235

Query  954   ---------HEKIGSNT------PWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVI  820
                         + S+T       W  WL++  +YQVA +Y+ TR++ N+SQT++++Y+I
Sbjct  236   EEEEAEGERRPLLPSSTVSSSLLQWKCWLQQPSFYQVALLYMSTRLIVNLSQTYISMYLI  295

Query  819   NDLRMSQSAKSLVPAIIYLCSFITSVLLQELEWS-GKRLKIFFAGGGILWLLCGAVVMLL  643
             N L + +   + +P ++YL  F++S +++ +    GK L  F    G+L ++  +  +LL
Sbjct  296   NTLGLPKKYIATIPLVMYLSGFLSSFIMKPVSKRIGKSLTYFV---GLLLIMAFSYWVLL  352

Query  642   PIKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVAL  463
               KM   +Y  +VL+G  +A ++V S+ M + L+       AFVYG+M F DK+  GVA+
Sbjct  353   DNKMGQQIYGAAVLLGAGSATILVISLSMTAELIADQTQSGAFVYGAMSFTDKLGNGVAV  412

Query  462   YFLESFEDADPVACNPA  412
               +++      V C PA
Sbjct  413   MMIQAMHPCHTVVCCPA  429



>ref|XP_008332994.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Cynoglossus semilaevis]
 ref|XP_008332995.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Cynoglossus semilaevis]
Length=495

 Score =   178 bits (451),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 137/443 (31%), Positives = 231/443 (52%), Gaps = 63/443 (14%)
 Frame = -2

Query  1581  RCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTIIAGE  1405
             +CS   Y VGH LND+    W+TYLL++   + GL  ++A ++ LVGQ ADA +T + G 
Sbjct  14    KCS---YAVGHFLNDLCASMWFTYLLIFYHSVLGLQNTNAGLLLLVGQIADAISTPLVGY  70

Query  1404  LID------RFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAV  1243
               D       +G+ K WH  G + V +SF  +F   C  C+ L   +P   ++ + I  +
Sbjct  71    ESDSSPGCGNYGKRKTWHLVGTLSVILSFGFIFN-QCPGCEPL---TPQWASMTFFIPVI  126

Query  1242  -VFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF------  1084
              VF  GW+ TQISH+S++  +   E +++   + R AFT++A++ +Y V + +F      
Sbjct  127   IVFQFGWAATQISHLSLIPELVSCEHAKVEITAYRYAFTVIANITVYTVAYLLFHVQAID  186

Query  1083  TNNAEDIKTQ----YRWMAfisifiggvfviiFHLGVKE------PRKKDDDGHEKIGSN  934
              NN + +  Q    +R ++ I + IG VF IIFHLG +E      P    +DG  ++   
Sbjct  187   DNNTDSLGPQDIPVFRNLSLIVLGIGTVFSIIFHLGTRELKPAAGPAGVLEDGEVRVAKR  246

Query  933   ----------------------------TPWTYWLKRVLYYQVASIYVFTRVVTNVSQTF  838
                                           W  WL++  +YQVA +Y+ TR+  N+SQT+
Sbjct  247   WEEEEEEEEGEEEELRPLISHPQMSRTLLQWKCWLRQPSFYQVALLYMSTRLTVNLSQTY  306

Query  837   LAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQEL-EWSGKRLKIFFAGGGILWLLCG  661
             +++Y+I  L + ++  + +P ++YL  F++S +++ L +W GK L  F    G+L ++  
Sbjct  307   ISMYLIYTLELPKNFIATIPLVVYLSGFLSSFIMKPLSKWIGKCLTYFM---GLLLIMIF  363

Query  660   AVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKV  481
             +  +LL   M   +Y  +VL+G  +A ++V S+ M + L+       AFVYG+M F DKV
Sbjct  364   SYWVLLDDHMEERVYGAAVLLGAGSATILVISLSMTAELIGNQTQSGAFVYGAMSFTDKV  423

Query  480   LCGVALYFLESFEDADPVACNPA  412
               G+A+  +++       AC PA
Sbjct  424   ANGIAVMIIQALHPCQNTACCPA  446



>ref|XP_002116430.1| hypothetical protein TRIADDRAFT_30948 [Trichoplax adhaerens]
 gb|EDV21100.1| hypothetical protein TRIADDRAFT_30948 [Trichoplax adhaerens]
Length=469

 Score =   177 bits (449),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 131/455 (29%), Positives = 235/455 (52%), Gaps = 45/455 (10%)
 Frame = -2

Query  1623  GRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTD-IGLSPSSAAIVTLV  1447
             G+   +   +  L      ++GVGH+LND+    W++YLL+Y+   IG S   A I+ L+
Sbjct  7     GKIRSKNSYQSKLDCRQRFSFGVGHVLNDLCASMWFSYLLVYMHSVIGFSHIHAGILMLI  66

Query  1446  GQFADAFTTIIAGELIDR------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSD  1285
             GQ AD   T I G   DR      +G+ K WH  G   V VS+  +F      C +  + 
Sbjct  67    GQVADGICTPIIGYESDRTADKCYYGRRKSWHLLGVCCVIVSYAFVFN----KCFVCSAV  122

Query  1284  SPTVQTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLY  1105
             +     + Y    ++F  GW+ TQISH+S++  +T +E+ R+   + R AFT+++++ +Y
Sbjct  123   TAWPLLIYYTPFVILFQFGWAATQISHLSLIPELTDDENERVGLNAIRYAFTVISNIYVY  182

Query  1104  AVTFFVF-----------------TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEP  976
              V F +                      + + T + ++    + IG +  IIFH+G KE 
Sbjct  183   LVAFMLLRFHGGKYRIPTLTISVGNKRLKVVYTLFNYLVGSVLGIGLIAAIIFHVGTKEK  242

Query  975   RKKDDD---GHEKIGSNTPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRM  805
             R+ + +     E+    T W  WLK  L+Y+VA +Y+ +R++ N++Q ++ +YVI  L +
Sbjct  243   RQHEINCRTTQERYKKKT-WIDWLKSSLFYRVAVLYMCSRLIVNITQVYIPLYVIKTLHL  301

Query  804   SQSAKSLVPAIIYLCSFITSVLLQELEWS-GKRLKIFFAGGGILWLLCGAV---VMLLPI  637
              +   +LVP  +Y+  F+ S++L+ + +  G+++  F A      ++CG     + LLP 
Sbjct  302   HKMHIALVPLTVYVSGFLVSLVLKPINYHLGRKITFFLA-----LVMCGGFCCCIYLLPA  356

Query  636   KMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYF  457
                  +YA + ++G+    ++VT + M + L+ K+++  AFVYG+M F DK+  G+A+  
Sbjct  357   SHAYVVYAGATMLGVGGTSLLVTVLSMTADLISKNVESGAFVYGAMSFTDKLSNGIAVII  416

Query  456   LESFEDADPV-ACNPAQACFSVTRFSLGFIPGIAA  355
             ++S      +  C  + A +   R  L ++PG AA
Sbjct  417   IQSIHPCAHIDNCANSAAYY---RSVLTYVPGGAA  448



>ref|XP_008872640.1| hypothetical protein H310_08595 [Aphanomyces invadans]
 gb|ETV98443.1| hypothetical protein H310_08595 [Aphanomyces invadans]
Length=526

 Score =   178 bits (451),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 144/485 (30%), Positives = 246/485 (51%), Gaps = 71/485 (15%)
 Frame = -2

Query  1572  VLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTIIAGELID  1396
             +L Y VGH+LND+   CW++YLL++L  + GLSP  +A+V   GQ AD   T + G + D
Sbjct  18    ILAYAVGHVLNDMCASCWFSYLLVFLNGVAGLSPVDSALVMFSGQIADGLATPLVGVVSD  77

Query  1395  R--------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAVV  1240
             +        FG+ K W   G ++V V F  +FG TC+P  +  S S     + YC+SA V
Sbjct  78    KSTGFPAIGFGRRKTWLAGGSVLVVVCFYGVFG-TCVPKLLTASPSRLTLVLYYCVSASV  136

Query  1239  FCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTN-NAEDI  1063
             F  GW+  Q+SHM+MV  +T N++ R    S R AFT++++++++ V   +  + +  ++
Sbjct  137   FNVGWAAVQVSHMAMVPELTTNDNIRCVLNSTRYAFTILSNVVVFVVFLLLLHDVDPLEV  196

Query  1062  KTQYRW--MAfisifiggvfviiFHLGVKE--------PRKK--DDDGHEKIGSNTP---  928
                Y++  +  +S+ +GG+    F LG  E        P+++      H +  +  P   
Sbjct  197   PDAYKFTLLTTVSLVVGGICTAWFLLGTDEVVKMPPSPPKRRLTPSPSHGEALNRGPNAL  256

Query  927   --------------------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLR  808
                                 W  W K  ++Y+V  +Y+ TR+  NV+Q ++   +   L 
Sbjct  257   TFEADLPLVAAMDSTAVALKWFDWFKVGMFYEVGVVYMCTRLTVNVTQVYIPFLLTVTLD  316

Query  807   MSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRL--KIFFAGGGILWLLCGAVVMLLPIK  634
             MS ++ ++VP ++Y+  F+ +     L W  +++  +  +A G  L  L  A+  LL   
Sbjct  317   MSATSIAIVPLLVYVSGFLATF---PLRWMNEKMGREGTYAAGAALVTLSLALAWLLTPD  373

Query  633   MNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFL  454
              +S++Y LSVL+G  N+++MVTS+ +E  LV    +  AFVYG+M F DK+  GVA+ ++
Sbjct  374   TSSWIYVLSVLLGFGNSIIMVTSVCLEGDLVGDSCESGAFVYGAMSFTDKISNGVAVLWI  433

Query  453   ESFEDADPVACNPAQACFSVT--------RFSLGFIPGIAALFGVIVSFTMKLLHTSHKK  298
             ++  +A        QA F  T        R +   +P + A+ G +  + MK     H  
Sbjct  434   QNEREA-------IQAQFPSTTAEDGEFVRAAYCILPAVCAIVGALTLYYMK-----HGS  481

Query  297   QPLAE  283
             + L E
Sbjct  482   KTLLE  486



>gb|AAH68439.1| Chromosome 19 open reading frame 28 [Homo sapiens]
Length=480

 Score =   177 bits (448),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 137/450 (30%), Positives = 232/450 (52%), Gaps = 49/450 (11%)
 Frame = -2

Query  1599  EEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFT  1423
               +PL   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   
Sbjct  13    SPRPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLC  72

Query  1422  TIIAGELIDR-------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQT  1267
             T + G   DR       +G  K WH  G + V +SF  +F     PC   G+ +P     
Sbjct  73    TPLVGYEADRAASCCARYGPRKAWHLVGTVCVLLSFPFIFS----PCLGCGAATPEWAAL  128

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
             + Y    V+F  GW+ TQISH+S++  +  N+  ++   + R AFT+VA++ +Y   + +
Sbjct  129   LYYGPFIVIFQFGWASTQISHLSLIPELVTNDHEKVELTALRYAFTVVANITVYGAAWLL  188

Query  1086  F-------TNNAEDIKTQ----------YRWMAfisifiggvfviiFHLGVKEPRKKDDD  958
                         +DI             +R ++ + + +G VF ++FHLG +E R+    
Sbjct  189   LHLQGSSRVEPTQDISISDQLGGQDVPVFRNLSLLVVGVGAVFSLLFHLGTRERRRPHA-  247

Query  957   GHEKIGSNTP------------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVIND  814
               E+ G +TP            W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   
Sbjct  248   --EEPGEHTPLLAPATAQPLLLWKHWLREPAFYQVGILYMTTRLIVNLSQTYMAMYLTYS  305

Query  813   LRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIK  634
             L + +   + +P ++YL  F++S L++ +     R   +F+  G+L +L  A  + L   
Sbjct  306   LHLPKKFIATIPLVMYLSGFLSSFLMKPINKCIGRNMTYFS--GLLVILAFAAWVALAEG  363

Query  633   MNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFL  454
             +   +YA +VL+G   A ++VTS+ M + L+  H +  AFVYGSM F+DKV  G+A+  +
Sbjct  364   LGVAVYAAAVLLGAGCATILVTSLAMTADLIGPHTNSGAFVYGSMSFLDKVANGLAVMAI  423

Query  453   ESFEDADPVACNPAQACFSVTRFSLGFIPG  364
             +S        C   +AC S+  +++  + G
Sbjct  424   QSLHPCPSELC--CRACVSLYHWAMVAVTG  451



>ref|XP_008431821.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Poecilia reticulata]
Length=480

 Score =   177 bits (448),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 130/437 (30%), Positives = 228/437 (52%), Gaps = 47/437 (11%)
 Frame = -2

Query  1605  EEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADA  1429
              + ++ L     L+Y  GH LND+    W+TYLL++   + G   ++A ++ LVGQ ADA
Sbjct  2     SDTDRSLTAIRKLSYAAGHFLNDLCASMWFTYLLVFYHSVLGFQNTNAGLLLLVGQIADA  61

Query  1428  FTTIIAGELIDR------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
               T + G   D+      +G+ K WH  G + V VSF  +F   C+ C     ++P   +
Sbjct  62    ICTPLVGYESDQTSGCGNYGKRKTWHLVGTLSVAVSFAFIFN-QCLVCD---PNTPQWAS  117

Query  1266  VGYCIS-AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFF  1090
             + Y     ++F  GW+ TQISH+S++  +   E +++   + R AFT++A++ +YA+ + 
Sbjct  118   LIYFAPFIIIFQFGWAATQISHLSLIPELVTCEHAKVELTAYRYAFTVIANITVYALAYL  177

Query  1089  VFTNNAEDIKTQ--------YRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEK----  946
             +F   A + +          +R ++ I + IG VF   FHLG  E R       +     
Sbjct  178   LFHGQAGEDEDSLGPADTNIFRNLSLIVLGIGAVFAAFFHLGTTE-RPNHQASRDSGGEE  236

Query  945   ------------IGSNT------PWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVI  820
                         + S+T       W  WL++  +YQVA +Y+ TR++ N+SQT++++Y+I
Sbjct  237   EEEEEEGERRPLLPSSTVSSSLLQWKCWLQQPSFYQVALLYMSTRLIVNLSQTYISMYLI  296

Query  819   NDLRMSQSAKSLVPAIIYLCSFITSVLLQELEWS-GKRLKIFFAGGGILWLLCGAVVMLL  643
             N L + +   + +P ++YL  F++S +++ +    GK L  F    G+L ++  +  +LL
Sbjct  297   NTLGLPKKYIATIPLMMYLSGFLSSFIMKPVSKRIGKSLTYFV---GLLLIMAFSYWVLL  353

Query  642   PIKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVAL  463
               KM   +Y  +VL+G+ +A ++V S+ M + L+       AFVYG+M F DK+  GVA+
Sbjct  354   DDKMGQQIYGAAVLLGVGSATILVISLSMTAELISDQTQSGAFVYGAMSFTDKLANGVAV  413

Query  462   YFLESFEDADPVACNPA  412
               +++      V C PA
Sbjct  414   MMIQAMHPCHTVVCCPA  430



>ref|NP_778148.2| major facilitator superfamily domain-containing protein 12 isoform 
c [Homo sapiens]
 sp|Q6NUT3.2|MFS12_HUMAN RecName: Full=Major facilitator superfamily domain-containing 
protein 12 [Homo sapiens]
 gb|EAW69309.1| chromosome 19 open reading frame 28, isoform CRA_a [Homo sapiens]
 gb|EAW69311.1| chromosome 19 open reading frame 28, isoform CRA_a [Homo sapiens]
Length=480

 Score =   176 bits (447),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 137/450 (30%), Positives = 231/450 (51%), Gaps = 49/450 (11%)
 Frame = -2

Query  1599  EEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFT  1423
               +PL   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   
Sbjct  13    SPRPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLC  72

Query  1422  TIIAGELIDR-------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQT  1267
             T + G   DR       +G  K WH  G + V +SF  +F     PC   G+ +P     
Sbjct  73    TPLVGYEADRAASCCARYGPRKAWHLVGTVCVLLSFPFIFS----PCLGCGAATPEWAAL  128

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
             + Y    V+F  GW+ TQISH+S++  +  N+  ++   + R AFT+VA++ +Y   + +
Sbjct  129   LYYGPFIVIFQFGWASTQISHLSLIPELVTNDHEKVELTALRYAFTVVANITVYGAAWLL  188

Query  1086  F-------TNNAEDIKTQ----------YRWMAfisifiggvfviiFHLGVKEPRKKDDD  958
                         +DI             +R ++ + + +G VF ++FHLG +E R+    
Sbjct  189   LHLQGSSRVEPTQDISISDQLGGQDVPVFRNLSLLVVGVGAVFSLLFHLGTRERRRPHA-  247

Query  957   GHEKIGSNTP------------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVIND  814
               E+ G +TP            W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   
Sbjct  248   --EEPGEHTPLLAPATAQPLLLWKHWLREPAFYQVGILYMTTRLIVNLSQTYMAMYLTYS  305

Query  813   LRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIK  634
             L + +   + +P ++YL  F++S L++ +     R   +F+  G+L +L  A  + L   
Sbjct  306   LHLPKKFIATIPLVMYLSGFLSSFLMKPINKCIGRNMTYFS--GLLVILAFAAWVALAEG  363

Query  633   MNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFL  454
             +   +YA +VL+G   A ++VTS+ M + L+  H +  AFVYGSM F+DKV  G+A+  +
Sbjct  364   LGVAVYAAAVLLGAGCATILVTSLAMTADLIGPHTNSGAFVYGSMSFLDKVANGLAVMAI  423

Query  453   ESFEDADPVACNPAQACFSVTRFSLGFIPG  364
             +S        C   +AC S   +++  + G
Sbjct  424   QSLHPCPSELC--CRACVSFYHWAMVAVTG  451



>ref|XP_005999123.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X1 [Latimeria chalumnae]
Length=491

 Score =   176 bits (446),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 130/429 (30%), Positives = 223/429 (52%), Gaps = 43/429 (10%)
 Frame = -2

Query  1599  EEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFT  1423
             ++  L  C  L+Y +GH LND+    W+TYLL+Y   + G + S A ++ LVGQ AD   
Sbjct  3     DQPSLSLCGRLSYSIGHFLNDLCASMWFTYLLVYYHAVLGFNNSYAGVLLLVGQVADGVC  62

Query  1422  TIIAGELIDR------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVG  1261
             T + G   D+      +G+ K WH  G I V +SF  +F     PC      +P    + 
Sbjct  63    TPLIGYESDQSRGCGTYGKRKSWHLVGTISVVLSFPFIFN----PCMGCTESTPHWVALV  118

Query  1260  YCIS-AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF  1084
             Y I   V+F  GW+ TQISH+S++  +  ++  ++   + R AFT+ A++++Y V + +F
Sbjct  119   YFIPFIVIFQFGWAATQISHLSLIPELVASDHEKVELTALRYAFTVTANIVVYGVAWLLF  178

Query  1083  --------------TNNAEDIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDD-----  961
                           +  ++DI   +R +A I + +G +F I+FH+G KE     D     
Sbjct  179   HFQVGHSDDPSISKSLGSQDIPV-FRNLALIIVGLGTLFSILFHVGTKEKASHSDTTPVA  237

Query  960   DGHEKIGSNT------P---WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLR  808
             D H  +   T      P   W +WLK   +YQVA++Y+ TR++ N+SQT++A+Y+ N L 
Sbjct  238   DEHTPLVDKTLTAPTSPLLLWKHWLKEPAFYQVAALYMCTRLIVNLSQTYIAMYLTNSLH  297

Query  807   MSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMN  628
             + +   + +P ++YL  F+ S L++ +     R   +    G+L +   A  +LL   + 
Sbjct  298   LPKKYIATIPLVMYLSGFLFSFLMKPINKLIGRNVTYLV--GLLIIFAFAYWILLVQNIG  355

Query  627   SFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLES  448
               +Y  +VL+G  +A +++TS+ M + L+  +    AFVYG+M F DK+  G+A+  +++
Sbjct  356   HAVYGAAVLLGTGSATILITSLSMTADLIGANTQSGAFVYGAMSFTDKLANGIAVVIIQN  415

Query  447   FEDADPVAC  421
                     C
Sbjct  416   LHPCHTQKC  424



>ref|XP_002159338.2| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Hydra vulgaris]
Length=485

 Score =   176 bits (445),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 132/447 (30%), Positives = 234/447 (52%), Gaps = 43/447 (10%)
 Frame = -2

Query  1563  YGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTIIAGELID---  1396
             YGVGH+LND+T   W++Y+L+++  +   +  +A  + L GQ ADA  T   G   D   
Sbjct  13    YGVGHVLNDLTAAMWFSYMLIFMHKVVAFTNVNAGFIILAGQIADALATTFVGYQSDTTV  72

Query  1395  --RFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAVVFCSGWS  1222
               ++G+ KIWH  G I V +SF  +F      C    + SP+   + Y    V+F  GW+
Sbjct  73    NVKYGRRKIWHLLGVICVAISFPFIFSLCISNC---ANSSPSSLMIYYIPFVVIFQFGWA  129

Query  1221  CTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTNNAEDIKT-----  1057
              TQISH+S++  IT  E  ++   + R  FT++++L+++ V F +F  N    +      
Sbjct  130   STQISHLSLIPEITTCEQGKVELNAYRYFFTVLSNLIVFGVCFTLFQMNNTGTEALTKAD  189

Query  1056  --QYRWMAfisifiggvfviiFHLGVKEP--------RKKDDDGH------EKIGSNTPW  925
               +++ +A   + +G +F+IIFH+GVKE            D++        + +      
Sbjct  190   AFKFQVLAVSMVGLGLLFMIIFHVGVKEEPVGSLYSVSYGDEEATSLAASIQSVSCQKTI  249

Query  924   TYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITS  745
               W K  L+YQV  +Y+ TR++ NVSQ +++ +V++ L++ +S+ ++ PAIIY+   + S
Sbjct  250   KSWFKTPLFYQVGWLYMMTRLIVNVSQIYISYFVLDSLKLPKSSIAIAPAIIYVSGILAS  309

Query  744   VLLQELEWSGKRLKIFFAGGGILWLLCGAVVML-----LPIKMNSFMYALSVLIGIANAL  580
             + L +L      LK+ +  G  L L+  + V       L  +     Y  +V +G+  + 
Sbjct  310   I-LAKLFNRKLGLKLTYLLG--LCLITASSVWFYELEELSSRFKFEAYGATVFLGMGGST  366

Query  579   MMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFE--DADPVACNPAQA  406
             +++ S+ M S ++DK+ D +AFVYGSM F+DK+  G A+  ++  +   + P+ C   Q 
Sbjct  367   LLIVSLAMISEMIDKNTDTAAFVYGSMSFLDKISNGGAVMIIQYLQPCKSIPICCKDCQE  426

Query  405   CFSVTRFSLGFIPGIAALFGVIVSFTM  325
              F   R+ +  +PG  A+  +I   T+
Sbjct  427   YF---RYIMSLVPGSCAVLALICLLTL  450



>ref|XP_004078977.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Oryzias latipes]
Length=469

 Score =   175 bits (444),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 130/420 (31%), Positives = 226/420 (54%), Gaps = 41/420 (10%)
 Frame = -2

Query  1569  LTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTIIAGELIDR  1393
             L+Y VGH LND+    W+TYLL++   + G   ++A ++ LVGQ AD   T + G   D+
Sbjct  15    LSYAVGHFLNDLCASMWFTYLLVFYHSVLGFYNTNAGVLLLVGQVADGICTPLIGYESDQ  74

Query  1392  ------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCIS-AVVFC  1234
                   +G+ K WH  G + VG+SF  +F   C+ C    +D+P   ++ Y     ++F 
Sbjct  75    TPGCGNYGKRKTWHLVGTLSVGISFAFIFN-QCLGCT---ADTPQWASLLYFSPFIIIFQ  130

Query  1233  SGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF--TNNAEDIK  1060
              GW+ TQISH+S++  +   E  ++   + R AFT++A++ ++A+ + +F       D  
Sbjct  131   FGWAATQISHLSLIPELVSCEHDKVELTAYRYAFTVIANITVFAMAYLLFHVQGGGGDPL  190

Query  1059  TQ---------YRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKI----------GS  937
             +          +R +A I + IG +F + FHLG  E RK      E+            S
Sbjct  191   SDSLGPADAPVFRNLALIVLGIGALFSVFFHLGTTESRKPGLKEEEEEAEGERRPLLPSS  250

Query  936   NTP----WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAII  769
             NT     W  WL++  +YQVA +Y+ TR++ N+SQT++++Y++N L++ ++  + +P ++
Sbjct  251   NTSPVLQWKCWLQQPSFYQVALLYMSTRLIVNLSQTYISMYLLNTLQLPKNFIATIPLVM  310

Query  768   YLCSFITSVLLQELEWS-GKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGI  592
             YL  F++S +++ L    GK L  F    G+L ++  +  +LL  +M   +Y  +VL+G 
Sbjct  311   YLSGFLSSFIMKTLSKRIGKSLTYFV---GLLLIMGFSYWVLLDARMGQRIYGAAVLLGT  367

Query  591   ANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPA  412
              +A ++V S+ M + L+       AFVYG+M F DK+  G A+  +++      V C PA
Sbjct  368   GSATILVISLAMTAELIADQTQSGAFVYGAMSFTDKLANGFAVMVIQALHPCHTVVCCPA  427



>ref|XP_004865894.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X3 [Heterocephalus glaber]
Length=480

 Score =   175 bits (444),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 145/463 (31%), Positives = 238/463 (51%), Gaps = 49/463 (11%)
 Frame = -2

Query  1599  EEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFT  1423
               +PL   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   
Sbjct  13    SPRPLSLAARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLC  72

Query  1422  TIIAGELIDR--------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQ  1270
             T + G   DR        +G  K WH AG + V +SF  +F     PC   G+ +P    
Sbjct  73    TPLVGYEADRAAGGRCARYGPRKAWHLAGTVCVLLSFPFIFS----PCLGCGASTPEWAA  128

Query  1269  TVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFF  1090
              + Y    VVF  GW+ TQI+H+S++  +  ++  ++   + R AFT+VA++ +Y   + 
Sbjct  129   LLYYGPFIVVFQFGWAATQIAHLSLIPELVTSDHEKVELTALRYAFTVVANIAVYGAAWL  188

Query  1089  VFTNNA-------EDIKTQ----------YRWMAfisifiggvfviiFHLGVKE---PRK  970
             +    A       EDI             +R ++   + +G VF ++FHLG +E   PR+
Sbjct  189   LLHLQASSHSGPTEDIAVGDQLGVQDVPVFRNLSLAVVGVGAVFSLLFHLGTRERHRPRR  248

Query  969   -KDDDGHEKIGSNTP-----WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLR  808
              ++ D H  + S+       W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L 
Sbjct  249   VEEPDEHSPLISSATGPLLLWKHWLREPAFYQVGILYMTTRLIVNLSQTYIAMYLTYSLH  308

Query  807   MSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMN  628
             + +   + +P ++YL  F +S L++ L  S  R   +FA  G+L +L  A  + L  ++ 
Sbjct  309   LPKRFIATIPLVMYLSGFFSSFLMKPLNRSIGRNFTYFA--GLLVVLAFASWVTLADRLG  366

Query  627   SFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLES  448
               +YA +VL+G   A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  ++S
Sbjct  367   MAVYAAAVLLGAGCATILVTSLAMTADLIGSHSQSGAFVYGAMSFSDKVANGLAVMAVQS  426

Query  447   FEDADPVACNPAQACFSVTRFSLGFIPGIAALFGVIVSFTMKL  319
                     C   +AC     + +     +A   GV V+ T+ L
Sbjct  427   LHPCPSELC--CKACMDFYHWVM-----VAVTGGVGVAATLAL  462



>ref|XP_005098266.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X3 [Aplysia californica]
Length=521

 Score =   176 bits (446),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 143/467 (31%), Positives = 238/467 (51%), Gaps = 49/467 (10%)
 Frame = -2

Query  1605  EEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSS-AAIVTLVGQFADA  1429
             +  E  L  C  ++YGVGH+LND+T   W++YLL++L  +   P+  A  + L+GQ +DA
Sbjct  37    QHTELALNNCERMSYGVGHVLNDLTASMWFSYLLVFLHQVRNFPNLLAGNLMLIGQVSDA  96

Query  1428  FTTIIAGELIDR------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
               T   G   DR       G+ K WH  G + V  SF  LF    I C   G      Q 
Sbjct  97    IFTPFIGFESDRTQGIKYLGKRKTWHLIGTLCVMASFPFLF----IECITCGFAPNIAQF  152

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
             V Y    V+F  GW+ TQISH+S  N  T     R+   S RN+FT++++L +Y +   +
Sbjct  153   VYYAPFVVIFQFGWAATQISHLSFANDYTPYSGERVRLQSIRNSFTVMSNLSVYGIFVLL  212

Query  1086  F-------TNNAEDIKT----QYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIG  940
             F       + + +D+      ++R +A IS+ +G VF +IF++G KE RK   D    + 
Sbjct  213   FYLEGKSSSGSNDDLGPGDGPKFRNLALISVGLGTVFNVIFYVGTKERRKSSSDQKSLLD  272

Query  939   -------------SNTPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQ  799
                          S   W  WLK   +YQ+A +Y+  R+  NVSQ +  +Y+   +++ +
Sbjct  273   PEQTTIERSTVQKSKMQWKDWLKEHQFYQIALLYMTARLYINVSQVYFPMYLTETVKLDK  332

Query  798   SAKSLVPAIIYLCSFITSVLLQEL-EWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSF  622
             ++ +++P + Y+ SF  S+L   +  ++G++L  F    G L  +   + +      +  
Sbjct  333   NSIAILPLVTYVSSFFMSLLAPVMNHYAGRKLSYFI---GALIGIASCLWLYFVGHRDFT  389

Query  621   MYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESF-  445
             +Y  +VL+G AN+L+++T I + S L+ +  +  AFV+G+M F DK+  G+A+  ++ F 
Sbjct  390   VYGCAVLMGCANSLLLITVISLTSDLIKQDTESGAFVFGAMSFTDKLSNGLAVLLIQKFH  449

Query  444   --ED-ADP----VACNPAQACFSVTRFSLGFIPGIAALFGVIVSFTM  325
               ED ++P    + C P  AC    R+    IPG A +  +I   T+
Sbjct  450   PCEDYSNPYMTDMGCCP--ACEPYYRYVQSTIPGGALIVALIALATL  494



>ref|XP_004576190.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Maylandia zebra]
 ref|XP_004576191.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X2 [Maylandia zebra]
Length=474

 Score =   175 bits (443),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 130/418 (31%), Positives = 228/418 (55%), Gaps = 39/418 (9%)
 Frame = -2

Query  1569  LTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTIIAGELIDR  1393
             L+Y VGH LND+    W+TYLL++   + G   +SA ++ LVGQ AD   T + G   DR
Sbjct  14    LSYAVGHFLNDLCASMWFTYLLVFYHSVLGFQNTSAGVLLLVGQVADGICTPLIGYESDR  73

Query  1392  ------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCIS-AVVFC  1234
                   +G+ K WH  G + V +SF  +F   C+ C  L   +P   ++ Y +   ++F 
Sbjct  74    SPGFRNYGKRKTWHLVGTLSVVLSFAFIFN-QCVGCSFL---TPQWASLIYFVPFIIIFQ  129

Query  1233  SGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTNNA---EDI  1063
              GW+ TQISH+S++  +   E +++   + R AFT++A++ +Y V + +F   A   ED 
Sbjct  130   FGWAATQISHLSLIPELVTCEHAKVELTAYRYAFTVIANITVYGVAYLLFHVQAGEDEDP  189

Query  1062  KTQ-------YRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTP--------  928
              +        +R ++ I + IG VF ++FH+G KE     ++  E  G   P        
Sbjct  190   DSLGPADIIIFRNLSLIVLGIGVVFSVVFHVGTKESNGASEESEEAEGERRPLLPRSNTF  249

Query  927   -----WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYL  763
                  W  WL++  +YQVA +Y+ TR++ N+SQT++++Y+IN L + +   + +P ++Y+
Sbjct  250   SSLLQWKCWLRQPSFYQVAVLYMSTRLIVNLSQTYISMYLINTLGLPKKFIATIPLVMYV  309

Query  762   CSFITSVLLQEL-EWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIAN  586
               F++S +++ + +  GK L  F    G+L ++  +  +LL + M   +Y  +VL+G  +
Sbjct  310   SGFLSSFIMKPVSKLIGKCLTYFV---GLLLIMAFSYWVLLDVTMGQQVYGAAVLLGAGS  366

Query  585   ALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPA  412
             A ++V S+ M + L+      +AFVYG+M F DK+  G+A+  +++      V C PA
Sbjct  367   ATILVISLAMTAELIADQTQSAAFVYGAMSFTDKLANGLAVMIIQALHPCHTVVCCPA  424



>ref|XP_007440721.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Python bivittatus]
Length=491

 Score =   175 bits (444),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 134/429 (31%), Positives = 227/429 (53%), Gaps = 42/429 (10%)
 Frame = -2

Query  1602  EEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAF  1426
             +E +PL   + L+Y VGH LND+    W+TYLL+Y   + G S   A  + L GQ AD  
Sbjct  2     DEPQPLPIRARLSYSVGHFLNDLCASMWFTYLLVYFHSVLGYSTRHAGALLLAGQVADGI  61

Query  1425  TTIIAGELID------RFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQT  1267
              T + G   D      R+G+ K WH AG I V +SF  +F     PC     ++P     
Sbjct  62    CTPLVGYEADQAGGCARYGRRKSWHLAGTISVLISFPFIFS----PCIGCSENTPEWAAL  117

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
             + +    ++F  GW+ TQISH+S++  +  ++  ++   + R AFT++A++ +Y V +F+
Sbjct  118   IYFIPFIIIFQFGWAATQISHLSLIPELVTSDHEKVELTAFRYAFTVMANITVYGVAWFL  177

Query  1086  F---TNNAEDIK-TQ---------YRWMAfisifiggvfviiFHLGVKE-----PRKKDD  961
                  ++AE  K TQ         +R ++ I I +G +  ++FHLG KE     PR  D 
Sbjct  178   LHFQIDHAETKKFTQHLGRHDIPVFRNLSLIVIGLGSITSLLFHLGTKENAQTLPRLPDP  237

Query  960   DGHEKIGS---NTP-----WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRM  805
             + H  + S     P     W  W     +YQVA +Y+ TR++ N+SQT++A+Y+ N L +
Sbjct  238   EEHTPLLSPDQKQPQPFLLWKDWFLEPAFYQVAMLYMCTRLIVNLSQTYIAMYLTNSLLL  297

Query  804   SQSAKSLVPAIIYLCSFITSVLLQELEWS-GKRLKIFFAGGGILWLLCGAVVMLLPIKMN  628
              +   + +P ++Y+  F++S L++ +    G+ L  F    G+L +L  A  + L  ++ 
Sbjct  298   PKKYIATIPLVMYISGFLSSFLMKTVNKRIGRNLTYFL---GLLIILAFASWVALAEQLG  354

Query  627   SFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLES  448
               +Y  +VL+G+ +A ++VTS+ M + L+  H    AFVYG+M F DKV  G+++  +++
Sbjct  355   IEVYGAAVLLGVGSATILVTSLSMTADLIGTHTHSGAFVYGAMSFTDKVANGLSVMIIQN  414

Query  447   FEDADPVAC  421
                     C
Sbjct  415   LHPCPTKLC  423



>ref|XP_007578421.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Poecilia formosa]
 ref|XP_007578422.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Poecilia formosa]
Length=479

 Score =   175 bits (443),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 130/436 (30%), Positives = 225/436 (52%), Gaps = 46/436 (11%)
 Frame = -2

Query  1605  EEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADA  1429
              + ++ L     L+Y  GH LND+    W+TYLL++   + G   ++A ++ LVGQ ADA
Sbjct  2     SDTDRSLSAVRKLSYAAGHFLNDLCASMWFTYLLVFYHSVLGFQNTNAGVLLLVGQIADA  61

Query  1428  FTTIIAGELIDR------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
               T + G   D+      +G+ K WH  G + V VSF  +F   C+ C     ++P   +
Sbjct  62    ICTPLVGYESDQTSGCGNYGKRKTWHLVGTLSVVVSFAFIFN-RCLACD---PNTPQWAS  117

Query  1266  VGYCIS-AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFF  1090
             + Y     ++F  GW+ TQISH+S++  +   E +++   + R AFT++A++ +YA+ + 
Sbjct  118   LIYFAPFIIIFQFGWAATQISHLSLIPELVTCEHAKVELTAYRYAFTVIANITVYALAYL  177

Query  1089  VFTNNA-EDIKTQ-------YRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKI---  943
             +F   A ED  +        +R ++ I + IG +F   FHLG  E R       +     
Sbjct  178   LFHGQAGEDEDSLGPADTNIFRNLSLIVLGIGALFAAFFHLGTTE-RPNHIASRDSGGER  236

Query  942   ------------------GSNTPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVIN  817
                                S   W  WL++  +YQVA +Y+ TR++ N+SQT++++Y+IN
Sbjct  237   EEEAEGERRPLLPSSAVSSSLLQWKCWLQQPSFYQVALLYMSTRLIVNLSQTYISMYLIN  296

Query  816   DLRMSQSAKSLVPAIIYLCSFITSVLLQELEWS-GKRLKIFFAGGGILWLLCGAVVMLLP  640
              L + +   + +P ++YL  F++S +++ +    GK L  F    G+L ++  +  +LL 
Sbjct  297   TLGLPKKYIATIPLVMYLSGFLSSFIMKPVSKRIGKSLTYFV---GLLLIMAFSYWVLLD  353

Query  639   IKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALY  460
              KM   +Y  +VL+G  +A ++V S+ M + L+       AFVYG+M F DK+  GVA+ 
Sbjct  354   NKMGQQIYGAAVLLGAGSATILVISLSMTAELISDQTQSGAFVYGAMSFTDKLANGVAVM  413

Query  459   FLESFEDADPVACNPA  412
              +++      V C PA
Sbjct  414   MIQAMHPCHTVVCCPA  429



>ref|XP_010365588.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X1 [Rhinopithecus roxellana]
Length=480

 Score =   175 bits (443),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 137/449 (31%), Positives = 230/449 (51%), Gaps = 47/449 (10%)
 Frame = -2

Query  1599  EEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFT  1423
               +PL   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   
Sbjct  13    SPRPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLC  72

Query  1422  TIIAGELIDR-------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTV  1264
             T + G   DR       +G  K WH  G + V +SF  +F   C+ C +   +   +   
Sbjct  73    TPLVGYEADRAAGCCPRYGPRKAWHLVGTVCVLLSFPFIFS-PCLGCGVATPEWAALLYY  131

Query  1263  GYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF  1084
             G  I  V+F  GW+ TQISH+S++  +  N+  ++   + R AFT+VA++ +Y   + + 
Sbjct  132   GPFI--VIFQFGWASTQISHLSLIPELVTNDHEKVELTALRYAFTVVANITVYGAAWLLL  189

Query  1083  -------TNNAEDIK----------TQYRWMAfisifiggvfviiFHLGVKEPRKKDDDG  955
                       A+DI             +R ++ + + +G VF ++FHLG +E R+     
Sbjct  190   HLQGSSRVEPAQDIDISDQLGGQDVPMFRNLSLLVVGVGAVFSLLFHLGTRERRRPHV--  247

Query  954   HEKIGSNTP------------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDL  811
              E+ G +TP            W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L
Sbjct  248   -EEPGEHTPLLAPAVTQPLLLWKHWLREPAFYQVGMLYMTTRLIVNLSQTYMAMYLTYSL  306

Query  810   RMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKM  631
              + +   + +P ++YL  F +S L++ +     R   +F+  G+L +L  A  + L   +
Sbjct  307   HLPKKFIATIPLVMYLSGFFSSFLMKPINKRIGRNMTYFS--GLLVILAFAAWVALAEGL  364

Query  630   NSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLE  451
                +YA +VL+G   A ++VTS+ M + L+  H +  AFVYGSM F DKV  G+A+  ++
Sbjct  365   GVAVYAAAVLLGAGCATILVTSLAMTADLIGPHTNSGAFVYGSMSFSDKVANGLAVMAIQ  424

Query  450   SFEDADPVACNPAQACFSVTRFSLGFIPG  364
             S        C   +AC S   +++  + G
Sbjct  425   SLHPCPSELC--CRACVSFYHWAMVAVTG  451



>ref|XP_005098265.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X2 [Aplysia californica]
Length=603

 Score =   177 bits (448),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 140/459 (31%), Positives = 233/459 (51%), Gaps = 43/459 (9%)
 Frame = -2

Query  1605  EEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSS-AAIVTLVGQFADA  1429
             +  E  L  C  ++YGVGH+LND+T   W++YLL++L  +   P+  A  + L+GQ +DA
Sbjct  37    QHTELALNNCERMSYGVGHVLNDLTASMWFSYLLVFLHQVRNFPNLLAGNLMLIGQVSDA  96

Query  1428  FTTIIAGELIDR------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
               T   G   DR       G+ K WH  G + V  SF  LF    I C   G      Q 
Sbjct  97    IFTPFIGFESDRTQGIKYLGKRKTWHLIGTLCVMASFPFLF----IECITCGFAPNIAQF  152

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
             V Y    V+F  GW+ TQISH+S  N  T     R+   S RN+FT++++L +Y +   +
Sbjct  153   VYYAPFVVIFQFGWAATQISHLSFANDYTPYSGERVRLQSIRNSFTVMSNLSVYGIFVLL  212

Query  1086  F-------TNNAEDIKT----QYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIG  940
             F       + + +D+      ++R +A IS+ +G VF +IF++G KE RK   D    + 
Sbjct  213   FYLEGKSSSGSNDDLGPGDGPKFRNLALISVGLGTVFNVIFYVGTKERRKSSSDQKSLLD  272

Query  939   -------------SNTPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQ  799
                          S   W  WLK   +YQ+A +Y+  R+  NVSQ +  +Y+   +++ +
Sbjct  273   PEQTTIERSTVQKSKMQWKDWLKEHQFYQIALLYMTARLYINVSQVYFPMYLTETVKLDK  332

Query  798   SAKSLVPAIIYLCSFITSVLLQEL-EWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSF  622
             ++ +++P + Y+ SF  S+L   +  ++G++L  F    G L  +   + +      +  
Sbjct  333   NSIAILPLVTYVSSFFMSLLAPVMNHYAGRKLSYFI---GALIGIASCLWLYFVGHRDFT  389

Query  621   MYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFE  442
             +Y  +VL+G AN+L+++T I + S L+ +  +  AFV+G+M F DK+  G+A+  ++ F 
Sbjct  390   VYGCAVLMGCANSLLLITVISLTSDLIKQDTESGAFVFGAMSFTDKLSNGLAVLLIQKFH  449

Query  441   DADPVACNPAQACFSVTRFSLGFIPGIAALFGVIVSFTM  325
               +   C P  AC    R+    IPG A +  +I   T+
Sbjct  450   PCE--GCCP--ACEPYYRYVQSTIPGGALIVALIALATL  484



>ref|XP_004865893.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X2 [Heterocephalus glaber]
Length=501

 Score =   175 bits (444),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 145/463 (31%), Positives = 238/463 (51%), Gaps = 49/463 (11%)
 Frame = -2

Query  1599  EEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFT  1423
               +PL   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   
Sbjct  13    SPRPLSLAARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLC  72

Query  1422  TIIAGELIDR--------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQ  1270
             T + G   DR        +G  K WH AG + V +SF  +F     PC   G+ +P    
Sbjct  73    TPLVGYEADRAAGGRCARYGPRKAWHLAGTVCVLLSFPFIFS----PCLGCGASTPEWAA  128

Query  1269  TVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFF  1090
              + Y    VVF  GW+ TQI+H+S++  +  ++  ++   + R AFT+VA++ +Y   + 
Sbjct  129   LLYYGPFIVVFQFGWAATQIAHLSLIPELVTSDHEKVELTALRYAFTVVANIAVYGAAWL  188

Query  1089  VFTNNA-------EDIKTQ----------YRWMAfisifiggvfviiFHLGVKE---PRK  970
             +    A       EDI             +R ++   + +G VF ++FHLG +E   PR+
Sbjct  189   LLHLQASSHSGPTEDIAVGDQLGVQDVPVFRNLSLAVVGVGAVFSLLFHLGTRERHRPRR  248

Query  969   -KDDDGHEKIGSNTP-----WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLR  808
              ++ D H  + S+       W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L 
Sbjct  249   VEEPDEHSPLISSATGPLLLWKHWLREPAFYQVGILYMTTRLIVNLSQTYIAMYLTYSLH  308

Query  807   MSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMN  628
             + +   + +P ++YL  F +S L++ L  S  R   +FA  G+L +L  A  + L  ++ 
Sbjct  309   LPKRFIATIPLVMYLSGFFSSFLMKPLNRSIGRNFTYFA--GLLVVLAFASWVTLADRLG  366

Query  627   SFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLES  448
               +YA +VL+G   A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  ++S
Sbjct  367   MAVYAAAVLLGAGCATILVTSLAMTADLIGSHSQSGAFVYGAMSFSDKVANGLAVMAVQS  426

Query  447   FEDADPVACNPAQACFSVTRFSLGFIPGIAALFGVIVSFTMKL  319
                     C   +AC     + +     +A   GV V+ T+ L
Sbjct  427   LHPCPSELC--CKACMDFYHWVM-----VAVTGGVGVAATLAL  462



>ref|XP_007992976.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X1 [Chlorocebus sabaeus]
Length=480

 Score =   175 bits (443),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 137/450 (30%), Positives = 229/450 (51%), Gaps = 49/450 (11%)
 Frame = -2

Query  1599  EEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFT  1423
               +PL   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   
Sbjct  13    SRRPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLC  72

Query  1422  TIIAGELIDR-------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQT  1267
             T + G   DR       +G  K WH  G + V +SF  +F     PC   G+ +P     
Sbjct  73    TPLVGYEADRAAGCCPRYGPRKAWHLVGTVCVLLSFPFIFS----PCLGCGAATPEWAAL  128

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
             + Y    V+F  GW+ TQISH+S++  +  N+  ++   + R AFT+VA++ +Y   + +
Sbjct  129   LYYGPFIVIFQFGWASTQISHLSLIPELVTNDHEKVELTALRYAFTVVANITVYGAAWLL  188

Query  1086  F-------TNNAEDIK----------TQYRWMAfisifiggvfviiFHLGVKEPRKKDDD  958
                         +DI             +R ++ + + +G VF ++FHLG +E R+    
Sbjct  189   LHLQGSSRVEPTQDIDIGDQLGGQDVPMFRNLSLLVVGVGAVFSLLFHLGTRERRRPHV-  247

Query  957   GHEKIGSNTP------------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVIND  814
               E+ G +TP            W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   
Sbjct  248   --EEPGEHTPLLAPAVAQPLLLWKHWLREPAFYQVGVLYMTTRLIVNLSQTYMAMYLTYS  305

Query  813   LRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIK  634
             L + +   + +P ++YL  F +S L++ +     R   +F+  G+L +L  A  + L   
Sbjct  306   LHLPKKFIATIPLVMYLSGFFSSFLMKPINKRIGRNMTYFS--GLLVILAFAAWVALAEG  363

Query  633   MNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFL  454
             +   +YA +VL+G   A ++VTS+ M + L+  H +  AFVYGSM F DKV  G+A+  +
Sbjct  364   LGVAIYAAAVLLGAGCATILVTSLAMTADLIGPHTNSGAFVYGSMSFSDKVANGLAVMAI  423

Query  453   ESFEDADPVACNPAQACFSVTRFSLGFIPG  364
             +S        C   +AC S   +++  + G
Sbjct  424   QSLHPCPSELC--CRACVSFYHWAMVAVTG  451



>ref|XP_003779074.1| PREDICTED: LOW QUALITY PROTEIN: major facilitator superfamily 
domain-containing protein 12 [Pongo abelii]
Length=480

 Score =   174 bits (442),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 138/448 (31%), Positives = 229/448 (51%), Gaps = 49/448 (11%)
 Frame = -2

Query  1593  KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTI  1417
             +PL   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   T 
Sbjct  15    RPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLCTP  74

Query  1416  IAGELIDR-------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQTVG  1261
             + G   DR       +G  K WH  G + V +SF  +F     PC   G+ +P     + 
Sbjct  75    LVGYEADRAASCCARYGPRKAWHLVGTVCVLLSFPFIF----XPCLGCGAATPEWAALLY  130

Query  1260  YCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF-  1084
             Y    V+F  GW+ TQISH+S++  +  NE  ++   + R AFT+VA++ +Y   + +  
Sbjct  131   YGPFIVIFQFGWASTQISHLSLIPELVTNEHEKVELTALRYAFTVVANITVYGAAWLLLH  190

Query  1083  ------TNNAEDIKTQ----------YRWMAfisifiggvfviiFHLGVKEPRKKDDDGH  952
                       +DI             +R ++ + + +G VF ++FHLG +E R+      
Sbjct  191   LQGSSRAEPTQDISISDQLGGQDVPVFRNLSLLVVGVGAVFSLLFHLGTRERRRPHV---  247

Query  951   EKIGSNTP------------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLR  808
             E+ G +TP            W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L 
Sbjct  248   EEPGEHTPLLAPATAQPLLLWKHWLREPAFYQVGMLYMATRLIVNLSQTYMAMYLTYSLH  307

Query  807   MSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMN  628
             + +   + +P ++YL  F +S L++ +     R   +F+  G+L +L  A  + L   + 
Sbjct  308   LPKKFIATIPLVMYLSGFFSSFLMKPINKCIGRNMTYFS--GLLVILAFAAWVALAEGLG  365

Query  627   SFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLES  448
               +YA +VL+G   A ++VTS+ M + L+  H +  AFVYGSM F DKV  G+A+  ++S
Sbjct  366   VAVYAAAVLLGAGCATILVTSLAMTADLIGPHTNSGAFVYGSMSFSDKVANGLAVMAIQS  425

Query  447   FEDADPVACNPAQACFSVTRFSLGFIPG  364
                     C   +AC S   +++  + G
Sbjct  426   LHPCPSELC--CRACVSFYHWAMVAVTG  451



>ref|XP_006722709.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X2 [Homo sapiens]
 ref|XP_006722710.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X3 [Homo sapiens]
Length=538

 Score =   175 bits (444),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 137/450 (30%), Positives = 231/450 (51%), Gaps = 49/450 (11%)
 Frame = -2

Query  1599  EEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFT  1423
               +PL   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   
Sbjct  13    SPRPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLC  72

Query  1422  TIIAGELIDR-------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQT  1267
             T + G   DR       +G  K WH  G + V +SF  +F     PC   G+ +P     
Sbjct  73    TPLVGYEADRAASCCARYGPRKAWHLVGTVCVLLSFPFIFS----PCLGCGAATPEWAAL  128

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
             + Y    V+F  GW+ TQISH+S++  +  N+  ++   + R AFT+VA++ +Y   + +
Sbjct  129   LYYGPFIVIFQFGWASTQISHLSLIPELVTNDHEKVELTALRYAFTVVANITVYGAAWLL  188

Query  1086  F-------TNNAEDIKTQ----------YRWMAfisifiggvfviiFHLGVKEPRKKDDD  958
                         +DI             +R ++ + + +G VF ++FHLG +E R+    
Sbjct  189   LHLQGSSRVEPTQDISISDQLGGQDVPVFRNLSLLVVGVGAVFSLLFHLGTRERRRPHA-  247

Query  957   GHEKIGSNTP------------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVIND  814
               E+ G +TP            W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   
Sbjct  248   --EEPGEHTPLLAPATAQPLLLWKHWLREPAFYQVGILYMTTRLIVNLSQTYMAMYLTYS  305

Query  813   LRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIK  634
             L + +   + +P ++YL  F++S L++ +     R   +F+  G+L +L  A  + L   
Sbjct  306   LHLPKKFIATIPLVMYLSGFLSSFLMKPINKCIGRNMTYFS--GLLVILAFAAWVALAEG  363

Query  633   MNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFL  454
             +   +YA +VL+G   A ++VTS+ M + L+  H +  AFVYGSM F+DKV  G+A+  +
Sbjct  364   LGVAVYAAAVLLGAGCATILVTSLAMTADLIGPHTNSGAFVYGSMSFLDKVANGLAVMAI  423

Query  453   ESFEDADPVACNPAQACFSVTRFSLGFIPG  364
             +S        C   +AC S   +++  + G
Sbjct  424   QSLHPCPSELC--CRACVSFYHWAMVAVTG  451



>ref|XP_007245843.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Astyanax mexicanus]
 ref|XP_007245844.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X2 [Astyanax mexicanus]
 ref|XP_007245845.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X3 [Astyanax mexicanus]
Length=459

 Score =   173 bits (439),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 129/415 (31%), Positives = 224/415 (54%), Gaps = 39/415 (9%)
 Frame = -2

Query  1569  LTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTIIAGELIDR  1393
             L Y VGH LND+  C W+TYLL+Y   +     +SA ++ LVGQ AD  +T + G   DR
Sbjct  12    LAYAVGHFLNDLCACMWFTYLLVYYHSVLSFRDTSAGLLLLVGQIADGISTPLVGYESDR  71

Query  1392  ------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQTVGYCISAVVFC  1234
                   +G+ K WH  G + V +SF  +F     PC   G  +P  V  + +    +VF 
Sbjct  72    TRGCGTYGKRKTWHLIGTVSVMLSFPFIFN----PCVGCGVGTPQWVGLIYFMPFIIVFQ  127

Query  1233  SGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF------TNNA  1072
              GW+ TQISH+S++  +   E +++   + R AFT++A++ +Y V + +F        + 
Sbjct  128   FGWAATQISHLSLIPELVTCEHAKVELTAYRYAFTVMANITVYGVAWLLFHFQHLADPSV  187

Query  1071  EDIKTQ-----YRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEK----------IGS  937
              D  +Q     +R +A I + +G +F +IFH+G +E     D+  E+           GS
Sbjct  188   ADHLSQVDIPIFRDLALIVLGVGAIFTLIFHMGTQERVPLRDETGERHPLLPDFSSGSGS  247

Query  936   NT--PWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYL  763
              T   W +W     +YQVA +Y+ TR++ N+SQT++++++IN L + +   + +P +IY+
Sbjct  248   RTLLQWKHWFTEPSFYQVALLYMCTRLIVNLSQTYISMFLINSLLLPKKYIATIPLVIYV  307

Query  762   CSFITSVLLQELEWS-GKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIAN  586
               F++S+ ++ +    G  +  F    G++ +L  AV +LL ++M S ++  +VL+G  +
Sbjct  308   SGFVSSLGMKPVSKRIGTTMTYFL---GLMPILGFAVWVLLDLQMGSRVFGAAVLLGSGS  364

Query  585   ALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVAC  421
             A+++V S+ M + L+       AFVYG+M F DKV  G+A+  ++       + C
Sbjct  365   AVILVMSLSMTANLIGDQTQSGAFVYGAMSFTDKVSNGLAVMLIQGLYPCRTLVC  419



>ref|XP_005098264.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Aplysia californica]
Length=613

 Score =   175 bits (444),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 143/467 (31%), Positives = 238/467 (51%), Gaps = 49/467 (10%)
 Frame = -2

Query  1605  EEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDIGLSPSS-AAIVTLVGQFADA  1429
             +  E  L  C  ++YGVGH+LND+T   W++YLL++L  +   P+  A  + L+GQ +DA
Sbjct  37    QHTELALNNCERMSYGVGHVLNDLTASMWFSYLLVFLHQVRNFPNLLAGNLMLIGQVSDA  96

Query  1428  FTTIIAGELIDR------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
               T   G   DR       G+ K WH  G + V  SF  LF    I C   G      Q 
Sbjct  97    IFTPFIGFESDRTQGIKYLGKRKTWHLIGTLCVMASFPFLF----IECITCGFAPNIAQF  152

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
             V Y    V+F  GW+ TQISH+S  N  T     R+   S RN+FT++++L +Y +   +
Sbjct  153   VYYAPFVVIFQFGWAATQISHLSFANDYTPYSGERVRLQSIRNSFTVMSNLSVYGIFVLL  212

Query  1086  F-------TNNAEDIKT----QYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIG  940
             F       + + +D+      ++R +A IS+ +G VF +IF++G KE RK   D    + 
Sbjct  213   FYLEGKSSSGSNDDLGPGDGPKFRNLALISVGLGTVFNVIFYVGTKERRKSSSDQKSLLD  272

Query  939   -------------SNTPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQ  799
                          S   W  WLK   +YQ+A +Y+  R+  NVSQ +  +Y+   +++ +
Sbjct  273   PEQTTIERSTVQKSKMQWKDWLKEHQFYQIALLYMTARLYINVSQVYFPMYLTETVKLDK  332

Query  798   SAKSLVPAIIYLCSFITSVLLQEL-EWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSF  622
             ++ +++P + Y+ SF  S+L   +  ++G++L  F    G L  +   + +      +  
Sbjct  333   NSIAILPLVTYVSSFFMSLLAPVMNHYAGRKLSYFI---GALIGIASCLWLYFVGHRDFT  389

Query  621   MYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESF-  445
             +Y  +VL+G AN+L+++T I + S L+ +  +  AFV+G+M F DK+  G+A+  ++ F 
Sbjct  390   VYGCAVLMGCANSLLLITVISLTSDLIKQDTESGAFVFGAMSFTDKLSNGLAVLLIQKFH  449

Query  444   --ED-ADP----VACNPAQACFSVTRFSLGFIPGIAALFGVIVSFTM  325
               ED ++P    + C P  AC    R+    IPG A +  +I   T+
Sbjct  450   PCEDYSNPYMTDMGCCP--ACEPYYRYVQSTIPGGALIVALIALATL  494



>ref|XP_005587567.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X1 [Macaca fascicularis]
Length=480

 Score =   173 bits (439),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 137/450 (30%), Positives = 228/450 (51%), Gaps = 49/450 (11%)
 Frame = -2

Query  1599  EEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFT  1423
               +PL   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   
Sbjct  13    SRRPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLC  72

Query  1422  TIIAGELIDR-------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQT  1267
             T + G   DR       +G  K WH  G + V +SF  +F     PC   G+ +P     
Sbjct  73    TPLVGYEADRAAGCCPRYGPRKAWHLVGTVCVLLSFPFIFS----PCLGCGAATPEWAAL  128

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
             + Y    V+F  GW+ TQISH+S++  +  N+  ++   + R AFT+VA++ +Y   + +
Sbjct  129   LYYGPFIVIFQFGWASTQISHLSLIPELVTNDHEKVELTALRYAFTVVANITVYGAAWLL  188

Query  1086  F-------TNNAEDIK----------TQYRWMAfisifiggvfviiFHLGVKEPRKKDDD  958
                         +DI             +R ++ + + +G VF ++FHLG +E R+    
Sbjct  189   LHLQGSSRVEPTQDIDIGDQLGGQDVPMFRNLSLLVVGVGAVFSLLFHLGTRERRRPHV-  247

Query  957   GHEKIGSNTP------------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVIND  814
               E+ G +TP            W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   
Sbjct  248   --EEPGEHTPLLAPAVAQPLLLWKHWLREPAFYQVGVLYMTTRLIVNLSQTYMAMYLTYS  305

Query  813   LRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIK  634
             L + +   + +P ++YL  F +S L++ +     R   +F   G+L +L  A  + L   
Sbjct  306   LHLPKKFIATIPLVMYLSGFFSSFLMKPINKRIGRNMTYFL--GLLVILAFAAWVALAEG  363

Query  633   MNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFL  454
             +   +YA +VL+G   A ++VTS+ M + L+  H +  AFVYGSM F DKV  G+A+  +
Sbjct  364   LGVAVYAAAVLLGAGCATILVTSLAMTADLIGPHTNSGAFVYGSMSFSDKVANGLAVMAI  423

Query  453   ESFEDADPVACNPAQACFSVTRFSLGFIPG  364
             +S        C   +AC S   +++  + G
Sbjct  424   QSLHPCPSELC--CRACVSFYHWAMVAVTG  451



>tpg|DAA27823.1| TPA: hypothetical protein BOS_7721 [Bos taurus]
Length=476

 Score =   173 bits (438),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 135/434 (31%), Positives = 224/434 (52%), Gaps = 45/434 (10%)
 Frame = -2

Query  1593  KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTI  1417
             +PL   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   T 
Sbjct  15    RPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLCTP  74

Query  1416  IAGELIDR-------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQTVG  1261
             + G   DR       FG  K WH  G I V +SF  +F     PC   G+ +P     + 
Sbjct  75    LVGFEADRAAGRCARFGPRKAWHLVGTICVLLSFPFIFS----PCLGCGAATPEWAALLY  130

Query  1260  YCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF-  1084
             Y    V+F  GW+ TQI+H+S++  +  N+  ++   + R AFT+VA++ +Y   + +  
Sbjct  131   YGPFIVIFQFGWAATQIAHLSLIPELVTNDHEKVELTALRYAFTVVANITVYGAAWLLLH  190

Query  1083  ------TNNAEDIKTQ--------YRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEK  946
                   T   ED+  Q        +R ++ + + +G VF ++FHLG +E R++     E+
Sbjct  191   LQGSPHTGPTEDVSDQLGVQDVPVFRNLSLLVVGVGAVFSLLFHLGTREGRRRQV---EE  247

Query  945   IGSNTP------------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMS  802
              G ++P            W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L + 
Sbjct  248   PGEHSPLLAPSTTQPLLLWKHWLREPAFYQVGLLYMSTRLIVNLSQTYIAMYLTYSLHLP  307

Query  801   QSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSF  622
             +   + +P ++YL  F +S L++ +     R   +F   G+L +L  A  + L  ++   
Sbjct  308   KRFIATIPLVMYLSGFCSSFLMKPVNKCIGRNMTYFV--GLLVILAFAAWVALAEELGMA  365

Query  621   MYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFE  442
             +Y  +VL+G+  A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  ++S  
Sbjct  366   VYVAAVLLGMGCATILVTSLAMTADLIGPHTHSGAFVYGAMSFSDKVANGLAVMAIQSLH  425

Query  441   DADPVACNPAQACF  400
                   C  A   F
Sbjct  426   PCSLELCCKACVAF  439



>ref|XP_010766473.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X1 [Notothenia coriiceps]
Length=431

 Score =   172 bits (436),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 127/420 (30%), Positives = 228/420 (54%), Gaps = 42/420 (10%)
 Frame = -2

Query  1602  EEEKPLGR----CSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQF  1438
             E+  P GR    C  + +  GH LND+    W+TYLL+YL  + G   +   ++ L+GQ 
Sbjct  2     EQFVPAGRSLSACRRVCFAAGHFLNDLCSSMWFTYLLVYLHSVLGFRSTYGGVLLLIGQI  61

Query  1437  ADAFTTIIAGELIDR----FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-V  1273
             AD  +T + G   D+    +G+ K WH  G I V VSF  +F     PC      +P   
Sbjct  62    ADGVSTPLVGYQSDKTSCFYGKRKTWHLFGTICVLVSFPFIFN----PCLACNDSTPQWA  117

Query  1272  QTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
             Q + +    ++F  GW+ TQISH+S++  +  +ES R+   + R AFT+VA++ +Y+V +
Sbjct  118   QILYFSPFIIIFQIGWAATQISHLSLIPGLVSSESDRVELTAYRYAFTVVANITVYSVAW  177

Query  1092  FVFTNNAED-IKTQ------------YRWMAfisifiggvfviiFHLGVKEPRKKDDDGH  952
              +F   A++ + T             +R +A + +  G +F ++FH+G KE        +
Sbjct  178   LLFHFQAQNNMDTSISDSLGKVDIPLFRTLALVMLATGALFSMVFHIGTKEEVTDSMSEN  237

Query  951   EKIGSNTP----------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMS  802
             ++I  +T           W +WLK   +YQVA +Y+ TR++ N+SQT+++VY+ N L + 
Sbjct  238   QRILPSTSQEESPGLVFQWKHWLKEPSFYQVAFLYMCTRLIVNLSQTYISVYLTNSLMLP  297

Query  801   QSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAG-GGILWLLCGAVVMLLPIKMNS  625
             ++  +++P ++Y+  F+ S++++ +    KR+ I      G+L ++  AV +L+   M +
Sbjct  298   KNYIAIIPLVMYVSGFVCSLVMKPVS---KRMGISITYLVGLLLVVGFAVWVLVDKSMGA  354

Query  624   -FMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLES  448
               +Y  +VL+G  +A ++V S+ M + L+ +    +AFVYGSM   DK+  G+ +  ++S
Sbjct  355   ETIYGAAVLLGAGSASILVMSLSMTATLIGEQTGSAAFVYGSMSLTDKLANGLGVLLIQS  414



>emb|CDQ71408.1| unnamed protein product [Oncorhynchus mykiss]
Length=548

 Score =   174 bits (441),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 132/462 (29%), Positives = 233/462 (50%), Gaps = 54/462 (12%)
 Frame = -2

Query  1671  NCFLPGHTISVYRRIMGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylT  1492
             N  L    + +   +M       E   PL R   L Y  GH LND+    W+TYLL+Y  
Sbjct  9     NLILSSFQMKLLVTVMSDQLLSNERSLPLFR--RLCYAAGHFLNDLCASLWFTYLLVYYH  66

Query  1491  DI-GLSPSSAAIVTLVGQFADAFTTIIAGELIDR------FGQFKIWHGAGCIMVGVSFI  1333
              + G   + A ++  +GQ AD  +T + G   DR      +G+ K WH  G I V +SF 
Sbjct  67    SVLGFKSTYAGVLLFIGQIADGVSTPLVGIESDRTAGCGSYGKRKTWHLVGTISVLISFP  126

Query  1332  SLFGGTCIPCKILGSDSPT-VQTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIA  1156
              +F     PC   G ++P  V    +    ++F  GW+ TQISH+S++  +  +E +++ 
Sbjct  127   FIFN----PCLGCGDNTPQWVWLTYFTPFIIIFQFGWAATQISHLSLIPELVSSEHAKVE  182

Query  1155  CVSCRNAFTMVASLMLYAVTFFVFTNNAE--------------DIKTQYRWMAfisifig  1018
               + R AFT+VA++ +YAV   +F   A+              DI   +R ++ I + IG
Sbjct  183   LTAYRYAFTVVANITVYAVALLLFHFQAQQTGDPSVTDSLGIVDIPI-FRDLSLIVLGIG  241

Query  1017  gvfviiFHLGVKE-------PRKKDDDGHEKIGSNT---------PWTYWLKRVLYYQVA  886
              VF  +FHLG +E       P  ++D+    I   +          W +WLK   +YQVA
Sbjct  242   AVFSFVFHLGTRERVPHREEPGSQNDESQPLISPTSHNTIPQSLLQWNHWLKEPSFYQVA  301

Query  885   SIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQEL-EWSGKR  709
              +Y+ TR++ N+SQT++++Y+IN L + ++  + +P ++Y+  F+ S++++ + ++ G  
Sbjct  302   FLYMCTRLIVNLSQTYVSMYLINSLLLPKNFIATIPLVMYVSGFVCSLVMKPISKFVGIS  361

Query  708   LKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHL  529
             +       G++ +L  +  +L+ + +   +Y  +VL+G  +A ++V S+ M + L+ +  
Sbjct  362   MTYLL---GLVLILGFSSWVLVGMNIGRLIYGAAVLLGAGSATILVMSLSMTAKLIGEQT  418

Query  528   DGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQAC  403
                AFVYG+M F DKV  G+ +  ++         CN   +C
Sbjct  419   QSGAFVYGAMSFTDKVANGIGVIIIQRLH-----PCNSQDSC  455



>ref|XP_005654765.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X1 [Sus scrofa]
Length=478

 Score =   172 bits (437),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 136/434 (31%), Positives = 226/434 (52%), Gaps = 41/434 (9%)
 Frame = -2

Query  1599  EEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFT  1423
               +PL   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   
Sbjct  13    PPRPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLC  72

Query  1422  TIIAGELIDR-------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQT  1267
             T + G  +DR       FG  K WH  G I V +SF  +F     PC   G+ +P     
Sbjct  73    TPLVGFEVDRAAGRCARFGPRKAWHLVGTICVLLSFPFIFS----PCLGCGATTPEWAAL  128

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
             + Y    V+F  GW+ TQI+H+S++  +  N+  ++   + R AFT+VA++ +Y   + +
Sbjct  129   LYYGPFIVIFQFGWAATQIAHLSLIPELVTNDHEKVELTALRYAFTVVANITVYGAAWLL  188

Query  1086  F-------TNNAEDIKTQ--------YRWMAfisifiggvfviiFHLGVKEPRKK---DD  961
                       + +DI  Q        +R ++ + + IG VF ++FHLG +E R++   + 
Sbjct  189   LHLQGSPHMESTQDINDQLGVQDVPVFRNLSLLVVGIGAVFSLLFHLGTREGRRRQVEEP  248

Query  960   DGHEKI---GSNTP---WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQ  799
             D H  +    +  P   W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L + +
Sbjct  249   DEHGPLLAPATARPLLLWKHWLQEPAFYQVGLLYMSTRLIVNLSQTYMAMYLTYSLNLPK  308

Query  798   SAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFM  619
                + +P ++YL  F +S L++ +     R   +F   G+L +L  A  + L  ++   +
Sbjct  309   KFIATIPLVMYLSGFFSSFLMKPINKCIGRNMTYFV--GLLVILAFAAWVALTNELGVAV  366

Query  618   YALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFED  439
             Y  +VL+G   A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  ++S   
Sbjct  367   YVAAVLLGTGCATILVTSLAMTADLIGPHTHSGAFVYGAMSFSDKVANGLAVMAIQSLHP  426

Query  438   ADPVACNPAQACFS  397
                  C   +AC S
Sbjct  427   CSLELC--CRACVS  438



>ref|XP_007908362.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Callorhinchus milii]
Length=481

 Score =   172 bits (437),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 129/427 (30%), Positives = 226/427 (53%), Gaps = 44/427 (10%)
 Frame = -2

Query  1593  KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTI  1417
             +PL  C  L Y VGH LND+    W+TYLLLY+  + G S + A  + LVGQ ADA +T 
Sbjct  5     EPLSLCHRLCYAVGHFLNDLCASLWFTYLLLYIHAVLGFSSAGAGALLLVGQLADALSTP  64

Query  1416  IAGELIDRF------GQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT---VQTV  1264
             I G   D        G+ K WH  G + V +SF  +F         LG    T    Q V
Sbjct  65    IIGLEADHGPACGCCGRRKTWHLVGTVCVALSFPFIFN------PALGRTPATPEWAQLV  118

Query  1263  GYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF  1084
              +    V+F  GW+ TQISH+S++  +  ++  ++   + R AFT+VA++ ++AV + +F
Sbjct  119   YFLPFVVIFQFGWAATQISHLSLIPELASSQQEKVELTAFRYAFTVVANITVFAVAWLLF  178

Query  1083  TNNAEDIKTQ----------YRWMAfisifiggvfviiFHLGVKEPRK-------KDDDG  955
                  D  +           +R +A I + IG +F IIFH+G +EP +        ++D 
Sbjct  179   HFQGLDPASASSLGEQDIPLFRSLALIVVGIGTLFSIIFHVGTREPERVGQRLEAGNEDQ  238

Query  954   H---EKIG---SNTPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSA  793
                 E++G       W +WL+ + +Y VA +Y+ TR++ N+SQT++ +Y+   L + ++ 
Sbjct  239   EPLVERVGGPEQRLDWKHWLQELSFYHVACLYMCTRLIVNLSQTYIVMYITYTLNLPKNY  298

Query  792   KSLVPAIIYLCSFITSVLLQEL-EWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMY  616
              ++VP ++Y+  F++S  ++ + +W G+ +  F    G++ +L  A  +    ++   ++
Sbjct  299   VAIVPLVMYVSGFLSSFCMKPVNQWVGRNMTYFL---GLVLILAFAYWVCF-FRIEKDIF  354

Query  615   ALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDA  436
               +VL+G  +A ++VTS+ M + L+  +   +AFVYG+M F DK+  G+ +  +++    
Sbjct  355   GAAVLLGSGSATILVTSLSMTADLIGDNTQSAAFVYGAMSFTDKLANGLGVITIQNLHPC  414

Query  435   DPVACNP  415
                 C P
Sbjct  415   RSQICCP  421



>emb|CAJ81767.1| chromosome 19 open reading frame 28 [Xenopus (Silurana) tropicalis]
Length=466

 Score =   172 bits (437),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 128/417 (31%), Positives = 216/417 (52%), Gaps = 49/417 (12%)
 Frame = -2

Query  1488  IGLSPSSAAIVTLVGQFADAFTTIIAGELIDR------FGQFKIWHGAGCIMVGVSFISL  1327
             +G     A I+ L+GQ AD   T + G   DR      +G+ K WH  G I V +SF  +
Sbjct  14    LGFDSFYAGILLLIGQIADGICTPLVGYESDRHPGLLSYGRRKSWHLVGTISVVLSFPFI  73

Query  1326  FGGTCIPCKILGSDSPTVQTVG--YCIS-AVVFCSGWSCTQISHMSMVNCITLNESSRIA  1156
             F       + LG    T Q VG  Y I   V+F  GW+ TQISH+S++  ++ N+  ++ 
Sbjct  74    FN------QCLGCTQNTPQWVGLIYFIPFIVIFQFGWAATQISHLSLIPELSQNDHDKVE  127

Query  1155  CVSCRNAFTMVASLMLYAVTFFVF--------TNNAEDIKTQ----YRWMAfisifiggv  1012
               + R AFT++A++ +YAV + +         T N E++  Q    +R +A I + +G +
Sbjct  128   LTAFRYAFTVMANITVYAVAWLLLHFHMGEDKTENMENLSRQDIPIFRALALIMVGVGSL  187

Query  1011  fviiFHLGVKEP-----RKKDDDGHEKIGSNTP-----------WTYWLKRVLYYQVASI  880
             F ++FH+G KE      R  + D  +   S  P           W  WL    +YQVA +
Sbjct  188   FSLLFHIGTKEKPQTFHRLLETDDPDSPHSEEPRLSEPPVPLMVWKRWLMEPSFYQVAVL  247

Query  879   YVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQEL-EWSGKRLK  703
             Y+ TR++ N+SQTF+AVY+ N L + ++  + +P ++Y+  F++S L++ + +W G+ L 
Sbjct  248   YMCTRLIVNLSQTFIAVYLTNSLHLPKNYIATIPLVMYVSGFVSSFLMKPINKWIGRNLT  307

Query  702   IFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDG  523
              F    G++ +   A  + L   +   +Y  +V++G  +A ++VTS+ M + L+  H   
Sbjct  308   YFL---GLIAIAAFAAWVALDPGLGVAVYGAAVVLGTGSATILVTSLSMTADLIGTHSRS  364

Query  522   SAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRFSLGFIPGIAAL  352
             +AFVYG+M F DKV  G+A+  ++S        C P  AC     + +  + G+ A+
Sbjct  365   AAFVYGAMSFTDKVANGLAVVAIQSLHPCRTQVCCP--ACIPFYHWVMVTVTGVVAI  419



>ref|XP_004865892.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X1 [Heterocephalus glaber]
Length=571

 Score =   174 bits (440),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 135/423 (32%), Positives = 223/423 (53%), Gaps = 42/423 (10%)
 Frame = -2

Query  1599  EEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFT  1423
               +PL   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   
Sbjct  13    SPRPLSLAARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLC  72

Query  1422  TIIAGELIDR--------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQ  1270
             T + G   DR        +G  K WH AG + V +SF  +F     PC   G+ +P    
Sbjct  73    TPLVGYEADRAAGGRCARYGPRKAWHLAGTVCVLLSFPFIFS----PCLGCGASTPEWAA  128

Query  1269  TVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFF  1090
              + Y    VVF  GW+ TQI+H+S++  +  ++  ++   + R AFT+VA++ +Y   + 
Sbjct  129   LLYYGPFIVVFQFGWAATQIAHLSLIPELVTSDHEKVELTALRYAFTVVANIAVYGAAWL  188

Query  1089  VF-------TNNAEDIKTQ----------YRWMAfisifiggvfviiFHLGVKE---PRK  970
             +        +   EDI             +R ++   + +G VF ++FHLG +E   PR+
Sbjct  189   LLHLQASSHSGPTEDIAVGDQLGVQDVPVFRNLSLAVVGVGAVFSLLFHLGTRERHRPRR  248

Query  969   -KDDDGHEKIGSNTP-----WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLR  808
              ++ D H  + S+       W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L 
Sbjct  249   VEEPDEHSPLISSATGPLLLWKHWLREPAFYQVGILYMTTRLIVNLSQTYIAMYLTYSLH  308

Query  807   MSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMN  628
             + +   + +P ++YL  F +S L++ L  S  R   +FA  G+L +L  A  + L  ++ 
Sbjct  309   LPKRFIATIPLVMYLSGFFSSFLMKPLNRSIGRNFTYFA--GLLVVLAFASWVTLADRLG  366

Query  627   SFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLES  448
               +YA +VL+G   A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  ++S
Sbjct  367   MAVYAAAVLLGAGCATILVTSLAMTADLIGSHSQSGAFVYGAMSFSDKVANGLAVMAVQS  426

Query  447   FED  439
                
Sbjct  427   LHP  429



>ref|XP_002898143.1| Glycoside-Pentoside-Hexuronide (GPH):Cation Symporter Family 
[Phytophthora infestans T30-4]
 gb|EEY63556.1| Glycoside-Pentoside-Hexuronide (GPH):Cation Symporter Family 
[Phytophthora infestans T30-4]
Length=495

 Score =   172 bits (437),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 127/407 (31%), Positives = 221/407 (54%), Gaps = 36/407 (9%)
 Frame = -2

Query  1569  LTYGVGHMLNDITQCCWytylllylTD-IGLSPSSAAIVTLVGQFADAFTTIIAGELIDR  1393
             L+YGVGH+LND+    W++YLL++L   + +SP  +A+V   GQ AD   T + G   DR
Sbjct  12    LSYGVGHVLNDMCASTWFSYLLVFLLHAVDMSPVDSAVVMFCGQIADGLATPLVGVFSDR  71

Query  1392  --------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAVVF  1237
                      G+ K W   G ++V + F  +FG  C P     S S  V  V Y  +A +F
Sbjct  72    SSGLPWLGLGRRKTWLAIGSLLVILCFFFVFGA-CAPRWFSDSPSRMVLLVYYSAAASIF  130

Query  1236  CSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTNNAEDI--  1063
               GW+  Q+SHM+MV  ++ +++ R    S R AFT+++++M++ V F V       +  
Sbjct  131   NIGWATVQVSHMAMVPELSDDDNVRCVLNSTRYAFTILSNVMVFCV-FLVLLRVVSPLGV  189

Query  1062  --KTQYRWMAfisifiggvfviiFHLGVKE--PRKKDDDGH----------------EKI  943
                 ++  +A  S+ +GG+  ++F  G  E  P   D +G                 + +
Sbjct  190   PDAEKFTLLACTSLLVGGICTVVFLAGTPEKSPVMADLEGRGHSAFPCEGDLDVPAVDVV  249

Query  942   GS--NTPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAII  769
             G+  +  W+ W K  ++Y+V  +Y+ TR+V NV+Q F++ Y+I  L+MS S+ ++VP ++
Sbjct  250   GASDHMTWSCWFKLGMFYEVGMVYMCTRLVVNVTQVFISFYLIVTLQMSASSIAIVPLLV  309

Query  768   YLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIA  589
             YL  F+ +  L+ L  S  R   F  G G++ +       L P +  +++Y  S+++G+ 
Sbjct  310   YLSGFLATFFLRYLNESLGRTGSFALGAGLIVVALVLSYFLTP-ETATWVYPFSIILGMG  368

Query  588   NALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLES  448
             N+++MVTS+ +   LV  +++  AFVYG+M F DK+  G+A+ F+++
Sbjct  369   NSIIMVTSVCLTGDLVGNNVESGAFVYGAMSFTDKISNGIAILFIQN  415



>ref|XP_010745276.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Larimichthys crocea]
Length=489

 Score =   172 bits (436),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 130/447 (29%), Positives = 229/447 (51%), Gaps = 56/447 (13%)
 Frame = -2

Query  1605  EEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADA  1429
              + ++ L     L+Y VGH LND+    W+TYLL++   + G   ++A ++ LVGQ ADA
Sbjct  2     SDTQRSLPALKRLSYAVGHFLNDLCASMWFTYLLVFYHSVLGFQNTNAGVLLLVGQIADA  61

Query  1428  FTTIIAGELIDR------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
               T + G   DR      +G+ K WH  G + V +SF  +F   C+ C    + +P   +
Sbjct  62    ICTPLIGYESDRTPGCGNYGKRKTWHLVGTLSVLLSFAFIFN-QCLGC---AAVTPQWAS  117

Query  1266  VGYCIS-AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFF  1090
             + Y +   ++F  GW+ TQISH+S++  +   E +++   + R AFT++A++ +YAV + 
Sbjct  118   LTYFVPFIIIFQFGWAATQISHLSLIPELVTCEHAKVELTAYRYAFTVIANITVYAVAYL  177

Query  1089  VF---TNNAEDIKTQ---------YRWMAfisifiggvfviiFHLGVKEPRKKDD-----  961
             +F   T   +D  +          +R +A I + IG +F + FHLG  E +         
Sbjct  178   LFHMQTREDDDPLSDTLGPADVPIFRNLALIVLGIGVLFSLFFHLGTTESKSGAGGEAGE  237

Query  960   -----------------------DGHEKIGSNTPWTYWLKRVLYYQVASIYVFTRVVTNV  850
                                         + S   W  WL++  +YQVA +Y+ TR++ N+
Sbjct  238   EEGRKRMEEEEEEEEGAERRPLLSRPRTLSSLLQWKCWLRQPSFYQVALLYMSTRLIVNL  297

Query  849   SQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQEL-EWSGKRLKIFFAGGGILW  673
             SQT++++Y+IN L + +   + +P ++Y+  F++S +++ L +  GK L  F    G+L 
Sbjct  298   SQTYISMYLINTLGLPKKFIATIPLVMYVSGFLSSFIMKPLSKLIGKCLTYFV---GLLL  354

Query  672   LLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGF  493
             ++  +  +L+  KM   +Y  +VL+G  +A ++V S+ M + L+       AFVYG+M F
Sbjct  355   IMAFSFWVLVDGKMGQQVYGAAVLLGAGSATILVISLAMTAELIADQTQSGAFVYGAMSF  414

Query  492   IDKVLCGVALYFLESFEDADPVACNPA  412
              DK+  GVA+  +++      V C PA
Sbjct  415   TDKLANGVAVMIIQALHPCHTVLCCPA  441



>ref|XP_006047941.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X3 [Bubalus bubalis]
Length=476

 Score =   172 bits (435),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 134/434 (31%), Positives = 224/434 (52%), Gaps = 45/434 (10%)
 Frame = -2

Query  1593  KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTI  1417
             +PL   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   T 
Sbjct  15    RPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLCTP  74

Query  1416  IAGELIDR-------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQTVG  1261
             + G   DR       FG  K WH  G I V +SF  +F     PC   G+ +P     + 
Sbjct  75    LVGFEADRAAGRCARFGPRKAWHLVGTICVLLSFPFIFS----PCLGCGAATPEWAALLY  130

Query  1260  YCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF-  1084
             Y    V+F  GW+ TQI+H+S++  +  N+  ++   + R AFT+VA++ +Y   + +  
Sbjct  131   YGPFIVIFQFGWAATQIAHLSLIPELVTNDHEKVELTALRYAFTVVANITVYGAAWLLLH  190

Query  1083  ------TNNAEDIKTQ--------YRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEK  946
                   +   ED+  Q        +R ++ + + +G VF ++FHLG +E R++     E+
Sbjct  191   LQGSPHSGPTEDVSDQLGVQDVPVFRNLSLLVVGVGAVFSLLFHLGTREGRRRQV---EE  247

Query  945   IGSNTP------------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMS  802
              G ++P            W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L + 
Sbjct  248   PGEHSPLLAPSTTQPLLLWKHWLREPAFYQVGLLYMSTRLIVNLSQTYIAMYLTYSLHLP  307

Query  801   QSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSF  622
             +   + +P ++YL  F +S L++ +     R   +F   G+L +L  A  + L  ++   
Sbjct  308   KRFIATIPLVMYLSGFCSSFLMKPVNKCIGRNMTYFV--GLLVILAFAAWVALAEELGMA  365

Query  621   MYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFE  442
             +Y  +VL+G+  A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  ++S  
Sbjct  366   VYVAAVLLGMGCATILVTSLAMTADLIGPHTHSGAFVYGAMSFSDKVANGLAVMAIQSLH  425

Query  441   DADPVACNPAQACF  400
                   C  A   F
Sbjct  426   PCSLELCCKACVAF  439



>ref|XP_006738796.1| PREDICTED: major facilitator superfamily domain-containing protein 
12, partial [Leptonychotes weddellii]
Length=470

 Score =   171 bits (433),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 142/460 (31%), Positives = 235/460 (51%), Gaps = 46/460 (10%)
 Frame = -2

Query  1599  EEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFT  1423
               +PL   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   
Sbjct  5     PPRPLSVAARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLC  64

Query  1422  TIIAGELIDRF-------GQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQT  1267
             T + G   DR        G  K WH  G I V +SF  +F     PC   G+ +P     
Sbjct  65    TPLVGYEADRAAGRCVRCGPRKAWHLVGTICVLLSFPFIFS----PCLGCGAATPEWAAL  120

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
             + Y    V+F  GW+ TQI+H+S++  +  N+  ++   + R AFT+VAS+ +Y+  + +
Sbjct  121   LYYAPFIVIFQFGWAATQIAHLSLIPELATNDHEKVELTALRYAFTVVASITVYSAAWVL  180

Query  1086  F-------TNNAEDIKTQ--------YRWMAfisifiggvfviiFHLGVKE---PRKKDD  961
                        A  +  Q        ++ ++ + + +G V  ++FHLG +E   PR ++ 
Sbjct  181   LHLQGSPSLGGARRVTDQLGVQDVPVFQNLSLLVVGVGAVSSLLFHLGTREGRRPRAEEP  240

Query  960   DGHEKI---GSNTP---WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQ  799
             D H  +    +  P   W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L + +
Sbjct  241   DEHSPLLAPATARPLLLWKHWLREPAFYQVGLLYMSTRLIVNLSQTYIAMYLTYSLNLPK  300

Query  798   SAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFM  619
                + +P ++YL  F +S L++ +     R   +FA  G+L +L  A  + L   +   +
Sbjct  301   KFIATIPLVMYLSGFCSSFLMKPVNKCIGRNLTYFA--GLLVILAFAAWVALADGLGMAV  358

Query  618   YALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFED  439
             YA +VL+G   A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  ++S   
Sbjct  359   YAAAVLLGTGCATILVTSLAMTADLIGPHTHSGAFVYGAMSFSDKVANGLAVMAIQSLYP  418

Query  438   ADPVACNPAQACFSVTRFSLGFIPGIAALFGVIVSFTMKL  319
                  C   +AC    R+ +     +AA  GV V+ T+ L
Sbjct  419   CSLEIC--CRACMGFYRWVM-----VAATGGVGVAATLCL  451



>ref|XP_004008662.1| PREDICTED: LOW QUALITY PROTEIN: major facilitator superfamily 
domain-containing protein 12 [Ovis aries]
Length=469

 Score =   171 bits (432),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 130/413 (31%), Positives = 217/413 (53%), Gaps = 45/413 (11%)
 Frame = -2

Query  1569  LTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTIIAGELIDR  1393
             L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   T + G   DR
Sbjct  16    LSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLCTPLVGFEADR  75

Query  1392  -------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQTVGYCISAVVF  1237
                    FG  K WH  G I V +SF  +F     PC   G  +P     + Y    V+F
Sbjct  76    AAGRCARFGPRKAWHLVGTICVLLSFPFIFS----PCLGCGPATPEWAALLYYGPFIVIF  131

Query  1236  CSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF-------TN  1078
               GW+ TQI+H+S++  +  N+  ++   + R AFT+VA++ +Y   + +        T 
Sbjct  132   QFGWAATQIAHLSLIPELVTNDHEKVELTALRYAFTVVANITVYGAAWLLLHLQGSPRTG  191

Query  1077  NAEDIKTQ--------YRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTP--  928
              AED+  Q        +R ++ + + +G +F ++FHLG +E R++     E+ G ++P  
Sbjct  192   PAEDVSDQLGVQDVPVFRNLSLLVVGVGAIFSLLFHLGTREGRRRQV---EEPGEHSPLL  248

Query  927   ----------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVP  778
                       W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L + +   + +P
Sbjct  249   VPSTAQPLLLWKHWLREPAFYQVGLLYMSTRLIVNLSQTYIAMYLTYSLHLPKRFIATIP  308

Query  777   AIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLI  598
              ++YL  F +S L++ +     R   +F   G+L +L  A  + L  ++   +Y  +VL+
Sbjct  309   LVMYLSGFCSSFLMKPVNKCIGRNMTYFV--GLLVILAFAAWVALADELGMAVYVAAVLL  366

Query  597   GIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFED  439
             G+  A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  ++S   
Sbjct  367   GMGCATILVTSLAMTADLIGPHTHSGAFVYGAMSFSDKVANGLAVMAIQSLHP  419



>ref|XP_009525330.1| hypothetical protein PHYSODRAFT_558093 [Phytophthora sojae]
 gb|EGZ22613.1| hypothetical protein PHYSODRAFT_558093 [Phytophthora sojae]
Length=499

 Score =   171 bits (433),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 127/412 (31%), Positives = 221/412 (54%), Gaps = 37/412 (9%)
 Frame = -2

Query  1569  LTYGVGHMLNDITQCCWytylllylTD-IGLSPSSAAIVTLVGQFADAFTTIIAGELIDR  1393
             L YGVGH+LND+    W++YLL++L   + +SP  +A+V   GQ AD   T + G   DR
Sbjct  15    LAYGVGHVLNDMCASTWFSYLLVFLLHAVDMSPVDSAVVMFCGQIADGIATPLVGVFSDR  74

Query  1392  --------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAVVF  1237
                      G+ K W   G ++V + F  +FG  C P  +    S  V  V Y  +A VF
Sbjct  75    SSGLPALGLGRRKTWLAVGSLLVVLCFFFVFGA-CAPRWLWAEPSRMVLLVYYSAAASVF  133

Query  1236  CSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTNNAEDI--  1063
               GW+  Q+SHM+MV  ++ +++ R    S R AFT++++++++ V F V     E    
Sbjct  134   NVGWATVQVSHMAMVPELSDDDNVRCVLNSTRYAFTILSNVLVFCV-FLVLLRVVEPFGV  192

Query  1062  --KTQYRWMAfisifiggvfviiFHLGVKE--PRKKDDDGH----------------EKI  943
                 ++  +A+ S+ +GGV  ++F  G  E  P   D +G                 E +
Sbjct  193   PDAEKFTLLAYTSLVVGGVCTVVFLSGTPENSPVMADLEGRGPSAFPCEGDLDVPAVEVV  252

Query  942   GSNTP---WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAI  772
             G+++    W+ W K  ++Y+V  +Y+ TR+V NV+Q F++ Y+I  L MS ++ ++VP +
Sbjct  253   GTSSDKMTWSCWFKLGMFYEVGLVYMCTRLVVNVTQVFISFYLIVTLDMSATSIAIVPLL  312

Query  771   IYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGI  592
             +YL  F+ +  L+ L  +  R   F  G  ++ +       L P +  +++Y  S+++G+
Sbjct  313   VYLSGFLATFFLRYLNEALGRTGSFALGAALIVVALVLSYFLTP-ETATWVYPFSIILGM  371

Query  591   ANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDA  436
              N+++MVTS+ +   LV  +++  AFVYG+M F DK+  G+A+ F+++   A
Sbjct  372   GNSIIMVTSVCLTGDLVGNNVESGAFVYGAMSFTDKISNGIAILFIQNTRQA  423



>ref|XP_005171266.1| PREDICTED: major facilitator superfamily domain containing 12a 
isoform X1 [Danio rerio]
Length=506

 Score =   171 bits (433),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 129/435 (30%), Positives = 228/435 (52%), Gaps = 43/435 (10%)
 Frame = -2

Query  1608  EEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFAD  1432
             ++  E  L     L+Y VGH LND+    W+TYLL++   + G   + A ++ LVGQ AD
Sbjct  2     QDSSEASLPVIRRLSYSVGHFLNDLCASMWFTYLLVFYHSVLGFENTYAGVLLLVGQIAD  61

Query  1431  AFTTIIAGELIDR------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQ  1270
                T + G   DR      +G+ K WH  G I V +SF  +F   C+ C +   ++P   
Sbjct  62    GVCTPLIGYESDRTPGCGSYGKRKTWHLVGTISVLLSFPFIFN-QCLGCDL---NTPQWV  117

Query  1269  TVGYCIS-AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
             +V Y     ++F  GW+ TQISH+S++  +   E  ++   + R AFT++A++ +YAV +
Sbjct  118   SVTYFAPFIIIFQFGWAATQISHLSLIPELVSCEHEKVELTAYRYAFTVIANITVYAVAW  177

Query  1092  FVFTNNAEDIKTQ-----------YRWMAfisifiggvfviiFHLGVKEPRK--KDDDG-  955
              +F     D               +R ++ I + IG VF  +FHLG +E  +  +++DG 
Sbjct  178   LLFHFQEGDDPAVMDNLGPVDIPVFRNLSLIVVGIGAVFTFLFHLGTREKGRPFQEEDGS  237

Query  954   ----HEKIGSNTP---------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVIND  814
                  + + +NT          W  WL +  +YQVA +Y+ TR++ N+SQT++++Y+   
Sbjct  238   SPGERQPLINNTTVAPPANLLHWNNWLTQPSFYQVALLYMSTRLIVNLSQTYISMYLTYT  297

Query  813   LRMSQSAKSLVPAIIYLCSFITSVLLQEL-EWSGKRLKIFFAGGGILWLLCGAVVMLLPI  637
             L + ++  + +P +++L  F +S +++ + +  GK +  F    G+L +L  +  +LL  
Sbjct  298   LLLPKNYIATIPLVMFLSGFASSFIMKPVSKLIGKCMTYFL---GLLLILAFSYWVLLDT  354

Query  636   KMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYF  457
              M   +Y  +VL+G+ +A ++V S+ M + L+       AFVYG+M F DKV  G+ +  
Sbjct  355   HMGDKVYGAAVLLGVGSATILVMSLAMTAELIGDQTHSGAFVYGAMSFTDKVANGLGVMI  414

Query  456   LESFEDADPVACNPA  412
             +++      + C PA
Sbjct  415   IQTLHPCRTMVCCPA  429



>ref|NP_001038437.1| major facilitator superfamily domain containing 12a [Danio rerio]
Length=489

 Score =   171 bits (432),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 129/435 (30%), Positives = 228/435 (52%), Gaps = 43/435 (10%)
 Frame = -2

Query  1608  EEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFAD  1432
             ++  E  L     L+Y VGH LND+    W+TYLL++   + G   + A ++ LVGQ AD
Sbjct  2     QDSSEASLPVIRRLSYSVGHFLNDLCASMWFTYLLVFYHSVLGFENTYAGVLLLVGQIAD  61

Query  1431  AFTTIIAGELIDR------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQ  1270
                T + G   DR      +G+ K WH  G I V +SF  +F   C+ C +   ++P   
Sbjct  62    GVCTPLIGYESDRTPGCGSYGKRKTWHLVGTISVLLSFPFIFN-QCLGCDL---NTPQWV  117

Query  1269  TVGYCIS-AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
             +V Y     ++F  GW+ TQISH+S++  +   E  ++   + R AFT++A++ +YAV +
Sbjct  118   SVTYFAPFIIIFQFGWAATQISHLSLIPELVSCEHEKVELTAYRYAFTVIANITVYAVAW  177

Query  1092  FVFTNNAEDIKTQ-----------YRWMAfisifiggvfviiFHLGVKEPRK--KDDDG-  955
              +F     D               +R ++ I + IG VF  +FHLG +E  +  +++DG 
Sbjct  178   LLFHFQEGDDPAVMDNLGPVDIPVFRNLSLIVVGIGAVFTFLFHLGTREKGRPFQEEDGS  237

Query  954   ----HEKIGSNTP---------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVIND  814
                  + + +NT          W  WL +  +YQVA +Y+ TR++ N+SQT++++Y+   
Sbjct  238   SPGERQPLINNTTVAPPANLLHWNNWLTQPSFYQVALLYMSTRLIVNLSQTYISMYLTYT  297

Query  813   LRMSQSAKSLVPAIIYLCSFITSVLLQEL-EWSGKRLKIFFAGGGILWLLCGAVVMLLPI  637
             L + ++  + +P +++L  F +S +++ + +  GK +  F    G+L +L  +  +LL  
Sbjct  298   LLLPKNYIATIPLVMFLSGFASSFIMKPVSKLIGKCMTYFL---GLLLILAFSYWVLLDT  354

Query  636   KMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYF  457
              M   +Y  +VL+G+ +A ++V S+ M + L+       AFVYG+M F DKV  G+ +  
Sbjct  355   HMGDKVYGAAVLLGVGSATILVMSLAMTAELIGDQTHSGAFVYGAMSFTDKVANGLGVMI  414

Query  456   LESFEDADPVACNPA  412
             +++      + C PA
Sbjct  415   IQTLHPCRTMVCCPA  429



>ref|XP_004654770.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Jaculus jaculus]
Length=526

 Score =   171 bits (433),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 130/419 (31%), Positives = 214/419 (51%), Gaps = 38/419 (9%)
 Frame = -2

Query  1599  EEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFT  1423
                PL   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   
Sbjct  20    PRPPLSLAARLSYAVGHFLNDLCASMWFTYLLLYLHAVRAYSSRGAGLLLLLGQVADGLC  79

Query  1422  TIIAGELIDRF-----GQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQTVG  1261
             T + G   DR      G  K WH AG + V +SF  +F     PC   G  +P     + 
Sbjct  80    TPLVGLEADRARCARCGPRKAWHLAGTLCVLLSFPFIFS----PCLGCGDATPEWAALLY  135

Query  1260  YCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFT  1081
             Y    V+F  GW+ TQI+H+S++  +  ++  ++   + R AFT+VA++ ++   + +  
Sbjct  136   YGPFIVIFQFGWAATQIAHLSLIPELVTSDHEKVELTALRYAFTVVANITVFGAAWLLLH  195

Query  1080  NNAE-------DIKTQ--------YRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEK  946
                        D+  Q        +R +A + + +G    ++FHLG +E R+    G E 
Sbjct  196   LQGSPRPGLDVDVGDQLGMQDVPVFRNLALLVVGVGAAASLLFHLGTREARRARTHGDEP  255

Query  945   --------IGSNTP--WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQS  796
                       S  P  WT+WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L + + 
Sbjct  256   NEHSPLLAPASRAPLVWTHWLREPAFYQVGVLYMTTRLIVNLSQTYIAMYLTYSLSLPKK  315

Query  795   AKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMY  616
               + +P ++YL  F++S L++ +  S  R   +FA  G+L +L  A  + L   +   +Y
Sbjct  316   FIATIPLVMYLSGFLSSFLMKPINRSFGRNMTYFA--GLLVVLAFAAWVALAGHLGVAVY  373

Query  615   ALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFED  439
               +VL+G   A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  ++S   
Sbjct  374   GAAVLLGAGCATILVTSLAMTADLIGPHTHSGAFVYGAMSFSDKVANGLAVMAVQSLHP  432



>gb|AAI28827.1| Si:dkey-218h11.4 protein [Danio rerio]
Length=507

 Score =   171 bits (432),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 129/435 (30%), Positives = 228/435 (52%), Gaps = 43/435 (10%)
 Frame = -2

Query  1608  EEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFAD  1432
             ++  E  L     L+Y VGH LND+    W+TYLL++   + G   + A ++ LVGQ AD
Sbjct  2     QDSSEASLPVIRRLSYSVGHFLNDLCASMWFTYLLVFYHSVLGFENTYAGVLLLVGQIAD  61

Query  1431  AFTTIIAGELIDR------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQ  1270
                T + G   DR      +G+ K WH  G I V +SF  +F   C+ C +   ++P   
Sbjct  62    GVCTPLIGYESDRTPGCGSYGKRKTWHLVGTISVLLSFPFIFN-QCLGCDL---NTPQWV  117

Query  1269  TVGYCIS-AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTF  1093
             +V Y     ++F  GW+ TQISH+S++  +   E  ++   + R AFT++A++ +YAV +
Sbjct  118   SVTYFAPFIIIFQFGWAATQISHLSLIPELVSCEHEKVELTAYRYAFTVIANITVYAVAW  177

Query  1092  FVFTNNAEDIKTQ-----------YRWMAfisifiggvfviiFHLGVKEPRK--KDDDG-  955
              +F     D               +R ++ I + IG VF  +FHLG +E  +  +++DG 
Sbjct  178   LLFHFQEGDDPAVMDNLGSVDIPVFRNLSLIVVGIGAVFTFLFHLGTREKGRSFQEEDGS  237

Query  954   ----HEKIGSNTP---------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVIND  814
                  + + +NT          W  WL +  +YQVA +Y+ TR++ N+SQT++++Y+   
Sbjct  238   SPGERQPLINNTTVAPPANLLHWNNWLTQPSFYQVALLYMSTRLIVNLSQTYISMYLTYT  297

Query  813   LRMSQSAKSLVPAIIYLCSFITSVLLQEL-EWSGKRLKIFFAGGGILWLLCGAVVMLLPI  637
             L + ++  + +P +++L  F +S +++ + +  GK +  F    G+L +L  +  +LL  
Sbjct  298   LLLPKNYIATIPLVMFLSGFASSFIMKPVSKLIGKCMTYFL---GLLLILAFSYWVLLDT  354

Query  636   KMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYF  457
              M   +Y  +VL+G+ +A ++V S+ M + L+       AFVYG+M F DKV  G+ +  
Sbjct  355   HMGDKVYGAAVLLGVGSATILVMSLAMTAELIGDQTHSGAFVYGAMSFTDKVANGLGVMI  414

Query  456   LESFEDADPVACNPA  412
             +++      + C PA
Sbjct  415   IQTLHPCRTMVCCPA  429



>ref|XP_001626723.1| predicted protein [Nematostella vectensis]
 gb|EDO34623.1| predicted protein [Nematostella vectensis]
Length=403

 Score =   168 bits (426),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 127/396 (32%), Positives = 225/396 (57%), Gaps = 36/396 (9%)
 Frame = -2

Query  1563  YGVGHMLNDITQCCWytylllylTD-IGLSPSSAAIVTLVGQFADAFTTIIAGELIDR--  1393
             YGVGH+LND+T   W+TY+L+YL   I  S  +A ++ L+GQ ADA +T + G   D+  
Sbjct  13    YGVGHILNDLTASMWFTYMLVYLHKVIKFSNMNAGVLLLIGQVADAISTPLVGIESDKTG  72

Query  1392  ---FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT--VGYCISAVVFCSG  1228
                FG+ KIWH  G I V +SF  +F     PC  +GSDS +     V Y    V+F  G
Sbjct  73    QIKFGRRKIWHLIGTISVIISFPFIFN----PC--VGSDSASEYALFVYYSPFIVIFQFG  126

Query  1227  WSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTNNAEDIKTQ--  1054
             W+ TQISH+S++  +   E  +    + R A T+ +++ ++ +T+ +     E++     
Sbjct  127   WASTQISHLSLIPELVSTEQEKCDLNAFRYAATVASNIFVFIITWIMLDAGKEELDPNML  186

Query  1053  -------YRWMAfisifiggvfviiFHLGVKEPRKKDDDGHE-----KIGSNTPWTYWLK  910
                    + ++ FI + +G VFV IFH+GVKE  K  D  HE        S + W  W +
Sbjct  187   SKSDSKAFMYVVFIVVGVGLVFVTIFHVGVKE--KPRDCSHEFATASSKRSASNWKMWFR  244

Query  909   RVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQE  730
               L+YQ A +Y+ TR++ N++Q ++ +Y +  L +++   +++P IIY+  F+++ L + 
Sbjct  245   VPLFYQTAILYMCTRLIVNITQVYIPMYTLETLHLTKDKIAIMPLIIYVSGFLSTFLSKP  304

Query  729   L-EWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGME  553
             + +  G++++       ++ L+  +V M      N+ +Y +SVLIGI  + ++VT++ M 
Sbjct  305   MNKLIGRKVRHI-----LISLVSFSVWMWFLPARNAQVYGVSVLIGIGGSTLLVTALTML  359

Query  552   SALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESF  445
             + L+ ++++  AFVYG+M F+DK+  G+ +  +++F
Sbjct  360   ADLIGENVETGAFVYGAMSFMDKMSNGIVVQIVQAF  395



>ref|XP_003914705.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Papio anubis]
Length=480

 Score =   170 bits (430),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 136/450 (30%), Positives = 228/450 (51%), Gaps = 49/450 (11%)
 Frame = -2

Query  1599  EEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFT  1423
               +PL   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   
Sbjct  13    SRRPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLC  72

Query  1422  TIIAGELIDR-------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQT  1267
             T + G   DR       +G  K WH  G + V +SF  +F     PC   G+ +P     
Sbjct  73    TPLVGYEADRAAGCCPRYGPRKAWHLVGTVCVLLSFPFIFS----PCLGCGAATPEWAAL  128

Query  1266  VGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
             + Y    V+F  GW+ TQISH+S++  +  N+  ++   + R AFT+VA++ +Y   + +
Sbjct  129   LYYGPFIVIFQFGWASTQISHLSLIPELVTNDHEKVELTALRYAFTVVANITVYGAAWLL  188

Query  1086  F-------TNNAEDIK----------TQYRWMAfisifiggvfviiFHLGVKEPRKKDDD  958
                         +DI             +R ++ + + +G VF ++FHLG +E  +    
Sbjct  189   LHLQGSSRVEPTQDIDIGDQLGGQDVPMFRNLSLLVVGVGAVFSLLFHLGTRERCRPHV-  247

Query  957   GHEKIGSNTP------------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVIND  814
               E+ G +TP            W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   
Sbjct  248   --EEPGEHTPLLAPAVAQPLLLWKHWLREPAFYQVGVLYMTTRLIVNLSQTYMAMYLTYS  305

Query  813   LRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIK  634
             L + +   + +P ++YL  F +S L++ +     R   +F+  G+L +L  A  + L   
Sbjct  306   LHLPKKFIATIPLVMYLSGFFSSFLMKPINKRIGRNMTYFS--GLLVILAFAAWVALAEG  363

Query  633   MNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFL  454
             +   +YA +VL+G   A ++VTS+ M + L+  H +  AFVYGSM F DKV  G+A+  +
Sbjct  364   LGVAVYAAAVLLGAGCATILVTSLAMTADLIGPHTNSGAFVYGSMSFSDKVANGLAVMAI  423

Query  453   ESFEDADPVACNPAQACFSVTRFSLGFIPG  364
             +S        C   +AC S   +++  + G
Sbjct  424   QSLHPCPSELC--CRACVSFYHWAMVAVTG  451



>ref|XP_006047939.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X1 [Bubalus bubalis]
Length=574

 Score =   171 bits (434),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 131/421 (31%), Positives = 221/421 (52%), Gaps = 45/421 (11%)
 Frame = -2

Query  1593  KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTI  1417
             +PL   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   T 
Sbjct  15    RPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLCTP  74

Query  1416  IAGELIDR-------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQTVG  1261
             + G   DR       FG  K WH  G I V +SF  +F     PC   G+ +P     + 
Sbjct  75    LVGFEADRAAGRCARFGPRKAWHLVGTICVLLSFPFIFS----PCLGCGAATPEWAALLY  130

Query  1260  YCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF-  1084
             Y    V+F  GW+ TQI+H+S++  +  N+  ++   + R AFT+VA++ +Y   + +  
Sbjct  131   YGPFIVIFQFGWAATQIAHLSLIPELVTNDHEKVELTALRYAFTVVANITVYGAAWLLLH  190

Query  1083  ------TNNAEDIKTQ--------YRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEK  946
                   +   ED+  Q        +R ++ + + +G VF ++FHLG +E R++     E+
Sbjct  191   LQGSPHSGPTEDVSDQLGVQDVPVFRNLSLLVVGVGAVFSLLFHLGTREGRRRQV---EE  247

Query  945   IGSNTP------------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMS  802
              G ++P            W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L + 
Sbjct  248   PGEHSPLLAPSTTQPLLLWKHWLREPAFYQVGLLYMSTRLIVNLSQTYIAMYLTYSLHLP  307

Query  801   QSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSF  622
             +   + +P ++YL  F +S L++ +     R   +F   G+L +L  A  + L  ++   
Sbjct  308   KRFIATIPLVMYLSGFCSSFLMKPVNKCIGRNMTYFV--GLLVILAFAAWVALAEELGMA  365

Query  621   MYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFE  442
             +Y  +VL+G+  A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  ++S  
Sbjct  366   VYVAAVLLGMGCATILVTSLAMTADLIGPHTHSGAFVYGAMSFSDKVANGLAVMAIQSLH  425

Query  441   D  439
              
Sbjct  426   P  426



>ref|XP_004633000.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Octodon degus]
Length=482

 Score =   170 bits (430),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 143/467 (31%), Positives = 235/467 (50%), Gaps = 49/467 (10%)
 Frame = -2

Query  1611  REEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFA  1435
             R     + L   + ++Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ A
Sbjct  9     RAGMPPRTLSLTARMSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVA  68

Query  1434  DAFTTIIAGELIDR--------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSP  1279
             D   T + G   DR        +G  K WH AG I V +SF  +F     PC   G+ +P
Sbjct  69    DGLCTPLVGYEADRAAGGRCARYGPRKAWHLAGTICVLLSFPFIFS----PCLGCGASTP  124

Query  1278  T-VQTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYA  1102
                  + Y    VVF  GW+ TQI+H+S++  +  ++  ++   + R AFT+VA++ +Y 
Sbjct  125   EWAALLYYGPFIVVFQFGWAATQIAHLSLIPELVTSDHEKVELTALRYAFTVVANIAVYG  184

Query  1101  VTFFVFTNNA-------EDIKTQ----------YRWMAfisifiggvfviiFHLGVKEPR  973
               + +    A       EDI             +R ++   + +G VF ++FHLG +E R
Sbjct  185   AAWLLLHLQASSHLGPTEDITMGDQLGVQDVPVFRNLSLAVVGVGAVFSLLFHLGTRERR  244

Query  972   K----KDDDGHEKIGSNTP-----WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVI  820
             +    ++ D H  + S        W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+ 
Sbjct  245   RPRWVEEPDEHSPLVSPAAQPLLLWKHWLQEPAFYQVGILYMTTRLIVNLSQTYMAMYLT  304

Query  819   NDLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLP  640
               L + +   + +P ++YL  F +S L++ L     R   +FA  G+L +L  A  + L 
Sbjct  305   YSLHLPKRFIATIPLVMYLSGFFSSFLMKPLNRCIGRNLTYFA--GLLVILAFAAWVALT  362

Query  639   IKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALY  460
              ++   +YA +VL+G   A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+ 
Sbjct  363   NRLGVAVYAAAVLLGAGCATILVTSLAMTADLIGPHSQSGAFVYGAMSFSDKVANGLAVM  422

Query  459   FLESFEDADPVACNPAQACFSVTRFSLGFIPGIAALFGVIVSFTMKL  319
              ++S        C   +AC     + +     +A   GV V+ T+ L
Sbjct  423   AVQSLHPCPSELC--CKACMGFYHWVM-----VAVTGGVGVAATLAL  462



>ref|XP_005754451.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X1 [Pundamilia nyererei]
 ref|XP_005754452.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X2 [Pundamilia nyererei]
 ref|XP_005754453.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X3 [Pundamilia nyererei]
Length=424

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 130/416 (31%), Positives = 229/416 (55%), Gaps = 42/416 (10%)
 Frame = -2

Query  1569  LTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTIIAGELIDR  1393
             L+Y VGH LND+    W+TYLL++   + G   +SA ++ LVGQ AD   T + G   DR
Sbjct  14    LSYAVGHFLNDLCASMWFTYLLVFYHSVLGFQNTSAGVLLLVGQVADGICTPLIGYESDR  73

Query  1392  ------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCIS-AVVFC  1234
                   +G+ K WH  G + V +SF  +F   C+ C  L   +P   ++ Y +   ++F 
Sbjct  74    SPGCRNYGKRKTWHLVGTLSVVLSFAFIFN-QCVGCSFL---TPQWASLIYFVPFIIIFQ  129

Query  1233  SGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTNNA---EDI  1063
              GW+ TQISH+S++  +   E +++   + R AFT++A++ +Y V + +F   A   ED 
Sbjct  130   FGWAATQISHLSLIPELVTCEHAKVELTAYRYAFTVIANITVYGVAYLLFHVQAGEDEDP  189

Query  1062  KTQ-------YRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIG--------SNT-  931
              +        +R ++ I + IG VF ++FH+G KE     ++  E  G        SNT 
Sbjct  190   DSLGPADIIIFRNLSLIVLGIGVVFSVVFHVGTKESNGASEESEEAEGERRLLLPRSNTF  249

Query  930   ----PWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYL  763
                  W  WL++  +YQVA +Y+ TR++ N+SQT++++Y+IN L + +   + +P ++Y+
Sbjct  250   SSLLQWKCWLRQPSFYQVAVLYMSTRLIVNLSQTYISMYLINTLGLPKKFIATIPLVMYV  309

Query  762   CSFITSVLLQEL-EWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIAN  586
               F++S +++ + +  GK L  F    G+L ++  +  +LL + M   +Y  +VL+G  +
Sbjct  310   SGFLSSFIMKPVSKLIGKCLTYFV---GLLLIMAFSYWVLLDVTMGQQVYGAAVLLGAGS  366

Query  585   ALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACN  418
             A ++V S+ M + L+      +AFVYG+M F DK+  G+A+  +++     P  C+
Sbjct  367   ATILVISLAMTAELIADQTQSAAFVYGAMSFTDKLANGLAVMIIQALH---PCQCS  419



>ref|XP_005954279.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Pantholops hodgsonii]
Length=548

 Score =   170 bits (430),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 131/413 (32%), Positives = 217/413 (53%), Gaps = 45/413 (11%)
 Frame = -2

Query  1569  LTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTIIAGELIDR  1393
             L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   T + G   DR
Sbjct  95    LSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLCTPLVGFEADR  154

Query  1392  -------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQTVGYCISAVVF  1237
                    FG  K WH  G I V +SF  +F     PC   G  +P     + Y    V+F
Sbjct  155   AAGRCARFGPRKAWHLVGTICVLLSFPFIFS----PCLGCGPATPEWAALLYYGPFIVIF  210

Query  1236  CSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF-------TN  1078
               GW+ TQI+H+S++  +  N+  ++   + R AFT+VA++ +Y   + +        T 
Sbjct  211   QFGWAATQIAHLSLIPELVTNDHEKVELTALRYAFTVVANITVYGAAWLLLHLQGSPRTG  270

Query  1077  NAEDIKTQ--------YRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGSNTP--  928
              AED+  Q        +R ++ + + +G VF ++FHLG +E R++     E+ G ++P  
Sbjct  271   PAEDVSDQLGVQDVPVFRNLSLLVVGVGAVFSLLFHLGTREGRRRQV---EEPGEHSPLL  327

Query  927   ----------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVP  778
                       W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L + +   + +P
Sbjct  328   APSTAQPLLLWKHWLREPAFYQVGLLYMSTRLIVNLSQTYIAMYLTYSLHLPKRFIATIP  387

Query  777   AIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLI  598
              ++YL  F +S L++ +     R   +F   G+L +L  A  + L  ++   +Y  +VL+
Sbjct  388   LVMYLSGFCSSFLMKPVNKCIGRNMTYFV--GLLVILAFAAWVALADELGVAVYVAAVLL  445

Query  597   GIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFED  439
             G+  A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  ++S   
Sbjct  446   GMGCATILVTSLAMTADLIGPHTYSGAFVYGAMSFSDKVANGLAVMAIQSLHP  498



>ref|XP_006267441.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X2 [Alligator mississippiensis]
Length=489

 Score =   169 bits (427),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 137/439 (31%), Positives = 230/439 (52%), Gaps = 57/439 (13%)
 Frame = -2

Query  1593  KPLGRC----SVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADA  1429
             +P GR     + L+Y VGH+LND+    W+TYLL Y   + G S ++A  + L GQ AD 
Sbjct  3     EPPGRALPARARLSYAVGHVLNDLCASMWFTYLLAYAHSVLGYSSAAAGALLLAGQVADG  62

Query  1428  FTTIIAGELIDR------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
               T + G   DR      +G+ K WH AG I V + F  +F     PC  LG    T Q 
Sbjct  63    VCTPLVGYESDRSAGCGRYGRRKSWHLAGTICVLLCFPFIFN----PC--LGCQESTPQW  116

Query  1266  VG---YCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVT  1096
                  +    ++F  GW+ TQISH+S++  +   +  ++   + R AFT++A++ +YAV 
Sbjct  117   AALFYFIPFIIIFQFGWAATQISHLSLIPELVTTDHEKVELTALRYAFTVMANITVYAVA  176

Query  1095  FFV--FTNNAEDIKTQ-----------YRWMAfisifiggvfviiFHLGVKE---PRKKD  964
             + +  F N     + Q           +R ++ I + +G +F ++FH+G KE   P+ + 
Sbjct  177   WLLLHFQNRHAGPQEQMDHLGKQDIPVFRNLSLIVVGLGALFSLLFHMGTKEKKHPQARP  236

Query  963   DDGHEKI-----GSNTP------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVIN  817
              D  E       G  TP      W +WL    +YQVA +Y+ TR++ N+SQT++A+Y+ N
Sbjct  237   PDPEEHTPLLHGGGRTPPRPFMLWKHWLLEPAFYQVAMLYMVTRLIVNLSQTYIAMYLTN  296

Query  816   DLRMSQSAKSLVPAIIYLCSFITSVLLQEL-EWSGKRLKIFFAGGGILWLLCGAVVMLLP  640
              L + +   + +P ++Y+  F++S L++ + +W G+ L  F    G+L +L  A  + L 
Sbjct  297   SLLLPKKFIATIPLVMYISGFLSSFLMKPVNKWIGRNLTYF---AGLLIILAFATWVALD  353

Query  639   IKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALY  460
              ++   +Y  +VL+G  +A ++VTS+ M + L+  +    AFVYG+M F DKV  G+A+ 
Sbjct  354   RRIGVEIYGAAVLLGAGSATILVTSLSMTADLIGSNTHSGAFVYGAMSFTDKVANGLAVM  413

Query  459   FLESFEDADPVACNPAQAC  403
              +++          P+Q C
Sbjct  414   AIQNLHPC------PSQLC  426



>ref|NP_001274458.1| major facilitator superfamily domain-containing protein 12 isoform 
d [Homo sapiens]
 gb|AAH36706.1| C19orf28 protein [Homo sapiens]
 gb|ABM83210.1| chromosome 19 open reading frame 28 [synthetic construct]
 gb|ABM86410.1| chromosome 19 open reading frame 28 [synthetic construct]
Length=471

 Score =   168 bits (426),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 132/443 (30%), Positives = 226/443 (51%), Gaps = 44/443 (10%)
 Frame = -2

Query  1599  EEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFT  1423
               +PL   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   
Sbjct  13    SPRPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLC  72

Query  1422  TIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQTVGYCISA  1246
             T + G   DR       +G  C+++   FI        PC   G+ +P     + Y    
Sbjct  73    TPLVGYEADRAASCCARYGTVCVLLSFPFI------FSPCLGCGAATPEWAALLYYGPFI  126

Query  1245  VVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF------  1084
             V+F  GW+ TQISH+S++  +  N+  ++   + R AFT+VA++ +Y   + +       
Sbjct  127   VIFQFGWASTQISHLSLIPELVTNDHEKVELTALRYAFTVVANITVYGAAWLLLHLQGSS  186

Query  1083  -TNNAEDIKTQ----------YRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKIGS  937
                  +DI             +R ++ + + +G VF ++FHLG +E R+      E+ G 
Sbjct  187   RVEPTQDISISDQLGGQDVPVFRNLSLLVVGVGAVFSLLFHLGTRERRRPHA---EEPGE  243

Query  936   NTP------------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSA  793
             +TP            W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L + +  
Sbjct  244   HTPLLAPATAQPLLLWKHWLREPAFYQVGILYMTTRLIVNLSQTYMAMYLTYSLHLPKKF  303

Query  792   KSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYA  613
              + +P ++YL  F++S L++ +     R   +F+  G+L +L  A  + L   +   +YA
Sbjct  304   IATIPLVMYLSGFLSSFLMKPINKCIGRNMTYFS--GLLVILAFAAWVALAEGLGVAVYA  361

Query  612   LSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDAD  433
              +VL+G   A ++VTS+ M + L+  H +  AFVYGSM F+DKV  G+A+  ++S     
Sbjct  362   AAVLLGAGCATILVTSLAMTADLIGPHTNSGAFVYGSMSFLDKVANGLAVMAIQSLHPCP  421

Query  432   PVACNPAQACFSVTRFSLGFIPG  364
                C   +AC S   +++  + G
Sbjct  422   SELC--CRACVSFYHWAMVAVTG  442



>ref|XP_010964996.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Camelus bactrianus]
Length=478

 Score =   169 bits (427),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 141/472 (30%), Positives = 240/472 (51%), Gaps = 46/472 (10%)
 Frame = -2

Query  1593  KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTI  1417
             +PL   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   T 
Sbjct  15    RPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLCTP  74

Query  1416  IAGELIDR-------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQTVG  1261
             + G   DR       FG  K WH  G I V +SF  +F     PC   G+ +P     + 
Sbjct  75    LVGFEADRAAGRCARFGPRKAWHLVGTICVLLSFPFIFS----PCLGCGAATPEWAALLY  130

Query  1260  YCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF-  1084
             Y    V+F  GW+ TQI+H+S++  +  N+  ++   + R AFT+VA++ +Y   + +  
Sbjct  131   YGPFIVIFQFGWAATQIAHLSLIPELVTNDHEKVELTALRYAFTVVANITVYGAAWLLLH  190

Query  1083  ------TNNAEDIKTQ--------YRWMAfisifiggvfviiFHLGVKE---PRKKDDDG  955
                     +A+D+           +R ++ + + +G VF ++FHLG KE   P+ ++ D 
Sbjct  191   LQGSTHMGSAQDVSDHLGAQDVPVFRNLSLLVVGVGAVFSLLFHLGTKEGRWPQVEEPDE  250

Query  954   HEKI---GSNTP---WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSA  793
             H  +    +  P   W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L + +  
Sbjct  251   HSPLLAPAAAQPLVLWKHWLQEPAFYQVGLLYMSTRLIVNLSQTYMAMYLTYSLSLPKRF  310

Query  792   KSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYA  613
              + +P ++YL  F +S L++ +     R   +F   G+L +L  A  + L   +   +Y 
Sbjct  311   IATIPLVMYLSGFFSSFLMKPVNKRIGRNMTYFM--GLLVILAFAAWVALADVLGVAVYV  368

Query  612   LSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDAD  433
              +VL+G   A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  ++S     
Sbjct  369   AAVLLGAGCATILVTSLSMTADLIGPHTHSGAFVYGAMSFSDKVANGLAVMAIQSLHPCT  428

Query  432   PVACNPAQACFSVTRFSLGFIP---GIAALFGV--IVSFTMKLLHTSHKKQP  292
                C   +AC     + +  +    G+AA   +  ++ + ++L H     QP
Sbjct  429   SDLC--CRACVGFYHWVMVAVTGGVGVAATLALCSLLIWPIRLRHWDPGAQP  478



>ref|XP_006267440.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X1 [Alligator mississippiensis]
Length=494

 Score =   169 bits (427),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 137/439 (31%), Positives = 230/439 (52%), Gaps = 57/439 (13%)
 Frame = -2

Query  1593  KPLGRC----SVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADA  1429
             +P GR     + L+Y VGH+LND+    W+TYLL Y   + G S ++A  + L GQ AD 
Sbjct  3     EPPGRALPARARLSYAVGHVLNDLCASMWFTYLLAYAHSVLGYSSAAAGALLLAGQVADG  62

Query  1428  FTTIIAGELIDR------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQT  1267
               T + G   DR      +G+ K WH AG I V + F  +F     PC  LG    T Q 
Sbjct  63    VCTPLVGYESDRSAGCGRYGRRKSWHLAGTICVLLCFPFIFN----PC--LGCQESTPQW  116

Query  1266  VG---YCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVT  1096
                  +    ++F  GW+ TQISH+S++  +   +  ++   + R AFT++A++ +YAV 
Sbjct  117   AALFYFIPFIIIFQFGWAATQISHLSLIPELVTTDHEKVELTALRYAFTVMANITVYAVA  176

Query  1095  FFV--FTNNAEDIKTQ-----------YRWMAfisifiggvfviiFHLGVKE---PRKKD  964
             + +  F N     + Q           +R ++ I + +G +F ++FH+G KE   P+ + 
Sbjct  177   WLLLHFQNRHAGPQEQMDHLGKQDIPVFRNLSLIVVGLGALFSLLFHMGTKEKKHPQARP  236

Query  963   DDGHEKI-----GSNTP------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVIN  817
              D  E       G  TP      W +WL    +YQVA +Y+ TR++ N+SQT++A+Y+ N
Sbjct  237   PDPEEHTPLLHGGGRTPPRPFMLWKHWLLEPAFYQVAMLYMVTRLIVNLSQTYIAMYLTN  296

Query  816   DLRMSQSAKSLVPAIIYLCSFITSVLLQEL-EWSGKRLKIFFAGGGILWLLCGAVVMLLP  640
              L + +   + +P ++Y+  F++S L++ + +W G+ L  F    G+L +L  A  + L 
Sbjct  297   SLLLPKKFIATIPLVMYISGFLSSFLMKPVNKWIGRNLTYF---AGLLIILAFATWVALD  353

Query  639   IKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALY  460
              ++   +Y  +VL+G  +A ++VTS+ M + L+  +    AFVYG+M F DKV  G+A+ 
Sbjct  354   RRIGVEIYGAAVLLGAGSATILVTSLSMTADLIGSNTHSGAFVYGAMSFTDKVANGLAVM  413

Query  459   FLESFEDADPVACNPAQAC  403
              +++          P+Q C
Sbjct  414   AIQNLHPC------PSQLC  426



>ref|XP_004378702.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Trichechus manatus latirostris]
Length=553

 Score =   169 bits (429),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 127/410 (31%), Positives = 219/410 (53%), Gaps = 40/410 (10%)
 Frame = -2

Query  1569  LTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTIIAGELIDR  1393
             L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   T + G   DR
Sbjct  21    LSYAVGHFLNDLCASMWFTYLLLYLHSVSAYSSRGAGLLLLLGQVADGLCTPLVGYEADR  80

Query  1392  -------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQTVGYCISAVVF  1237
                    +G  K WH  G + V +SF  +F     PC   G+ +P     + Y    V+F
Sbjct  81    AAGCCPRYGPRKAWHLVGTVCVLLSFPFIFS----PCLGCGAATPEWAALLYYGPFIVIF  136

Query  1236  CSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF-------TN  1078
               GW+ TQI+H+S++  +  NE  ++   + R AFT+VA++ +Y   + +          
Sbjct  137   QFGWAATQIAHLSLIPELVTNEHEKVELTALRYAFTVVANITVYGAAWLLLHLQGSPHVG  196

Query  1077  NAEDIKTQ--------YRWMAfisifiggvfviiFHLGVKE---PRKKDDDGHEKIGSNT  931
               ++I  +        +R ++ + + IG VF ++FHLG +E   PR ++ D H  + ++ 
Sbjct  197   PTQEISDELGVQDVPVFRNLSLLVVGIGAVFSLLFHLGTREGRRPRWEEPDEHSPLLTHE  256

Query  930   P-----WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIY  766
                   W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L + +   +++P ++Y
Sbjct  257   AQPLLLWKHWLQEPAFYQVGLLYMSTRLIVNLSQTYMAMYLTYSLSLPKKFIAIIPLVMY  316

Query  765   LCSFITSVLLQEL-EWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIA  589
             L  F +S L++ + +W G+ +  F    G+L +L  +  + L   +   +Y  +VL+G+ 
Sbjct  317   LSGFFSSFLMKPINKWIGRNMTYF---TGLLVILAFSAWVALANGLGVAVYVAAVLLGMG  373

Query  588   NALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFED  439
              A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  ++S   
Sbjct  374   CATILVTSLAMTADLIGPHTHSGAFVYGAMSFSDKVANGLAVMAIQSLHP  423



>gb|ETL89732.1| hypothetical protein L917_11381, partial [Phytophthora parasitica]
Length=551

 Score =   169 bits (429),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 128/423 (30%), Positives = 224/423 (53%), Gaps = 52/423 (12%)
 Frame = -2

Query  1569  LTYGVGHMLNDITQCCWytylllylTD-IGLSPSSAAIVTLVGQFADAFTTIIAGELIDR  1393
             L+YGVGH+LND+    W++YLL++L   + +SP  +A+V   GQ AD   T + G   DR
Sbjct  52    LSYGVGHVLNDMCASTWFSYLLVFLLHAVDMSPVDSAVVMFCGQIADGLATPLVGVFSDR  111

Query  1392  --------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAVVF  1237
                      G+ K W   G ++V + F  +FG  C P     S S  V  V Y  +A +F
Sbjct  112   SSGLPWLGLGRRKTWLAIGSVLVILCFFFVFGA-CAPRWFSDSPSRMVLLVYYSAAASIF  170

Query  1236  CSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTNNAEDI--  1063
               GW+  Q+SHM+MV  ++ +++ R    S R AFT++++++++ V F V       +  
Sbjct  171   NVGWATVQVSHMAMVPELSDDDNVRCVLNSTRYAFTILSNVLVFCV-FLVLLRVVSPLGV  229

Query  1062  --KTQYRWMAfisifiggvfviiFHLGVKEP---RKKDDD-----------------GH-  952
                 ++  +A+ S+ +GG+  ++F  G  E     KK+ D                 GH 
Sbjct  230   PDAEKFTLLAYTSLLVGGICTVVFLTGTPEKVTVEKKEKDPAEILAQSPVMADLEGRGHS  289

Query  951   -------------EKIGS--NTPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVIN  817
                          E +G+  +  W+ W K  ++Y+V  +Y+ TR+V NV+Q F++ Y+I 
Sbjct  290   AFPCEGDLDVPTVEVVGTSDHMAWSCWFKLGMFYEVGLVYMCTRLVVNVTQVFISFYLIV  349

Query  816   DLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPI  637
              L+MS ++ ++VP ++YL  F+ +  L+ L  S  R   F  G G++ +       L P 
Sbjct  350   TLQMSATSIAIVPLLVYLSGFLATFFLRYLNESLGRTGSFALGAGLIVVALVLSYFLTP-  408

Query  636   KMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYF  457
             +  +++Y  S+++G+ N+++MVTS+ +   LV  +++  AFVYG+M F DK+  G+A+ F
Sbjct  409   ETATWVYPFSIVLGMGNSIIMVTSVCLTGDLVGNNVESGAFVYGAMSFTDKISNGIAILF  468

Query  456   LES  448
             +++
Sbjct  469   IQN  471



>ref|XP_010866675.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Esox lucius]
Length=506

 Score =   169 bits (427),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 126/431 (29%), Positives = 222/431 (52%), Gaps = 51/431 (12%)
 Frame = -2

Query  1569  LTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTIIAGELIDR  1393
             L+Y VGH LND+    W+TYLL++   + G   + A ++ LVGQ AD   T + G   DR
Sbjct  15    LSYSVGHFLNDLCASMWFTYLLVFYHSVLGFHNTYAGVLLLVGQIADGVCTPLIGYESDR  74

Query  1392  ------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAVVFCS  1231
                   +G+ K WH  G + V VSF  +F   C+ C     D+P   ++ Y I  ++   
Sbjct  75    TPGFRTYGKRKTWHLVGTVSVLVSFAFIFN-QCLGCN---QDTPQWVSLTYFIPFIIIFQ  130

Query  1230  -GWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTNNAEDIKTQ  1054
              GW+ TQISH+S++  +   E +++   + R AFT++A++ +YAV + +F   +E  +  
Sbjct  131   FGWAATQISHLSLIPELVSCEHAKVELTAYRYAFTVMANITVYAVAYLLFHLQSESDQEP  190

Query  1053  -------------YRWMAfisifiggvfviiFHLGVKEPRKKDDD---------------  958
                          +R ++ I + IG +F ++FHLG KE +  + +               
Sbjct  191   TLTETLGPIDINIFRNLSLIVLGIGALFSLVFHLGTKETKGGEGEKEVKRDEEESEEDGE  250

Query  957   ------GHEKIGSNTP---WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRM  805
                   G + I    P   W  WL++  +YQVA IY+ TR++ N+SQT++++Y+ N L +
Sbjct  251   RRPLIPGPKTISPPQPLLSWKCWLEQPSFYQVAFIYMATRLMVNLSQTYISMYLTNSLML  310

Query  804   SQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNS  625
              +   + +P ++Y+  F +S +++ +     +   +F   G+L ++  +  +LL  KM  
Sbjct  311   PKKYIATIPLVMYVSGFASSFIMKPISRRIGKCMTYFV--GLLLIMAFSYWVLLDDKMGD  368

Query  624   FMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESF  445
              +Y  ++L+G  +A ++V S+ M + L+       AFVYG+M F DKV  G+A+  +++ 
Sbjct  369   QIYVTAILLGAGSATILVMSLSMTADLIGDQTQSGAFVYGAMSFTDKVANGLAVMIIQTM  428

Query  444   EDADPVACNPA  412
                    C PA
Sbjct  429   HPCHTQVCCPA  439



>gb|ETP40937.1| hypothetical protein F442_11806, partial [Phytophthora parasitica 
P10297]
Length=551

 Score =   169 bits (429),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 128/423 (30%), Positives = 224/423 (53%), Gaps = 52/423 (12%)
 Frame = -2

Query  1569  LTYGVGHMLNDITQCCWytylllylTD-IGLSPSSAAIVTLVGQFADAFTTIIAGELIDR  1393
             L+YGVGH+LND+    W++YLL++L   + +SP  +A+V   GQ AD   T + G   DR
Sbjct  52    LSYGVGHVLNDMCASTWFSYLLVFLLHAVDMSPVDSAVVMFCGQIADGLATPLVGVFSDR  111

Query  1392  --------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAVVF  1237
                      G+ K W   G ++V + F  +FG  C P     S S  V  V Y  +A +F
Sbjct  112   SSGLPWLGLGRRKTWLAIGSVLVILCFFFVFGA-CAPRWFSDSPSRMVLLVYYSAAASIF  170

Query  1236  CSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTNNAEDI--  1063
               GW+  Q+SHM+MV  ++ +++ R    S R AFT++++++++ V F V       +  
Sbjct  171   NVGWATVQVSHMAMVPELSDDDNVRCVLNSTRYAFTILSNVLVFCV-FLVLLRVVSPLGV  229

Query  1062  --KTQYRWMAfisifiggvfviiFHLGVKEP---RKKDDD-----------------GH-  952
                 ++  +A+ S+ +GG+  ++F  G  E     KK+ D                 GH 
Sbjct  230   PDAEKFTLLAYTSLLVGGICTVVFLTGTPEKVTVEKKEKDPAKILAQSPVMADLEGRGHS  289

Query  951   -------------EKIGS--NTPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVIN  817
                          E +G+  +  W+ W K  ++Y+V  +Y+ TR+V NV+Q F++ Y+I 
Sbjct  290   AFPCEGDLDVPTVEVVGTSDHMTWSCWFKLGMFYEVGLVYMCTRLVVNVTQVFISFYLIV  349

Query  816   DLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPI  637
              L+MS ++ ++VP ++YL  F+ +  L+ L  S  R   F  G G++ +       L P 
Sbjct  350   TLQMSATSIAIVPLLVYLSGFLATFFLRYLNESLGRTGSFALGAGLIVVALVLSYFLTP-  408

Query  636   KMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYF  457
             +  +++Y  S+++G+ N+++MVTS+ +   LV  +++  AFVYG+M F DK+  G+A+ F
Sbjct  409   ETATWVYPFSIVLGMGNSIIMVTSVCLTGDLVGNNVESGAFVYGAMSFTDKISNGIAILF  468

Query  456   LES  448
             +++
Sbjct  469   IQN  471



>ref|XP_010870147.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Esox lucius]
Length=485

 Score =   168 bits (426),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 130/440 (30%), Positives = 225/440 (51%), Gaps = 54/440 (12%)
 Frame = -2

Query  1605  EEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADA  1429
              E   PL R   L+Y  GH LND+    W+TYLL+Y   + G   + A ++ L+GQ AD 
Sbjct  8     NERSLPLFR--RLSYAAGHFLNDLCASLWFTYLLIYYHSVLGFKSTYAGLLLLIGQIADG  65

Query  1428  FTTIIAGELIDR------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQ  1270
              +T + G   DR      +G+ K WH  G + + VSF  +F     PC   G ++P  V+
Sbjct  66    ISTPVVGIESDRKAGCATYGKRKSWHLVGTMCLLVSFPFIFN----PCLGCGDNTPQWVE  121

Query  1269  TVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFF  1090
              + +    V+F  GW+  QISH+S++  +  +E +++   + R +FT+VA++ +YAV + 
Sbjct  122   LLYFTPFIVIFQFGWATIQISHLSLIPELVSSEHAKVELTAYRYSFTVVANITVYAVAWL  181

Query  1089  VFTNNAE--------------DIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGH  952
             +F   A+              DI   +R ++FI + IG  F I FHLG +E     ++  
Sbjct  182   LFNFQAQPTAGSHVTNGLSIADIPI-FRNLSFIVLGIGTAFTIFFHLGTREGVGHTEESG  240

Query  951   EKIGSNTP----------------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVI  820
                G + P                W  WL    +YQVA +Y+ TR++ N+SQT++++YV+
Sbjct  241   SPNGESCPLISPTPLTGAPQSLLQWRNWLNEPSFYQVAFLYMCTRLMVNLSQTYISMYVV  300

Query  819   NDLRMSQSAKSLVPAIIYLCSFITSVLLQEL-EWSGKRLKIFFAGGGILWLLCGAVVMLL  643
             N L + +S  + +P ++Y+  F+ S++++ + +  G  +  F    G++ +L  +  +L+
Sbjct  301   NSLLLPKSFIATIPLVMYVSGFMCSLVMKPISKLIGISMTYFL---GLVLILGFSSWVLV  357

Query  642   PIKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVAL  463
                M   +Y  +V++G  +A ++V S+ M + L+       AFVYG+M F DKV  G  +
Sbjct  358   DTNMGKLIYGATVMLGAGSATILVMSLSMTANLIGDQTQSGAFVYGAMSFTDKVANGFGV  417

Query  462   YFLESFEDADPVACNPAQAC  403
               ++S        CN   +C
Sbjct  418   IIIQSLHP-----CNSQTSC  432



>gb|ETO71726.1| hypothetical protein F444_11977, partial [Phytophthora parasitica 
P1976]
Length=551

 Score =   169 bits (429),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 128/423 (30%), Positives = 224/423 (53%), Gaps = 52/423 (12%)
 Frame = -2

Query  1569  LTYGVGHMLNDITQCCWytylllylTD-IGLSPSSAAIVTLVGQFADAFTTIIAGELIDR  1393
             L+YGVGH+LND+    W++YLL++L   + +SP  +A+V   GQ AD   T + G   DR
Sbjct  52    LSYGVGHVLNDMCASTWFSYLLVFLLHAVDMSPVDSAVVMFCGQIADGLATPLVGVFSDR  111

Query  1392  --------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAVVF  1237
                      G+ K W   G ++V + F  +FG  C P     S S  V  V Y  +A +F
Sbjct  112   SSGLPWLGLGRRKTWLAIGSVLVILCFFFVFGA-CAPRWFSDSPSRMVLLVYYSAAASIF  170

Query  1236  CSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTNNAEDI--  1063
               GW+  Q+SHM+MV  ++ +++ R    S R AFT++++++++ V F V       +  
Sbjct  171   NVGWATVQVSHMAMVPELSDDDNVRCVLNSTRYAFTILSNVLVFCV-FLVLLRVVSPLGV  229

Query  1062  --KTQYRWMAfisifiggvfviiFHLGVKEP---RKKDDD-----------------GH-  952
                 ++  +A+ S+ +GG+  ++F  G  E     KK+ D                 GH 
Sbjct  230   PDAEKFTLLAYTSLLVGGICTVVFLTGTPEKVTVEKKEKDPAEILAQSPVMADLEGRGHS  289

Query  951   -------------EKIGS--NTPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVIN  817
                          E +G+  +  W+ W K  ++Y+V  +Y+ TR+V NV+Q F++ Y+I 
Sbjct  290   AFPCEGDLDVPAVEVVGTSDHMTWSCWFKLGMFYEVGLVYMCTRLVVNVTQVFISFYLIV  349

Query  816   DLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPI  637
              L+MS ++ ++VP ++YL  F+ +  L+ L  S  R   F  G G++ +       L P 
Sbjct  350   TLQMSATSIAIVPLLVYLSGFLATFFLRYLNESLGRTGSFALGAGLIVVALVLSYFLTP-  408

Query  636   KMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYF  457
             +  +++Y  S+++G+ N+++MVTS+ +   LV  +++  AFVYG+M F DK+  G+A+ F
Sbjct  409   ETATWVYPFSIVLGMGNSIIMVTSVCLTGDLVGNNVESGAFVYGAMSFTDKISNGIAILF  468

Query  456   LES  448
             +++
Sbjct  469   IQN  471



>ref|XP_008908125.1| hypothetical protein PPTG_12703 [Phytophthora parasitica INRA-310]
 gb|ETN06633.1| hypothetical protein PPTG_12703 [Phytophthora parasitica INRA-310]
Length=511

 Score =   169 bits (427),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 128/423 (30%), Positives = 224/423 (53%), Gaps = 52/423 (12%)
 Frame = -2

Query  1569  LTYGVGHMLNDITQCCWytylllylTD-IGLSPSSAAIVTLVGQFADAFTTIIAGELIDR  1393
             L+YGVGH+LND+    W++YLL++L   + +SP  +A+V   GQ AD   T + G   DR
Sbjct  12    LSYGVGHVLNDMCASTWFSYLLVFLLHAVDMSPVDSAVVMFCGQIADGLATPLVGVFSDR  71

Query  1392  --------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAVVF  1237
                      G+ K W   G ++V + F  +FG  C P     S S  V  V Y  +A +F
Sbjct  72    SSGLPWLGLGRRKTWLAIGSVLVILCFFFVFGA-CAPRWFSDSPSRMVLLVYYSAAASIF  130

Query  1236  CSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTNNAEDI--  1063
               GW+  Q+SHM+MV  ++ +++ R    S R AFT++++++++ V F V       +  
Sbjct  131   NVGWATVQVSHMAMVPELSDDDNVRCVLNSTRYAFTILSNVLVFCV-FLVLLRVVSPLGV  189

Query  1062  --KTQYRWMAfisifiggvfviiFHLGVKEP---RKKDDD-----------------GH-  952
                 ++  +A+ S+ +GG+  ++F  G  E     KK+ D                 GH 
Sbjct  190   PDAEKFTLLAYTSLLVGGICTVVFLTGTPEKVTVEKKEKDPAEILAQSPVMADLEGRGHS  249

Query  951   -------------EKIGS--NTPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVIN  817
                          E +G+  +  W+ W K  ++Y+V  +Y+ TR+V NV+Q F++ Y+I 
Sbjct  250   AFPCEGDLDVPAVEVVGTSDHMTWSCWFKLGMFYEVGLVYMCTRLVVNVTQVFISFYLIV  309

Query  816   DLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPI  637
              L+MS ++ ++VP ++YL  F+ +  L+ L  S  R   F  G G++ +       L P 
Sbjct  310   TLQMSATSIAIVPLLVYLSGFLATFFLRYLNESLGRTGSFALGAGLIVVALVLSYFLTP-  368

Query  636   KMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYF  457
             +  +++Y  S+++G+ N+++MVTS+ +   LV  +++  AFVYG+M F DK+  G+A+ F
Sbjct  369   ETATWVYPFSIVLGMGNSIIMVTSVCLTGDLVGNNVESGAFVYGAMSFTDKISNGIAILF  428

Query  456   LES  448
             +++
Sbjct  429   IQN  431



>ref|XP_008835254.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X1 [Nannospalax galili]
Length=476

 Score =   168 bits (425),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 138/423 (33%), Positives = 219/423 (52%), Gaps = 38/423 (9%)
 Frame = -2

Query  1593  KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTI  1417
             + L   S L++ VGH LND+    W+TYLLLYL  + G S   A ++ L+GQ AD   T 
Sbjct  14    RSLSPASRLSFAVGHFLNDLCAAMWFTYLLLYLHSVRGYSSRGAGLLLLLGQAADGLCTP  73

Query  1416  IAGELIDRF-----GQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQTVGYC  1255
             I G   DR      G  K WH AG I V +SF  +F     PC   G  +P     V Y 
Sbjct  74    IVGYEADRAAPSSCGPRKAWHLAGTICVLLSFPFIFS----PCLGCGEATPEWAALVYYG  129

Query  1254  ISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF---  1084
                VVF  GW+ TQI+H+S++  +  ++  ++   + R AFT+VA++ ++   + +    
Sbjct  130   PFIVVFQFGWAATQIAHLSLIPELVTSDHEKVELTALRYAFTVVANITVFGAAWLLLHLQ  189

Query  1083  --TNNAEDIKTQ----------YRWMAfisifiggvfviiFHLGVKE-----PRKKDDDG  955
               T+   D+             +R +A + + +G +F  +FHLG KE     PR  D D 
Sbjct  190   GSTHVGPDVGVGDLLGEQDVPVFRNLALLVVGVGAIFSFLFHLGTKEGCRPQPRGMDPDE  249

Query  954   HEKIGSNTP-----WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAK  790
             +  + ++T      W  WLK   +YQV  +Y+ TR++ N+SQT++A+Y+   L + +   
Sbjct  250   YSPLVASTARPLLLWKQWLKEPAFYQVGMLYMTTRLIVNLSQTYIAMYLTYSLSLPKKFI  309

Query  789   SLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYAL  610
             + +P ++YL  F++S L++ +  S  R   +F   G+L +L  A  + L  KM   +Y  
Sbjct  310   ATIPLVMYLSGFVSSFLMKPINRSIGRNMTYFT--GLLVILAFAAWVALVDKMGVSVYGA  367

Query  609   SVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP  430
             +VL+G   A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  ++S      
Sbjct  368   AVLLGAGCATILVTSLAMTADLIGPHTHSGAFVYGAMSFSDKVANGLAVMAVQSLHPCPS  427

Query  429   VAC  421
               C
Sbjct  428   ELC  430



>ref|XP_004688956.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Condylura cristata]
Length=478

 Score =   168 bits (425),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 128/416 (31%), Positives = 217/416 (52%), Gaps = 39/416 (9%)
 Frame = -2

Query  1593  KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTI  1417
             +PL   + L+Y VGH LND+    W+TYLL+YL  +   S   A ++ L+GQ AD   T 
Sbjct  15    QPLPLAARLSYAVGHFLNDLCASMWFTYLLIYLHSVRAYSSRGAGLLLLLGQVADGLCTP  74

Query  1416  IAGELIDRF-------GQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQTVG  1261
             + G   DR        G  K WH  G + V +SF  +F     PC   G+ +P     + 
Sbjct  75    LVGYEADRAAGRCVRCGPRKTWHLVGTVCVLLSFPFIFS----PCLGCGAATPEWAALLY  130

Query  1260  YCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF-  1084
             Y    V+F  GW+ TQI+H+S++  +  N+  ++   + R AFT+VA++ +Y  T+ +  
Sbjct  131   YGPFIVIFQFGWAATQIAHLSLIPELVTNDQEKVELTALRYAFTVVANITVYGATWLLLH  190

Query  1083  ------TNNAEDIKTQ--------YRWMAfisifiggvfviiFHLGVKE---PRKKDDDG  955
                       ED + Q        +R ++ + + +G VF ++FHLG +E   P+ ++ D 
Sbjct  191   LQGSSHAGRPEDARDQLGVQDVPVFRNLSLLVVGVGAVFSLLFHLGTREGRRPQAQEPDE  250

Query  954   HEKI---GSNTP---WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSA  793
             H  +    +  P   W +WL+   +YQV  +Y+ TR++ N+SQ ++ +Y+   LR+ +  
Sbjct  251   HSPLLAPATARPLLLWNHWLREPAFYQVGLLYMSTRLIVNLSQVYMTMYLTYSLRLPKKF  310

Query  792   KSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYA  613
              + +P ++YL  F +S L++ +     R   +FA  G+L +L  A  + L  ++   +Y 
Sbjct  311   IATIPLVMYLSGFCSSFLMKPVNKCIGRNMTYFA--GLLVILAFAAWVALADELGVAVYV  368

Query  612   LSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESF  445
              +VL+G     ++VTS+ M + L+  H    AFVYG+M F DKV  G+A   ++S 
Sbjct  369   AAVLLGAGCTTILVTSLAMTADLIGPHTHSGAFVYGAMSFSDKVANGLAAMAIQSL  424



>gb|ETP12844.1| hypothetical protein F441_11845, partial [Phytophthora parasitica 
CJ01A1]
Length=551

 Score =   169 bits (428),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 128/423 (30%), Positives = 224/423 (53%), Gaps = 52/423 (12%)
 Frame = -2

Query  1569  LTYGVGHMLNDITQCCWytylllylTD-IGLSPSSAAIVTLVGQFADAFTTIIAGELIDR  1393
             L+YGVGH+LND+    W++YLL++L   + +SP  +A+V   GQ AD   T + G   DR
Sbjct  52    LSYGVGHVLNDMCASTWFSYLLVFLLHAVDMSPVDSAVVMFCGQIADGLATPLVGVFSDR  111

Query  1392  --------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAVVF  1237
                      G+ K W   G ++V + F  +FG  C P     S S  V  V Y  +A +F
Sbjct  112   SSGLPWLGLGRRKTWLAIGSLLVILCFFFVFGA-CAPRWFSDSPSRMVLLVYYSAAASIF  170

Query  1236  CSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTNNAEDI--  1063
               GW+  Q+SHM+MV  ++ +++ R    S R AFT++++++++ V F V       +  
Sbjct  171   NVGWATVQVSHMAMVPELSDDDNVRCVLNSTRYAFTILSNVLVFCV-FLVLLRVVSPLGV  229

Query  1062  --KTQYRWMAfisifiggvfviiFHLGVKEP---RKKDDD-----------------GH-  952
                 ++  +A+ S+ +GG+  ++F  G  E     KK+ D                 GH 
Sbjct  230   PDAEKFTLLAYTSLLVGGICTVVFLTGTPEKVTVEKKEKDPAKILAQSPVMADLEGRGHS  289

Query  951   -------------EKIGS--NTPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVIN  817
                          E +G+  +  W+ W K  ++Y+V  +Y+ TR+V NV+Q F++ Y+I 
Sbjct  290   AFPCEGDLDVPAVEVVGTSDHMTWSCWFKLGMFYEVGLVYMCTRLVVNVTQVFISFYLIV  349

Query  816   DLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPI  637
              L+MS ++ ++VP ++YL  F+ +  L+ L  S  R   F  G G++ +       L P 
Sbjct  350   TLQMSATSIAIVPLLVYLSGFLATFFLRYLNESLGRTGSFALGAGLIVVALVLSYFLTP-  408

Query  636   KMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYF  457
             +  +++Y  S+++G+ N+++MVTS+ +   LV  +++  AFVYG+M F DK+  G+A+ F
Sbjct  409   ETATWVYPFSIVLGMGNSIIMVTSVCLTGDLVGNNVESGAFVYGAMSFTDKISNGIAILF  468

Query  456   LES  448
             +++
Sbjct  469   IQN  471



>gb|ETL36514.1| hypothetical protein L916_11516, partial [Phytophthora parasitica]
Length=551

 Score =   169 bits (427),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 128/423 (30%), Positives = 224/423 (53%), Gaps = 52/423 (12%)
 Frame = -2

Query  1569  LTYGVGHMLNDITQCCWytylllylTD-IGLSPSSAAIVTLVGQFADAFTTIIAGELIDR  1393
             L+YGVGH+LND+    W++YLL++L   + +SP  +A+V   GQ AD   T + G   DR
Sbjct  52    LSYGVGHVLNDMCASTWFSYLLVFLLHAVDMSPVDSAVVMFCGQIADGLATPLVGVFSDR  111

Query  1392  --------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAVVF  1237
                      G+ K W   G ++V + F  +FG  C P     S S  V  V Y  +A +F
Sbjct  112   SSGLPWLGLGRRKTWLAIGSLLVILCFFFVFGA-CAPRWFSDSPSRMVLLVYYSAAASIF  170

Query  1236  CSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTNNAEDI--  1063
               GW+  Q+SHM+MV  ++ +++ R    S R AFT++++++++ V F V       +  
Sbjct  171   NVGWATVQVSHMAMVPELSDDDNVRCVLNSTRYAFTILSNVLVFCV-FLVLLRVVSPLGV  229

Query  1062  --KTQYRWMAfisifiggvfviiFHLGVKEP---RKKDDD-----------------GH-  952
                 ++  +A+ S+ +GG+  ++F  G  E     KK+ D                 GH 
Sbjct  230   PDAEKFTLLAYTSLLVGGICTVVFLTGTPEKVTVEKKEKDPAKILAQSPVMADLEGRGHS  289

Query  951   -------------EKIGS--NTPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVIN  817
                          E +G+  +  W+ W K  ++Y+V  +Y+ TR+V NV+Q F++ Y+I 
Sbjct  290   AFPCEGDLDVPAVEVVGTSDHMTWSCWFKLGMFYEVGLVYMCTRLVVNVTQVFISFYLIV  349

Query  816   DLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPI  637
              L+MS ++ ++VP ++YL  F+ +  L+ L  S  R   F  G G++ +       L P 
Sbjct  350   TLQMSATSIAIVPLLVYLSGFLATFFLRYLNESLGRTGSFALGAGLIVVALVLSYFLTP-  408

Query  636   KMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYF  457
             +  +++Y  S+++G+ N+++MVTS+ +   LV  +++  AFVYG+M F DK+  G+A+ F
Sbjct  409   ETATWVYPFSIVLGMGNSIIMVTSVCLTGDLVGNNVESGAFVYGAMSFTDKISNGIAILF  468

Query  456   LES  448
             +++
Sbjct  469   IQN  471



>gb|ETI43084.1| hypothetical protein F443_11886, partial [Phytophthora parasitica 
P1569]
 gb|ETK83125.1| hypothetical protein L915_11598, partial [Phytophthora parasitica]
 gb|ETM43005.1| hypothetical protein L914_11433, partial [Phytophthora parasitica]
Length=551

 Score =   169 bits (427),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 128/423 (30%), Positives = 224/423 (53%), Gaps = 52/423 (12%)
 Frame = -2

Query  1569  LTYGVGHMLNDITQCCWytylllylTD-IGLSPSSAAIVTLVGQFADAFTTIIAGELIDR  1393
             L+YGVGH+LND+    W++YLL++L   + +SP  +A+V   GQ AD   T + G   DR
Sbjct  52    LSYGVGHVLNDMCASTWFSYLLVFLLHAVDMSPVDSAVVMFCGQIADGLATPLVGVFSDR  111

Query  1392  --------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAVVF  1237
                      G+ K W   G ++V + F  +FG  C P     S S  V  V Y  +A +F
Sbjct  112   SSGLPWLGLGRRKTWLAIGSLLVILCFFFVFGA-CAPRWFSDSPSRMVLLVYYSAAASIF  170

Query  1236  CSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTNNAEDI--  1063
               GW+  Q+SHM+MV  ++ +++ R    S R AFT++++++++ V F V       +  
Sbjct  171   NVGWATVQVSHMAMVPELSDDDNVRCVLNSTRYAFTILSNVLVFCV-FLVLLRVVSPLGV  229

Query  1062  --KTQYRWMAfisifiggvfviiFHLGVKEP---RKKDDD-----------------GH-  952
                 ++  +A+ S+ +GG+  ++F  G  E     KK+ D                 GH 
Sbjct  230   PDAEKFTLLAYTSLLVGGICTVVFLTGTPEKVTVEKKEKDPAEILAQSPVMADLEGRGHS  289

Query  951   -------------EKIGS--NTPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVIN  817
                          E +G+  +  W+ W K  ++Y+V  +Y+ TR+V NV+Q F++ Y+I 
Sbjct  290   AFPCEGDLDVPAVEVVGTSDHMTWSCWFKLGMFYEVGLVYMCTRLVVNVTQVFISFYLIV  349

Query  816   DLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPI  637
              L+MS ++ ++VP ++YL  F+ +  L+ L  S  R   F  G G++ +       L P 
Sbjct  350   TLQMSATSIAIVPLLVYLSGFLATFFLRYLNESLGRTGSFALGAGLIVVALVLSYFLTP-  408

Query  636   KMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYF  457
             +  +++Y  S+++G+ N+++MVTS+ +   LV  +++  AFVYG+M F DK+  G+A+ F
Sbjct  409   ETATWVYPFSIVLGMGNSIIMVTSVCLTGDLVGNNVESGAFVYGAMSFTDKISNGIAILF  468

Query  456   LES  448
             +++
Sbjct  469   IQN  471



>gb|ELK37475.1| hypothetical protein MDA_GLEAN10011135 [Myotis davidii]
Length=450

 Score =   167 bits (422),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 125/412 (30%), Positives = 215/412 (52%), Gaps = 51/412 (12%)
 Frame = -2

Query  1599  EEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFT  1423
               +PL   + L+Y VGH LND+    W+TYLL+YL  +   S   A I+ L+GQ AD   
Sbjct  13    PPRPLSLTARLSYAVGHFLNDLCASMWFTYLLVYLHSVRAYSSRGAGILLLLGQVADGLC  72

Query  1422  TIIAGELIDRFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQTVGYCISA  1246
             T +                   I V +SF  +F     PC   G+ +P     + Y    
Sbjct  73    TPLR-----------------TICVLLSFPFIFS----PCLGCGASTPEWAALLYYGPFI  111

Query  1245  VVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF------  1084
             V+F  GW+ TQI+H+S++  +  N+  ++   + R AFT+VA++ +Y   + +       
Sbjct  112   VIFQFGWAATQIAHLSLIPELVTNDHEKVELTALRYAFTVVANITVYGAAWLLLHLQASA  171

Query  1083  -TNNAEDIKTQ--------YRWMAfisifiggvfviiFHLGVKEPRKK---DDDGHEKIG  940
              T    D+  Q        +R ++ + + IG +F ++FHLG +E RK+   + D H  + 
Sbjct  172   NTGPTPDVSDQLGVQDVPVFRNLSLLVVGIGAIFSLLFHLGTREGRKQLVEEPDEHSPLL  231

Query  939   SNTP------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVP  778
             + T       W +WL++  +YQV  +Y+ TR++ N+SQT++A+Y+   L + +   + +P
Sbjct  232   APTTARPLLLWKHWLRQPAFYQVGFLYMSTRLIVNLSQTYMAMYLTYSLNLPKKFIATIP  291

Query  777   AIIYLCSFITSVLLQEL-EWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVL  601
              ++YL  F +S L+  + +W G+ +  F    G+L +L  A  + L  ++   +YA +VL
Sbjct  292   LVMYLSGFFSSFLMNPINKWIGRNMTYFV---GLLVILAFAAWVALADRLGVAVYAAAVL  348

Query  600   IGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESF  445
             +G+  A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  ++S 
Sbjct  349   LGMGCATILVTSLAMTADLIGPHTHSGAFVYGAMSFSDKVANGLAVMVIQSL  400



>ref|XP_006514282.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X1 [Mus musculus]
Length=473

 Score =   167 bits (424),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 134/443 (30%), Positives = 222/443 (50%), Gaps = 41/443 (9%)
 Frame = -2

Query  1617  DNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQ  1441
             D+      + L   + L++ VGH LND+    W+TYLLL+L  + G S   A ++ L+GQ
Sbjct  6     DDAGPGPPRTLSLAARLSFAVGHFLNDLCAGMWFTYLLLFLHSVRGYSSRGAGLLLLLGQ  65

Query  1440  FADAFTTIIAGELIDRF-----GQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT  1276
              AD   T + G   DR      G  K WH AG + V +SF  +F     PC   G  +P 
Sbjct  66    VADGLCTPLVGYEADRASCVRCGPRKAWHLAGTVCVLLSFPFIFS----PCLGCGEATPE  121

Query  1275  -VQTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAV  1099
                 + Y    VVF  GW+ TQI+H+S++  +  ++  ++   + R AFT+VA++ +Y  
Sbjct  122   WAALLYYGPFIVVFQFGWAATQIAHLSLIPELVTSDHEKVELTALRYAFTVVANITVYGA  181

Query  1098  TFFVF-----TNNAEDIKTQ----------YRWMAfisifiggvfviiFHLGVKEPRKKD  964
              + +       +  +DI             +R +A + + +G +F ++FHLG KE  +  
Sbjct  182   AWLLLHLQGSAHGEQDISVGDQLGVQDVPVFRNLALLVVGVGAIFSLLFHLGTKEGHRSQ  241

Query  963   DDGHEKIGSNTP-----------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVIN  817
               G+E    +TP           W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+  
Sbjct  242   HWGNEP-NEHTPLVAPAAQPLLLWKHWLREPAFYQVGMLYMTTRLIVNLSQTYIAMYLTY  300

Query  816   DLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPI  637
              L + +   + +P ++YL  F +S L++ +     R   +F   G+L +L  A  + L  
Sbjct  301   SLSLPKKFIATIPLVMYLSGFFSSFLMKPVNRRIGRNMTYFT--GLLVILAFAAWVALAD  358

Query  636   KMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYF  457
              +   +Y  +VL+G   A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  
Sbjct  359   NLGVAVYGAAVLLGAGCATILVTSLAMTADLIGPHTHSGAFVYGAMSFSDKVANGLAVMA  418

Query  456   LESFEDADPVACNPAQACFSVTR  388
             ++S     P    PA    S  R
Sbjct  419   VQSLHPC-PGPARPALTSGSPGR  440



>ref|XP_003975549.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Takifugu rubripes]
Length=490

 Score =   167 bits (424),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 129/435 (30%), Positives = 226/435 (52%), Gaps = 57/435 (13%)
 Frame = -2

Query  1569  LTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTIIAGELIDR  1393
             L+Y VGH  ND+    W+TYLL++   + GL  ++A ++ LVGQ ADA  T + G   DR
Sbjct  14    LSYAVGHFFNDLCASMWFTYLLVFYHSVLGLQNANAGVLLLVGQVADALCTPLIGYESDR  73

Query  1392  ------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAVVFCS  1231
                   +G+ K WH  G + V +SF  +F   C+ C    S +P   +V Y I  ++   
Sbjct  74    TAGCGNYGKRKTWHLVGTLSVLLSFNFIFN-ECVGCS---SITPQWASVTYFIPFIIIFQ  129

Query  1230  -GWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF-----TNNAE  1069
              GW+  QISH++++  +   E +R+   + R AFT++A++ +YAV + +F      N  +
Sbjct  130   FGWAAIQISHLALIPELVTCEHARVELTAYRYAFTVIANITVYAVAYLLFHLLTGVNGND  189

Query  1068  DIKTQ---------YRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKI---------  943
             ++            ++ +A I + +G VF + FH+G  E R+  +  H++          
Sbjct  190   NLSDDALGPADAPVFKNLALIVLGVGAVFSVFFHVGTAESRQTKEVRHKREEEEKQQEED  249

Query  942   ---GSNTP-------------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDL  811
                 ++ P             W  WL++  +YQVA +Y+ TR++ N+SQT++++Y+IN L
Sbjct  250   EEQSASRPLLPKSRTLLLLLQWKCWLRQPSFYQVALLYMTTRLIVNLSQTYMSMYLINTL  309

Query  810   RMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRL--KIFFAGGGILWLLCGAVVMLLPI  637
              + +   + +P ++YL  F+ S +++ +     RL  K F    G+L ++  +  +LL  
Sbjct  310   GLHKKFIATIPLVMYLSGFLCSFIMKPVS----RLIGKCFTYALGLLLVMTFSGWVLLDE  365

Query  636   KMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYF  457
             +M   +Y  +VL+G  +A ++V S+ M + L+       AFVYGSM F DK+  GVA+  
Sbjct  366   QMGERVYGAAVLLGAGSATILVISLAMTAELIADQTQSGAFVYGSMSFADKLSNGVAVMM  425

Query  456   LESFEDADPVACNPA  412
             +++        C PA
Sbjct  426   IQALHPCRTSVCCPA  440



>ref|XP_009013147.1| hypothetical protein HELRODRAFT_110029 [Helobdella robusta]
 gb|ESO09125.1| hypothetical protein HELRODRAFT_110029 [Helobdella robusta]
Length=490

 Score =   167 bits (424),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 122/406 (30%), Positives = 206/406 (51%), Gaps = 34/406 (8%)
 Frame = -2

Query  1587  LGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTIIA  1411
             L  C  L++ +GH  ND+    W+TYLL++LTDI GLS   A  + L+GQ  DA +T   
Sbjct  9     LSLCQKLSFSLGHFYNDLCSTMWFTYLLIFLTDIIGLSNEMAGYLLLLGQVVDAVSTPFL  68

Query  1410  GELIDR------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCIS  1249
             G   D       + + K WH  G I V  SF  LF    +PC    +     + + Y   
Sbjct  69    GYESDAANGLCGYSKRKSWHLLGTIFVTCSFTFLF----LPCFGGANAEDWAKFIYYSPF  124

Query  1248  AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTNNAE  1069
              ++F  GW+  QI+HM++V  +T +ES R+   S RNA T+ A++++Y + + +F  ++ 
Sbjct  125   VILFQFGWAAVQIAHMTLVTELTPDESERVGLNSYRNAMTLFANVLVYGIAWSLFHRDSN  184

Query  1068  DIKTQ-----YRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKI-------GSNTPW  925
             +  +Q     +  + F  + IG    I FH+  KEP    D    ++            W
Sbjct  185   EQWSQQDTSLFMILMFAVVAIGVTCTIFFHIFTKEPGDLRDQYENQVLIQRVDDQPKMEW  244

Query  924   TYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITS  745
               WLK   +Y V   Y+F R+++NVSQT+   Y+I+ L +++   +++P ++++  FITS
Sbjct  245   ADWLKEPQFYLVGICYMFARLISNVSQTYWPFYIIDSLHLTKQYAAIIPLVVFVSGFITS  304

Query  744   VLLQELEWSGKRLKIFFAGG-----GILWLLCGAVVMLLPIKMNSFMYALSVLIGIANAL  580
             +L++ L     R   F  G       +LW+        L    +  ++  +V+IG+ +  
Sbjct  305   LLMRPLNKVFGRKPTFLLGSIVMGMALLWM------AFLDYNSSKQVFGSAVIIGVGSTT  358

Query  579   MMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFE  442
             ++VT++ M + ++ +    SAFVYG M F DK+  GV L  ++  E
Sbjct  359   LLVTALSMVADVIGEQTSSSAFVYGVMSFGDKLSSGVTLMLIQLLE  404



>ref|XP_006206624.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Vicugna pacos]
Length=554

 Score =   168 bits (426),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 130/417 (31%), Positives = 219/417 (53%), Gaps = 37/417 (9%)
 Frame = -2

Query  1593  KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTI  1417
             +PL   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   T 
Sbjct  15    RPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLCTP  74

Query  1416  IAGELIDR-------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGY  1258
             + G   DR       FG  K WH  G I V +SF  +F   C+ C+    +   +   G 
Sbjct  75    LVGFEADRAAGRCARFGPRKAWHLVGTICVLLSFPFIFS-PCLGCRAATPEWAALLYYGP  133

Query  1257  CISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF--  1084
              I  V+F  GW+ TQI+H+S++  +  N+  ++   + R AFT+VA++ +Y   + +   
Sbjct  134   FI--VIFQFGWAATQIAHLSLIPELVTNDHEKVELTALRYAFTVVANITVYGAAWLLLHL  191

Query  1083  -----TNNAEDIKTQ--------YRWMAfisifiggvfviiFHLGVKEPRK---KDDDGH  952
                    +A+D+           +R ++ + + +G VF ++FHLG KE R+   ++ D H
Sbjct  192   QGSTHMGSAQDVSDHLGAQDVPVFRNLSLLVVGVGAVFSLLFHLGTKEGRRLQAEEPDEH  251

Query  951   EKI---GSNTP---WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAK  790
               +    +  P   W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L + +   
Sbjct  252   SPLLAPAAARPLVLWKHWLQEPAFYQVGLLYMSTRLIVNLSQTYMAMYLTYSLNLPKRFI  311

Query  789   SLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYAL  610
             + +P ++YL  F +S L++ +     R   +F   G+L +L  A  + L   +   +Y  
Sbjct  312   ATIPLVMYLSGFFSSFLMKPVNKCIGRNMTYFM--GLLVILAFAAWVALADVLGVAVYVA  369

Query  609   SVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFED  439
             +VL+G   A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  ++S   
Sbjct  370   AVLLGAGCATILVTSLSMTADLIGPHTHSGAFVYGAMSFSDKVANGLAVMAIQSLHP  426



>ref|XP_007176611.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X4 [Balaenoptera acutorostrata scammoni]
Length=430

 Score =   166 bits (420),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 133/416 (32%), Positives = 222/416 (53%), Gaps = 37/416 (9%)
 Frame = -2

Query  1593  KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTI  1417
             +PL   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   T 
Sbjct  15    RPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLCTP  74

Query  1416  IAGELIDR-------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGY  1258
             + G   DR       FG  K WH  G I V +SF  +F   C+ C+   S    V  + Y
Sbjct  75    LVGFEADRAAGRCARFGPRKAWHLVGTICVLLSFPFIFS-PCLGCQ--ASTPEWVALLYY  131

Query  1257  CISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF--  1084
                 V+F  GW+ TQI+H+S++  +  N+  ++   + R AFT+VAS+ +Y   + +   
Sbjct  132   GPFIVIFQFGWAATQIAHLSLIPELVTNDHEKVELTALRYAFTVVASITVYGAAWLLLHL  191

Query  1083  -----TNNAEDIKTQ--------YRWMAfisifiggvfviiFHLGVKEPRKK---DDDGH  952
                    + +D+  Q        +R ++ + + IG VF ++FHLG +E R++   + D H
Sbjct  192   QGSPHMGSTQDVYDQLGVQDVPVFRNLSLLVVGIGAVFSLLFHLGTREGRRRQVEEPDEH  251

Query  951   EKI---GSNTP---WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAK  790
               +    +  P   W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L + +   
Sbjct  252   SPLLAPATARPLLLWKHWLREPAFYQVGLLYMSTRLIVNLSQTYMAMYLTYSLNLPKKFI  311

Query  789   SLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYAL  610
             + +P ++YL  F++S LL+ +     R   +F   G+L +L  A  + L  ++   +Y +
Sbjct  312   ATIPLVMYLSGFLSSFLLKPVNKCIGRNMTYFV--GLLVILAFAAWVALADELGVAVYVV  369

Query  609   SVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFE  442
             +VL+G   A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  ++S  
Sbjct  370   AVLLGTGCATILVTSLAMTADLIGPHTHSGAFVYGAMSFSDKVANGLAVMAIQSLH  425



>ref|XP_004395407.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Odobenus rosmarus divergens]
Length=478

 Score =   167 bits (422),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 141/459 (31%), Positives = 233/459 (51%), Gaps = 48/459 (10%)
 Frame = -2

Query  1593  KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTI  1417
             +PL   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   T 
Sbjct  15    RPLSVAARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLCTP  74

Query  1416  IAGELIDRF-------GQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQTVG  1261
             + G   DR        G  K WH  G I V +SF  +F     PC   G+ +P     + 
Sbjct  75    LVGYEADRAAGHCVRCGPRKAWHLVGTICVLLSFPFIFS----PCLGCGAATPEWAALLY  130

Query  1260  YCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF-  1084
             Y    V+F  GW+  QI+H+S++  +  N+  ++   + R AFT+VAS+ +Y   + +  
Sbjct  131   YAPFIVIFQFGWAAAQIAHLSLIPELATNDHEKVELTALRYAFTVVASITVYGAAWVLLH  190

Query  1083  ------TNNAEDIKTQ--------YRWMAfisifiggvfviiFHLGVKE---PRKKDDDG  955
                      A  +  Q        ++ ++ + + +G V  ++FHLG +E   PR ++ D 
Sbjct  191   LQGSPSLGGARRVTDQLGIQDVLVFQNLSLLVVGVGAVSSLLFHLGTREGRRPRAEEPDE  250

Query  954   HEKI---GSNTP---WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSA  793
             H  +    +  P   W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L + +  
Sbjct  251   HSPLLAPATARPLLLWKHWLREPAFYQVGLLYMSTRLIVNLSQTYIAMYLTYSLNLPKKF  310

Query  792   KSLVPAIIYLCSFITSVLLQELEWS-GKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMY  616
              + +P ++YL  F +S L++ +    G+ L  F    G+L +L  A  + L   +   +Y
Sbjct  311   IATIPLVMYLSGFCSSFLMKPVNRCIGRNLTYFV---GLLVILAFAAWVALADGLGMAVY  367

Query  615   ALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDA  436
             A +VL+G   A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  ++S    
Sbjct  368   AAAVLLGTGCATILVTSLAMTADLIGPHTHSGAFVYGAMSFSDKVANGLAVMAIQSLYPC  427

Query  435   DPVACNPAQACFSVTRFSLGFIPGIAALFGVIVSFTMKL  319
                 C   +AC    R+ +     +AA  GV V+ T+ L
Sbjct  428   SLEIC--CRACMGFYRWVM-----VAATGGVGVAATLCL  459



>ref|XP_624057.2| PREDICTED: major facilitator superfamily domain-containing protein 
12-like isoform X2 [Apis mellifera]
Length=486

 Score =   167 bits (423),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 141/479 (29%), Positives = 247/479 (52%), Gaps = 55/479 (11%)
 Frame = -2

Query  1635  RRIMGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAI  1459
              +I+  D  E  +  PL     L YG+GH+LNDI    W+TYLL++   + G +P+ A +
Sbjct  4     EQIITEDYSEIIQYLPLSL--KLLYGIGHVLNDICASMWFTYLLVFFHLVLGFNPTLAGV  61

Query  1458  VTLVGQFADAFTTIIAGELIDR--------FGQFKIWH--GAGCIMVGVSFISLFGGTCI  1309
             +  +GQ ADA  T   G   D+        +G+ K WH  G  CI+    FI      CI
Sbjct  62    ILFIGQIADALATPFVGFYSDKNNDFWLCKYGKRKTWHLIGTLCILFAFPFIF---SRCI  118

Query  1308  PCKILGSDSPTVQTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFT  1129
              C+   +     Q + Y    ++F  GW+  QISH+S+V   T  E  R   ++ R +FT
Sbjct  119   GCE---TAHEWAQLIYYAAFVIIFQFGWAAVQISHLSLVPEFTYIEYERTELIAIRYSFT  175

Query  1128  MVASLMLYAVTFFVF--TNNAE-------DIKTQYRWMAfisifiggvfviiFHLGVKEP  976
             +++++ +Y +T+ +   TN+ +       D  T+++ + FI I IG +   +FH+ VKE 
Sbjct  176   VLSNVFVYCITWAILHITNSKDSNSQIGPDDTTKFQEVVFIGIGIGTITSFLFHIFVKEN  235

Query  975   RKKDDDGHEKIGSNTPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQS  796
                 +    +  S+   +  LK +  YQVA IY+ TR+  N+SQ ++ +Y+   L M  +
Sbjct  236   LNNSNGLMNR--SSRTISLILKDIQLYQVACIYMSTRLFINLSQIYVPLYLHISLNMPAT  293

Query  795   AKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGIL------WLLCGAVVMLLPIK  634
             + +++P I+YL SF+ S++++ L     R KI +  G +L      W+  G  +  +  +
Sbjct  294   SLAIIPLIMYLSSFVMSLIIERLNTKLGR-KISYCFGVVLGVCACIWIQFGNDLTYIRYQ  352

Query  633   MNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFL  454
                 +Y + +++G A ++M+VTS+G+ +  + +++D  AFVYG M F DK+  G+A+  +
Sbjct  353   ----IYLVFLILGSAGSVMLVTSLGITADFIGQNIDNGAFVYGIMSFTDKLCNGLAVMLI  408

Query  453   ESFEDADPVACNPAQACFSVTRFSLGFIPGIAALFGVIVSFTMKLLH------TSHKKQ  295
             +          N    C +  R  L ++ GI+A+FG+++   +K  H      T H +Q
Sbjct  409   QYL--------NCWVDCKNYYRDVLVYVCGISAIFGMLMILCIKSFHHGTTYNTLHSEQ  459



>ref|XP_007489237.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X2 [Monodelphis domestica]
Length=473

 Score =   167 bits (422),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 127/418 (30%), Positives = 216/418 (52%), Gaps = 42/418 (10%)
 Frame = -2

Query  1596  EKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTT  1420
             E  L   + L+Y VGH LND+    W+TYLLLYL  + G S   A I+ L+GQ AD   T
Sbjct  3     EPGLPLVARLSYSVGHFLNDLCASMWFTYLLLYLHSVQGYSSWGAGILLLLGQLADGVCT  62

Query  1419  IIAGELID-------RFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVG  1261
              + G   D       R+G  K WH  G   V +SF  +F   C+ C    S +     + 
Sbjct  63    PLVGYEADHSGGCCGRYGPRKSWHLVGTFCVLLSFPFIFN-PCLGCT--ASTAEWAAIIY  119

Query  1260  YCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF-  1084
             Y    V+F  GW+ TQISH+S++  +  N+  ++   + R AFT+VA++ +Y   + +  
Sbjct  120   YAPFIVIFQFGWAATQISHLSLIPELVTNDHEKVELTAFRYAFTVVANIAVYGAAWLLLH  179

Query  1083  ----------TNNAEDIKTQ----YRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEK  946
                       +   + +  Q    +R ++ + + +G VF ++FHLG +E R+    G E+
Sbjct  180   FQGSHSESPDSGPGDQLGLQDVPVFRNLSLMVVCVGAVFSLLFHLGTRERRRP---GPEE  236

Query  945   IGSNTP-----------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQ  799
                ++P           W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L + +
Sbjct  237   PSEHSPLLPPAAQPRLLWKHWLREPSFYQVGLLYMSTRLIVNLSQTYMAMYLTYSLSLPK  296

Query  798   SAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFM  619
                + +P ++Y+  F +S  ++ +     R   +F   G+L +L  A  + L   +   +
Sbjct  297   KFIATIPLVMYVSGFFSSFFMKPVNKRIGRNLTYFV--GLLVILAFASWVALANLLGPAV  354

Query  618   YALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESF  445
             Y  +VL+GI +A ++V S+ M + L+  H +  AFVYG+M F DKV  G+A+  ++S 
Sbjct  355   YGAAVLLGIGSATILVMSLSMTADLIGSHTNSGAFVYGAMSFTDKVANGLAVMAIQSL  412



>ref|XP_001364611.2| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X1 [Monodelphis domestica]
Length=484

 Score =   167 bits (422),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 127/418 (30%), Positives = 216/418 (52%), Gaps = 42/418 (10%)
 Frame = -2

Query  1596  EKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTT  1420
             E  L   + L+Y VGH LND+    W+TYLLLYL  + G S   A I+ L+GQ AD   T
Sbjct  3     EPGLPLVARLSYSVGHFLNDLCASMWFTYLLLYLHSVQGYSSWGAGILLLLGQLADGVCT  62

Query  1419  IIAGELID-------RFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVG  1261
              + G   D       R+G  K WH  G   V +SF  +F   C+ C    S +     + 
Sbjct  63    PLVGYEADHSGGCCGRYGPRKSWHLVGTFCVLLSFPFIFN-PCLGCT--ASTAEWAAIIY  119

Query  1260  YCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF-  1084
             Y    V+F  GW+ TQISH+S++  +  N+  ++   + R AFT+VA++ +Y   + +  
Sbjct  120   YAPFIVIFQFGWAATQISHLSLIPELVTNDHEKVELTAFRYAFTVVANIAVYGAAWLLLH  179

Query  1083  ----------TNNAEDIKTQ----YRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEK  946
                       +   + +  Q    +R ++ + + +G VF ++FHLG +E R+    G E+
Sbjct  180   FQGSHSESPDSGPGDQLGLQDVPVFRNLSLMVVCVGAVFSLLFHLGTRERRRP---GPEE  236

Query  945   IGSNTP-----------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQ  799
                ++P           W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L + +
Sbjct  237   PSEHSPLLPPAAQPRLLWKHWLREPSFYQVGLLYMSTRLIVNLSQTYMAMYLTYSLSLPK  296

Query  798   SAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFM  619
                + +P ++Y+  F +S  ++ +     R   +F   G+L +L  A  + L   +   +
Sbjct  297   KFIATIPLVMYVSGFFSSFFMKPVNKRIGRNLTYFV--GLLVILAFASWVALANLLGPAV  354

Query  618   YALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESF  445
             Y  +VL+GI +A ++V S+ M + L+  H +  AFVYG+M F DKV  G+A+  ++S 
Sbjct  355   YGAAVLLGIGSATILVMSLSMTADLIGSHTNSGAFVYGAMSFTDKVANGLAVMAIQSL  412



>ref|XP_010599581.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Loxodonta africana]
Length=488

 Score =   167 bits (422),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 125/414 (30%), Positives = 217/414 (52%), Gaps = 40/414 (10%)
 Frame = -2

Query  1626  MGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTL  1450
             MG   +E    + L   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L
Sbjct  1     MGPGPQEAAAPRALSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSVLAYSSRGAGLLLL  60

Query  1449  VGQFADAFTTIIAGELIDR-------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILG  1291
             +GQ AD   T + G   DR       +G  K WH  G + V +SF  +F     PC   G
Sbjct  61    LGQVADGLCTPLVGYEADRAAGCCARYGPRKAWHLVGTVCVLLSFPFIFS----PCLGCG  116

Query  1290  SDSPT-VQTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASL  1114
             + +P     + Y    V+F  GW+ TQI+H+S++  +  N+  ++   + R AFT+VA++
Sbjct  117   ATTPEWAALIYYGPFIVIFQFGWAATQIAHLSLIPELVTNDHEKVELTALRYAFTVVANI  176

Query  1113  MLYAVTFFVF-------TNNAEDIKTQ--------YRWMAfisifiggvfviiFHLGVKE  979
              +Y   + +            +++  Q        +R ++ + + IG +F ++FHLG +E
Sbjct  177   TVYGTAWLLLHLQGSPHMGPTQEVSDQLGVQDVPVFRNLSLLVVGIGAIFSLLFHLGTRE  236

Query  978   ---PRKKDDDGHEKIGSNTP-----WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYV  823
                PR ++ D H  + +        W  WL+   +YQV  +Y+ TR++ N+SQT++A+Y+
Sbjct  237   WRQPRLEEPDEHSPLLTPVARPLLLWKDWLREPAFYQVGLLYMSTRLIVNLSQTYMAMYL  296

Query  822   INDLRMSQSAKSLVPAIIYLCSFITSVLLQEL-EWSGKRLKIFFAGGGILWLLCGAVVML  646
                L++ +   + +P ++YL  F +S+L++ + +W G+ L  F    G+L +L  +  + 
Sbjct  297   TYSLKLPKKFIASIPLVMYLSGFFSSLLMKPINKWIGRNLTYF---TGLLVILAFSAWVA  353

Query  645   LPIKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDK  484
             L  ++   +Y ++VL+G   A ++VTS+ M + L+  H    AFVYG+M F D 
Sbjct  354   LANELGLAVYVVAVLLGAGCATILVTSLAMTADLIGPHTHSGAFVYGAMSFSDN  407



>ref|XP_418193.3| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X6 [Gallus gallus]
Length=494

 Score =   167 bits (422),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 133/423 (31%), Positives = 225/423 (53%), Gaps = 40/423 (9%)
 Frame = -2

Query  1569  LTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTIIAGELIDR  1393
             L++  GH LND+    W+TYLLLYL  + G S   A  + L GQ AD   T + G   DR
Sbjct  16    LSFAAGHFLNDLCASLWFTYLLLYLHAVLGYSHGLAGGLLLAGQVADGLCTPLLGYEADR  75

Query  1392  ------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCIS-AVVFC  1234
                   +G+ K WH AG   V +SF  +F   C+ CK     +P      Y +   V+F 
Sbjct  76    SAGCGRYGRRKSWHLAGTTCVLISFPFIFN-PCLGCK---EGTPQWAAFIYYLPFIVIFQ  131

Query  1233  SGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFT------NNA  1072
              GW+ TQISH+S++  +  ++  ++   + R AFT++A++ +Y + + +           
Sbjct  132   FGWAATQISHLSLIPELVTSDHEKVELTAFRYAFTVMANITVYGLAWLLLNLQVDQPERT  191

Query  1071  EDIKTQ----YRWMAfisifiggvfviiFHLGVKE--------PRKKDDDGH-EKIGSNT  931
             E +  Q    +R ++ I + +G +F + FHLG KE        P+ K+     +K  + +
Sbjct  192   EHLGFQDVPVFRNLSLIVVGLGALFSLFFHLGTKEKLYPLGSVPQPKESTPLLQKEPTRS  251

Query  930   P-----WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIY  766
             P     W  WL    +YQVA +Y+ TR++ N+SQT++A+Y+ N L + +   + +P ++Y
Sbjct  252   PRSLLVWKDWLLEPSFYQVAVLYMATRLIVNLSQTYIAMYLTNSLLLPKKYIATIPLVMY  311

Query  765   LCSFITSVLLQEL-EWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIA  589
             +  F++S L++ + +W G+ L  F    GIL +L  A  + L  +M + +Y ++VL+G  
Sbjct  312   ISGFLSSFLMKPVNKWIGRNLTYFV---GILVILAFASWVSLSREMGAEIYGVAVLLGAG  368

Query  588   NALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQ  409
             +A ++VTS+ M + L+  +   SAFVYG+M F DK+  G+A+  +++        C PA 
Sbjct  369   SATILVTSLSMTADLIGTNTHSSAFVYGAMSFTDKMANGLAVMLIQNLHPCPTELCCPAC  428

Query  408   ACF  400
               F
Sbjct  429   VSF  431



>ref|XP_007104297.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X1 [Physeter catodon]
Length=478

 Score =   166 bits (421),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 136/430 (32%), Positives = 225/430 (52%), Gaps = 37/430 (9%)
 Frame = -2

Query  1593  KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTI  1417
             +PL   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   T 
Sbjct  15    RPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLCTP  74

Query  1416  IAGELIDR-------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGY  1258
             + G   DR       FG  K WH  G I V +SF  +F   C+ CK   +    V  + Y
Sbjct  75    LVGFEADRAAGRCARFGPRKAWHLVGTICVLLSFPFIFS-PCLGCK--ATTPEWVALLYY  131

Query  1257  CISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF--  1084
                 V+F  GW+ TQI+H+S++  +  N+  ++   + R AFT+VAS+ +Y   + +   
Sbjct  132   GPFIVIFQFGWAATQIAHLSLIPELVTNDHEKVELTALRYAFTVVASITVYGAAWLLLHL  191

Query  1083  -----TNNAEDIKTQ--------YRWMAfisifiggvfviiFHLGVKEPRKK---DDDGH  952
                    + +DI  Q        +R ++ + + +G VF ++FHLG +E R++   + D H
Sbjct  192   QGSSHMGSTQDIYDQLGVQDVPVFRNLSLLVVGVGAVFSLLFHLGTREGRRRQVEEPDEH  251

Query  951   EKI---GSNTP---WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAK  790
               +    +  P   W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L + +   
Sbjct  252   SPLLAPATARPLLLWKHWLREPAFYQVGLLYMSTRLIVNLSQTYMAMYLTYSLNLPKKFI  311

Query  789   SLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYAL  610
             + +P ++YL  F+ S LL+ +     R   +F   G+L +L  A  + L  ++   +Y +
Sbjct  312   ATIPLVMYLSGFLFSFLLKPVNKCIGRNMTYFV--GLLVILAFAAWVALADELGVAVYVV  369

Query  609   SVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP  430
             +VL+G+  A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  ++S      
Sbjct  370   AVLLGMGCATILVTSLAMTADLIGPHTHSGAFVYGAMSFSDKVANGLAVMAIQSLHPCSS  429

Query  429   VACNPAQACF  400
               C  A   F
Sbjct  430   ELCCKACVAF  439



>ref|NP_082933.2| major facilitator superfamily domain-containing protein 12 [Mus 
musculus]
 sp|Q3U481.1|MFS12_MOUSE RecName: Full=Major facilitator superfamily domain-containing 
protein 12 [Mus musculus]
 dbj|BAE32552.1| unnamed protein product [Mus musculus]
 dbj|BAE29021.1| unnamed protein product [Mus musculus]
 dbj|BAE42237.1| unnamed protein product [Mus musculus]
 gb|AAI18621.1| RIKEN cDNA F630110N24 gene [Mus musculus]
 gb|AAI19791.1| RIKEN cDNA F630110N24 gene [Mus musculus]
 gb|EDL31420.1| mCG12122 [Mus musculus]
Length=476

 Score =   166 bits (421),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 130/432 (30%), Positives = 218/432 (50%), Gaps = 40/432 (9%)
 Frame = -2

Query  1617  DNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQ  1441
             D+      + L   + L++ VGH LND+    W+TYLLL+L  + G S   A ++ L+GQ
Sbjct  6     DDAGPGPPRTLSLAARLSFAVGHFLNDLCAGMWFTYLLLFLHSVRGYSSRGAGLLLLLGQ  65

Query  1440  FADAFTTIIAGELIDRF-----GQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT  1276
              AD   T + G   DR      G  K WH AG + V +SF  +F     PC   G  +P 
Sbjct  66    VADGLCTPLVGYEADRASCVRCGPRKAWHLAGTVCVLLSFPFIFS----PCLGCGEATPE  121

Query  1275  -VQTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAV  1099
                 + Y    VVF  GW+ TQI+H+S++  +  ++  ++   + R AFT+VA++ +Y  
Sbjct  122   WAALLYYGPFIVVFQFGWAATQIAHLSLIPELVTSDHEKVELTALRYAFTVVANITVYGA  181

Query  1098  TFFVF-----TNNAEDIKTQ----------YRWMAfisifiggvfviiFHLGVKEPRKKD  964
              + +       +  +DI             +R +A + + +G +F ++FHLG KE  +  
Sbjct  182   AWLLLHLQGSAHGEQDISVGDQLGVQDVPVFRNLALLVVGVGAIFSLLFHLGTKEGHRSQ  241

Query  963   DDGHEKIGSNTP-----------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVIN  817
               G+E    +TP           W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+  
Sbjct  242   HWGNEP-NEHTPLVAPAAQPLLLWKHWLREPAFYQVGMLYMTTRLIVNLSQTYIAMYLTY  300

Query  816   DLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPI  637
              L + +   + +P ++YL  F +S L++ +     R   +F   G+L +L  A  + L  
Sbjct  301   SLSLPKKFIATIPLVMYLSGFFSSFLMKPVNRRIGRNMTYFT--GLLVILAFAAWVALAD  358

Query  636   KMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYF  457
              +   +Y  +VL+G   A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  
Sbjct  359   NLGVAVYGAAVLLGAGCATILVTSLAMTADLIGPHTHSGAFVYGAMSFSDKVANGLAVMA  418

Query  456   LESFEDADPVAC  421
             ++S        C
Sbjct  419   VQSLHPCPSELC  430



>ref|XP_004948760.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X8 [Gallus gallus]
Length=508

 Score =   167 bits (422),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 133/423 (31%), Positives = 225/423 (53%), Gaps = 40/423 (9%)
 Frame = -2

Query  1569  LTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTIIAGELIDR  1393
             L++  GH LND+    W+TYLLLYL  + G S   A  + L GQ AD   T + G   DR
Sbjct  16    LSFAAGHFLNDLCASLWFTYLLLYLHAVLGYSHGLAGGLLLAGQVADGLCTPLLGYEADR  75

Query  1392  ------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCIS-AVVFC  1234
                   +G+ K WH AG   V +SF  +F   C+ CK     +P      Y +   V+F 
Sbjct  76    SAGCGRYGRRKSWHLAGTTCVLISFPFIFN-PCLGCK---EGTPQWAAFIYYLPFIVIFQ  131

Query  1233  SGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFT------NNA  1072
              GW+ TQISH+S++  +  ++  ++   + R AFT++A++ +Y + + +           
Sbjct  132   FGWAATQISHLSLIPELVTSDHEKVELTAFRYAFTVMANITVYGLAWLLLNLQVDQPERT  191

Query  1071  EDIKTQ----YRWMAfisifiggvfviiFHLGVKE--------PRKKDDDGH-EKIGSNT  931
             E +  Q    +R ++ I + +G +F + FHLG KE        P+ K+     +K  + +
Sbjct  192   EHLGFQDVPVFRNLSLIVVGLGALFSLFFHLGTKEKLYPLGSVPQPKESTPLLQKEPTRS  251

Query  930   P-----WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIY  766
             P     W  WL    +YQVA +Y+ TR++ N+SQT++A+Y+ N L + +   + +P ++Y
Sbjct  252   PRSLLVWKDWLLEPSFYQVAVLYMATRLIVNLSQTYIAMYLTNSLLLPKKYIATIPLVMY  311

Query  765   LCSFITSVLLQEL-EWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIA  589
             +  F++S L++ + +W G+ L  F    GIL +L  A  + L  +M + +Y ++VL+G  
Sbjct  312   ISGFLSSFLMKPVNKWIGRNLTYFV---GILVILAFASWVSLSREMGAEIYGVAVLLGAG  368

Query  588   NALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQ  409
             +A ++VTS+ M + L+  +   SAFVYG+M F DK+  G+A+  +++        C PA 
Sbjct  369   SATILVTSLSMTADLIGTNTHSSAFVYGAMSFTDKMANGLAVMLIQNLHPCPTELCCPAC  428

Query  408   ACF  400
               F
Sbjct  429   VSF  431



>ref|XP_007176609.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X2 [Balaenoptera acutorostrata scammoni]
Length=490

 Score =   166 bits (421),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 145/479 (30%), Positives = 246/479 (51%), Gaps = 53/479 (11%)
 Frame = -2

Query  1593  KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTI  1417
             +PL   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   T 
Sbjct  15    RPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLCTP  74

Query  1416  IAGELIDR-------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGY  1258
             + G   DR       FG  K WH  G I V +SF  +F   C+ C+   S    V  + Y
Sbjct  75    LVGFEADRAAGRCARFGPRKAWHLVGTICVLLSFPFIFS-PCLGCQ--ASTPEWVALLYY  131

Query  1257  CISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF--  1084
                 V+F  GW+ TQI+H+S++  +  N+  ++   + R AFT+VAS+ +Y   + +   
Sbjct  132   GPFIVIFQFGWAATQIAHLSLIPELVTNDHEKVELTALRYAFTVVASITVYGAAWLLLHL  191

Query  1083  -----TNNAEDIKTQ--------YRWMAfisifiggvfviiFHLGVKEPRKK---DDDGH  952
                    + +D+  Q        +R ++ + + IG VF ++FHLG +E R++   + D H
Sbjct  192   QGSPHMGSTQDVYDQLGVQDVPVFRNLSLLVVGIGAVFSLLFHLGTREGRRRQVEEPDEH  251

Query  951   EKI---GSNTP---WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAK  790
               +    +  P   W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L + +   
Sbjct  252   SPLLAPATARPLLLWKHWLREPAFYQVGLLYMSTRLIVNLSQTYMAMYLTYSLNLPKKFI  311

Query  789   SLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYAL  610
             + +P ++YL  F++S LL+ +     R   +F   G+L +L  A  + L  ++   +Y +
Sbjct  312   ATIPLVMYLSGFLSSFLLKPVNKCIGRNMTYFV--GLLVILAFAAWVALADELGVAVYVV  369

Query  609   SVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP  430
             +VL+G   A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  ++S      
Sbjct  370   AVLLGTGCATILVTSLAMTADLIGPHTHSGAFVYGAMSFSDKVANGLAVMAIQSLHPCSS  429

Query  429   VACNPAQACFSVTRFSLGFIPGIAALFGVIVSFTMKL---------LHTSHKKQPLAEP  280
               C   +AC +   + +     +A   GV V+ T+ L         L + +  +P ++P
Sbjct  430   ELC--CKACVAFYHWVM-----VAVTGGVGVAATLALCCLLVWPVRLRSCYPDRPPSKP  481



>ref|XP_005332265.1| PREDICTED: major facilitator superfamily domain-containing protein 
12, partial [Ictidomys tridecemlineatus]
Length=460

 Score =   166 bits (420),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 128/417 (31%), Positives = 218/417 (52%), Gaps = 40/417 (10%)
 Frame = -2

Query  1569  LTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTIIAGELIDR  1393
             L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   T + G   DR
Sbjct  4     LSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLCTPLVGYEADR  63

Query  1392  -------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAVV-F  1237
                    +G  K WH  G I V +SF  +F     PC   G+ +P    + Y    +V F
Sbjct  64    AAGRCARYGPRKAWHLVGTICVLLSFPFIFS----PCLGCGAATPEWAALLYYGPFIVTF  119

Query  1236  CSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF-------TN  1078
               GW+ TQI+H+S++  +  ++  ++   + R AFT+VA++ ++   + +        + 
Sbjct  120   QFGWAATQIAHLSLIPELVTSDHEKVELTALRYAFTVVANITVFGAAWLLLHLQGSSSSG  179

Query  1077  NAEDIKTQ----------YRWMAfisifiggvfviiFHLGVKE---PRKKDDDGHEKIGS  937
              A+D+             +R ++ + + +G VF ++FHLG +E   PR ++ D H  + +
Sbjct  180   PAQDVSVGDQLGVQDVPVFRNLSLMVVGVGAVFSLLFHLGTREGRRPRGEEPDEHSPLVA  239

Query  936   NTP-----WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAI  772
               P     W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L + +   + +P +
Sbjct  240   PRPQPLLLWKHWLQEPAFYQVGVLYMTTRLIVNLSQTYMAMYLTYSLHLPKRFIATIPLV  299

Query  771   IYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGI  592
             +YL  F++S L++ +     R   +FA  G+L +L  A  + L   +   +Y  +VL+G 
Sbjct  300   MYLSGFLSSFLMKPVNKCIGRNLTYFA--GLLVVLVFAAWVALVDTLGVAVYVAAVLLGA  357

Query  591   ANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVAC  421
               A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  ++S        C
Sbjct  358   GCATILVTSLAMTADLIGPHTHSGAFVYGAMSFSDKVANGLAVMVVQSLHPCPSELC  414



>ref|NP_001102200.1| major facilitator superfamily domain-containing protein 12 [Rattus 
norvegicus]
 gb|EDL89156.1| rCG29238 [Rattus norvegicus]
Length=476

 Score =   166 bits (420),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 128/425 (30%), Positives = 219/425 (52%), Gaps = 38/425 (9%)
 Frame = -2

Query  1599  EEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFT  1423
               + L   + L++ VGH LND+    W+TYLLL+L  + G S   A ++ L+GQ AD   
Sbjct  12    PPRSLSLAARLSFAVGHFLNDLCAGMWFTYLLLFLHSVRGYSSRGAGLLLLLGQVADGLC  71

Query  1422  TIIAGELIDRF-----GQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQTVG  1261
             T + G   DR      G  K WH AG + V +SF  +F     PC   G  +P     + 
Sbjct  72    TPLVGYEADRAACVRCGPRKAWHLAGTVCVLLSFPFIFS----PCLGCGEATPEWAALLY  127

Query  1260  YCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF-  1084
             Y    V+F  GW+ TQI+H+S++  +T ++  ++   + R AFT+VA++ +Y   + +  
Sbjct  128   YGPFIVIFQFGWAATQIAHLSLIPELTTSDHEKVELTALRYAFTVVANITVYGAAWLLLH  187

Query  1083  ----TNNAEDIK----------TQYRWMAfisifiggvfviiFHLGVKEPRKK-----DD  961
                  +  ++I           + +R +A + + +G VF ++FHLG KE R+      + 
Sbjct  188   LQGSAHGGQNISVGDQLGVQDVSVFRNLALLVVGVGAVFSLLFHLGTKESRRPQHQGIEP  247

Query  960   DGHEKIGSNTP-----WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQS  796
             D H  + +  P     W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L + + 
Sbjct  248   DEHSPLVAPVPQSLLLWKHWLQEPAFYQVGLLYMTTRLIVNLSQTYIAMYLTYSLSLPKK  307

Query  795   AKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMY  616
               + +P ++YL  F +S L++ +     R   +F   G+L +L  A  + L   +   +Y
Sbjct  308   FIATIPLVMYLSGFFSSFLMKPINRRIGRNMTYFT--GLLVILAFAAWVALADNLGVAVY  365

Query  615   ALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDA  436
               ++L+G   A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  ++S    
Sbjct  366   GAALLLGAGCATILVTSLAMTADLIGPHTHSGAFVYGAMSFSDKVANGLAVMAVQSLHPC  425

Query  435   DPVAC  421
                 C
Sbjct  426   PSELC  430



>ref|XP_007176610.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X3 [Balaenoptera acutorostrata scammoni]
Length=478

 Score =   166 bits (420),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 136/430 (32%), Positives = 225/430 (52%), Gaps = 37/430 (9%)
 Frame = -2

Query  1593  KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTI  1417
             +PL   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   T 
Sbjct  15    RPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLCTP  74

Query  1416  IAGELIDR-------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGY  1258
             + G   DR       FG  K WH  G I V +SF  +F   C+ C+   S    V  + Y
Sbjct  75    LVGFEADRAAGRCARFGPRKAWHLVGTICVLLSFPFIFS-PCLGCQ--ASTPEWVALLYY  131

Query  1257  CISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF--  1084
                 V+F  GW+ TQI+H+S++  +  N+  ++   + R AFT+VAS+ +Y   + +   
Sbjct  132   GPFIVIFQFGWAATQIAHLSLIPELVTNDHEKVELTALRYAFTVVASITVYGAAWLLLHL  191

Query  1083  -----TNNAEDIKTQ--------YRWMAfisifiggvfviiFHLGVKEPRKK---DDDGH  952
                    + +D+  Q        +R ++ + + IG VF ++FHLG +E R++   + D H
Sbjct  192   QGSPHMGSTQDVYDQLGVQDVPVFRNLSLLVVGIGAVFSLLFHLGTREGRRRQVEEPDEH  251

Query  951   EKI---GSNTP---WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAK  790
               +    +  P   W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L + +   
Sbjct  252   SPLLAPATARPLLLWKHWLREPAFYQVGLLYMSTRLIVNLSQTYMAMYLTYSLNLPKKFI  311

Query  789   SLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYAL  610
             + +P ++YL  F++S LL+ +     R   +F   G+L +L  A  + L  ++   +Y +
Sbjct  312   ATIPLVMYLSGFLSSFLLKPVNKCIGRNMTYFV--GLLVILAFAAWVALADELGVAVYVV  369

Query  609   SVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP  430
             +VL+G   A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  ++S      
Sbjct  370   AVLLGTGCATILVTSLAMTADLIGPHTHSGAFVYGAMSFSDKVANGLAVMAIQSLHPCSS  429

Query  429   VACNPAQACF  400
               C  A   F
Sbjct  430   ELCCKACVAF  439



>ref|XP_007460404.1| PREDICTED: LOW QUALITY PROTEIN: major facilitator superfamily 
domain-containing protein 12 [Lipotes vexillifer]
Length=499

 Score =   166 bits (421),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 140/457 (31%), Positives = 238/457 (52%), Gaps = 44/457 (10%)
 Frame = -2

Query  1593  KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTI  1417
             +PL   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   T 
Sbjct  15    RPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLCTP  74

Query  1416  IAGELIDR-------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGY  1258
             + G   DR       FG  K WH  G I V +SF  +F   C+ CK   +    V  + Y
Sbjct  75    LVGFEADRAAGRCASFGPRKAWHLVGTICVLLSFPFIFS-PCLGCK--ATTPEWVALLYY  131

Query  1257  CISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF--  1084
                 V+F  GW+ TQI+H+S++  +  N+  ++   + R AFT+VAS+ +Y   + +   
Sbjct  132   GPFIVIFQFGWAATQIAHLSLIPELVTNDHEKVELTALRYAFTVVASITVYGAAWLLLHL  191

Query  1083  -----TNNAEDIKTQ--------YRWMAfisifiggvfviiFHLGVKEPRKK---DDDGH  952
                    + +D+  Q        +R ++ + + +G VF ++F LG +E R++   + D H
Sbjct  192   QGSPHMGSTQDVYDQLGVQDVPVFRNLSLLVVGVGAVFSLLFQLGTREGRRRQVEEPDEH  251

Query  951   EKI---GSNTP---WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAK  790
               +    +  P   W +WL+   +YQV  +Y+ TR++ N+SQT++A Y+   L + +   
Sbjct  252   SPLLAPATARPLLLWKHWLREPAFYQVGLLYMSTRLIVNLSQTYMATYLTYSLNLPKKFI  311

Query  789   SLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYAL  610
             + +P ++YL  F++S LL+ +     R   +F   G+L +L  A  + L  ++   +Y +
Sbjct  312   ATIPLVMYLSGFLSSFLLKPVNKRIGRNMTYFV--GLLVILAFAAWVALADELGVAVYVV  369

Query  609   SVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP  430
             +VL+G+  A ++VTS+ M + L+  H    AFVYG+M F+DKV  G+A+  ++S      
Sbjct  370   AVLLGMGCATILVTSLAMTADLIGPHTHSGAFVYGAMSFLDKVANGLAVMAIQSLHPCSS  429

Query  429   VACNPAQACFSVTRFSLGFIPGIAALFGVIVSFTMKL  319
               C   +AC +   + +     +A   GV V+ T+ L
Sbjct  430   ELC--CKACVAFYHWVM-----VAVTGGVGVAATLAL  459



>ref|XP_007176608.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X1 [Balaenoptera acutorostrata scammoni]
Length=499

 Score =   166 bits (420),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 142/457 (31%), Positives = 238/457 (52%), Gaps = 44/457 (10%)
 Frame = -2

Query  1593  KPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTI  1417
             +PL   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   T 
Sbjct  15    RPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLCTP  74

Query  1416  IAGELIDR-------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGY  1258
             + G   DR       FG  K WH  G I V +SF  +F   C+ C+   S    V  + Y
Sbjct  75    LVGFEADRAAGRCARFGPRKAWHLVGTICVLLSFPFIFS-PCLGCQ--ASTPEWVALLYY  131

Query  1257  CISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF--  1084
                 V+F  GW+ TQI+H+S++  +  N+  ++   + R AFT+VAS+ +Y   + +   
Sbjct  132   GPFIVIFQFGWAATQIAHLSLIPELVTNDHEKVELTALRYAFTVVASITVYGAAWLLLHL  191

Query  1083  -----TNNAEDIKTQ--------YRWMAfisifiggvfviiFHLGVKEPRKK---DDDGH  952
                    + +D+  Q        +R ++ + + IG VF ++FHLG +E R++   + D H
Sbjct  192   QGSPHMGSTQDVYDQLGVQDVPVFRNLSLLVVGIGAVFSLLFHLGTREGRRRQVEEPDEH  251

Query  951   EKI---GSNTP---WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAK  790
               +    +  P   W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L + +   
Sbjct  252   SPLLAPATARPLLLWKHWLREPAFYQVGLLYMSTRLIVNLSQTYMAMYLTYSLNLPKKFI  311

Query  789   SLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYAL  610
             + +P ++YL  F++S LL+ +     R   +F   G+L +L  A  + L  ++   +Y +
Sbjct  312   ATIPLVMYLSGFLSSFLLKPVNKCIGRNMTYFV--GLLVILAFAAWVALADELGVAVYVV  369

Query  609   SVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADP  430
             +VL+G   A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  ++S      
Sbjct  370   AVLLGTGCATILVTSLAMTADLIGPHTHSGAFVYGAMSFSDKVANGLAVMAIQSLHPCSS  429

Query  429   VACNPAQACFSVTRFSLGFIPGIAALFGVIVSFTMKL  319
               C   +AC +   + +     +A   GV V+ T+ L
Sbjct  430   ELC--CKACVAFYHWVM-----VAVTGGVGVAATLAL  459



>ref|XP_004615067.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Sorex araneus]
Length=471

 Score =   166 bits (419),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 131/425 (31%), Positives = 220/425 (52%), Gaps = 45/425 (11%)
 Frame = -2

Query  1599  EEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFT  1423
             E   L   + L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   
Sbjct  2     EPGALSLWARLSYAVGHFLNDLCASMWFTYLLLYLDSVRAYSSRGAGLLLLLGQVADGLC  61

Query  1422  TIIAGELIDR-------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTV  1264
             T + G   DR       +G  K WH  G + V +SF  +F     PC   G  +P    +
Sbjct  62    TTLVGFEADRAAGRCARYGPRKAWHLVGTVCVLLSFPFIFS----PCLGCGPATPEWAAL  117

Query  1263  GYCIS-AVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV  1087
              Y     V+F  GW+ TQI+H+S++  +  ++  ++   + R AFT+VA++ +YA  + +
Sbjct  118   FYYGPFIVIFQFGWAATQIAHLSLIPELVTSDHEKVELTALRYAFTVVANITVYATQWLL  177

Query  1086  F-------TNNAEDIKTQ--------YRWMAfisifiggvfviiFHLGVKEPRKKDDDG-  955
                     +  A D   Q        +R ++ + + +G VF ++FHLG +E R+   D  
Sbjct  178   LHFQGPVPSGAAPDASDQLGPQDAPAFRNLSLLVVGVGAVFSLLFHLGTREGRRPPPDAV  237

Query  954   HEKIGSNTP------------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDL  811
              E+ G ++P            W +WL+   +YQV+ +Y+ TR+V N+SQ +L +Y+   L
Sbjct  238   PEEPGEHSPLLAPTQARPLMLWKHWLREPAFYQVSFLYMNTRLVVNLSQIYLGLYLTYTL  297

Query  810   RMSQSAKSLVPAIIYLCSFITSVLLQEL-EWSGKRLKIFFAGGGILWLLCGAVVMLLPIK  634
              + +   + +P ++YL  F +S L++ + +  G+ L  F    G+L +L  A  + L   
Sbjct  298   NLPKKFTATIPLVMYLSGFFSSFLMKPVNKHMGRNLTYFI---GLLLVLTFASWVALADV  354

Query  633   MNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFL  454
                 +YA++VL+G   A +++TS+ M + L+  H    AFVYG+M F DKV  G+A+  +
Sbjct  355   QGVAVYAVAVLLGSGCATILITSLAMTADLIGPHTHSGAFVYGAMSFSDKVANGLAVMVI  414

Query  453   ESFED  439
             +S + 
Sbjct  415   QSLQP  419



>ref|XP_003760775.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Sarcophilus harrisii]
Length=486

 Score =   166 bits (419),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 126/411 (31%), Positives = 216/411 (53%), Gaps = 44/411 (11%)
 Frame = -2

Query  1569  LTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTIIAGELIDR  1393
             L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   T + G   DR
Sbjct  11    LSYAVGHFLNDLCASMWFTYLLLYLHSVQSYSSWGAGVLLLLGQLADGVCTPLVGYEADR  70

Query  1392  -------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQTVGYCISAVVF  1237
                    +G  K WH  G I V +SF  +F     PC    + +P     V Y    V+F
Sbjct  71    SGGCCGRYGPRKSWHLVGTICVLLSFPFIFN----PCLGCTAATPEWAALVYYAPFIVIF  126

Query  1236  CSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFV--FTNNAEDI  1063
               GW+ TQISH+S++  +  N+  ++   + R AFT+VA++ +Y   + +  F  +  ++
Sbjct  127   QFGWAATQISHLSLIPELVTNDHEKVELTAFRYAFTVVANIAVYGAAWLLLHFQGSHSEV  186

Query  1062  KTQ-------------YRWMAfisifiggvfviiFHLGVKE-PRKKDDDGHEKIGSNTP-  928
                             +R ++ + + +G VF ++FHLG KE PR++   G E+   ++P 
Sbjct  187   PDSGPGDQLGLQDVPVFRNLSLMVVGVGAVFSLLFHLGTKEHPRQRQ--GLEEPSEHSPL  244

Query  927   ----------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVP  778
                       W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L++ +   + +P
Sbjct  245   LPPASRPMLLWKHWLREPSFYQVGMLYMSTRLIVNLSQTYMAMYLTYSLKLPKKFIATIP  304

Query  777   AIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLI  598
              ++Y+  F +S  ++ +     R   +F   G+L +L  A  + L   +   +Y  +VL+
Sbjct  305   LVMYISGFFSSFFMKSVNKCIGRNLTYFV--GLLVILAFASWVALVNLLGVAVYGAAVLL  362

Query  597   GIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESF  445
             G+ +A ++V S+ M + L+  H +  AFVYG+M F DKV  G+A+  ++S 
Sbjct  363   GVGSATILVMSLSMTADLIGSHTNSGAFVYGAMSFSDKVANGLAVMVIQSL  413



>ref|XP_005359045.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Microtus ochrogaster]
Length=476

 Score =   165 bits (418),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 131/425 (31%), Positives = 219/425 (52%), Gaps = 38/425 (9%)
 Frame = -2

Query  1599  EEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFT  1423
               + L   + L++ VGH LND+    W+TYLLL+L  + G S   A ++ L+GQ AD   
Sbjct  12    PPRTLSPAARLSFAVGHFLNDLCAGMWFTYLLLFLHSVRGYSSRGAGLLLLLGQAADGLC  71

Query  1422  TIIAGELIDRF-----GQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQTVG  1261
             T + G   DR      G  K WH AG + V +SF  +F     PC   G  +P     + 
Sbjct  72    TPLVGYEADRAACARCGPRKAWHLAGTVCVLLSFPFIFS----PCLGCGEATPEWAALLY  127

Query  1260  YCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF-  1084
             Y    V+F  GW+ TQI+H+S++  +  +E  ++   + R AFT+VA++ +Y   + +  
Sbjct  128   YAPFIVIFQFGWAATQIAHLSLIPELVTSEHEKVELTALRYAFTVVANITVYGAAWLLLH  187

Query  1083  ----TNNAEDIKTQ----------YRWMAfisifiggvfviiFHLGVKE-----PRKKDD  961
                  +  +DI             +R +A + + +G +F ++FHLG KE     PR+ + 
Sbjct  188   LQGSAHGEQDISVGDQLGVQDVPVFRNLALLVVGVGAIFSLLFHLGTKEGRQPRPREIEP  247

Query  960   DGHEKIGSNTP-----WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQS  796
             D H  + + T      W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L + + 
Sbjct  248   DEHSPLVAPTARPLLLWKHWLREPAFYQVGMLYMTTRLIVNLSQTYIAMYLTYSLSLPKK  307

Query  795   AKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMY  616
               + +P ++YL  F +S L++ +     R   +F   G+L +L  A  + L  K+   +Y
Sbjct  308   FIATIPLVMYLSGFFSSFLMKPVNRRIGRNMTYFT--GLLVILAFAAWVALVDKLGVAVY  365

Query  615   ALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDA  436
               +VL+G   A ++VTS+ M + L+  H    AFVYG+M F DKV  G+A+  ++S    
Sbjct  366   GAAVLLGAGCATILVTSLAMTADLIGPHTHSGAFVYGAMSFSDKVANGLAVMAVQSLHPC  425

Query  435   DPVAC  421
                 C
Sbjct  426   PSELC  430



>ref|XP_004714442.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Echinops telfairi]
Length=477

 Score =   165 bits (417),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 129/420 (31%), Positives = 218/420 (52%), Gaps = 45/420 (11%)
 Frame = -2

Query  1569  LTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTIIAGELIDR  1393
             L+Y VGH LND+    W+TYLLLYL  +   S   A ++ L+GQ AD   T + G   DR
Sbjct  22    LSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLCTPLVGYEADR  81

Query  1392  F------GQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQTVGYCISAVVFC  1234
                    G  K WH  G I V +SF  +F     PC    + +P     + Y    V+F 
Sbjct  82    AAGCVRCGPRKAWHLVGTICVLLSFPFIFS----PCPGCAASTPEWAALLYYSPFIVIFQ  137

Query  1233  SGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFF-------VFTNN  1075
              GW+ TQI+H+S++  +  N+  ++   + R AFT+VA++ +Y   +        +   +
Sbjct  138   FGWAATQIAHLSLIPELVSNDHEKVELTALRYAFTVVANITVYGAAWLLLHLQGSIHARS  197

Query  1074  AEDIKTQ--------YRWMAfisifiggvfviiFHLGVKEPRKKDDDGH----EKIGSNT  931
              ++   Q        +R ++ + + IG +F ++FHLG +E  +   +GH    E+    +
Sbjct  198   NQEFSDQLGVQDVPVFRNLSLLVVGIGAIFSLLFHLGTRERPRPRLEGHQPQPEEPNEQS  257

Query  930   P-----------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSL  784
             P           W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+   L + +   + 
Sbjct  258   PLLTPTARPVLLWKHWLREPAFYQVGLLYMSTRLIVNLSQTYIAMYLTYSLNLPKRFIAT  317

Query  783   VPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSV  604
             +P ++Y+  F +S L++ +  +  R   +FA  G+L +L  A  + L   M   +YA++V
Sbjct  318   IPLVMYVSGFASSFLMKPVNRAIGRNLTYFA--GLLVILAFAAWVALASGMGMTVYAVAV  375

Query  603   LIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFED-ADPV  427
             L+G   A +++TS+ M + L+  H    AFVYG+M F DKV  G+A+  ++S    A PV
Sbjct  376   LLGAGCATILITSLAMTADLIGPHTHSGAFVYGAMSFSDKVSNGLAVMAIQSLSPCASPV  435



>dbj|BAE32913.1| unnamed protein product [Mus musculus]
Length=476

 Score =   165 bits (417),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 129/432 (30%), Positives = 217/432 (50%), Gaps = 40/432 (9%)
 Frame = -2

Query  1617  DNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQ  1441
             D+      + L   + L++ VGH LND+    W+TYLLL+L  + G S   A ++ L+GQ
Sbjct  6     DDAGPGPPRTLSLAARLSFAVGHFLNDLCAGMWFTYLLLFLHSVRGYSSRGAGLLLLLGQ  65

Query  1440  FADAFTTIIAGELIDRF-----GQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT  1276
              AD   T + G   DR      G  K WH AG + V +SF  +F     PC   G  +P 
Sbjct  66    VADGLCTPLVGYEADRASCVRCGPRKAWHLAGTVCVLLSFPFIFS----PCLGCGEATPE  121

Query  1275  -VQTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAV  1099
                 + Y    VVF  GW+ TQI+H+S++  +  ++  ++   + R AFT+VA++ +Y  
Sbjct  122   WAALLYYGPFIVVFQFGWAATQIAHLSLIPELVTSDHEKVELTALRYAFTVVANITVYGA  181

Query  1098  TFFVF-----TNNAEDIKTQ----------YRWMAfisifiggvfviiFHLGVKEPRKKD  964
              + +       +  +DI             +R +A + + +G +F ++FHLG KE  +  
Sbjct  182   AWLLLHLQGSAHGEQDISVGDQLGVQDVPVFRNLALLVVGVGAIFSLLFHLGTKEGHRSQ  241

Query  963   DDGHEKIGSNTP-----------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVIN  817
               G+E    +TP           W +WL+   +YQV  +Y+ TR++ N+SQT++A+Y+  
Sbjct  242   HWGNEP-NEHTPLVAPAAQPLLLWKHWLREPAFYQVGMLYMTTRLIVNLSQTYIAMYLTY  300

Query  816   DLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGAVVMLLPI  637
              L + +   + +P ++YL  F +S L++ +     R   +F   G+L +L  A  + L  
Sbjct  301   SLSLPKKFIATIPLVMYLSGFFSSFLMKPVNRRIGRNMTYFT--GLLVILAFAAWVALAD  358

Query  636   KMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYF  457
              +   +Y  +VL+G   A ++VTS+ M + L+  H    AF YG+M F DKV  G+A+  
Sbjct  359   NLGVAVYGAAVLLGAGCATILVTSLAMTADLIGPHTHSGAFAYGAMSFSDKVANGLAVMA  418

Query  456   LESFEDADPVAC  421
             ++S        C
Sbjct  419   VQSLHPCPSELC  430



>gb|KDR13311.1| putative MFS-type transporter C19orf28 [Zootermopsis nevadensis]
Length=484

 Score =   164 bits (416),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 147/457 (32%), Positives = 235/457 (51%), Gaps = 45/457 (10%)
 Frame = -2

Query  1569  LTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTIIAGELIDR  1393
             L YG+GH+LNDI    W+TYLL++   +       + +V LVGQ ADA  T   G   DR
Sbjct  21    LAYGIGHVLNDICASMWFTYLLVFFHLVLKFDSFLSGVVLLVGQVADAVATPFIGLQSDR  80

Query  1392  --------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAVVF  1237
                     +G+ K WH  G I V  SF  +F   C+ C+  GS     Q V Y    ++F
Sbjct  81    DDDFWLCKYGRRKTWHLLGTICVLGSFPFIFS-PCLNCE--GSHQ-MAQLVYYSAFIIIF  136

Query  1236  CSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF----TNNAE  1069
               GW+  QISH+SM+  +T +E  R    + R +FT+ +++++Y +T+ V      N+A+
Sbjct  137   QFGWASVQISHLSMIPDLTPSEHERTELTAIRYSFTVCSNVLVYLITWLVLHIGSENDAQ  196

Query  1068  ----DIKTQYRWMAfisifiggvfviiFHLGVKEPRKKDDDGHEKI-GSNTPWTYWLKRV  904
                 DI  +++ +  I I IG +    FHL V E       GH ++ G        LK V
Sbjct  197   IGPGDIG-KFQHIVLIGIGIGALTSSAFHLLVSEGSAP---GHVRLAGQRKSAGSLLKDV  252

Query  903   LYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELE  724
               YQVA +Y+ TR+  N+SQ ++ +Y+   L M   + ++VP +++L SF  S+L+  L 
Sbjct  253   QLYQVALVYMSTRLFANLSQVYIPLYLHESLSMGAESLAVVPLVMFLSSFAMSLLVNVLN  312

Query  723   WSGKRLKIFFAGGGIL------WLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSI  562
                 R K+ F  GGIL      W+  G+ V          +Y +++L+G  +++M+VTS+
Sbjct  313   KKCGR-KLAFLVGGILGISACVWIHFGSGVFYTKYG----IYLVAILLGAGSSVMLVTSL  367

Query  561   GMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRFS  382
             G+ + L+  +++  AFVYG+M F+DK+  GVA+  +   +D      +P        R  
Sbjct  368   GITADLIGPNIESGAFVYGTMSFMDKLSNGVAVTVI---QDLKSTTLSP-----DYYRDV  419

Query  381   LGFIPGIAALFGVIVSFTMKLLHTSHKKQPLAEPLLA  271
             L  + G AA+FG++V  T+       K+    EP+ A
Sbjct  420   LMSVCGGAAIFGLVVLATLAPFQIGTKRTADGEPVYA  456



>ref|XP_004948759.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 isoform X7 [Gallus gallus]
Length=556

 Score =   166 bits (419),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 133/423 (31%), Positives = 225/423 (53%), Gaps = 40/423 (9%)
 Frame = -2

Query  1569  LTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTIIAGELIDR  1393
             L++  GH LND+    W+TYLLLYL  + G S   A  + L GQ AD   T + G   DR
Sbjct  16    LSFAAGHFLNDLCASLWFTYLLLYLHAVLGYSHGLAGGLLLAGQVADGLCTPLLGYEADR  75

Query  1392  ------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCIS-AVVFC  1234
                   +G+ K WH AG   V +SF  +F   C+ CK     +P      Y +   V+F 
Sbjct  76    SAGCGRYGRRKSWHLAGTTCVLISFPFIFN-PCLGCK---EGTPQWAAFIYYLPFIVIFQ  131

Query  1233  SGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFT------NNA  1072
              GW+ TQISH+S++  +  ++  ++   + R AFT++A++ +Y + + +           
Sbjct  132   FGWAATQISHLSLIPELVTSDHEKVELTAFRYAFTVMANITVYGLAWLLLNLQVDQPERT  191

Query  1071  EDIKTQ----YRWMAfisifiggvfviiFHLGVKE--------PRKKDDDGH-EKIGSNT  931
             E +  Q    +R ++ I + +G +F + FHLG KE        P+ K+     +K  + +
Sbjct  192   EHLGFQDVPVFRNLSLIVVGLGALFSLFFHLGTKEKLYPLGSVPQPKESTPLLQKEPTRS  251

Query  930   P-----WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIY  766
             P     W  WL    +YQVA +Y+ TR++ N+SQT++A+Y+ N L + +   + +P ++Y
Sbjct  252   PRSLLVWKDWLLEPSFYQVAVLYMATRLIVNLSQTYIAMYLTNSLLLPKKYIATIPLVMY  311

Query  765   LCSFITSVLLQEL-EWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIA  589
             +  F++S L++ + +W G+ L  F    GIL +L  A  + L  +M + +Y ++VL+G  
Sbjct  312   ISGFLSSFLMKPVNKWIGRNLTYFV---GILVILAFASWVSLSREMGAEIYGVAVLLGAG  368

Query  588   NALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQ  409
             +A ++VTS+ M + L+  +   SAFVYG+M F DK+  G+A+  +++        C PA 
Sbjct  369   SATILVTSLSMTADLIGTNTHSSAFVYGAMSFTDKMANGLAVMLIQNLHPCPTELCCPAC  428

Query  408   ACF  400
               F
Sbjct  429   VSF  431



>gb|ELU08281.1| hypothetical protein CAPTEDRAFT_96409 [Capitella teleta]
Length=484

 Score =   164 bits (415),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 143/487 (29%), Positives = 250/487 (51%), Gaps = 53/487 (11%)
 Frame = -2

Query  1599  EEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFT  1423
             + + L R    T+ VGH+LND+    W++YLLL+L ++   S   A  + L+GQ  DA  
Sbjct  2     DVQRLSRTQKATFSVGHVLNDLCASMWFSYLLLFLHNVLQFSNVFAGYLMLLGQVVDALC  61

Query  1422  TIIAGELIDR------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPT-VQTV  1264
             T   G   DR      +G+ K WH  G   V  SF  +F   CI C    +DS    + V
Sbjct  62    TPFVGYESDRTPGCGNYGKRKTWHLIGSACVACSFPFVFM-QCITC----ADSDDWAKFV  116

Query  1263  GYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVF  1084
              Y    V+F  GW+ TQISH+S++  +T  +SSR+   S R A T+V+S+ +YA+   +F
Sbjct  117   YYAPFVVIFQFGWASTQISHLSLIPDLTACQSSRVELNSSRYAMTVVSSIAVYAIAAGIF  176

Query  1083  --TNNAEDIKTQ----YRWMAfisifiggvfviiFHLGVKEPRK-------------KDD  961
               + ++  +  Q    +R +A I + +GG+F ++FH+G KE  +             KD 
Sbjct  177   GPSRDSSALGPQDLDSFRTLALIVVGMGGLFSLVFHVGTKENARQTFPSAVIAAGINKDA  236

Query  960   DGHEKIGSNTP------WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQ  799
                 ++   TP      W  WLK++ +YQ+A IY+ TR++ NVSQ ++ +Y+++ L++ +
Sbjct  237   SDSTEVSVVTPQFKFMEWRDWLKQMQFYQIAGIYMCTRLIVNVSQIYIPMYLVHSLQLDK  296

Query  798   SAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWL--LCGAVVMLLPIKMNS  625
                ++VP  +++  F+ S+ ++       R   +F G  ++++  +C   +  L   + +
Sbjct  297   VFIAIVPLAVFVSGFMMSIAMKFTNRVLGRKGSYFLGLCLVFVSCVCFWCLQYLSAHLET  356

Query  624   FM-YALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLES  448
              + +  ++L+G   + ++VTS+ M + L+ +H    AFVYG+M F DK+  G+A+  ++ 
Sbjct  357   ILVFGPAILLGAGGSTILVTSLSMTADLIGEHTYSGAFVYGAMSFTDKLSNGIAVVLIQH  416

Query  447   FE--DADPVACNPAQACFSVTRFSLGFIPGIAALFGVIVSFTM------KLLHTSHKKQP  292
             F     D   C    AC    R ++ FIPG  A+    +  ++      +L H S  ++ 
Sbjct  417   FHPCKTDGPCC---AACVWYYRDAMVFIPGGIAILTCFILLSLLPQNIGRLTH-SQDEED  472

Query  291   LAEPLLA  271
                PLL 
Sbjct  473   ERRPLLG  479



>ref|XP_009562409.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Cuculus canorus]
Length=475

 Score =   164 bits (415),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 131/424 (31%), Positives = 222/424 (52%), Gaps = 44/424 (10%)
 Frame = -2

Query  1569  LTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTIIAGELIDR  1393
             L++  GH LND+    W+TYLLLYL  + G     A  + L GQ AD   T + G   DR
Sbjct  21    LSFAAGHFLNDLCASLWFTYLLLYLHAVLGYGHRLAGALLLAGQAADGLCTPLLGYETDR  80

Query  1392  ------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCISAV-VFC  1234
                   +G+ K WH AG   V +SF  +F   C+ CK    ++P      Y +  + +F 
Sbjct  81    SAGCGRYGRRKSWHLAGTTCVLISFPFIFN-PCLGCK---ENTPQWAAFVYYLPFILIFQ  136

Query  1233  SGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFTNNAEDIKTQ  1054
              GW+ TQISH+S++  +  ++  ++   + R AFT++A++ +Y +  F            
Sbjct  137   FGWAATQISHLSLIPELVSSDHEKVELTAFRYAFTVMANITVYGLPIF------------  184

Query  1053  YRWMAfisifiggvfviiFHLGVKE-------PRKKDDDGHEKIGSNTP------WTYWL  913
              R ++ I + +G VF +IFHLG KE       P+ +++    +    +P      W  WL
Sbjct  185   -RDLSLIVVGVGAVFSLIFHLGTKEKPYAGSLPQPEENMSLLQKEPTSPAHPLLIWKDWL  243

Query  912   KRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQ  733
                 +YQVA +Y+ TR++ N+SQT++A+Y+ N L + +   + +P ++Y+  F++S L++
Sbjct  244   LEPAFYQVAVLYMSTRLIVNLSQTYIAMYLTNSLLLPKKYIATIPLVMYVSGFLSSFLMK  303

Query  732   EL-EWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIANALMMVTSIGM  556
                +W G+ L       GIL +L  A  + L  +M + +Y  +VL+G  +A ++VTS+ M
Sbjct  304   PANKWIGRNLTYSV---GILVVLAFASWVTLAREMGAEIYGAAVLLGAGSATILVTSLSM  360

Query  555   ESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQACFSVTRFSLG  376
              + L+  +   SAFVYG+M F DK+  G+A+  +++        C P  AC S   + + 
Sbjct  361   TADLIGTNTHSSAFVYGAMSFTDKMANGLAVMVIQNLHPCPTELCCP--ACISFYHWVMV  418

Query  375   FIPG  364
              + G
Sbjct  419   LVTG  422



>ref|XP_007524968.1| PREDICTED: major facilitator superfamily domain-containing protein 
12 [Erinaceus europaeus]
Length=476

 Score =   164 bits (415),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 133/433 (31%), Positives = 216/433 (50%), Gaps = 46/433 (11%)
 Frame = -2

Query  1626  MGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTL  1450
             MG          P  R   L++ VGH LND+    W+TYLLLYL  +   S   A ++ L
Sbjct  1     MGPGPGAGRALSPWAR---LSFAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLL  57

Query  1449  VGQFADAFTTIIAGELIDR------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGS  1288
             +GQ AD   T + G   DR      +G  K WH  G I V +SF  +F     PC     
Sbjct  58    LGQVADGLCTPLVGVEADRTAACVRYGPRKAWHLVGTICVLLSFPFIFS----PCLGCSD  113

Query  1287  DSPT-VQTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLM  1111
              +P     + Y    VVF  GW+ TQI+H+S++  +  NE  ++   + R AFT+VA++ 
Sbjct  114   TTPEWAAMLYYSPFIVVFQFGWAATQIAHLSLIPVLVTNEHEKVELTALRYAFTVVANIT  173

Query  1110  LYAVTFFVF-------TNNAEDIKTQ--------YRWMAfisifiggvfviiFHLGVKEP  976
             +Y   + +             D++ Q        +R +A + + +G  F  IFHLG +E 
Sbjct  174   VYGAAWLLLHLQVSPQVGAPPDLRDQLGVQDVPVFRNLALLVVGLGAFFSFIFHLGTREG  233

Query  975   RKKD--------DDGHEKI---GSNTP---WTYWLKRVLYYQVASIYVFTRVVTNVSQTF  838
             R+          +D H  +   G   P   W  WL++  +YQV  +Y+ TR++ N+SQT+
Sbjct  234   RRPPGTGSELPAEDEHSPLLAPGVARPLLLWKDWLRQPAFYQVGILYMSTRLIVNLSQTY  293

Query  837   LAVYVINDLRMSQSAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGILWLLCGA  658
             +A+Y+   L + +   + +P ++Y+  F +S L++ +     R   +F+G  +L +L  A
Sbjct  294   MAMYLTYSLSLPKKFIATIPLVMYVSGFASSFLMKPVNRCLGRNLTYFSG--LLVVLAFA  351

Query  657   VVMLLPIKMNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVL  478
               + L   +   +YA +VL+G+  A ++VTS+ M + L+  H    AFVYG+M F DKV 
Sbjct  352   AWVALADALGPAVYAAAVLLGVGCATILVTSLAMTADLIGPHTHSGAFVYGAMSFSDKVA  411

Query  477   CGVALYFLESFED  439
              G+A+  ++S   
Sbjct  412   NGLAVMAIQSLHP  424



>ref|XP_001605086.1| PREDICTED: major facilitator superfamily domain-containing protein 
12-like [Nasonia vitripennis]
Length=480

 Score =   164 bits (415),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 138/462 (30%), Positives = 234/462 (51%), Gaps = 53/462 (11%)
 Frame = -2

Query  1620  RDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVG  1444
              DN++E +  PL   S L YGVGH+LND+    W+TYLL+Y   + G SP+ A +V L+G
Sbjct  9     NDNQQEIQRVPLK--SKLAYGVGHVLNDVCASMWFTYLLVYFHLVLGFSPAYAGVVLLIG  66

Query  1443  QFADAFTTIIAGELID--------RFGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGS  1288
             Q ADA  T   G   D        R+G+ K WH  G I V  +F  +F   CI C     
Sbjct  67    QVADAVATPFVGLHSDKNDDFWLCRYGRRKTWHLMGTICVVATFPFIFSH-CIGC-----  120

Query  1287  DSPTV----QTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVA  1120
              SP      Q + Y    ++F  GW+  QISH+S++  +T ++  R A  + R +FT+ +
Sbjct  121   -SPRTHQWAQLIYYAAFVIIFQFGWASVQISHLSLIPDLTPSDLERTALTAIRYSFTVFS  179

Query  1119  SLMLYAVTFFVFTNNAE--------DIKTQYRWMAfisifiggvfviiFHLGVKEPRKKD  964
             ++++Y VT+ V    +E        +   +++ +  I + IG +  IIFH+ V+E   +D
Sbjct  180   NVLVYCVTWAVLHITSESPTDKIGPNDAYKFQEIVLIGMSIGVLSSIIFHIFVRENNSRD  239

Query  963   -----DDGHEKIGSNTPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQ  799
                       +    TP++ + K    YQ+A IY+ TR+  N++QT++ +Y+   L+M  
Sbjct  240   ALTGVSQEQSQRELQTPFSIF-KDPELYQIACIYMPTRLFVNLTQTYIPLYLHETLQMPA  298

Query  798   SAKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGG-----GILWLLCGAVVMLLPIK  634
             ++ +++P I+YL SF  S+ +  +     R   +  G         W+  G     + + 
Sbjct  299   TSLAIIPLIMYLSSFKASLAINYINAKLGRKGSYLIGAVMGLSACTWIFFGKGEQFVSL-  357

Query  633   MNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFL  454
                F+Y +S+L+G   ++M+VTS+ + +  +    +  AFVYG M F DK+  G+A+  +
Sbjct  358   ---FIYPVSLLLGSGGSMMIVTSLAITADYIGHSTENGAFVYGVMSFTDKLSNGLAVMII  414

Query  453   ESFEDADPVACNPAQACFSVTRFSLGFIPGIAALFGVIVSFT  328
             +         C     C    +  L F+ G AA+FG+I++ +
Sbjct  415   QYMR------CT--TDCTDYYKQILSFVCGGAAVFGLIMTLS  448



>ref|XP_003213238.2| PREDICTED: major facilitator superfamily domain-containing protein 
12, partial [Meleagris gallopavo]
Length=483

 Score =   164 bits (414),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 135/423 (32%), Positives = 223/423 (53%), Gaps = 40/423 (9%)
 Frame = -2

Query  1569  LTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAIVTLVGQFADAFTTIIAGELIDR  1393
             L++  GH LND+    W+TYLLLYL  + G S   A  + L GQ AD   T + G   DR
Sbjct  5     LSFAAGHFLNDLCASLWFTYLLLYLHAVLGYSHGLAGGLLLAGQVADGLCTPLLGYEADR  64

Query  1392  ------FGQFKIWHGAGCIMVGVSFISLFGGTCIPCKILGSDSPTVQTVGYCIS-AVVFC  1234
                   +G+ K WH AG   V +SF  +F   C+ CK     +P      Y +   V+F 
Sbjct  65    SAGCGRYGRRKSWHLAGTTCVLISFPFIFN-PCLGCK---EGTPQWAAFIYYLPFIVIFQ  120

Query  1233  SGWSCTQISHMSMVNCITLNESSRIACVSCRNAFTMVASLMLYAVTFFVFT------NNA  1072
              GW+ TQISH+S++  +  ++  ++   + R AFT++A++ +Y + + +           
Sbjct  121   FGWAATQISHLSLIPELVTSDHEKVELTAFRYAFTVMANITVYGLAWLLLNLQVDQPERT  180

Query  1071  EDIKTQ----YRWMAfisifiggvfviiFHLGVKE---PRKKDDDGHE------KIGSNT  931
             E +  Q    +R ++ I + +G VF +IFHLG KE   P        E      K  + +
Sbjct  181   EHLGIQDVSVFRNLSLIVVGLGAVFSLIFHLGTKEKLYPLGSVSQPQESTPLLQKEPTRS  240

Query  930   P-----WTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQSAKSLVPAIIY  766
             P     W  WL    +YQVA +Y+ TR++ N+SQT++A+Y+ N L + +   + +P ++Y
Sbjct  241   PRSLLVWKDWLLEPSFYQVAVLYMATRLIVNLSQTYIAMYLTNSLLLPKKYIATIPLVMY  300

Query  765   LCSFITSVLLQEL-EWSGKRLKIFFAGGGILWLLCGAVVMLLPIKMNSFMYALSVLIGIA  589
             +  F++S L++ + +W G+ L  F    GIL +L  A  + L  +M + +Y ++VL+G  
Sbjct  301   ISGFLSSFLMKPVNKWIGRNLTYFV---GILVILAFASWVSLSREMGAEIYGVAVLLGAG  357

Query  588   NALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVALYFLESFEDADPVACNPAQ  409
             +A ++VTS+ M + L+  +   SAFVYG+M F DK+  G+A+  +++        C PA 
Sbjct  358   SATILVTSLSMTADLIGTNTHSSAFVYGAMSFTDKMANGLAVMLIQNLHPCPTELCCPAC  417

Query  408   ACF  400
               F
Sbjct  418   VSF  420



>ref|XP_003494067.1| PREDICTED: uncharacterized MFS-type transporter C19orf28 homolog 
[Bombus impatiens]
Length=488

 Score =   164 bits (415),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 143/472 (30%), Positives = 243/472 (51%), Gaps = 54/472 (11%)
 Frame = -2

Query  1635  RRIMGRDNREEEEEKPLGRCSVLTYGVGHMLNDITQCCWytylllylTDI-GLSPSSAAI  1459
              +I+  D  E  +  P  R   L YG+GH+LNDI    W+TYLL++   + G +  SA I
Sbjct  4     EQIVTDDYSEIIQRLPFSR--KLLYGIGHVLNDICASMWFTYLLVFFHLVLGFNSISAGI  61

Query  1458  VTLVGQFADAFTTIIAGELIDR--------FGQFKIWH--GAGCIMVGVSFISLFGGTCI  1309
             + L+GQ ADA  T   G   D+        +G+ K WH  G  CI+    FI      CI
Sbjct  62    ILLIGQVADALATPFVGFHSDKDDNFGLCKYGRRKTWHLIGTLCILFAFPFIF---SRCI  118

Query  1308  PCKILGSDSPTVQTVGYCISAVVFCSGWSCTQISHMSMVNCITLNESSRIACVSCRNAFT  1129
              C+   +     Q + Y    ++F  GW+  QISH+S+V  +T +E  R   ++ R +FT
Sbjct  119   GCE---TSHEWAQLIYYAAFVIIFQFGWAAVQISHLSLVPELTPSEYERTELIAIRYSFT  175

Query  1128  MVASLMLYAVTFFVF----TNNAE-----DIKTQYRWMAfisifiggvfviiFHLGVKEP  976
             +++++ +Y +T+ V     TN +      D   +++ + FI I +G V  I+FH  VKE 
Sbjct  176   VLSNIFVYCITWAVLHVTDTNASNSQIGPDDAKKFQEVVFIGIGVGAVTSILFHTFVKEN  235

Query  975   RKKDDDGHEKIGSNTPWTYWLKRVLYYQVASIYVFTRVVTNVSQTFLAVYVINDLRMSQS  796
                + DG     S T     LK V  YQVA IY+ TR+  N+SQ ++ +Y+   L M  +
Sbjct  236   FVNNSDGSLNRNSRTVLVL-LKDVQLYQVACIYMPTRLFVNLSQIYIPLYLHKSLNMPAT  294

Query  795   AKSLVPAIIYLCSFITSVLLQELEWSGKRLKIFFAGGGIL------WLLCGAVVMLLPIK  634
             + + +P I+YL SF+ S+++++L     R K+ +  G +L      W+  G  +     +
Sbjct  295   SLATIPLIMYLSSFVMSLIIEKLNTKLGR-KVSYCFGVLLGVFACIWIQLGTGLTYTKYQ  353

Query  633   MNSFMYALSVLIGIANALMMVTSIGMESALVDKHLDGSAFVYGSMGFIDKVLCGVA---L  463
                 +Y +S+++G A ++M+VTS+G+ +  + ++++  AFVYG M F DK+  G+A   +
Sbjct  354   ----IYPVSLILGSAGSIMLVTSLGVTADFIGQNVNSGAFVYGIMSFTDKLCNGLAVMLI  409

Query  462   YFLESFEDADPVACNPAQACFSVTRFSLGFIPGIAALFGVIVSFTMKLLHTS  307
              +L S+ D           C +  +  L ++   +A+ G+++   +K  H S
Sbjct  410   QYLSSWID-----------CKNYYKSVLVYVCATSAMVGLLMILCIKPFHHS  450



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4968245977748