BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19115_g1_i1 len=887 path=[545:0-356 20:357-886]

Length=887
                                                                      Score     E

ref|XP_011082761.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    244   7e-77   
ref|XP_007149389.1|  hypothetical protein PHAVU_005G066200g             238   1e-74   
ref|XP_006442502.1|  hypothetical protein CICLE_v10022456mg             237   4e-74   
ref|XP_009622401.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    237   5e-74   
ref|XP_007021735.1|  Uncharacterized protein TCM_031777                 236   5e-74   
ref|XP_009339946.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    235   1e-73   
ref|XP_003596364.1|  177 protein                                        235   1e-73   
ref|XP_006370148.1|  hypothetical protein POPTR_0001s40140g             235   2e-73   
ref|XP_004489028.1|  PREDICTED: uncharacterized protein LOC101497242    235   2e-73   
ref|XP_011013261.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    235   2e-73   
gb|KDP34762.1|  hypothetical protein JCGZ_10542                         235   2e-73   
ref|XP_009334040.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    234   3e-73   
ref|XP_008368001.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    234   3e-73   
ref|XP_011015901.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    234   5e-73   
gb|AFK47598.1|  unknown                                                 234   6e-73   
ref|XP_006592933.1|  PREDICTED: uncharacterized protein LOC100806...    234   6e-73   
ref|XP_002317458.1|  hypothetical protein POPTR_0011s11120g             233   7e-73   Populus trichocarpa [western balsam poplar]
ref|XP_004294145.1|  PREDICTED: uncharacterized protein LOC101307097    234   7e-73   
ref|XP_007212123.1|  hypothetical protein PRUPE_ppa012057mg             234   8e-73   
ref|XP_008226537.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    234   8e-73   
ref|NP_001237763.1|  uncharacterized protein LOC100527554               234   9e-73   
ref|XP_002530382.1|  conserved hypothetical protein                     234   1e-72   Ricinus communis
ref|XP_006360044.1|  PREDICTED: uncharacterized protein LOC102584680    234   1e-72   
gb|AFK34719.1|  unknown                                                 233   1e-72   
ref|XP_008342774.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    233   1e-72   
gb|KHG25854.1|  Major vault                                             232   2e-72   
ref|XP_007215057.1|  hypothetical protein PRUPE_ppa012217mg             232   3e-72   
ref|XP_007133232.1|  hypothetical protein PHAVU_011G162700g             232   3e-72   
gb|KDP35079.1|  hypothetical protein JCGZ_11031                         231   4e-72   
gb|KHN36883.1|  hypothetical protein glysoja_001614                     232   4e-72   
ref|XP_010277024.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    232   4e-72   
ref|XP_006446791.1|  hypothetical protein CICLE_v10016699mg             233   4e-72   
ref|XP_002280666.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    231   4e-72   Vitis vinifera
ref|XP_004248241.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    233   5e-72   
ref|XP_010279129.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    231   5e-72   
ref|XP_003540402.1|  PREDICTED: uncharacterized protein LOC100802...    231   5e-72   
ref|XP_006469013.1|  PREDICTED: uncharacterized protein LOC102606613    231   6e-72   
ref|XP_004516078.1|  PREDICTED: uncharacterized protein LOC101514778    231   6e-72   
emb|CDP06011.1|  unnamed protein product                                232   7e-72   
ref|XP_011085992.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    231   7e-72   
emb|CAN66524.1|  hypothetical protein VITISV_034969                     230   9e-72   Vitis vinifera
gb|KHN36698.1|  hypothetical protein glysoja_001429                     231   9e-72   
ref|XP_002320411.1|  hypothetical protein POPTR_0014s13900g             230   9e-72   Populus trichocarpa [western balsam poplar]
ref|XP_007132855.1|  hypothetical protein PHAVU_011G130300g             231   9e-72   
ref|XP_004303183.1|  PREDICTED: uncharacterized protein LOC101307414    232   1e-71   
ref|XP_007048693.1|  Pleckstrin domain-containing family N member 1     232   1e-71   
ref|XP_010035859.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    230   1e-71   
ref|XP_002521586.1|  conserved hypothetical protein                     230   1e-71   Ricinus communis
ref|XP_004243287.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    230   1e-71   
ref|XP_009770169.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    231   1e-71   
ref|XP_006348870.1|  PREDICTED: uncharacterized protein LOC102600485    230   1e-71   
gb|KHG07235.1|  Putative beta-lactamase-like 1                          230   1e-71   
ref|XP_011033736.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    230   2e-71   
ref|XP_010052695.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    229   2e-71   
gb|EYU45022.1|  hypothetical protein MIMGU_mgv1a014215mg                230   3e-71   
gb|AES67378.2|  DUF640 family protein                                   229   3e-71   
ref|XP_009133547.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    229   4e-71   
ref|XP_010108230.1|  hypothetical protein L484_018651                   229   4e-71   
ref|XP_009786006.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    229   4e-71   
emb|CDP15936.1|  unnamed protein product                                228   5e-71   
ref|XP_010508549.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    229   5e-71   
ref|XP_010506094.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    229   5e-71   
ref|NP_001235660.1|  uncharacterized protein LOC100306225               229   5e-71   
ref|XP_003597127.1|  177 protein                                        229   6e-71   
ref|XP_006296565.1|  hypothetical protein CARUB_v100241591mg            228   6e-71   
ref|XP_009593391.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    228   8e-71   
gb|EPS59921.1|  hypothetical protein M569_14884                         227   8e-71   
ref|XP_011083008.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    228   9e-71   
ref|XP_009774704.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    228   1e-70   
ref|XP_007149738.1|  hypothetical protein PHAVU_005G095100g             227   1e-70   
ref|XP_010052190.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    228   1e-70   
ref|XP_004487154.1|  PREDICTED: uncharacterized protein LOC101499419    227   1e-70   
gb|KCW67509.1|  hypothetical protein EUGRSUZ_F01238                     228   1e-70   
ref|XP_008371461.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    228   1e-70   
ref|XP_008448236.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    228   2e-70   
ref|XP_002522583.1|  conserved hypothetical protein                     228   2e-70   Ricinus communis
ref|XP_010062813.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    228   2e-70   
emb|CDY55387.1|  BnaA05g34250D                                          227   2e-70   
emb|CDO96796.1|  unnamed protein product                                228   2e-70   
gb|ACJ85482.1|  unknown                                                 227   2e-70   Medicago truncatula
gb|KDP21096.1|  hypothetical protein JCGZ_21567                         227   2e-70   
ref|XP_003526225.1|  PREDICTED: uncharacterized protein LOC100815968    227   2e-70   
ref|XP_008358651.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    228   2e-70   
gb|AFK41155.1|  unknown                                                 227   2e-70   
ref|NP_565978.1|  uncharacterized protein                               227   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009773140.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    227   3e-70   
ref|XP_007025375.1|  Beta-lactamase-like protein ENSP00000383859        227   3e-70   
emb|CDY14848.1|  BnaC04g48450D                                          227   3e-70   
emb|CAN63025.1|  hypothetical protein VITISV_034817                     227   3e-70   Vitis vinifera
ref|XP_009142076.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    226   3e-70   
ref|XP_002879996.1|  hypothetical protein ARALYDRAFT_903634             226   4e-70   
ref|XP_006362411.1|  PREDICTED: uncharacterized protein LOC102591189    227   4e-70   
ref|XP_002285447.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    228   5e-70   Vitis vinifera
ref|XP_006411528.1|  hypothetical protein EUTSA_v10017308mg             226   5e-70   
ref|XP_006467647.1|  PREDICTED: uncharacterized protein LOC102611919    227   5e-70   
ref|XP_003607586.1|  177 protein                                        226   5e-70   
ref|XP_010655519.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    226   5e-70   
ref|XP_006358940.1|  PREDICTED: uncharacterized protein LOC102602985    227   6e-70   
emb|CAN72178.1|  hypothetical protein VITISV_012478                     226   6e-70   Vitis vinifera
ref|XP_010109876.1|  hypothetical protein L484_003806                   226   6e-70   
ref|XP_010104392.1|  hypothetical protein L484_010344                   226   6e-70   
ref|XP_008381217.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    226   6e-70   
ref|XP_006449503.1|  hypothetical protein CICLE_v10016772mg             226   7e-70   
ref|XP_009343797.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    226   7e-70   
ref|XP_009142855.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    226   8e-70   
ref|XP_010314085.1|  PREDICTED: LOW QUALITY PROTEIN: protein LIGH...    225   9e-70   
ref|XP_004233074.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    226   1e-69   
ref|XP_009608555.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    226   1e-69   
ref|XP_010324393.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    226   1e-69   
ref|XP_011008476.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    225   1e-69   
ref|XP_002301561.2|  hypothetical protein POPTR_0002s22690g             224   2e-69   Populus trichocarpa [western balsam poplar]
ref|XP_011101384.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    225   2e-69   
ref|XP_002305745.1|  hypothetical protein POPTR_0004s05610g             224   2e-69   Populus trichocarpa [western balsam poplar]
ref|XP_008465553.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    224   4e-69   
ref|XP_008225289.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    224   4e-69   
ref|XP_004146094.1|  PREDICTED: uncharacterized protein LOC101204141    225   4e-69   
gb|KGN55073.1|  hypothetical protein Csa_4G627230                       224   5e-69   
ref|XP_004171006.1|  PREDICTED: uncharacterized LOC101204141            224   6e-69   
ref|XP_011008166.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    223   6e-69   
ref|XP_011098405.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    223   8e-69   
ref|XP_008463732.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    224   9e-69   
gb|AFK41138.1|  unknown                                                 223   9e-69   
ref|XP_004293946.1|  PREDICTED: uncharacterized protein LOC101295...    223   1e-68   
ref|XP_010525031.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    223   1e-68   
ref|XP_007212120.1|  hypothetical protein PRUPE_ppa012018mg             223   1e-68   
ref|XP_011098044.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    222   1e-68   
ref|XP_010553628.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    222   2e-68   
ref|XP_003542999.1|  PREDICTED: uncharacterized protein LOC100778886    222   2e-68   
gb|EPS69070.1|  hypothetical protein M569_05697                         220   2e-68   
ref|XP_007148048.1|  hypothetical protein PHAVU_006G176100g             222   2e-68   
ref|XP_010524062.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    222   2e-68   
gb|KGN47252.1|  hypothetical protein Csa_6G236080                       223   3e-68   
ref|XP_006348309.1|  PREDICTED: uncharacterized protein LOC102581082    222   3e-68   
ref|XP_004171262.1|  PREDICTED: uncharacterized LOC101216601            223   3e-68   
ref|XP_004151474.1|  PREDICTED: uncharacterized protein LOC101210225    222   3e-68   
gb|AFK49191.1|  unknown                                                 222   4e-68   
gb|KGN65636.1|  hypothetical protein Csa_1G474480                       221   5e-68   
ref|XP_004150559.1|  PREDICTED: uncharacterized protein LOC101216601    223   5e-68   
ref|XP_004136831.1|  PREDICTED: uncharacterized protein LOC101208687    221   6e-68   
ref|XP_009626514.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    221   8e-68   
ref|XP_006442831.1|  hypothetical protein CICLE_v10023710mg             226   8e-68   
ref|XP_008455303.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    221   8e-68   
ref|XP_004485894.1|  PREDICTED: uncharacterized protein LOC101502781    220   1e-67   
ref|XP_004174117.1|  PREDICTED: uncharacterized protein LOC101228453    221   1e-67   
ref|NP_001237249.1|  uncharacterized protein LOC100306082               220   1e-67   
ref|XP_011011486.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    219   2e-67   
ref|XP_009784769.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    220   3e-67   
ref|XP_002317421.1|  hypothetical protein POPTR_0011s07350g             219   3e-67   Populus trichocarpa [western balsam poplar]
ref|XP_009790882.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    219   3e-67   
ref|XP_009790219.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    218   5e-67   
ref|XP_009587002.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    218   7e-67   
ref|XP_010531928.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    218   1e-66   
gb|EYU30777.1|  hypothetical protein MIMGU_mgv1a014751mg                216   3e-66   
ref|XP_004505495.1|  PREDICTED: uncharacterized protein LOC101509969    216   4e-66   
ref|XP_006478612.1|  PREDICTED: probable disease resistance prote...    235   6e-66   
ref|XP_002889213.1|  At1g78815                                          216   8e-66   
ref|NP_565190.1|  protein LIGHT SENSITIVE HYPOCOTYLS 7                  216   8e-66   Arabidopsis thaliana [mouse-ear cress]
gb|ABF83646.1|  At1g78815                                               216   9e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010429720.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    215   1e-65   
ref|XP_010540518.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    215   1e-65   
ref|XP_010417489.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    215   1e-65   
ref|XP_006302860.1|  hypothetical protein CARUB_v10020990mg             215   1e-65   
gb|AAM64330.1|  unknown                                                 215   1e-65   Arabidopsis thaliana [mouse-ear cress]
gb|KFK28531.1|  hypothetical protein AALP_AA7G008800                    215   2e-65   
ref|XP_009106595.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    214   5e-65   
ref|XP_006389954.1|  hypothetical protein EUTSA_v10019792mg             214   5e-65   
emb|CDX88480.1|  BnaC06g39240D                                          213   7e-65   
ref|XP_009108375.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    213   1e-64   
emb|CDY67351.1|  BnaCnng54640D                                          213   1e-64   
gb|KFK42237.1|  hypothetical protein AALP_AA2G229400                    213   1e-64   
ref|XP_006286146.1|  hypothetical protein CARUB_v10007704mg             213   1e-64   
ref|XP_010439831.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    213   1e-64   
ref|NP_193596.1|  uncharacterized protein                               213   1e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010434509.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    213   2e-64   
emb|CDX76510.1|  BnaA08g08900D                                          213   2e-64   
gb|KDO64048.1|  hypothetical protein CISIN_1g0003541mg                  223   2e-64   
emb|CDX78877.1|  BnaA01g09440D                                          213   2e-64   
ref|XP_010449492.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    212   2e-64   
emb|CDX85083.1|  BnaC07g08230D                                          213   2e-64   
ref|XP_009102637.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    212   3e-64   
emb|CDY34056.1|  BnaC03g62760D                                          211   4e-64   
ref|XP_006414079.1|  hypothetical protein EUTSA_v10027091mg             211   5e-64   
emb|CDY69731.1|  BnaCnng65050D                                          211   6e-64   
emb|CDY14588.1|  BnaC02g25250D                                          211   9e-64   
emb|CDY26881.1|  BnaA02g19060D                                          211   9e-64   
ref|XP_002870033.1|  hypothetical protein ARALYDRAFT_914818             211   9e-64   
ref|XP_009108056.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    210   2e-63   
ref|XP_010327093.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    209   2e-63   
ref|XP_009132033.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    209   3e-63   
ref|XP_010549405.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    209   4e-63   
ref|XP_009128313.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    208   7e-63   
ref|XP_009385358.1|  PREDICTED: protein G1-like7                        209   8e-63   
ref|XP_003539992.1|  PREDICTED: uncharacterized protein LOC100806134    207   8e-63   
gb|KHG29970.1|  Putative beta-lactamase-like 1                          207   1e-62   
gb|EYU43335.1|  hypothetical protein MIMGU_mgv1a022623mg                207   1e-62   
ref|XP_009383380.1|  PREDICTED: protein G1-like7                        207   2e-62   
emb|CDY01557.1|  BnaC07g35470D                                          207   2e-62   
ref|XP_003524092.1|  PREDICTED: uncharacterized protein LOC100775838    208   4e-62   
ref|XP_002973743.1|  hypothetical protein SELMODRAFT_36560              204   5e-62   
ref|XP_003531069.1|  PREDICTED: uncharacterized protein LOC100798406    207   7e-62   
ref|XP_010906808.1|  PREDICTED: LOW QUALITY PROTEIN: protein G1-l...    206   8e-62   
gb|EPS68444.1|  hypothetical protein M569_06326                         205   9e-62   
ref|XP_004504735.1|  PREDICTED: uncharacterized protein LOC101506113    207   1e-61   
ref|XP_009419635.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    206   1e-61   
gb|EYU41125.1|  hypothetical protein MIMGU_mgv1a021620mg                204   1e-61   
ref|XP_009411199.1|  PREDICTED: protein G1-like7                        206   2e-61   
ref|XP_008802142.1|  PREDICTED: LOW QUALITY PROTEIN: protein G1-l...    204   2e-61   
ref|XP_003531259.1|  PREDICTED: uncharacterized protein LOC100810655    204   2e-61   
ref|XP_007159450.1|  hypothetical protein PHAVU_002G238600g             204   2e-61   
ref|XP_004244278.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    204   2e-61   
ref|XP_009398867.1|  PREDICTED: protein G1-like4                        205   2e-61   
ref|XP_007159026.1|  hypothetical protein PHAVU_002G202200g             206   3e-61   
dbj|BAI52974.1|  G1-like protein                                        205   3e-61   Selaginella moellendorffii
ref|XP_002892379.1|  hypothetical protein ARALYDRAFT_887918             204   4e-61   
ref|XP_010529198.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    204   5e-61   
ref|XP_010518804.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    203   7e-61   
ref|XP_010457872.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    203   7e-61   
gb|AES98763.2|  DUF640 family protein                                   204   7e-61   
gb|EYU28084.1|  hypothetical protein MIMGU_mgv1a022457mg                202   9e-61   
ref|XP_010475462.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    203   9e-61   
ref|XP_010487116.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    203   9e-61   
ref|XP_008649559.1|  PREDICTED: protein G1-like7                        206   9e-61   
ref|NP_563780.1|  protein LIGHT SENSITIVE HYPOCOTYLS 6                  203   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010538562.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    203   1e-60   
ref|XP_006303356.1|  hypothetical protein CARUB_v10010340mg             203   1e-60   
ref|XP_009136943.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   1e-60   
gb|KEH31304.1|  G1-like protein                                         204   1e-60   
ref|NP_001143976.1|  uncharacterized protein LOC100276793               206   2e-60   Zea mays [maize]
ref|XP_003615805.1|  hypothetical protein MTR_5g072510                  204   2e-60   
ref|XP_002267312.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   2e-60   Vitis vinifera
ref|XP_008657105.1|  PREDICTED: protein G1-like7                        202   2e-60   
gb|KHG10505.1|  Error-prone DNA polymerase                              203   3e-60   
gb|KHN45745.1|  hypothetical protein glysoja_043995                     201   3e-60   
ref|XP_008804907.1|  PREDICTED: protein G1-like7                        202   3e-60   
ref|XP_009615590.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   6e-60   
ref|XP_010922606.1|  PREDICTED: protein G1-like7                        202   6e-60   
gb|KFK43023.1|  hypothetical protein AALP_AA1G068900                    201   6e-60   
ref|XP_007016962.1|  Zinc finger protein ZFPM1                          202   6e-60   
ref|XP_010043398.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   7e-60   
ref|XP_006417846.1|  hypothetical protein EUTSA_v10009726mg             201   7e-60   
ref|XP_003629770.1|  177 protein                                        200   8e-60   
emb|CDY64755.1|  BnaCnng44770D                                          200   9e-60   
ref|XP_006443825.1|  hypothetical protein CICLE_v10022295mg             200   1e-59   
ref|XP_010043397.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   1e-59   
gb|EYU45980.1|  hypothetical protein MIMGU_mgv1a021801mg                200   2e-59   
ref|XP_002313971.1|  hypothetical protein POPTR_0009s07990g             201   2e-59   Populus trichocarpa [western balsam poplar]
ref|XP_002961823.1|  hypothetical protein SELMODRAFT_68566              199   2e-59   
ref|XP_006282119.1|  hypothetical protein CARUB_v10028368mg             199   2e-59   
ref|XP_006847407.1|  hypothetical protein AMTR_s00153p00047660          200   2e-59   
ref|XP_010906823.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    200   3e-59   
ref|XP_010685918.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   3e-59   
emb|CDP09236.1|  unnamed protein product                                200   3e-59   
ref|XP_011003514.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    200   4e-59   
ref|XP_010043396.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   4e-59   
emb|CDY02038.1|  BnaC04g14630D                                          197   4e-59   
ref|XP_004504297.1|  PREDICTED: uncharacterized protein LOC101498424    198   5e-59   
emb|CDY10247.1|  BnaC05g04900D                                          199   5e-59   
emb|CDY06675.1|  BnaA10g04540D                                          198   6e-59   
gb|KEH41129.1|  G1-like protein                                         199   6e-59   
ref|XP_006398272.1|  hypothetical protein EUTSA_v10001044mg             197   1e-58   
ref|XP_009144329.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    197   1e-58   
ref|XP_009128817.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    197   1e-58   
ref|XP_003638136.1|  hypothetical protein MTR_119s0026                  204   1e-58   
emb|CDY10712.1|  BnaA05g12240D                                          196   1e-58   
ref|XP_004134659.1|  PREDICTED: uncharacterized protein LOC101214534    198   1e-58   
emb|CDY06030.1|  BnaA09g37500D                                          197   1e-58   
ref|XP_008355077.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    198   2e-58   
ref|XP_008465528.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    197   2e-58   
ref|XP_002298496.1|  hypothetical protein POPTR_0001s28780g             198   2e-58   Populus trichocarpa [western balsam poplar]
ref|XP_002862737.1|  hypothetical protein ARALYDRAFT_920315             197   2e-58   
ref|XP_010497623.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   2e-58   
ref|XP_009385214.1|  PREDICTED: protein G1-like7                        197   2e-58   
ref|XP_003537309.1|  PREDICTED: uncharacterized protein LOC100775798    198   2e-58   
ref|XP_010542671.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   3e-58   
ref|XP_010689830.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   3e-58   
ref|XP_009763597.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   3e-58   
ref|XP_002879250.1|  hypothetical protein ARALYDRAFT_901988             196   4e-58   
ref|XP_009354180.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    197   4e-58   
ref|XP_009611433.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   5e-58   
ref|XP_002866271.1|  hypothetical protein ARALYDRAFT_919048             195   5e-58   
gb|EPS74620.1|  hypothetical protein M569_00139                         195   6e-58   
ref|XP_006401075.1|  hypothetical protein EUTSA_v10014789mg             195   7e-58   
ref|XP_009118997.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   1e-57   
ref|NP_200658.1|  protein LIGHT SENSITIVE HYPOCOTYLS 5                  194   1e-57   
emb|CDY59064.1|  BnaAnng15760D                                          195   1e-57   
emb|CDY52287.1|  BnaA03g57800D                                          195   1e-57   
ref|XP_008811689.1|  PREDICTED: protein G1-like7                        196   1e-57   
ref|XP_006281173.1|  hypothetical protein CARUB_v10027208mg             194   2e-57   
emb|CDY59510.1|  BnaCnng35040D                                          194   2e-57   
ref|XP_010521971.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    194   2e-57   
ref|XP_009126748.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    194   2e-57   
ref|XP_009118463.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    194   2e-57   
emb|CDY32697.1|  BnaA02g07590D                                          193   3e-57   
ref|XP_006353047.1|  PREDICTED: uncharacterized protein LOC102583639    193   3e-57   
ref|XP_009605797.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    193   3e-57   
emb|CDX87760.1|  BnaC02g31890D                                          193   3e-57   
ref|XP_002863446.1|  hypothetical protein ARALYDRAFT_916864             193   4e-57   
ref|XP_004233194.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    193   5e-57   
ref|XP_009770526.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    192   6e-57   
ref|XP_010453783.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    192   8e-57   
ref|XP_010443587.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    192   8e-57   
ref|XP_010483448.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    192   1e-56   
emb|CDY35523.1|  BnaA01g23890D                                          192   1e-56   
emb|CDY61050.1|  BnaCnng37250D                                          192   1e-56   
ref|XP_007022986.1|  Uncharacterized protein TCM_026988                 192   2e-56   
gb|KFK39618.1|  hypothetical protein AALP_AA3G267200                    192   2e-56   
ref|XP_011043717.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    191   2e-56   
ref|XP_002313621.2|  hypothetical protein POPTR_0009s15930g             191   2e-56   
ref|XP_006410079.1|  hypothetical protein EUTSA_v10017270mg             191   3e-56   
emb|CDY32977.1|  BnaA10g11830D                                          191   3e-56   
ref|XP_009391700.1|  PREDICTED: protein G1-like7                        193   3e-56   
ref|XP_006406049.1|  hypothetical protein EUTSA_v10021563mg             191   3e-56   
ref|XP_009124995.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    191   4e-56   
emb|CDY30000.1|  BnaC01g40080D                                          191   4e-56   
ref|NP_173135.1|  uncharacterized protein                               190   4e-56   
ref|XP_004239743.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    191   5e-56   
emb|CDY21126.1|  BnaA01g33570D                                          191   5e-56   
ref|XP_010907173.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    191   5e-56   
ref|XP_008807164.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    192   5e-56   
ref|XP_008438509.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    190   6e-56   
ref|XP_010414174.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    191   6e-56   
ref|XP_010488385.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    191   6e-56   
ref|XP_006845978.1|  hypothetical protein AMTR_s00155p00022580          191   6e-56   
emb|CDO99243.1|  unnamed protein product                                190   7e-56   
ref|XP_010510232.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    191   7e-56   
ref|XP_002317078.1|  hypothetical protein POPTR_0011s16010g             192   7e-56   
ref|XP_011024904.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    191   8e-56   
ref|NP_001078202.2|  protein LIGHT SENSITIVE HYPOCOTYLS 4               190   8e-56   
ref|XP_010469755.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    191   9e-56   
ref|XP_011091303.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    190   1e-55   
ref|XP_010466654.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    190   1e-55   
ref|XP_006410244.1|  hypothetical protein EUTSA_v10017162mg             191   1e-55   
gb|KDP34854.1|  hypothetical protein JCGZ_09142                         191   1e-55   
ref|XP_006857299.1|  hypothetical protein AMTR_s00067p00052610          190   1e-55   
ref|XP_006354481.1|  PREDICTED: uncharacterized protein LOC102586971    190   1e-55   
ref|XP_002883419.1|  hypothetical protein ARALYDRAFT_898842             190   1e-55   
ref|XP_010488383.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    190   1e-55   
ref|XP_010069122.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    190   1e-55   
ref|XP_006298606.1|  hypothetical protein CARUB_v10014690mg             190   1e-55   
ref|XP_010512305.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   1e-55   
ref|XP_010052568.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   1e-55   
ref|XP_011040543.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    191   2e-55   
ref|XP_002862787.1|  hypothetical protein ARALYDRAFT_497295             190   2e-55   
ref|XP_008439509.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   2e-55   
gb|KFK27377.1|  hypothetical protein AALP_AA8G375000                    189   2e-55   
emb|CDY57087.1|  BnaA04g28750D                                          190   2e-55   
ref|XP_007143862.1|  hypothetical protein PHAVU_007G108200g             189   2e-55   
ref|XP_006293520.1|  hypothetical protein CARUB_v10024036mg             190   2e-55   
ref|XP_010926891.1|  PREDICTED: protein G1-like1                        191   2e-55   
ref|XP_002533787.1|  conserved hypothetical protein                     191   2e-55   
ref|XP_004490633.1|  PREDICTED: uncharacterized protein LOC101513114    190   2e-55   
emb|CDY15426.1|  BnaC04g41970D                                          190   2e-55   
ref|XP_008810562.1|  PREDICTED: protein G1-like4                        189   2e-55   
ref|XP_007143863.1|  hypothetical protein PHAVU_007G108200g             189   2e-55   
sp|Q941W1.1|G1L7_ORYSJ  RecName: Full=Protein G1-like7                  189   3e-55   
sp|A2XED8.1|G1L7_ORYSI  RecName: Full=Protein G1-like7                  189   3e-55   
ref|XP_009120359.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   3e-55   
ref|XP_006606387.1|  PREDICTED: uncharacterized protein LOC100806...    189   3e-55   
ref|XP_006606388.1|  PREDICTED: uncharacterized protein LOC100806...    189   3e-55   
ref|XP_010650097.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   3e-55   
ref|XP_010527402.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   3e-55   
ref|NP_565716.1|  uncharacterized protein                               189   3e-55   
ref|XP_003556381.1|  PREDICTED: uncharacterized protein LOC100806...    188   3e-55   
ref|XP_009412626.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    190   3e-55   
ref|XP_001760807.1|  predicted protein                                  187   3e-55   
ref|XP_004134409.1|  PREDICTED: uncharacterized protein LOC101212284    188   4e-55   
ref|XP_010532649.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    188   4e-55   
ref|XP_004167341.1|  PREDICTED: uncharacterized protein LOC101231116    188   4e-55   
ref|XP_002879309.1|  hypothetical protein ARALYDRAFT_344884             189   5e-55   
ref|XP_006410245.1|  hypothetical protein EUTSA_v10017162mg             190   5e-55   
ref|XP_010023924.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    188   5e-55   
ref|XP_004497868.1|  PREDICTED: uncharacterized protein LOC101506...    189   6e-55   
ref|XP_009772674.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    188   6e-55   
ref|XP_009141136.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    190   6e-55   
gb|EPS66277.1|  hypothetical protein M569_08502                         186   6e-55   
ref|XP_003536217.1|  PREDICTED: uncharacterized protein LOC100789...    188   7e-55   
ref|XP_002271024.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   7e-55   
ref|XP_006345889.1|  PREDICTED: uncharacterized protein LOC102588665    188   7e-55   
ref|XP_007010574.1|  Uncharacterized protein TCM_044482                 200   7e-55   
ref|XP_006589267.1|  PREDICTED: uncharacterized protein LOC100789...    188   8e-55   
gb|EPS68159.1|  hypothetical protein M569_06614                         186   8e-55   
ref|XP_010905797.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    188   8e-55   
ref|XP_009603577.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    187   9e-55   
emb|CDY10790.1|  BnaA05g11460D                                          188   9e-55   
ref|XP_009400810.1|  PREDICTED: protein G1-like4                        187   9e-55   
gb|AFK48050.1|  unknown                                                 187   1e-54   
gb|KFK31223.1|  hypothetical protein AALP_AA6G084400                    188   1e-54   
emb|CDY24755.1|  BnaC04g13600D                                          188   1e-54   
ref|XP_008804103.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   1e-54   
ref|XP_007142170.1|  hypothetical protein PHAVU_008G258200g             188   1e-54   
ref|XP_003590857.1|  hypothetical protein MTR_1g075990                  187   1e-54   
ref|XP_004247736.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    187   1e-54   
ref|XP_009144232.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    187   1e-54   
ref|XP_008674867.1|  PREDICTED: protein G1-like7                        187   1e-54   
ref|XP_009384186.1|  PREDICTED: protein G1-like1                        188   2e-54   
ref|XP_009398447.1|  PREDICTED: protein G1-like4                        187   2e-54   
ref|XP_008789168.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   2e-54   
ref|XP_004134890.1|  PREDICTED: uncharacterized protein LOC101208925    187   2e-54   
gb|KGN49491.1|  hypothetical protein Csa_6G526250                       187   2e-54   
ref|XP_010935915.1|  PREDICTED: protein G1-like4                        187   2e-54   
ref|XP_003544306.1|  PREDICTED: uncharacterized protein LOC100780494    187   2e-54   
ref|XP_011005316.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    188   2e-54   
ref|XP_008367221.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    187   2e-54   
ref|XP_002458704.1|  hypothetical protein SORBIDRAFT_03g038670          187   2e-54   
ref|XP_010934319.1|  PREDICTED: protein G1-like4                        186   2e-54   
ref|XP_008341169.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    187   2e-54   
gb|EEE55616.1|  hypothetical protein OsJ_03942                          186   2e-54   
ref|XP_009144231.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    187   2e-54   
ref|XP_004242504.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    187   3e-54   
ref|XP_007145860.1|  hypothetical protein PHAVU_007G274100g             187   3e-54   
ref|XP_006350860.1|  PREDICTED: uncharacterized protein LOC102596443    187   3e-54   
ref|XP_004970435.1|  PREDICTED: uncharacterized protein LOC101754104    187   3e-54   
ref|XP_008808528.1|  PREDICTED: protein G1-like1                        187   3e-54   
ref|XP_009387892.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   3e-54   
ref|XP_009417987.1|  PREDICTED: protein G1-like7                        187   3e-54   
ref|XP_009797641.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   3e-54   
ref|XP_009419675.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    187   3e-54   
ref|XP_011080720.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   4e-54   
ref|XP_004296375.1|  PREDICTED: uncharacterized protein LOC101303109    186   4e-54   
ref|XP_006378330.1|  hypothetical protein POPTR_0010s08140g             186   4e-54   
ref|XP_009399464.1|  PREDICTED: protein G1-like4                        186   4e-54   
ref|XP_010104757.1|  hypothetical protein L484_021447                   186   4e-54   
ref|XP_008793554.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    187   5e-54   
ref|XP_009336145.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   5e-54   
gb|KDP40343.1|  hypothetical protein JCGZ_02341                         186   6e-54   
ref|XP_001765087.1|  predicted protein                                  184   6e-54   
ref|XP_010098512.1|  hypothetical protein L484_025951                   187   6e-54   
ref|XP_003567242.1|  PREDICTED: protein G1-like7                        186   6e-54   
ref|XP_009762992.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    187   6e-54   
ref|XP_009399257.1|  PREDICTED: protein G1-like1                        186   6e-54   
ref|XP_010921009.1|  PREDICTED: LOW QUALITY PROTEIN: protein G1-l...    187   6e-54   
ref|XP_010264562.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   6e-54   
ref|XP_001753736.1|  predicted protein                                  183   7e-54   
ref|XP_007035134.1|  Uncharacterized protein TCM_020903                 186   7e-54   
ref|XP_010262338.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   7e-54   
ref|XP_011004043.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    185   7e-54   
ref|XP_002306857.2|  hypothetical protein POPTR_0005s24730g             185   7e-54   
ref|XP_008224344.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   7e-54   
ref|XP_008356205.1|  PREDICTED: LOW QUALITY PROTEIN: protein LIGH...    186   7e-54   
ref|XP_009365981.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   7e-54   
gb|ACN41049.1|  unknown                                                 186   8e-54   
gb|EMT15017.1|  hypothetical protein F775_09728                         185   8e-54   
ref|XP_008807719.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   8e-54   
ref|XP_009613005.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    185   9e-54   
ref|XP_009391974.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    185   9e-54   
ref|XP_009401942.1|  PREDICTED: protein G1-like4                        185   9e-54   
ref|XP_010671018.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    185   9e-54   
ref|XP_002311674.2|  hypothetical protein POPTR_0008s16750g             185   9e-54   
ref|XP_001753216.1|  predicted protein                                  183   9e-54   
ref|XP_010246796.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   9e-54   
sp|A2Y5N0.1|G1L8_ORYSI  RecName: Full=Protein G1-like8                  186   1e-53   
ref|XP_010262340.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   1e-53   
ref|XP_004962398.1|  PREDICTED: skin secretory protein xP2-like         188   1e-53   
gb|KDO60474.1|  hypothetical protein CISIN_1g046561mg                   185   1e-53   
ref|XP_010522152.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    185   1e-53   
ref|XP_006468373.1|  PREDICTED: uncharacterized protein LOC102627798    186   1e-53   
ref|XP_006420250.1|  hypothetical protein CICLE_v10005901mg             185   1e-53   
dbj|BAJ89549.1|  predicted protein                                      185   1e-53   
gb|KEH23934.1|  G1-like protein                                         185   1e-53   
ref|XP_008391225.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    185   1e-53   
ref|XP_007226923.1|  hypothetical protein PRUPE_ppa015837mg             185   1e-53   
ref|XP_008235666.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    185   1e-53   
emb|CDX86199.1|  BnaA06g29160D                                          184   2e-53   
ref|XP_010923781.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    185   2e-53   
ref|XP_008785240.1|  PREDICTED: LOW QUALITY PROTEIN: protein G1-l...    185   2e-53   
gb|EYU43203.1|  hypothetical protein MIMGU_mgv1a013748mg                184   2e-53   
ref|XP_003571880.1|  PREDICTED: protein G1-like5                        184   2e-53   
gb|EPS74320.1|  hypothetical protein M569_00435                         183   2e-53   
gb|KEH42512.1|  G1-like protein                                         185   2e-53   
ref|XP_006395017.1|  hypothetical protein EUTSA_v10004974mg             184   2e-53   
emb|CAN67056.1|  hypothetical protein VITISV_036348                     183   2e-53   
ref|XP_009384790.1|  PREDICTED: protein G1-like7                        185   2e-53   
dbj|BAK01969.1|  predicted protein                                      185   2e-53   
dbj|BAI52973.1|  G1-like protein                                        184   2e-53   
ref|XP_009780996.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    183   3e-53   
gb|EPS67535.1|  hypothetical protein M569_07240                         182   3e-53   
ref|XP_002299015.2|  hypothetical protein POPTR_0001s46470g             187   3e-53   
ref|XP_007201372.1|  hypothetical protein PRUPE_ppa012142mg             183   3e-53   
ref|XP_004292213.1|  PREDICTED: uncharacterized protein LOC101301170    184   3e-53   
ref|XP_010652376.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    183   3e-53   
ref|XP_007050277.1|  IQ motif and SEC7 domain-containing protein 2      183   3e-53   
sp|Q6ATW6.1|G1L8_ORYSJ  RecName: Full=Protein G1-like8                  185   3e-53   
ref|XP_010557118.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   3e-53   
gb|ABK21716.1|  unknown                                                 184   4e-53   
ref|XP_004493783.1|  PREDICTED: uncharacterized protein LOC101490141    184   4e-53   
ref|XP_011080055.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    183   4e-53   
ref|XP_003537033.1|  PREDICTED: uncharacterized protein LOC100803605    184   4e-53   
ref|XP_011028817.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    183   4e-53   
ref|XP_008382857.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   4e-53   
ref|XP_006352738.1|  PREDICTED: uncharacterized protein LOC102585062    184   4e-53   
ref|XP_002441248.1|  hypothetical protein SORBIDRAFT_09g023120          185   4e-53   
ref|XP_003581429.1|  PREDICTED: protein G1-like4                        184   4e-53   
ref|XP_009129837.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    183   4e-53   
ref|XP_004966292.1|  PREDICTED: uncharacterized protein LOC101766...    186   4e-53   
ref|XP_009369473.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   4e-53   
ref|XP_009629990.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   4e-53   
ref|XP_002302041.2|  hypothetical protein POPTR_0002s03860g             183   5e-53   
ref|XP_011085173.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   5e-53   
ref|XP_002440915.1|  hypothetical protein SORBIDRAFT_09g016440          187   5e-53   
gb|KDP26521.1|  hypothetical protein JCGZ_17679                         183   6e-53   



>ref|XP_011082761.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Sesamum 
indicum]
Length=182

 Score =   244 bits (622),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPVALS C+Y+HVLDFM YLDQFGKTKVH+QGC+FFGQ 
Sbjct  37   RYESQKRRDWNTFGQYLRNQRPPVALSQCNYSHVLDFMRYLDQFGKTKVHIQGCVFFGQP  96

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPLRQAWGSLDALIGRLRAA+EENGG PETNPFANGAIR+YLREVRD QAKAR
Sbjct  97   EPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGVPETNPFANGAIRVYLREVRDSQAKAR  156

Query  526  GIPY  515
            GIPY
Sbjct  157  GIPY  160



>ref|XP_007149389.1| hypothetical protein PHAVU_005G066200g [Phaseolus vulgaris]
 gb|ESW21383.1| hypothetical protein PHAVU_005G066200g [Phaseolus vulgaris]
Length=179

 Score =   238 bits (607),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPVALS C  +HVL+F+ YLDQFGKTKVHLQGCLFFGQ+
Sbjct  33   RYESQKRRDWNTFGQYLRNQRPPVALSQCSSSHVLEFLRYLDQFGKTKVHLQGCLFFGQS  92

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPLRQAWGSLDALIGRLRAA+EENGG PETNPFA+GAIR+YLREVRD QAKAR
Sbjct  93   EPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAKAR  152

Query  526  GIPY  515
            GIPY
Sbjct  153  GIPY  156



>ref|XP_006442502.1| hypothetical protein CICLE_v10022456mg [Citrus clementina]
 ref|XP_006477739.1| PREDICTED: uncharacterized protein LOC102620640 [Citrus sinensis]
 gb|ESR55742.1| hypothetical protein CICLE_v10022456mg [Citrus clementina]
 gb|KDO47016.1| hypothetical protein CISIN_1g029917mg [Citrus sinensis]
Length=185

 Score =   237 bits (604),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPVALS C+  HVLDF+ YLDQFGKTKVHLQGC+FFGQ 
Sbjct  39   RYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLDFLRYLDQFGKTKVHLQGCVFFGQP  98

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPC+CPL+QAWGSLDALIGRLRAA+EENGG PETNPFA+GAIR+YLREVRD QAKAR
Sbjct  99   EPPGPCSCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRIYLREVRDSQAKAR  158

Query  526  GIPY  515
            GIPY
Sbjct  159  GIPY  162



>ref|XP_009622401.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=198

 Score =   237 bits (605),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS+C+Y HVLDF+ YLDQFGKTKVHL GCLFFGQ 
Sbjct  47   RYESQKRRDWNTFGQYLKNQRPPVPLSNCNYNHVLDFLKYLDQFGKTKVHLHGCLFFGQP  106

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA+GAIR+YLREVRD QAKAR
Sbjct  107  EPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPESNPFASGAIRVYLREVRDSQAKAR  166

Query  526  GIPY  515
            GIPY
Sbjct  167  GIPY  170



>ref|XP_007021735.1| Uncharacterized protein TCM_031777 [Theobroma cacao]
 gb|EOY13260.1| Uncharacterized protein TCM_031777 [Theobroma cacao]
Length=186

 Score =   236 bits (603),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPVALS C+  HVL+F+ YLDQFGKTKVHLQGC+FFGQ 
Sbjct  39   RYESQKRRDWNTFGQYLRNQRPPVALSQCNANHVLEFLRYLDQFGKTKVHLQGCVFFGQP  98

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPLRQAWGSLDALIGRLRAA+EENGG PETNPFA+GAIR+YLREVRD QAKAR
Sbjct  99   EPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRIYLREVRDSQAKAR  158

Query  526  GIPY  515
            GIPY
Sbjct  159  GIPY  162



>ref|XP_009339946.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Pyrus 
x bretschneideri]
Length=183

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPVALS  +  HVLDF+ YLDQFGKTKVHLQGC+FFGQ 
Sbjct  35   RYESQKRRDWNTFGQYLRNQRPPVALSQSNSNHVLDFLRYLDQFGKTKVHLQGCVFFGQP  94

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPLRQAWGSLDALIGRLRAA+EENGG PETNPFA GAIR+YLREVRD QAKAR
Sbjct  95   EPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFATGAIRVYLREVRDSQAKAR  154

Query  526  GIPY  515
            GIPY
Sbjct  155  GIPY  158



>ref|XP_003596364.1| 177 protein [Medicago truncatula]
 gb|AES66615.1| DUF640 family protein [Medicago truncatula]
Length=178

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPVALS+C+  HVL+F+ YLDQFGKTKVHLQGCLFFGQ 
Sbjct  33   RYESQKRRDWNTFGQYLRNQRPPVALSNCNSNHVLEFLRYLDQFGKTKVHLQGCLFFGQT  92

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPL+QAWGSLDALIGRLRAA+EENGG PETNPFA+G+IR+YLREVRD QAKAR
Sbjct  93   EPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGSIRIYLREVRDSQAKAR  152

Query  526  GIPY  515
            GIPY
Sbjct  153  GIPY  156



>ref|XP_006370148.1| hypothetical protein POPTR_0001s40140g [Populus trichocarpa]
 gb|ERP66717.1| hypothetical protein POPTR_0001s40140g [Populus trichocarpa]
Length=176

 Score =   235 bits (599),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPVALS C+  HVL+F+ YLDQFGKTKVHLQGC+FFGQ 
Sbjct  31   RYESQKRRDWNTFGQYLRNQRPPVALSQCNANHVLEFLRYLDQFGKTKVHLQGCVFFGQP  90

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPL+QAWGSLDALIGRLRAA+EENGG PETNPFA+GAIR+YLREVRD QAKAR
Sbjct  91   EPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAKAR  150

Query  526  GIPY  515
            GIPY
Sbjct  151  GIPY  154



>ref|XP_004489028.1| PREDICTED: uncharacterized protein LOC101497242 [Cicer arietinum]
Length=189

 Score =   235 bits (600),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPVALS C+  HVL+F+ YLDQFGKTKVHLQGCLFFGQ 
Sbjct  45   RYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCLFFGQV  104

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPL+QAWGSLDALIGRLRAA+EENGG PETNPFA+G+IR+YLREVRD QAKAR
Sbjct  105  EPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGSIRIYLREVRDSQAKAR  164

Query  526  GIPY  515
            GIPY
Sbjct  165  GIPY  168



>ref|XP_011013261.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Populus 
euphratica]
Length=176

 Score =   235 bits (599),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPVALS C+  HVL+F+ YLDQFGKTKVHLQGC+FFGQ 
Sbjct  31   RYESQKRRDWNTFGQYLRNQRPPVALSQCNANHVLEFLRYLDQFGKTKVHLQGCVFFGQP  90

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPL+QAWGSLDALIGRLRAA+EENGG PETNPFA+GAIR+YLREVRD QAKAR
Sbjct  91   EPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAKAR  150

Query  526  GIPY  515
            GIPY
Sbjct  151  GIPY  154



>gb|KDP34762.1| hypothetical protein JCGZ_10542 [Jatropha curcas]
Length=184

 Score =   235 bits (600),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPV L++C+ THVLDF+ YLDQFGKTKVHLQGC+FFGQ 
Sbjct  38   RYESQKRRDWNTFGQYLRNQRPPVTLANCNATHVLDFLRYLDQFGKTKVHLQGCVFFGQP  97

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPL+QAWGSLDALIGRLRAA+EENGG PETNPFA+GAIR+YLREVRD QAKAR
Sbjct  98   EPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAKAR  157

Query  526  GIPY  515
            GIPY
Sbjct  158  GIPY  161



>ref|XP_009334040.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
Length=186

 Score =   234 bits (598),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPVALS  +  HVLDF+ YLDQFGKTKVH QGC+FFGQ 
Sbjct  38   RYESQKRRDWNTFGQYLRNQRPPVALSQSNSNHVLDFLRYLDQFGKTKVHAQGCVFFGQP  97

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPLRQAWGSLDALIGRLRAA+EENGG PETNPFA+GAIR+YLREVRD QAKAR
Sbjct  98   EPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAKAR  157

Query  526  GIPY  515
            GIPY
Sbjct  158  GIPY  161



>ref|XP_008368001.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
Length=186

 Score =   234 bits (598),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPVALS  +  HVLDF+ YLDQFGKTKVH QGC+FFGQ 
Sbjct  38   RYESQKRRDWNTFGQYLRNQRPPVALSQSNSNHVLDFLRYLDQFGKTKVHAQGCVFFGQP  97

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPLRQAWGSLDALIGRLRAA+EENGG PETNPFA+GAIR+YLREVRD QAKAR
Sbjct  98   EPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAKAR  157

Query  526  GIPY  515
            GIPY
Sbjct  158  GIPY  161



>ref|XP_011015901.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Populus 
euphratica]
Length=176

 Score =   234 bits (596),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPVALS C+  HVL+F+ YLDQFGKTKVH+QGC+FFGQ 
Sbjct  31   RYESQKRRDWNTFGQYLRNQRPPVALSQCNANHVLEFLRYLDQFGKTKVHVQGCVFFGQP  90

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPL+QAWGSLDALIGRLRAA+EENGG PETNPFA+GAIR+YLREVRD QAKAR
Sbjct  91   EPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAKAR  150

Query  526  GIPY  515
            GIPY
Sbjct  151  GIPY  154



>gb|AFK47598.1| unknown [Lotus japonicus]
Length=179

 Score =   234 bits (596),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPVALS C+   VL+F+ YLDQFGKTKVH+QGCLFFGQA
Sbjct  31   RYESQKRRDWNTFGQYLRNQRPPVALSQCNSNQVLEFLRYLDQFGKTKVHVQGCLFFGQA  90

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPLRQAWGSLDALIGRLRAA+EENGG PE NPFA+G IR+YLREVRD QAKAR
Sbjct  91   EPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPEANPFASGTIRLYLREVRDSQAKAR  150

Query  526  GIPY  515
            GIPY
Sbjct  151  GIPY  154



>ref|XP_006592933.1| PREDICTED: uncharacterized protein LOC100806493 isoform X1 [Glycine 
max]
 ref|XP_006592934.1| PREDICTED: uncharacterized protein LOC100806493 isoform X2 [Glycine 
max]
Length=184

 Score =   234 bits (596),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPVALS C   HVL+F+ YLDQFGKTKVH QGCLFFGQ 
Sbjct  37   RYESQKRRDWNTFGQYLRNQRPPVALSQCSSNHVLEFLRYLDQFGKTKVHSQGCLFFGQT  96

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPLRQAWGSLDALIGRLRAA+EENGG PETNPFA+GAIR+YLREVRD Q+KAR
Sbjct  97   EPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQSKAR  156

Query  526  GIPY  515
            GIPY
Sbjct  157  GIPY  160



>ref|XP_002317458.1| hypothetical protein POPTR_0011s11120g [Populus trichocarpa]
 gb|EEE98070.1| hypothetical protein POPTR_0011s11120g [Populus trichocarpa]
Length=176

 Score =   233 bits (595),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPVALS C+   VLDF+ YLDQFGKTKVHLQGC+FFGQ 
Sbjct  31   RYESQKRRDWNTFGQYLRNQRPPVALSQCNANQVLDFLRYLDQFGKTKVHLQGCVFFGQP  90

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPL+QAWGSLDALIGRLRAA+EENGG PETNPFA+GAIR+YLREVRD QAKAR
Sbjct  91   EPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAKAR  150

Query  526  GIPY  515
            GIPY
Sbjct  151  GIPY  154



>ref|XP_004294145.1| PREDICTED: uncharacterized protein LOC101307097 [Fragaria vesca 
subsp. vesca]
Length=194

 Score =   234 bits (597),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPVALS  + +HVLDF+ YLDQFGKTKVHLQGC+FFGQ 
Sbjct  42   RYESQKRRDWNTFGQYLRNQRPPVALSQSNSSHVLDFLRYLDQFGKTKVHLQGCVFFGQP  101

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA+GAIR+YLREVRD QAKAR
Sbjct  102  EPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPESNPFASGAIRVYLREVRDSQAKAR  161

Query  526  GIPY  515
            GIPY
Sbjct  162  GIPY  165



>ref|XP_007212123.1| hypothetical protein PRUPE_ppa012057mg [Prunus persica]
 gb|EMJ13322.1| hypothetical protein PRUPE_ppa012057mg [Prunus persica]
Length=185

 Score =   234 bits (596),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPVALS  +  HVLDF+ YLDQFGKTKVHLQGC+FFGQ 
Sbjct  37   RYESQKRRDWNTFGQYLRNQRPPVALSQSNSNHVLDFLRYLDQFGKTKVHLQGCVFFGQP  96

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPLRQAWGSLDALIGRLRAA+EENGG PETNPFA+GAIR+YLREVRD QAKAR
Sbjct  97   EPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAKAR  156

Query  526  GIPY  515
            GIPY
Sbjct  157  GIPY  160



>ref|XP_008226537.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Prunus 
mume]
Length=186

 Score =   234 bits (596),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPVALS  +  HVLDF+ YLDQFGKTKVHLQGC+FFGQ 
Sbjct  38   RYESQKRRDWNTFGQYLRNQRPPVALSQSNSNHVLDFLRYLDQFGKTKVHLQGCVFFGQP  97

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPLRQAWGSLDALIGRLRAA+EENGG PETNPFA+GAIR+YLREVRD QAKAR
Sbjct  98   EPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAKAR  157

Query  526  GIPY  515
            GIPY
Sbjct  158  GIPY  161



>ref|NP_001237763.1| uncharacterized protein LOC100527554 [Glycine max]
 gb|ACU16651.1| unknown [Glycine max]
Length=194

 Score =   234 bits (596),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPVALS C   HVL+F+ YLDQFGKTKVH QGCLFFGQ 
Sbjct  47   RYESQKRRDWNTFGQYLRNQRPPVALSQCSSNHVLEFLRYLDQFGKTKVHSQGCLFFGQT  106

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPLRQAWGSLDALIGRLRAA+EENGG PETNPFA+G IR+YLREVRD QAKAR
Sbjct  107  EPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGTIRVYLREVRDSQAKAR  166

Query  526  GIPY  515
            GIPY
Sbjct  167  GIPY  170



>ref|XP_002530382.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32002.1| conserved hypothetical protein [Ricinus communis]
Length=197

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPVALS C+  HVLDF+ YLDQFGKTKVHLQGC+FFGQ 
Sbjct  50   RYESQKRRDWNTFGQYLRNQRPPVALSQCNANHVLDFLRYLDQFGKTKVHLQGCVFFGQP  109

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPL+QAWGSLDALIGRLRAA+EENGG PETNPFA+GAIR++LREVRD QAKAR
Sbjct  110  EPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVHLREVRDSQAKAR  169

Query  526  GIPY  515
            GIPY
Sbjct  170  GIPY  173



>ref|XP_006360044.1| PREDICTED: uncharacterized protein LOC102584680 [Solanum tuberosum]
Length=207

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV+L  C+Y HVLDF+ YLDQFGKTKVHL GCLFFGQ 
Sbjct  51   RYESQKRRDWNTFGQYLKNQRPPVSLPQCNYNHVLDFLRYLDQFGKTKVHLHGCLFFGQP  110

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPLRQAWGSLDALIGRLRAA+EENGG  ETNPFA+GAIR+YLREVRD QAKAR
Sbjct  111  EPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLQETNPFASGAIRVYLREVRDSQAKAR  170

Query  526  GIPY  515
            GIPY
Sbjct  171  GIPY  174



>gb|AFK34719.1| unknown [Lotus japonicus]
Length=179

 Score =   233 bits (594),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPVALS C+   VL+F+ YLDQFGKTKVH+QGCLFFGQA
Sbjct  31   RYESQKRRDWNTFGQYLRNQRPPVALSQCNSNQVLEFLRYLDQFGKTKVHVQGCLFFGQA  90

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPLRQAWGSLDALIGRLRAA+EENGG PE NPFA+G IR+YLREVRD QAKAR
Sbjct  91   EPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPEANPFASGTIRLYLREVRDSQAKAR  150

Query  526  GIPY  515
            GIPY
Sbjct  151  GIPY  154



>ref|XP_008342774.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
 ref|XP_009354254.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
 ref|XP_009348397.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
Length=185

 Score =   233 bits (594),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPVALS C+Y HVL+F+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  35   RYESQKRRDWNTFGQYLKNQRPPVALSQCNYNHVLEFLRYLDQFGKTKVHLQGCMFYGQP  94

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPE NPFA+GAIR+YLREVR+ QAKAR
Sbjct  95   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFASGAIRVYLREVRECQAKAR  154

Query  526  GIPY  515
            GIPY
Sbjct  155  GIPY  158



>gb|KHG25854.1| Major vault [Gossypium arboreum]
Length=179

 Score =   232 bits (592),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDW TFGQYLRN+RPPVA+S C+  HVLDF+ YLDQFGKTKVHLQGC+FFGQ 
Sbjct  32   RYESQKRRDWITFGQYLRNRRPPVAISQCNANHVLDFLGYLDQFGKTKVHLQGCMFFGQP  91

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPC C LRQAWGSLDALIGRLRAA+EENGGSPETNPFANGAIR+YLREVRD QAKAR
Sbjct  92   EPPGPCACSLRQAWGSLDALIGRLRAAYEENGGSPETNPFANGAIRIYLREVRDSQAKAR  151

Query  526  GIPY  515
            GIPY
Sbjct  152  GIPY  155



>ref|XP_007215057.1| hypothetical protein PRUPE_ppa012217mg [Prunus persica]
 ref|XP_008229093.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Prunus 
mume]
 gb|EMJ16256.1| hypothetical protein PRUPE_ppa012217mg [Prunus persica]
Length=179

 Score =   232 bits (591),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C+Y HVL+F+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  31   RYESQKRRDWNTFGQYLKNQRPPVPLSQCNYNHVLEFLRYLDQFGKTKVHLQGCMFYGQP  90

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+GAIR+YLREVR+ QAKAR
Sbjct  91   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKAR  150

Query  526  GIPY  515
            GIPY
Sbjct  151  GIPY  154



>ref|XP_007133232.1| hypothetical protein PHAVU_011G162700g [Phaseolus vulgaris]
 gb|AGV54196.1| 177 protein [Phaseolus vulgaris]
 gb|ESW05226.1| hypothetical protein PHAVU_011G162700g [Phaseolus vulgaris]
Length=187

 Score =   232 bits (592),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPVALS C+   VLDF+ YLDQFGKTKVH QGCLFFGQ 
Sbjct  41   RYESQKRRDWNTFGQYLRNQRPPVALSQCNSNQVLDFLRYLDQFGKTKVHAQGCLFFGQV  100

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPL+QAWGSLDALIGRLRAA+EENGG PETNPFA+GAIR+YLREVRD QAKAR
Sbjct  101  EPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAKAR  160

Query  526  GIPY  515
            GIPY
Sbjct  161  GIPY  164



>gb|KDP35079.1| hypothetical protein JCGZ_11031 [Jatropha curcas]
Length=169

 Score =   231 bits (590),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C+  HVLDF+ YLDQFGKTKVH+QGC+F+GQ 
Sbjct  23   RYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHVQGCMFYGQP  82

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+GAIR+YLREVRD QAKAR
Sbjct  83   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRDCQAKAR  142

Query  526  GIPY  515
            GIPY
Sbjct  143  GIPY  146



>gb|KHN36883.1| hypothetical protein glysoja_001614 [Glycine soja]
Length=193

 Score =   232 bits (592),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPVALS C   HVL+F+ YLDQFGKTKVH QGCLFFGQ 
Sbjct  46   RYESQKRRDWNTFGQYLRNQRPPVALSQCSSNHVLEFLRYLDQFGKTKVHSQGCLFFGQT  105

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPLRQAWGSLDALIGRLRAA+EENGG PETNPFA+G IR+YLREVRD QAKAR
Sbjct  106  EPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGTIRVYLREVRDSQAKAR  165

Query  526  GIPY  515
            GIPY
Sbjct  166  GIPY  169



>ref|XP_010277024.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Nelumbo 
nucifera]
Length=182

 Score =   232 bits (591),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV+LS C+ +HVLDF+ YLDQFGKTKVHLQGC+FFGQ 
Sbjct  30   RYESQKRRDWNTFGQYLKNQRPPVSLSQCNCSHVLDFLRYLDQFGKTKVHLQGCVFFGQP  89

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPF +GAIR+YLREVR+ QAKAR
Sbjct  90   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFGSGAIRVYLREVRECQAKAR  149

Query  526  GIPY  515
            GIPY
Sbjct  150  GIPY  153



>ref|XP_006446791.1| hypothetical protein CICLE_v10016699mg [Citrus clementina]
 gb|ESR60031.1| hypothetical protein CICLE_v10016699mg [Citrus clementina]
Length=209

 Score =   233 bits (593),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C   HVLDF+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  63   RYESQKRRDWNTFGQYLKNQRPPVPLSQCSCNHVLDFLRYLDQFGKTKVHLQGCMFYGQP  122

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+GAIR+YLREVR+ QAKAR
Sbjct  123  EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKAR  182

Query  526  GIPY  515
            GIPY
Sbjct  183  GIPY  186



>ref|XP_002280666.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Vitis 
vinifera]
Length=167

 Score =   231 bits (589),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C+  HVLDF+ YLDQFGKTKVHLQGC+FFGQ 
Sbjct  27   RYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFFGQP  86

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDAL+GRLRAA+EENGGSPETNPFA+GAIR+YLREVR+ Q+KAR
Sbjct  87   EPPAPCTCPLRQAWGSLDALVGRLRAAYEENGGSPETNPFASGAIRIYLREVRECQSKAR  146

Query  526  GIPY  515
            GIPY
Sbjct  147  GIPY  150



>ref|XP_004248241.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Solanum 
lycopersicum]
Length=213

 Score =   233 bits (593),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPP++L  C+Y HVLDF+ YLDQFGKTKVHL GCLFFGQ 
Sbjct  57   RYESQKRRDWNTFGQYLKNQRPPISLPQCNYNHVLDFLRYLDQFGKTKVHLHGCLFFGQP  116

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPLRQAWGSLDALIGRLRAA+EENGG  ETNPFA+GAIR+YLREVRD QAKAR
Sbjct  117  EPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLQETNPFASGAIRVYLREVRDSQAKAR  176

Query  526  GIPY  515
            GIPY
Sbjct  177  GIPY  180



>ref|XP_010279129.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nelumbo 
nucifera]
Length=176

 Score =   231 bits (590),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV+LS C  +HVL+F+ YLDQFGKTKVHLQGC+FFGQ 
Sbjct  28   RYESQKRRDWNTFGQYLKNQRPPVSLSQCSCSHVLEFLRYLDQFGKTKVHLQGCIFFGQP  87

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPF +GAIR+YLREVR+ QAKAR
Sbjct  88   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFGSGAIRVYLREVRECQAKAR  147

Query  526  GIPY  515
            GIPY
Sbjct  148  GIPY  151



>ref|XP_003540402.1| PREDICTED: uncharacterized protein LOC100802937 isoform X1 [Glycine 
max]
 ref|XP_006592869.1| PREDICTED: uncharacterized protein LOC100802937 isoform X2 [Glycine 
max]
 gb|KHN27942.1| hypothetical protein glysoja_007674 [Glycine soja]
Length=175

 Score =   231 bits (589),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C+  HVLDF+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  29   RYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYGQP  88

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+G+IR+YL+EVR+ QAKAR
Sbjct  89   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLKEVRECQAKAR  148

Query  526  GIPY  515
            GIPY
Sbjct  149  GIPY  152



>ref|XP_006469013.1| PREDICTED: uncharacterized protein LOC102606613 [Citrus sinensis]
 gb|KDO63369.1| hypothetical protein CISIN_1g047785mg [Citrus sinensis]
Length=174

 Score =   231 bits (589),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C   HVLDF+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  28   RYESQKRRDWNTFGQYLKNQRPPVPLSQCSCNHVLDFLRYLDQFGKTKVHLQGCMFYGQP  87

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+GAIR+YLREVR+ QAKAR
Sbjct  88   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKAR  147

Query  526  GIPY  515
            GIPY
Sbjct  148  GIPY  151



>ref|XP_004516078.1| PREDICTED: uncharacterized protein LOC101514778 [Cicer arietinum]
Length=179

 Score =   231 bits (589),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPVALS C+   VLDF+ YLDQFGKTKVH+QGC+FFGQ 
Sbjct  30   RYESQKRRDWNTFGQYLRNQRPPVALSQCNSNQVLDFLRYLDQFGKTKVHVQGCIFFGQV  89

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPL+QAWGSLDALIGRLRAA+EENGG PETNPFA+GAIR+YLR+VRD QAKAR
Sbjct  90   EPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRLYLRQVRDSQAKAR  149

Query  526  GIPY  515
            GIPY
Sbjct  150  GIPY  153



>emb|CDP06011.1| unnamed protein product [Coffea canephora]
Length=200

 Score =   232 bits (591),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPV LS C++ HVLDF+ YLDQFGKTKVHLQGC+FFG  
Sbjct  52   RYESQKRRDWNTFGQYLRNQRPPVPLSQCNFNHVLDFLRYLDQFGKTKVHLQGCVFFGHP  111

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPLRQAWGSLDALIGRLRAA+EENGG P+ NPFA+GAIR+YLREVRD QAKAR
Sbjct  112  EPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPDKNPFASGAIRVYLREVRDSQAKAR  171

Query  526  GIPY  515
            GIPY
Sbjct  172  GIPY  175



>ref|XP_011085992.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Sesamum 
indicum]
Length=175

 Score =   231 bits (588),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV+LSHC+  HVL+F+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  25   RYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQP  84

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EE+GGSPETNPF NGAIR+YLREV+D QAKAR
Sbjct  85   DPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKDSQAKAR  144

Query  526  GIPY  515
            GIPY
Sbjct  145  GIPY  148



>emb|CAN66524.1| hypothetical protein VITISV_034969 [Vitis vinifera]
Length=158

 Score =   230 bits (586),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C+  HVLDF+ YLDQFGKTKVHLQGC+FFGQ 
Sbjct  27   RYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFFGQP  86

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDAL+GRLRAA+EENGGSPETNPFA+GAIR+YLREVR+ Q+KAR
Sbjct  87   EPPAPCTCPLRQAWGSLDALVGRLRAAYEENGGSPETNPFASGAIRIYLREVRECQSKAR  146

Query  526  GIPY  515
            GIPY
Sbjct  147  GIPY  150



>gb|KHN36698.1| hypothetical protein glysoja_001429 [Glycine soja]
Length=175

 Score =   231 bits (588),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C+  HVLDF+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  29   RYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYGQP  88

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+G+IR+YL+E+R+ QAKAR
Sbjct  89   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLKEIRECQAKAR  148

Query  526  GIPY  515
            GIPY
Sbjct  149  GIPY  152



>ref|XP_002320411.1| hypothetical protein POPTR_0014s13900g [Populus trichocarpa]
 gb|ABK93899.1| unknown [Populus trichocarpa]
 gb|EEE98726.1| hypothetical protein POPTR_0014s13900g [Populus trichocarpa]
Length=170

 Score =   230 bits (587),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C+  HVLDF+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  24   RYESQKRRDWNTFGQYLKNQRPPVPLSQCNSNHVLDFLRYLDQFGKTKVHLQGCMFYGQP  83

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGG+PETNPFAN +IR+YLREVRD QAKAR
Sbjct  84   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTPETNPFANASIRVYLREVRDYQAKAR  143

Query  526  GIPY  515
            GIP+
Sbjct  144  GIPH  147



>ref|XP_007132855.1| hypothetical protein PHAVU_011G130300g [Phaseolus vulgaris]
 gb|ESW04849.1| hypothetical protein PHAVU_011G130300g [Phaseolus vulgaris]
Length=183

 Score =   231 bits (588),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C+  HVLDF+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  38   RYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYGQP  97

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+G+IR+YLREVR+ QAKAR
Sbjct  98   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLREVRECQAKAR  157

Query  526  GIPY  515
            GIPY
Sbjct  158  GIPY  161



>ref|XP_004303183.1| PREDICTED: uncharacterized protein LOC101307414 [Fragaria vesca 
subsp. vesca]
Length=209

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPV LS C+Y+HVL+F+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  39   RYESQKRRDWNTFGQYLRNQRPPVPLSQCNYSHVLEFLRYLDQFGKTKVHLQGCMFYGQP  98

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGG+PE+NPFA+GAIR+YLREVR+ QAKAR
Sbjct  99   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGAPESNPFASGAIRVYLREVRECQAKAR  158

Query  526  GIPY  515
            GIPY
Sbjct  159  GIPY  162



>ref|XP_007048693.1| Pleckstrin domain-containing family N member 1 [Theobroma cacao]
 gb|EOX92850.1| Pleckstrin domain-containing family N member 1 [Theobroma cacao]
Length=212

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C+  HVLDF+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  66   RYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYGQP  125

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+GAIR+YLREVR+ QAKAR
Sbjct  126  EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKAR  185

Query  526  GIPY  515
            GIPY
Sbjct  186  GIPY  189



>ref|XP_010035859.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Eucalyptus 
grandis]
 gb|KCW47341.1| hypothetical protein EUGRSUZ_K01128 [Eucalyptus grandis]
Length=174

 Score =   230 bits (587),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWN F QYL+NQRPPV LS C+YTHVL+F+ YLDQFGKTKVH+QGC+F+GQ 
Sbjct  27   RYESQKRRDWNAFIQYLKNQRPPVPLSQCNYTHVLEFLRYLDQFGKTKVHIQGCIFYGQP  86

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGG+PETNPFA+GAIR+YLREVRD Q+KAR
Sbjct  87   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTPETNPFASGAIRVYLREVRDCQSKAR  146

Query  526  GIPY  515
            GIPY
Sbjct  147  GIPY  150



>ref|XP_002521586.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40857.1| conserved hypothetical protein [Ricinus communis]
Length=174

 Score =   230 bits (587),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C+  HVLDF+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  27   RYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYGQP  86

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+GAIR++LREVRD QAKAR
Sbjct  87   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVFLREVRDCQAKAR  146

Query  526  GIPY  515
            GIPY
Sbjct  147  GIPY  150



>ref|XP_004243287.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Solanum 
lycopersicum]
Length=167

 Score =   230 bits (586),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPV++S C+  HVL+F+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  21   RYESQKRRDWNTFGQYLRNQRPPVSISQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQP  80

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+GAIR+YLREV++ QAKAR
Sbjct  81   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQAKAR  140

Query  526  GIPY  515
            GIPY
Sbjct  141  GIPY  144



>ref|XP_009770169.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=206

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS+C+Y HVLDF+ YLDQFGKTKVHL GCLFFGQ 
Sbjct  49   RYESQKRRDWNTFGQYLKNQRPPVPLSNCNYNHVLDFLRYLDQFGKTKVHLHGCLFFGQP  108

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P GPCTCPLRQAWGSLDALIGRLRAA+EENGG P +NPFA+GAIR+YLRE+RD QAKAR
Sbjct  109  DPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPVSNPFASGAIRVYLREIRDSQAKAR  168

Query  526  GIPY  515
            GIPY
Sbjct  169  GIPY  172



>ref|XP_006348870.1| PREDICTED: uncharacterized protein LOC102600485 [Solanum tuberosum]
Length=173

 Score =   230 bits (587),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPV++S C+  HVL+F+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  27   RYESQKRRDWNTFGQYLRNQRPPVSMSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQP  86

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+GAIR+YLREV++ QAKAR
Sbjct  87   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQAKAR  146

Query  526  GIPY  515
            GIPY
Sbjct  147  GIPY  150



>gb|KHG07235.1| Putative beta-lactamase-like 1 [Gossypium arboreum]
Length=175

 Score =   230 bits (587),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C+  HVLDF+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  29   RYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYGQP  88

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+GAIR+YLREVR+ QAKAR
Sbjct  89   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKAR  148

Query  526  GIPY  515
            GIPY
Sbjct  149  GIPY  152



>ref|XP_011033736.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Populus 
euphratica]
 ref|XP_011033737.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Populus 
euphratica]
 ref|XP_011033738.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Populus 
euphratica]
Length=170

 Score =   230 bits (586),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C+  HVLDF+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  24   RYESQKRRDWNTFGQYLKNQRPPVPLSQCNSNHVLDFLRYLDQFGKTKVHLQGCMFYGQP  83

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGG+PETNPFAN +IR+YLREVRD QAKAR
Sbjct  84   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTPETNPFANASIRVYLREVRDYQAKAR  143

Query  526  GIPY  515
            GIP+
Sbjct  144  GIPH  147



>ref|XP_010052695.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Eucalyptus 
grandis]
 gb|KCW89641.1| hypothetical protein EUGRSUZ_A01916 [Eucalyptus grandis]
Length=176

 Score =   229 bits (585),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFG YLRNQRPPV LS C+  HVL+F+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  28   RYESQKRRDWNTFGHYLRNQRPPVPLSQCNCNHVLEFLRYLDQFGKTKVHLQGCVFYGQP  87

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+GAIR+YLREVR+ QAKAR
Sbjct  88   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKAR  147

Query  526  GIPY  515
            GIPY
Sbjct  148  GIPY  151



>gb|EYU45022.1| hypothetical protein MIMGU_mgv1a014215mg [Erythranthe guttata]
Length=197

 Score =   230 bits (587),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPV L  C+Y+HVL+FM YLDQFGKTKVH QGC FFGQ 
Sbjct  42   RYESQKRRDWNTFGQYLRNQRPPVGLPQCNYSHVLEFMRYLDQFGKTKVHGQGCPFFGQP  101

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPC CPLRQAWGSLDAL+GRLRAA+EENGGS ETNPFANGAIR+YLREVRD QAKAR
Sbjct  102  EPAGPCACPLRQAWGSLDALVGRLRAAYEENGGSQETNPFANGAIRVYLREVRDSQAKAR  161

Query  526  GIPY  515
            GIPY
Sbjct  162  GIPY  165



>gb|AES67378.2| DUF640 family protein [Medicago truncatula]
Length=167

 Score =   229 bits (583),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL N RPPV LSHC+  HVL+F+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  23   RYESQKRRDWNTFGQYLNNLRPPVPLSHCNSNHVLEFLRYLDQFGKTKVHLQGCMFYGQP  82

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGG+PETNPFA+GAIR+YLREVR+ QAKAR
Sbjct  83   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTPETNPFASGAIRVYLREVRECQAKAR  142

Query  526  GIPY  515
            GIPY
Sbjct  143  GIPY  146



>ref|XP_009133547.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Brassica 
rapa]
Length=177

 Score =   229 bits (584),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV +SHC+  HVLDF+ YLDQFGKTKVH+ GC+F+GQ 
Sbjct  25   RYESQKRRDWNTFGQYLKNQRPPVPMSHCNCNHVLDFLRYLDQFGKTKVHVPGCMFYGQP  84

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+GAIR+YLREVR+ QAKAR
Sbjct  85   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKAR  144

Query  526  GIPY  515
            GIPY
Sbjct  145  GIPY  148



>ref|XP_010108230.1| hypothetical protein L484_018651 [Morus notabilis]
 gb|EXC18470.1| hypothetical protein L484_018651 [Morus notabilis]
Length=184

 Score =   229 bits (584),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRR W TFGQYLRNQRPPVALS C+  HVLDF+ YLDQFGKTKVHLQGC+FFGQ 
Sbjct  34   RYESQKRRGWETFGQYLRNQRPPVALSQCNGNHVLDFLRYLDQFGKTKVHLQGCVFFGQP  93

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPC+CPLRQAWGSLDALIGRLRAA+EENGG PETNPFA+GAIR+YLR+VRD QAKAR
Sbjct  94   EPPGPCSCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLRDVRDSQAKAR  153

Query  526  GIPY  515
            GIPY
Sbjct  154  GIPY  157



>ref|XP_009786006.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=177

 Score =   229 bits (583),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPV++S C+  HVL+F+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  27   RYESQKRRDWNTFGQYLRNQRPPVSISQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQP  86

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+GAIR+YLREV++ Q+KAR
Sbjct  87   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQSKAR  146

Query  526  GIPY  515
            GIPY
Sbjct  147  GIPY  150



>emb|CDP15936.1| unnamed protein product [Coffea canephora]
Length=170

 Score =   228 bits (582),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C+ +HVL+F+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  22   RYESQKRRDWNTFGQYLKNQRPPVPLSQCNSSHVLEFLRYLDQFGKTKVHLQGCMFYGQP  81

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPE+NPFA+GAIR+YLREV++ QAKAR
Sbjct  82   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPESNPFASGAIRVYLREVKECQAKAR  141

Query  526  GIPY  515
            GIPY
Sbjct  142  GIPY  145



>ref|XP_010508549.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Camelina 
sativa]
 ref|XP_010508550.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Camelina 
sativa]
 ref|XP_010517796.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Camelina 
sativa]
 ref|XP_010517797.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Camelina 
sativa]
Length=178

 Score =   229 bits (583),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV +SHC   HVLDF+ YLDQFGKTKVH+ GC+F+GQ 
Sbjct  25   RYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVPGCMFYGQP  84

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+GAIR+YLREVR+ QAKAR
Sbjct  85   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKAR  144

Query  526  GIPY  515
            GIPY
Sbjct  145  GIPY  148



>ref|XP_010506094.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Camelina 
sativa]
 ref|XP_010506095.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Camelina 
sativa]
Length=178

 Score =   229 bits (583),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV +SHC   HVLDF+ YLDQFGKTKVH+ GC+F+GQ 
Sbjct  25   RYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVPGCMFYGQP  84

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+GAIR+YLREVR+ QAKAR
Sbjct  85   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKAR  144

Query  526  GIPY  515
            GIPY
Sbjct  145  GIPY  148



>ref|NP_001235660.1| uncharacterized protein LOC100306225 [Glycine max]
 gb|ACU14309.1| unknown [Glycine max]
Length=175

 Score =   229 bits (583),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C+  HVLDF+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  29   RYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYGQP  88

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDAL GRLRAA+EENGGSPETNPFA+G+IR+YL+E+R+ QAKAR
Sbjct  89   EPPAPCTCPLRQAWGSLDALTGRLRAAYEENGGSPETNPFASGSIRVYLKEIRECQAKAR  148

Query  526  GIPY  515
            GIPY
Sbjct  149  GIPY  152



>ref|XP_003597127.1| 177 protein [Medicago truncatula]
Length=186

 Score =   229 bits (583),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL N RPPV LSHC+  HVL+F+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  23   RYESQKRRDWNTFGQYLNNLRPPVPLSHCNSNHVLEFLRYLDQFGKTKVHLQGCMFYGQP  82

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGG+PETNPFA+GAIR+YLREVR+ QAKAR
Sbjct  83   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTPETNPFASGAIRVYLREVRECQAKAR  142

Query  526  GIPY  515
            GIPY
Sbjct  143  GIPY  146



>ref|XP_006296565.1| hypothetical protein CARUB_v100241591mg [Capsella rubella]
 ref|XP_006296566.1| hypothetical protein CARUB_v100241591mg [Capsella rubella]
 gb|EOA29463.1| hypothetical protein CARUB_v100241591mg [Capsella rubella]
 gb|EOA29464.1| hypothetical protein CARUB_v100241591mg [Capsella rubella]
Length=178

 Score =   228 bits (582),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV +SHC   HVLDF+ YLDQFGKTKVH+ GC+F+GQ 
Sbjct  25   RYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVPGCMFYGQP  84

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+GAIR+YLREVR+ QAKAR
Sbjct  85   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKAR  144

Query  526  GIPY  515
            GIPY
Sbjct  145  GIPY  148



>ref|XP_009593391.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
 ref|XP_009593396.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=177

 Score =   228 bits (582),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPPV++S C+  HVL+F+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  27   RYESQKRRDWNTFGQYLRNQRPPVSISQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQP  86

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+GAIR+YLREV++ Q+KAR
Sbjct  87   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQSKAR  146

Query  526  GIPY  515
            GIPY
Sbjct  147  GIPY  150



>gb|EPS59921.1| hypothetical protein M569_14884, partial [Genlisea aurea]
Length=143

 Score =   227 bits (578),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL+NQRPPV L HC+Y+HVLDFM YLDQFGKTKVHL+GC+FFGQ 
Sbjct  13   RYESQKRRDWNTFRQYLKNQRPPVPLEHCNYSHVLDFMRYLDQFGKTKVHLRGCVFFGQP  72

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P G CTCPLRQAWGSLDAL+GRLRAA+E NGGS ETNPFA+GAIR+YLREVRD+QAKAR
Sbjct  73   DPDGACTCPLRQAWGSLDALVGRLRAAYEGNGGSQETNPFADGAIRVYLREVRDLQAKAR  132

Query  526  GIPY  515
            GIPY
Sbjct  133  GIPY  136



>ref|XP_011083008.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Sesamum 
indicum]
Length=172

 Score =   228 bits (581),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQ+L+NQRPPVAL  C+  HVLDF+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  26   RYESQKRRDWNTFGQFLKNQRPPVALPQCNSNHVLDFLRYLDQFGKTKVHLQGCIFYGQP  85

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+GAIR+YLREV++ QAKAR
Sbjct  86   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRIYLREVKECQAKAR  145

Query  526  GIPY  515
            GIPY
Sbjct  146  GIPY  149



>ref|XP_009774704.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=190

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDW TFGQYL+N +PPV LS+C+Y HVLDF+ YLDQFGKTKVHL GC+FFG++
Sbjct  39   RYESQKRRDWTTFGQYLKNHKPPVPLSNCNYNHVLDFLRYLDQFGKTKVHLHGCVFFGES  98

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            E GGPCTCPLRQAWGSLDALIGRLRAA+EENGG  ETNPFAN AIR+YLREVRD QAKAR
Sbjct  99   EQGGPCTCPLRQAWGSLDALIGRLRAAYEENGGLQETNPFANSAIRIYLREVRDSQAKAR  158

Query  526  GIPY  515
            GIPY
Sbjct  159  GIPY  162



>ref|XP_007149738.1| hypothetical protein PHAVU_005G095100g [Phaseolus vulgaris]
 gb|AGV54192.1| hypothetical protein [Phaseolus vulgaris]
 gb|ESW21732.1| hypothetical protein PHAVU_005G095100g [Phaseolus vulgaris]
Length=165

 Score =   227 bits (579),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C+  HVLDF+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  22   RYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCVFYGQP  81

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA  +IR+YL+E+R+ QAKAR
Sbjct  82   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFATSSIRLYLKEIRECQAKAR  141

Query  526  GIPY  515
            GIPY
Sbjct  142  GIPY  145



>ref|XP_010052190.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Eucalyptus 
grandis]
 gb|KCW76110.1| hypothetical protein EUGRSUZ_D00487 [Eucalyptus grandis]
Length=177

 Score =   228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQ+PPVALS C+  HVL+F+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  32   RYESQKRRDWNTFGQYLRNQKPPVALSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQR  91

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGG+PE NPF NGAIR+YLREV++ QAKAR
Sbjct  92   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGAPENNPFGNGAIRVYLREVKECQAKAR  151

Query  526  GIPY  515
            GIPY
Sbjct  152  GIPY  155



>ref|XP_004487154.1| PREDICTED: uncharacterized protein LOC101499419 [Cicer arietinum]
Length=166

 Score =   227 bits (579),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL NQRPP+ LSHC+  HVL+F+ YLDQFGKTKVHLQGC+FFGQ 
Sbjct  21   RYESQKRRDWNTFGQYLNNQRPPIPLSHCNCNHVLEFLRYLDQFGKTKVHLQGCMFFGQP  80

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGS ETNPFA+ AIR+YLREVR+ QAKAR
Sbjct  81   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSQETNPFASSAIRVYLREVRECQAKAR  140

Query  526  GIPY  515
            GIPY
Sbjct  141  GIPY  144



>gb|KCW67509.1| hypothetical protein EUGRSUZ_F01238 [Eucalyptus grandis]
 gb|KCW67510.1| hypothetical protein EUGRSUZ_F01238 [Eucalyptus grandis]
Length=184

 Score =   228 bits (581),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL NQRPPVA+S C+ THVL+F+ YLDQFGKTKVH  GC++FGQ 
Sbjct  34   RYESQKRRDWNTFGQYLSNQRPPVAISQCNSTHVLEFLRYLDQFGKTKVHFNGCVYFGQP  93

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPL+QAWGSLDALIGRLRAA+EENGG PETNPFA+ +IR+YLREVRD QAKAR
Sbjct  94   EPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASSSIRVYLREVRDSQAKAR  153

Query  526  GIPY  515
            GIPY
Sbjct  154  GIPY  157



>ref|XP_008371461.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
 ref|XP_008371462.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
 ref|XP_009349575.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
 ref|XP_009349639.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
Length=187

 Score =   228 bits (581),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQ PPV+LSHC+  HVLDF+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  41   RYESQKRRDWNTFGQYLKNQSPPVSLSHCNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQP  100

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EE+GGSPETNPF NGAIR+YLREV++ QAKAR
Sbjct  101  DPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAKAR  160

Query  526  GIPY  515
            GIPY
Sbjct  161  GIPY  164



>ref|XP_008448236.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Cucumis 
melo]
Length=200

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPVALS C++ HVL+F+ YLDQFGKTKVH+QGC+F+GQ 
Sbjct  31   RYESQKRRDWNTFGQYLKNQRPPVALSQCNFNHVLEFLRYLDQFGKTKVHVQGCMFYGQP  90

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPL+QAWGSLDALIGRLRAA+EENGGSPETNPFA+ +IR+YLREVR+ QAKAR
Sbjct  91   EPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASASIRVYLREVRECQAKAR  150

Query  526  GIPY  515
            GIPY
Sbjct  151  GIPY  154



>ref|XP_002522583.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39883.1| conserved hypothetical protein [Ricinus communis]
Length=180

 Score =   228 bits (580),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV+LS C+  HVLDF+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  32   RYESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQP  91

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EE+GGSPETNPF NGAIR+YLREVR+ QAKAR
Sbjct  92   DPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRECQAKAR  151

Query  526  GIPY  515
            GIPY
Sbjct  152  GIPY  155



>ref|XP_010062813.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7 [Eucalyptus 
grandis]
 ref|XP_010062814.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7 [Eucalyptus 
grandis]
 ref|XP_010062815.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7 [Eucalyptus 
grandis]
 gb|KCW69948.1| hypothetical protein EUGRSUZ_F03266 [Eucalyptus grandis]
Length=182

 Score =   228 bits (580),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPP+A++  +  HVLDF+ YLDQFGKTKVHL GC++FGQ 
Sbjct  34   RYESQKRRDWNTFGQYLRNQRPPIAITQFNSNHVLDFLRYLDQFGKTKVHLHGCIYFGQP  93

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPLRQAWGSLDALIGRLRAA+EENGG PE NPFA+G+IRMYLREV+D QAKAR
Sbjct  94   EPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPEANPFASGSIRMYLREVKDSQAKAR  153

Query  526  GIPY  515
            GIPY
Sbjct  154  GIPY  157



>emb|CDY55387.1| BnaA05g34250D [Brassica napus]
Length=178

 Score =   227 bits (579),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPP+ +SHC+  HVLDF+ YLDQFGKTKVH+ GC+F+GQ 
Sbjct  25   RYESQKRRDWNTFGQYLRNQRPPLPMSHCNCNHVLDFLRYLDQFGKTKVHVPGCMFYGQP  84

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+GAIR+YLREVR+ QAKAR
Sbjct  85   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKAR  144

Query  526  GIPY  515
            GIP+
Sbjct  145  GIPF  148



>emb|CDO96796.1| unnamed protein product [Coffea canephora]
Length=189

 Score =   228 bits (580),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV+LS C+  HVL+F+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  40   RYESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQP  99

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPF NGAIR+YLREV++ QAKAR
Sbjct  100  DPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFGNGAIRVYLREVKECQAKAR  159

Query  526  GIPY  515
            GIPY
Sbjct  160  GIPY  163



>gb|ACJ85482.1| unknown [Medicago truncatula]
 gb|AFK37885.1| unknown [Medicago truncatula]
Length=167

 Score =   227 bits (578),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL N RPPV LSHC+  HVL+F+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  23   RYESQKRRDWNTFGQYLNNLRPPVPLSHCNSNHVLEFLRYLDQFGKTKVHLQGCMFYGQP  82

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGG+PETNPFA+GAIR+YLREVR+ +AKAR
Sbjct  83   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGAPETNPFASGAIRVYLREVRECRAKAR  142

Query  526  GIPY  515
            GIPY
Sbjct  143  GIPY  146



>gb|KDP21096.1| hypothetical protein JCGZ_21567 [Jatropha curcas]
Length=182

 Score =   227 bits (579),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV+LS C+  HVLDF+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  35   RYESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQP  94

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EE+GGSPETNPF NGAIR+YLREVR+ QAKAR
Sbjct  95   DPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRECQAKAR  154

Query  526  GIPY  515
            GIPY
Sbjct  155  GIPY  158



>ref|XP_003526225.1| PREDICTED: uncharacterized protein LOC100815968 [Glycine max]
 gb|KHN33957.1| hypothetical protein glysoja_036764 [Glycine soja]
Length=179

 Score =   227 bits (579),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C+   VLDF+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  33   RYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNQVLDFLRYLDQFGKTKVHLQGCMFYGQP  92

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+G+IR+YLREVR+ QAKAR
Sbjct  93   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLREVRECQAKAR  152

Query  526  GIPY  515
            GIPY
Sbjct  153  GIPY  156



>ref|XP_008358651.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
 ref|XP_009352770.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
Length=190

 Score =   228 bits (580),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQ PPV+LSHC+  HVLDF+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  41   RYESQKRRDWNTFGQYLKNQSPPVSLSHCNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQP  100

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EE+GGSPETNPF NGAIR+YLREV++ QAKAR
Sbjct  101  DPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAKAR  160

Query  526  GIPY  515
            GIPY
Sbjct  161  GIPY  164



>gb|AFK41155.1| unknown [Lotus japonicus]
Length=185

 Score =   227 bits (579),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQK+RDWNTFGQYLRNQRPPVALS C+  HVL+F+ YLDQFGKTKVH QGCLFFGQ 
Sbjct  38   RYESQKKRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHSQGCLFFGQT  97

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPL+QAWGSLDALIGRLRAA+EENGG PETNPFA+G+IR++L EVRD QAKAR
Sbjct  98   EPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGSIRVHLHEVRDFQAKAR  157

Query  526  GIPY  515
            GIPY
Sbjct  158  GIPY  161



>ref|NP_565978.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_850374.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9S7R3.1|LSH10_ARATH RecName: Full=Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10; AltName: 
Full=Protein ORGAN BOUNDARY 10 [Arabidopsis thaliana]
 gb|AAF24517.1|AF218765_1 177 protein [Arabidopsis thaliana]
 gb|AAD22993.1| expressed protein [Arabidopsis thaliana]
 dbj|BAC43308.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC43624.1| unknown protein [Arabidopsis thaliana]
 gb|AAO39968.1| At2g42610 [Arabidopsis thaliana]
 gb|ABQ85148.1| unknown [Arabidopsis thaliana]
 gb|ABQ85149.1| unknown [Arabidopsis thaliana]
 gb|ABQ85150.1| unknown [Arabidopsis thaliana]
 gb|ABQ85151.1| unknown [Arabidopsis thaliana]
 gb|ABQ85152.1| unknown [Arabidopsis thaliana]
 gb|ABQ85153.1| unknown [Arabidopsis thaliana]
 gb|ABQ85154.1| unknown [Arabidopsis thaliana]
 gb|ABQ85155.1| unknown [Arabidopsis thaliana]
 gb|ABQ85156.1| unknown [Arabidopsis thaliana]
 gb|ABQ85157.1| unknown [Arabidopsis thaliana]
 gb|ABQ85158.1| unknown [Arabidopsis thaliana]
 gb|ABQ85159.1| unknown [Arabidopsis thaliana]
 gb|ABQ85160.1| unknown [Arabidopsis thaliana]
 gb|ABQ85161.1| unknown [Arabidopsis thaliana]
 gb|ABQ85162.1| unknown [Arabidopsis thaliana]
 gb|ABQ85163.1| unknown [Arabidopsis thaliana]
 gb|ABQ85164.1| unknown [Arabidopsis thaliana]
 gb|ABQ85165.1| unknown [Arabidopsis thaliana]
 gb|ABQ85166.1| unknown [Arabidopsis thaliana]
 gb|ABQ85167.1| unknown [Arabidopsis thaliana]
 gb|ABQ85168.1| unknown [Arabidopsis thaliana]
 gb|ABQ85169.1| unknown [Arabidopsis thaliana]
 gb|ABQ85170.1| unknown [Arabidopsis thaliana]
 gb|ABQ85171.1| unknown [Arabidopsis thaliana]
 gb|AEC10147.1| uncharacterized protein AT2G42610 [Arabidopsis thaliana]
 gb|AEC10148.1| uncharacterized protein AT2G42610 [Arabidopsis thaliana]
Length=177

 Score =   227 bits (578),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV +SHC   HVLDF+ YLDQFGKTKVH+ GC+F+GQ 
Sbjct  25   RYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVPGCMFYGQP  84

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGG PETNPFA+GAIR+YLREVR+ QAKAR
Sbjct  85   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGPPETNPFASGAIRVYLREVRECQAKAR  144

Query  526  GIPY  515
            GIPY
Sbjct  145  GIPY  148



>ref|XP_009773140.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=188

 Score =   227 bits (579),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPVALS C+  HVL+F+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  33   RYESQKRRDWNTFGQYLKNQRPPVALSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQP  92

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPE NPF NGAIR+YLREV++ QAKAR
Sbjct  93   DPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRLYLREVKECQAKAR  152

Query  526  GIPY  515
            GIPY
Sbjct  153  GIPY  156



>ref|XP_007025375.1| Beta-lactamase-like protein ENSP00000383859 [Theobroma cacao]
 gb|EOY27997.1| Beta-lactamase-like protein ENSP00000383859 [Theobroma cacao]
Length=179

 Score =   227 bits (578),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPVALS C+  HVLDF+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  31   RYESQKRRDWNTFGQYLKNQRPPVALSQCNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQP  90

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EE+GGS ETNPF NGAIR+YLREVR+ QAKAR
Sbjct  91   DPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSSETNPFGNGAIRVYLREVRECQAKAR  150

Query  526  GIPY  515
            GIPY
Sbjct  151  GIPY  154



>emb|CDY14848.1| BnaC04g48450D [Brassica napus]
Length=177

 Score =   227 bits (578),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV +SHC   HVLDF+ YLDQFGKTKVH+ GC+F+GQ 
Sbjct  25   RYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVFGCMFYGQP  84

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA GAIR+YLREVR+ QAKAR
Sbjct  85   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFATGAIRVYLREVRECQAKAR  144

Query  526  GIPY  515
            GIPY
Sbjct  145  GIPY  148



>emb|CAN63025.1| hypothetical protein VITISV_034817 [Vitis vinifera]
Length=177

 Score =   227 bits (578),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQ+L+NQRPPVAL+ C+   VLDF+ YLDQFGKTKVHLQGC++FGQ 
Sbjct  30   RYESQKRRDWNTFGQFLKNQRPPVALAQCNSNQVLDFLRYLDQFGKTKVHLQGCVYFGQP  89

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPL+QAWGSLDALIGRLRAA+EENGG PE NPFA+GAIR+YLREVRD QAKAR
Sbjct  90   EPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPEKNPFASGAIRIYLREVRDSQAKAR  149

Query  526  GIPY  515
            G+PY
Sbjct  150  GVPY  153



>ref|XP_009142076.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Brassica 
rapa]
 emb|CDY47983.1| BnaA04g24610D [Brassica napus]
Length=176

 Score =   226 bits (577),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV +SHC   HVLDF+ YLDQFGKTKVH+ GC+F+GQ 
Sbjct  25   RYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVFGCMFYGQP  84

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA GAIR+YLREVR+ QAKAR
Sbjct  85   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFATGAIRVYLREVRECQAKAR  144

Query  526  GIPY  515
            GIPY
Sbjct  145  GIPY  148



>ref|XP_002879996.1| hypothetical protein ARALYDRAFT_903634 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56255.1| hypothetical protein ARALYDRAFT_903634 [Arabidopsis lyrata subsp. 
lyrata]
Length=177

 Score =   226 bits (577),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV +SHC   HVLDF+ YLDQFGKTKVH+ GC+F+GQ 
Sbjct  25   RYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVPGCMFYGQP  84

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPE NPFA+GAIR+YLREVR+ QAKAR
Sbjct  85   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPEANPFASGAIRVYLREVRECQAKAR  144

Query  526  GIPY  515
            GIPY
Sbjct  145  GIPY  148



>ref|XP_006362411.1| PREDICTED: uncharacterized protein LOC102591189 [Solanum tuberosum]
Length=191

 Score =   227 bits (578),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV+LS C+  HVL+F+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  34   RYESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQP  93

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPE NPF NGAIR+YLREV++ QAKAR
Sbjct  94   DPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRLYLREVKECQAKAR  153

Query  526  GIPY  515
            GIPY
Sbjct  154  GIPY  157



>ref|XP_002285447.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Vitis 
vinifera]
Length=220

 Score =   228 bits (580),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQ+L+NQRPPVAL+ C+   VLDF+ YLDQFGKTKVHLQGC++FGQ 
Sbjct  73   RYESQKRRDWNTFGQFLKNQRPPVALAQCNSNQVLDFLRYLDQFGKTKVHLQGCVYFGQP  132

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPL+QAWGSLDALIGRLRAA+EENGG PE NPFA+GAIR+YLREVRD QAKAR
Sbjct  133  EPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPEKNPFASGAIRIYLREVRDSQAKAR  192

Query  526  GIPY  515
            G+PY
Sbjct  193  GVPY  196



>ref|XP_006411528.1| hypothetical protein EUTSA_v10017308mg [Eutrema salsugineum]
 gb|ESQ52981.1| hypothetical protein EUTSA_v10017308mg [Eutrema salsugineum]
Length=177

 Score =   226 bits (577),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRP V +SHC   HVLDF+ YLDQFGKTKVH+ GC+F+GQ 
Sbjct  25   RYESQKRRDWNTFGQYLKNQRPSVPMSHCSCNHVLDFLRYLDQFGKTKVHVPGCMFYGQP  84

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+GAIR+YLREVR+ QAKAR
Sbjct  85   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKAR  144

Query  526  GIPY  515
            GIPY
Sbjct  145  GIPY  148



>ref|XP_006467647.1| PREDICTED: uncharacterized protein LOC102611919 [Citrus sinensis]
 gb|KDO77861.1| hypothetical protein CISIN_1g029090mg [Citrus sinensis]
Length=199

 Score =   227 bits (578),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV+LS C   HVLDF+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  50   RYESQKRRDWNTFGQYLKNQRPPVSLSQCSCNHVLDFLRYLDQFGKTKVHLHGCVFFGQP  109

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EE+GGSPETNPF NGAIR+YLREVR+ QAKAR
Sbjct  110  DPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRECQAKAR  169

Query  526  GIPY  515
            GIPY
Sbjct  170  GIPY  173



>ref|XP_003607586.1| 177 protein [Medicago truncatula]
 gb|AES89783.1| DUF640 family protein [Medicago truncatula]
Length=176

 Score =   226 bits (576),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL N RPPV LS C+  HVLDF+ YLDQFGKTKVH+QGC+F+GQ 
Sbjct  29   RYESQKRRDWNTFGQYLNNMRPPVPLSQCNSNHVLDFLRYLDQFGKTKVHVQGCMFYGQP  88

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSP+TNPFA+G+IR+YLRE+R+ QAKAR
Sbjct  89   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPDTNPFASGSIRVYLREIRESQAKAR  148

Query  526  GIPY  515
            GIPY
Sbjct  149  GIPY  152



>ref|XP_010655519.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Vitis 
vinifera]
 ref|XP_010655520.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Vitis 
vinifera]
Length=175

 Score =   226 bits (576),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV+L+ C   HVL+F+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  29   RYESQKRRDWNTFGQYLKNQRPPVSLAQCSCNHVLEFLRYLDQFGKTKVHLHGCVFFGQP  88

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EE+GGSPETNPF NGAIR+YLREVRD Q+KAR
Sbjct  89   DPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDCQSKAR  148

Query  526  GIPY  515
            GIPY
Sbjct  149  GIPY  152



>ref|XP_006358940.1| PREDICTED: uncharacterized protein LOC102602985 [Solanum tuberosum]
Length=205

 Score =   227 bits (578),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C+Y HVL+F+ YLDQFGKTKVHL GC FFGQ 
Sbjct  51   RYESQKRRDWNTFGQYLKNQRPPVPLSQCNYNHVLEFLRYLDQFGKTKVHLHGCPFFGQP  110

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPLRQAWGSLDALIGRLRAA+EENGG PE NPFA+G+IR+YLREVRD QAKAR
Sbjct  111  EPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPENNPFASGSIRVYLREVRDFQAKAR  170

Query  526  GIPY  515
            GI Y
Sbjct  171  GISY  174



>emb|CAN72178.1| hypothetical protein VITISV_012478 [Vitis vinifera]
Length=175

 Score =   226 bits (576),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV+L+ C   HVL+F+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  29   RYESQKRRDWNTFGQYLKNQRPPVSLAQCSCNHVLEFLRYLDQFGKTKVHLHGCVFFGQP  88

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EE+GGSPETNPF NGAIR+YLREVRD Q+KAR
Sbjct  89   DPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDCQSKAR  148

Query  526  GIPY  515
            GIPY
Sbjct  149  GIPY  152



>ref|XP_010109876.1| hypothetical protein L484_003806 [Morus notabilis]
 gb|EXC24829.1| hypothetical protein L484_003806 [Morus notabilis]
Length=194

 Score =   226 bits (577),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQK+RDWNTFGQYL+NQ PPVALS C+  HVLDF+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  42   RYESQKKRDWNTFGQYLKNQTPPVALSQCNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQP  101

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EE+GGSPETNPF NGAIR+YLREV++ QAKAR
Sbjct  102  DPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAKAR  161

Query  526  GIPY  515
            GIPY
Sbjct  162  GIPY  165



>ref|XP_010104392.1| hypothetical protein L484_010344 [Morus notabilis]
 gb|EXC00237.1| hypothetical protein L484_010344 [Morus notabilis]
Length=173

 Score =   226 bits (575),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C+  HVLDF+ YLDQFGKTKVH+QGC+F+GQ 
Sbjct  25   RYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHVQGCMFYGQP  84

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGG PETNPFA+GAIR+YLREVR+ QAKAR
Sbjct  85   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGFPETNPFASGAIRVYLREVRECQAKAR  144

Query  526  GIPY  515
            GIPY
Sbjct  145  GIPY  148



>ref|XP_008381217.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
Length=181

 Score =   226 bits (576),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPVALS  +Y HVL+F+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  31   RYESQKRRDWNTFGQYLKNQRPPVALSQSNYNHVLEFLRYLDQFGKTKVHLQGCMFYGQP  90

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPE NPFA+GAIR+YLREVR+ QA AR
Sbjct  91   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFASGAIRVYLREVRECQAMAR  150

Query  526  GIPY  515
            GIP+
Sbjct  151  GIPF  154



>ref|XP_006449503.1| hypothetical protein CICLE_v10016772mg [Citrus clementina]
 ref|XP_006449504.1| hypothetical protein CICLE_v10016772mg [Citrus clementina]
 gb|ESR62743.1| hypothetical protein CICLE_v10016772mg [Citrus clementina]
 gb|ESR62744.1| hypothetical protein CICLE_v10016772mg [Citrus clementina]
Length=199

 Score =   226 bits (577),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV+LS C   HVLDF+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  50   RYESQKRRDWNTFGQYLKNQRPPVSLSQCSCNHVLDFLRYLDQFGKTKVHLHGCVFFGQP  109

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EE+GGSPETNPF NGAIR+YLREVR+ QAKAR
Sbjct  110  DPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRECQAKAR  169

Query  526  GIPY  515
            GIPY
Sbjct  170  GIPY  173



>ref|XP_009343797.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
Length=181

 Score =   226 bits (576),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPVALS  +Y HVL+F+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  31   RYESQKRRDWNTFGQYLKNQRPPVALSQSNYNHVLEFLRYLDQFGKTKVHLQGCMFYGQP  90

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPE NPFA+GAIR+YLREVR+ QA AR
Sbjct  91   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFASGAIRVYLREVRECQAMAR  150

Query  526  GIPY  515
            GIP+
Sbjct  151  GIPF  154



>ref|XP_009142855.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Brassica 
rapa]
 ref|XP_009142857.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Brassica 
rapa]
 ref|XP_009142858.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Brassica 
rapa]
 ref|XP_009142859.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Brassica 
rapa]
 ref|XP_009142860.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Brassica 
rapa]
Length=178

 Score =   226 bits (575),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQRPP+ +SHC+  HVLDF+ +LDQFGKTKVH+ GC+F+GQ 
Sbjct  25   RYESQKRRDWNTFGQYLRNQRPPLPMSHCNCNHVLDFLRHLDQFGKTKVHVPGCMFYGQP  84

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+GAIR+YLREVR+ QAKAR
Sbjct  85   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKAR  144

Query  526  GIPY  515
            GIP+
Sbjct  145  GIPF  148



>ref|XP_010314085.1| PREDICTED: LOW QUALITY PROTEIN: protein LIGHT-DEPENDENT SHORT 
HYPOCOTYLS 10, partial [Solanum lycopersicum]
Length=171

 Score =   225 bits (574),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C+Y HVL+F+ YLDQFGKTKVHL GC FFGQ 
Sbjct  17   RYESQKRRDWNTFGQYLKNQRPPVPLSQCNYNHVLEFLRYLDQFGKTKVHLHGCPFFGQP  76

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPLRQAWGSLDALIGRLRAA+EENGG PE NPFA+GAIR+YLREVRD QAKAR
Sbjct  77   EPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPENNPFASGAIRVYLREVRDFQAKAR  136

Query  526  GIPY  515
            GI Y
Sbjct  137  GICY  140



>ref|XP_004233074.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Solanum 
lycopersicum]
Length=191

 Score =   226 bits (575),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C+  HVL+F+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  34   RYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQP  93

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPE NPF NGAIR+YLREV++ QAKAR
Sbjct  94   DPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRLYLREVKECQAKAR  153

Query  526  GIPY  515
            GIPY
Sbjct  154  GIPY  157



>ref|XP_009608555.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=187

 Score =   226 bits (575),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C+  HVL+F+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  32   RYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQP  91

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPE NPF NGAIR+YLREV++ QAKAR
Sbjct  92   DPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRLYLREVKECQAKAR  151

Query  526  GIPY  515
            GIPY
Sbjct  152  GIPY  155



>ref|XP_010324393.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like isoform 
X1 [Solanum lycopersicum]
Length=199

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+N +PPV L  C+Y HVLDF+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  41   RYESQKRRDWNTFGQYLKNHKPPVPLPQCNYNHVLDFLRYLDQFGKTKVHLNGCVFFGQV  100

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            E  GPCTCPLRQAWGSLDALIGRLRAA+EENGG  ETNPFAN AIR+YLREVRD QAKAR
Sbjct  101  EQVGPCTCPLRQAWGSLDALIGRLRAAYEENGGLQETNPFANSAIRIYLREVRDSQAKAR  160

Query  526  GIPY  515
            GIPY
Sbjct  161  GIPY  164



>ref|XP_011008476.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
Length=177

 Score =   225 bits (573),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV+LS C+  HVLDF+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  31   RYESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQP  90

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAAFEE+GGS ETNPF NGAIR+YLREV++ QAKAR
Sbjct  91   DPPAPCTCPLRQAWGSLDALIGRLRAAFEEHGGSAETNPFGNGAIRVYLREVKECQAKAR  150

Query  526  GIPY  515
            GIPY
Sbjct  151  GIPY  154



>ref|XP_002301561.2| hypothetical protein POPTR_0002s22690g [Populus trichocarpa]
 gb|ABK94357.1| unknown [Populus trichocarpa]
 gb|EEE80834.2| hypothetical protein POPTR_0002s22690g [Populus trichocarpa]
Length=170

 Score =   224 bits (572),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C+  HVLDF+ YLDQFGKTKVHLQ C+F+GQ 
Sbjct  24   RYESQKRRDWNTFGQYLKNQRPPVPLSQCNSNHVLDFLRYLDQFGKTKVHLQSCMFYGQP  83

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGG+ ETNPFAN +IR+YLREV+D QAKAR
Sbjct  84   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTLETNPFANASIRVYLREVKDYQAKAR  143

Query  526  GIPY  515
            GIP+
Sbjct  144  GIPH  147



>ref|XP_011101384.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Sesamum 
indicum]
Length=183

 Score =   225 bits (573),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV +S C+  HVL+F+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  34   RYESQKRRDWNTFGQYLKNQRPPVPISQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQP  93

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EE+GGSPETNPF NGAIR+YLREV+D QAKAR
Sbjct  94   DPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKDCQAKAR  153

Query  526  GIPY  515
            GIPY
Sbjct  154  GIPY  157



>ref|XP_002305745.1| hypothetical protein POPTR_0004s05610g [Populus trichocarpa]
 gb|ABK93578.1| unknown [Populus trichocarpa]
 gb|EEE86256.1| hypothetical protein POPTR_0004s05610g [Populus trichocarpa]
Length=177

 Score =   224 bits (572),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV+LS C+  HVLDF+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  31   RYESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQP  90

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAAFEE+GGS ETNPF NGAIR+YLREV++ QAKAR
Sbjct  91   DPPAPCTCPLRQAWGSLDALIGRLRAAFEEHGGSAETNPFGNGAIRVYLREVKECQAKAR  150

Query  526  GIPY  515
            GIPY
Sbjct  151  GIPY  154



>ref|XP_008465553.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Cucumis 
melo]
Length=182

 Score =   224 bits (571),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQ PPV+LS C+  HVL+F+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  28   RYESQKRRDWNTFGQYLKNQTPPVSLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQP  87

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EE+GGSPETNPF NGAIR+YLREV++ QAKAR
Sbjct  88   DPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAKAR  147

Query  526  GIPY  515
            GIPY
Sbjct  148  GIPY  151



>ref|XP_008225289.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Prunus 
mume]
Length=187

 Score =   224 bits (571),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQ PPV+LS C+  HVLDF+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  37   RYESQKRRDWNTFGQYLKNQTPPVSLSQCNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQP  96

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EE+GGSPETNPF NGAIR+YLREV++ QAKAR
Sbjct  97   DPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAKAR  156

Query  526  GIPY  515
            GIPY
Sbjct  157  GIPY  160



>ref|XP_004146094.1| PREDICTED: uncharacterized protein LOC101204141 [Cucumis sativus]
Length=204

 Score =   225 bits (573),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDW TFGQYLRNQRPP+A+S C+ +HVL+F+ YLDQFGKTKVHL GC FFG+ 
Sbjct  61   RYESQKRRDWYTFGQYLRNQRPPLAISQCNSSHVLEFLRYLDQFGKTKVHLNGCGFFGEP  120

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPLRQAWGSLDALIGRLRAA+EENGGS +TNPFA+GAIR+YLREVRD Q+KAR
Sbjct  121  EPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGSSDTNPFASGAIRVYLREVRDSQSKAR  180

Query  526  GIPY  515
            GIPY
Sbjct  181  GIPY  184



>gb|KGN55073.1| hypothetical protein Csa_4G627230 [Cucumis sativus]
Length=201

 Score =   224 bits (572),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDW TFGQYLRNQRPP+A+S C+ +HVL+F+ YLDQFGKTKVHL GC FFG+ 
Sbjct  61   RYESQKRRDWYTFGQYLRNQRPPLAISQCNSSHVLEFLRYLDQFGKTKVHLNGCGFFGEP  120

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPLRQAWGSLDALIGRLRAA+EENGGS +TNPFA+GAIR+YLREVRD Q+KAR
Sbjct  121  EPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGSSDTNPFASGAIRVYLREVRDSQSKAR  180

Query  526  GIPY  515
            GIPY
Sbjct  181  GIPY  184



>ref|XP_004171006.1| PREDICTED: uncharacterized LOC101204141, partial [Cucumis sativus]
Length=200

 Score =   224 bits (571),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDW TFGQYLRNQRPP+A+S C+ +HVL+F+ YLDQFGKTKVHL GC FFG+ 
Sbjct  62   RYESQKRRDWYTFGQYLRNQRPPLAISQCNSSHVLEFLRYLDQFGKTKVHLNGCGFFGEP  121

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPLRQAWGSLDALIGRLRAA+EENGGS +TNPFA+GAIR+YLREVRD Q+KAR
Sbjct  122  EPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGSSDTNPFASGAIRVYLREVRDSQSKAR  181

Query  526  GIPY  515
            GIPY
Sbjct  182  GIPY  185



>ref|XP_011008166.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
 ref|XP_011008167.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
 ref|XP_011008168.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
 ref|XP_011008170.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
Length=170

 Score =   223 bits (568),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C+  HVLDF+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  24   RYESQKRRDWNTFGQYLKNQRPPVPLSQCNSNHVLDFLRYLDQFGKTKVHLQGCMFYGQP  83

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAW SLDALIGRLRAA+EENGG+ ETNPFAN +IR+YLREV+D QAKAR
Sbjct  84   EPPAPCTCPLRQAWCSLDALIGRLRAAYEENGGTLETNPFANASIRVYLREVKDYQAKAR  143

Query  526  GIPY  515
            GIP+
Sbjct  144  GIPH  147



>ref|XP_011098405.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Sesamum 
indicum]
Length=173

 Score =   223 bits (568),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = -2

Query  871  KRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQAEPGGP  692
            KRRDWNTFGQYLRNQRPPV L  C+Y+HVLDF+ YLDQFGKTKVH+QGC+FFGQ EP GP
Sbjct  24   KRRDWNTFGQYLRNQRPPVGLPQCNYSHVLDFLRYLDQFGKTKVHVQGCVFFGQPEPAGP  83

Query  691  CTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKARGIPY  515
            C+CPLRQAWGSLDALIGRLRAA+EENGG+ ETNPFANGAIR+YLREVR+ QAKARGIPY
Sbjct  84   CSCPLRQAWGSLDALIGRLRAAYEENGGAAETNPFANGAIRVYLREVRESQAKARGIPY  142



>ref|XP_008463732.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Cucumis 
melo]
Length=199

 Score =   224 bits (570),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDW TFGQYLRNQRPP+A+S C+ +HVL+F+ YLDQFGKTKVHL GC FFG+ 
Sbjct  59   RYESQKRRDWYTFGQYLRNQRPPLAISQCNSSHVLEFLRYLDQFGKTKVHLNGCGFFGEP  118

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPCTCPLRQAWGSLDALIGRLRAA+EENGGS +TNPFA+GAIR+YLREVRD Q+KAR
Sbjct  119  EPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGSSDTNPFASGAIRVYLREVRDSQSKAR  178

Query  526  GIPY  515
            GIPY
Sbjct  179  GIPY  182



>gb|AFK41138.1| unknown [Lotus japonicus]
Length=173

 Score =   223 bits (568),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL NQRPPV LS C++ HV++F+ YLDQFGKTKVHLQGC++FG  
Sbjct  26   RYESQKRRDWNTFGQYLNNQRPPVPLSQCNFNHVMEFLRYLDQFGKTKVHLQGCVYFGMP  85

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPE NPFA+G IR+YLREVR+ QAKAR
Sbjct  86   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPEANPFASGFIRVYLREVRECQAKAR  145

Query  526  GIPY  515
            GIPY
Sbjct  146  GIPY  149



>ref|XP_004293946.1| PREDICTED: uncharacterized protein LOC101295692 isoform 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_004293947.1| PREDICTED: uncharacterized protein LOC101295692 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=187

 Score =   223 bits (569),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQ PPV +SHC + HVLDF+ YLDQFGKTKVHL  C+FFGQ 
Sbjct  38   RYESQKRRDWNTFGQYLKNQTPPVPMSHCQFNHVLDFLRYLDQFGKTKVHLHCCVFFGQP  97

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG+PETNPF NGAIR+YLREV++ QAKAR
Sbjct  98   DPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGAPETNPFGNGAIRVYLREVKECQAKAR  157

Query  526  GIPY  515
            GIPY
Sbjct  158  GIPY  161



>ref|XP_010525031.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
 ref|XP_010525039.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
Length=178

 Score =   223 bits (568),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C+  HVLDF+ YLDQFGKTKVH+ GC+F+GQ 
Sbjct  27   RYESQKRRDWNTFGQYLKNQRPPVHLSQCNCNHVLDFLRYLDQFGKTKVHVPGCMFYGQP  86

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPE NPFA GAIR+YLREVR+ QAKAR
Sbjct  87   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPEMNPFATGAIRVYLREVRECQAKAR  146

Query  526  GIPY  515
            GIPY
Sbjct  147  GIPY  150



>ref|XP_007212120.1| hypothetical protein PRUPE_ppa012018mg [Prunus persica]
 gb|EMJ13319.1| hypothetical protein PRUPE_ppa012018mg [Prunus persica]
Length=187

 Score =   223 bits (568),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQ PPV+LS C+  HVLDF+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  37   RYESQKRRDWNTFGQYLKNQTPPVSLSQCNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQP  96

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPL+QAWGSLDALIGRLRAA+EE+GGSPETNPF NGAIR+YLREV++ QAKAR
Sbjct  97   DPPAPCTCPLKQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAKAR  156

Query  526  GIPY  515
            GIPY
Sbjct  157  GIPY  160



>ref|XP_011098044.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like, 
partial [Sesamum indicum]
Length=157

 Score =   222 bits (565),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQ+LRNQRPPVALS C   HVL+F+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  25   RYESQKRRDWNTFGQFLRNQRPPVALSQCSSGHVLEFLRYLDQFGKTKVHLQGCIFYGQP  84

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGG  ETNPFA+ AIR+YLREV++ QAKAR
Sbjct  85   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGPQETNPFASSAIRIYLREVKESQAKAR  144

Query  526  GIPY  515
            GIPY
Sbjct  145  GIPY  148



>ref|XP_010553628.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
 ref|XP_010553707.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
Length=170

 Score =   222 bits (566),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPP+ LS C  +HVLDF+ YLDQFGKTKVH+ GC+F+GQ 
Sbjct  28   RYESQKRRDWNTFGQYLKNQRPPMPLSQCSCSHVLDFLRYLDQFGKTKVHVPGCMFYGQP  87

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PC CPLRQAWGSLDALIGRLRAA+EENGG PETNPFA+GAIR YL+EVRD QAKAR
Sbjct  88   EPPAPCICPLRQAWGSLDALIGRLRAAYEENGGPPETNPFASGAIRAYLKEVRDCQAKAR  147

Query  526  GIPY  515
            GIPY
Sbjct  148  GIPY  151



>ref|XP_003542999.1| PREDICTED: uncharacterized protein LOC100778886 [Glycine max]
Length=181

 Score =   222 bits (566),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQ PPV+LS C++ HVL+F+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  33   RYESQKRRDWNTFGQYLKNQTPPVSLSQCNFNHVLEFLRYLDQFGKTKVHLHGCIFFGQP  92

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EE GGSPETNPF +GAIR+YLREV++ QAKAR
Sbjct  93   DPPAPCTCPLRQAWGSLDALIGRLRAAYEERGGSPETNPFGSGAIRVYLREVKECQAKAR  152

Query  526  GIPY  515
            GIPY
Sbjct  153  GIPY  156



>gb|EPS69070.1| hypothetical protein M569_05697, partial [Genlisea aurea]
Length=131

 Score =   220 bits (561),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQ+LRNQRPPVALS C+  HVLDF+ YLDQFGKT+VH QGC+F+GQ 
Sbjct  5    RYESQKRRDWNTFGQFLRNQRPPVALSQCNINHVLDFLRYLDQFGKTRVHAQGCIFYGQP  64

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PC CPL+QAWGSLDALIGRLRAA+EENGGSPETNPFA+ AIR++LRE+++ QAKAR
Sbjct  65   EPPAPCGCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASAAIRVFLREIKECQAKAR  124

Query  526  GIPY  515
            GIPY
Sbjct  125  GIPY  128



>ref|XP_007148048.1| hypothetical protein PHAVU_006G176100g [Phaseolus vulgaris]
 gb|ESW20042.1| hypothetical protein PHAVU_006G176100g [Phaseolus vulgaris]
Length=183

 Score =   222 bits (566),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQ PPV+LS C++ HVL+F+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  35   RYESQKRRDWNTFGQYLKNQTPPVSLSLCNFNHVLEFLRYLDQFGKTKVHLHGCIFFGQP  94

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EE+GGSPETNPF +GAIR+YLREV++ QAKAR
Sbjct  95   DPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGSGAIRVYLREVKECQAKAR  154

Query  526  GIPY  515
            GIPY
Sbjct  155  GIPY  158



>ref|XP_010524062.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
Length=176

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C+  HVLDF+ YLDQFGKTKVH  GC+F+GQ 
Sbjct  27   RYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHAPGCMFYGQP  86

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PC CPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+GAIR++LREVR+ QAKAR
Sbjct  87   EPPAPCICPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVFLREVRECQAKAR  146

Query  526  GIPY  515
            GIPY
Sbjct  147  GIPY  150



>gb|KGN47252.1| hypothetical protein Csa_6G236080 [Cucumis sativus]
Length=205

 Score =   223 bits (567),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRP VALS C++ HVL+F+ YLDQFGKTKVH+QGC+F+G  
Sbjct  31   RYESQKRRDWNTFGQYLKNQRPAVALSQCNFNHVLEFLRYLDQFGKTKVHVQGCMFYGHP  90

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPL+QAWGSLDALIGRLRAA+EENGGSPETNPFA  +IR+YLR+VR+ QAKAR
Sbjct  91   EPPSPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFATASIRLYLRQVRECQAKAR  150

Query  526  GIPY  515
            GIPY
Sbjct  151  GIPY  154



>ref|XP_006348309.1| PREDICTED: uncharacterized protein LOC102581082 [Solanum tuberosum]
Length=191

 Score =   222 bits (566),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+N +PPV L  C+Y HVLDF+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  46   RYESQKRRDWNTFGQYLKNHKPPVPLPQCNYNHVLDFLRYLDQFGKTKVHLNGCVFFGQV  105

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            E  GPCTCPL+QAWGSLDALIGRLRAA+EENGG  ETNPFAN AIR++LREVRD QAKAR
Sbjct  106  EQVGPCTCPLKQAWGSLDALIGRLRAAYEENGGLQETNPFANSAIRIHLREVRDSQAKAR  165

Query  526  GIPY  515
            GIPY
Sbjct  166  GIPY  169



>ref|XP_004171262.1| PREDICTED: uncharacterized LOC101216601 [Cucumis sativus]
Length=206

 Score =   223 bits (567),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRP VALS C++ HVL+F+ YLDQFGKTKVH+QGC+F+G  
Sbjct  31   RYESQKRRDWNTFGQYLKNQRPAVALSQCNFNHVLEFLRYLDQFGKTKVHVQGCMFYGHP  90

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPL+QAWGSLDALIGRLRAA+EENGGSPETNPFA  +IR+YLR+VR+ QAKAR
Sbjct  91   EPPSPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFATASIRLYLRQVRECQAKAR  150

Query  526  GIPY  515
            GIPY
Sbjct  151  GIPY  154



>ref|XP_004151474.1| PREDICTED: uncharacterized protein LOC101210225 [Cucumis sativus]
Length=187

 Score =   222 bits (565),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQ P V+LS C+  HVL+F+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  27   RYESQKRRDWNTFGQYLKNQTPAVSLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQP  86

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EE+GGSPETNPF NGAIR+YLREV++ QAKAR
Sbjct  87   DPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAKAR  146

Query  526  GIPY  515
            GIPY
Sbjct  147  GIPY  150



>gb|AFK49191.1| unknown [Medicago truncatula]
 gb|KEH36593.1| DUF640 family protein [Medicago truncatula]
Length=184

 Score =   222 bits (565),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQK+RDWNTFGQYLRNQ PPV+LS C++ HVL+F+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  35   RYESQKKRDWNTFGQYLRNQSPPVSLSQCNFNHVLEFLRYLDQFGKTKVHLHGCIFFGQP  94

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EE+GGSPE NPF  GAIR+YLREV++ Q+KAR
Sbjct  95   DPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPENNPFGTGAIRVYLREVKECQSKAR  154

Query  526  GIPY  515
            GIPY
Sbjct  155  GIPY  158



>gb|KGN65636.1| hypothetical protein Csa_1G474480 [Cucumis sativus]
Length=186

 Score =   221 bits (564),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQ P V+LS C+  HVL+F+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  27   RYESQKRRDWNTFGQYLKNQTPAVSLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQP  86

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EE+GGSPETNPF NGAIR+YLREV++ QAKAR
Sbjct  87   DPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAKAR  146

Query  526  GIPY  515
            GIPY
Sbjct  147  GIPY  150



>ref|XP_004150559.1| PREDICTED: uncharacterized protein LOC101216601 [Cucumis sativus]
Length=226

 Score =   223 bits (567),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRP VALS C++ HVL+F+ YLDQFGKTKVH+QGC+F+G  
Sbjct  31   RYESQKRRDWNTFGQYLKNQRPAVALSQCNFNHVLEFLRYLDQFGKTKVHVQGCMFYGHP  90

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPL+QAWGSLDALIGRLRAA+EENGGSPETNPFA  +IR+YLR+VR+ QAKAR
Sbjct  91   EPPSPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFATASIRLYLRQVRECQAKAR  150

Query  526  GIPY  515
            GIPY
Sbjct  151  GIPY  154



>ref|XP_004136831.1| PREDICTED: uncharacterized protein LOC101208687 [Cucumis sativus]
 ref|XP_004155471.1| PREDICTED: uncharacterized protein LOC101230404 [Cucumis sativus]
 gb|KGN43628.1| hypothetical protein Csa_7G048120 [Cucumis sativus]
Length=189

 Score =   221 bits (563),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL+NQRPPV LSHC+   VL+F+ YLDQFGKTKVH+QGC+F+GQ 
Sbjct  33   RYESQKRRDWNTFCQYLKNQRPPVPLSHCNCNQVLEFLRYLDQFGKTKVHIQGCMFYGQP  92

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGS ETNPFA+GAIR+YLR+VR+ QAKAR
Sbjct  93   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSQETNPFASGAIRVYLRDVRECQAKAR  152

Query  526  GIPY  515
            GIPY
Sbjct  153  GIPY  156



>ref|XP_009626514.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=176

 Score =   221 bits (562),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYLRNQR P+ LS C+  HVL+F+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  28   RYESQKRRDWNTFNQYLRNQRQPIPLSQCNSNHVLEFLRYLDQFGKTKVHLQGCMFYGQP  87

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+ AIR+YLREV++ QAKAR
Sbjct  88   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASTAIRVYLREVKECQAKAR  147

Query  526  GIPY  515
            GI Y
Sbjct  148  GIAY  151



>ref|XP_006442831.1| hypothetical protein CICLE_v10023710mg [Citrus clementina]
 gb|ESR56071.1| hypothetical protein CICLE_v10023710mg [Citrus clementina]
Length=332

 Score =   226 bits (575),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C  +HVL+F+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  185  RYESQKRRDWNTFGQYLKNQRPPVPLSQCSSSHVLEFLRYLDQFGKTKVHLQGCMFYGQP  244

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+G +R++L EVR+ QAKAR
Sbjct  245  NPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGEMRVFLGEVRERQAKAR  304

Query  526  GIPY  515
            GIPY
Sbjct  305  GIPY  308



>ref|XP_008455303.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Cucumis 
melo]
Length=188

 Score =   221 bits (562),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL+NQRPPV LSHC+   VL+F+ YLDQFGKTKVH+QGC+F+GQ 
Sbjct  32   RYESQKRRDWNTFCQYLKNQRPPVPLSHCNCNQVLEFLRYLDQFGKTKVHIQGCMFYGQP  91

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGS ETNPFA+GAIR+YLR+VR+ QAKAR
Sbjct  92   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSQETNPFASGAIRVYLRDVRECQAKAR  151

Query  526  GIPY  515
            GIPY
Sbjct  152  GIPY  155



>ref|XP_004485894.1| PREDICTED: uncharacterized protein LOC101502781 [Cicer arietinum]
Length=183

 Score =   220 bits (561),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQK+RDWNTFGQYLRNQ P V+LS C++ HVL+F+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  34   RYESQKKRDWNTFGQYLRNQTPAVSLSQCNFNHVLEFLRYLDQFGKTKVHLHGCIFFGQP  93

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EE+GGSPE NPF +GAIR+YLREV++ Q+KAR
Sbjct  94   DPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPENNPFGSGAIRVYLREVKECQSKAR  153

Query  526  GIPY  515
            GIPY
Sbjct  154  GIPY  157



>ref|XP_004174117.1| PREDICTED: uncharacterized protein LOC101228453 [Cucumis sativus]
Length=191

 Score =   221 bits (562),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQ P V+LS C+  HVL+F+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  31   RYESQKRRDWNTFGQYLKNQTPAVSLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQP  90

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EE+GGSPETNPF NGAIR+YLREV++ QAKAR
Sbjct  91   DPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAKAR  150

Query  526  GIPY  515
            GIPY
Sbjct  151  GIPY  154



>ref|NP_001237249.1| uncharacterized protein LOC100306082 [Glycine max]
 gb|ACU14083.1| unknown [Glycine max]
Length=181

 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQ PPV+LS C++ HVL+F+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  33   RYESQKRRDWNTFGQYLKNQTPPVSLSQCNFNHVLEFLRYLDQFGKTKVHLHGCIFFGQP  92

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EE+GGS ETNPF +GAIR+YLREV++ QAKAR
Sbjct  93   DPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSAETNPFGSGAIRVYLREVKECQAKAR  152

Query  526  GIPY  515
            GIPY
Sbjct  153  GIPY  156



>ref|XP_011011486.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
Length=177

 Score =   219 bits (559),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV+LS  +  HVLDF+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  31   RYESQKRRDWNTFGQYLKNQRPPVSLSQSNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQP  90

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PCTCPLRQAWGSLDALIGRLRAA+EE+GGS ETNPF NGAIR+YLREV++ QAKAR
Sbjct  91   NPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSAETNPFGNGAIRVYLREVKECQAKAR  150

Query  526  GIPY  515
            GIPY
Sbjct  151  GIPY  154



>ref|XP_009784769.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=196

 Score =   220 bits (560),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFG YL+N RPP+ LS C+Y HVL+F+ YLDQFGKTKVHL GC FFGQ 
Sbjct  45   RYESQKRRDWNTFGHYLKNLRPPIPLSQCNYNHVLEFLRYLDQFGKTKVHLHGCPFFGQP  104

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP GPC CPLRQAWGSLDALIGRLRAA+EENGG PE NPFA+G+IR+YLREVRD QAKAR
Sbjct  105  EPPGPCACPLRQAWGSLDALIGRLRAAYEENGGLPENNPFASGSIRIYLREVRDFQAKAR  164

Query  526  GIPY  515
            GI Y
Sbjct  165  GISY  168



>ref|XP_002317421.1| hypothetical protein POPTR_0011s07350g [Populus trichocarpa]
 gb|ABK94387.1| unknown [Populus trichocarpa]
 gb|EEE98033.1| hypothetical protein POPTR_0011s07350g [Populus trichocarpa]
Length=177

 Score =   219 bits (558),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV+LS  +  HVLDF+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  31   RYESQKRRDWNTFGQYLKNQRPPVSLSQSNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQP  90

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PCTCPLRQAWGSLDALIGRLRAA+EE+GGS ETNPF NGAIR+YLREV++ QAKAR
Sbjct  91   NPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSAETNPFGNGAIRVYLREVKECQAKAR  150

Query  526  GIPY  515
            GIPY
Sbjct  151  GIPY  154



>ref|XP_009790882.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=176

 Score =   219 bits (558),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF Q+LRNQR P+ LS C+  HVL+F+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  28   RYESQKRRDWNTFNQFLRNQRQPIPLSQCNDNHVLEFLGYLDQFGKTKVHLQGCMFYGQP  87

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+ AIR+YLREV++ QAKAR
Sbjct  88   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASTAIRVYLREVKECQAKAR  147

Query  526  GIPY  515
            GI Y
Sbjct  148  GIAY  151



>ref|XP_009790219.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=176

 Score =   218 bits (556),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF Q+LRNQR P+ LS C+  HVL+F+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  28   RYESQKRRDWNTFNQFLRNQRQPIPLSQCNGNHVLEFLGYLDQFGKTKVHLQGCMFYGQP  87

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+ AIR+YLREV++ QAKAR
Sbjct  88   EPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASTAIRVYLREVKECQAKAR  147

Query  526  GIPY  515
            GI Y
Sbjct  148  GIAY  151



>ref|XP_009587002.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=180

 Score =   218 bits (556),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RY SQKRRDWNTFGQYL+N +PPV LS+C+Y HVL F+ YLDQFGKTKVHL GC+FFG++
Sbjct  29   RYVSQKRRDWNTFGQYLKNHKPPVPLSNCNYNHVLHFLRYLDQFGKTKVHLHGCIFFGES  88

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            E   PCTCPLRQAWGSLDALIGRLRAA+EENGG  ETNPFAN AIR+YLREVRD QAKAR
Sbjct  89   EQTEPCTCPLRQAWGSLDALIGRLRAAYEENGGLQETNPFANSAIRIYLREVRDSQAKAR  148

Query  526  GIPY  515
            GI Y
Sbjct  149  GISY  152



>ref|XP_010531928.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7 [Tarenaya 
hassleriana]
Length=183

 Score =   218 bits (555),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYLRNQRPPV +S C+  ++LDF+ YLDQFGKTKVHLQGC+FFGQ 
Sbjct  24   RYESQKRRDWNTFCQYLRNQRPPVHISQCNTNNILDFLRYLDQFGKTKVHLQGCVFFGQP  83

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P G C CPLRQAWGSLDALIGRLRAA+EENGG PE NPFA G IR+YLREVRD QAKAR
Sbjct  84   DPSGQCNCPLRQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVYLREVRDSQAKAR  143

Query  526  GIPY  515
            G+PY
Sbjct  144  GVPY  147



>gb|EYU30777.1| hypothetical protein MIMGU_mgv1a014751mg [Erythranthe guttata]
Length=179

 Score =   216 bits (551),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQ+LRN RP V ++ C+ +HVLDFM YLDQFGKTKVH QGC F+GQ 
Sbjct  25   RYESQKRRDWNTFGQFLRNMRPAVGVAQCNSSHVLDFMRYLDQFGKTKVHSQGCTFYGQP  84

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PCTCPLRQAWGSLDAL+GRLRAA+EENGGSPE+NPFA+ +IRMYLREV++ Q+KAR
Sbjct  85   EPPAPCTCPLRQAWGSLDALVGRLRAAYEENGGSPESNPFASSSIRMYLREVKECQSKAR  144

Query  526  GIPY  515
            GIPY
Sbjct  145  GIPY  148



>ref|XP_004505495.1| PREDICTED: uncharacterized protein LOC101509969 [Cicer arietinum]
Length=165

 Score =   216 bits (550),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+ Q+PPV L HC+  +VLDF+ YLDQFGKTKVH+QGC+F+G  
Sbjct  24   RYESQKRRDWNTFGQYLKTQKPPVPLVHCNSNNVLDFLRYLDQFGKTKVHIQGCMFYGNP  83

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PC+CPLRQAWGSLDALIGRLRAA+EENGGSP TNPFA  +IR+YLREVR+ QA AR
Sbjct  84   EPPAPCSCPLRQAWGSLDALIGRLRAAYEENGGSPHTNPFATSSIRLYLREVRECQALAR  143

Query  526  GIPY  515
            GIPY
Sbjct  144  GIPY  147



>ref|XP_006478612.1| PREDICTED: probable disease resistance protein At4g27220-like 
isoform X1 [Citrus sinensis]
Length=1622

 Score =   235 bits (600),  Expect = 6e-66, Method: Composition-based stats.
 Identities = 100/124 (81%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -2

Query  886   RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
             RYE QKRRDWNTFGQYL+NQRPPV LS C  +HVL+F+ YLD FGK KVHLQGC+F+GQ 
Sbjct  1483  RYELQKRRDWNTFGQYLKNQRPPVPLSQCSSSHVLEFLRYLDPFGKIKVHLQGCMFYGQP  1542

Query  706   EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
              P  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+G IR+YLREVR+ QAKAR
Sbjct  1543  NPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGEIRVYLREVRECQAKAR  1602

Query  526   GIPY  515
             GIPY
Sbjct  1603  GIPY  1606



>ref|XP_002889213.1| At1g78815 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65472.1| At1g78815 [Arabidopsis lyrata subsp. lyrata]
Length=191

 Score =   216 bits (550),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYLRNQ+PPV +S C   H+LDF+ YLDQFGKTKVH+ GC+FFGQ 
Sbjct  36   RYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHIHGCVFFGQV  95

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP G C CPL+QAWGSLDALIGRLRAAFEENGG PE NPFA G IR++LREVRD QAKAR
Sbjct  96   EPAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQAKAR  155

Query  526  GIPY  515
            G+PY
Sbjct  156  GVPY  159



>ref|NP_565190.1| protein LIGHT SENSITIVE HYPOCOTYLS 7 [Arabidopsis thaliana]
 sp|Q9ZVA0.1|LSH7_ARATH RecName: Full=Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7; AltName: 
Full=Protein ORGAN BOUNDARY 7 [Arabidopsis thaliana]
 gb|AAC83029.1| Strong similarity to T16B12.3 gi|3746060 unknown protein from 
Arabidopsis thaliana BAC gb|AC005311 [Arabidopsis thaliana]
 gb|AEE36158.1| uncharacterized protein AT1G78815 [Arabidopsis thaliana]
Length=195

 Score =   216 bits (550),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYLRNQ+PPV +S C   H+LDF+ YLDQFGKTKVH+ GC+FFGQ 
Sbjct  40   RYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHIHGCVFFGQV  99

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP G C CPL+QAWGSLDALIGRLRAAFEENGG PE NPFA G IR++LREVRD QAKAR
Sbjct  100  EPAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQAKAR  159

Query  526  GIPY  515
            G+PY
Sbjct  160  GVPY  163



>gb|ABF83646.1| At1g78815 [Arabidopsis thaliana]
Length=195

 Score =   216 bits (550),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYLRNQ+PPV +S C   H+LDF+ YLDQFGKTKVH+ GC+FFGQ 
Sbjct  40   RYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHIHGCVFFGQV  99

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP G C CPL+QAWGSLDALIGRLRAAFEENGG PE NPFA G IR++LREVRD QAKAR
Sbjct  100  EPAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQAKAR  159

Query  526  GIPY  515
            G+PY
Sbjct  160  GVPY  163



>ref|XP_010429720.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Camelina 
sativa]
Length=193

 Score =   215 bits (548),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYLRNQ+PPV +S C   H+LDF+ YLDQFGKTKVH+ GC+FFGQ 
Sbjct  38   RYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFGQV  97

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP G C CPL+QAWGSLDALIGRLRAAFEENGG PE NPFA G IR++LREVRD QAKAR
Sbjct  98   EPAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQAKAR  157

Query  526  GIPY  515
            G+PY
Sbjct  158  GVPY  161



>ref|XP_010540518.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
Length=179

 Score =   215 bits (547),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV+ +   + HV+DF+ YLDQFGKTKVH  GC+FFGQ 
Sbjct  16   RYESQKRRDWNTFGQYLKNQRPPVSFAQLSFNHVIDFLKYLDQFGKTKVHHHGCVFFGQP  75

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P GPCTCPL+QAWGSLDALIGRLRAAFEE+GGS + NPF NGAIR+YLREVRD Q+KAR
Sbjct  76   DPPGPCTCPLKQAWGSLDALIGRLRAAFEEHGGSSDQNPFGNGAIRVYLREVRDSQSKAR  135

Query  526  GIPY  515
            GI Y
Sbjct  136  GIQY  139



>ref|XP_010417489.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Camelina 
sativa]
Length=196

 Score =   215 bits (548),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYLRNQ+PPV +S C   H+LDF+ YLDQFGKTKVH+ GC+FFGQ 
Sbjct  41   RYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFGQV  100

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP G C CPL+QAWGSLDALIGRLRAAFEENGG PE NPFA G IR++LREVRD QAKAR
Sbjct  101  EPAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQAKAR  160

Query  526  GIPY  515
            G+PY
Sbjct  161  GVPY  164



>ref|XP_006302860.1| hypothetical protein CARUB_v10020990mg [Capsella rubella]
 gb|EOA35758.1| hypothetical protein CARUB_v10020990mg [Capsella rubella]
Length=191

 Score =   215 bits (548),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYLRNQ+PPV +S C   H+LDF+ YLDQFGKTKVH+ GC+FFGQ 
Sbjct  36   RYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFGQV  95

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP G C CPL+QAWGSLDALIGRLRAAFEENGG PE NPFA G IR++LREVRD QAKAR
Sbjct  96   EPAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQAKAR  155

Query  526  GIPY  515
            G+PY
Sbjct  156  GVPY  159



>gb|AAM64330.1| unknown [Arabidopsis thaliana]
Length=195

 Score =   215 bits (548),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYLRNQ+PPV +S C   H+LDF+ YLDQFGKTKVH+ GC+FFGQ 
Sbjct  40   RYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHIHGCVFFGQV  99

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP G C CPL+QAWGSLDALIGRLRAAFEENGG PE NPFA G IR++LREVRD QAKAR
Sbjct  100  EPAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQAKAR  159

Query  526  GIPY  515
            G+PY
Sbjct  160  GVPY  163



>gb|KFK28531.1| hypothetical protein AALP_AA7G008800 [Arabis alpina]
Length=194

 Score =   215 bits (547),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL++Q PP+ +S  DYTHVL F+ YLDQFGKTKVH Q C+FFGQ 
Sbjct  40   RYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQP  99

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGSPETNPFANGAIRMYLREVRDMQAKA  530
            +P GPCTCPLRQAWGSLDALIGRLRAA+EE+ GGSPETNPFANG+IR++LREVR+ QAKA
Sbjct  100  DPPGPCTCPLRQAWGSLDALIGRLRAAYEEHGGGSPETNPFANGSIRVHLREVRESQAKA  159

Query  529  RGIPY  515
            RGIPY
Sbjct  160  RGIPY  164



>ref|XP_009106595.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7 [Brassica 
rapa]
 emb|CDX87432.1| BnaA07g34410D [Brassica napus]
Length=190

 Score =   214 bits (544),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYLRNQ+PPV +S C   H+LDF+ YLDQFGKTKVH+ GC+FFGQ 
Sbjct  40   RYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFGQV  99

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP G C CPL+QAWGSLDALIGRLRAA+EENGG PE NPFA G IR++LREVRD QAKAR
Sbjct  100  EPAGQCNCPLKQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVFLREVRDSQAKAR  159

Query  526  GIPY  515
            G+PY
Sbjct  160  GVPY  163



>ref|XP_006389954.1| hypothetical protein EUTSA_v10019792mg [Eutrema salsugineum]
 gb|ESQ27240.1| hypothetical protein EUTSA_v10019792mg [Eutrema salsugineum]
Length=188

 Score =   214 bits (544),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYLRNQ+PPV +S C   H+LDF+ YLDQFGKTKVH+ GC+FFGQ 
Sbjct  34   RYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFGQV  93

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP G C CPL+QAWGSLDALIGRLRAA+EENGG PE NPFA G IR++LREVRD QAKAR
Sbjct  94   EPAGQCNCPLKQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVFLREVRDSQAKAR  153

Query  526  GIPY  515
            G+PY
Sbjct  154  GVPY  157



>emb|CDX88480.1| BnaC06g39240D [Brassica napus]
Length=185

 Score =   213 bits (543),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYLRNQ PPV +S C   H+LDF+ YLDQFGKTKVH+ GC+FFGQ 
Sbjct  35   RYESQKRRDWNTFCQYLRNQHPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFGQV  94

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP G C CPL+QAWGSLDALIGRLRAA+EENGG PE NPFA G IR++LREVRD QAKAR
Sbjct  95   EPAGQCNCPLKQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVFLREVRDSQAKAR  154

Query  526  GIPY  515
            G+PY
Sbjct  155  GVPY  158



>ref|XP_009108375.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9 [Brassica 
rapa]
 ref|XP_009108376.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9 [Brassica 
rapa]
Length=193

 Score =   213 bits (542),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL++Q PP+ +S  DYTHVL F+ YLDQFGKTKVH Q C+FFGQ 
Sbjct  39   RYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQP  98

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGSPETNPFANGAIRMYLREVRDMQAKA  530
            +P GPCTCPL+QAWGSLDALIGRLRAA+EE+ GGSP+TNPFANG+IR++LREVR+ QAKA
Sbjct  99   DPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAKA  158

Query  529  RGIPY  515
            RGIPY
Sbjct  159  RGIPY  163



>emb|CDY67351.1| BnaCnng54640D [Brassica napus]
Length=193

 Score =   213 bits (542),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL++Q PP+ +S  DYTHVL F+ YLDQFGKTKVH Q C+FFGQ 
Sbjct  37   RYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQP  96

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGSPETNPFANGAIRMYLREVRDMQAKA  530
            +P GPCTCPL+QAWGSLDALIGRLRAA+EE+ GGSP+TNPFANG+IR++LREVR+ QAKA
Sbjct  97   DPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAKA  156

Query  529  RGIPY  515
            RGIPY
Sbjct  157  RGIPY  161



>gb|KFK42237.1| hypothetical protein AALP_AA2G229400 [Arabis alpina]
Length=200

 Score =   213 bits (542),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYLRNQ+PPV +S C   H+LDF+ YLDQFGKTKVH+ GC+FFGQ 
Sbjct  44   RYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFGQV  103

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP G C CPL+QAWGSLDALIGRLRAA+EENGG PE NPFA G IR++LREVRD QAKAR
Sbjct  104  EPPGQCNCPLKQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVFLREVRDSQAKAR  163

Query  526  GIPY  515
            G+PY
Sbjct  164  GVPY  167



>ref|XP_006286146.1| hypothetical protein CARUB_v10007704mg [Capsella rubella]
 gb|EOA19044.1| hypothetical protein CARUB_v10007704mg [Capsella rubella]
Length=191

 Score =   213 bits (542),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL++Q PP+ +S  DYTHVL F+ YLDQFGKTKVH Q C+FFGQ 
Sbjct  37   RYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHQQACVFFGQP  96

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGSPETNPFANGAIRMYLREVRDMQAKA  530
            +P GPCTCPL+QAWGSLDALIGRLRAA+EE+ GGSP+TNPFANG+IR++LREVR+ QAKA
Sbjct  97   DPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAKA  156

Query  529  RGIPY  515
            RGIPY
Sbjct  157  RGIPY  161



>ref|XP_010439831.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Camelina 
sativa]
Length=191

 Score =   213 bits (542),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL++Q PP+ +S  DYTHVL F+ YLDQFGKTKVH Q C+FFGQ 
Sbjct  37   RYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQP  96

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGSPETNPFANGAIRMYLREVRDMQAKA  530
            +P GPCTCPL+QAWGSLDALIGRLRAA+EE+ GGSP+TNPFANG+IR++LREVR+ QAKA
Sbjct  97   DPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAKA  156

Query  529  RGIPY  515
            RGIPY
Sbjct  157  RGIPY  161



>ref|NP_193596.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9SN52.1|LSH9_ARATH RecName: Full=Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9; AltName: 
Full=Protein ORGAN BOUNDARY 9 [Arabidopsis thaliana]
 emb|CAB37446.1| putative protein [Arabidopsis thaliana]
 emb|CAB78863.1| putative protein [Arabidopsis thaliana]
 gb|AAR24223.1| At4g18610 [Arabidopsis thaliana]
 gb|AAT35235.1| At4g18610 [Arabidopsis thaliana]
 gb|AEE84068.1| uncharacterized protein AT4G18610 [Arabidopsis thaliana]
Length=191

 Score =   213 bits (541),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL++Q PP+ +S  DYTHVL F+ YLDQFGKTKVH Q C+FFGQ 
Sbjct  37   RYESQKRRDWNTFVQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQP  96

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGSPETNPFANGAIRMYLREVRDMQAKA  530
            +P GPCTCPL+QAWGSLDALIGRLRAA+EE+ GGSP+TNPFANG+IR++LREVR+ QAKA
Sbjct  97   DPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAKA  156

Query  529  RGIPY  515
            RGIPY
Sbjct  157  RGIPY  161



>ref|XP_010434509.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9 [Camelina 
sativa]
Length=191

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL++Q PP+ +S  DYTHVL F+ YLDQFGKTKVH Q C+FFGQ 
Sbjct  37   RYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQP  96

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGSPETNPFANGAIRMYLREVRDMQAKA  530
            +P GPCTCPL+QAWGSLDALIGRLRAA+EE+ GGSP+TNPFANG+IR++LREVR+ QAKA
Sbjct  97   DPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAKA  156

Query  529  RGIPY  515
            RGIPY
Sbjct  157  RGIPY  161



>emb|CDX76510.1| BnaA08g08900D [Brassica napus]
Length=193

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL++Q PP+ +S  DYTHVL F+ YLDQFGKTKVH Q C+FFGQ 
Sbjct  39   RYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQP  98

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGSPETNPFANGAIRMYLREVRDMQAKA  530
            +P GPCTCPL+QAWGSLDALIGRLRAA+EE+ GGSP+TNPFANG+IR++LREVR+ QAKA
Sbjct  99   DPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAKA  158

Query  529  RGIPY  515
            RGIPY
Sbjct  159  RGIPY  163



>gb|KDO64048.1| hypothetical protein CISIN_1g0003541mg, partial [Citrus sinensis]
Length=553

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYE QKRRDWNTFGQYL+NQRPPV LS C  +HVL+F+ YLD FGK KVHLQGC+F+GQ 
Sbjct  414  RYELQKRRDWNTFGQYLKNQRPPVPLSQCSSSHVLEFLRYLDPFGKIKVHLQGCMFYGQP  473

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PCTCPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+G IR+YLREVR+ QAKAR
Sbjct  474  NPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGEIRVYLREVRECQAKAR  533

Query  526  GIPY  515
            GIPY
Sbjct  534  GIPY  537



>emb|CDX78877.1| BnaA01g09440D [Brassica napus]
Length=196

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL++Q PP+ +S  DYTHVL F+ YLDQFGKTKVH Q C+FFGQ 
Sbjct  40   RYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQP  99

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGSPETNPFANGAIRMYLREVRDMQAKA  530
            +P GPCTCPL+QAWGSLDALIGRLRAA+EE+ GGSP+TNPFANG+IR++LREVR+ QAKA
Sbjct  100  DPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAKA  159

Query  529  RGIPY  515
            RGIPY
Sbjct  160  RGIPY  164



>ref|XP_010449492.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Camelina 
sativa]
Length=192

 Score =   212 bits (540),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL++Q PP+ +S  DYTHVL F+ YLDQFGKTKVH Q C+FFGQ 
Sbjct  37   RYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQP  96

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGSPETNPFANGAIRMYLREVRDMQAKA  530
            +P GPCTCPL+QAWGSLDALIGRLRAA+EE+ GGSP+TNPFANG+IR++LREVR+ QAKA
Sbjct  97   DPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAKA  156

Query  529  RGIPY  515
            RGIPY
Sbjct  157  RGIPY  161



>emb|CDX85083.1| BnaC07g08230D [Brassica napus]
Length=199

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYE+QKRRDWNTFGQYLRN RPP++LS C   HVL+F+ YLDQFGKTKVH+Q C FFG  
Sbjct  48   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHMQICPFFGHP  107

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPF   A+R+YLREVRD QAKAR
Sbjct  108  NPPAPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQAKAR  167

Query  526  GIPY  515
            GI Y
Sbjct  168  GISY  171



>ref|XP_009102637.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4 [Brassica 
rapa]
 emb|CDX77531.1| BnaA07g06690D [Brassica napus]
Length=199

 Score =   212 bits (539),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYE+QKRRDWNTFGQYLRN RPP++LS C   HVL+F+ YLDQFGKTKVH+Q C FFG  
Sbjct  48   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHMQICPFFGHP  107

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPF   A+R+YLREVRD QAKAR
Sbjct  108  NPPAPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQAKAR  167

Query  526  GIPY  515
            GI Y
Sbjct  168  GISY  171



>emb|CDY34056.1| BnaC03g62760D [Brassica napus]
Length=193

 Score =   211 bits (538),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL++Q PP  +S  DYTHVL F+ YLDQFGKTKVH Q C+FFGQ 
Sbjct  39   RYESQKRRDWNTFIQYLKSQNPPQMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQP  98

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGSPETNPFANGAIRMYLREVRDMQAKA  530
            +P GPCTCPL+QAWGSLDALIGRLRAA+EE+ GGSP+TNPFANG+IR++LREVR+ QAKA
Sbjct  99   DPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAKA  158

Query  529  RGIPY  515
            RGIPY
Sbjct  159  RGIPY  163



>ref|XP_006414079.1| hypothetical protein EUTSA_v10027091mg [Eutrema salsugineum]
 gb|ESQ55532.1| hypothetical protein EUTSA_v10027091mg [Eutrema salsugineum]
Length=193

 Score =   211 bits (538),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL++Q PP+ +S  DYTHVL F+ YLDQFGKTKVH Q C+F+GQ 
Sbjct  39   RYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHQQACVFYGQP  98

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGSPETNPFANGAIRMYLREVRDMQAKA  530
            +P GPCTCPL+QAWGSLDALIGRLRAA+EE+ GGSP+TNPFANG+IR++LREVR+ QAKA
Sbjct  99   DPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRIHLREVRESQAKA  158

Query  529  RGIPY  515
            RGIPY
Sbjct  159  RGIPY  163



>emb|CDY69731.1| BnaCnng65050D [Brassica napus]
Length=195

 Score =   211 bits (537),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYE+QKRRDWNTFGQYLRN RPP++LS C   HVL+F+ YLDQFGKTKVH Q C FFG  
Sbjct  47   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQLCPFFGHP  106

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPF   A+R+YLREVRD QAKAR
Sbjct  107  NPPAPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQAKAR  166

Query  526  GIPY  515
            GI Y
Sbjct  167  GISY  170



>emb|CDY14588.1| BnaC02g25250D [Brassica napus]
Length=190

 Score =   211 bits (536),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQK+RDWNTF QYLRNQ+PPV +S C   H+LDF+ YLDQFGKTKVH  GC+FFGQ 
Sbjct  35   RYESQKKRDWNTFCQYLRNQQPPVHVSQCGSNHILDFLQYLDQFGKTKVHAHGCVFFGQV  94

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP G C CPL+QAWGSLDALIGRLRAA+EENGG PE NPFA G IR++L+EVRD QAKAR
Sbjct  95   EPSGQCNCPLKQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVFLKEVRDSQAKAR  154

Query  526  GIPY  515
            G+PY
Sbjct  155  GVPY  158



>emb|CDY26881.1| BnaA02g19060D [Brassica napus]
Length=191

 Score =   211 bits (536),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQK+RDWNTF QYLRNQ+PPV +S C   H+LDF+ YLDQFGKTKVH  GC+FFGQ 
Sbjct  35   RYESQKKRDWNTFCQYLRNQQPPVHVSQCGSNHILDFLQYLDQFGKTKVHAHGCVFFGQV  94

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP G C CPL+QAWGSLDALIGRLRAA+EENGG PE NPFA G IR++L+EVRD QAKAR
Sbjct  95   EPSGQCNCPLKQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVFLKEVRDSQAKAR  154

Query  526  GIPY  515
            G+PY
Sbjct  155  GVPY  158



>ref|XP_002870033.1| hypothetical protein ARALYDRAFT_914818 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46292.1| hypothetical protein ARALYDRAFT_914818 [Arabidopsis lyrata subsp. 
lyrata]
Length=191

 Score =   211 bits (536),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL++Q PP+ +S  DYTHVL F+ YLDQFGKTKVH Q C+FFGQ 
Sbjct  37   RYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQP  96

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGSPETNPFANGAIRMYLREVRDMQAKA  530
            +P GPCTCPL+QAWGSLDALIGRLRAA+EE+ GGSP+ NPFANG+IR++LREVR+ QAKA
Sbjct  97   DPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDANPFANGSIRVHLREVRESQAKA  156

Query  529  RGIPY  515
            RGIPY
Sbjct  157  RGIPY  161



>ref|XP_009108056.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Brassica 
rapa]
Length=195

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYE+QKRRDWNTFGQYLRN RPP++LS C   HVL+F+ YLDQFGKTKVH Q C FFG A
Sbjct  47   RYENQKRRDWNTFGQYLRNHRPPLSLSRCGGAHVLEFLRYLDQFGKTKVHTQLCPFFGHA  106

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PC CPLRQAWGSLDALIGRLRAAFEENGGSPETNPF   A+R+YLREVRD QAKAR
Sbjct  107  NPPAPCACPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQAKAR  166

Query  526  GIPY  515
            GI Y
Sbjct  167  GISY  170



>ref|XP_010327093.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Solanum 
lycopersicum]
Length=178

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF  YL+NQRPP+ L HC   HVL+F+ YLDQFGKTKVHL GC+F+GQ 
Sbjct  27   RYESQKRRDWNTFNHYLKNQRPPILLPHCHSNHVLEFLRYLDQFGKTKVHLLGCMFYGQP  86

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLDALIGRLRAA+EENGGS ETNPFA+  IR+YLREV++ QAKAR
Sbjct  87   DPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSSETNPFASVGIRVYLREVKECQAKAR  146

Query  526  GIPY  515
            GI Y
Sbjct  147  GIAY  150



>ref|XP_009132033.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9 [Brassica 
rapa]
Length=196

 Score =   209 bits (532),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL++Q PP+ +S  DYTHVL F+ YL QFGKTKVH Q C+FFGQ 
Sbjct  40   RYESQKRRDWNTFIQYLKSQNPPLMISQFDYTHVLGFLRYLAQFGKTKVHRQACVFFGQP  99

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGSPETNPFANGAIRMYLREVRDMQAKA  530
            +P GPCTCPL+QAWGSLDALIGRLRAA+EE+ GGSP+TNPFANG+IR++LREVR+ QAKA
Sbjct  100  DPSGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAKA  159

Query  529  RGIPY  515
            RGIPY
Sbjct  160  RGIPY  164



>ref|XP_010549405.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
Length=190

 Score =   209 bits (531),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQK RDWNTFGQYL NQRPPV+++  ++ HV++F+ YLDQFGKTKVH  GC FFGQ 
Sbjct  26   RYESQKLRDWNTFGQYLNNQRPPVSVTQFNFNHVINFLKYLDQFGKTKVHHHGCAFFGQP  85

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P GPCTCPL+QAWGSLDALIGRLRAA+EE+GGSP  NPF NGAIR+YLREVRD Q+KAR
Sbjct  86   DPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGSPGLNPFGNGAIRVYLREVRDSQSKAR  145

Query  526  GIPY  515
            GI Y
Sbjct  146  GIQY  149



>ref|XP_009128313.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Brassica 
rapa]
Length=191

 Score =   208 bits (530),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQK+RDWNTF QYLRNQ+PPV +S C   H+LDF+ YLDQFGKTKVH  GC+FFGQ 
Sbjct  35   RYESQKKRDWNTFCQYLRNQQPPVHVSQCGSNHILDFLQYLDQFGKTKVHAHGCVFFGQV  94

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP G C CPL+QAWGSLDAL GRLRAA+EENGG PE NPFA G IR++L+EVRD QAKAR
Sbjct  95   EPSGQCNCPLKQAWGSLDALSGRLRAAYEENGGLPERNPFAGGGIRVFLKEVRDSQAKAR  154

Query  526  GIPY  515
            G+PY
Sbjct  155  GVPY  158



>ref|XP_009385358.1| PREDICTED: protein G1-like7 [Musa acuminata subsp. malaccensis]
Length=210

 Score =   209 bits (531),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYLRN +PP+AL+ C   HV++F+ YLDQFGKTKVH  GC F+G A
Sbjct  37   RYESQKRRDWNTFLQYLRNHKPPLALARCSGAHVIEFLRYLDQFGKTKVHAPGCAFYGHA  96

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P GPC CPLRQAWGSLDALIGRLRAA+EE+GG+PETNPFA  A+R+YLR+VR+ QAKAR
Sbjct  97   SPPGPCACPLRQAWGSLDALIGRLRAAYEESGGTPETNPFAARAVRIYLRDVRESQAKAR  156

Query  526  GIPY  515
            GIPY
Sbjct  157  GIPY  160



>ref|XP_003539992.1| PREDICTED: uncharacterized protein LOC100806134 [Glycine max]
Length=177

 Score =   207 bits (528),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C+  HVLDF+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  32   RYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYGQP  91

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PC CPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+G+IR+YLREVR+ QAKAR
Sbjct  92   EPPAPCACPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLREVRECQAKAR  151

Query  526  GIPY  515
            GI Y
Sbjct  152  GIAY  155



>gb|KHG29970.1| Putative beta-lactamase-like 1 [Gossypium arboreum]
Length=161

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 106/119 (89%), Gaps = 2/119 (2%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C+  HVLDF+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  31   RYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQP  90

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKA  530
            +P  PCTCPLRQAWGSLDALIGRLRAA+EE+GGSPETNPF NGAIR+YLRE  D +AKA
Sbjct  91   DPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLRE--DDKAKA  147



>gb|EYU43335.1| hypothetical protein MIMGU_mgv1a022623mg, partial [Erythranthe 
guttata]
Length=169

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL+NQ PP++L +C Y HVL+F+ YLDQFGKTKVHL GC FFGQ 
Sbjct  26   RYESQKRRDWNTFLQYLKNQNPPLSLPNCSYNHVLEFLRYLDQFGKTKVHLHGCPFFGQP  85

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P G CTCPLRQAWGSLDALIGRLRAA+EE+GG PE NPF NGAIR+YLREV++ QAKAR
Sbjct  86   DPPGQCTCPLRQAWGSLDALIGRLRAAYEEHGGPPEGNPFGNGAIRVYLREVKECQAKAR  145

Query  526  GI  521
            GI
Sbjct  146  GI  147



>ref|XP_009383380.1| PREDICTED: protein G1-like7 [Musa acuminata subsp. malaccensis]
Length=200

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYLRN +PP+ L+ C   HV++F+ YLDQFGKTKVHL GC F+G  
Sbjct  27   RYESQKRRDWNTFLQYLRNHKPPLVLTRCSGAHVIEFLRYLDQFGKTKVHLSGCAFYGHP  86

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PCTCPLRQAWGSLDALIGRLRAA+EE+GGSPETNPFA  A+R++LR+VRD QAKAR
Sbjct  87   SPPAPCTCPLRQAWGSLDALIGRLRAAYEESGGSPETNPFAARAVRIFLRDVRDSQAKAR  146

Query  526  GIPY  515
            GIPY
Sbjct  147  GIPY  150



>emb|CDY01557.1| BnaC07g35470D [Brassica napus]
Length=191

 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL++Q PP+ +   DYTHVL F+ YLDQFGKTKVH Q C+FFGQ 
Sbjct  40   RYESQKRRDWNTFIQYLKSQNPPLLMPQFDYTHVLCFLRYLDQFGKTKVHQQACVFFGQP  99

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGSPETNPFANGAIRMYLREVRDMQAKA  530
            +P GPCTCPL+QAWGSLDALIGRLRAA+EE+ GGSP+TNPFANG+IR++LREVR+ QAKA
Sbjct  100  DPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAKA  159

Query  529  RGIPY  515
            RGIPY
Sbjct  160  RGIPY  164



>ref|XP_003524092.1| PREDICTED: uncharacterized protein LOC100775838 [Glycine max]
Length=236

 Score =   208 bits (529),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+N RPP+ LS C   HVL+F+ YLDQFGKTKVH + C +FG +
Sbjct  47   RYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHAETCAYFGNS  106

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P GPC CPLRQAWGSLDALIGRLRAAFEENGG+PE NPF   A+R+YLREVRD QAKAR
Sbjct  107  HPPGPCACPLRQAWGSLDALIGRLRAAFEENGGTPEMNPFGTRAVRLYLREVRDAQAKAR  166

Query  526  GIPY  515
            GI Y
Sbjct  167  GIAY  170



>ref|XP_002973743.1| hypothetical protein SELMODRAFT_36560, partial [Selaginella moellendorffii]
 ref|XP_002975792.1| hypothetical protein SELMODRAFT_36559, partial [Selaginella moellendorffii]
 gb|EFJ23421.1| hypothetical protein SELMODRAFT_36559, partial [Selaginella moellendorffii]
 gb|EFJ25403.1| hypothetical protein SELMODRAFT_36560, partial [Selaginella moellendorffii]
Length=153

 Score =   204 bits (520),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYE+QKRRDWNTFGQYL+N RPP+ALS C   HVL+F+ YLDQFGKTK+H   C FFG A
Sbjct  22   RYEAQKRRDWNTFGQYLKNHRPPLALSRCSGAHVLEFLRYLDQFGKTKIHAPACPFFGLA  81

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PC CPLRQAWGSLDALIGRLRAAFEE+GG PE+NPF   A+R+YLREVR+MQAKAR
Sbjct  82   HPPAPCACPLRQAWGSLDALIGRLRAAFEEHGGKPESNPFGARAVRLYLREVREMQAKAR  141

Query  526  GIPY  515
            GI Y
Sbjct  142  GIAY  145



>ref|XP_003531069.1| PREDICTED: uncharacterized protein LOC100798406 [Glycine max]
Length=247

 Score =   207 bits (528),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+N RPP+ LS C   HVL+F+ YLDQFGKTKVH + C +FG +
Sbjct  48   RYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHAETCGYFGNS  107

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P GPC CPLRQAWGSLDALIGRLRAAFEENGG+PE NPF   A+R+YLREVRD QAKAR
Sbjct  108  HPPGPCACPLRQAWGSLDALIGRLRAAFEENGGAPEMNPFGTRAVRLYLREVRDAQAKAR  167

Query  526  GIPY  515
            GI Y
Sbjct  168  GIAY  171



>ref|XP_010906808.1| PREDICTED: LOW QUALITY PROTEIN: protein G1-like4 [Elaeis guineensis]
Length=198

 Score =   206 bits (523),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+N RPP+ LS C   HVL+F+ YLDQFGKTKVH Q C FFG  
Sbjct  52   RYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHTQMCPFFGHP  111

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PC+CPLRQAWGSLDALIGRLRAA+EENGG PE+NPF   A+R+YLREVR++QAKAR
Sbjct  112  NPPAPCSCPLRQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRLYLREVRELQAKAR  171

Query  526  GIPY  515
            GI Y
Sbjct  172  GISY  175



>gb|EPS68444.1| hypothetical protein M569_06326 [Genlisea aurea]
Length=181

 Score =   205 bits (521),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYLRNQRPPV+L  C+  HVL+FM YLDQFGKTKVH++GC+FFG+ 
Sbjct  31   RYESQKRRDWNTFRQYLRNQRPPVSLGQCNGGHVLEFMRYLDQFGKTKVHVRGCVFFGRP  90

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP   CTCP+RQAWGSLDAL+GRLRAA+E +GG+ E NPFA+ AIR YL+EVR+ QAKAR
Sbjct  91   EPDSACTCPVRQAWGSLDALVGRLRAAYEGSGGAQERNPFADAAIRRYLKEVRETQAKAR  150

Query  526  GIPY  515
            GIPY
Sbjct  151  GIPY  154



>ref|XP_004504735.1| PREDICTED: uncharacterized protein LOC101506113 [Cicer arietinum]
Length=236

 Score =   207 bits (526),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+N RPP+ LS C   HVL+F+ YLDQFGKTKVH + C +FG +
Sbjct  47   RYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHSENCAYFGNS  106

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P GPC CPL+QAWGSLDALIGRLRAAFEENGGSPE NPF   A+R+YLREVRD QAKAR
Sbjct  107  NPPGPCPCPLKQAWGSLDALIGRLRAAFEENGGSPEINPFGARAVRLYLREVRDAQAKAR  166

Query  526  GIPY  515
            GI Y
Sbjct  167  GIGY  170



>ref|XP_009419635.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Musa 
acuminata subsp. malaccensis]
Length=213

 Score =   206 bits (524),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWN+FGQYLRN RPP+ LS C   HVL+F+ YLDQFGKTKVH  GC FFG  
Sbjct  23   RYESQKRRDWNSFGQYLRNHRPPLELSRCSGAHVLEFLRYLDQFGKTKVHTAGCPFFGHP  82

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PCTCPLRQAWGSLD+L+GRLRAAFEE+GG PE NPFA  A+R+YLREVRD QAKAR
Sbjct  83   QPPAPCTCPLRQAWGSLDSLVGRLRAAFEEDGGQPEVNPFAARAVRLYLREVRDSQAKAR  142

Query  526  GIPY  515
            GI Y
Sbjct  143  GIAY  146



>gb|EYU41125.1| hypothetical protein MIMGU_mgv1a021620mg [Erythranthe guttata]
Length=170

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQ+LRNQRP V L HC+ +HVLDF+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  23   RYESQKRRDWNTFGQFLRNQRPSVGLPHCNSSHVLDFLRYLDQFGKTKVHLQGCVFYGQP  82

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PC CPL+QAWGSLDALIGRLRAA+EENGGSPE+NPFA+GAIR+YLREV++ Q+KAR
Sbjct  83   EPPAPCACPLKQAWGSLDALIGRLRAAYEENGGSPESNPFASGAIRIYLREVKECQSKAR  142

Query  526  GIPY  515
            GIPY
Sbjct  143  GIPY  146



>ref|XP_009411199.1| PREDICTED: protein G1-like7 [Musa acuminata subsp. malaccensis]
Length=221

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYLRN +PP+AL+ C   HV++F+ YLDQFGKTKVH  GC F+G  
Sbjct  48   RYESQKRRDWNTFLQYLRNHKPPLALARCSGAHVIEFLRYLDQFGKTKVHAPGCAFYGHP  107

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P GPC CPLRQAWGSLDALIGRLRAA+EE+GG+PETNPFA  A+R+YLR+VR+ QAKAR
Sbjct  108  SPPGPCACPLRQAWGSLDALIGRLRAAYEESGGTPETNPFAARAVRIYLRDVRESQAKAR  167

Query  526  GIPY  515
            GIPY
Sbjct  168  GIPY  171



>ref|XP_008802142.1| PREDICTED: LOW QUALITY PROTEIN: protein G1-like4 [Phoenix dactylifera]
Length=189

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+N RPP+ LS C   HVL+F+ YLDQFGKTKVH Q C FFG  
Sbjct  43   RYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHTQMCPFFGHP  102

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PC+CPLRQAWGSLDALIGRLRAA+EENGG PE+NPF   A+R+YLREVR++QAKAR
Sbjct  103  NPPAPCSCPLRQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRLYLREVRELQAKAR  162

Query  526  GIPY  515
            GI Y
Sbjct  163  GISY  166



>ref|XP_003531259.1| PREDICTED: uncharacterized protein LOC100810655 [Glycine max]
 gb|KHN47994.1| hypothetical protein glysoja_015464 [Glycine soja]
Length=167

 Score =   204 bits (518),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRNQ PPV LS C++ HVLDF+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  19   RYESQKRRDWNTFGQYLRNQSPPVPLSQCNFNHVLDFLRYLDQFGKTKVHLHGCIFFGQP  78

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PC CPLRQAWGSLDALIGRLRAA+EE+GGSPETNPF  GAIR+YLREV++ QAKAR
Sbjct  79   TPPAPCACPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGGGAIRVYLREVKECQAKAR  138

Query  526  GIPY  515
            GIPY
Sbjct  139  GIPY  142



>ref|XP_007159450.1| hypothetical protein PHAVU_002G238600g [Phaseolus vulgaris]
 gb|ESW31444.1| hypothetical protein PHAVU_002G238600g [Phaseolus vulgaris]
Length=179

 Score =   204 bits (519),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQ PPVALS C++ HVLDF+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  31   RYESQKRRDWNTFGQYLKNQSPPVALSQCNFNHVLDFLRYLDQFGKTKVHLHGCIFFGQP  90

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PC CPLRQAWGSLDALIGRLRAA+EE+GGSPETNPF  G+IR+YLREV++ QAKAR
Sbjct  91   TPPAPCACPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGGGSIRVYLREVKECQAKAR  150

Query  526  GIPY  515
            GIPY
Sbjct  151  GIPY  154



>ref|XP_004244278.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like isoform 
X2 [Solanum lycopersicum]
Length=168

 Score =   204 bits (518),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 105/127 (83%), Gaps = 3/127 (2%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+N +PPV L  C+Y HVLDF+ YLDQFGKTKVHL GC+FFGQ 
Sbjct  41   RYESQKRRDWNTFGQYLKNHKPPVPLPQCNYNHVLDFLRYLDQFGKTKVHLNGCVFFGQV  100

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVR---DMQA  536
            E  GPCTCPLRQAWGSLDALIGRLRAA+EENGG  ETNPFAN AIR+YLRE R   D++ 
Sbjct  101  EQVGPCTCPLRQAWGSLDALIGRLRAAYEENGGLQETNPFANSAIRIYLREARADEDLKL  160

Query  535  KARGIPY  515
            +   I +
Sbjct  161  RINSIAF  167



>ref|XP_009398867.1| PREDICTED: protein G1-like4 [Musa acuminata subsp. malaccensis]
Length=206

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYLRN RPP++LS C  +HVL+F+ YLDQFGKTK+H   C FFG +
Sbjct  43   RYESQKRRDWNTFGQYLRNHRPPLSLSQCSSSHVLEFLRYLDQFGKTKIHTHLCPFFGNS  102

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PC CPLRQAWGSLDALIGRLRAA+EENGG PE+NPF   AIR+YLREVR++Q+KAR
Sbjct  103  NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKPESNPFGARAIRLYLREVREVQSKAR  162

Query  526  GIPY  515
            GI Y
Sbjct  163  GISY  166



>ref|XP_007159026.1| hypothetical protein PHAVU_002G202200g [Phaseolus vulgaris]
 gb|ESW31020.1| hypothetical protein PHAVU_002G202200g [Phaseolus vulgaris]
Length=230

 Score =   206 bits (523),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+N RPP+ LS C   HVL+F+ YLDQFGKTKVH + C FFG +
Sbjct  42   RYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHAETCAFFGNS  101

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P GPC+CPL+QAWGSLDALIGRLRAAFEE+GG+PE NPF   A+R+YLREVRD QAKAR
Sbjct  102  HPPGPCSCPLKQAWGSLDALIGRLRAAFEEHGGAPEMNPFGTRAVRLYLREVRDAQAKAR  161

Query  526  GIPY  515
            GI Y
Sbjct  162  GIAY  165



>dbj|BAI52974.1| G1-like protein [Selaginella moellendorffii]
Length=225

 Score =   205 bits (522),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYE+QKRRDWNTFGQYL+N RPP+ALS C   HVL+F+ YLDQFGKTK+H   C FFG A
Sbjct  37   RYEAQKRRDWNTFGQYLKNHRPPLALSRCSGAHVLEFLRYLDQFGKTKIHAPACPFFGLA  96

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PC CPLRQAWGSLDALIGRLRAAFEE+GG PE+NPF   A+R+YLREVR+MQAKAR
Sbjct  97   HPPAPCACPLRQAWGSLDALIGRLRAAFEEHGGKPESNPFGARAVRLYLREVREMQAKAR  156

Query  526  GIPY  515
            GI Y
Sbjct  157  GIAY  160



>ref|XP_002892379.1| hypothetical protein ARALYDRAFT_887918 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68638.1| hypothetical protein ARALYDRAFT_887918 [Arabidopsis lyrata subsp. 
lyrata]
Length=198

 Score =   204 bits (519),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL+N +PP+ALS C   HV++F+ YLDQFGKTKVH+  C +FG  
Sbjct  33   RYESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAACPYFGHQ  92

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PC+CPL+QAWGSLDALIGRLRAA+EENGG P++NPFA  A+R+YLREVR+ QAKAR
Sbjct  93   QPPSPCSCPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFATRAVRIYLREVRESQAKAR  152

Query  526  GIPY  515
            GIPY
Sbjct  153  GIPY  156



>ref|XP_010529198.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
 ref|XP_010529199.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
 ref|XP_010529200.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
 ref|XP_010532377.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
 ref|XP_010532378.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
 ref|XP_010532379.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
Length=208

 Score =   204 bits (519),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL++Q PPV++S  DY+HVL F+ YLDQFGKTKVH   C+FFGQ 
Sbjct  44   RYESQKRRDWNTFLQYLKSQNPPVSMSQFDYSHVLSFLKYLDQFGKTKVHHPSCVFFGQP  103

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGSPETNPFANGAIRMYLREVRDMQAKA  530
            +P  PCTCPLRQAWGSLDALIGRLRAA+EE+ GGSPE NPF NGAIR++LRE+R+ QA+A
Sbjct  104  DPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGGSPENNPFGNGAIRVHLREMRESQARA  163

Query  529  RGIPY  515
            RGIPY
Sbjct  164  RGIPY  168



>ref|XP_010518804.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
 ref|XP_010518805.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
 ref|XP_010518806.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
Length=195

 Score =   203 bits (517),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL++Q+PP+++S  +Y+HVL F+ YLDQFGKTKVH Q C+FFGQ 
Sbjct  38   RYESQKRRDWNTFLQYLKSQKPPISMSQFEYSHVLSFLNYLDQFGKTKVHNQACVFFGQP  97

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGSPETNPFANGAIRMYLREVRDMQAKA  530
            +P   CTCPLRQAWGSLDALIGRLRAA+EE+ GGS E+NPFANGAIR++LREV++ Q++A
Sbjct  98   DPPAACTCPLRQAWGSLDALIGRLRAAYEEHGGGSTESNPFANGAIRVHLREVKESQSRA  157

Query  529  RGIPY  515
            RGIPY
Sbjct  158  RGIPY  162



>ref|XP_010457872.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6-like [Camelina 
sativa]
Length=196

 Score =   203 bits (517),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL+N +PP+ALS C   HV++F+ YLDQFGKTKVH+  C +FG  
Sbjct  33   RYESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAACPYFGHQ  92

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PC+CPL+QAWGSLDALIGRLRAA+EENGG P++NPFA  A+R+YLREVR+ QAKAR
Sbjct  93   QPPSPCSCPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFAARAVRIYLREVRETQAKAR  152

Query  526  GIPY  515
            GIPY
Sbjct  153  GIPY  156



>gb|AES98763.2| DUF640 family protein [Medicago truncatula]
Length=225

 Score =   204 bits (519),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYLRN +PP+ L+ C   HV++F+ YLDQFGKTKVH+ GC +FGQ 
Sbjct  37   RYESQKRRDWNTFQQYLRNHKPPLTLALCSGAHVIEFLKYLDQFGKTKVHVIGCPYFGQP  96

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PC CPL+QAWGSLDALIGRLRAAFEENGG PE+NPF   A+R+YLREV+D QAKAR
Sbjct  97   NPPSPCACPLKQAWGSLDALIGRLRAAFEENGGKPESNPFGTRAVRIYLREVKDGQAKAR  156

Query  526  GIPY  515
            G+PY
Sbjct  157  GVPY  160



>gb|EYU28084.1| hypothetical protein MIMGU_mgv1a022457mg [Erythranthe guttata]
Length=176

 Score =   202 bits (515),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV+L  C+  HVL+F+ YLDQFGKTKVH+ GC+FFGQ 
Sbjct  23   RYESQKRRDWNTFGQYLKNQRPPVSLPQCNCNHVLEFLRYLDQFGKTKVHVHGCVFFGQP  82

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PCTCPLRQAWGSLDALIGRLRAA+EE+GGSPETNPF NG+IR+YLREV+D QAKAR
Sbjct  83   APPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGSIRVYLREVKDCQAKAR  142

Query  526  GIPY  515
            GIPY
Sbjct  143  GIPY  146



>ref|XP_010475462.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6-like [Camelina 
sativa]
Length=196

 Score =   203 bits (516),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL+N +PP+ALS C   HV++F+ YLDQFGKTKVH+  C +FG  
Sbjct  33   RYESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAACPYFGHQ  92

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PC+CPL+QAWGSLDALIGRLRAA+EENGG P++NPFA  A+R+YLREVR+ QAKAR
Sbjct  93   QPPSPCSCPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFAARAVRIYLREVRESQAKAR  152

Query  526  GIPY  515
            GIPY
Sbjct  153  GIPY  156



>ref|XP_010487116.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6 [Camelina 
sativa]
Length=196

 Score =   203 bits (516),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL+N +PP+ALS C   HV++F+ YLDQFGKTKVH+  C +FG  
Sbjct  33   RYESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAACPYFGHQ  92

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PC+CPL+QAWGSLDALIGRLRAA+EENGG P++NPFA  A+R+YLREVR+ QAKAR
Sbjct  93   QPPSPCSCPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFAARAVRIYLREVRESQAKAR  152

Query  526  GIPY  515
            GIPY
Sbjct  153  GIPY  156



>ref|XP_008649559.1| PREDICTED: protein G1-like7 [Zea mays]
 gb|AFW77771.1| putative protein of unknown function (DUF640) domain family protein 
[Zea mays]
Length=301

 Score =   206 bits (525),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYLRN +PP+ L+ C   HV++F+ YLDQFGKTKVH +GC +FGQ 
Sbjct  83   RYESQKRRDWNTFLQYLRNHKPPLTLARCSGAHVIEFLRYLDQFGKTKVHAEGCAYFGQP  142

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG PE+NPFA  A+R+YLR+VR+ QAKAR
Sbjct  143  NPPAPCTCPLRQAWGSLDALIGRLRAAYEESGGRPESNPFAAKAVRIYLRDVREAQAKAR  202

Query  526  GIPY  515
            GIPY
Sbjct  203  GIPY  206



>ref|NP_563780.1| protein LIGHT SENSITIVE HYPOCOTYLS 6 [Arabidopsis thaliana]
 sp|Q9LMK2.1|LSH6_ARATH RecName: Full=Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6; AltName: 
Full=Protein ORGAN BOUNDARY 6 [Arabidopsis thaliana]
 gb|AAF82211.1|AC067971_19 Strong similarity to an unknown protein At2g31160 gi|3746060 
from Arabidopsis thaliana BAC F7F1 gb|AC005311. EST gb|AI998165 
comes from this gene [Arabidopsis thaliana]
 gb|AAM63916.1| unknown [Arabidopsis thaliana]
 gb|AAO41893.1| unknown protein [Arabidopsis thaliana]
 gb|AAV84524.1| At1g07090 [Arabidopsis thaliana]
 gb|ABD42982.1| At1g07090 [Arabidopsis thaliana]
 gb|AEE28076.1| uncharacterized protein AT1G07090 [Arabidopsis thaliana]
Length=196

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL+N +PP+ALS C   HV++F+ YLDQFGKTKVH+  C +FG  
Sbjct  31   RYESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAACPYFGHQ  90

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PC+CPL+QAWGSLDALIGRLRAA+EENGG P++NPFA  A+R+YLREVR+ QAKAR
Sbjct  91   QPPSPCSCPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFAARAVRIYLREVRESQAKAR  150

Query  526  GIPY  515
            GIPY
Sbjct  151  GIPY  154



>ref|XP_010538562.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
Length=198

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL++Q PPV+ S  DY+HVL F+ YLDQFGKTKVH Q C+FFGQ 
Sbjct  35   RYESQKRRDWNTFLQYLKSQNPPVSTSRFDYSHVLSFLQYLDQFGKTKVHDQACVFFGQP  94

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGSPETNPFANGAIRMYLREVRDMQAKA  530
             P  PCTCPLRQAWGSLDALIGRLRAA+EE+ GGSPE NPF NGAIR++LREVR+ QA+A
Sbjct  95   NPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGGSPENNPFGNGAIRVHLREVREAQARA  154

Query  529  RGIPY  515
            RGI +
Sbjct  155  RGITH  159



>ref|XP_006303356.1| hypothetical protein CARUB_v10010340mg [Capsella rubella]
 gb|EOA36254.1| hypothetical protein CARUB_v10010340mg [Capsella rubella]
Length=198

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL+N +PP+ALS C   HV++F+ YLDQFGKTKVH+  C +FG  
Sbjct  34   RYESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAACPYFGHQ  93

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PC+CPL+QAWGSLDALIGRLRAA+EENGG P++NPFA  A+R+YLREVR+ QAKAR
Sbjct  94   QPPSPCSCPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFAARAVRIYLREVRESQAKAR  153

Query  526  GIPY  515
            GIPY
Sbjct  154  GIPY  157



>ref|XP_009136943.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Brassica 
rapa]
 ref|XP_009136944.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Brassica 
rapa]
 emb|CDY53996.1| BnaA03g58210D [Brassica napus]
Length=191

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL++Q PP+ +S  +YTHVL F+ YLDQFGKTKVH Q C+FFGQ 
Sbjct  40   RYESQKRRDWNTFIQYLKSQNPPLLMSQFNYTHVLCFLRYLDQFGKTKVHEQACVFFGQP  99

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGSPETNPFANGAIRMYLREVRDMQAKA  530
            +P G CTCPL+QAWGSLDALIGRLRAA+EE+ GGSP+TNPFANG+IR++LREVR+ QAKA
Sbjct  100  DPPGACTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAKA  159

Query  529  RGIPY  515
            RGI Y
Sbjct  160  RGISY  164



>gb|KEH31304.1| G1-like protein [Medicago truncatula]
Length=234

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+N RPP+ LS C   HVL+F+ YLDQFGKTKVH + C +FG +
Sbjct  46   RYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHSENCAYFGNS  105

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P GPC CPL+QAWGSLDALIGRLRAAFEENGGS E NPF   A+R+YLREVRD QAKAR
Sbjct  106  HPPGPCPCPLKQAWGSLDALIGRLRAAFEENGGSQEMNPFGARAVRLYLREVRDAQAKAR  165

Query  526  GIPY  515
            GI Y
Sbjct  166  GIGY  169



>ref|NP_001143976.1| uncharacterized protein LOC100276793 [Zea mays]
 gb|ACG36867.1| hypothetical protein [Zea mays]
Length=305

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYLRN +PP+ L+ C   HV++F+ YLDQFGKTKVH +GC +FGQ 
Sbjct  85   RYESQKRRDWNTFLQYLRNHKPPLTLARCSGAHVIEFLRYLDQFGKTKVHAEGCAYFGQP  144

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG PE+NPFA  A+R+YLR+VR+ QAKAR
Sbjct  145  NPPAPCTCPLRQAWGSLDALIGRLRAAYEESGGRPESNPFAAKAVRIYLRDVREAQAKAR  204

Query  526  GIPY  515
            GIPY
Sbjct  205  GIPY  208



>ref|XP_003615805.1| hypothetical protein MTR_5g072510 [Medicago truncatula]
Length=257

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYLRN +PP+ L+ C   HV++F+ YLDQFGKTKVH+ GC +FGQ 
Sbjct  37   RYESQKRRDWNTFQQYLRNHKPPLTLALCSGAHVIEFLKYLDQFGKTKVHVIGCPYFGQP  96

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PC CPL+QAWGSLDALIGRLRAAFEENGG PE+NPF   A+R+YLREV+D QAKAR
Sbjct  97   NPPSPCACPLKQAWGSLDALIGRLRAAFEENGGKPESNPFGTRAVRIYLREVKDGQAKAR  156

Query  526  GIPY  515
            G+PY
Sbjct  157  GVPY  160



>ref|XP_002267312.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 1-like [Vitis 
vinifera]
Length=181

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYE+QKRRDWNTFGQYLRN RPP++LS C+  HVL+F+ YLDQFGKTKVH Q C FFG  
Sbjct  38   RYENQKRRDWNTFGQYLRNHRPPLSLSLCNGAHVLEFLRYLDQFGKTKVHNQTCPFFGLK  97

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PC CPLRQAWGSLDALIGRLRAA+EE+GG PE NPF   A+R+YLREVRD QAKAR
Sbjct  98   NPPAPCPCPLRQAWGSLDALIGRLRAAYEEHGGKPEANPFGARAVRLYLREVRDFQAKAR  157

Query  526  GIPY  515
            G+ Y
Sbjct  158  GVSY  161



>ref|XP_008657105.1| PREDICTED: protein G1-like7 [Zea mays]
 gb|AFW84710.1| putative protein of unknown function (DUF640) domain family protein 
[Zea mays]
Length=208

 Score =   202 bits (514),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYLRN RPP+ L+ C   HV++F+ YLDQFGKTKVH  GC ++GQ 
Sbjct  33   RYESQKRRDWNTFLQYLRNHRPPLTLARCSGAHVIEFLRYLDQFGKTKVHAAGCAYYGQR  92

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P GPC CPLRQAWGSLDALIGRLRAA+EE+G +PE+NP A  A+R+YLREVRD QAKAR
Sbjct  93   APPGPCPCPLRQAWGSLDALIGRLRAAYEESGRTPESNPLAARAVRIYLREVRDSQAKAR  152

Query  526  GIPY  515
            GIPY
Sbjct  153  GIPY  156



>gb|KHG10505.1| Error-prone DNA polymerase [Gossypium arboreum]
Length=238

 Score =   203 bits (516),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL+N +PP+ L+ C   HV++F+ YLDQFGKTKVH+ GC +FG  
Sbjct  52   RYESQKRRDWNTFLQYLKNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHITGCPYFGHP  111

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PC+CPL+QAWGSLDALIGRLRAA+EENGG PE+NPFA  A+R+YLREVR+ QAKAR
Sbjct  112  NPPAPCSCPLKQAWGSLDALIGRLRAAYEENGGRPESNPFAARAVRIYLREVREGQAKAR  171

Query  526  GIPY  515
            GIPY
Sbjct  172  GIPY  175



>gb|KHN45745.1| hypothetical protein glysoja_043995 [Glycine soja]
Length=178

 Score =   201 bits (511),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+NQRPPV LS C+  HVLDF+ YLDQFGKTKVHLQGC+F+GQ 
Sbjct  32   RYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYGQP  91

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PC CPLRQAWGSLDALIGRLRAA+EENGGSPETNPFA+G+IR+YLREVR+ QAKAR
Sbjct  92   EPPAPCACPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLREVRECQAKAR  151

Query  526  GIPY  515
             + +
Sbjct  152  ALAF  155



>ref|XP_008804907.1| PREDICTED: protein G1-like7 [Phoenix dactylifera]
Length=229

 Score =   202 bits (515),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYLRN +PP+ L+ C   HV++F+ YLDQFGKTKVH  GC FFGQ 
Sbjct  44   RYESQKRRDWNTFLQYLRNHKPPLTLARCSGAHVIEFLRYLDQFGKTKVHNAGCTFFGQP  103

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P GPC CPL+QAWGSLDALIGRLRAA+EE+GG PE NPFA  A+R+YLREVR+ QAKAR
Sbjct  104  NPPGPCACPLKQAWGSLDALIGRLRAAYEESGGRPEANPFAARAVRIYLREVRESQAKAR  163

Query  526  GIPY  515
            G+PY
Sbjct  164  GVPY  167



>ref|XP_009615590.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=194

 Score =   201 bits (511),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTFGQYL+N RPP+ LS C+Y HVL+F+ YLDQFGKTKVHL GC FFGQ 
Sbjct  43   RYESQKRRDWNTFGQYLKNLRPPIPLSQCNYNHVLEFLRYLDQFGKTKVHLHGCPFFGQP  102

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            EP  PC CPLRQAWGSLDALIGRLRAA+EENGG PE NPFA+G+IR+YLREVRD QAKAR
Sbjct  103  EPPAPCACPLRQAWGSLDALIGRLRAAYEENGGLPENNPFASGSIRIYLREVRDFQAKAR  162

Query  526  GIPY  515
            GI Y
Sbjct  163  GISY  166



>ref|XP_010922606.1| PREDICTED: protein G1-like7 [Elaeis guineensis]
Length=225

 Score =   202 bits (513),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYLRN +PP+ L+ C   HV++F+ YLDQFGKTKVH  GC FFGQ 
Sbjct  40   RYESQKRRDWNTFLQYLRNHKPPLTLARCSGAHVIEFLRYLDQFGKTKVHNAGCTFFGQP  99

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P GPC CPL+QAWGSLDALIGRLRAA+EE+GG PE NPFA  A+R+YLREVR+ QAKAR
Sbjct  100  NPPGPCACPLKQAWGSLDALIGRLRAAYEESGGRPEANPFAARAVRIYLREVRESQAKAR  159

Query  526  GIPY  515
            G+PY
Sbjct  160  GVPY  163



>gb|KFK43023.1| hypothetical protein AALP_AA1G068900 [Arabis alpina]
Length=194

 Score =   201 bits (511),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL+N +PP+ALS C   HV++F+ YLDQFGKTKVH+  C +FG  
Sbjct  33   RYESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAACPYFGHQ  92

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PC CPL+QAWGSLDALIGRLRAA+EENGG P++NPFA  A+R+YLREVR+ QAKAR
Sbjct  93   QPPSPCACPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFAARAVRIYLREVRESQAKAR  152

Query  526  GIPY  515
            GIPY
Sbjct  153  GIPY  156



>ref|XP_007016962.1| Zinc finger protein ZFPM1 [Theobroma cacao]
 gb|EOY34581.1| Zinc finger protein ZFPM1 [Theobroma cacao]
Length=241

 Score =   202 bits (514),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL+N +PP+ L+ C   HV++F+ YLDQFGKTKVH+ GC +FG  
Sbjct  53   RYESQKRRDWNTFLQYLKNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHITGCPYFGHP  112

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PC+CPL+QAWGSLDALIGRLRAA+EENGG PE+NPF   A+R+YLREVR+ QAKAR
Sbjct  113  NPPAPCSCPLKQAWGSLDALIGRLRAAYEENGGRPESNPFGAKAVRIYLREVREGQAKAR  172

Query  526  GIPY  515
            GIPY
Sbjct  173  GIPY  176



>ref|XP_010043398.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5 isoform 
X3 [Eucalyptus grandis]
 gb|KCW85401.1| hypothetical protein EUGRSUZ_B02224 [Eucalyptus grandis]
Length=204

 Score =   201 bits (511),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL+N +PP+ L+ C    VL+F+ YLDQFGKTKVH+ GC FFG  
Sbjct  50   RYESQKRRDWNTFLQYLQNHKPPLTLARCSGAQVLEFLKYLDQFGKTKVHMNGCPFFGNP  109

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P GPC CPL+QAWGSLDALIGRLRAAFEENGG PE NPFA  A+R+YLREV++ QAKAR
Sbjct  110  TPPGPCACPLKQAWGSLDALIGRLRAAFEENGGRPELNPFAARAVRIYLREVKEGQAKAR  169

Query  526  GIPY  515
            GIPY
Sbjct  170  GIPY  173



>ref|XP_006417846.1| hypothetical protein EUTSA_v10009726mg [Eutrema salsugineum]
 gb|ESQ36199.1| hypothetical protein EUTSA_v10009726mg [Eutrema salsugineum]
Length=200

 Score =   201 bits (511),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL+N +PP+ALS C   HV++F+ YLDQFGKTKVH+  C +FG  
Sbjct  35   RYESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAVCPYFGHQ  94

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PC CPL+QAWGSLDALIGRLRAA+EENGG P++NPFA  A+R+YLREVR+ QAKAR
Sbjct  95   QPPSPCACPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFAARAVRIYLREVRESQAKAR  154

Query  526  GIPY  515
            GIPY
Sbjct  155  GIPY  158



>ref|XP_003629770.1| 177 protein [Medicago truncatula]
 gb|AET04246.1| DUF640 family protein [Medicago truncatula]
Length=185

 Score =   200 bits (509),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL++Q P V LSHC++ HVLDF+ YLDQFGKTKVH QGC+FFGQ 
Sbjct  31   RYESQKRRDWNTFNQYLKSQNPLVPLSHCNFNHVLDFLRYLDQFGKTKVHFQGCIFFGQP  90

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PC CPL+QAWGSLDALIGRLRAA+EENGGS ETNPFA GAIR+YLREV+D Q KAR
Sbjct  91   TPPAPCACPLKQAWGSLDALIGRLRAAYEENGGSSETNPFAGGAIRVYLREVKDSQQKAR  150

Query  526  GIPY  515
            GIPY
Sbjct  151  GIPY  154



>emb|CDY64755.1| BnaCnng44770D [Brassica napus]
Length=192

 Score =   200 bits (509),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYE+QKRRDWNTF QYLRN RPP++L  C   HVL+F+ YLDQFGKTKVH Q C FFG +
Sbjct  25   RYENQKRRDWNTFCQYLRNHRPPLSLPSCSGAHVLEFLRYLDQFGKTKVHHQNCAFFGLS  84

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PC CPLRQAWGSLDALIGRLRAA+EENGG PE NPF + A+R+YLREVRD QAKAR
Sbjct  85   NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGPPEANPFGSRAVRLYLREVRDFQAKAR  144

Query  526  GIPY  515
            G+ Y
Sbjct  145  GVSY  148



>ref|XP_006443825.1| hypothetical protein CICLE_v10022295mg [Citrus clementina]
 ref|XP_006479528.1| PREDICTED: uncharacterized protein LOC102612277 [Citrus sinensis]
 gb|ESR57065.1| hypothetical protein CICLE_v10022295mg [Citrus clementina]
Length=204

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYE+QKRRDWNTFGQYL+N RPP++LS C   HVL+F+ YLDQFGKTKVH   C F+G  
Sbjct  52   RYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHQ  111

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PC CPLRQAWGSLDALIGRLRAAFEENGG PE NPF   A+R+YLREVRD+Q+KAR
Sbjct  112  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDVQSKAR  171

Query  526  GIPY  515
            GI Y
Sbjct  172  GISY  175



>ref|XP_010043397.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5 isoform 
X2 [Eucalyptus grandis]
 gb|KCW85400.1| hypothetical protein EUGRSUZ_B02224 [Eucalyptus grandis]
Length=225

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL+N +PP+ L+ C    VL+F+ YLDQFGKTKVH+ GC FFG  
Sbjct  50   RYESQKRRDWNTFLQYLQNHKPPLTLARCSGAQVLEFLKYLDQFGKTKVHMNGCPFFGNP  109

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P GPC CPL+QAWGSLDALIGRLRAAFEENGG PE NPFA  A+R+YLREV++ QAKAR
Sbjct  110  TPPGPCACPLKQAWGSLDALIGRLRAAFEENGGRPELNPFAARAVRIYLREVKEGQAKAR  169

Query  526  GIPY  515
            GIPY
Sbjct  170  GIPY  173



>gb|EYU45980.1| hypothetical protein MIMGU_mgv1a021801mg [Erythranthe guttata]
Length=201

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYLRN +PP+ L+ C   HV++F+ YLDQFGKTKVH+ GC +FGQ 
Sbjct  43   RYESQKRRDWNTFQQYLRNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHVTGCPYFGQP  102

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
            +P  PC C L+QAWGSLDALIGRLRAA+EENGG P+TNPF   A+R+YLREVR+ QAKAR
Sbjct  103  DPPAPCACQLKQAWGSLDALIGRLRAAYEENGGRPDTNPFGAKAVRIYLREVRESQAKAR  162

Query  526  GIPY  515
            GIPY
Sbjct  163  GIPY  166



>ref|XP_002313971.1| hypothetical protein POPTR_0009s07990g [Populus trichocarpa]
 gb|EEE87926.1| hypothetical protein POPTR_0009s07990g [Populus trichocarpa]
Length=223

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL+N +PP+ L+ C   HV++F+ YLDQFGKTKVH+ GC +FG  
Sbjct  48   RYESQKRRDWNTFLQYLKNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHITGCPYFGHP  107

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PC+CPL+QAWGSLDALIGRLRAA+EENGG PE+NPF   A+R+YLREVR+ QAKAR
Sbjct  108  NPPAPCSCPLKQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRIYLREVREGQAKAR  167

Query  526  GIPY  515
            GIPY
Sbjct  168  GIPY  171



>ref|XP_002961823.1| hypothetical protein SELMODRAFT_68566, partial [Selaginella moellendorffii]
 ref|XP_002980828.1| hypothetical protein SELMODRAFT_58613, partial [Selaginella moellendorffii]
 gb|EFJ18013.1| hypothetical protein SELMODRAFT_58613, partial [Selaginella moellendorffii]
 gb|EFJ37083.1| hypothetical protein SELMODRAFT_68566, partial [Selaginella moellendorffii]
Length=173

 Score =   199 bits (506),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYE+QKRRDWNTFGQYLRN RPP+ L  C   +VL+F+ YLDQFGKTK+H   C FFG A
Sbjct  28   RYEAQKRRDWNTFGQYLRNHRPPLTLPRCSGANVLEFLRYLDQFGKTKIHAPACPFFGIA  87

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PC CPLRQAWGSLDALIGRLRAAFEE+GG PE+NPF   A+R+YLREVR+MQAKAR
Sbjct  88   HPPAPCACPLRQAWGSLDALIGRLRAAFEEHGGKPESNPFGARAVRLYLREVREMQAKAR  147

Query  526  GIPY  515
            GI Y
Sbjct  148  GIAY  151



>ref|XP_006282119.1| hypothetical protein CARUB_v10028368mg [Capsella rubella]
 gb|EOA15017.1| hypothetical protein CARUB_v10028368mg [Capsella rubella]
Length=169

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 106/125 (85%), Gaps = 1/125 (1%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL+   PP+A+S  D+THVL F+ YLDQFGKTKVH Q C+FFGQ 
Sbjct  30   RYESQKRRDWNTFLQYLKTLNPPMAISIFDHTHVLSFLKYLDQFGKTKVHNQVCVFFGQP  89

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGSPETNPFANGAIRMYLREVRDMQAKA  530
            +P  PCTCPL+QAWGSLDALIGRLRAA+EE+ GGS E NPF NG+IR+YLREVR  QAKA
Sbjct  90   DPPLPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSSENNPFGNGSIRIYLREVRQFQAKA  149

Query  529  RGIPY  515
            RGIPY
Sbjct  150  RGIPY  154



>ref|XP_006847407.1| hypothetical protein AMTR_s00153p00047660 [Amborella trichopoda]
 gb|ERN08988.1| hypothetical protein AMTR_s00153p00047660 [Amborella trichopoda]
Length=203

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYL+N +PP++LS C   HV++F+ YLDQFGKTKVHL GC +FG  
Sbjct  40   RYESQKRRDWNTFLQYLKNHKPPLSLSRCSGAHVIEFLKYLDQFGKTKVHLVGCPYFGHP  99

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P  PC CPL+QAWGSLDALIGRLRAA+EENGG P+ NPF   A+R+YLREVR+ QAKAR
Sbjct  100  SPPNPCACPLKQAWGSLDALIGRLRAAYEENGGRPDANPFGARAVRIYLREVRESQAKAR  159

Query  526  GIPY  515
            GIPY
Sbjct  160  GIPY  163



>ref|XP_010906823.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6-like [Elaeis 
guineensis]
Length=218

 Score =   200 bits (508),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = -2

Query  886  RYESQKRRDWNTFGQYLRNQRPPVALSHCDYTHVLDFMAYLDQFGKTKVHLQGCLFFGQA  707
            RYESQKRRDWNTF QYLRN +PP+ L+ C   HV++F+ YLDQFGKTKVH  GC FFG  
Sbjct  36   RYESQKRRDWNTFLQYLRNHKPPLTLARCSGAHVIEFLRYLDQFGKTKVHNAGCAFFGHP  95

Query  706  EPGGPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFANGAIRMYLREVRDMQAKAR  527
             P GPC CPL+QAWGSLDALIGRLRAA+EE+GG PE NPFA  A+R+YLREVR+ QAKAR
Sbjct  96   NPPGPCACPLKQAWGSLDALIGRLRAAYEESGGRPEANPFAARAVRIYLREVRESQAKAR  155

Query  526  GIPY  515
            GIPY
Sbjct  156  GIPY  159



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1790173656348