BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19101_g1_i1 len=706 path=[440:0-375 113:376-538 977:539-543
2057:544-619 977:620-624 2057:625-700 977:701-705]

Length=706
                                                                      Score     E

ref|XP_009620404.1|  PREDICTED: germin-like protein subfamily 1 m...    197   1e-58   
ref|XP_009795503.1|  PREDICTED: germin-like protein subfamily 1 m...    196   3e-58   
ref|XP_009784933.1|  PREDICTED: germin-like protein subfamily 1 m...    196   3e-58   
emb|CDP16787.1|  unnamed protein product                                195   4e-58   
ref|XP_009612542.1|  PREDICTED: putative germin-like protein 2-1        195   5e-58   
ref|XP_009612541.1|  PREDICTED: germin-like protein subfamily 1 m...    194   8e-58   
ref|XP_009786129.1|  PREDICTED: putative germin-like protein 2-1        194   9e-58   
emb|CDP22064.1|  unnamed protein product                                194   2e-57   
ref|XP_009795501.1|  PREDICTED: putative germin-like protein 2-1        193   2e-57   
ref|XP_009625530.1|  PREDICTED: putative germin-like protein 2-1        193   3e-57   
emb|CDP16790.1|  unnamed protein product                                193   4e-57   
ref|XP_009786127.1|  PREDICTED: putative germin-like protein 2-1        192   4e-57   
ref|XP_009627660.1|  PREDICTED: germin-like protein subfamily 1 m...    192   4e-57   
ref|XP_006349261.1|  PREDICTED: putative germin-like protein 2-1-...    192   7e-57   
ref|XP_009612543.1|  PREDICTED: germin-like protein subfamily 1 m...    192   7e-57   
ref|XP_004230405.1|  PREDICTED: germin-like protein subfamily 1 m...    191   1e-56   
ref|XP_011099652.1|  PREDICTED: putative germin-like protein 2-1        191   1e-56   
emb|CDP16789.1|  unnamed protein product                                198   2e-56   
ref|XP_009620917.1|  PREDICTED: germin-like protein subfamily 1 m...    191   2e-56   
ref|XP_004230404.1|  PREDICTED: putative germin-like protein 2-1        191   2e-56   
ref|XP_006349267.1|  PREDICTED: germin-like protein subfamily 1 m...    191   2e-56   
ref|XP_004230403.1|  PREDICTED: putative germin-like protein 2-1        191   2e-56   
gb|EYU28622.1|  hypothetical protein MIMGU_mgv1a018753mg                191   3e-56   
ref|XP_006358463.1|  PREDICTED: germin-like protein subfamily 1 m...    190   3e-56   
ref|XP_006349263.1|  PREDICTED: germin-like protein subfamily 1 m...    190   5e-56   
emb|CDP10693.1|  unnamed protein product                                189   6e-56   
ref|XP_011099651.1|  PREDICTED: germin-like protein subfamily 1 m...    189   6e-56   
ref|XP_006346966.1|  PREDICTED: putative germin-like protein 2-1-...    189   6e-56   
gb|EYU20541.1|  hypothetical protein MIMGU_mgv1a018988mg                189   7e-56   
gb|KCW80407.1|  hypothetical protein EUGRSUZ_C01764                     189   9e-56   
ref|XP_006358459.1|  PREDICTED: germin-like protein subfamily 1 m...    189   9e-56   
ref|XP_009341765.1|  PREDICTED: germin-like protein subfamily 1 m...    189   9e-56   
gb|AFW90592.1|  germin-like protein subfamily 1 member 20 precursor     189   1e-55   
gb|EYU38444.1|  hypothetical protein MIMGU_mgv1a013102mg                189   1e-55   
ref|XP_010024920.1|  PREDICTED: germin-like protein subfamily 1 m...    189   1e-55   
emb|CDP21353.1|  unnamed protein product                                195   1e-55   
ref|XP_002531991.1|  Rhicadhesin receptor precursor, putative           187   2e-55   Ricinus communis
ref|XP_010042132.1|  PREDICTED: germin-like protein subfamily 1 m...    188   2e-55   
ref|XP_006358461.1|  PREDICTED: germin-like protein subfamily 1 m...    188   2e-55   
ref|XP_010024921.1|  PREDICTED: germin-like protein subfamily 1 m...    188   2e-55   
ref|XP_010024911.1|  PREDICTED: germin-like protein subfamily 1 m...    187   3e-55   
emb|CDP10695.1|  unnamed protein product                                187   3e-55   
gb|EYU20547.1|  hypothetical protein MIMGU_mgv1a023357mg                188   3e-55   
ref|XP_010052624.1|  PREDICTED: germin-like protein subfamily 1 m...    187   3e-55   
emb|CDP10694.1|  unnamed protein product                                187   3e-55   
ref|XP_002530594.1|  Rhicadhesin receptor precursor, putative           186   3e-55   Ricinus communis
gb|KCW76697.1|  hypothetical protein EUGRSUZ_D01057                     187   4e-55   
gb|EYU40208.1|  hypothetical protein MIMGU_mgv1a020439mg                187   5e-55   
emb|CDP16791.1|  unnamed protein product                                187   5e-55   
ref|XP_010024919.1|  PREDICTED: germin-like protein subfamily 1 m...    187   5e-55   
ref|XP_006358462.1|  PREDICTED: germin-like protein subfamily 1 m...    187   5e-55   
ref|XP_010024918.1|  PREDICTED: germin-like protein subfamily 1 m...    187   5e-55   
ref|XP_006349264.1|  PREDICTED: germin-like protein subfamily 1 m...    187   7e-55   
gb|KCW61445.1|  hypothetical protein EUGRSUZ_H04176                     187   7e-55   
gb|EYU40210.1|  hypothetical protein MIMGU_mgv1a022317mg                187   7e-55   
ref|XP_010251872.1|  PREDICTED: putative germin-like protein 2-1        186   8e-55   
ref|XP_002531992.1|  Rhicadhesin receptor precursor, putative           186   8e-55   Ricinus communis
gb|EYU20548.1|  hypothetical protein MIMGU_mgv1a013109mg                186   1e-54   
ref|XP_010251871.1|  PREDICTED: putative germin-like protein 2-1        186   1e-54   
emb|CDP10932.1|  unnamed protein product                                186   2e-54   
ref|XP_008393482.1|  PREDICTED: germin-like protein subfamily 1 m...    186   2e-54   
ref|XP_002319672.1|  hypothetical protein POPTR_0013s04850g             185   2e-54   Populus trichocarpa [western balsam poplar]
ref|XP_010041605.1|  PREDICTED: germin-like protein subfamily 1 m...    185   2e-54   
gb|KCW80409.1|  hypothetical protein EUGRSUZ_C01766                     185   2e-54   
gb|EYU40211.1|  hypothetical protein MIMGU_mgv1a013108mg                186   2e-54   
ref|XP_002319671.1|  hypothetical protein POPTR_0013s04840g             185   3e-54   Populus trichocarpa [western balsam poplar]
ref|XP_010027145.1|  PREDICTED: germin-like protein subfamily 1 m...    185   3e-54   
emb|CDP16788.1|  unnamed protein product                                185   3e-54   
gb|EYU20535.1|  hypothetical protein MIMGU_mgv1a013054mg                185   3e-54   
ref|XP_010024913.1|  PREDICTED: germin-like protein subfamily 1 m...    185   4e-54   
ref|XP_006349268.1|  PREDICTED: germin-like protein subfamily 1 m...    185   4e-54   
ref|XP_010066338.1|  PREDICTED: germin-like protein subfamily 1 m...    184   4e-54   
ref|XP_011038440.1|  PREDICTED: germin-like protein subfamily 1 m...    184   4e-54   
gb|EYU20536.1|  hypothetical protein MIMGU_mgv1a025658mg                185   4e-54   
ref|XP_010048221.1|  PREDICTED: germin-like protein subfamily 1 m...    184   5e-54   
emb|CDP10698.1|  unnamed protein product                                184   6e-54   
gb|EYU20545.1|  hypothetical protein MIMGU_mgv1a020779mg                184   6e-54   
gb|EYU20549.1|  hypothetical protein MIMGU_mgv1a020596mg                184   7e-54   
ref|XP_007200176.1|  hypothetical protein PRUPE_ppa016529mg             184   8e-54   
ref|XP_011034444.1|  PREDICTED: germin-like protein subfamily 1 m...    184   9e-54   
ref|XP_006358464.1|  PREDICTED: germin-like protein subfamily 1 m...    184   9e-54   
ref|XP_007199217.1|  hypothetical protein PRUPE_ppa021882mg             184   9e-54   
ref|XP_011034445.1|  PREDICTED: germin-like protein subfamily 1 m...    184   9e-54   
gb|KCW61456.1|  hypothetical protein EUGRSUZ_H04192                     184   9e-54   
ref|XP_010024917.1|  PREDICTED: germin-like protein subfamily 1 m...    184   1e-53   
emb|CAN80134.1|  hypothetical protein VITISV_012033                     184   1e-53   Vitis vinifera
ref|XP_010024912.1|  PREDICTED: germin-like protein subfamily 1 m...    184   1e-53   
ref|XP_010251869.1|  PREDICTED: putative germin-like protein 2-1 ...    183   1e-53   
ref|XP_011034442.1|  PREDICTED: germin-like protein subfamily 1 m...    184   1e-53   
ref|XP_010251870.1|  PREDICTED: putative germin-like protein 2-1 ...    183   1e-53   
emb|CDP10933.1|  unnamed protein product                                183   1e-53   
ref|XP_010027139.1|  PREDICTED: germin-like protein subfamily 1 m...    183   1e-53   
gb|EYU20539.1|  hypothetical protein MIMGU_mgv1a013072mg                183   2e-53   
gb|EYU20542.1|  hypothetical protein MIMGU_mgv1a020630mg                183   2e-53   
ref|XP_011034443.1|  PREDICTED: germin-like protein subfamily 1 m...    183   2e-53   
ref|XP_008375054.1|  PREDICTED: germin-like protein subfamily 1 m...    183   2e-53   
ref|XP_002276644.1|  PREDICTED: putative germin-like protein 2-1        183   2e-53   Vitis vinifera
ref|XP_010050748.1|  PREDICTED: uncharacterized protein LOC104439371    189   2e-53   
ref|XP_006349265.1|  PREDICTED: germin-like protein subfamily 1 m...    183   3e-53   
gb|KCW61438.1|  hypothetical protein EUGRSUZ_H04168                     182   3e-53   
gb|KCW82834.1|  hypothetical protein EUGRSUZ_C04205                     182   3e-53   
ref|XP_010024923.1|  PREDICTED: germin-like protein subfamily 1 m...    182   3e-53   
ref|XP_011038438.1|  PREDICTED: germin-like protein subfamily 1 m...    182   3e-53   
gb|EYU20546.1|  hypothetical protein MIMGU_mgv1a013111mg                182   3e-53   
gb|EYU20540.1|  hypothetical protein MIMGU_mgv1a013117mg                182   3e-53   
ref|XP_010024926.1|  PREDICTED: germin-like protein subfamily 1 m...    182   3e-53   
ref|XP_007030276.1|  RmlC-like cupins superfamily protein               182   4e-53   
ref|XP_006387364.1|  hypothetical protein POPTR_1158s00200g             182   4e-53   
ref|XP_010050166.1|  PREDICTED: germin-like protein subfamily 1 m...    182   5e-53   
ref|XP_010024924.1|  PREDICTED: germin-like protein subfamily 1 m...    182   5e-53   
ref|XP_002276315.2|  PREDICTED: putative germin-like protein 2-1        182   5e-53   Vitis vinifera
ref|XP_010251867.1|  PREDICTED: putative germin-like protein 2-1        182   5e-53   
ref|XP_007201690.1|  hypothetical protein PRUPE_ppa016952mg             180   6e-53   
emb|CDP14600.1|  unnamed protein product                                182   6e-53   
gb|KCW44233.1|  hypothetical protein EUGRSUZ_L02343                     182   8e-53   
emb|CDP10701.1|  unnamed protein product                                182   8e-53   
ref|XP_011038439.1|  PREDICTED: germin-like protein subfamily 1 m...    182   9e-53   
ref|XP_002276756.2|  PREDICTED: putative germin-like protein 2-1        181   9e-53   Vitis vinifera
gb|KCW64218.1|  hypothetical protein EUGRSUZ_G01868                     181   1e-52   
ref|XP_010049990.1|  PREDICTED: germin-like protein subfamily 1 m...    181   1e-52   
gb|KCW76699.1|  hypothetical protein EUGRSUZ_D01059                     181   1e-52   
ref|XP_010054506.1|  PREDICTED: uncharacterized protein LOC104442816    187   1e-52   
ref|XP_002319184.1|  hypothetical protein POPTR_0013s06030g             181   1e-52   Populus trichocarpa [western balsam poplar]
ref|XP_010241946.1|  PREDICTED: putative germin-like protein 2-1        181   2e-52   
ref|XP_010027143.1|  PREDICTED: uncharacterized protein LOC104417591    187   2e-52   
ref|XP_008393483.1|  PREDICTED: germin-like protein subfamily 1 m...    181   2e-52   
ref|XP_008351931.1|  PREDICTED: germin-like protein subfamily 1 m...    180   2e-52   
emb|CDP14601.1|  unnamed protein product                                180   2e-52   
ref|XP_009349816.1|  PREDICTED: germin-like protein subfamily 1 m...    180   2e-52   
ref|XP_007200183.1|  hypothetical protein PRUPE_ppa016284mg             180   2e-52   
ref|XP_010050174.1|  PREDICTED: germin-like protein subfamily 1 m...    180   3e-52   
ref|XP_008237387.1|  PREDICTED: germin-like protein subfamily 1 m...    180   3e-52   
gb|KCW61442.1|  hypothetical protein EUGRSUZ_H04173                     179   3e-52   
gb|EYU40209.1|  hypothetical protein MIMGU_mgv1a013129mg                180   3e-52   
ref|XP_008360941.1|  PREDICTED: germin-like protein subfamily 1 m...    180   3e-52   
ref|XP_011034308.1|  PREDICTED: germin-like protein subfamily 1 m...    180   4e-52   
ref|XP_008237521.1|  PREDICTED: germin-like protein subfamily 1 m...    180   4e-52   
ref|XP_008780704.1|  PREDICTED: germin-like protein 8-5                 177   5e-52   
ref|XP_008367619.1|  PREDICTED: germin-like protein subfamily 1 m...    179   5e-52   
ref|XP_002265608.1|  PREDICTED: putative germin-like protein 2-1        179   5e-52   Vitis vinifera
ref|XP_003633724.1|  PREDICTED: putative germin-like protein 2-1        179   6e-52   
emb|CBI33612.3|  unnamed protein product                                179   6e-52   
ref|XP_010662281.1|  PREDICTED: putative germin-like protein 2-1        178   6e-52   
emb|CAN70189.1|  hypothetical protein VITISV_016562                     179   6e-52   Vitis vinifera
ref|XP_007201563.1|  hypothetical protein PRUPE_ppa018105mg             179   6e-52   
ref|XP_010050157.1|  PREDICTED: germin-like protein subfamily 1 m...    179   7e-52   
ref|XP_010051709.1|  PREDICTED: germin-like protein subfamily 1 m...    179   8e-52   
ref|XP_002530595.1|  Oxalate oxidase 2 precursor, putative              178   9e-52   Ricinus communis
ref|XP_010049992.1|  PREDICTED: germin-like protein subfamily 1 m...    179   1e-51   
ref|XP_010051710.1|  PREDICTED: germin-like protein subfamily 1 m...    178   1e-51   
ref|XP_010049996.1|  PREDICTED: germin-like protein subfamily 1 m...    178   1e-51   
ref|XP_006358460.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    179   1e-51   
ref|XP_007030272.1|  RmlC-like cupins superfamily protein               178   1e-51   
ref|XP_010049995.1|  PREDICTED: germin-like protein subfamily 1 m...    178   1e-51   
ref|XP_010049993.1|  PREDICTED: germin-like protein subfamily 1 m...    178   1e-51   
emb|CAN66771.1|  hypothetical protein VITISV_022559                     178   1e-51   Vitis vinifera
ref|XP_002265857.1|  PREDICTED: putative germin-like protein 2-1        178   1e-51   Vitis vinifera
ref|XP_010041604.1|  PREDICTED: germin-like protein subfamily 1 m...    178   1e-51   
emb|CBI33611.3|  unnamed protein product                                180   1e-51   
ref|XP_008240380.1|  PREDICTED: germin-like protein subfamily 1 m...    178   1e-51   
ref|XP_010257844.1|  PREDICTED: putative germin-like protein 2-1        178   1e-51   
ref|XP_006845051.1|  hypothetical protein AMTR_s00794p00001640          178   1e-51   
ref|XP_009620876.1|  PREDICTED: putative germin-like protein 2-1        177   2e-51   
ref|XP_008778966.1|  PREDICTED: putative germin-like protein 2-1        178   2e-51   
ref|XP_007030265.1|  Germin-like protein 2                              178   2e-51   
ref|XP_003633723.2|  PREDICTED: putative germin-like protein 2-1        178   2e-51   
emb|CAN71631.1|  hypothetical protein VITISV_015711                     177   2e-51   Vitis vinifera
ref|XP_010066342.1|  PREDICTED: germin-like protein subfamily 1 m...    178   2e-51   
ref|XP_003633711.2|  PREDICTED: putative germin-like protein 2-1        177   2e-51   
ref|XP_007201630.1|  hypothetical protein PRUPE_ppa020060mg             178   2e-51   
emb|CBI33610.3|  unnamed protein product                                180   2e-51   
ref|XP_010911724.1|  PREDICTED: putative germin-like protein 2-1        177   2e-51   
ref|XP_010027140.1|  PREDICTED: uncharacterized protein LOC104417587    186   3e-51   
ref|XP_008243694.1|  PREDICTED: germin-like protein 9-1                 184   3e-51   
emb|CAN72994.1|  hypothetical protein VITISV_000563                     177   3e-51   Vitis vinifera
ref|XP_010049991.1|  PREDICTED: germin-like protein subfamily 1 m...    177   3e-51   
ref|XP_010066343.1|  PREDICTED: germin-like protein subfamily 1 m...    177   3e-51   
ref|XP_008243693.1|  PREDICTED: germin-like protein subfamily 1 m...    176   3e-51   
ref|XP_004293676.1|  PREDICTED: putative germin-like protein 2-1-...    177   3e-51   
ref|XP_011034305.1|  PREDICTED: germin-like protein subfamily 1 m...    177   3e-51   
ref|XP_007210592.1|  hypothetical protein PRUPE_ppa016616mg             177   3e-51   
ref|XP_010048594.1|  PREDICTED: germin-like protein subfamily 1 m...    177   4e-51   
emb|CAN73848.1|  hypothetical protein VITISV_021639                     174   4e-51   Vitis vinifera
gb|KCW82831.1|  hypothetical protein EUGRSUZ_C04202                     177   5e-51   
ref|XP_008237526.1|  PREDICTED: germin-like protein subfamily 1 m...    177   5e-51   
ref|XP_009355938.1|  PREDICTED: germin-like protein subfamily 1 m...    177   5e-51   
ref|XP_009385875.1|  PREDICTED: putative germin-like protein 2-1        176   7e-51   
ref|XP_007201148.1|  hypothetical protein PRUPE_ppa016020mg             176   7e-51   
emb|CDP16786.1|  unnamed protein product                                186   8e-51   
ref|XP_010051708.1|  PREDICTED: germin-like protein subfamily 1 m...    177   8e-51   
ref|XP_007140907.1|  hypothetical protein PHAVU_008G151200g             176   9e-51   
ref|XP_007030278.1|  Germin-like protein subfamily 1 member 18          183   9e-51   
ref|XP_010027136.1|  PREDICTED: uncharacterized protein LOC104417584    183   1e-50   
ref|XP_009357348.1|  PREDICTED: germin-like protein subfamily 1 m...    176   1e-50   
ref|XP_010659820.1|  PREDICTED: germin-like protein 3 isoform X1        175   1e-50   
ref|XP_011013026.1|  PREDICTED: germin-like protein subfamily 1 m...    176   1e-50   
ref|XP_011034307.1|  PREDICTED: germin-like protein subfamily 1 m...    176   1e-50   
gb|EPS67173.1|  hypothetical protein M569_07603                         176   1e-50   
ref|XP_007030273.1|  RmlC-like cupins superfamily protein               176   1e-50   
ref|XP_007030289.1|  RmlC-like cupins superfamily protein               175   2e-50   
ref|XP_009402557.1|  PREDICTED: putative germin-like protein 2-1        175   2e-50   
ref|XP_004291649.1|  PREDICTED: germin-like protein subfamily 1 m...    176   2e-50   
emb|CBI36791.3|  unnamed protein product                                175   2e-50   
ref|XP_007143989.1|  hypothetical protein PHAVU_007G119700g             175   2e-50   
ref|XP_008237522.1|  PREDICTED: germin-like protein subfamily 1 m...    176   2e-50   
ref|XP_008443754.1|  PREDICTED: germin-like protein subfamily 1 m...    175   2e-50   
ref|XP_007143990.1|  hypothetical protein PHAVU_007G119700g             175   2e-50   
ref|XP_004301229.1|  PREDICTED: germin-like protein subfamily 1 m...    175   2e-50   
ref|XP_008237524.1|  PREDICTED: germin-like protein subfamily 1 m...    175   2e-50   
ref|XP_010024915.1|  PREDICTED: putative germin-like protein 2-1        175   3e-50   
gb|KCW61437.1|  hypothetical protein EUGRSUZ_H04167                     175   3e-50   
ref|NP_001236994.1|  uncharacterized protein LOC100527249 precursor     175   3e-50   
ref|XP_007200157.1|  hypothetical protein PRUPE_ppa016753mg             175   3e-50   
ref|XP_009402547.1|  PREDICTED: putative germin-like protein 2-1 ...    175   3e-50   
gb|KCW61443.1|  hypothetical protein EUGRSUZ_H04174                     174   3e-50   
ref|XP_007201862.1|  hypothetical protein PRUPE_ppa020162mg             175   3e-50   
gb|KCW61436.1|  hypothetical protein EUGRSUZ_H04166                     174   3e-50   
ref|XP_008780761.1|  PREDICTED: germin-like protein 8-5                 172   4e-50   
ref|XP_008393146.1|  PREDICTED: germin-like protein subfamily 1 m...    174   4e-50   
gb|ACG69479.1|  germin-like protein 3                                   174   4e-50   Glycine max [soybeans]
emb|CAN70904.1|  hypothetical protein VITISV_032927                     173   4e-50   Vitis vinifera
emb|CAB65370.1|  germin-like protein                                    173   5e-50   Pisum sativum [garden pea]
gb|AFK49577.1|  unknown                                                 174   6e-50   
gb|KCW44232.1|  hypothetical protein EUGRSUZ_L02342                     174   6e-50   
ref|XP_003590904.1|  Germin-like protein subfamily 1 member             174   6e-50   
ref|XP_008363404.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    174   6e-50   
emb|CAN74828.1|  hypothetical protein VITISV_002139                     172   7e-50   Vitis vinifera
ref|XP_004142552.1|  PREDICTED: germin-like protein subfamily 1 m...    174   8e-50   
ref|XP_010251866.1|  PREDICTED: putative germin-like protein 2-1        173   9e-50   
gb|KDP23768.1|  hypothetical protein JCGZ_23601                         174   9e-50   
gb|KCW76698.1|  hypothetical protein EUGRSUZ_D01058                     172   1e-49   
ref|XP_007140901.1|  hypothetical protein PHAVU_008G1508000g            171   1e-49   
emb|CAN74480.1|  hypothetical protein VITISV_042844                     172   1e-49   Vitis vinifera
gb|ADD71877.1|  germin-like protein subfamily 1 member 1 precursor      173   1e-49   Arachis hypogaea [goober]
ref|XP_002281186.2|  PREDICTED: uncharacterized protein LOC100244552    180   1e-49   Vitis vinifera
ref|XP_006375870.1|  germin-like protein 1                              173   1e-49   
ref|XP_002265447.3|  PREDICTED: uncharacterized protein LOC100242782    179   1e-49   Vitis vinifera
ref|XP_010907049.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    173   1e-49   
ref|XP_002265297.3|  PREDICTED: uncharacterized protein LOC100247931    180   2e-49   Vitis vinifera
ref|XP_009402551.1|  PREDICTED: putative germin-like protein 2-1        172   2e-49   
ref|XP_008381868.1|  PREDICTED: germin-like protein subfamily 1 m...    171   2e-49   
ref|XP_004290344.1|  PREDICTED: germin-like protein subfamily 1 m...    173   2e-49   
ref|XP_009402550.1|  PREDICTED: putative germin-like protein 2-1        172   2e-49   
ref|XP_006375871.1|  hypothetical protein POPTR_0013s04880g             172   2e-49   
ref|XP_009402555.1|  PREDICTED: putative germin-like protein 2-2 ...    172   2e-49   
ref|XP_009402552.1|  PREDICTED: germin-like protein 12-2 isoform X1     172   3e-49   
ref|XP_009402556.1|  PREDICTED: putative germin-like protein 2-2 ...    171   3e-49   
ref|XP_010662282.1|  PREDICTED: putative germin-like protein 2-1        171   3e-49   
ref|XP_011099650.1|  PREDICTED: germin-like protein subfamily 1 m...    172   3e-49   
emb|CBI36790.3|  unnamed protein product                                172   3e-49   
gb|KHN28992.1|  Germin-like protein 12-1                                171   3e-49   
ref|XP_009402554.1|  PREDICTED: germin-like protein 12-2 isoform X2     172   3e-49   
ref|XP_010549631.1|  PREDICTED: germin-like protein subfamily 1 m...    169   3e-49   
gb|KHN10835.1|  Germin-like protein 12-1                                171   3e-49   
ref|XP_002452101.1|  hypothetical protein SORBIDRAFT_04g019700          172   3e-49   Sorghum bicolor [broomcorn]
emb|CAN71140.1|  hypothetical protein VITISV_005471                     172   4e-49   Vitis vinifera
ref|XP_006599050.1|  PREDICTED: germin-like protein subfamily 1 m...    172   4e-49   
ref|XP_008780786.1|  PREDICTED: germin-like protein 8-5                 169   4e-49   
ref|XP_007030281.1|  RmlC-like cupins superfamily protein isoform 2     172   4e-49   
ref|XP_007030280.1|  RmlC-like cupins superfamily protein isoform 1     172   4e-49   
emb|CBI39477.3|  unnamed protein product                                171   4e-49   
ref|XP_007030284.1|  RmlC-like cupins superfamily protein               172   5e-49   
gb|KHN28993.1|  Germin-like protein 12-1                                170   5e-49   
ref|XP_008237525.1|  PREDICTED: germin-like protein subfamily 1 m...    172   5e-49   
ref|XP_002319674.2|  hypothetical protein POPTR_0013s04920g             171   6e-49   Populus trichocarpa [western balsam poplar]
emb|CAB65371.1|  germin-like protein                                    171   6e-49   Pisum sativum [garden pea]
ref|XP_002284624.1|  PREDICTED: germin-like protein subfamily 1 m...    171   6e-49   Vitis vinifera
ref|NP_001237300.1|  uncharacterized protein LOC100527781 precursor     171   6e-49   
ref|XP_007199406.1|  hypothetical protein PRUPE_ppa026225mg             171   6e-49   
ref|NP_001268198.1|  germin-like protein 3 precursor                    171   6e-49   
ref|XP_002277055.1|  PREDICTED: putative germin-like protein 2-1        171   7e-49   Vitis vinifera
ref|XP_010024914.1|  PREDICTED: putative germin-like protein 2-1        171   7e-49   
gb|KDP23764.1|  hypothetical protein JCGZ_23597                         171   8e-49   
ref|NP_001241319.1|  germin-like protein subfamily 1 member 7-lik...    171   8e-49   
ref|XP_003553909.1|  PREDICTED: germin-like protein subfamily 1 m...    171   8e-49   
ref|XP_002488986.1|  hypothetical protein SORBIDRAFT_0737s002010        169   8e-49   Sorghum bicolor [broomcorn]
ref|XP_004952511.1|  PREDICTED: putative germin-like protein 2-2-...    171   9e-49   
emb|CAN80133.1|  hypothetical protein VITISV_012032                     171   9e-49   Vitis vinifera
ref|NP_001066188.1|  Os12g0154700                                       171   9e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008776811.1|  PREDICTED: putative germin-like protein 2-1 ...    170   9e-49   
ref|XP_008776810.1|  PREDICTED: putative germin-like protein 2-1 ...    170   1e-48   
gb|KHN28990.1|  Germin-like protein subfamily 1 member 7                171   1e-48   
ref|XP_006845853.1|  hypothetical protein AMTR_s00154p00039580          169   1e-48   
emb|CDP10146.1|  unnamed protein product                                171   1e-48   
ref|XP_002523177.1|  Rhicadhesin receptor precursor, putative           170   1e-48   
ref|XP_007030263.1|  Germin-like protein subfamily 1 member 18          171   1e-48   
ref|XP_006375874.1|  germin-like protein 1                              170   1e-48   
ref|XP_009402546.1|  PREDICTED: germin-like protein 12-2                170   1e-48   
emb|CAN74481.1|  hypothetical protein VITISV_042845                     169   1e-48   
ref|XP_002523178.1|  Rhicadhesin receptor precursor, putative           170   1e-48   
ref|XP_003536153.1|  PREDICTED: germin-like protein subfamily 1 m...    171   1e-48   
emb|CBI36816.3|  unnamed protein product                                170   1e-48   
ref|XP_002284320.1|  PREDICTED: germin-like protein subfamily 1 m...    170   2e-48   
ref|XP_004972687.1|  PREDICTED: germin-like protein 12-2-like           170   2e-48   
ref|XP_003553592.1|  PREDICTED: germin-like protein subfamily 1 m...    170   2e-48   
gb|KHN14792.1|  Germin-like protein subfamily 1 member 7                171   2e-48   
ref|XP_004513532.1|  PREDICTED: germin-like protein subfamily 1 m...    170   2e-48   
gb|KHN04965.1|  Germin-like protein subfamily 1 member 7                170   2e-48   
ref|XP_008775104.1|  PREDICTED: putative germin-like protein 2-1        170   2e-48   
ref|XP_006659897.1|  PREDICTED: germin-like protein 8-11-like           170   2e-48   
ref|XP_002270404.2|  PREDICTED: putative germin-like protein 2-1        170   2e-48   
ref|XP_002443981.1|  hypothetical protein SORBIDRAFT_07g005330          170   2e-48   
ref|XP_004142551.1|  PREDICTED: germin-like protein subfamily 1 m...    170   2e-48   
ref|XP_004489240.1|  PREDICTED: germin-like protein subfamily 1 m...    170   2e-48   
ref|XP_009385876.1|  PREDICTED: germin-like protein 12-2                169   2e-48   
emb|CBI39473.3|  unnamed protein product                                170   2e-48   
ref|XP_010689305.1|  PREDICTED: germin-like protein                     170   2e-48   
ref|XP_004155681.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    170   2e-48   
gb|ACG69478.1|  germin-like protein 2                                   170   2e-48   
ref|XP_006659188.1|  PREDICTED: germin-like protein 12-2-like           170   2e-48   
ref|XP_010911182.1|  PREDICTED: putative germin-like protein 2-1        169   3e-48   
ref|XP_008808516.1|  PREDICTED: putative germin-like protein 2-1        169   3e-48   
ref|NP_001066189.1|  Os12g0154800                                       170   3e-48   
ref|XP_006840206.1|  hypothetical protein AMTR_s00089p00127600          169   3e-48   
ref|XP_003618167.1|  Germin-like protein                                169   3e-48   
ref|NP_001238673.1|  uncharacterized protein LOC100527866 precursor     169   3e-48   
gb|EMT32553.1|  Putative germin-like protein 2-2                        169   3e-48   
ref|XP_002443980.1|  hypothetical protein SORBIDRAFT_07g005320          169   3e-48   
ref|NP_001268128.1|  germin-like protein 5                              169   3e-48   
ref|XP_003618165.1|  Germin-like protein subfamily 1 member             169   3e-48   
emb|CAN61141.1|  hypothetical protein VITISV_024669                     168   3e-48   
ref|NP_001267943.1|  germin-like protein 4 precursor                    169   3e-48   
ref|XP_003618162.1|  Germin-like protein subfamily 1 member             169   4e-48   
ref|NP_001267940.1|  germin-like protein 1                              169   4e-48   
ref|XP_011075124.1|  PREDICTED: putative germin-like protein 2-1 ...    168   4e-48   
ref|XP_009414512.1|  PREDICTED: putative germin-like protein 2-1        169   4e-48   
ref|XP_011075123.1|  PREDICTED: putative germin-like protein 2-1 ...    168   4e-48   
ref|XP_003618164.1|  Germin-like protein subfamily 1 member             169   4e-48   
ref|NP_001240963.1|  germin-like protein subfamily 1 member 7-lik...    169   4e-48   
gb|EAY82306.1|  hypothetical protein OsI_37516                          169   5e-48   
ref|XP_008778853.1|  PREDICTED: putative germin-like protein 2-1        169   5e-48   
sp|Q6K5P9.1|GL22_ORYSJ  RecName: Full=Putative germin-like protei...    169   5e-48   
ref|XP_011037778.1|  PREDICTED: putative germin-like protein 2-1        169   5e-48   
emb|CBI36811.3|  unnamed protein product                                169   5e-48   
ref|NP_001066190.2|  Os12g0154900                                       168   5e-48   
ref|XP_002443982.1|  hypothetical protein SORBIDRAFT_07g005340          168   6e-48   
ref|XP_002284284.2|  PREDICTED: germin-like protein subfamily 1 m...    169   6e-48   
ref|XP_004513533.1|  PREDICTED: germin-like protein subfamily 1 m...    169   6e-48   
ref|XP_002284616.2|  PREDICTED: germin-like protein subfamily 1 m...    169   6e-48   
ref|XP_002443971.1|  hypothetical protein SORBIDRAFT_07g005250          168   6e-48   
ref|XP_002443973.1|  hypothetical protein SORBIDRAFT_07g005270          169   6e-48   
gb|KCW82833.1|  hypothetical protein EUGRSUZ_C04204                     168   7e-48   
emb|CAN63889.1|  hypothetical protein VITISV_027218                     168   7e-48   
ref|NP_001152473.1|  germin-like protein subfamily 1 member 11 pr...    169   8e-48   
ref|XP_006856738.1|  hypothetical protein AMTR_s03266p00004160          167   8e-48   
ref|XP_011075120.1|  PREDICTED: putative germin-like protein 2-1 ...    168   9e-48   
ref|XP_006840195.1|  hypothetical protein AMTR_s00089p00119070          168   9e-48   
gb|AFK48994.1|  unknown                                                 168   9e-48   
ref|XP_011075121.1|  PREDICTED: putative germin-like protein 2-1 ...    168   9e-48   
ref|XP_003604731.1|  Germin-like protein subfamily 1 member             168   9e-48   
ref|XP_008662711.1|  PREDICTED: putative germin-like protein 12-4       168   1e-47   
ref|XP_003604729.1|  Germin-like protein subfamily 1 member             168   1e-47   
emb|CAN63434.1|  hypothetical protein VITISV_033830                     168   1e-47   
ref|XP_004489241.1|  PREDICTED: putative germin-like protein 2-1-...    168   1e-47   
gb|ACG69489.1|  germin-like protein 13                                  168   1e-47   
ref|XP_003604730.1|  Germin-like protein subfamily 1 member             168   1e-47   
sp|Q2QXJ1.1|GL123_ORYSJ  RecName: Full=Putative germin-like prote...    168   1e-47   
ref|XP_011075119.1|  PREDICTED: putative germin-like protein 2-1 ...    168   1e-47   
ref|XP_002862402.1|  hypothetical protein ARALYDRAFT_497466             167   1e-47   
gb|EMS48827.1|  Germin-like protein 8-5                                 168   1e-47   
ref|XP_006857270.1|  hypothetical protein AMTR_s00067p00014150          167   1e-47   
gb|KDP34915.1|  hypothetical protein JCGZ_09203                         167   1e-47   
ref|NP_001046876.1|  Os02g0491800                                       168   1e-47   
ref|XP_008443751.1|  PREDICTED: germin-like protein subfamily 1 m...    168   1e-47   
ref|XP_004972678.1|  PREDICTED: germin-like protein 12-2-like iso...    167   2e-47   
gb|KFK33230.1|  hypothetical protein AALP_AA6G347300                    167   2e-47   
ref|XP_010463900.1|  PREDICTED: germin-like protein subfamily 1 m...    167   2e-47   
ref|XP_010659615.1|  PREDICTED: germin-like protein subfamily 1 m...    167   2e-47   
ref|XP_002443979.1|  hypothetical protein SORBIDRAFT_07g005310          167   2e-47   
ref|XP_002443983.1|  hypothetical protein SORBIDRAFT_07g005350          167   2e-47   
ref|XP_002276926.2|  PREDICTED: uncharacterized protein LOC100251187    173   2e-47   
ref|XP_007030274.1|  Germin-like protein subfamily 1 member 18          176   2e-47   
ref|XP_003547666.1|  PREDICTED: germin-like protein subfamily 1 m...    167   2e-47   
emb|CAN63888.1|  hypothetical protein VITISV_027217                     164   2e-47   
gb|EEC83018.1|  hypothetical protein OsI_28085                          167   2e-47   
gb|KFK33231.1|  hypothetical protein AALP_AA6G347400                    167   3e-47   
ref|NP_001061160.1|  Os08g0189500                                       167   3e-47   
gb|EAZ05851.1|  hypothetical protein OsI_28086                          167   3e-47   
ref|XP_011037744.1|  PREDICTED: putative germin-like protein 2-1        167   3e-47   
ref|XP_002443972.1|  hypothetical protein SORBIDRAFT_07g005260          167   3e-47   
ref|XP_004972677.1|  PREDICTED: germin-like protein 12-2-like iso...    167   3e-47   
gb|EYU40207.1|  hypothetical protein MIMGU_mgv1a012993mg                167   3e-47   
ref|NP_001241457.1|  germin-like protein subfamily 1 member 7-lik...    167   3e-47   
ref|XP_008225614.1|  PREDICTED: putative germin-like protein 2-3        167   3e-47   
gb|EAY85909.1|  hypothetical protein OsI_07272                          167   3e-47   
ref|XP_006377949.1|  germin-like protein 1                              167   3e-47   
ref|NP_001061164.1|  Os08g0190100                                       167   3e-47   
ref|NP_187246.1|  germin-like protein subfamily 1 member 7              167   3e-47   
gb|KCW61433.1|  hypothetical protein EUGRSUZ_H04161                     167   3e-47   
gb|AFK39387.1|  unknown                                                 167   3e-47   
ref|XP_010659856.1|  PREDICTED: germin-like protein subfamily 1 m...    167   4e-47   
ref|NP_001066191.1|  Os12g0155000                                       166   4e-47   
ref|XP_002452097.1|  hypothetical protein SORBIDRAFT_04g019640          166   4e-47   
ref|XP_003593910.1|  Germin-like protein subfamily 1 member             167   4e-47   
gb|EMT15740.1|  Germin-like protein 8-5                                 167   4e-47   
ref|XP_006659186.1|  PREDICTED: germin-like protein 12-2-like           167   4e-47   
ref|XP_007214200.1|  hypothetical protein PRUPE_ppa022275mg             166   4e-47   
ref|XP_007030176.1|  Germin-like protein subfamily 1 member 18          169   4e-47   
ref|XP_002445171.1|  hypothetical protein SORBIDRAFT_07g005230          167   4e-47   
gb|EAZ05858.1|  hypothetical protein OsI_28093                          166   4e-47   
gb|AFW61073.1|  hypothetical protein ZEAMMB73_930166                    165   4e-47   
ref|XP_008678216.1|  PREDICTED: putative germin-like protein 12-4       167   4e-47   
ref|XP_008678222.1|  PREDICTED: putative germin-like protein 12-4       167   4e-47   
ref|XP_008678213.1|  PREDICTED: putative germin-like protein 12-4       167   4e-47   
ref|XP_006659193.1|  PREDICTED: germin-like protein 8-11-like           166   5e-47   
ref|XP_002884546.1|  hypothetical protein ARALYDRAFT_477892             167   5e-47   
gb|EMT02678.1|  Putative germin-like protein 2-1                        166   5e-47   
emb|CAB55559.1|  germin-like protein                                    167   5e-47   
sp|Q2QXJ0.2|GL124_ORYSJ  RecName: Full=Putative germin-like prote...    166   5e-47   
ref|XP_008383376.1|  PREDICTED: putative germin-like protein 2-3 ...    165   5e-47   
ref|XP_008678209.1|  PREDICTED: putative germin-like protein 12-4       166   5e-47   
ref|XP_004972688.1|  PREDICTED: putative germin-like protein 12-4...    166   5e-47   
ref|XP_010235436.1|  PREDICTED: putative germin-like protein 2-2 ...    166   6e-47   
emb|CBI36810.3|  unnamed protein product                                169   6e-47   
gb|ACT22757.1|  GER4h                                                   166   6e-47   
ref|XP_002443976.1|  hypothetical protein SORBIDRAFT_07g005300          166   6e-47   
ref|XP_009402558.1|  PREDICTED: putative germin-like protein 2-1        166   6e-47   
ref|XP_003574976.1|  PREDICTED: putative germin-like protein 2-2 ...    166   6e-47   
ref|XP_004972685.1|  PREDICTED: putative germin-like protein 12-4...    166   6e-47   
ref|XP_009113441.1|  PREDICTED: germin-like protein subfamily 1 m...    166   6e-47   
gb|AAG00425.1|AF250933_1  germin A                                      166   6e-47   
ref|XP_004972682.1|  PREDICTED: putative germin-like protein 12-4...    167   6e-47   
gb|ACT22756.1|  GER4a                                                   166   7e-47   
gb|AJA71638.1|  germin-like protein                                     166   7e-47   
ref|XP_004972686.1|  PREDICTED: putative germin-like protein 12-4...    166   7e-47   
dbj|BAK01981.1|  predicted protein                                      166   7e-47   
ref|XP_011002009.1|  PREDICTED: germin-like protein subfamily 1 m...    166   8e-47   
emb|CBI36815.3|  unnamed protein product                                166   8e-47   
ref|XP_008678218.1|  PREDICTED: putative germin-like protein 12-4...    166   9e-47   
ref|XP_002299047.1|  germin-like protein 1                              166   9e-47   
gb|KHN10832.1|  Germin-like protein subfamily 1 member 18               167   9e-47   
ref|XP_009606432.1|  PREDICTED: germin-like protein subfamily 1 m...    166   9e-47   
emb|CAN73847.1|  hypothetical protein VITISV_021638                     166   1e-46   
ref|XP_002452098.1|  hypothetical protein SORBIDRAFT_04g019650          166   1e-46   
ref|XP_008678223.1|  PREDICTED: putative germin-like protein 12-4       166   1e-46   
ref|XP_008678215.1|  PREDICTED: germin-like protein 8-11                163   1e-46   
ref|XP_002452099.1|  hypothetical protein SORBIDRAFT_04g019670          165   1e-46   
ref|XP_004952510.1|  PREDICTED: putative germin-like protein 2-2-...    165   1e-46   
ref|XP_004972683.1|  PREDICTED: germin-like protein 8-5-like            166   1e-46   
ref|XP_010412923.1|  PREDICTED: germin-like protein subfamily 1 m...    166   1e-46   
ref|XP_004972680.1|  PREDICTED: germin-like protein 8-7-like            166   1e-46   
gb|KHN26390.1|  Germin-like protein subfamily 1 member 7                165   1e-46   
gb|KHN28994.1|  Germin-like protein subfamily 1 member 18               165   1e-46   
ref|XP_006442440.1|  hypothetical protein CICLE_v10023726mg             165   1e-46   
ref|XP_004293675.1|  PREDICTED: putative germin-like protein 2-1-...    165   1e-46   
ref|XP_008678208.1|  PREDICTED: putative germin-like protein 12-4       166   1e-46   
ref|XP_002313686.1|  germin-like protein 1                              165   1e-46   
ref|XP_003553912.1|  PREDICTED: germin-like protein subfamily 1 m...    165   1e-46   
gb|KDO42113.1|  hypothetical protein CISIN_1g027369mg                   165   1e-46   
ref|XP_002517294.1|  Rhicadhesin receptor precursor, putative           164   1e-46   
ref|XP_004972676.1|  PREDICTED: germin-like protein 8-7-like            165   1e-46   
ref|NP_001061161.1|  Os08g0189600                                       165   1e-46   
gb|EMS64312.1|  Germin-like protein 8-5                                 165   1e-46   
ref|XP_008371812.1|  PREDICTED: germin-like protein subfamily 1 m...    165   1e-46   
ref|XP_006468336.1|  PREDICTED: putative germin-like protein 2-2-...    165   1e-46   
ref|XP_008678207.1|  PREDICTED: germin-like protein 8-5                 165   1e-46   
ref|XP_006442444.1|  hypothetical protein CICLE_v10023384mg             165   2e-46   
ref|XP_004972675.1|  PREDICTED: putative germin-like protein 12-4...    165   2e-46   
ref|XP_006377955.1|  germin-like protein 1                              165   2e-46   
ref|NP_001061159.2|  Os08g0189400                                       164   2e-46   
gb|EMS56245.1|  Germin-like protein 8-5                                 165   2e-46   
ref|XP_006371120.1|  hypothetical protein POPTR_0019s04280g             165   2e-46   
ref|XP_011045439.1|  PREDICTED: germin-like protein subfamily 1 m...    165   2e-46   
ref|XP_002267617.1|  PREDICTED: putative germin-like protein 2-2        164   2e-46   
gb|EMS56244.1|  Germin-like protein 8-5                                 165   2e-46   
sp|Q6YZA6.1|GL85_ORYSJ  RecName: Full=Germin-like protein 8-5; Fl...    165   2e-46   
ref|XP_006659195.1|  PREDICTED: germin-like protein 8-11-like           165   2e-46   
ref|XP_006597669.1|  PREDICTED: putative germin-like protein 2-1-...    164   2e-46   
ref|XP_008225645.1|  PREDICTED: putative germin-like protein 2-1        164   2e-46   
ref|XP_008383374.1|  PREDICTED: putative germin-like protein 2-3 ...    164   2e-46   
ref|XP_010464157.1|  PREDICTED: germin-like protein subfamily 1 m...    165   2e-46   
ref|XP_003573513.1|  PREDICTED: germin-like protein 8-11                165   2e-46   
ref|XP_006442447.1|  hypothetical protein CICLE_v10024005mg             164   2e-46   
ref|XP_008225648.1|  PREDICTED: putative germin-like protein 2-3        164   2e-46   
ref|XP_006448869.1|  hypothetical protein CICLE_v10017587mg             164   2e-46   
ref|XP_008383375.1|  PREDICTED: putative germin-like protein 2-1 ...    164   2e-46   
gb|KDP34916.1|  hypothetical protein JCGZ_09204                         164   2e-46   
ref|XP_002517292.1|  Auxin-binding protein ABP19a precursor, puta...    164   2e-46   
gb|EAY85910.1|  hypothetical protein OsI_07273                          164   2e-46   
ref|XP_006405676.1|  hypothetical protein EUTSA_v10027913mg             164   2e-46   
gb|KDO38410.1|  hypothetical protein CISIN_1g048538mg                   163   2e-46   
ref|XP_010434310.1|  PREDICTED: germin-like protein subfamily 1 m...    165   2e-46   
ref|XP_006405677.1|  hypothetical protein EUTSA_v10027920mg             164   2e-46   
ref|XP_010024925.1|  PREDICTED: germin-like protein subfamily 1 m...    164   2e-46   
ref|XP_004293674.1|  PREDICTED: putative germin-like protein 2-1-...    164   2e-46   
ref|XP_008678220.1|  PREDICTED: putative germin-like protein 12-4       165   2e-46   
ref|XP_002276445.2|  PREDICTED: uncharacterized protein LOC100254460    172   3e-46   
ref|XP_008808107.1|  PREDICTED: putative germin-like protein 2-1 ...    164   3e-46   
ref|XP_006405680.1|  hypothetical protein EUTSA_v10027917mg             164   3e-46   
ref|XP_006405679.1|  hypothetical protein EUTSA_v10027925mg             164   3e-46   
ref|XP_008662705.1|  PREDICTED: putative germin-like protein 12-4       164   3e-46   
gb|ABS44860.1|  putative germin-like protein                            164   3e-46   
ref|XP_008358299.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    163   3e-46   
ref|XP_008678214.1|  PREDICTED: putative germin-like protein 12-4       164   3e-46   
ref|XP_006405681.1|  hypothetical protein EUTSA_v10027922mg             164   3e-46   
ref|XP_002280455.1|  PREDICTED: germin-like protein subfamily 1 m...    162   3e-46   
ref|XP_008808106.1|  PREDICTED: putative germin-like protein 2-1 ...    164   3e-46   
ref|XP_004295600.1|  PREDICTED: putative germin-like protein 2-2-...    164   3e-46   
ref|XP_002443974.1|  hypothetical protein SORBIDRAFT_07g005280          164   3e-46   
ref|XP_010234322.1|  PREDICTED: germin-like protein 8-8                 164   3e-46   



>ref|XP_009620404.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=228

 Score =   197 bits (500),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ RID+A  GL PPHTHPRATE++ VLEGTL V FV SNP    KNKLF+K
Sbjct  88   PGLNTLGISLVRIDYAPYGLNPPHTHPRATEILVVLEGTLYVGFVLSNPGPNMKNKLFTK  147

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             LKPGD F+FP+GL+HF +N+G+T A+ F+  SSQNPG +T+AN+ FGS PPI+ DVL K
Sbjct  148  ILKPGDVFVFPIGLIHFQFNIGKTTAVAFAGLSSQNPGVITIANAVFGSDPPINDDVLAK  207

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK INYLQSQ W
Sbjct  208  AFQVDKKVINYLQSQFW  224



>ref|XP_009795503.1| PREDICTED: germin-like protein subfamily 1 member 20 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009795504.1| PREDICTED: germin-like protein subfamily 1 member 20 isoform 
X2 [Nicotiana sylvestris]
Length=228

 Score =   196 bits (497),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARID+A  GL PPHTHPR TE++ VLEGTL V FV SNP    KNKLF+K
Sbjct  88   PGLNTLGISLARIDYAPYGLNPPHTHPRGTEILAVLEGTLYVGFVLSNPGPNMKNKLFTK  147

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP+GL+HF +NVG+TNA+ F+  SSQNPG +T+AN+ FGS PPI+ DVLTK
Sbjct  148  ILNPGDVFVFPIGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPINPDVLTK  207

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQSQ W
Sbjct  208  AFQVDKKVVDYLQSQFW  224



>ref|XP_009784933.1| PREDICTED: germin-like protein subfamily 1 member 20 [Nicotiana 
sylvestris]
Length=228

 Score =   196 bits (497),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARID+A  GL PPHTHPR TE++ VLEGTL V FV SNP    KNKLF+K
Sbjct  88   PGLNTLGISLARIDYAPYGLNPPHTHPRGTEILAVLEGTLYVGFVLSNPGPNMKNKLFTK  147

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP+GL+HF +NVG+TNA+ F+  SSQNPG +T+AN+ FGS PPI+ DVLTK
Sbjct  148  ILNPGDVFVFPIGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPINPDVLTK  207

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQSQ W
Sbjct  208  AFQVDKKVVDYLQSQFW  224



>emb|CDP16787.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   195 bits (496),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPRATE++ VLEGTLLV FV+SNP    KNKLF+K
Sbjct  87   PGLNTLGVSLARIDFAPYGLNPPHTHPRATEILVVLEGTLLVGFVTSNPGMNMKNKLFTK  146

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP GL+HF +N G +NA+ F+  SSQNPG +T+AN+ FGS PPIS+DVLTK
Sbjct  147  VLNPGDVFVFPEGLIHFQFNKGHSNAVAFAGLSSQNPGVITIANAVFGSKPPISRDVLTK  206

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DK  + YLQSQ W
Sbjct  207  AFQVDKNVVKYLQSQFW  223



>ref|XP_009612542.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana tomentosiformis]
Length=228

 Score =   195 bits (495),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ RID+A  GL PPHTHPRATEV+ VLEGTL V FV SNP    KNKLF+K
Sbjct  88   PGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLVVLEGTLYVGFVLSNPGPNMKNKLFTK  147

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             LKPGD F+FP+GL+HF +N+G+T A+ F+  SSQNPG +T+AN+ FGS PPI+ DVL K
Sbjct  148  ILKPGDVFVFPIGLIHFQFNIGKTTAVAFAGLSSQNPGVITIANAVFGSDPPINVDVLAK  207

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK I+YLQSQ W
Sbjct  208  AFQVDKKVIDYLQSQFW  224



>ref|XP_009612541.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=228

 Score =   194 bits (494),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARID+A  GL PPHTHPR TE++ VLEGTL V FV SNP    KNKLF+K
Sbjct  88   PGLNTLGISLARIDYAPYGLNPPHTHPRGTEILAVLEGTLYVGFVLSNPGPNMKNKLFTK  147

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP+GL+HF +NVG+T A+ F+  SSQNPG +T+AN+ FGS PPI+ DVLTK
Sbjct  148  ILNPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPPINPDVLTK  207

Query  362  AFRLDKKTINYLQSQTW  412
            AF+LDKK ++YLQSQ W
Sbjct  208  AFQLDKKVVDYLQSQFW  224



>ref|XP_009786129.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=228

 Score =   194 bits (493),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ RID+A  GL PPHTHPRA EV+ VLEGTL V FV SNP    KNKLF+K 
Sbjct  89   GLNTLGISLVRIDYAPYGLNPPHTHPRAAEVLVVLEGTLYVGFVLSNPGPNMKNKLFTKI  148

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            LKPGD F+FP+GL+HF +NVG+T A+ F+  SSQNPG +T+AN+ FGS PPI++DVLTKA
Sbjct  149  LKPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANAIFGSDPPINEDVLTKA  208

Query  365  FRLDKKTINYLQSQTW  412
            F++DKK I+YLQSQ W
Sbjct  209  FQVDKKVIDYLQSQFW  224



>emb|CDP22064.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPRATE++ VLEGTLLV FV+SNP    KNKLF+K
Sbjct  87   PGLNTLGVSLARIDFAPYGLNPPHTHPRATEILVVLEGTLLVGFVTSNPGMNMKNKLFTK  146

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP GL+HF +N G ++A+ F+  SSQNPG +T+AN+ FGS PPIS+DVLTK
Sbjct  147  VLNPGDVFVFPEGLIHFQFNKGHSSAVAFAGLSSQNPGVITIANAVFGSKPPISRDVLTK  206

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DK  + YLQSQ W
Sbjct  207  AFQVDKNVVKYLQSQFW  223



>ref|XP_009795501.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=228

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ RID+A  GL PPHTHPRATEV+ VLEGTL V FV SNP    KNKLF+K
Sbjct  88   PGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLAVLEGTLYVGFVLSNPGPNMKNKLFTK  147

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             LKPGD F+FP+GL+HF +N+G+  A+ F+  SSQNPG +T+AN+ FGS PPI+ DVL K
Sbjct  148  ILKPGDVFVFPIGLIHFQFNIGKNKAVAFAGLSSQNPGVITIANAVFGSDPPINDDVLAK  207

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK I+YLQSQ W
Sbjct  208  AFQVDKKVIDYLQSQFW  224



>ref|XP_009625530.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana tomentosiformis]
Length=228

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ RID+A  GL PPHTHPRATEV+ VLEGTL V FV SNP    KNKLF+K
Sbjct  88   PGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLVVLEGTLYVGFVLSNPGPNMKNKLFTK  147

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             LKPGD F+FP+GL+HF +N+G+T A+ F+  SSQNPG +T+AN+ FGS P I+ DVL K
Sbjct  148  ILKPGDVFVFPIGLIHFQFNIGKTTAVAFAGLSSQNPGVITIANAVFGSDPSINADVLAK  207

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK I+YLQSQ W
Sbjct  208  AFQVDKKVIDYLQSQFW  224



>emb|CDP16790.1| unnamed protein product [Coffea canephora]
Length=232

 Score =   193 bits (490),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+DFA  GL PPHTHPRATE++ VLEGTLLV FV+SNP    KNKLF+K
Sbjct  89   PGLNTLGVSLARLDFAPYGLNPPHTHPRATEILVVLEGTLLVGFVTSNPGMNMKNKLFTK  148

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP GL+HF +N G +NA+ F+A SSQNPG +T+AN+ FGS PPI  DVLTK
Sbjct  149  VLNPGDVFVFPEGLIHFQFNQGHSNAVAFAALSSQNPGVITIANAVFGSNPPIYPDVLTK  208

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DK  I YLQSQ W
Sbjct  209  AFQVDKNVIKYLQSQFW  225



>ref|XP_009786127.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=229

 Score =   192 bits (489),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ RID+A  GL PPHTHPRATEV+ VLEGTL V FV SNP    KNKLF+K
Sbjct  88   PGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLAVLEGTLYVGFVLSNPGPNMKNKLFTK  147

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             LKPGD F+FP+GL+HF +NVG+T A+ F+  SSQNPG +T+AN+ FGS P I+ DVL K
Sbjct  148  ILKPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANTVFGSDPQINDDVLAK  207

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK I+YLQSQ W
Sbjct  208  AFQVDKKVIDYLQSQFW  224



>ref|XP_009627660.1| PREDICTED: germin-like protein subfamily 1 member 20 [Nicotiana 
tomentosiformis]
Length=228

 Score =   192 bits (489),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARID+A  GL PPHTHPR TE++ VLEGTL V FV SNP    KNKLF+K
Sbjct  88   PGLNTLGISLARIDYAPYGLNPPHTHPRGTEILAVLEGTLYVGFVLSNPGPNMKNKLFTK  147

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP+GL+HF +NVG+T A+ F+  SSQNPG +T+AN+ FGS PPI+ DVLTK
Sbjct  148  ILNPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPPINPDVLTK  207

Query  362  AFRLDKKTINYLQSQTW  412
            AF+LD K ++YLQSQ W
Sbjct  208  AFQLDNKVVDYLQSQFW  224



>ref|XP_006349261.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum]
 ref|XP_006349262.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum]
Length=228

 Score =   192 bits (487),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 109/136 (80%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDFA  GL PPHTHPR TEV+ + EGTL V FV SNP    KNKLF+K 
Sbjct  89   GLNTLGISLARIDFAPYGLNPPHTHPRGTEVLALFEGTLYVGFVLSNPGPNMKNKLFTKI  148

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L PGD F+FP+GL+HF +NVG+TNA+ F+  SSQNPG +T+AN+ FGS PPIS DVL KA
Sbjct  149  LHPGDVFVFPVGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPISDDVLAKA  208

Query  365  FRLDKKTINYLQSQTW  412
            F++DKK ++YLQSQ W
Sbjct  209  FQIDKKVVDYLQSQFW  224



>ref|XP_009612543.1| PREDICTED: germin-like protein subfamily 1 member 20 [Nicotiana 
tomentosiformis]
Length=228

 Score =   192 bits (487),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARID+A  GL PPHTHPR TE++ VLEGTL V FV SNP    KNKLF+K
Sbjct  88   PGLNTLGISLARIDYAPYGLNPPHTHPRGTEILAVLEGTLYVGFVLSNPGPNMKNKLFTK  147

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP+GL+HF +NVG+TNA+ F+  SSQNPG +T+AN+ FGS PPI+ DVL K
Sbjct  148  ILNPGDVFVFPIGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPINPDVLAK  207

Query  362  AFRLDKKTINYLQSQTW  412
            AF++D K ++YLQSQ W
Sbjct  208  AFQVDNKVVDYLQSQFW  224



>ref|XP_004230405.1| PREDICTED: germin-like protein subfamily 1 member 14 [Solanum 
lycopersicum]
Length=228

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDFA  GL PPHTHPRATEV+ + EGTL V FV SNP    KNKLF+K 
Sbjct  89   GLNTLGISLARIDFAPYGLNPPHTHPRATEVLTLFEGTLYVGFVLSNPGPNMKNKLFTKI  148

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L PGD F+FP+GL+HF +NVG+TNA+ F+  SSQNPG +T+AN+ FGS PPI+ DVL KA
Sbjct  149  LHPGDVFVFPVGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPINDDVLAKA  208

Query  365  FRLDKKTINYLQSQTW  412
            F++DKK ++YLQSQ W
Sbjct  209  FQIDKKVVDYLQSQFW  224



>ref|XP_011099652.1| PREDICTED: putative germin-like protein 2-1 [Sesamum indicum]
Length=228

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 111/137 (81%), Gaps = 1/137 (1%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLN-GQKNKLFSK  181
            GLNT+G+S+ARIDFA  GL PPHTHPRATE++ ++EG+L V FV+SNP N  QKNKLF+K
Sbjct  88   GLNTLGISLARIDFAPYGLNPPHTHPRATEILVLVEGSLYVGFVTSNPANPNQKNKLFTK  147

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
            TL PGD F+FP GL+HF +NVG TNA+ F+  SSQNPG +T+AN+ FGS PPIS DVLT+
Sbjct  148  TLYPGDVFVFPEGLIHFQFNVGNTNAVAFAGLSSQNPGVITIANAVFGSDPPISSDVLTR  207

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DK  I YLQ Q W
Sbjct  208  AFQVDKNVIKYLQGQFW  224



>emb|CDP16789.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+DFA  GL PPHTHPRATE++ VLEGTLLV FV+SNP    KNKLF+K
Sbjct  345  PGLNTLGVSLARLDFAPYGLNPPHTHPRATEILVVLEGTLLVGFVTSNPGMNMKNKLFTK  404

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP GL+HF +N G+TNA+ F+A SSQNPG +T+AN+ FGS PPIS+DVLTK
Sbjct  405  VLNPGDVFVFPEGLIHFQFNQGQTNAVAFAALSSQNPGVITIANAVFGSKPPISRDVLTK  464

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DK  I YLQSQ W
Sbjct  465  AFQVDKNVIKYLQSQFW  481


 Score =   194 bits (494),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+DFA  GL PPHTHPRATE++ VLEGTLLV FV+SNP    KNKLF+K
Sbjct  87   PGLNTLGVSLARLDFAPYGLNPPHTHPRATEILVVLEGTLLVGFVTSNPGMNMKNKLFTK  146

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP GL+HF +N G +NA+ F+   SQNPG +T+AN+ FGS PPIS DVLTK
Sbjct  147  VLNPGDVFVFPQGLIHFQFNQGHSNAVAFAGLGSQNPGVITIANAVFGSNPPISPDVLTK  206

Query  362  AFRLDKKTINYLQSQTWPL  418
            AF++DKK I YLQSQ W +
Sbjct  207  AFQVDKKVIKYLQSQFWEI  225



>ref|XP_009620917.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=228

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARID+A  GL PPHTHPR TE++ VLEGTL V FV SNP    KNKLF+K
Sbjct  88   PGLNTLGISLARIDYAPYGLNPPHTHPRGTEILAVLEGTLYVGFVLSNPGPNIKNKLFTK  147

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP+GL+HF +NVG+T A+ F+  SSQNPG +T+AN+ FGS PPI+ DVLTK
Sbjct  148  ILNPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPPINPDVLTK  207

Query  362  AFRLDKKTINYLQSQTW  412
            AF+++KK ++YLQSQ W
Sbjct  208  AFQVEKKVVDYLQSQFW  224



>ref|XP_004230404.1| PREDICTED: putative germin-like protein 2-1 [Solanum lycopersicum]
Length=228

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 109/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ RID+A  GL PPHTHPR TEV+ VLEGTL V FV SNP    KNKLF+K
Sbjct  88   PGLNTLGISLVRIDYAPYGLNPPHTHPRGTEVLTVLEGTLYVGFVLSNPGPNMKNKLFTK  147

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP+GL+HF +NVG+T A+ F+  SSQNPG +T+AN+ FGS PPI+ DVL K
Sbjct  148  ILHPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPPINDDVLAK  207

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQSQ W
Sbjct  208  AFQVDKKVVHYLQSQFW  224



>ref|XP_006349267.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 109/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ RID+A  GL PPHTHPR TEV+ VLEGTL V FV SNP    KNKLF+K
Sbjct  88   PGLNTLGISLVRIDYAPYGLNPPHTHPRGTEVLTVLEGTLYVGFVLSNPGPNMKNKLFTK  147

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP+GL+HF +NVG+T A+ F+  SSQNPG +T+AN+ FGS PPI+ D+L K
Sbjct  148  ILHPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPPINDDILAK  207

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQSQ W
Sbjct  208  AFQVDKKVVDYLQSQFW  224



>ref|XP_004230403.1| PREDICTED: putative germin-like protein 2-1 [Solanum lycopersicum]
Length=228

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDFA  GL PPHTHPRATEV+ + EGTL V FV SNP    KNKLF+K 
Sbjct  89   GLNTLGISLARIDFAPYGLNPPHTHPRATEVLTLFEGTLYVGFVLSNPGPNMKNKLFTKI  148

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L PGD F+FP+GL+HF +NVG+T+A+ F+  SSQNPG +T+AN+ FGS PPI+ DVL KA
Sbjct  149  LHPGDVFVFPVGLIHFQFNVGKTDAVAFAGLSSQNPGVITIANAVFGSDPPINDDVLAKA  208

Query  365  FRLDKKTINYLQSQTW  412
            F++DKK ++YLQSQ W
Sbjct  209  FQIDKKVVDYLQSQFW  224



>gb|EYU28622.1| hypothetical protein MIMGU_mgv1a018753mg [Erythranthe guttata]
Length=230

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 112/138 (81%), Gaps = 1/138 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLN-GQKNKLFS  178
            PGLNT+G+S  RID+A NGL PPHTHPRATE++ VLEGTL V FV+SNP N   KNKLF+
Sbjct  89   PGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSNPANPAIKNKLFT  148

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K L PGD F+FP GL+HF +NVG+TNA+ F+A SSQNPG +T+AN+ FGS PPI+  VLT
Sbjct  149  KYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAALSSQNPGVITVANAVFGSDPPINPAVLT  208

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF+++K  I+YLQ+Q W
Sbjct  209  KAFQVEKNVIDYLQAQFW  226



>ref|XP_006358463.1| PREDICTED: germin-like protein subfamily 1 member 20-like [Solanum 
tuberosum]
Length=228

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 109/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR TEV+ VLEGTL V FV SNP    KNKLF+K
Sbjct  88   PGLNTLGISLARIDFAPYGLNPPHTHPRGTEVLVVLEGTLYVGFVLSNPGPNMKNKLFTK  147

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP+GL+HF +NVG+T A+ F+  SSQNP  +T+AN+ FGS PPI+ DVL K
Sbjct  148  ILHPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPVVITIANAIFGSDPPINDDVLAK  207

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQSQ W
Sbjct  208  AFQVDKKVVDYLQSQFW  224



>ref|XP_006349263.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   190 bits (482),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARID+A  G+ PPHTHPR TEV+ VLEGTL V FV SNP    KNKLF+K
Sbjct  88   PGLNTLGISLARIDYAPYGVNPPHTHPRGTEVLTVLEGTLYVGFVLSNPGANMKNKLFTK  147

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP+GL+HF +NVG+T A+ F+ F+SQN G +T+AN+ FGS PPI+ D+L K
Sbjct  148  ILHPGDVFVFPIGLIHFQFNVGKTKAVAFAGFNSQNQGVITIANAVFGSDPPINDDILAK  207

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQSQ W
Sbjct  208  AFQVDKKVVDYLQSQFW  224



>emb|CDP10693.1| unnamed protein product [Coffea canephora]
Length=219

 Score =   189 bits (480),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+AR+DFA  GL PPHTHPRATEV+FVLEGTL V FV+SNP N  KN+LF+KT
Sbjct  83   GLNTLGVSLARLDFAPYGLNPPHTHPRATEVLFVLEGTLNVGFVTSNPPNNMKNQLFTKT  142

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L PGD F+FP GL+HF +NVG+TNA+ F+ F SQNPG +T+AN+ FGS P IS DVL KA
Sbjct  143  LNPGDVFVFPEGLIHFQFNVGKTNAVAFAGFGSQNPGVITIANAVFGSDPLISADVLAKA  202

Query  365  FRLDKKTINYLQSQ  406
            F++DKK I+ L++Q
Sbjct  203  FQVDKKVIDLLEAQ  216



>ref|XP_011099651.1| PREDICTED: germin-like protein subfamily 1 member 13 [Sesamum 
indicum]
Length=229

 Score =   189 bits (481),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 112/138 (81%), Gaps = 1/138 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLN-GQKNKLFS  178
            PGLNT+G+S+ARIDFA  G+ PPHTHPRA+E++ V+EGTL V FV+SNP N   KNKLF+
Sbjct  88   PGLNTLGISLARIDFAPYGINPPHTHPRASEILLVVEGTLYVGFVTSNPANPTMKNKLFT  147

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K L PGD F+FP GL+HF +NVG+TNAL F+  SSQNPG +T+AN+ FGS PPI+ DVL 
Sbjct  148  KYLYPGDVFVFPQGLIHFQFNVGKTNALAFAGLSSQNPGVITIANAVFGSNPPINPDVLA  207

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF+++K  I+YLQ+Q W
Sbjct  208  KAFQVEKNVIDYLQAQFW  225



>ref|XP_006346966.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum]
Length=228

 Score =   189 bits (481),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 109/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARID+A  GL PPHTHPR TEV+ VLEGTL V FV SNP    KNKLF+K
Sbjct  88   PGLNTLGISLARIDYAPYGLNPPHTHPRGTEVLTVLEGTLYVGFVLSNPGPNMKNKLFTK  147

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP+GL+HF +NVG+T A+ F+  SSQNPG +T+AN+ FGS P I+ DVL K
Sbjct  148  ILHPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPSINNDVLAK  207

Query  362  AFRLDKKTINYLQSQTW  412
            AF+++KK +NYLQSQ W
Sbjct  208  AFQVEKKVVNYLQSQFW  224



>gb|EYU20541.1| hypothetical protein MIMGU_mgv1a018988mg [Erythranthe guttata]
Length=230

 Score =   189 bits (481),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 111/138 (80%), Gaps = 1/138 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLN-GQKNKLFS  178
            PGLNT+G+S  RID+A NGL PPHTHPRATE++ V+EGTL V FV+SNP N   KNKLF+
Sbjct  89   PGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVMEGTLYVGFVTSNPANPALKNKLFT  148

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K L PGD F+FP GL+HF +NVG+TNA+ F+A SSQNPG +T+AN+ FGS PPI+  VLT
Sbjct  149  KYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAALSSQNPGVITIANTVFGSDPPINPAVLT  208

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF++ K  I+YLQ+Q W
Sbjct  209  KAFQVKKNVIDYLQAQFW  226



>gb|KCW80407.1| hypothetical protein EUGRSUZ_C01764 [Eucalyptus grandis]
Length=221

 Score =   189 bits (479),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 111/137 (81%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR TEV+ V EGTLLVSFV+SN LN   N LF+K
Sbjct  84   PGLNTLGISMARIDFALGGLNPPHTHPRGTEVLVVTEGTLLVSFVTSNQLN---NTLFTK  140

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G+T AL F+A SSQNPG +T+AN+ FGS PPIS DVLTK
Sbjct  141  VLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTK  200

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQ+Q W
Sbjct  201  AFQVDKKVVDYLQAQFW  217



>ref|XP_006358459.1| PREDICTED: germin-like protein subfamily 1 member 20-like [Solanum 
tuberosum]
Length=228

 Score =   189 bits (480),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 108/136 (79%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDFA  G  PPHTHPR TEV+ VLEGTL V FV SNP    KNKLF+K 
Sbjct  89   GLNTLGISLARIDFAPYGFNPPHTHPRGTEVLAVLEGTLYVGFVLSNPGPNMKNKLFTKI  148

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L PGD F+FP+GL+HF +NVG+T A+ F+  SSQNPG +T+AN+ FGS PPI+ DVL KA
Sbjct  149  LHPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITVANAVFGSDPPINDDVLAKA  208

Query  365  FRLDKKTINYLQSQTW  412
            F++DKK ++YLQSQ W
Sbjct  209  FQVDKKVVDYLQSQFW  224



>ref|XP_009341765.1| PREDICTED: germin-like protein subfamily 1 member 17 [Pyrus x 
bretschneideri]
 ref|XP_009349818.1| PREDICTED: germin-like protein subfamily 1 member 17 [Pyrus x 
bretschneideri]
Length=230

 Score =   189 bits (480),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 109/137 (80%), Gaps = 1/137 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S AR+DFA NG+ PPHTHPRATE+  VLEG+L V FV+SN +NG  N+LF+K
Sbjct  91   PGLNTLGISFARVDFAPNGVNPPHTHPRATEIFIVLEGSLYVGFVTSN-INGDGNRLFTK  149

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  NVG+TNAL  +AF SQNPG +T+AN+ FGS PPI+ DVLTK
Sbjct  150  VLNKGDVFVFPIGLIHFQLNVGKTNALAIAAFGSQNPGVITIANAVFGSKPPINPDVLTK  209

Query  362  AFRLDKKTINYLQSQTW  412
            AF+LD   ++YLQ Q W
Sbjct  210  AFQLDNNVVDYLQKQFW  226



>gb|AFW90592.1| germin-like protein subfamily 1 member 20 precursor [Solanum 
tuberosum]
Length=228

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLN +G+S+ RID+A  GL PPHTHPR TEV+ VLEGTL V FV SNP    KNKLF+K
Sbjct  88   PGLNALGISLVRIDYAPYGLNPPHTHPRGTEVLTVLEGTLYVGFVLSNPGPNMKNKLFTK  147

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP+GL+HF +NVG+T A+ F+  SSQNPG +T+AN+ FGS PPI+ D+L K
Sbjct  148  ILHPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPPINDDILAK  207

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQSQ W
Sbjct  208  AFQVDKKVVDYLQSQFW  224



>gb|EYU38444.1| hypothetical protein MIMGU_mgv1a013102mg [Erythranthe guttata]
Length=230

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 111/138 (80%), Gaps = 1/138 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLN-GQKNKLFS  178
            PGLNT+G+S  RID+A NGL PPHTHPRATE++ VLEGTL V FV+SNP N   KNKLF+
Sbjct  89   PGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSNPANPAIKNKLFA  148

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K L PGD F+FP GL+HF +NVG+TNA+ F+  SSQNPG +T+AN+ FGS PPI+  VLT
Sbjct  149  KYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAGLSSQNPGVITVANAVFGSDPPINPAVLT  208

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF+++K  I+YLQ+Q W
Sbjct  209  KAFQVEKNVIDYLQAQFW  226



>ref|XP_010024920.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61459.1| hypothetical protein EUGRSUZ_H04195 [Eucalyptus grandis]
Length=223

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 111/137 (81%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA +GL PPH HPR TEV+ V+EGTLLV FV+SN LN   N LF+K
Sbjct  86   PGLNTLGISMARIDFAPSGLNPPHIHPRGTEVLVVIEGTLLVGFVTSNQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N G+T AL F+A SSQNPG +T+ANS FG+ PPIS DVLTK
Sbjct  143  VLYKGDVFVFPIGLIHFQLNTGKTPALAFAALSSQNPGVITIANSVFGAKPPISVDVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKKTI+YLQ+Q W
Sbjct  203  AFQVDKKTIDYLQAQFW  219



>emb|CDP21353.1| unnamed protein product [Coffea canephora]
Length=459

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPRATE++ VLEGTLLV FV+SNP    KNKLF+K
Sbjct  316  PGLNTLGVSLARIDFAPYGLNPPHTHPRATEILVVLEGTLLVGFVTSNPGMNMKNKLFTK  375

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP GL+HF +N G +NA+ F+  SSQNPG +T+AN+ FGS PPIS+DVLTK
Sbjct  376  VLNPGDVFVFPEGLIHFQFNKGHSNAVAFAGLSSQNPGVITIANAVFGSKPPISRDVLTK  435

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DK  + YLQSQ W
Sbjct  436  AFQVDKNVVKYLQSQFW  452


 Score =   185 bits (470),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPH HPRATEV+FVLEGTL+V FV+SNP    KNKLF+K
Sbjct  87   PGLNTLGVSLARIDFAPYGLNPPHIHPRATEVLFVLEGTLVVGFVTSNPGMNMKNKLFTK  146

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP GL+HF +N G +NA+ F+   SQNPG +T+AN+ FGS PPIS DVLTK
Sbjct  147  VLNPGDVFVFPQGLIHFQFNQGHSNAVAFAGLGSQNPGVITIANAVFGSDPPISPDVLTK  206

Query  362  AFRLDKKTINYLQSQTW  412
            AF++    I  LQSQ W
Sbjct  207  AFQVGNDVIKKLQSQFW  223



>ref|XP_002531991.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
 gb|EEF30390.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
Length=194

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 110/137 (80%), Gaps = 5/137 (4%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARID+A  GL PPHTHPRATE++ VLEGTL V FV+SNP     N+L +K
Sbjct  59   PGLNTLGISLARIDYAPYGLNPPHTHPRATEILVVLEGTLYVGFVTSNP-----NRLITK  113

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
            TLKPGD F+FP+G++HF +N G TNA+ F+  SSQNPG +T+AN+ FGS PPI+ DVLTK
Sbjct  114  TLKPGDVFVFPIGMIHFQFNTGSTNAVAFAGLSSQNPGAITIANAVFGSNPPINPDVLTK  173

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DK  +NYLQ Q W
Sbjct  174  AFQVDKSVVNYLQKQFW  190



>ref|XP_010042132.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
Length=223

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 111/137 (81%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR TEV+ V+EGTLLV FV+SN LN   N LF+K
Sbjct  86   PGLNTLGISMARIDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSNQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N G+T AL F++ SSQNPG +T+ANS FG+ PPIS DVLTK
Sbjct  143  VLYKGDVFVFPIGLIHFQLNTGKTPALAFASLSSQNPGVITIANSVFGAKPPISADVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKKT++YLQ+Q W
Sbjct  203  AFQVDKKTVDYLQAQFW  219



>ref|XP_006358461.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFAR GL PPHTHPR TEV+ VL+G L V FV SNP    KNKLF+K
Sbjct  90   PGLNTLGISLARIDFARRGLNPPHTHPRGTEVLVVLKGRLYVGFVLSNPGPNMKNKLFTK  149

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP GLVHF  NVG+TNA+ F+  SSQN G +T+AN+ FGS PPI+ DVL K
Sbjct  150  ILNPGDVFVFPEGLVHFQLNVGKTNAIAFAGLSSQNAGVITVANAVFGSDPPINDDVLAK  209

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK I+ LQ Q W
Sbjct  210  AFQVDKKVIDNLQEQIW  226



>ref|XP_010024921.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61460.1| hypothetical protein EUGRSUZ_H04196 [Eucalyptus grandis]
Length=223

 Score =   188 bits (477),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 111/137 (81%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA +GL PPHTHPR TEV+ V+EGTLLV FV+SN LN   N LF+K
Sbjct  86   PGLNTLGISMARIDFAPDGLNPPHTHPRGTEVLVVVEGTLLVGFVTSNQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N G+T AL F+A SSQNPG +T+ANS FG+ PPIS DVLTK
Sbjct  143  VLYKGDVFVFPIGLIHFQLNTGKTPALAFAALSSQNPGVITIANSVFGAKPPISVDVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF++D+KT+ YLQ+Q W
Sbjct  203  AFQVDEKTVEYLQAQFW  219



>ref|XP_010024911.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61444.1| hypothetical protein EUGRSUZ_H04175 [Eucalyptus grandis]
Length=221

 Score =   187 bits (476),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 110/137 (80%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR TEV+ V EGTLLV FV+SN LN   N LF+K
Sbjct  84   PGLNTLGISMARIDFAPGGLNPPHTHPRGTEVLVVTEGTLLVGFVTSNQLN---NTLFTK  140

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G+T AL F+A SSQNPG +T+AN+ FGS PPIS DVLTK
Sbjct  141  VLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTK  200

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQ+Q W
Sbjct  201  AFQVDKKVVDYLQAQFW  217



>emb|CDP10695.1| unnamed protein product [Coffea canephora]
Length=223

 Score =   187 bits (476),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 110/134 (82%), Gaps = 0/134 (0%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+AR+DFA  GL PPHTHPRATEV+FVLEGTL V FV+SNP N  KN+LF+KT
Sbjct  88   GLNTLGVSLARLDFAPFGLNPPHTHPRATEVLFVLEGTLHVGFVTSNPPNNMKNQLFTKT  147

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L PGD F+FP GL+HF +N G+TNA+ FSAF SQNPG +T+AN+ FGS P IS DVL KA
Sbjct  148  LNPGDVFVFPEGLIHFQFNFGKTNAVAFSAFGSQNPGVITIANAVFGSDPLISADVLAKA  207

Query  365  FRLDKKTINYLQSQ  406
            F++DKK I  L++Q
Sbjct  208  FQVDKKVIYLLEAQ  221



>gb|EYU20547.1| hypothetical protein MIMGU_mgv1a023357mg [Erythranthe guttata]
Length=231

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 111/138 (80%), Gaps = 1/138 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLN-GQKNKLFS  178
            PGLNT+G+S  RID+A NGL PPHTHPRATE++FV+EGTL V FV+SNP +   KNKLF+
Sbjct  90   PGLNTLGISAVRIDYAPNGLNPPHTHPRATEILFVMEGTLYVGFVTSNPADLALKNKLFT  149

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K L PGD F+FP GL+HF +NVG+TNA+ F+  SSQNPG +T+AN+ FG  PPI+  VLT
Sbjct  150  KYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGLDPPINPAVLT  209

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF+++K  I+YLQ+Q W
Sbjct  210  KAFQVEKNVIDYLQAQFW  227



>ref|XP_010052624.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW76696.1| hypothetical protein EUGRSUZ_D01056 [Eucalyptus grandis]
Length=223

 Score =   187 bits (476),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 110/137 (80%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR TEV+ ++EGTLLV FV+SN LN   N LF+K
Sbjct  86   PGLNTLGISMARIDFAPGGLNPPHTHPRGTEVLVIIEGTLLVGFVTSNQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N G+T AL F+  SSQNPG +T+ANS FG+ PPIS DVLTK
Sbjct  143  VLYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISADVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKKT++YLQ+Q W
Sbjct  203  AFQVDKKTVDYLQAQFW  219



>emb|CDP10694.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   187 bits (476),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 110/134 (82%), Gaps = 0/134 (0%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+AR+DFA  GL PPHTHPRATEV+FVLEG L V FV+SNP N  KN+LF+KT
Sbjct  88   GLNTLGVSLARLDFAPYGLNPPHTHPRATEVLFVLEGVLNVGFVTSNPPNNMKNQLFTKT  147

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L PGD F+FP GL+HF +NVG+TNA+ F+ F SQNPG +T+AN+ FGS P IS DVL KA
Sbjct  148  LNPGDVFVFPEGLIHFQFNVGKTNAVAFAGFGSQNPGVITIANAVFGSDPLISADVLAKA  207

Query  365  FRLDKKTINYLQSQ  406
            F++DKK I+ L++Q
Sbjct  208  FQVDKKVIDLLEAQ  221



>ref|XP_002530594.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
 gb|EEF31774.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
Length=190

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 109/137 (80%), Gaps = 5/137 (4%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARID+A  GL PPHTHPRATE++ VLEGTL V FV+SNP     N+L +K
Sbjct  55   PGLNTLGISLARIDYAPYGLNPPHTHPRATEILVVLEGTLYVGFVTSNP-----NRLITK  109

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
            TLKPGD F+FP+G++HF +N G TNA+ F+  SSQNPG +T+AN+ FGS PPI+ DVLTK
Sbjct  110  TLKPGDVFVFPIGMIHFQFNTGNTNAVAFAGLSSQNPGAITIANAVFGSNPPINADVLTK  169

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DK  + YLQ Q W
Sbjct  170  AFQVDKNVVKYLQQQFW  186



>gb|KCW76697.1| hypothetical protein EUGRSUZ_D01057 [Eucalyptus grandis]
Length=221

 Score =   187 bits (475),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 110/137 (80%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR TEV+ V EGTLLV FV+SN LN   N LF+K
Sbjct  84   PGLNTLGISMARIDFAPGGLNPPHTHPRGTEVLVVTEGTLLVGFVTSNQLN---NTLFTK  140

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G+T AL F+A SSQNPG +T+AN+ FGS PPIS DVLTK
Sbjct  141  VLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTK  200

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQ+Q W
Sbjct  201  AFQVDKKVVDYLQAQFW  217



>gb|EYU40208.1| hypothetical protein MIMGU_mgv1a020439mg [Erythranthe guttata]
Length=230

 Score =   187 bits (475),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 111/137 (81%), Gaps = 1/137 (1%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLN-GQKNKLFSK  181
            GLNT+G+S  RID+A NGL PPHTHPRATE++ VLEGTL V FV+SNP N   KNKLF+K
Sbjct  90   GLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSNPANPAIKNKLFTK  149

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP GL+HF +NVG+T A+ F+A SSQNPG +T+AN+ FGS PPI++ VLTK
Sbjct  150  YLYPGDVFVFPEGLIHFQFNVGKTKAVAFAALSSQNPGVITVANAVFGSDPPINRAVLTK  209

Query  362  AFRLDKKTINYLQSQTW  412
            AF+++K  I+YLQ+Q W
Sbjct  210  AFQVEKNVIDYLQAQFW  226



>emb|CDP16791.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   187 bits (475),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+DFA  GL PPHTHPRATEV+FVLEGTLLV FV+SNP    KNKLF+K
Sbjct  87   PGLNTLGVSLARLDFAPYGLNPPHTHPRATEVLFVLEGTLLVGFVTSNPGMNMKNKLFTK  146

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP GL+HF +N G+T+A+ F+ F SQNPG +T+AN+  GS PPIS DVLTK
Sbjct  147  VLNPGDVFVFPQGLIHFQFNQGKTDAVAFAGFGSQNPGVITIANAVVGSDPPISPDVLTK  206

Query  362  AFRLDKKTINYLQSQTW  412
            AF++    I  LQSQ W
Sbjct  207  AFQVGNDAIKKLQSQFW  223



>ref|XP_010024919.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 ref|XP_010042113.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61458.1| hypothetical protein EUGRSUZ_H04194 [Eucalyptus grandis]
Length=223

 Score =   187 bits (474),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S ARIDFA  GL PPHTHPR TEV+ V+EGTLLV FV+SN LN   N LF+K
Sbjct  86   PGLNTLGISAARIDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSNQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N G+T AL F+  SSQNPG +T+ANS FG+ PPIS DVLTK
Sbjct  143  VLYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISADVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKKT++YLQ+Q W
Sbjct  203  AFQVDKKTVDYLQAQFW  219



>ref|XP_006358462.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score =   187 bits (475),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFAR GL PPHTHPR TEV+ VL+G L V FV SNP    KNKLF+K
Sbjct  90   PGLNTLGISLARIDFARRGLNPPHTHPRGTEVLVVLKGRLYVGFVLSNPGPNMKNKLFTK  149

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP GL+HF  NVG+TNA+ F+  SSQN G +T+AN+ FGS PPI+ DVL K
Sbjct  150  ILNPGDVFVFPEGLIHFQLNVGKTNAIAFAGLSSQNAGVITVANAVFGSDPPINDDVLAK  209

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK I+ LQ Q W
Sbjct  210  AFQVDKKAIDDLQEQFW  226



>ref|XP_010024918.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61457.1| hypothetical protein EUGRSUZ_H04193 [Eucalyptus grandis]
Length=223

 Score =   187 bits (474),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S ARIDFA  GL PPHTHPR TEV+ V+EGTLLV FV+SN LN   N LF+K
Sbjct  86   PGLNTLGISAARIDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSNQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N G+T AL F+  SSQNPG +T+ANS FG+ PPIS DVLTK
Sbjct  143  VLYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGTKPPISADVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKKT++YLQ+Q W
Sbjct  203  AFQVDKKTVDYLQAQFW  219



>ref|XP_006349264.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   187 bits (474),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 108/136 (79%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDFA  GL PPHTHPR TEV+ + EGTL V FV SNP    KNKLF+K 
Sbjct  89   GLNTLGISLARIDFAPYGLNPPHTHPRGTEVLALFEGTLYVGFVLSNPGPNMKNKLFTKI  148

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L PGD F+FP+GL+HF +NVG+TNA+ F+  SSQNPG +T+AN+ FGS PPI+ DVL KA
Sbjct  149  LHPGDVFVFPVGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPINDDVLAKA  208

Query  365  FRLDKKTINYLQSQTW  412
            F+++ K ++YLQSQ W
Sbjct  209  FQIENKVVDYLQSQFW  224



>gb|KCW61445.1| hypothetical protein EUGRSUZ_H04176 [Eucalyptus grandis]
Length=223

 Score =   187 bits (474),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 108/137 (79%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S ARIDFA  GL PPHTHPR TEV+ V+EGTLLV FV+SN LN   N LF+K
Sbjct  86   PGLNTLGISAARIDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSNQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N G+T AL F+  SSQNPG +T+ANS FG+ PPIS D LTK
Sbjct  143  VLYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISADALTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKKTI+YLQ+Q W
Sbjct  203  AFQVDKKTIDYLQAQFW  219



>gb|EYU40210.1| hypothetical protein MIMGU_mgv1a022317mg [Erythranthe guttata]
Length=230

 Score =   187 bits (474),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 110/138 (80%), Gaps = 1/138 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLN-GQKNKLFS  178
            PGLNT+G+S  RID+A NGL PPHTHPRATE++ V EGTL V FV+SNP N   KNKLF+
Sbjct  89   PGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVSEGTLYVGFVTSNPANPAIKNKLFT  148

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K L PGD F+FP GL+HF +NVG+TNA+ F+A SSQNPG +T+AN+ FGS PPI+  VLT
Sbjct  149  KYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAALSSQNPGVITIANAVFGSDPPINPAVLT  208

Query  359  KAFRLDKKTINYLQSQTW  412
            K F+++K  I+YLQ+Q W
Sbjct  209  KGFQVEKNVIDYLQAQFW  226



>ref|XP_010251872.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score =   186 bits (473),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 109/137 (80%), Gaps = 4/137 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ RID+A  GL PPHTHPRATEV+ VLEGTL V FV+SNP    +N+L +K
Sbjct  86   PGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLVVLEGTLYVGFVTSNP----ENRLITK  141

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
            TL  GD F+FP+GL+HF +NVG TNA+ F+  SSQNPG +T+AN+ FGS PPI  DVL K
Sbjct  142  TLNKGDVFVFPVGLIHFQFNVGHTNAVAFAGLSSQNPGTITIANAVFGSXPPIKDDVLAK  201

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK I+YLQ+Q W
Sbjct  202  AFQVDKKVIDYLQAQFW  218



>ref|XP_002531992.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
 gb|EEF30391.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
Length=223

 Score =   186 bits (473),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 109/137 (80%), Gaps = 5/137 (4%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARID+A  GL PPHTHPRATE++ VLEGTL V FV+SNP     N+L +K
Sbjct  88   PGLNTLGISLARIDYAPYGLNPPHTHPRATEILVVLEGTLYVGFVTSNP-----NRLITK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
            TLKPGD F+FP+G++HF +N G TNA+ F+  SSQNPG +T+AN+ FGS PPI+ DVLTK
Sbjct  143  TLKPGDVFVFPIGMIHFQFNTGNTNAVAFAGLSSQNPGAITIANAVFGSNPPINADVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DK  + YLQ Q W
Sbjct  203  AFQVDKNVVKYLQKQFW  219



>gb|EYU20548.1| hypothetical protein MIMGU_mgv1a013109mg [Erythranthe guttata]
Length=230

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 111/138 (80%), Gaps = 1/138 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQ-KNKLFS  178
            PGLNT+G+S  RID+A NGL PPHTHPRATE++ VLEGTL V FV+SNP +   KNKLF+
Sbjct  89   PGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSNPADPTLKNKLFT  148

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K L PGD F+FP GL+HF +NVG+TNA+ F+A SSQNPG +T+AN+ FGS P I+  VLT
Sbjct  149  KYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAALSSQNPGVITIANAVFGSDPTINTAVLT  208

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF+++K  I+YLQ+Q W
Sbjct  209  KAFQVEKNVIDYLQAQFW  226



>ref|XP_010251871.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score =   186 bits (472),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 108/137 (79%), Gaps = 4/137 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ RID+A  GL PPHTHPRATEV+ VLEGTL V FV+SNP    +N+LF+K
Sbjct  86   PGLNTLGVSLVRIDYAPYGLNPPHTHPRATEVLVVLEGTLYVGFVTSNP----ENRLFTK  141

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF +NVG TNA+ F+  SSQNPG +T+AN+ FGS PPI  DVL K
Sbjct  142  VLNKGDVFVFPEGLIHFQFNVGHTNAVAFAGLSSQNPGTITIANAVFGSKPPIKDDVLAK  201

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK I+YLQ+Q W
Sbjct  202  AFQVDKKVIDYLQAQFW  218



>emb|CDP10932.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+GLS+ R+DFA  G++PPHTHPRATE V V+EGT+ + FV+SNP +  KN+L++K
Sbjct  89   PGLNTLGLSLLRVDFAPGGVIPPHTHPRATEAVVVIEGTIYIGFVTSNPADNTKNRLYAK  148

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             LKPGD F+ P+GLVHFL NVG+T A+   AF+SQNPG +T+AN+ FG+ P IS +VLTK
Sbjct  149  ILKPGDIFVLPIGLVHFLRNVGKTKAMGIVAFNSQNPGTITIANAVFGTEPLISPEVLTK  208

Query  362  AFRLDKKTINYLQSQ  406
            +F+LDKK I YLQS+
Sbjct  209  SFQLDKKVIEYLQSK  223



>ref|XP_008393482.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
 ref|XP_008351930.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=230

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 108/137 (79%), Gaps = 1/137 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S AR+DFA NGL PPHTHPRATE+  VLEG+L V FV+SN + G  N+LF+K
Sbjct  91   PGLNTLGISFARVDFAPNGLNPPHTHPRATEIFIVLEGSLYVGFVTSN-IEGDGNRLFTK  149

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  NVG+TNA+  +AFSSQNPG +T+AN+ FGS PPI+ DVLTK
Sbjct  150  VLYKGDVFVFPFGLIHFQLNVGKTNAVAIAAFSSQNPGVITVANAVFGSKPPINPDVLTK  209

Query  362  AFRLDKKTINYLQSQTW  412
            AF++D   ++YLQ Q W
Sbjct  210  AFQVDNNVVDYLQKQFW  226



>ref|XP_002319672.1| hypothetical protein POPTR_0013s04850g [Populus trichocarpa]
 gb|EEE95595.1| hypothetical protein POPTR_0013s04850g [Populus trichocarpa]
Length=221

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S ARIDFA  GL PPHTHPRATE++ V+EGTL V FV+SN  NG  N+L +K
Sbjct  87   PGLNTLGISFARIDFAPYGLNPPHTHPRATEIIVVVEGTLYVGFVTSNLANGD-NRLITK  145

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             LKPGD F+FP+GL+HF +NVG+T AL F+  SSQNPG +T+AN+ FGS PPI+ DVL K
Sbjct  146  ALKPGDVFVFPIGLIHFQFNVGKTKALAFAGLSSQNPGVITIANAVFGSDPPINPDVLAK  205

Query  362  AFRLDKKTINYLQ  400
            AF+LDKK ++YLQ
Sbjct  206  AFQLDKKVVDYLQ  218



>ref|XP_010041605.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
Length=221

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR TE++ V EGTLLV FV+SN LN   N  F+K
Sbjct  84   PGLNTLGISMARIDFAPGGLNPPHTHPRGTEILVVAEGTLLVGFVTSNQLN---NTFFTK  140

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G+T AL F+A SSQNPG +T+AN+ FGS PPIS DVLTK
Sbjct  141  VLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTK  200

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQ+Q W
Sbjct  201  AFQVDKKVVDYLQAQFW  217



>gb|KCW80409.1| hypothetical protein EUGRSUZ_C01766 [Eucalyptus grandis]
Length=221

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR +E++ V EGTLLV FV+SN LN   N  F+K
Sbjct  84   PGLNTLGISMARIDFAPGGLNPPHTHPRGSEILVVAEGTLLVGFVTSNQLN---NTFFTK  140

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G+T AL F+A SSQNPG +T+ANS FGS PPIS DVLTK
Sbjct  141  VLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANSVFGSKPPISADVLTK  200

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQ+Q W
Sbjct  201  AFQVDKKVVDYLQAQFW  217



>gb|EYU40211.1| hypothetical protein MIMGU_mgv1a013108mg [Erythranthe guttata]
Length=230

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 110/138 (80%), Gaps = 1/138 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLN-GQKNKLFS  178
            PGLNT+G+S  RID+A NGL PPHTHPRATE++ +L+GTL V FV+SNP +   KNKLF+
Sbjct  89   PGLNTLGISAVRIDYAPNGLNPPHTHPRATEILILLKGTLYVGFVTSNPADPALKNKLFT  148

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K L PGD F+FP GL+HF +NVG+TNA+ F+  SSQNPG +T+AN+ FGS PPI   VLT
Sbjct  149  KYLHPGDVFVFPQGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPIDPAVLT  208

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF+++K  I+YLQ+Q W
Sbjct  209  KAFQVEKDVIDYLQAQFW  226



>ref|XP_002319671.1| hypothetical protein POPTR_0013s04840g [Populus trichocarpa]
 gb|EEE95594.1| hypothetical protein POPTR_0013s04840g [Populus trichocarpa]
Length=221

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S ARIDFA  GL PPHTHPRATE++ V+EGTL V FV+SN  NG  N+L +K
Sbjct  87   PGLNTLGISFARIDFAPYGLNPPHTHPRATEIIVVVEGTLYVGFVTSNLANGD-NRLITK  145

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             LKPGD F+FP+GL+HF +NVG+T AL F+  SSQNPG +T+AN+ FGS PPI+ DVL K
Sbjct  146  ALKPGDVFVFPIGLIHFQFNVGKTKALAFAGLSSQNPGVITIANAVFGSDPPINPDVLAK  205

Query  362  AFRLDKKTINYLQ  400
            AF+LDKK ++YLQ
Sbjct  206  AFQLDKKIVDYLQ  218



>ref|XP_010027145.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61467.1| hypothetical protein EUGRSUZ_H04203 [Eucalyptus grandis]
Length=223

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR TEV+ V+EGTLLV FV+SN LN   N LF+K
Sbjct  86   PGLNTLGISMARIDFAPGGLNPPHTHPRGTEVLVVVEGTLLVGFVTSNQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G T AL F+  SSQNPG +T+AN+ FG+ PPIS DVLTK
Sbjct  143  VLYKGDVFVFPIGLIHFQLNIGNTYALAFAGLSSQNPGLITIANAVFGAKPPISADVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQ+Q W
Sbjct  203  AFQVDKKVVDYLQAQFW  219



>emb|CDP16788.1| unnamed protein product [Coffea canephora]
Length=229

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPH HPRATEV+FVLEGTL+V FV+SNP    KNKLF+K
Sbjct  87   PGLNTLGVSLARIDFAPYGLNPPHIHPRATEVLFVLEGTLVVGFVTSNPGMNMKNKLFTK  146

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP GL+HF +N G +NA+ F+   SQNPG +T+AN+ FGS PPIS DVLTK
Sbjct  147  VLNPGDVFVFPQGLIHFQFNQGHSNAVAFAGLGSQNPGVITIANAVFGSDPPISPDVLTK  206

Query  362  AFRLDKKTINYLQSQTW  412
            AF++    I  LQSQ W
Sbjct  207  AFQVGNDVIKKLQSQFW  223



>gb|EYU20535.1| hypothetical protein MIMGU_mgv1a013054mg [Erythranthe guttata]
Length=231

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 109/138 (79%), Gaps = 1/138 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLN-GQKNKLFS  178
            PGLNT+G+S  RID+A NGL PPHTHPRATE++ V+EGTL V FV+SNP N   KNKLF+
Sbjct  90   PGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVIEGTLYVGFVTSNPANPALKNKLFT  149

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K L PGD F+FP GL+HF +NVG+TNA+ F+  SSQNP  +T+AN+ FGS PPI+  VLT
Sbjct  150  KYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAGLSSQNPSVITIANAVFGSDPPINPAVLT  209

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF+++K  I+YLQ Q W
Sbjct  210  KAFQVEKNVIDYLQKQFW  227



>ref|XP_010024913.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61440.1| hypothetical protein EUGRSUZ_H04170 [Eucalyptus grandis]
Length=221

 Score =   185 bits (469),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR TEV+ V EG LLV FV+SN LN   N LF+K
Sbjct  84   PGLNTLGISMARIDFAPGGLNPPHTHPRGTEVLVVTEGALLVGFVTSNQLN---NTLFTK  140

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G+T AL F+A SSQNPG +T+AN+ FGS PPIS DVLTK
Sbjct  141  VLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTK  200

Query  362  AFRLDKKTINYLQSQTW  412
            AF++D+K ++YLQ+Q W
Sbjct  201  AFQVDRKVVDYLQAQFW  217



>ref|XP_006349268.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   185 bits (469),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 107/136 (79%), Gaps = 0/136 (0%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDFA  GL PPHTHPR TEV+ + EGTL V FV SNP    KNKLF+K 
Sbjct  89   GLNTLGISLARIDFAPYGLNPPHTHPRGTEVLALFEGTLYVGFVLSNPGPNMKNKLFTKI  148

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L PGD F+FP+GL+HF +NVG+TNA+ F+  SSQNPG + +AN+ FGS PPI+ DVL KA
Sbjct  149  LHPGDVFVFPVGLIHFQFNVGKTNAVAFAGLSSQNPGVIIIANAVFGSDPPINDDVLAKA  208

Query  365  FRLDKKTINYLQSQTW  412
            F+++ K ++YLQSQ W
Sbjct  209  FQIENKVVDYLQSQFW  224



>ref|XP_010066338.1| PREDICTED: germin-like protein subfamily 1 member 7 isoform X1 
[Eucalyptus grandis]
 ref|XP_010066339.1| PREDICTED: germin-like protein subfamily 1 member 7 isoform X2 
[Eucalyptus grandis]
 ref|XP_010066340.1| PREDICTED: germin-like protein subfamily 1 member 7 isoform X3 
[Eucalyptus grandis]
 ref|XP_010066341.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 ref|XP_010066345.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 ref|XP_010066346.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
Length=220

 Score =   184 bits (468),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PG+NT+G+S+ARIDFA  GL PPHTHPR TE++ V EGTLLV FV+SN LN   N  F+K
Sbjct  84   PGINTLGISMARIDFAPGGLNPPHTHPRGTEILVVAEGTLLVGFVTSNQLN---NTFFTK  140

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G+T AL F+A SSQNPG +T+AN+ FGS PPIS DVLTK
Sbjct  141  VLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTK  200

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQ+Q W
Sbjct  201  AFQVDKKVVDYLQAQFW  217



>ref|XP_011038440.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
Length=221

 Score =   184 bits (468),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 109/133 (82%), Gaps = 1/133 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPRATE++ V+EGTL V FV+SN  NG  N+L +K
Sbjct  87   PGLNTLGISLARIDFAPYGLNPPHTHPRATEIIVVVEGTLYVGFVTSNLANGD-NRLITK  145

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             LKPGD F+FP+GL+HF +N+G+T AL F+  SSQNPG +T+AN+ FGS PPI+ DVL K
Sbjct  146  ALKPGDVFVFPIGLIHFQFNMGKTKALAFAGLSSQNPGVITIANAVFGSDPPINPDVLAK  205

Query  362  AFRLDKKTINYLQ  400
            AF+LDKK ++YLQ
Sbjct  206  AFQLDKKVVDYLQ  218



>gb|EYU20536.1| hypothetical protein MIMGU_mgv1a025658mg [Erythranthe guttata]
Length=231

 Score =   185 bits (469),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 109/138 (79%), Gaps = 1/138 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLN-GQKNKLFS  178
            PGLNT+G+S  RID+A NGL PPHTHPRATE++ VLEGTL V FV+SNP N   KNKLF+
Sbjct  90   PGLNTLGISAVRIDYALNGLNPPHTHPRATEILVVLEGTLYVGFVTSNPANPALKNKLFT  149

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K L PGD F+FP GL+HF +N G+TNA+ F+  SSQNPG +T+AN+ FGS P I+  VLT
Sbjct  150  KYLYPGDVFVFPEGLIHFQFNAGKTNAVAFAGLSSQNPGVITIANAVFGSDPSINPAVLT  209

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF+++K  I+YLQ+Q W
Sbjct  210  KAFQVEKNVIDYLQAQFW  227



>ref|XP_010048221.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW80406.1| hypothetical protein EUGRSUZ_C01763 [Eucalyptus grandis]
Length=223

 Score =   184 bits (468),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+DFA  GL PPHTHPR TEV+ V+EGTLLV FV+SN LN   N LF+K
Sbjct  86   PGLNTLGISMARLDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSNQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N G+T AL F+  SSQNPG +T+ANS FG+ PPIS DVLTK
Sbjct  143  VLYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGARPPISADVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQ+Q W
Sbjct  203  AFQVDKKIVDYLQAQFW  219



>emb|CDP10698.1| unnamed protein product [Coffea canephora]
Length=223

 Score =   184 bits (467),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 107/135 (79%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT G+S+ARIDFA  G+  PHTHPRATEV+F +EGTL  SFV+SNP N  KN+LF+K
Sbjct  87   PGLNTFGISLARIDFAPYGVNTPHTHPRATEVIFAVEGTLAASFVTSNPPNNMKNRLFTK  146

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP GLVHF+ N+G+T AL FS FSSQNPG  T+AN  FG+ PPIS  VLTK
Sbjct  147  VLNPGDVFVFPQGLVHFIQNLGKTKALAFSGFSSQNPGVNTIANVVFGTEPPISLGVLTK  206

Query  362  AFRLDKKTINYLQSQ  406
            AF++DKK I+ L++Q
Sbjct  207  AFQVDKKVIDALEAQ  221



>gb|EYU20545.1| hypothetical protein MIMGU_mgv1a020779mg [Erythranthe guttata]
Length=231

 Score =   184 bits (468),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 110/138 (80%), Gaps = 1/138 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLN-GQKNKLFS  178
            PGLNT+G+S  RID+A NGL PPHTHPRATE++ V+EGTL V FV+SNP +   KNKLF+
Sbjct  90   PGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVMEGTLYVGFVTSNPADPALKNKLFT  149

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K L PGD F+FP GL+HF +NVG+TNA+ F+  SSQNPG +T+AN+ FGS P I+  VLT
Sbjct  150  KYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAGLSSQNPGVITVANAVFGSDPKINPAVLT  209

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF+++K  I+YLQ+Q W
Sbjct  210  KAFQVEKNVIDYLQAQFW  227



>gb|EYU20549.1| hypothetical protein MIMGU_mgv1a020596mg [Erythranthe guttata]
Length=231

 Score =   184 bits (467),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 110/138 (80%), Gaps = 1/138 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLN-GQKNKLFS  178
            PGLNT+G+S  RID+A NGL PPHTHPRATE++ V+EGTL V FV+SNP +   KNKLF+
Sbjct  90   PGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVMEGTLYVGFVTSNPADPALKNKLFT  149

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K L PGD F+FP GL+HF +NVG+TNA+ F+  SSQNPG +T+AN+ FGS P I+  VLT
Sbjct  150  KYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAGLSSQNPGVITVANAVFGSDPQINPAVLT  209

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF+++K  I+YLQ+Q W
Sbjct  210  KAFQVEKNVIDYLQAQFW  227



>ref|XP_007200176.1| hypothetical protein PRUPE_ppa016529mg [Prunus persica]
 gb|EMJ01375.1| hypothetical protein PRUPE_ppa016529mg [Prunus persica]
Length=226

 Score =   184 bits (467),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 107/136 (79%), Gaps = 3/136 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDFA NGL PPHTHPRATE++ VLEGTL V FV+SN   G  N+LF+K 
Sbjct  90   GLNTLGISLARIDFAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSN---GDGNRLFTKV  146

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  NVG  NA+ F+  SSQNPG +T+AN+ FGS PPI+ DVLTKA
Sbjct  147  LNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPPINPDVLTKA  206

Query  365  FRLDKKTINYLQSQTW  412
            F++D K ++YLQ Q W
Sbjct  207  FQVDNKVVDYLQKQFW  222



>ref|XP_011034444.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score =   184 bits (467),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 106/138 (77%), Gaps = 5/138 (4%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFA-RNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFS  178
            PGLNT+G+S+ RID+A   GL PPHTHPRATEV+ VLEGTL V FV+SNP     N+L +
Sbjct  88   PGLNTLGISVVRIDYAPYGGLNPPHTHPRATEVITVLEGTLYVGFVTSNP----DNRLIT  143

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K LKPGD F+FP GL+HF +NVG+T A   SA SSQNPG +T+AN+ FGS PPI  DVL 
Sbjct  144  KVLKPGDVFVFPFGLIHFQFNVGKTKAAAMSALSSQNPGVITIANAVFGSTPPIRSDVLA  203

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF+LDKK ++YLQ Q W
Sbjct  204  KAFQLDKKIVDYLQKQFW  221



>ref|XP_006358464.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score =   184 bits (467),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFAR GL PPHTHPR TEV+ VL+G L V FV SNP    KNKLF+K
Sbjct  90   PGLNTLGISLARIDFARRGLNPPHTHPRGTEVLVVLKGRLYVGFVLSNPGPNMKNKLFTK  149

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  NVG+TNA+ F+  SSQN G +T+AN+ FGS PPI+ DVL K
Sbjct  150  ILNSGDVFVFPEGLIHFQLNVGKTNAIAFAGLSSQNAGVITVANAVFGSDPPINDDVLAK  209

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK I+ LQ Q W
Sbjct  210  AFQVDKKAIDDLQEQFW  226



>ref|XP_007199217.1| hypothetical protein PRUPE_ppa021882mg [Prunus persica]
 gb|EMJ00416.1| hypothetical protein PRUPE_ppa021882mg [Prunus persica]
Length=226

 Score =   184 bits (466),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 107/136 (79%), Gaps = 3/136 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDFA NGL PPHTHPRATE++ VLEGTL V FV+SN   G  N+LF+K 
Sbjct  90   GLNTLGISLARIDFAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSN---GDGNRLFTKV  146

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  NVG  NA+ F+  SSQNPG +T+AN+ FGS PPI+ DVLTKA
Sbjct  147  LNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPPINPDVLTKA  206

Query  365  FRLDKKTINYLQSQTW  412
            F++D K ++YLQ Q W
Sbjct  207  FQVDNKVVDYLQKQFW  222



>ref|XP_011034445.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
 ref|XP_011038441.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
Length=221

 Score =   184 bits (466),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPRATE++ V+EGTL V FV+SN  NG  N+L +K
Sbjct  87   PGLNTLGISLARIDFAPYGLNPPHTHPRATEIIVVVEGTLYVGFVTSNLANGD-NRLITK  145

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             LKPGD F+FP+GL+HF +N+G+T AL F+  SSQNPG +T+AN+ FGS PPI+ DVL K
Sbjct  146  ALKPGDVFVFPIGLIHFQFNMGQTKALAFAGLSSQNPGVITIANAVFGSDPPINPDVLAK  205

Query  362  AFRLDKKTINYLQ  400
            AF+LDKK + YLQ
Sbjct  206  AFQLDKKVVEYLQ  218



>gb|KCW61456.1| hypothetical protein EUGRSUZ_H04192 [Eucalyptus grandis]
Length=223

 Score =   184 bits (466),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 108/137 (79%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S ARIDFA  GL PPHTHPR TEV+ V+EGTLLV FV+SN LN   N LF+K
Sbjct  86   PGLNTLGISAARIDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSNQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N G+T AL F+  SSQNPG +T+ANS FG+ PPIS DVLTK
Sbjct  143  VLYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISADVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKKT++YL +Q W
Sbjct  203  AFQVDKKTVDYLLAQFW  219



>ref|XP_010024917.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61455.1| hypothetical protein EUGRSUZ_H04191 [Eucalyptus grandis]
Length=221

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 108/137 (79%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR TE++ V EGTLLV FV+SN LN   N  F+K
Sbjct  84   PGLNTLGISMARIDFAPGGLNPPHTHPRGTEILVVAEGTLLVGFVTSNQLN---NTFFTK  140

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G+T  L F+A SSQNPG +T+AN+ FGS PPIS DVLTK
Sbjct  141  VLYKGDVFVFPIGLIHFQLNIGKTPTLAFAALSSQNPGVITIANAVFGSKPPISADVLTK  200

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQ+Q W
Sbjct  201  AFQVDKKVVDYLQAQFW  217



>emb|CAN80134.1| hypothetical protein VITISV_012033 [Vitis vinifera]
Length=224

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 107/136 (79%), Gaps = 4/136 (3%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+AR+D+A  GL PPHTHPRATE++ VLEGTL V FV+SNP    +N+L SK 
Sbjct  90   GLNTLGISLARVDYAPYGLNPPHTHPRATEILVVLEGTLYVGFVTSNP----ENRLISKV  145

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF +NVG TN +  +A SSQNPG +T+AN+ FGS PPIS DVLTKA
Sbjct  146  LNKGDVFVFPIGLIHFQFNVGHTNTVAIAALSSQNPGVITIANAVFGSDPPISIDVLTKA  205

Query  365  FRLDKKTINYLQSQTW  412
            F+LDK  +NYLQS  W
Sbjct  206  FQLDKDVVNYLQSSFW  221



>ref|XP_010024912.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
Length=229

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S ARIDFA  GL+PP+THPR TEV+ V++GTLLV FV+SN LN   N LF+K
Sbjct  92   PGLNTLGISAARIDFASGGLIPPNTHPRGTEVLVVIKGTLLVGFVTSNQLN---NTLFTK  148

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N G+T AL F+  SSQNPG +T+ANS FG+ PPIS DVLTK
Sbjct  149  VLYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISADVLTK  208

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQ+Q W
Sbjct  209  AFQVDKKAVDYLQAQFW  225



>ref|XP_010251869.1| PREDICTED: putative germin-like protein 2-1 isoform X1 [Nelumbo 
nucifera]
Length=222

 Score =   183 bits (465),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 106/137 (77%), Gaps = 4/137 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ RID+A  GL PPHTHPRATEV+ VLEG L V FV+SNP     N+LF+K
Sbjct  86   PGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLVVLEGRLYVGFVTSNP----DNRLFTK  141

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF +NVG TNA+ F+  SSQNPG +T+AN+ FGS PPI  DVL K
Sbjct  142  VLNKGDVFVFPEGLIHFQFNVGHTNAVAFAGLSSQNPGTITIANAVFGSKPPIKDDVLAK  201

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK I+YLQ+Q W
Sbjct  202  AFQVDKKVIDYLQAQFW  218



>ref|XP_011034442.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 106/138 (77%), Gaps = 5/138 (4%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFA-RNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFS  178
            PGLNT+G+S+ RID+A   GL PPHTHPRATEV+ VLEGTL V FV+SNP     N+L +
Sbjct  88   PGLNTLGISVVRIDYAPYGGLNPPHTHPRATEVITVLEGTLYVGFVTSNP----DNRLIT  143

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K LKPGD F+FP GL+HF +NVG+T A   SA SSQNPG +T+AN+ FGS PPI  DVL 
Sbjct  144  KVLKPGDVFVFPFGLIHFQFNVGKTKAAAMSALSSQNPGVITIANAVFGSTPPIRSDVLA  203

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF++DKK ++YLQ Q W
Sbjct  204  KAFQVDKKIVDYLQKQLW  221



>ref|XP_010251870.1| PREDICTED: putative germin-like protein 2-1 isoform X2 [Nelumbo 
nucifera]
Length=222

 Score =   183 bits (465),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 106/137 (77%), Gaps = 4/137 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ RID+A  GL PPHTHPRATEV+ VLEG L V FV+SNP     N+LF+K
Sbjct  86   PGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLVVLEGRLYVGFVTSNP----DNRLFTK  141

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF +NVG TNA+ F+  SSQNPG +T+AN+ FGS PPI  DVL K
Sbjct  142  VLNKGDVFVFPEGLIHFQFNVGHTNAVAFAGLSSQNPGTITIANAVFGSKPPIKDDVLAK  201

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK I+YLQ+Q W
Sbjct  202  AFQVDKKVIDYLQAQFW  218



>emb|CDP10933.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   183 bits (465),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+GLS+ R+DFA  G++PPHTHPRATE V V+EGT+   FV+SNP +  KN+L++K
Sbjct  89   PGLNTLGLSLLRVDFAPGGVIPPHTHPRATEAVVVIEGTIYAGFVTSNPADNTKNRLYAK  148

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             LKPGD F+FP+GLVHFL NVG+T A+   AF+SQNPG +T+AN+ FG+ P IS +VLTK
Sbjct  149  ILKPGDIFVFPIGLVHFLRNVGKTKAMGIVAFNSQNPGTITIANAVFGTEPLISPEVLTK  208

Query  362  AFRLDKKTINYLQSQ  406
            +F+LDKK I  LQS+
Sbjct  209  SFQLDKKVIESLQSK  223



>ref|XP_010027139.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
Length=221

 Score =   183 bits (465),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 108/136 (79%), Gaps = 3/136 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDFA  GL PPHTHPR TE++ V EGTLLV FV+SN LN   N  F+K 
Sbjct  85   GLNTLGISMARIDFAPGGLNPPHTHPRGTEILVVTEGTLLVGFVTSNQLN---NTFFTKV  141

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  N+G+T AL F+A SSQNPG +T+AN+ FGS PPIS DVLTKA
Sbjct  142  LYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGLITIANAVFGSKPPISADVLTKA  201

Query  365  FRLDKKTINYLQSQTW  412
            F++DKK ++YLQ+Q W
Sbjct  202  FQVDKKVVDYLQAQFW  217



>gb|EYU20539.1| hypothetical protein MIMGU_mgv1a013072mg [Erythranthe guttata]
Length=231

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 110/138 (80%), Gaps = 1/138 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLN-GQKNKLFS  178
            PGLNT+G+S  RID+A NGL PPHTHPRATE++ V+EGTL V FV+SNP +   KNKLF+
Sbjct  90   PGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVIEGTLYVGFVTSNPADPALKNKLFT  149

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K L PGD F+FP GL+HF +NVG+TNA+ F+  SSQNPG +T+AN+ FGS P I+  VLT
Sbjct  150  KYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPSINPAVLT  209

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF+++K  I+YLQ+Q W
Sbjct  210  KAFQVEKNIIDYLQAQFW  227



>gb|EYU20542.1| hypothetical protein MIMGU_mgv1a020630mg [Erythranthe guttata]
Length=231

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 109/138 (79%), Gaps = 1/138 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLN-GQKNKLFS  178
            PGLNT+G+S  RID+A NG  PPHTHPRATE++ V+EGTL V FV+SNP N   KNKLF+
Sbjct  90   PGLNTLGISAVRIDYAPNGSNPPHTHPRATEILVVMEGTLYVGFVTSNPANPALKNKLFT  149

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K L PGD F+FP GL+HF +NVG+TNA+ F+  SSQNPG +T+AN+ FGS P I+  VLT
Sbjct  150  KYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAGLSSQNPGVITVANAVFGSDPKINPAVLT  209

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF+++K  I+YLQ+Q W
Sbjct  210  KAFQVEKNVIDYLQAQFW  227



>ref|XP_011034443.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 106/138 (77%), Gaps = 5/138 (4%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFA-RNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFS  178
            PGLNT+G+S+ RID+A   GL PPHTHPRATEV+ VLEGTL V FV+SNP     N+L +
Sbjct  88   PGLNTLGISVVRIDYAPYGGLNPPHTHPRATEVITVLEGTLYVGFVTSNP----DNRLIT  143

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K LKPGD F+FP GL+HF +NVG+T A   SA SSQNPG +T+AN+ FGS PPI  DVL 
Sbjct  144  KVLKPGDVFVFPFGLIHFQFNVGKTKASAISALSSQNPGVITIANAVFGSTPPIRSDVLA  203

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF++DKK ++YLQ Q W
Sbjct  204  KAFQVDKKIVDYLQKQLW  221



>ref|XP_008375054.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=226

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 108/137 (79%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S AR+DFA NGL PPHTHPRATE++ VLEG+L V FV+SN   G  N+LF+K
Sbjct  89   PGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVLEGSLYVGFVTSN---GDGNRLFTK  145

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  NVG+TNAL  +  SSQNPG +T+AN+ FGS PPI+ DVL K
Sbjct  146  VLYKGDVFVFPVGLIHFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPPINPDVLAK  205

Query  362  AFRLDKKTINYLQSQTW  412
            AF++D+K ++YLQ Q W
Sbjct  206  AFQVDEKEVDYLQKQFW  222



>ref|XP_002276644.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=228

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 107/137 (78%), Gaps = 4/137 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+D+A  GL PPHTHPRATE++ VLEGTL V FV+SNP     N+L SK
Sbjct  90   PGLNTLGVSLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLISK  145

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  NVG+TNA+  ++ SSQNPG +T+AN+ FGS P IS DVLTK
Sbjct  146  VLYKGDVFVFPQGLIHFQLNVGKTNAVAIASLSSQNPGVITIANAVFGSKPAISADVLTK  205

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DK  INYLQSQ W
Sbjct  206  AFQVDKNVINYLQSQFW  222



>ref|XP_010050748.1| PREDICTED: uncharacterized protein LOC104439371 [Eucalyptus grandis]
Length=448

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 111/137 (81%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR TEV+ V EGTLLVSFV+SN LN   N LF+K
Sbjct  84   PGLNTLGISMARIDFALGGLNPPHTHPRGTEVLVVTEGTLLVSFVTSNQLN---NTLFTK  140

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G+T AL F+A SSQNPG +T+AN+ FGS PPIS DVLTK
Sbjct  141  VLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTK  200

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQ+Q W
Sbjct  201  AFQVDKKVVDYLQAQFW  217


 Score =   185 bits (470),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR +E++ V EGTLLV FV+SN LN   N  F+K
Sbjct  311  PGLNTLGISMARIDFAPGGLNPPHTHPRGSEILVVAEGTLLVGFVTSNQLN---NTFFTK  367

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G+T AL F+A SSQNPG +T+ANS FGS PPIS DVLTK
Sbjct  368  VLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANSVFGSKPPISADVLTK  427

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQ+Q W
Sbjct  428  AFQVDKKVVDYLQAQFW  444



>ref|XP_006349265.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   183 bits (464),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARID+A  GL PPHTHPR TE + VLEGTL V FV SNP    KNKLF+K
Sbjct  88   PGLNTLGISLARIDYAPYGLNPPHTHPRGTEFLVVLEGTLYVGFVLSNPGPNMKNKLFTK  147

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP+GL+HF +N G+T  + F+  SSQNPG +T+AN+ FGS PPI+ DVL K
Sbjct  148  ILHPGDVFVFPIGLIHFQFNPGKTKTVAFAGLSSQNPGVITIANAVFGSDPPINDDVLAK  207

Query  362  AFRLDKKTINYLQSQTW  412
            AF+++ K ++YLQSQ W
Sbjct  208  AFQIENKVVDYLQSQFW  224



>gb|KCW61438.1| hypothetical protein EUGRSUZ_H04168 [Eucalyptus grandis]
Length=221

 Score =   182 bits (463),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 108/137 (79%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR +E++ V EGTLLV FV+ N LN   N  F+K
Sbjct  84   PGLNTLGISMARIDFAPGGLNPPHTHPRGSEILVVAEGTLLVGFVTFNQLN---NTFFTK  140

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G+T AL F+A SSQNPG +T+ANS FGS PPIS DVLTK
Sbjct  141  VLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANSVFGSKPPISADVLTK  200

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQ+Q W
Sbjct  201  AFQVDKKVVDYLQAQFW  217



>gb|KCW82834.1| hypothetical protein EUGRSUZ_C04205 [Eucalyptus grandis]
Length=223

 Score =   182 bits (463),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR TE++ V+EGTLLV FV+S+ LN   N LF+K
Sbjct  86   PGLNTLGISMARIDFAPGGLNPPHTHPRGTELLVVVEGTLLVGFVTSDQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G T AL FS+FSSQNPG +T+AN+ FG+  PIS DVLTK
Sbjct  143  VLYKGDVFVFPIGLIHFQLNIGNTYALAFSSFSSQNPGLITIANAVFGAKAPISADVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF+LDKK + YL++Q W
Sbjct  203  AFQLDKKVVEYLEAQFW  219



>ref|XP_010024923.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61463.1| hypothetical protein EUGRSUZ_H04199 [Eucalyptus grandis]
Length=223

 Score =   182 bits (463),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+DFA  GL PPHTHPR TEV+ V+EGTLLV FV+S+ LN   N LF+K
Sbjct  86   PGLNTLGISMARLDFAPGGLNPPHTHPRGTEVLVVVEGTLLVGFVTSDQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G T AL F+  SSQNPG +T+AN+ FG+ PPIS DVLTK
Sbjct  143  VLYKGDVFVFPIGLIHFQLNIGNTYALAFAGLSSQNPGLITIANAVFGAKPPISADVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQ+Q W
Sbjct  203  AFQVDKKVVDYLQAQFW  219



>ref|XP_011038438.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score =   182 bits (463),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 106/138 (77%), Gaps = 5/138 (4%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFA-RNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFS  178
            PGLNT+G+S+ RID+A   GL PPHTHPRATEV+ VLEGTL V FV+SNP     N+L +
Sbjct  88   PGLNTLGISVVRIDYAPYGGLNPPHTHPRATEVITVLEGTLYVGFVTSNP----DNRLIT  143

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K LKPGD F+FP GL+HF +NVG+T A   SA SSQNPG +T+AN+ FGS PPI  DVL 
Sbjct  144  KVLKPGDVFVFPFGLIHFQFNVGKTKASAISALSSQNPGVITIANAVFGSTPPIRSDVLA  203

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF++DKK ++YLQ Q W
Sbjct  204  KAFQVDKKIVDYLQKQFW  221



>gb|EYU20546.1| hypothetical protein MIMGU_mgv1a013111mg [Erythranthe guttata]
Length=230

 Score =   182 bits (463),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 109/138 (79%), Gaps = 1/138 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLN-GQKNKLFS  178
            PGLNT+G+S  RID+A NGL PPHTHPRATE++ +L+GTL V FV+SNP +   KNKLF+
Sbjct  89   PGLNTLGISAVRIDYAPNGLNPPHTHPRATEILILLKGTLYVGFVTSNPADPALKNKLFA  148

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
              L PGD F+FP GL+HF +NVG+TNA+ F+  SSQNPG +T+AN+ FGS PPI+  VLT
Sbjct  149  TYLHPGDVFVFPQGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPINPAVLT  208

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF+++K  I YLQ+Q W
Sbjct  209  KAFQVEKDVIEYLQAQFW  226



>gb|EYU20540.1| hypothetical protein MIMGU_mgv1a013117mg [Erythranthe guttata]
Length=230

 Score =   182 bits (463),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 108/138 (78%), Gaps = 1/138 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLN-GQKNKLFS  178
            PGLNT+G+S  RID+A NGL PPHTHPRATE++ +L+GTL V FV+SNP +   KNKLF+
Sbjct  89   PGLNTLGISAVRIDYAPNGLNPPHTHPRATEILILLKGTLYVGFVTSNPADPALKNKLFA  148

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
              L PGD F+FP GL+HF +NVG+TNA+ F+  SSQNPG +T+AN+ FGS PPI   VLT
Sbjct  149  TYLHPGDVFVFPQGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPIDPAVLT  208

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF+++K  I YLQ+Q W
Sbjct  209  KAFQVEKDVIEYLQAQFW  226



>ref|XP_010024926.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61466.1| hypothetical protein EUGRSUZ_H04202 [Eucalyptus grandis]
Length=223

 Score =   182 bits (462),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+DFA  GL PPHTHPR TEV+ V+EGTLLV FV+S+ LN   N LF+K
Sbjct  86   PGLNTLGISMARLDFAPGGLNPPHTHPRGTEVLVVVEGTLLVGFVTSDQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G T AL F+  SSQNPG +T+AN+ FG+ PPIS DVLTK
Sbjct  143  VLYKGDVFVFPIGLIHFQLNIGNTYALAFAGLSSQNPGLITIANAVFGAKPPISADVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQ+Q W
Sbjct  203  AFQVDKKVVDYLQAQFW  219



>ref|XP_007030276.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 ref|XP_007030282.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10778.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10784.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=225

 Score =   182 bits (462),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 109/138 (79%), Gaps = 5/138 (4%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFA-RNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFS  178
            PGLNT+G+S+AR+DFA   GL PPHTHPRATE++ VLEGTL V FV+SNP     N+L +
Sbjct  88   PGLNTLGVSLARVDFAPYGGLNPPHTHPRATEILVVLEGTLYVGFVTSNP----DNRLIT  143

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K L PGD F+FP+GL+HF  N+G+TNA+ F+AF SQNPG +T+A + FGS PPI+ DVLT
Sbjct  144  KVLYPGDVFVFPVGLIHFQLNIGKTNAVAFAAFGSQNPGVITIAKAVFGSNPPINPDVLT  203

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF+LDK  + YLQSQ W
Sbjct  204  KAFQLDKNVVKYLQSQFW  221



>ref|XP_006387364.1| hypothetical protein POPTR_1158s00200g [Populus trichocarpa]
 gb|ERP46278.1| hypothetical protein POPTR_1158s00200g [Populus trichocarpa]
Length=228

 Score =   182 bits (462),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 110/138 (80%), Gaps = 2/138 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFA-RNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFS  178
            PGLNT+G+S ARIDFA   GL PPHTHPRATE++ V+EGTL V FV+SN  NG  N+L +
Sbjct  87   PGLNTLGISFARIDFAPHGGLNPPHTHPRATEILVVVEGTLYVGFVTSNLANGD-NRLIT  145

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K L PGD F+FP+GL+HF  NVGRTNA+ F++ SSQNPG +T+A + FG+ PPI+ +VLT
Sbjct  146  KVLNPGDVFVFPVGLIHFQLNVGRTNAVAFASLSSQNPGVITIAKAVFGADPPINPNVLT  205

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF++DKK ++YLQ Q W
Sbjct  206  KAFQVDKKVVDYLQKQLW  223



>ref|XP_010050166.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW89288.1| hypothetical protein EUGRSUZ_A01578 [Eucalyptus grandis]
Length=223

 Score =   182 bits (461),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+DFA  GL PPHTHPR TEV+ V+EGTLLV FV+SN LN   N LF+K
Sbjct  86   PGLNTLGISMARLDFAPGGLNPPHTHPRGTEVLVVVEGTLLVGFVTSNQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G T AL F+  SSQ+PG +T+AN+ FG+ PPIS DVLTK
Sbjct  143  VLYKGDVFVFPIGLIHFQLNIGNTYALAFAGLSSQSPGVITIANAVFGAKPPISADVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQ+Q W
Sbjct  203  AFQVDKKVVDYLQAQFW  219



>ref|XP_010024924.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61464.1| hypothetical protein EUGRSUZ_H04200 [Eucalyptus grandis]
Length=223

 Score =   182 bits (461),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+DFA  GL PPHTHPR TE++ V+EGTLLV FV+S+ LN   N LF+K
Sbjct  86   PGLNTLGISMARLDFAPGGLNPPHTHPRGTEILVVVEGTLLVGFVTSDQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G T AL F+  SSQNPG +T+AN+ FG+ PPIS DVLTK
Sbjct  143  VLYKGDVFVFPIGLIHFQLNIGNTYALAFAGLSSQNPGLITIANAVFGAKPPISADVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQ+Q W
Sbjct  203  AFQVDKKVVDYLQAQFW  219



>ref|XP_002276315.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=228

 Score =   182 bits (462),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 107/137 (78%), Gaps = 4/137 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+D+A  GL PPHTHPRATE++ VLEGTL V FV+SNP     N+L SK
Sbjct  90   PGLNTLGVSLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLISK  145

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  NVG+TNA+  ++ SSQNPG +T+AN+ FGS P IS DVLTK
Sbjct  146  VLYKGDVFVFPQGLIHFQLNVGKTNAVAIASLSSQNPGVITIANAVFGSKPAISADVLTK  205

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DK  +NYLQSQ W
Sbjct  206  AFQVDKNEVNYLQSQFW  222



>ref|XP_010251867.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score =   182 bits (461),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 106/137 (77%), Gaps = 4/137 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ RID+A  GL PPHTHPRATEV+ VLEG L V FV+SNP     N+LF+K
Sbjct  86   PGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLVVLEGRLYVGFVTSNP----DNRLFTK  141

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF +NVG TNA+ F+  SSQNPG +T+AN+ FG+ PPI  DVL K
Sbjct  142  VLNKGDVFVFPEGLIHFQFNVGHTNAVAFAGLSSQNPGTITIANAVFGAKPPIKDDVLAK  201

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK I+YLQ+Q W
Sbjct  202  AFQVDKKVIDYLQAQFW  218



>ref|XP_007201690.1| hypothetical protein PRUPE_ppa016952mg, partial [Prunus persica]
 gb|EMJ02889.1| hypothetical protein PRUPE_ppa016952mg, partial [Prunus persica]
Length=183

 Score =   180 bits (457),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 107/136 (79%), Gaps = 3/136 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+AR+DFA NGL PPHTHPRA+E++ VLEGTL V FV+SN   G  N+LF+K 
Sbjct  47   GLNTLGISLARLDFAPNGLNPPHTHPRASEILAVLEGTLYVGFVTSN---GDGNRLFTKV  103

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  NVG  NA+ F+  SSQNPG +T+AN+ FGS PPI+ DVLTKA
Sbjct  104  LNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPPINPDVLTKA  163

Query  365  FRLDKKTINYLQSQTW  412
            F++D K ++YLQ Q W
Sbjct  164  FQVDNKVVDYLQKQFW  179



>emb|CDP14600.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   182 bits (461),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 107/135 (79%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+GL++ R+DF  +G++PPHTHPRATE + VLEGT+   FV+SNP +  KNKLF+K
Sbjct  89   PGLNTLGLTVLRVDFEPDGVVPPHTHPRATEAIVVLEGTIYAGFVTSNPTDNTKNKLFAK  148

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             LKPGD F+FP+GLVHF  NVG+T  +   AF+SQNPG +T+ N+ FGS P I+ +VLTK
Sbjct  149  ILKPGDVFVFPIGLVHFQRNVGKTKGMAIVAFNSQNPGVITIGNAVFGSEPHIAPEVLTK  208

Query  362  AFRLDKKTINYLQSQ  406
            +F++DKK I YL+S+
Sbjct  209  SFQVDKKVIEYLESK  223



>gb|KCW44233.1| hypothetical protein EUGRSUZ_L02343 [Eucalyptus grandis]
Length=231

 Score =   182 bits (461),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 108/135 (80%), Gaps = 3/135 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR TE++ V EGTLLV FV+SN LN   N  F+K
Sbjct  84   PGLNTLGISMARIDFAPGGLNPPHTHPRGTEILVVAEGTLLVGFVTSNQLN---NTFFTK  140

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G+T AL F+A SSQNPG +T+AN+ FGS PPIS DVLTK
Sbjct  141  VLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTK  200

Query  362  AFRLDKKTINYLQSQ  406
            AF++DKK ++YLQ+Q
Sbjct  201  AFQVDKKVVDYLQAQ  215



>emb|CDP10701.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   182 bits (461),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+AR+DFA +GL PPHTHPRATEV+FVLEGTL V FV+SNP N  KN+LF+KT
Sbjct  88   GLNTLGVSLARLDFAPHGLNPPHTHPRATEVLFVLEGTLHVGFVTSNPPNNMKNQLFTKT  147

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L PGD F+FP GL+HF +N G+T A+ F+ F SQNPG +T+AN+ FGS P IS  VL KA
Sbjct  148  LNPGDVFVFPEGLIHFQFNFGKTKAVAFAGFGSQNPGVITIANAVFGSDPLISPAVLAKA  207

Query  365  FRLDKKTINYLQSQ  406
            F++DKK I+ L+ Q
Sbjct  208  FQVDKKVIDLLEGQ  221



>ref|XP_011038439.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=236

 Score =   182 bits (461),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 106/138 (77%), Gaps = 5/138 (4%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFA-RNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFS  178
            PGLNT+G+S+ RID+A   GL PPHTHPRATEV+ VLEGTL V FV+SNP     N+L +
Sbjct  99   PGLNTLGISLVRIDYAPYGGLNPPHTHPRATEVITVLEGTLYVGFVTSNP----DNRLIT  154

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K LKPGD F+FP GL+HF +NVG+T A   SA SSQNPG +T+AN+ FGS PPI  DVL 
Sbjct  155  KVLKPGDVFVFPFGLIHFQFNVGKTKASAISALSSQNPGVITIANAVFGSTPPIRSDVLA  214

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF++DKK ++YLQ Q W
Sbjct  215  KAFQVDKKIVDYLQKQFW  232



>ref|XP_002276756.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=228

 Score =   181 bits (460),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 107/137 (78%), Gaps = 4/137 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+D+A  GL PPH+HPRATE++ VLEGTL V FV+SNP     N+L SK
Sbjct  90   PGLNTLGVSLARVDYAPYGLNPPHSHPRATEILTVLEGTLYVGFVTSNP----DNRLISK  145

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  NVG+TNA+  ++ SSQNPG +T+AN+ FGS P IS DVLTK
Sbjct  146  VLHKGDVFVFPQGLIHFQLNVGKTNAVAIASLSSQNPGVITIANAVFGSKPAISADVLTK  205

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DK  +NYLQSQ W
Sbjct  206  AFQVDKNVVNYLQSQFW  222



>gb|KCW64218.1| hypothetical protein EUGRSUZ_G01868, partial [Eucalyptus grandis]
 gb|KCW64219.1| hypothetical protein EUGRSUZ_G01869, partial [Eucalyptus grandis]
 gb|KCW64222.1| hypothetical protein EUGRSUZ_G01872, partial [Eucalyptus grandis]
 gb|KCW64223.1| hypothetical protein EUGRSUZ_G01873, partial [Eucalyptus grandis]
Length=216

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 108/135 (80%), Gaps = 3/135 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PG+NT+G+S+ARIDFA  GL PPHTHPR TE++ V EGTLLV FV+SN LN   N  F+K
Sbjct  84   PGINTLGISMARIDFAPGGLNPPHTHPRGTEILVVAEGTLLVGFVTSNQLN---NTFFTK  140

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G+T AL F+A SSQNPG +T+AN+ FGS PPIS DVLTK
Sbjct  141  VLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTK  200

Query  362  AFRLDKKTINYLQSQ  406
            AF++DKK ++YLQ+Q
Sbjct  201  AFQVDKKVVDYLQAQ  215



>ref|XP_010049990.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW82832.1| hypothetical protein EUGRSUZ_C04203 [Eucalyptus grandis]
Length=223

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 107/137 (78%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ R+DFA  GL PPH HPR TEV  V+EGTLLV FV+SN LN   N LF+K
Sbjct  86   PGLNTLGISMVRVDFAPGGLNPPHFHPRGTEVQIVVEGTLLVGFVTSNQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G T AL  S+FSSQNPG +T+AN+ FG+ PPIS DVLTK
Sbjct  143  VLYKGDVFVFPIGLIHFQLNIGNTYALSISSFSSQNPGLITIANAVFGAKPPISADVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF+LDKK + YL++Q+W
Sbjct  203  AFQLDKKVVEYLEAQSW  219



>gb|KCW76699.1| hypothetical protein EUGRSUZ_D01059 [Eucalyptus grandis]
Length=221

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 107/137 (78%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR +E++ V EGTLLV FV+SN LN   N  F+K
Sbjct  84   PGLNTLGISMARIDFAPGGLNPPHTHPRGSEILVVAEGTLLVGFVTSNQLN---NTFFTK  140

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G+T AL F+A SSQNPG +T+ANS F S PPIS DVLTK
Sbjct  141  VLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANSVFRSKPPISADVLTK  200

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQ Q W
Sbjct  201  AFQVDKKVVDYLQVQFW  217



>ref|XP_010054506.1| PREDICTED: uncharacterized protein LOC104442816 [Eucalyptus grandis]
Length=448

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 110/137 (80%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR TEV+ V EGTLLV FV+SN LN   N LF+K
Sbjct  84   PGLNTLGISMARIDFAPGGLNPPHTHPRGTEVLVVTEGTLLVGFVTSNQLN---NTLFTK  140

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G+T AL F+A SSQNPG +T+AN+ FGS PPIS DVLTK
Sbjct  141  VLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTK  200

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQ+Q W
Sbjct  201  AFQVDKKVVDYLQAQFW  217


 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 107/137 (78%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR +E++ V EGTLLV FV+SN LN   N  F+K
Sbjct  311  PGLNTLGISMARIDFAPGGLNPPHTHPRGSEILVVAEGTLLVGFVTSNQLN---NTFFTK  367

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G+T AL F+A SSQNPG +T+ANS F S PPIS DVLTK
Sbjct  368  VLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANSVFRSKPPISADVLTK  427

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQ Q W
Sbjct  428  AFQVDKKVVDYLQVQFW  444



>ref|XP_002319184.1| hypothetical protein POPTR_0013s06030g [Populus trichocarpa]
 ref|XP_002319673.2| germin-like protein 1 [Populus trichocarpa]
 ref|XP_006375916.1| hypothetical protein POPTR_0013s06010g [Populus trichocarpa]
 ref|XP_002319185.2| hypothetical protein POPTR_0013s06020g [Populus trichocarpa]
 gb|EEE95107.1| hypothetical protein POPTR_0013s06030g [Populus trichocarpa]
 gb|EEE95596.2| germin-like protein 1 [Populus trichocarpa]
 gb|ERP53713.1| hypothetical protein POPTR_0013s06010g [Populus trichocarpa]
 gb|EEE95108.2| hypothetical protein POPTR_0013s06020g [Populus trichocarpa]
Length=228

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 110/138 (80%), Gaps = 2/138 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFA-RNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFS  178
            PGLNT+G+S ARIDFA   GL PPHTHPRATE++ V+EGTL V FV+SN  NG  N+L +
Sbjct  87   PGLNTLGISFARIDFAPHGGLNPPHTHPRATEILVVVEGTLYVGFVTSNLANGD-NRLIT  145

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K L PGD F+FP+GL+HF  NVG+TNA+ F++ SSQNPG +T+A + FG+ PPI+ +VLT
Sbjct  146  KVLNPGDVFVFPVGLIHFQLNVGKTNAVAFASLSSQNPGVITIAKAVFGADPPINPNVLT  205

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF++DKK ++YLQ Q W
Sbjct  206  KAFQVDKKVVDYLQKQLW  223



>ref|XP_010241946.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=223

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 104/137 (76%), Gaps = 4/137 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ RID+A  GL PPHTHPRATEV+ VLEG L V FV+SNP     N+LF+K
Sbjct  87   PGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLVVLEGRLYVGFVTSNP----DNRLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL HF +NVG TNA+ F+  SSQNPG +T+AN+ FG  PPI  DVL K
Sbjct  143  VLNKGDVFVFPQGLTHFQFNVGHTNAVAFAGLSSQNPGTITIANAVFGPKPPIKDDVLAK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK I+YLQ+Q W
Sbjct  203  AFQVDKKVIDYLQAQYW  219



>ref|XP_010027143.1| PREDICTED: uncharacterized protein LOC104417591 [Eucalyptus grandis]
Length=451

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S ARIDFA  GL PPHTHPR TEV+ V+EGTLLV FV+SN LN   N LF+K
Sbjct  314  PGLNTLGISAARIDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSNQLN---NTLFTK  370

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N G+T AL F+  SSQNPG +T+ANS FG+ PPIS DVLTK
Sbjct  371  VLYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGTKPPISADVLTK  430

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKKT++YLQ+Q W
Sbjct  431  AFQVDKKTVDYLQAQFW  447


 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 108/137 (79%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S ARIDFA  GL PPHTHPR TEV+ V+EGTLLV FV+SN LN   N LF+K
Sbjct  86   PGLNTLGISAARIDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSNQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N G+T AL F+  SSQNPG +T+ANS FG+ PPIS DVLTK
Sbjct  143  VLYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISADVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKKT++YL +Q W
Sbjct  203  AFQVDKKTVDYLLAQFW  219



>ref|XP_008393483.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=228

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 106/137 (77%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S AR+DFA NGL PPHTHPRATE++ V+EG+L V FV+SN   G  N+LF+K
Sbjct  91   PGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVVEGSLYVGFVTSN---GDGNRLFTK  147

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  NVG+TNAL  +  SSQNPG +T+AN+ FGS PPI+ DVL K
Sbjct  148  VLYKGDVFVFPIGLIHFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPPINPDVLAK  207

Query  362  AFRLDKKTINYLQSQTW  412
            AF++D   ++YLQ Q W
Sbjct  208  AFQVDBNVVDYLQKQFW  224



>ref|XP_008351931.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=228

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 106/137 (77%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S AR+DFA NGL PPHTHPRATE++ V+EG+L V FV+SN   G  N+LF+K
Sbjct  91   PGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVVEGSLYVGFVTSN---GDGNRLFTK  147

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  NVG+TNAL  +  SSQNPG +T+AN+ FGS PPI+ DVL K
Sbjct  148  VLYKGDVFVFPIGLIHFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPPINPDVLAK  207

Query  362  AFRLDKKTINYLQSQTW  412
            AF++D   ++YLQ Q W
Sbjct  208  AFQVDBNVVDYLQKQFW  224



>emb|CDP14601.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 107/135 (79%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+GL++ R+DF  +G +PPHTHPRATEV+ VLEGT+   FV+SNP +  KNKLF+K
Sbjct  89   PGLNTLGLTVVRVDFEPDGGVPPHTHPRATEVITVLEGTIYAGFVTSNPTDNTKNKLFAK  148

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             LKPGD F+FP+GLVHF  NVG+T  +   AF+SQNPG +T+ N+ FGS P I+ +VLTK
Sbjct  149  ILKPGDVFVFPVGLVHFHRNVGKTKGMAIVAFNSQNPGVITIGNAVFGSEPHIAPEVLTK  208

Query  362  AFRLDKKTINYLQSQ  406
            +F++DKK I Y++S+
Sbjct  209  SFQVDKKVIEYIESK  223



>ref|XP_009349816.1| PREDICTED: germin-like protein subfamily 1 member 13 [Pyrus x 
bretschneideri]
Length=228

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 106/137 (77%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S AR+DFA NGL PPHTHPRATE++ V+EG+L V FV+SN   G  N+LF+K
Sbjct  91   PGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVVEGSLYVGFVTSN---GDGNRLFTK  147

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  NVG+TNAL  +  SSQNPG +T+AN+ FGS PPI+ DVL K
Sbjct  148  VLYKGDVFVFPIGLIHFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPPINPDVLAK  207

Query  362  AFRLDKKTINYLQSQTW  412
            AF++D   ++YLQ Q W
Sbjct  208  AFQVDDNVVDYLQKQFW  224



>ref|XP_007200183.1| hypothetical protein PRUPE_ppa016284mg [Prunus persica]
 gb|EMJ01382.1| hypothetical protein PRUPE_ppa016284mg [Prunus persica]
Length=226

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 105/136 (77%), Gaps = 3/136 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDFA NGL PPHTHPRATE++ VLEGTL V FV+SN   G  N+LF+K 
Sbjct  90   GLNTLGISLARIDFAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSN---GDGNRLFTKV  146

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  NVG  NA+ F+  SSQNPG +T+AN+ FGS PPI+ DVL KA
Sbjct  147  LNEGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPPINPDVLAKA  206

Query  365  FRLDKKTINYLQSQTW  412
            F++D   ++YLQ Q W
Sbjct  207  FQVDNNLVDYLQKQFW  222



>ref|XP_010050174.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW89289.1| hypothetical protein EUGRSUZ_A01579 [Eucalyptus grandis]
Length=223

 Score =   180 bits (456),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 107/137 (78%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+DFA  GL PPHTHPR TEV+ V+EG LLV FV+SN LN   N LF+K
Sbjct  86   PGLNTLGISMARLDFAPGGLNPPHTHPRGTEVLVVVEGMLLVGFVTSNQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N G TNAL F+  SSQNPG +T+AN+ FG+  PIS DVLTK
Sbjct  143  VLYKGDVFVFPIGLIHFQLNTGNTNALAFAGLSSQNPGVITIANAVFGAKLPISTDVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQ+Q W
Sbjct  203  AFQVDKKEVDYLQAQFW  219



>ref|XP_008237387.1| PREDICTED: germin-like protein subfamily 1 member 20 [Prunus 
mume]
Length=233

 Score =   180 bits (457),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 104/136 (76%), Gaps = 3/136 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDF  NGL PPHTHPR TE++ VLEGTL V FV+SN   G  N+LF+K 
Sbjct  97   GLNTLGISLARIDFGPNGLNPPHTHPRGTEILVVLEGTLYVGFVTSN---GDGNRLFTKV  153

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  NVG  NA+  +A SSQNPG +T+AN+ FGS PPI+ DVL KA
Sbjct  154  LNKGDVFVFPIGLIHFQLNVGHVNAVALAALSSQNPGVITIANAVFGSKPPINPDVLAKA  213

Query  365  FRLDKKTINYLQSQTW  412
            F++D K +NYLQ Q W
Sbjct  214  FQVDNKVVNYLQKQFW  229



>gb|KCW61442.1| hypothetical protein EUGRSUZ_H04173, partial [Eucalyptus grandis]
Length=216

 Score =   179 bits (455),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 107/134 (80%), Gaps = 3/134 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDFA  GL PPHTHPR TE++ V EGTLLV FV+SN LN   N  F+K 
Sbjct  85   GLNTLGISMARIDFAPGGLNPPHTHPRGTEILVVTEGTLLVGFVTSNQLN---NTFFTKV  141

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  N+G+T AL F+A SSQNPG +T+AN+ FGS PPIS DVLTKA
Sbjct  142  LYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGLITIANAVFGSKPPISADVLTKA  201

Query  365  FRLDKKTINYLQSQ  406
            F++DKK ++YLQ+Q
Sbjct  202  FQVDKKVVDYLQAQ  215



>gb|EYU40209.1| hypothetical protein MIMGU_mgv1a013129mg [Erythranthe guttata]
Length=230

 Score =   180 bits (456),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 107/138 (78%), Gaps = 1/138 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLN-GQKNKLFS  178
            PGLNT+G+S  RID+A  GL PPHTHPRATE++ +L+GTL V FV+SNP +   KNKLF+
Sbjct  89   PGLNTLGISAVRIDYAPKGLNPPHTHPRATEILILLKGTLYVGFVTSNPADPALKNKLFA  148

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
              L PGD F+FP GL+HF +NVG+TNA+ F+  SSQNPG +T+AN+ FGS PPI   VLT
Sbjct  149  TYLHPGDVFVFPQGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPIDPVVLT  208

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF+++K  I YLQ+Q W
Sbjct  209  KAFQVEKDVIEYLQAQFW  226



>ref|XP_008360941.1| PREDICTED: germin-like protein subfamily 1 member 17 [Malus domestica]
Length=228

 Score =   180 bits (456),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 106/137 (77%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S AR+DFA NGL PPHTHPRATE++ V+EG+L V FV+SN   G  N+LF+K
Sbjct  91   PGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVVEGSLYVGFVTSN---GDGNRLFTK  147

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  NVG+TNAL  +  SSQNPG +T+AN+ FGS PPI+ DVL K
Sbjct  148  VLYKGDVFVFPIGLIHFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPPINPDVLAK  207

Query  362  AFRLDKKTINYLQSQTW  412
            AF++D   ++YLQ Q W
Sbjct  208  AFQVDDNVVDYLQKQFW  224



>ref|XP_011034308.1| PREDICTED: germin-like protein subfamily 1 member 16 [Populus 
euphratica]
Length=228

 Score =   180 bits (456),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 111/137 (81%), Gaps = 2/137 (1%)
 Frame = +2

Query  5    GLNTMGLSIARIDFA-RNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            GLNT+G+S+ARID+A   GL PPHTHPRATE++ V+EGTL V FV+SN  NG  N+L +K
Sbjct  88   GLNTLGISLARIDYAPHGGLTPPHTHPRATEILVVVEGTLYVGFVTSNLPNGD-NRLITK  146

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP+GLVHF  NVG+TNA+ F++ SSQNPG +T+AN+ FG+ PPI+ +VLTK
Sbjct  147  VLNPGDVFVFPVGLVHFQLNVGKTNAVAFASLSSQNPGVITIANAVFGADPPINPNVLTK  206

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQ Q W
Sbjct  207  AFQVDKKLVDYLQKQFW  223



>ref|XP_008237521.1| PREDICTED: germin-like protein subfamily 1 member 16 [Prunus 
mume]
Length=234

 Score =   180 bits (456),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 105/136 (77%), Gaps = 3/136 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDFA NGL PPHTHPRATE++ VLEGTL V FV+SN   G  N+LF+K 
Sbjct  98   GLNTLGISLARIDFAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSN---GDGNRLFTKV  154

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  NVG  NA+ F+  SSQNPG +T+AN+ FGS PPI+ DVL KA
Sbjct  155  LNKGDVFVFPIGLIHFQLNVGYVNAVAFAGLSSQNPGVITIANAVFGSKPPINPDVLAKA  214

Query  365  FRLDKKTINYLQSQTW  412
            F++D   ++YLQ Q W
Sbjct  215  FQVDNNVVDYLQKQFW  230



>ref|XP_008780704.1| PREDICTED: germin-like protein 8-5, partial [Phoenix dactylifera]
Length=152

 Score =   177 bits (449),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 108/137 (79%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+DFA  G+ PPH HPR TE++ VLEGTL V FV+SN LN   N+LF+K
Sbjct  14   PGLNTLGISLARLDFAPYGVNPPHIHPRGTEILTVLEGTLHVGFVTSNNLN---NQLFTK  70

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF +N G+TNA+  +A SSQNPG +T+AN+ FG+ PPIS  VL K
Sbjct  71   VLNKGDVFVFPQGLIHFQFNYGKTNAVAIAALSSQNPGVITIANAVFGAKPPISDYVLAK  130

Query  362  AFRLDKKTINYLQSQTW  412
            AF+LDKKT+++LQ+Q W
Sbjct  131  AFQLDKKTVDWLQAQFW  147



>ref|XP_008367619.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=228

 Score =   179 bits (455),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 105/137 (77%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S AR+DFA NGL PPHTHPRATE++ V EG+L V FV+SN   G  N+LF+K
Sbjct  91   PGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVXEGSLYVGFVTSN---GDGNRLFTK  147

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  NVG+TNAL  +  SSQNPG +T+AN+ FGS PPI+ DVL K
Sbjct  148  VLYKGDVFVFPIGLIHFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPPINPDVLAK  207

Query  362  AFRLDKKTINYLQSQTW  412
            AF++D   ++YLQ Q W
Sbjct  208  AFQVDDNVVDYLQKQFW  224



>ref|XP_002265608.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   179 bits (454),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 106/135 (79%), Gaps = 4/135 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+D+A  GL PPHTHPRATE++ VLEGTL V FV+SNP     N+L SK
Sbjct  90   PGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLISK  145

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  NVG+T A+  +A SSQNPG +T+AN+ FGS P IS DVLTK
Sbjct  146  VLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTK  205

Query  362  AFRLDKKTINYLQSQ  406
            AF++DKK ++YLQSQ
Sbjct  206  AFQVDKKVVDYLQSQ  220



>ref|XP_003633724.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   179 bits (454),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 106/135 (79%), Gaps = 4/135 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+D+A  GL PPHTHPRATE++ VLEGTL V FV+SNP     N+L SK
Sbjct  90   PGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLISK  145

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  NVG+T A+  +A SSQNPG +T+AN+ FGS P IS DVLTK
Sbjct  146  VLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTK  205

Query  362  AFRLDKKTINYLQSQ  406
            AF++DKK ++YLQSQ
Sbjct  206  AFQVDKKVVDYLQSQ  220



>emb|CBI33612.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   179 bits (454),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 106/135 (79%), Gaps = 4/135 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+D+A  GL PPHTHPRATE++ VLEGTL V FV+SNP     N+L SK
Sbjct  90   PGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLISK  145

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  NVG+T A+  +A SSQNPG +T+AN+ FGS P IS DVLTK
Sbjct  146  VLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTK  205

Query  362  AFRLDKKTINYLQSQ  406
            AF++DKK ++YLQSQ
Sbjct  206  AFQVDKKVVDYLQSQ  220



>ref|XP_010662281.1| PREDICTED: putative germin-like protein 2-1, partial [Vitis vinifera]
Length=187

 Score =   178 bits (451),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 105/137 (77%), Gaps = 4/137 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+D+A  GL PPHTHPRATE++ VLEGTL V FV+SNP     N+L SK
Sbjct  49   PGLNTLGVSLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLISK  104

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  NVG TNA+  ++ SSQNPG +T+AN+ FGS P IS DVLTK
Sbjct  105  VLHKGDIFVFPQGLIHFQLNVGTTNAVAIASLSSQNPGVITIANAVFGSKPAISADVLTK  164

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DK  + YLQSQ W
Sbjct  165  AFQVDKNVVEYLQSQFW  181



>emb|CAN70189.1| hypothetical protein VITISV_016562 [Vitis vinifera]
Length=214

 Score =   179 bits (453),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 106/135 (79%), Gaps = 4/135 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+D+A  GL PPHTHPRATE++ VLEGTL V FV+SNP     N+L SK
Sbjct  83   PGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLISK  138

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  NVG+T A+  +A SSQNPG +T+AN+ FGS P IS DVLTK
Sbjct  139  VLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTK  198

Query  362  AFRLDKKTINYLQSQ  406
            AF++DKK ++YLQSQ
Sbjct  199  AFQVDKKVVDYLQSQ  213



>ref|XP_007201563.1| hypothetical protein PRUPE_ppa018105mg [Prunus persica]
 gb|EMJ02762.1| hypothetical protein PRUPE_ppa018105mg [Prunus persica]
Length=227

 Score =   179 bits (454),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 106/136 (78%), Gaps = 3/136 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDFARNGL PPHTHPRATE++ VLEGTL V FV+SN  N   N+LF+K 
Sbjct  90   GLNTLGISLARIDFARNGLNPPHTHPRATEILLVLEGTLYVGFVTSNADN---NRLFTKV  146

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  NVG  +A+  +A SSQNPG +T+AN+ FGS PPI+ +VL KA
Sbjct  147  LNKGDVFVFPIGLIHFQLNVGEGDAVAQAALSSQNPGVITIANAVFGSDPPINPEVLAKA  206

Query  365  FRLDKKTINYLQSQTW  412
            F++D K + YLQ Q W
Sbjct  207  FQVDNKAVEYLQKQFW  222



>ref|XP_010050157.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW89287.1| hypothetical protein EUGRSUZ_A01577 [Eucalyptus grandis]
Length=223

 Score =   179 bits (454),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 107/137 (78%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+DFA  GL PPHTHPR TEV+ V+EGTLLV F++SN LN   N LF+K
Sbjct  86   PGLNTLGISMARLDFAPGGLNPPHTHPRGTEVLVVVEGTLLVGFITSNQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N G T AL F+  SSQNPG +T+AN+ FG+  PIS DVLTK
Sbjct  143  VLYKGDVFVFPIGLIHFQLNCGNTYALAFAGLSSQNPGVITIANAVFGAKSPISADVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YL++Q W
Sbjct  203  AFQVDKKVVDYLEAQFW  219



>ref|XP_010051709.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW82835.1| hypothetical protein EUGRSUZ_C04206 [Eucalyptus grandis]
Length=223

 Score =   179 bits (453),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 108/137 (79%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR TE++ V+EGTLLV FV+S+ LN   N LF+K
Sbjct  86   PGLNTLGISMARIDFAPGGLNPPHTHPRGTELLVVVEGTLLVGFVTSDQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G T AL FS  SSQNPG +T+AN+ FG+  PIS DVLTK
Sbjct  143  VLYKGDVFVFPIGLIHFQLNIGNTYALAFSGLSSQNPGLITIANAVFGAKAPISADVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF+LDKK +++L++Q W
Sbjct  203  AFQLDKKVVDHLEAQFW  219



>ref|XP_002530595.1| Oxalate oxidase 2 precursor, putative [Ricinus communis]
 gb|EEF31775.1| Oxalate oxidase 2 precursor, putative [Ricinus communis]
Length=209

 Score =   178 bits (452),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 108/138 (78%), Gaps = 6/138 (4%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFAR-NGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFS  178
            PGLNT+G+S+ARID+A   GL PPH HPRATE++ V+EGTL V FV+SNP     N+L +
Sbjct  73   PGLNTLGISLARIDYAAYGGLNPPHIHPRATEILVVVEGTLYVGFVTSNP-----NRLIT  127

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            KTLKPGD F+FP+GL+HF +N+G  NA+ F+  SSQNPG +T+AN+ FGS P I+ DVLT
Sbjct  128  KTLKPGDVFVFPVGLIHFQFNIGHNNAVAFAGLSSQNPGVITIANAVFGSNPSINPDVLT  187

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF++DK  +NYLQ Q W
Sbjct  188  KAFQVDKIVVNYLQEQFW  205



>ref|XP_010049992.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW82837.1| hypothetical protein EUGRSUZ_C04208 [Eucalyptus grandis]
Length=223

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 108/137 (79%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR TE++ V+EGTLLV FV+S+ LN   N LF+K
Sbjct  86   PGLNTLGISMARIDFAPGGLNPPHTHPRGTELLVVVEGTLLVGFVTSDQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G T AL FS  SSQNPG +T+AN+ FG+  PIS DVLTK
Sbjct  143  VLYKGDVFVFPIGLIHFQLNIGNTYALAFSGLSSQNPGLITIANAVFGAKAPISADVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF+LDKK +++L++Q W
Sbjct  203  AFQLDKKVVDHLEAQFW  219



>ref|XP_010051710.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW82838.1| hypothetical protein EUGRSUZ_C04209 [Eucalyptus grandis]
Length=223

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 108/137 (79%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR TE++ V+EGTLLV FV+S+ LN   N LF+K
Sbjct  86   PGLNTLGISMARIDFAPGGLNPPHTHPRGTELLVVVEGTLLVGFVTSDQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G T AL FS  SSQNPG +T+AN+ FG+  PIS DVLTK
Sbjct  143  VLYKGDVFVFPIGLIHFQLNIGNTYALAFSGLSSQNPGLITIANAVFGAKAPISADVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF+LDKK +++L++Q W
Sbjct  203  AFQLDKKVVDHLEAQFW  219



>ref|XP_010049996.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW82841.1| hypothetical protein EUGRSUZ_C04212 [Eucalyptus grandis]
Length=223

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 108/137 (79%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR TE++ V+EGTLLV FV+S+ LN   N LF+K
Sbjct  86   PGLNTLGISMARIDFAPGGLNPPHTHPRGTELLVVVEGTLLVGFVTSDQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G T AL FS  SSQNPG +T+AN+ FG+  PIS DVLTK
Sbjct  143  VLYKGDVFVFPIGLIHFQLNIGNTYALAFSGLSSQNPGLITIANAVFGAKAPISADVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF+LDKK +++L++Q W
Sbjct  203  AFQLDKKVVDHLEAQFW  219



>ref|XP_006358460.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
1 member 18-like [Solanum tuberosum]
Length=233

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 108/140 (77%), Gaps = 3/140 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFAR+GL PPHTHPR TEV+ VL+G L V FV SNP    KNKLF+K
Sbjct  90   PGLNTLGISLARIDFARHGLNPPHTHPRGTEVLVVLKGRLYVGFVLSNPGPNMKNKLFTK  149

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSA---PPISQDV  352
             L PGD F+FP GL+HF  NVG+TNA+ F+  SSQN G +T+AN+ FGS    PPI+ +V
Sbjct  150  ILNPGDVFVFPEGLIHFQLNVGKTNAIAFAGLSSQNAGVITVANAVFGSDPPHPPINDNV  209

Query  353  LTKAFRLDKKTINYLQSQTW  412
            L+KAF++DKK I+ LQ + W
Sbjct  210  LSKAFQVDKKVIDDLQEEFW  229



>ref|XP_007030272.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10774.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=225

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 109/138 (79%), Gaps = 5/138 (4%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARN-GLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFS  178
            PGLNT+G+S+ RID+A N GL PPHTHPRATE++ VLEGTL V FV+SNP     N+L +
Sbjct  88   PGLNTLGISLVRIDYAPNDGLNPPHTHPRATEILVVLEGTLYVGFVTSNP----DNRLIT  143

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K L PGD F+FP+GL+HF +NVG+TNA+ F+A SSQNPG +T+AN+ FG+ PPI+ DVL 
Sbjct  144  KILYPGDVFVFPIGLIHFQFNVGKTNAVAFAALSSQNPGVITIANAVFGANPPINPDVLV  203

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF+LDK  +  LQS+ W
Sbjct  204  KAFQLDKNVVKNLQSKFW  221



>ref|XP_010049995.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 ref|XP_010042080.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW82840.1| hypothetical protein EUGRSUZ_C04211 [Eucalyptus grandis]
Length=223

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 108/137 (79%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR TE++ V+EGTLLV FV+S+ LN   N LF+K
Sbjct  86   PGLNTLGISMARIDFAPGGLNPPHTHPRGTELLVVVEGTLLVGFVTSDQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G T AL FS  SSQNPG +T+AN+ FG+  PIS DVLTK
Sbjct  143  VLYKGDVFVFPIGLIHFQLNIGNTYALAFSGLSSQNPGLITIANAVFGAKAPISADVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF+LDKK +++L++Q W
Sbjct  203  AFQLDKKVVDHLEAQFW  219



>ref|XP_010049993.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW82839.1| hypothetical protein EUGRSUZ_C04210 [Eucalyptus grandis]
Length=223

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 108/137 (79%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR TE++ V+EGTLLV FV+S+ LN   N LF+K
Sbjct  86   PGLNTLGISMARIDFAPGGLNPPHTHPRGTELLVVVEGTLLVGFVTSDQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G T AL FS  SSQNPG +T+AN+ FG+  PIS DVLTK
Sbjct  143  VLYKGDVFVFPIGLIHFQLNIGNTYALAFSGLSSQNPGLITIANAVFGAKAPISADVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF+LDKK +++L++Q W
Sbjct  203  AFQLDKKVVDHLEAQFW  219



>emb|CAN66771.1| hypothetical protein VITISV_022559 [Vitis vinifera]
Length=205

 Score =   178 bits (451),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 106/135 (79%), Gaps = 4/135 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+D+A  GL PPHTHPRATE++ VLEGTL V FV+SNP     N+L SK
Sbjct  74   PGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLISK  129

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  NVG+T A+  +A SSQNPG +T+AN+ FGS P IS DVLTK
Sbjct  130  VLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTK  189

Query  362  AFRLDKKTINYLQSQ  406
            AF++DKK ++YLQSQ
Sbjct  190  AFQVDKKVVDYLQSQ  204



>ref|XP_002265857.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 106/135 (79%), Gaps = 4/135 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+D+A  GL PPHTHPRATE++ VLEGTL V FV+SNP     N+L SK
Sbjct  90   PGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLISK  145

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  NVG+T A+  +A SSQNPG +T+AN+ FGS P IS DVLTK
Sbjct  146  VLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTK  205

Query  362  AFRLDKKTINYLQSQ  406
            AF++DKK ++YLQSQ
Sbjct  206  AFQVDKKVVDYLQSQ  220



>ref|XP_010041604.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
Length=223

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 107/137 (78%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G++ AR+DFA  GL PPH HPR TE++ V+EGTL V FV+SN LN   N LF+K
Sbjct  86   PGLNTLGIATARLDFAPYGLNPPHIHPRGTEMLLVVEGTLHVGFVTSNQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  N+G+TNAL F+  SSQNPG +T+AN+ FGS PPI+ DVLTK
Sbjct  143  VLTKGDVFVFPQGLIHFQLNIGQTNALAFAFLSSQNPGLITIANTVFGSKPPINVDVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF++D K INYLQ+Q+W
Sbjct  203  AFQVDNKLINYLQAQSW  219



>emb|CBI33611.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 106/135 (79%), Gaps = 4/135 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+D+A  GL PPHTHPRATE++ VLEGTL V FV+SNP     N+L SK
Sbjct  148  PGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLISK  203

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  NVG+T A+  +A SSQNPG +T+AN+ FGS P IS DVLTK
Sbjct  204  VLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTK  263

Query  362  AFRLDKKTINYLQSQ  406
            AF++DKK ++YLQSQ
Sbjct  264  AFQVDKKVVDYLQSQ  278



>ref|XP_008240380.1| PREDICTED: germin-like protein subfamily 1 member 20 [Prunus 
mume]
Length=227

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 102/136 (75%), Gaps = 3/136 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDFA NGL PPHTHPR TE + VLEGTL V FVSSN   G  N+LF+K 
Sbjct  91   GLNTLGISLARIDFAPNGLNPPHTHPRGTEFLIVLEGTLYVGFVSSN---GDNNRLFTKV  147

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  NVG  NAL  +  SSQNPG +T+AN+ FGS PPI+ DVL KA
Sbjct  148  LNKGDVFVFPVGLIHFQLNVGHVNALAVAGLSSQNPGVITIANAVFGSNPPINPDVLAKA  207

Query  365  FRLDKKTINYLQSQTW  412
            F++D K + YLQ Q W
Sbjct  208  FQIDDKEVEYLQKQFW  223



>ref|XP_010257844.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=224

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 104/137 (76%), Gaps = 4/137 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPRATE++ VLEGTL V F +SNP     N+L +K
Sbjct  88   PGLNTLGISLARIDFAPYGLNPPHTHPRATEILVVLEGTLYVGFATSNP----DNRLITK  143

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
            TL  GD F+FP+GL+HF +N G TNA+  +  SSQNPG +T+AN+ FGS PPI  DVL +
Sbjct  144  TLNKGDVFVFPVGLIHFQFNTGETNAVALAGLSSQNPGVITIANAVFGSKPPIRDDVLAR  203

Query  362  AFRLDKKTINYLQSQTW  412
            AFR+D K I+ LQ+Q W
Sbjct  204  AFRVDTKLIDNLQAQFW  220



>ref|XP_006845051.1| hypothetical protein AMTR_s00794p00001640 [Amborella trichopoda]
 gb|ERN06726.1| hypothetical protein AMTR_s00794p00001640 [Amborella trichopoda]
Length=220

 Score =   178 bits (451),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 105/137 (77%), Gaps = 4/137 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ RID+AR G  PPHTHPRATE++ VLEG+L V FV+SNP     N+L +K
Sbjct  84   PGLNTLGISLVRIDYARGGQNPPHTHPRATEILTVLEGSLYVGFVTSNP----DNRLITK  139

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
            T++ GD F+FP GL+HF  NVG  NA+  +A SSQNPG +T+AN+ FGS P IS DVL K
Sbjct  140  TIQKGDVFVFPEGLIHFQQNVGSKNAVAIAALSSQNPGVITIANAVFGSKPAISNDVLAK  199

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK +N LQSQ W
Sbjct  200  AFQVDKKVVNRLQSQFW  216



>ref|XP_009620876.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana tomentosiformis]
Length=211

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = +2

Query  23   LSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKTLKPGDS  202
            +S+ARID+A  GL PPHTHPR TE++ VLEGTL V FV SNP    KNKLF+K L PGD 
Sbjct  78   ISLARIDYAPYGLNPPHTHPRGTEILAVLEGTLYVGFVLSNPGPNMKNKLFTKILNPGDV  137

Query  203  FIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKAFRLDKK  382
            F+FP+GL+HF +NVG+TNA+ F+  SSQNPG +T+AN+ FGS PPI+ DVL KAF++D K
Sbjct  138  FVFPIGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPINPDVLAKAFQVDNK  197

Query  383  TINYLQSQTW  412
             ++YLQSQ W
Sbjct  198  VVDYLQSQFW  207



>ref|XP_008778966.1| PREDICTED: putative germin-like protein 2-1 [Phoenix dactylifera]
Length=221

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 107/136 (79%), Gaps = 4/136 (3%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDFA  GL PPH HPRATE++ VLEG+L V FV+SNP     N+LF+K 
Sbjct  85   GLNTLGISLARIDFAPYGLNPPHIHPRATEILTVLEGSLYVGFVTSNP----DNRLFAKV  140

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            +  GD F+FP GL+HF +N G  NA+  +A SSQNPG +T+AN+ FGS PPIS+DVL KA
Sbjct  141  INKGDVFVFPQGLIHFQFNYGTKNAVAIAALSSQNPGVITVANAVFGSKPPISRDVLAKA  200

Query  365  FRLDKKTINYLQSQTW  412
            F++DKKTI++LQ+Q W
Sbjct  201  FQVDKKTIDWLQAQFW  216



>ref|XP_007030265.1| Germin-like protein 2 [Theobroma cacao]
 gb|EOY10767.1| Germin-like protein 2 [Theobroma cacao]
Length=221

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 107/136 (79%), Gaps = 5/136 (4%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLL-PPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFS  178
            PGLNT+G+S+ RID+A NG L PPHTHPR TE++ VLEGTL V FV+SNP     N+L S
Sbjct  89   PGLNTLGISLVRIDYAPNGGLNPPHTHPRGTEILVVLEGTLYVGFVTSNP----NNRLIS  144

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K L PGD F+FP+GL+HF  NVG+TNA+ F+  SSQNPG +T+AN+ FGS PPI+ DVLT
Sbjct  145  KILSPGDVFVFPIGLIHFQQNVGKTNAVAFAGLSSQNPGVITIANAVFGSNPPINPDVLT  204

Query  359  KAFRLDKKTINYLQSQ  406
             AF+LDKK + YLQS+
Sbjct  205  GAFQLDKKVVKYLQSR  220



>ref|XP_003633723.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=226

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 105/135 (78%), Gaps = 4/135 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+D+A  GL PPHTHPRATE++ VLEGTL V FV+SNP     N+L  K
Sbjct  95   PGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLICK  150

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  NVG+T A+  +A SSQNPG +T+AN+ FGS P IS DVLTK
Sbjct  151  VLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTK  210

Query  362  AFRLDKKTINYLQSQ  406
            AF++DKK ++YLQSQ
Sbjct  211  AFQVDKKVVDYLQSQ  225



>emb|CAN71631.1| hypothetical protein VITISV_015711 [Vitis vinifera]
Length=204

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 106/135 (79%), Gaps = 4/135 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+D+A  GL PPHTHPRATE++ VLEGTL V FV+SNP     N+L SK
Sbjct  73   PGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLISK  128

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  NVG+T A+  +A SSQNPG +T+AN+ FGS P IS DVLTK
Sbjct  129  VLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTK  188

Query  362  AFRLDKKTINYLQSQ  406
            AF++DKK ++YLQSQ
Sbjct  189  AFQVDKKVVDYLQSQ  203



>ref|XP_010066342.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
Length=223

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 106/137 (77%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G++ AR+DFA  GL PPH HPR TE++ V+EGTL V FV+SN LN   N LF+K
Sbjct  86   PGLNTLGIATARLDFAPYGLNPPHIHPRGTEMLLVVEGTLHVGFVTSNQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  N+G+TNAL F+  SSQNPG +T+AN+ FGS PPI+ DVLTK
Sbjct  143  VLTKGDVFVFPQGLIHFQLNIGQTNALAFAFLSSQNPGLITIANTVFGSKPPINVDVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF++D K INYLQ+Q W
Sbjct  203  AFQVDNKLINYLQAQNW  219



>ref|XP_003633711.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 106/135 (79%), Gaps = 4/135 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+D+A  GL PPHTHPRATE++ VLEGTL V FV+SNP     N+L +K
Sbjct  90   PGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLIAK  145

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  NVG+T A+  +A SSQNPG +T+AN+ FGS P IS DVLTK
Sbjct  146  VLYKGDVFVFPEGLIHFHLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTK  205

Query  362  AFRLDKKTINYLQSQ  406
            AF++DKK ++YLQSQ
Sbjct  206  AFQVDKKVVDYLQSQ  220



>ref|XP_007201630.1| hypothetical protein PRUPE_ppa020060mg [Prunus persica]
 gb|EMJ02829.1| hypothetical protein PRUPE_ppa020060mg [Prunus persica]
Length=233

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 104/136 (76%), Gaps = 3/136 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDF  NGL PPHTHPR TE++ V+EGTL V FV+SN   G  N+LF+K 
Sbjct  97   GLNTLGISLARIDFGPNGLNPPHTHPRGTEILVVVEGTLYVGFVTSN---GDGNRLFTKV  153

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  NVG  NA+  +A SSQNPG +T+AN+ FGS PPI+ DVL KA
Sbjct  154  LNKGDVFVFPIGLIHFQLNVGHVNAVALAALSSQNPGVITIANAVFGSKPPINPDVLAKA  213

Query  365  FRLDKKTINYLQSQTW  412
            F++D K ++YLQ Q W
Sbjct  214  FQVDNKVVDYLQKQFW  229



>emb|CBI33610.3| unnamed protein product [Vitis vinifera]
Length=315

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 106/135 (79%), Gaps = 4/135 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+D+A  GL PPHTHPRATE++ VLEGTL V FV+SNP     N+L SK
Sbjct  184  PGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLISK  239

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  NVG+T A+  +A SSQNPG +T+AN+ FGS P IS DVLTK
Sbjct  240  VLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTK  299

Query  362  AFRLDKKTINYLQSQ  406
            AF++DKK ++YLQSQ
Sbjct  300  AFQVDKKVVDYLQSQ  314



>ref|XP_010911724.1| PREDICTED: putative germin-like protein 2-1 [Elaeis guineensis]
Length=221

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 107/136 (79%), Gaps = 4/136 (3%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+AR+DFA  GL PPHTHPR TE++ VLEGTL V FV+SNP     N+LFSK 
Sbjct  85   GLNTLGISLARLDFAPYGLNPPHTHPRGTEILVVLEGTLYVGFVTSNP----NNQLFSKV  140

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP GL+HF +N G+T+A+  +  SSQNPG +T+AN+ FG+ PPIS +VL KA
Sbjct  141  LHEGDVFVFPQGLIHFQFNNGKTSAVALAGLSSQNPGVITIANAVFGAKPPISDEVLAKA  200

Query  365  FRLDKKTINYLQSQTW  412
            F+LDKKT+++LQ+Q W
Sbjct  201  FQLDKKTVDWLQAQFW  216



>ref|XP_010027140.1| PREDICTED: uncharacterized protein LOC104417587 [Eucalyptus grandis]
Length=549

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 108/137 (79%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S ARIDFA  GL PPHTHPR TEV+ V+EGTLLV FV+SN LN   N LF+K
Sbjct  412  PGLNTLGISAARIDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSNQLN---NTLFTK  468

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N G+T AL F+  SSQNPG +T+ANS FG+ PPIS D LTK
Sbjct  469  VLYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISADALTK  528

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKKTI+YLQ+Q W
Sbjct  529  AFQVDKKTIDYLQAQFW  545


 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 105/137 (77%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+++AR+DFA  GL PPH HPR TE++ V+EGTL V FV+SN LN   N LF+K
Sbjct  86   PGLNTLGITMARLDFAPYGLNPPHIHPRGTEMLVVVEGTLYVGFVTSNQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  N+G+ NAL F+  SSQNPG +T+ANS FGS P I+ DVLTK
Sbjct  143  VLTKGDVFVFPQGLIHFQLNIGQANALAFAFLSSQNPGLITIANSVFGSKPLINVDVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF++D K INYLQ+Q W
Sbjct  203  AFQVDNKLINYLQAQNW  219


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 54/100 (54%), Gaps = 3/100 (3%)
 Frame = -2

Query  369  RNALVRTSCEIGGADPKAELARVTYPGFWLLKAENSKALVRPTL*RK*TSPMGKMKESPG  190
             +ALVRTS E+GG DP   LA V  PGFWLL+A  + A V P    K   P+G    SP 
Sbjct  222  NHALVRTSAEMGGFDPNTALAMVITPGFWLLRAAKASAGVFPMFSWKWMRPIGNTNTSPL  281

Query  189  LRVLEKSLFF*PLSGFEETKLTRRVPSRTNTTSVARGWVW  70
               L K + F   +  + TK T  VPS T  TSV RG+ +
Sbjct  282  YNTLVKRVLF---NWLDVTKPTSSVPSVTTRTSVPRGFTF  318



>ref|XP_008243694.1| PREDICTED: germin-like protein 9-1 [Prunus mume]
Length=456

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 107/136 (79%), Gaps = 3/136 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDFA NGL PPHTHPRATE++ VLEGTL V FV+SN   G  N+LF+K 
Sbjct  90   GLNTLGISLARIDFAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSN---GDGNRLFTKE  146

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  NVG  NA+ F+  SSQNPG +T+AN+ FGS PPI+ DVLTKA
Sbjct  147  LNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPPINPDVLTKA  206

Query  365  FRLDKKTINYLQSQTW  412
            F++D K ++YLQ Q W
Sbjct  207  FQVDNKVVDYLQKQFW  222


 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 107/136 (79%), Gaps = 3/136 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDFA NGL PPHTHPRATE++ VLEGTL V FV+SN   G  N+LF+K 
Sbjct  320  GLNTLGISLARIDFAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSN---GDGNRLFTKE  376

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  NVG  NA+ F+  SSQNPG +T+AN+ FGS PPI+ DVLTKA
Sbjct  377  LNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPPINPDVLTKA  436

Query  365  FRLDKKTINYLQSQTW  412
            F++D K ++YLQ Q W
Sbjct  437  FQVDNKVVDYLQKQFW  452



>emb|CAN72994.1| hypothetical protein VITISV_000563 [Vitis vinifera]
Length=205

 Score =   177 bits (448),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 106/135 (79%), Gaps = 4/135 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+D+A  GL PPHTHPRATE++ VLEGTL V FV+SNP     N+L +K
Sbjct  74   PGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLIAK  129

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  NVG+T A+  +A SSQNPG +T+AN+ FGS P IS DVLTK
Sbjct  130  VLYKGDVFVFPEGLIHFHLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTK  189

Query  362  AFRLDKKTINYLQSQ  406
            AF++DKK ++YLQSQ
Sbjct  190  AFQVDKKVVDYLQSQ  204



>ref|XP_010049991.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW82836.1| hypothetical protein EUGRSUZ_C04207 [Eucalyptus grandis]
Length=223

 Score =   177 bits (450),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 107/137 (78%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR TE++ V+EGTLLV FV+S+ LN   N LF+K
Sbjct  86   PGLNTLGISMARIDFAPGGLNPPHTHPRGTELLVVVEGTLLVGFVTSDQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G T AL FS  SSQNPG +T+AN+ FG+  PIS DVLTK
Sbjct  143  VLYKGDVFVFPIGLIHFQLNIGNTYALAFSGLSSQNPGLITIANAVFGAKAPISADVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF+LDKK +++L+ Q W
Sbjct  203  AFQLDKKVVDHLEVQFW  219



>ref|XP_010066343.1| PREDICTED: germin-like protein subfamily 1 member 17 [Eucalyptus 
grandis]
 ref|XP_010066344.1| PREDICTED: germin-like protein subfamily 1 member 17 [Eucalyptus 
grandis]
 ref|XP_010066348.1| PREDICTED: germin-like protein subfamily 1 member 17 [Eucalyptus 
grandis]
 gb|KCW64220.1| hypothetical protein EUGRSUZ_G01870 [Eucalyptus grandis]
 gb|KCW64221.1| hypothetical protein EUGRSUZ_G01871 [Eucalyptus grandis]
 gb|KCW64224.1| hypothetical protein EUGRSUZ_G01874 [Eucalyptus grandis]
Length=222

 Score =   177 bits (449),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 106/137 (77%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G++ AR+DFA  GL PPH HPR TE++ V+EGTL V FV+SN LN   N LF+K
Sbjct  85   PGLNTLGIATARLDFAPYGLNPPHIHPRGTEMLLVVEGTLHVGFVTSNQLN---NTLFTK  141

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  N+G+TNAL F+  SSQNPG +T+AN+ FGS PPI+ DVLTK
Sbjct  142  VLTKGDVFVFPQGLIHFQLNIGQTNALAFAFLSSQNPGLITIANTVFGSKPPINVDVLTK  201

Query  362  AFRLDKKTINYLQSQTW  412
            AF++D K INYLQ+Q W
Sbjct  202  AFQVDNKLINYLQAQNW  218



>ref|XP_008243693.1| PREDICTED: germin-like protein subfamily 1 member 11 [Prunus 
mume]
Length=197

 Score =   176 bits (447),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 106/136 (78%), Gaps = 3/136 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+AR+DFARNGL PPHTHPRATE++ VLEGTL V FV+SN  N   N+LF+K 
Sbjct  60   GLNTLGISLARMDFARNGLNPPHTHPRATEILLVLEGTLYVGFVTSNADN---NRLFTKV  116

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  NVG  +A+  +A SSQNPG +T+AN+ FGS PPI+ +VL KA
Sbjct  117  LNKGDVFVFPVGLIHFQRNVGEGDAVDQAALSSQNPGVITIANAVFGSDPPINPEVLAKA  176

Query  365  FRLDKKTINYLQSQTW  412
            F++D K + YLQ Q W
Sbjct  177  FQVDNKAVEYLQKQFW  192



>ref|XP_004293676.1| PREDICTED: putative germin-like protein 2-1-like [Fragaria vesca 
subsp. vesca]
Length=214

 Score =   177 bits (448),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 107/135 (79%), Gaps = 4/135 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT G+SIARIDFA  G+ PPHTHPRATE++ VLEG+L V FV+SNP    +NKL +K
Sbjct  83   PGLNTFGISIARIDFAAWGVNPPHTHPRATEILTVLEGSLQVGFVTSNP----ENKLITK  138

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L+PGD F+FP GLVHF YNVG T A+ +SAFSSQNPG +TLAN+ FG+ P IS D+LTK
Sbjct  139  ILQPGDVFVFPEGLVHFQYNVGYTIAVAYSAFSSQNPGTITLANTVFGARPHISSDILTK  198

Query  362  AFRLDKKTINYLQSQ  406
            AF +DK+ I  +QS+
Sbjct  199  AFLVDKEAIYNIQSR  213



>ref|XP_011034305.1| PREDICTED: germin-like protein subfamily 1 member 16 [Populus 
euphratica]
Length=228

 Score =   177 bits (449),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 110/138 (80%), Gaps = 2/138 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFA-RNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFS  178
            PGLNT+ +S+ RID+A   GL PPHTHPRATE++ V+EGTL V FV+SN  NG  N+L +
Sbjct  87   PGLNTLSISLVRIDYAPHGGLNPPHTHPRATEILVVVEGTLYVGFVTSNLPNGD-NRLIT  145

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K L PGD F+FP+GLVHF  NVG+TNA+ F++ SSQNPG +T+AN+ FG+ PPI+ +VLT
Sbjct  146  KVLNPGDVFVFPVGLVHFQLNVGKTNAVAFASLSSQNPGVITIANAVFGADPPINPNVLT  205

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF++DKK ++YLQ Q W
Sbjct  206  KAFQVDKKLVDYLQKQFW  223



>ref|XP_007210592.1| hypothetical protein PRUPE_ppa016616mg [Prunus persica]
 gb|EMJ11791.1| hypothetical protein PRUPE_ppa016616mg [Prunus persica]
Length=227

 Score =   177 bits (449),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 102/136 (75%), Gaps = 3/136 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDFA NGL PPHTHPR TE + VLEGTL V FV+SN   G  N+LF+K 
Sbjct  91   GLNTLGISLARIDFAPNGLNPPHTHPRGTEFLIVLEGTLYVGFVTSN---GDNNRLFTKV  147

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  NVG  NAL  +  SSQNPG +T+AN+ FGS PPI+ DVL KA
Sbjct  148  LNKGDVFVFPVGLIHFQLNVGHVNALAVAGLSSQNPGVITIANAVFGSNPPINPDVLAKA  207

Query  365  FRLDKKTINYLQSQTW  412
            F++D K + YLQ Q W
Sbjct  208  FQIDDKEVEYLQKQFW  223



>ref|XP_010048594.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW80890.1| hypothetical protein EUGRSUZ_C02258 [Eucalyptus grandis]
Length=223

 Score =   177 bits (449),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 105/137 (77%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PG+NT+G+S+ARIDFA  GL PPH HPR +EV FV EG LL  FV+SN LN   N  F+K
Sbjct  86   PGVNTLGVSMARIDFAPGGLNPPHLHPRGSEVQFVAEGMLLAGFVTSNQLN---NTFFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F FP+GL+HF  N+G T AL FS+FSSQNPG +T+AN+ FG+ PPIS DVLTK
Sbjct  143  VLYKGDVFAFPIGLIHFQLNIGNTYALAFSSFSSQNPGIITVANAVFGAKPPISVDVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF+LDKK ++YLQ+Q W
Sbjct  203  AFQLDKKVVDYLQAQFW  219



>emb|CAN73848.1| hypothetical protein VITISV_021639 [Vitis vinifera]
Length=141

 Score =   174 bits (441),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 107/135 (79%), Gaps = 4/135 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ RID+A  G  PPHTHPRATE++ VLEGTLLV FV+SNP    +N+LFSK
Sbjct  10   PGLNTLGISLVRIDYAPYGQNPPHTHPRATEILTVLEGTLLVGFVTSNP----QNRLFSK  65

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF +N+G TNA+  +A +SQNPG +T+A++ FGS PPI+ D L +
Sbjct  66   VLNKGDVFVFPIGLIHFQFNIGHTNAVAIAALNSQNPGVITIABAVFGSNPPINPDFLAR  125

Query  362  AFRLDKKTINYLQSQ  406
            AF+LDKK + YLQ++
Sbjct  126  AFQLDKKVVEYLQAR  140



>gb|KCW82831.1| hypothetical protein EUGRSUZ_C04202, partial [Eucalyptus grandis]
Length=216

 Score =   177 bits (448),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 107/137 (78%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPH HP  TEV+ V+EGTLLV FV+S+ LN   N LF+K
Sbjct  79   PGLNTLGISMARIDFAPGGLNPPHNHPHGTEVLIVVEGTLLVGFVTSDQLN---NTLFTK  135

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             +  GD F+F +GL+HF  N+G T AL FS+FSSQNPG +T+AN+ FG+ PPIS DVLTK
Sbjct  136  VIYKGDVFVFSIGLIHFQLNIGNTYALAFSSFSSQNPGLITIANAVFGAKPPISADVLTK  195

Query  362  AFRLDKKTINYLQSQTW  412
            AF+L+KK + YL++Q W
Sbjct  196  AFQLNKKVVEYLEAQFW  212



>ref|XP_008237526.1| PREDICTED: germin-like protein subfamily 1 member 11 [Prunus 
mume]
Length=228

 Score =   177 bits (448),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 104/136 (76%), Gaps = 3/136 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDFA NGL PPHTHPRATE++ VLEGTL V FV+SN   G  N+LF+K 
Sbjct  92   GLNTLGISLARIDFAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSN---GDGNRLFTKV  148

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  NVG  NA+ F+  SSQNPG +T+AN+ FGS P I+ DVL KA
Sbjct  149  LNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPLINPDVLAKA  208

Query  365  FRLDKKTINYLQSQTW  412
            F++D   ++YLQ Q W
Sbjct  209  FQVDNNVVDYLQKQFW  224



>ref|XP_009355938.1| PREDICTED: germin-like protein subfamily 1 member 13 [Pyrus x 
bretschneideri]
Length=226

 Score =   177 bits (448),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 106/137 (77%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S AR+DFA NGL PPHTHPRATE++ VLEG+L V FV+SN      N+LF+K
Sbjct  89   PGLNTLGISFARLDFAPNGLNPPHTHPRATEILIVLEGSLYVGFVTSN---ADGNRLFTK  145

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  NVG+TNAL  +  SSQNPG +T+AN+ FGS P I+ DVL K
Sbjct  146  VLYKGDVFVFPVGLIHFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPHINPDVLAK  205

Query  362  AFRLDKKTINYLQSQTW  412
            AF++D+K ++YLQ Q W
Sbjct  206  AFQVDEKEVDYLQKQFW  222



>ref|XP_009385875.1| PREDICTED: putative germin-like protein 2-1 [Musa acuminata subsp. 
malaccensis]
Length=223

 Score =   176 bits (447),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 105/136 (77%), Gaps = 2/136 (1%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ RID+   GL PPHTHPRATE++ V+EG LLV FV+SN  +G  N+LF+K 
Sbjct  85   GLNTLGISMVRIDYGPKGLNPPHTHPRATEILTVIEGQLLVGFVTSNTDDG--NRLFTKM  142

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            LK GD F+FP GL+HF +N G T  +   A SSQNPG +T+AN+ FGS PPIS DVL KA
Sbjct  143  LKKGDVFVFPEGLIHFQFNPGHTKTIAIGALSSQNPGTITIANAVFGSKPPISDDVLAKA  202

Query  365  FRLDKKTINYLQSQTW  412
            F++DKKTI++LQ+Q W
Sbjct  203  FQVDKKTIDWLQAQFW  218



>ref|XP_007201148.1| hypothetical protein PRUPE_ppa016020mg [Prunus persica]
 gb|EMJ02347.1| hypothetical protein PRUPE_ppa016020mg [Prunus persica]
Length=226

 Score =   176 bits (447),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 103/136 (76%), Gaps = 3/136 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ RIDFA NGL PPHTHPRA+E + VLEGTL V FV+SN   G  N+LF+K 
Sbjct  90   GLNTLGISLTRIDFAPNGLNPPHTHPRASEFLVVLEGTLYVGFVTSN---GDGNRLFTKV  146

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  NVG  NA+ F+  SSQNPG +T+AN+ FGS PPI+ DVL KA
Sbjct  147  LNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPPINPDVLAKA  206

Query  365  FRLDKKTINYLQSQTW  412
            F++D   ++YLQ Q W
Sbjct  207  FQVDDNVVDYLQKQLW  222



>emb|CDP16786.1| unnamed protein product [Coffea canephora]
Length=690

 Score =   186 bits (471),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPH HPRATEV+FVLEGTL+V FV+SNP    KNKLF+K
Sbjct  548  PGLNTLGVSLARIDFAPYGLNPPHIHPRATEVLFVLEGTLVVGFVTSNPGMNMKNKLFTK  607

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP GL+HF +N G +NA+ F+   SQNPG +T+AN+ FGS PPIS DVLTK
Sbjct  608  VLNPGDVFVFPQGLIHFQFNQGHSNAVAFAGLGSQNPGVITIANAVFGSDPPISPDVLTK  667

Query  362  AFRLDKKTINYLQSQTW  412
            AF++    I  LQSQ W
Sbjct  668  AFQVGNDVIKKLQSQFW  684


 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 114/158 (72%), Gaps = 4/158 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+DFA  GL PPHTHPRATEV+FVLEGTLLV FV+SNP    KNKLF+K
Sbjct  87   PGLNTLGVSLARLDFAPYGLNPPHTHPRATEVLFVLEGTLLVGFVTSNPGMNMKNKLFTK  146

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP GL+HF +N G T+A+ F+   SQNPG +T+AN+ FGS PPIS DVLTK
Sbjct  147  VLNPGDVFVFPQGLIHFQFNQGETDAVAFAGLGSQNPGVITIANAVFGSDPPISPDVLTK  206

Query  362  AFRLDKKTINYLQSQTWPLI*YSTSMLLLLIIIFELYA  475
            AF++    I  LQ Q      + TS ++ + +   + A
Sbjct  207  AFQVGNDVIKKLQVQLI----FDTSFVITMAVRIHIAA  240


 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPH HPRATEV+FVLEGTL+V FV+SNP    KNKLF+K
Sbjct  318  PGLNTLGVSLARIDFAPYGLNPPHIHPRATEVLFVLEGTLVVGFVTSNPGMNMKNKLFTK  377

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP GL+HF +N G +NA+ F+   SQNPG +T+AN+ FGS PPIS DVLTK
Sbjct  378  VLNPGDVFVFPQGLIHFQFNQGHSNAVAFAGLGSQNPGVITIANAVFGSDPPISPDVLTK  437

Query  362  AFRLDKKTI  388
            AF++    +
Sbjct  438  AFQVGNDVL  446



>ref|XP_010051708.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
Length=251

 Score =   177 bits (449),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 107/137 (78%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPH HP  TEV+ V+EGTLLV FV+S+ LN   N LF+K
Sbjct  114  PGLNTLGISMARIDFAPGGLNPPHNHPHGTEVLIVVEGTLLVGFVTSDQLN---NTLFTK  170

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             +  GD F+F +GL+HF  N+G T AL FS+FSSQNPG +T+AN+ FG+ PPIS DVLTK
Sbjct  171  VIYKGDVFVFSIGLIHFQLNIGNTYALAFSSFSSQNPGLITIANAVFGAKPPISADVLTK  230

Query  362  AFRLDKKTINYLQSQTW  412
            AF+L+KK + YL++Q W
Sbjct  231  AFQLNKKVVEYLEAQFW  247



>ref|XP_007140907.1| hypothetical protein PHAVU_008G151200g [Phaseolus vulgaris]
 ref|XP_007140912.1| hypothetical protein PHAVU_008G151500g [Phaseolus vulgaris]
 gb|ESW12901.1| hypothetical protein PHAVU_008G151200g [Phaseolus vulgaris]
 gb|ESW12906.1| hypothetical protein PHAVU_008G151500g [Phaseolus vulgaris]
Length=220

 Score =   176 bits (446),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 105/137 (77%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR TE++ V+EGTL V FV+SN      N+LF+K
Sbjct  83   PGLNTLGISLARIDFAPKGLNPPHTHPRGTEILIVVEGTLYVGFVTSNQ---DGNRLFTK  139

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  NVG  NA+  +  SSQNPG +T+AN+ F S PPIS +VLTK
Sbjct  140  VLNKGDVFVFPIGLIHFQLNVGYGNAVAIAGLSSQNPGTITIANALFKSDPPISPEVLTK  199

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DK TI+YLQ Q+W
Sbjct  200  AFQVDKSTIDYLQKQSW  216



>ref|XP_007030278.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10780.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=476

 Score =   183 bits (464),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 109/138 (79%), Gaps = 5/138 (4%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFA-RNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFS  178
            PGLNT+G+S+AR+DFA   GL PPHTHPRATE++ VLEGTL V FV+SNP     N+L +
Sbjct  339  PGLNTLGVSLARVDFAPYGGLNPPHTHPRATEILVVLEGTLYVGFVTSNP----DNRLIT  394

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K L PGD F+FP+GL+HF  N+G+TNA+ F+AF SQNPG +T+A + FGS PPI+ DVLT
Sbjct  395  KVLYPGDVFVFPVGLIHFQLNIGKTNAVAFAAFGSQNPGVITIAKAVFGSNPPINPDVLT  454

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF+LDK  + YLQSQ W
Sbjct  455  KAFQLDKNVVKYLQSQFW  472


 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 108/139 (78%), Gaps = 5/139 (4%)
 Frame = +2

Query  5    GLNTMGLSIARIDFA-RNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            GLNT+G+S+ARID+A   GL PPHTHPRA+E++ VLEGTL V FV+SNP    +N+L +K
Sbjct  90   GLNTLGISLARIDYAPYGGLNPPHTHPRASEILVVLEGTLYVGFVTSNP----ENRLITK  145

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP+GL+HF  N+G+TNA+ F+  SSQNPG +T+A + FGS PPI+ DVLTK
Sbjct  146  VLYPGDVFVFPVGLIHFQLNIGKTNAVAFAGLSSQNPGVITIAKAVFGSNPPINPDVLTK  205

Query  362  AFRLDKKTINYLQSQTWPL  418
            AF+LDK  +  LQS+  P+
Sbjct  206  AFQLDKNIVTSLQSRLQPI  224



>ref|XP_010027136.1| PREDICTED: uncharacterized protein LOC104417584 [Eucalyptus grandis]
Length=492

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 108/137 (79%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR +E++ V EGTLLV FV+ N LN   N  F+K
Sbjct  84   PGLNTLGISMARIDFAPGGLNPPHTHPRGSEILVVAEGTLLVGFVTFNQLN---NTFFTK  140

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  N+G+T AL F+A SSQNPG +T+ANS FGS PPIS DVLTK
Sbjct  141  VLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANSVFGSKPPISADVLTK  200

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQ+Q W
Sbjct  201  AFQVDKKVVDYLQAQFW  217


 Score =   178 bits (451),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 106/136 (78%), Gaps = 3/136 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+AR DFA  GL PPHTHPR TE++ V EGTLLV FV+SN LN   N  F+K 
Sbjct  356  GLNTLGISMARTDFAPGGLNPPHTHPRGTEILVVTEGTLLVGFVTSNQLN---NTFFTKV  412

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  N+G+T AL F+A SSQNPG +T+AN+ FGS PPIS  VLTKA
Sbjct  413  LYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGLITIANAVFGSKPPISAGVLTKA  472

Query  365  FRLDKKTINYLQSQTW  412
            F++DKK ++YLQ+Q W
Sbjct  473  FQVDKKVVDYLQAQFW  488



>ref|XP_009357348.1| PREDICTED: germin-like protein subfamily 1 member 13 [Pyrus x 
bretschneideri]
Length=226

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 105/137 (77%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S AR+DFA NGL PPHTHPRATE++ VLEG+L V FV+SN      N+LF+K
Sbjct  89   PGLNTLGISFARLDFAPNGLNPPHTHPRATEILIVLEGSLYVGFVTSN---ADGNRLFTK  145

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  NVG+TNAL     SSQNPG +T+AN+ FGS P I+ DVL K
Sbjct  146  VLYKGDVFVFPVGLIHFQLNVGKTNALAIGGLSSQNPGVITIANAVFGSNPHINPDVLAK  205

Query  362  AFRLDKKTINYLQSQTW  412
            AF++D+K ++YLQ Q W
Sbjct  206  AFQVDEKEVDYLQKQFW  222



>ref|XP_010659820.1| PREDICTED: germin-like protein 3 isoform X1 [Vitis vinifera]
Length=190

 Score =   175 bits (443),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 106/137 (77%), Gaps = 4/137 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ RID+A  G  PPHTHPRATE++ VLEGTLLV FV+SN     +N+L SK
Sbjct  54   PGLNTLGISMVRIDYAPYGQNPPHTHPRATEILVVLEGTLLVGFVTSN----NENRLISK  109

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF +NVG+TNA+ F+  SSQNPG +T+AN+ FGS PPI  DVLT+
Sbjct  110  VLYKGDVFVFPIGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPIDPDVLTR  169

Query  362  AFRLDKKTINYLQSQTW  412
            AF+LD+  +  LQS+ W
Sbjct  170  AFQLDEDVVKDLQSRFW  186



>ref|XP_011013026.1| PREDICTED: germin-like protein subfamily 1 member 16 [Populus 
euphratica]
Length=228

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 108/138 (78%), Gaps = 2/138 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFA-RNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFS  178
            PGLNT+G+S+ RID+A   GL PPHTHPRATE++ V+EGTL V F++SN   G  N+L +
Sbjct  87   PGLNTLGISLVRIDYAPHGGLNPPHTHPRATEILLVVEGTLYVGFLTSNLAKG-GNRLIT  145

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K L PGD F+FP+GL+HF  NVG+TNA+ F++ SSQNPG +T+AN+ FG+ PP++ +VLT
Sbjct  146  KVLNPGDVFVFPVGLIHFQLNVGKTNAVAFASLSSQNPGVITIANAVFGADPPMNPNVLT  205

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF LDKK + YLQ Q W
Sbjct  206  KAFHLDKKLVEYLQKQIW  223



>ref|XP_011034307.1| PREDICTED: germin-like protein subfamily 1 member 16 [Populus 
euphratica]
Length=229

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 108/138 (78%), Gaps = 2/138 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFA-RNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFS  178
            PGLNT+G+S+ RID+A   GL PPHTHPRATE++ V+EGTL V F++SN   G  N+L +
Sbjct  88   PGLNTLGISLVRIDYAPHGGLNPPHTHPRATEILLVVEGTLYVGFLTSNLAKG-GNRLIT  146

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K L PGD F+FP+GL+HF  NVG+TNA+ F++ SSQNPG +T+AN+ FG+ PP++ +VLT
Sbjct  147  KVLNPGDVFVFPVGLIHFQLNVGKTNAVAFASLSSQNPGVITIANAVFGADPPMNPNVLT  206

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF LDKK + YLQ Q W
Sbjct  207  KAFHLDKKLVEYLQKQIW  224



>gb|EPS67173.1| hypothetical protein M569_07603 [Genlisea aurea]
Length=220

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 104/135 (77%), Gaps = 4/135 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+++ARIDFA +GL PPH HPRA+E + VLEG L V FV+SNP     NKLF+K
Sbjct  89   PGLNTLGVAMARIDFAPHGLNPPHVHPRASEALLVLEGNLYVGFVTSNP----DNKLFAK  144

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
            TL PGD F+FP GL+HF  NVG TNA+  +   SQNPG +T+AN+ FGS PPI+ DVL K
Sbjct  145  TLCPGDVFVFPQGLIHFQLNVGSTNAVAIATLGSQNPGVITVANAVFGSQPPINPDVLVK  204

Query  362  AFRLDKKTINYLQSQ  406
            AF++DK  I+YLQ+Q
Sbjct  205  AFQVDKSVISYLQAQ  219



>ref|XP_007030273.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10775.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=224

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 108/138 (78%), Gaps = 5/138 (4%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFA-RNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFS  178
            PGLNT+G+S+ RID+A   GL PPHTHPR TE++ V+EGTL V FV+SNP    +N+LF+
Sbjct  89   PGLNTLGISLVRIDYAPYGGLNPPHTHPRGTEILVVVEGTLYVGFVTSNP----ENRLFT  144

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K L PGD F+FP+GL+HF +N+G+T A+ F+  SSQN G +T+AN+ FGS PPI+ DVLT
Sbjct  145  KVLYPGDVFVFPIGLIHFQFNIGKTEAVAFAGLSSQNAGVITIANAVFGSDPPINPDVLT  204

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF+LDK  + YLQS+ W
Sbjct  205  KAFQLDKNMVAYLQSRFW  222



>ref|XP_007030289.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10791.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=221

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 108/136 (79%), Gaps = 5/136 (4%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFA-RNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFS  178
            PGLNT+G+S+ARID+A   GL PPHTHPRATE++ V +GTL V FV+SNP     NK F+
Sbjct  89   PGLNTLGISLARIDYAPYGGLNPPHTHPRATEILAVKKGTLYVGFVTSNP----DNKFFT  144

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K LK GD F+FP+GL+HF +N+G+TNA+ F+  SSQNPG +T+AN+ FGS PPI+ DVL 
Sbjct  145  KILKTGDVFVFPVGLIHFQFNIGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPDVLA  204

Query  359  KAFRLDKKTINYLQSQ  406
            KAF+LDKK + +LQ+Q
Sbjct  205  KAFKLDKKVVEFLQTQ  220



>ref|XP_009402557.1| PREDICTED: putative germin-like protein 2-1 [Musa acuminata subsp. 
malaccensis]
Length=222

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 106/135 (79%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ RID+  NGL PPHTHPRATE++ V+EG LLV FV+SN  +G  N+LF+K
Sbjct  85   PGLNTLGISMVRIDYIPNGLNPPHTHPRATEILTVIEGQLLVGFVTSNSDDG--NRLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             LK GD F+FP GL+HF +N G TN     A SSQNPG +T+A++ FGS PPIS ++L K
Sbjct  143  MLKKGDVFVFPQGLIHFQFNPGHTNTFAIGALSSQNPGTITIADAVFGSNPPISDEILAK  202

Query  362  AFRLDKKTINYLQSQ  406
            AF++DKKTI++LQ+Q
Sbjct  203  AFQVDKKTIDWLQAQ  217



>ref|XP_004291649.1| PREDICTED: germin-like protein subfamily 1 member 11-like [Fragaria 
vesca subsp. vesca]
Length=230

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 107/138 (78%), Gaps = 5/138 (4%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLL-PPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFS  178
            PGLNT+G+S+ARID+A NG L PPHTHPRA+EV+ VLEGTL V FV+SNP     NKL S
Sbjct  93   PGLNTLGISLARIDYAPNGGLNPPHTHPRASEVLVVLEGTLYVGFVTSNP----DNKLIS  148

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K L  GD F+FP+GL+HF  N+G  NA+  +A SSQNPG +T+AN+ FG+ PPI+ DVL+
Sbjct  149  KVLNKGDVFVFPVGLIHFQLNIGPVNAVALAALSSQNPGVITIANAVFGANPPINPDVLS  208

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF++D+K + YLQ Q W
Sbjct  209  KAFQVDEKLVEYLQKQFW  226



>emb|CBI36791.3| unnamed protein product [Vitis vinifera]
Length=225

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 106/137 (77%), Gaps = 4/137 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ RID+A  G  PPHTHPRATE++ VLEGTLLV FV+SN     +N+L SK
Sbjct  89   PGLNTLGISMVRIDYAPYGQNPPHTHPRATEILVVLEGTLLVGFVTSN----NENRLISK  144

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF +NVG+TNA+ F+  SSQNPG +T+AN+ FGS PPI  DVLT+
Sbjct  145  VLYKGDVFVFPIGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPIDPDVLTR  204

Query  362  AFRLDKKTINYLQSQTW  412
            AF+LD+  +  LQS+ W
Sbjct  205  AFQLDEDVVKDLQSRFW  221



>ref|XP_007143989.1| hypothetical protein PHAVU_007G119700g [Phaseolus vulgaris]
 gb|ESW15983.1| hypothetical protein PHAVU_007G119700g [Phaseolus vulgaris]
Length=224

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 103/136 (76%), Gaps = 3/136 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDFA  GL PPHTHPR TE++ VLEGTL V FV+SN      N+LF+K 
Sbjct  86   GLNTLGISLARIDFAPKGLNPPHTHPRGTEILVVLEGTLYVGFVASNQ---NDNRLFTKV  142

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  NVG  NA+  +  SSQNPG +T+AN+ FGS PPIS ++L KA
Sbjct  143  LNKGDVFVFPIGLIHFQQNVGYGNAVAIAGLSSQNPGVITIANAVFGSKPPISDEILAKA  202

Query  365  FRLDKKTINYLQSQTW  412
            F++DK TI+YLQ Q W
Sbjct  203  FQVDKNTIDYLQKQFW  218



>ref|XP_008237522.1| PREDICTED: germin-like protein subfamily 1 member 11 isoform 
X1 [Prunus mume]
Length=229

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 104/136 (76%), Gaps = 3/136 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDFA NGL PPHTHPRATE++ VLEGTL V FV+SN   G  N+LF+K 
Sbjct  93   GLNTLGISLARIDFAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSN---GDGNRLFTKV  149

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  NVG  NA+ F+  SSQNPG +T+AN+ FGS P I+ DVL KA
Sbjct  150  LNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPLINPDVLAKA  209

Query  365  FRLDKKTINYLQSQTW  412
            F++D K ++ LQ Q W
Sbjct  210  FQVDDKVVDNLQKQFW  225



>ref|XP_008443754.1| PREDICTED: germin-like protein subfamily 1 member 17 [Cucumis 
melo]
Length=223

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 105/135 (78%), Gaps = 5/135 (4%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARID+A NGL PPHTHPRATE++ V+EGTLLV FV+SNP     NKLF+K
Sbjct  91   PGLNTLGISLARIDYAPNGLNPPHTHPRATEILVVVEGTLLVGFVTSNP-----NKLFTK  145

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF +NVG   AL F+  SSQNPG +T+AN+ FGS PPIS DVLTK
Sbjct  146  VLNKGDVFVFPVGLIHFQFNVGHYPALAFAGLSSQNPGVITIANAVFGSDPPISIDVLTK  205

Query  362  AFRLDKKTINYLQSQ  406
            AF++D   I+ L  Q
Sbjct  206  AFQVDNNVIHALMKQ  220



>ref|XP_007143990.1| hypothetical protein PHAVU_007G119700g [Phaseolus vulgaris]
 gb|ESW15984.1| hypothetical protein PHAVU_007G119700g [Phaseolus vulgaris]
Length=228

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 103/136 (76%), Gaps = 3/136 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDFA  GL PPHTHPR TE++ VLEGTL V FV+SN      N+LF+K 
Sbjct  90   GLNTLGISLARIDFAPKGLNPPHTHPRGTEILVVLEGTLYVGFVASNQ---NDNRLFTKV  146

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  NVG  NA+  +  SSQNPG +T+AN+ FGS PPIS ++L KA
Sbjct  147  LNKGDVFVFPIGLIHFQQNVGYGNAVAIAGLSSQNPGVITIANAVFGSKPPISDEILAKA  206

Query  365  FRLDKKTINYLQSQTW  412
            F++DK TI+YLQ Q W
Sbjct  207  FQVDKNTIDYLQKQFW  222



>ref|XP_004301229.1| PREDICTED: germin-like protein subfamily 1 member 7-like [Fragaria 
vesca subsp. vesca]
Length=209

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 107/137 (78%), Gaps = 3/137 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLL-PPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            GLNT+G+S+ARID+A NG L PPHTHPRA+E + V+EGTL V FV+SN  NG  NKLF+K
Sbjct  71   GLNTLGISLARIDYAPNGGLNPPHTHPRASEFLVVMEGTLYVGFVTSNSDNG--NKLFTK  128

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP+GL+HF +N+G+ NA+  +  SSQNPG +T+AN+ FGS PPI  DVLTK
Sbjct  129  VLYPGDVFVFPVGLIHFQFNIGKVNAVAIAGLSSQNPGVITIANAVFGSKPPIKLDVLTK  188

Query  362  AFRLDKKTINYLQSQTW  412
            AF+++   + YLQ+Q W
Sbjct  189  AFQVESNVVEYLQNQFW  205



>ref|XP_008237524.1| PREDICTED: germin-like protein subfamily 1 member 11 isoform 
X2 [Prunus mume]
Length=228

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 104/136 (76%), Gaps = 3/136 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDFA NGL PPHTHPRATE++ VLEGTL V FV+SN   G  N+LF+K 
Sbjct  92   GLNTLGISLARIDFAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSN---GDGNRLFTKV  148

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  NVG  NA+ F+  SSQNPG +T+AN+ FGS P I+ DVL KA
Sbjct  149  LNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPLINPDVLAKA  208

Query  365  FRLDKKTINYLQSQTW  412
            F++D K ++ LQ Q W
Sbjct  209  FQVDDKVVDNLQKQFW  224



>ref|XP_010024915.1| PREDICTED: putative germin-like protein 2-1 [Eucalyptus grandis]
Length=223

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 105/137 (77%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+++AR+DFA  GL PPH HPR TE++ V+EGTL V FV+SN LN   N LF+K
Sbjct  86   PGLNTLGIAMARLDFAPYGLNPPHIHPRGTEMLVVVEGTLYVGFVTSNQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  N+G+ NAL F+  SSQNPG +T+ANS FGS P I+ DVLTK
Sbjct  143  VLTKGDVFVFPQGLIHFQLNIGQANALAFAFLSSQNPGLITIANSVFGSKPLINVDVLTK  202

Query  362  AFRLDKKTINYLQSQTW  412
            AF++D K INYLQ+Q W
Sbjct  203  AFQVDNKLINYLQAQNW  219



>gb|KCW61437.1| hypothetical protein EUGRSUZ_H04167 [Eucalyptus grandis]
Length=222

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 105/137 (77%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+++AR+DFA  GL PPH HPR TE++ V+EGTL V FV+SN LN   N LF+K
Sbjct  85   PGLNTLGIAMARLDFAPYGLNPPHIHPRGTEMLVVVEGTLYVGFVTSNQLN---NTLFTK  141

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  N+G+ NAL F+  SSQNPG +T+ANS FGS P I+ DVLTK
Sbjct  142  VLTKGDVFVFPQGLIHFQLNIGQANALAFAFLSSQNPGLITIANSVFGSKPLINVDVLTK  201

Query  362  AFRLDKKTINYLQSQTW  412
            AF++D K INYLQ+Q W
Sbjct  202  AFQVDNKLINYLQAQNW  218



>ref|NP_001236994.1| uncharacterized protein LOC100527249 precursor [Glycine max]
 gb|ACU16305.1| unknown [Glycine max]
Length=221

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 105/137 (77%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARID+A  GL PPHTHPR TE++ VLEGTL V FV+SN      N+LF+K
Sbjct  83   PGLNTLGISLARIDYAPKGLNPPHTHPRGTEILIVLEGTLYVGFVTSN---QDGNRLFTK  139

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GLVHF  NVG  NA+  +  SSQNPG +T+AN+ F + PPIS +VLTK
Sbjct  140  VLNKGDVFVFPIGLVHFQLNVGYGNAVAIAGLSSQNPGTITIANALFKANPPISPEVLTK  199

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DK TI+YLQ Q+W
Sbjct  200  AFQVDKSTIDYLQKQSW  216



>ref|XP_007200157.1| hypothetical protein PRUPE_ppa016753mg [Prunus persica]
 gb|EMJ01356.1| hypothetical protein PRUPE_ppa016753mg [Prunus persica]
Length=226

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 103/136 (76%), Gaps = 3/136 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDFA NGL PPHTHPRATE++ VLEGTL V FV+SN   G  N+LF+K 
Sbjct  90   GLNTLGISLARIDFAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSN---GDGNRLFTKV  146

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  NVG  NA+ F+  SSQNPG +T+A + FGS PPI+ DVL KA
Sbjct  147  LNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIAKAVFGSQPPINPDVLAKA  206

Query  365  FRLDKKTINYLQSQTW  412
            F++D   ++ LQ Q W
Sbjct  207  FQVDDNVVDNLQKQFW  222



>ref|XP_009402547.1| PREDICTED: putative germin-like protein 2-1 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009402548.1| PREDICTED: putative germin-like protein 2-1 isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009402549.1| PREDICTED: putative germin-like protein 2-1 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=221

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 103/136 (76%), Gaps = 4/136 (3%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ RID+   GL PPHTHPRATE++ V+EG LLV FV+SN      N+LF+K 
Sbjct  85   GLNTLGISMVRIDYGPKGLNPPHTHPRATEILTVIEGQLLVGFVTSN----TDNRLFTKM  140

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            LK GD F+FP GL+HF +N G  N +   A SSQNPG +T+AN+ FGS PPIS DVL KA
Sbjct  141  LKKGDVFVFPEGLIHFQFNPGNCNTIAIGALSSQNPGTITIANAVFGSKPPISDDVLAKA  200

Query  365  FRLDKKTINYLQSQTW  412
            F++DKKTI++LQ+Q W
Sbjct  201  FQVDKKTIDWLQAQFW  216



>gb|KCW61443.1| hypothetical protein EUGRSUZ_H04174 [Eucalyptus grandis]
Length=222

 Score =   174 bits (442),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 105/137 (77%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+++AR+DFA  GL PPH HPR TE++ V+EGTL V FV+SN LN   N LF+K
Sbjct  85   PGLNTLGITMARLDFAPYGLNPPHIHPRGTEMLVVVEGTLYVGFVTSNQLN---NTLFTK  141

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  N+G+ NAL F+  SSQNPG +T+ANS FGS P I+ DVLTK
Sbjct  142  VLTKGDVFVFPQGLIHFQLNIGQANALAFAFLSSQNPGLITIANSVFGSKPLINVDVLTK  201

Query  362  AFRLDKKTINYLQSQTW  412
            AF++D K INYLQ+Q W
Sbjct  202  AFQVDNKLINYLQAQNW  218



>ref|XP_007201862.1| hypothetical protein PRUPE_ppa020162mg [Prunus persica]
 gb|EMJ03061.1| hypothetical protein PRUPE_ppa020162mg [Prunus persica]
Length=226

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 103/136 (76%), Gaps = 3/136 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDFA NGL PPHTHPRATE++ VLEGTL V FV+SN   G  N+LF+K 
Sbjct  90   GLNTLGISLARIDFAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSN---GDGNRLFTKV  146

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  NVG  NA+ F+  SSQNPG +T+A + FGS PPI+ DVL KA
Sbjct  147  LNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIAKAVFGSQPPINPDVLAKA  206

Query  365  FRLDKKTINYLQSQTW  412
            F++D   ++ LQ Q W
Sbjct  207  FQVDDNVVDNLQKQFW  222



>gb|KCW61436.1| hypothetical protein EUGRSUZ_H04166, partial [Eucalyptus grandis]
Length=216

 Score =   174 bits (442),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 105/134 (78%), Gaps = 3/134 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+AR DFA  GL PPHTHPR TE++ V EGTLLV FV+SN LN   N  F+K 
Sbjct  85   GLNTLGISMARTDFAPGGLNPPHTHPRGTEILVVTEGTLLVGFVTSNQLN---NTFFTKV  141

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  N+G+T AL F+A SSQNPG +T+AN+ FGS PPIS  VLTKA
Sbjct  142  LYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGLITIANAVFGSKPPISAGVLTKA  201

Query  365  FRLDKKTINYLQSQ  406
            F++DKK ++YLQ+Q
Sbjct  202  FQVDKKVVDYLQAQ  215



>ref|XP_008780761.1| PREDICTED: germin-like protein 8-5, partial [Phoenix dactylifera]
Length=148

 Score =   172 bits (436),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 106/137 (77%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+DFA  G+ PPH HPR TE++ VLEGTL V FV+SN  N   N+LF+K
Sbjct  10   PGLNTLGISLARLDFAPYGVNPPHIHPRGTEILTVLEGTLHVGFVTSNNPN---NQLFTK  66

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF +N G+TNA+  +  SSQNPG +T+AN+ FG+ PPIS  VL K
Sbjct  67   VLNKGDVFVFPQGLIHFQFNYGKTNAVAIAGLSSQNPGVITIANAVFGAKPPISDYVLAK  126

Query  362  AFRLDKKTINYLQSQTW  412
            AF+LDKKT+++LQ+Q W
Sbjct  127  AFQLDKKTVDWLQAQFW  143



>ref|XP_008393146.1| PREDICTED: germin-like protein subfamily 1 member 11 [Malus domestica]
Length=225

 Score =   174 bits (442),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 105/136 (77%), Gaps = 4/136 (3%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDFA NGL PPHTHPR TE++F+ EGTL V FV+SNP     N+LF+K 
Sbjct  90   GLNTLGISLARIDFAPNGLNPPHTHPRGTEILFLQEGTLYVGFVTSNP----NNRLFTKV  145

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  NVG T+A+  +  SSQNPG +T+AN+ FG+ PPI+ DVL KA
Sbjct  146  LNKGDVFVFPVGLIHFQLNVGHTSAVAIAGLSSQNPGVITIANAVFGANPPINPDVLAKA  205

Query  365  FRLDKKTINYLQSQTW  412
            F++D K ++YLQ Q W
Sbjct  206  FQVDDKLVSYLQKQFW  221



>gb|ACG69479.1| germin-like protein 3 [Glycine max]
 gb|KHN10834.1| Germin-like protein subfamily 1 member 7 [Glycine soja]
Length=221

 Score =   174 bits (441),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 105/137 (77%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARID+A  GL PPHTHPR TE++ VLEGTL V FV+SN      N+LF+K
Sbjct  83   PGLNTLGISLARIDYAPKGLNPPHTHPRGTEILIVLEGTLYVGFVTSN---QDGNRLFTK  139

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  NVG  NA+  +  SSQNPG +T+AN+ F + PPIS +VLTK
Sbjct  140  VLNKGDVFVFPIGLIHFQLNVGYGNAVAIAGLSSQNPGTITIANALFKANPPISPEVLTK  199

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DK TI+YLQ Q+W
Sbjct  200  AFQVDKSTIDYLQKQSW  216



>emb|CAN70904.1| hypothetical protein VITISV_032927 [Vitis vinifera]
Length=196

 Score =   173 bits (439),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 105/135 (78%), Gaps = 4/135 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+D+A  GL PPHTH RATE++ VLEGTL V FV+SNP     N+L +K
Sbjct  65   PGLNTLGISLARVDYAPYGLNPPHTHLRATEILTVLEGTLYVGFVTSNP----DNRLIAK  120

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  NVG+T A+  +A SSQNPG +T+AN+ FGS P IS DVLTK
Sbjct  121  VLYKGDVFVFPEGLIHFHLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTK  180

Query  362  AFRLDKKTINYLQSQ  406
            AF++DKK ++YLQSQ
Sbjct  181  AFQVDKKVVDYLQSQ  195



>emb|CAB65370.1| germin-like protein [Pisum sativum]
Length=195

 Score =   173 bits (439),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 103/136 (76%), Gaps = 3/136 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDFA  GL PPH HPR TE++ VLEGTL V FV+SN     KN+LF+K 
Sbjct  59   GLNTLGISLARIDFAPKGLNPPHIHPRGTEILTVLEGTLYVGFVTSNQ---DKNRLFTKV  115

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  NVG  NA+  +  SSQNPG +T+AN+ F S PPIS +VLTKA
Sbjct  116  LNKGDVFVFPIGLIHFQLNVGYGNAVAIAGLSSQNPGVITIANALFKSNPPISDEVLTKA  175

Query  365  FRLDKKTINYLQSQTW  412
            F++DK  I+YLQ QTW
Sbjct  176  FQVDKSIIDYLQGQTW  191



>gb|AFK49577.1| unknown [Lotus japonicus]
Length=220

 Score =   174 bits (440),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 102/137 (74%), Gaps = 4/137 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFAR GL PPH+HPR TE++ VLEGTL V FV+SNP    +N+L +K
Sbjct  84   PGLNTLGISLARIDFARKGLNPPHSHPRGTEILIVLEGTLYVGFVTSNP----ENRLITK  139

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  NVG  NA   +  SSQNPG  T+AN+ FGS P IS  VLTK
Sbjct  140  VLNKGDVFVFPIGLIHFQLNVGYGNAAAIAGLSSQNPGVTTIANAVFGSDPSISSQVLTK  199

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DK  ++YLQ Q W
Sbjct  200  AFQVDKNVVDYLQKQFW  216



>gb|KCW44232.1| hypothetical protein EUGRSUZ_L02342, partial [Eucalyptus grandis]
Length=218

 Score =   174 bits (440),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 106/136 (78%), Gaps = 3/136 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G++ AR+DFA  GL PPH HPR TE++ V+EGTL V FV+SN LN   N LF+K
Sbjct  86   PGLNTLGIATARLDFAPYGLNPPHIHPRGTEMLLVVEGTLHVGFVTSNQLN---NTLFTK  142

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  N+G+TNAL F+  SSQNPG +T+AN+ FGS PPI+ DVLTK
Sbjct  143  VLTKGDVFVFPQGLIHFQLNIGQTNALAFAFLSSQNPGLITIANTVFGSKPPINVDVLTK  202

Query  362  AFRLDKKTINYLQSQT  409
            AF++D K INYLQ+Q+
Sbjct  203  AFQVDNKLINYLQAQS  218



>ref|XP_003590904.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 gb|AES61155.1| germin family protein [Medicago truncatula]
 gb|AFK44678.1| unknown [Medicago truncatula]
Length=222

 Score =   174 bits (440),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 103/136 (76%), Gaps = 3/136 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+AR+DFA  GL PPHTHPR TE++ VLEGTL V FVSSN  N   N+LF+K 
Sbjct  86   GLNTLGISLARVDFAPKGLNPPHTHPRGTEILVVLEGTLYVGFVSSNQDN---NRLFTKV  142

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  NVG   A+  +  SSQNPG +T+AN+ FGS PPIS +VLTKA
Sbjct  143  LNKGDVFVFPIGLIHFQLNVGYGEAIAIAGLSSQNPGVITIANAVFGSKPPISLEVLTKA  202

Query  365  FRLDKKTINYLQSQTW  412
            F++DK  I+YLQ Q W
Sbjct  203  FQVDKNVIDYLQKQFW  218



>ref|XP_008363404.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
1 member 11 [Malus domestica]
Length=225

 Score =   174 bits (441),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 103/137 (75%), Gaps = 4/137 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+ +S+ RIDFA NGL PPHTHPR TE++F+ EGTL V FV+SNP     N+LF+K
Sbjct  89   PGLNTLSISLVRIDFAPNGLNPPHTHPRGTEILFLQEGTLYVGFVTSNP----DNRLFTK  144

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  NVG TNA+  S  SSQNPG +T+AN+ FG+ PPI+ DVL K
Sbjct  145  VLNKGDVFVFPVGLIHFQLNVGHTNAVAISGLSSQNPGVITIANAVFGANPPINPDVLAK  204

Query  362  AFRLDKKTINYLQSQTW  412
            AF+++ K + YLQ Q W
Sbjct  205  AFQVEBKLVTYLQKQFW  221



>emb|CAN74828.1| hypothetical protein VITISV_002139 [Vitis vinifera]
Length=186

 Score =   172 bits (437),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 105/136 (77%), Gaps = 4/136 (3%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ RID+A  G  PPHTHPRATE++ VLEGTLLV FV+SN     +N+L SK 
Sbjct  51   GLNTLGISMVRIDYAPYGQNPPHTHPRATEILVVLEGTLLVGFVTSN----NENRLISKV  106

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF +NVG+TNA+ F+  SSQNPG +T+AN+ FGS PPI  DVLT+A
Sbjct  107  LYKGDVFVFPIGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPIDPDVLTRA  166

Query  365  FRLDKKTINYLQSQTW  412
            F+LD+  +  LQS+ W
Sbjct  167  FQLDEDVVKDLQSRFW  182



>ref|XP_004142552.1| PREDICTED: germin-like protein subfamily 1 member 17-like [Cucumis 
sativus]
 ref|XP_004155680.1| PREDICTED: germin-like protein subfamily 1 member 17-like [Cucumis 
sativus]
 gb|KGN66715.1| Rhicadhesin receptor [Cucumis sativus]
Length=224

 Score =   174 bits (440),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 105/135 (78%), Gaps = 5/135 (4%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARID+A  GL PPHTHPRATE++ V+EGTLLV FV+SNP     NKLF+K
Sbjct  92   PGLNTLGISLARIDYAPYGLNPPHTHPRATEILVVVEGTLLVGFVTSNP-----NKLFTK  146

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF +NVG + AL F+  SSQNPG +T+AN+ FGS PPIS DVLTK
Sbjct  147  VLNKGDVFVFPIGLIHFQFNVGHSPALAFAGLSSQNPGVITIANAVFGSDPPISIDVLTK  206

Query  362  AFRLDKKTINYLQSQ  406
            AF++D   I+ L  Q
Sbjct  207  AFQVDNNVIHALMKQ  221



>ref|XP_010251866.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score =   173 bits (439),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 105/137 (77%), Gaps = 4/137 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARID+A  GL P H HPRAT+V+ VLEGTL VSFV+SN      N+LF+K
Sbjct  86   PGLNTLGISMARIDYAPYGLNPLHMHPRATKVLVVLEGTLYVSFVTSN----LDNRLFTK  141

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF +NVG TNA+ F+  SSQNPG +T+AN+ F + PPI  DVL K
Sbjct  142  VLNKGDVFVFPKGLIHFQFNVGHTNAVAFAGLSSQNPGTITIANAVFEAKPPIKNDVLAK  201

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQ+Q W
Sbjct  202  AFQVDKKVVDYLQAQFW  218



>gb|KDP23768.1| hypothetical protein JCGZ_23601 [Jatropha curcas]
Length=229

 Score =   174 bits (440),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 106/136 (78%), Gaps = 6/136 (4%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLL-PPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFS  178
            PGLNT+G+S+ARID+A NG L PPHTHPRATE++ V+EGTL V FV+SNP     N+L S
Sbjct  95   PGLNTLGISLARIDYAPNGGLNPPHTHPRATEILVVVEGTLYVGFVTSNP-----NRLIS  149

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K L PGD F+FP+GL+HF  N+ +TNA+ F+  SSQNPG +T+AN+ FG  PPI+ DVLT
Sbjct  150  KVLYPGDVFVFPIGLIHFQMNIAKTNAVAFAGLSSQNPGVITIANALFGPKPPINPDVLT  209

Query  359  KAFRLDKKTINYLQSQ  406
            +AF+LDK  + YLQ Q
Sbjct  210  RAFQLDKNVVGYLQKQ  225



>gb|KCW76698.1| hypothetical protein EUGRSUZ_D01058, partial [Eucalyptus grandis]
Length=189

 Score =   172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 104/137 (76%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+++A +DFA  GL PPH HPR TE++ V+EGTL V FV+SN LN   N LF+K
Sbjct  52   PGLNTLGIAMAHLDFAPYGLNPPHIHPRGTEMLVVVEGTLYVGFVTSNQLN---NTLFTK  108

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  N+G+ NAL F+  SSQNPG +T+ANS FGS P I+ DVLTK
Sbjct  109  VLTKGDVFVFPQGLIHFQLNIGQANALAFAFLSSQNPGLITIANSVFGSKPLINVDVLTK  168

Query  362  AFRLDKKTINYLQSQTW  412
            AF++D K INYLQ+Q W
Sbjct  169  AFQVDNKLINYLQAQNW  185



>ref|XP_007140901.1| hypothetical protein PHAVU_008G1508000g, partial [Phaseolus vulgaris]
 gb|ESW12895.1| hypothetical protein PHAVU_008G1508000g, partial [Phaseolus vulgaris]
Length=164

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 112/157 (71%), Gaps = 3/157 (2%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ARIDFA  GL PPHTHPR TE++ V+EGTL V FV+SN      N+LF+K
Sbjct  9    PGLNTLGISLARIDFAPKGLNPPHTHPRGTEILIVVEGTLYVGFVTSNQ---DGNRLFTK  65

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF  NVG  NA+  +A SSQNPG +T+AN+ F + P IS +VLTK
Sbjct  66   VLNKGDVFVFPIGLIHFQLNVGYDNAVAIAALSSQNPGTITIANALFKANPSISPEVLTK  125

Query  362  AFRLDKKTINYLQSQTWPLI*YSTSMLLLLIIIFELY  472
            AF++DK  I+YLQ Q W  + ++  + L   +  +L+
Sbjct  126  AFQVDKTIIDYLQKQLWLYLMFAAILTLTKYVTCDLF  162



>emb|CAN74480.1| hypothetical protein VITISV_042844 [Vitis vinifera]
Length=192

 Score =   172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 105/137 (77%), Gaps = 4/137 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ RID+A  G  PPHTHPRATE++ VLEGTLLV FV+SN     +N+L SK
Sbjct  56   PGLNTLGISMVRIDYAPYGQNPPHTHPRATEILVVLEGTLLVGFVTSN----NENRLISK  111

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF +NVG+T A+ F+  SSQNPG +T+AN+ FGS PPI  DVLT+
Sbjct  112  VLYKGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPPIDPDVLTR  171

Query  362  AFRLDKKTINYLQSQTW  412
            AF+LD+  +  LQS+ W
Sbjct  172  AFQLDEDVVKDLQSRFW  188



>gb|ADD71877.1| germin-like protein subfamily 1 member 1 precursor [Arachis hypogaea]
Length=223

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 102/136 (75%), Gaps = 2/136 (1%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDF   GL PPHTHPRATE++ V+EGTLLV FV+SN  N   N+LF+K 
Sbjct  86   GLNTLGISLARIDFGPKGLNPPHTHPRATEILIVIEGTLLVGFVTSNQNN--TNRLFTKV  143

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  N+G  NA   +  SSQNPG +T+AN+ FGS PPIS ++L KA
Sbjct  144  LNKGDVFVFPIGLIHFQSNIGYGNAFAIAGLSSQNPGVITIANAVFGSTPPISPEILAKA  203

Query  365  FRLDKKTINYLQSQTW  412
            F++D   INYLQ Q W
Sbjct  204  FQVDNNVINYLQKQFW  219



>ref|XP_002281186.2| PREDICTED: uncharacterized protein LOC100244552 [Vitis vinifera]
Length=478

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 106/135 (79%), Gaps = 4/135 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+D+A  GL PPHTHPRATE++ VLEGTL V FV+SNP     N+L SK
Sbjct  347  PGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLISK  402

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  NVG+T A+  +A SSQNPG +T+AN+ FGS P IS DVLTK
Sbjct  403  VLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTK  462

Query  362  AFRLDKKTINYLQSQ  406
            AF++DKK ++YLQSQ
Sbjct  463  AFQVDKKVVDYLQSQ  477


 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 103/137 (75%), Gaps = 4/137 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            P LNT+G+S+AR+D+A  GL PPHT+PRATE++ VLEGTL V FV+SNP     N+L SK
Sbjct  74   PELNTLGISLARVDYAPYGLNPPHTYPRATEILTVLEGTLYVGFVTSNP----DNRLISK  129

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD FIF  GL+HF  NV +T A+  +A SSQN G +T+AN+ FGS P IS DVLTK
Sbjct  130  VLYKGDVFIFLEGLIHFQLNVRKTKAVAIAALSSQNLGVITIANAVFGSKPAISADVLTK  189

Query  362  AFRLDKKTINYLQSQTW  412
            AF++DKK ++YLQSQ W
Sbjct  190  AFQVDKKVVDYLQSQFW  206



>ref|XP_006375870.1| germin-like protein 1 [Populus trichocarpa]
 gb|ERP53667.1| germin-like protein 1 [Populus trichocarpa]
Length=225

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 104/138 (75%), Gaps = 5/138 (4%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFA-RNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFS  178
            PGLNT+G+S+ RID+A   GL PPHTHPRATE++ VLEGTL V FV+SNP     N+L +
Sbjct  88   PGLNTLGISLVRIDYAPYGGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLIT  143

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K L PGD F+FP+GL+HF +NVG+T A    A SSQNPG +T+AN+ FGS PPI  DVL 
Sbjct  144  KVLHPGDVFVFPVGLIHFQFNVGKTKASAIGALSSQNPGVITIANAVFGSTPPIRSDVLA  203

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF++DK  +++LQ Q W
Sbjct  204  KAFQVDKNIVDFLQKQFW  221



>ref|XP_002265447.3| PREDICTED: uncharacterized protein LOC100242782 [Vitis vinifera]
Length=450

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 106/135 (79%), Gaps = 4/135 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+D+A  GL PPHTHPRATE++ VLEGTL V FV+SNP     N+L SK
Sbjct  319  PGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLISK  374

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  NVG+T A+  +A SSQNPG +T+AN+ FGS P IS DVLTK
Sbjct  375  VLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTK  434

Query  362  AFRLDKKTINYLQSQ  406
            AF++DKK ++YLQSQ
Sbjct  435  AFQVDKKVVDYLQSQ  449


 Score =   164 bits (415),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 100/135 (74%), Gaps = 4/135 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            P L T+G+S+AR+D+A  GL PPHTHPR TE++  LEGTL V FV+SNP     N+L SK
Sbjct  53   PDLKTLGISLARVDYAPYGLNPPHTHPRDTEILTFLEGTLYVGFVTSNP----DNRLISK  108

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP  L+HF  NV +T A+  +A SSQNPG +T+AN+ FGS P IS DVLTK
Sbjct  109  VLYKGDVFVFPEDLIHFQLNVEKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTK  168

Query  362  AFRLDKKTINYLQSQ  406
            AF++DKK ++YLQSQ
Sbjct  169  AFQVDKKVVDYLQSQ  183



>ref|XP_010907049.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein 8-2 [Elaeis 
guineensis]
Length=224

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 106/135 (79%), Gaps = 4/135 (3%)
 Frame = +2

Query  8    LNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKTL  187
            LNT+G+S+AR+DFA  GL PPHTHPR TE++ VLEGTL V FV+SNP     N+LF+K L
Sbjct  89   LNTLGISLARLDFAPYGLNPPHTHPRGTEILVVLEGTLYVGFVTSNP----NNQLFTKVL  144

Query  188  KPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKAF  367
              GD F+FP GL+HF +N G+T+A+ F+  SSQN G +T+AN+ FG+ PPIS +VL KAF
Sbjct  145  HEGDVFVFPQGLIHFQFNNGKTSAVAFAGLSSQNLGVITIANAVFGAMPPISDEVLAKAF  204

Query  368  RLDKKTINYLQSQTW  412
            +LDKKT+++LQ+Q W
Sbjct  205  QLDKKTVDWLQAQLW  219



>ref|XP_002265297.3| PREDICTED: uncharacterized protein LOC100247931 [Vitis vinifera]
Length=490

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 106/135 (79%), Gaps = 4/135 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+D+A  GL PPHTHPRATE++ VLEGTL V FV+SNP     N+L SK
Sbjct  90   PGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLISK  145

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  NVG+T A+  +A SSQNPG +T+AN+ FGS P IS DVLTK
Sbjct  146  VLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTK  205

Query  362  AFRLDKKTINYLQSQ  406
            AF++DKK ++YLQSQ
Sbjct  206  AFQVDKKVVDYLQSQ  220


 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 104/135 (77%), Gaps = 4/135 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+D+A  GL PPHTHPRATE++ VLEGTL V FV+SNP     N+L  K
Sbjct  359  PGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLICK  414

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD FIFP GL+HF  NVG+T A+  +A SSQNPG +T+AN+ FGS P IS DVLTK
Sbjct  415  VLYKGDVFIFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTK  474

Query  362  AFRLDKKTINYLQSQ  406
            AF++DK  ++YLQSQ
Sbjct  475  AFQVDKNVVDYLQSQ  489



>ref|XP_009402551.1| PREDICTED: putative germin-like protein 2-1 [Musa acuminata subsp. 
malaccensis]
Length=217

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 104/134 (78%), Gaps = 2/134 (1%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ RID+A  GL  PHTHPRATE++ V+EG LLV FV+SN  +G  N+LF+K 
Sbjct  85   GLNTLGISMVRIDYAPRGLNAPHTHPRATEILTVIEGQLLVGFVTSNSDDG--NRLFTKM  142

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            LK GD F+FP GL+HF +N G T  +   A SSQNPG +T+AN+ FGS PPIS DVL KA
Sbjct  143  LKKGDVFVFPQGLIHFQFNPGHTKTIAIGALSSQNPGTITIANAVFGSKPPISDDVLAKA  202

Query  365  FRLDKKTINYLQSQ  406
            F++DKKTI++LQ+Q
Sbjct  203  FQVDKKTIDWLQAQ  216



>ref|XP_008381868.1| PREDICTED: germin-like protein subfamily 1 member 11 [Malus domestica]
Length=185

 Score =   171 bits (434),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 103/136 (76%), Gaps = 4/136 (3%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ARIDFA NGL PPHTHPR TE++F+ EGTL V FV+SNP     N+LF+K 
Sbjct  50   GLNTLGISLARIDFAPNGLNPPHTHPRGTEILFLQEGTLYVGFVTSNP----DNRLFTKV  105

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            L  GD F+FP+GL+HF  NVG   A+  +  SSQNPG +T+AN+ FG+ PPI+ DVL KA
Sbjct  106  LNKGDVFVFPVGLIHFQLNVGHXXAVAIAGLSSQNPGVITIANAVFGANPPINPDVLAKA  165

Query  365  FRLDKKTINYLQSQTW  412
            F++D K ++YLQ Q W
Sbjct  166  FQVDDKLVSYLQKQFW  181



>ref|XP_004290344.1| PREDICTED: germin-like protein subfamily 1 member 18-like [Fragaria 
vesca subsp. vesca]
Length=230

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 106/137 (77%), Gaps = 3/137 (2%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLL-PPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            GLNT+G+S+ARID+A NG L PPHTHPRA+E + V+EGTL V FV+SN  NG  NKLF+K
Sbjct  92   GLNTLGISLARIDYAPNGGLNPPHTHPRASEFLVVMEGTLYVGFVTSNTDNG--NKLFTK  149

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L PGD F+FP+GL+HF +N+G+  A+  +  SSQNPG +T+AN+ FGS PPI  DVLTK
Sbjct  150  VLYPGDVFVFPVGLIHFQFNIGKVKAVAIAGLSSQNPGAITIANAVFGSKPPIKFDVLTK  209

Query  362  AFRLDKKTINYLQSQTW  412
            AF++D   + YLQ+Q W
Sbjct  210  AFQVDNNVVQYLQNQFW  226



>ref|XP_009402550.1| PREDICTED: putative germin-like protein 2-1 [Musa acuminata subsp. 
malaccensis]
Length=217

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 104/134 (78%), Gaps = 2/134 (1%)
 Frame = +2

Query  5    GLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSKT  184
            GLNT+G+S+ RID+A  GL  PHTHPRATE++ V+EG LLV FV+SN  +G  N+LF+K 
Sbjct  85   GLNTLGISMVRIDYAPRGLNAPHTHPRATEILTVIEGQLLVGFVTSNTDDG--NRLFTKM  142

Query  185  LKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTKA  364
            LK GD F+FP GL+HF +N G T  +   A SSQNPG +T+AN+ FGS PPIS DVL KA
Sbjct  143  LKKGDVFVFPQGLIHFQFNPGHTKTIAIGALSSQNPGTITIANAVFGSKPPISDDVLAKA  202

Query  365  FRLDKKTINYLQSQ  406
            F++DKKTI++LQ+Q
Sbjct  203  FQVDKKTIDWLQAQ  216



>ref|XP_006375871.1| hypothetical protein POPTR_0013s04880g, partial [Populus trichocarpa]
 gb|ERP53668.1| hypothetical protein POPTR_0013s04880g, partial [Populus trichocarpa]
Length=221

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 103/138 (75%), Gaps = 5/138 (4%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFA-RNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFS  178
            PGLNT+G+S+ RID+A   GL PPHTHPRATE++ VLEGTL V FV+SNP     N+L +
Sbjct  84   PGLNTLGISLVRIDYAPYGGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLIT  139

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K L PGD F+FP+GL+HF +NVG+T A    A SSQNPG +T+ N+ FGS PPI  DVL 
Sbjct  140  KVLHPGDVFVFPVGLIHFQFNVGKTKASAIGALSSQNPGVITITNAVFGSTPPIRSDVLA  199

Query  359  KAFRLDKKTINYLQSQTW  412
            KAF++DK  ++YLQ Q W
Sbjct  200  KAFQVDKNLVDYLQKQFW  217



>ref|XP_009402555.1| PREDICTED: putative germin-like protein 2-2 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=203

 Score =   172 bits (435),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 104/135 (77%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ RID+   GL PPHTHP ATE+V V+EG L V FV+SN  +G  N+LF+K
Sbjct  70   PGLNTLGISMVRIDYVPKGLNPPHTHPPATEIVTVIEGQLFVGFVTSNGEDG--NRLFTK  127

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             LK GD F+FP GL+HF +N G TN +   A SSQNPG +T+A++ FGS PPIS DVL K
Sbjct  128  MLKKGDVFVFPQGLIHFQFNPGHTNTVAIGALSSQNPGTITIADAVFGSKPPISDDVLAK  187

Query  362  AFRLDKKTINYLQSQ  406
            AF++DKKT+++LQ+Q
Sbjct  188  AFQVDKKTVDWLQAQ  202



>ref|XP_009402552.1| PREDICTED: germin-like protein 12-2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=217

 Score =   172 bits (436),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 104/135 (77%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ RID+   GL PPHTHP ATE+V V+EG L V FV+SN  +G  N+LF+K
Sbjct  84   PGLNTLGISMVRIDYVPKGLNPPHTHPPATEIVTVIEGQLFVGFVTSNGEDG--NRLFTK  141

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             LK GD F+FP GL+HF +N G TN +   A SSQNPG +T+A++ FGS PPIS DVL K
Sbjct  142  MLKKGDVFVFPQGLIHFQFNPGHTNTVAIGALSSQNPGTITIADAVFGSKPPISDDVLAK  201

Query  362  AFRLDKKTINYLQSQ  406
            AF++DKKT+++LQ+Q
Sbjct  202  AFQVDKKTVDWLQAQ  216



>ref|XP_009402556.1| PREDICTED: putative germin-like protein 2-2 isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=196

 Score =   171 bits (434),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 104/135 (77%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ RID+   GL PPHTHP ATE+V V+EG L V FV+SN  +G  N+LF+K
Sbjct  63   PGLNTLGISMVRIDYVPKGLNPPHTHPPATEIVTVIEGQLFVGFVTSNGEDG--NRLFTK  120

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             LK GD F+FP GL+HF +N G TN +   A SSQNPG +T+A++ FGS PPIS DVL K
Sbjct  121  MLKKGDVFVFPQGLIHFQFNPGHTNTVAIGALSSQNPGTITIADAVFGSKPPISDDVLAK  180

Query  362  AFRLDKKTINYLQSQ  406
            AF++DKKT+++LQ+Q
Sbjct  181  AFQVDKKTVDWLQAQ  195



>ref|XP_010662282.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=192

 Score =   171 bits (434),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 104/137 (76%), Gaps = 4/137 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+AR+D+A  GL PPHTHPRATE++ VLEGTL V FV+SNP     N+L SK
Sbjct  54   PGLNTLGVSLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLISK  109

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP GL+HF  NVG TNA+  ++ SSQNPG +T+A++ FGS P IS DVLTK
Sbjct  110  VLYKGDLFVFPQGLIHFQLNVGTTNAVAIASLSSQNPGVITIASAVFGSKPAISVDVLTK  169

Query  362  AFRLDKKTINYLQSQTW  412
            AF+LDK  +  LQSQ W
Sbjct  170  AFQLDKNVVANLQSQFW  186



>ref|XP_011099650.1| PREDICTED: germin-like protein subfamily 1 member 13 [Sesamum 
indicum]
Length=231

 Score =   172 bits (437),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 106/138 (77%), Gaps = 1/138 (1%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLN-GQKNKLFS  178
            PGLNT+G+SI RIDFA NG+ PPH HPRA+E++ VL+G L   F+++NP N   KNKLF+
Sbjct  90   PGLNTLGISIVRIDFAPNGVNPPHEHPRASEILVVLKGKLYAGFITTNPPNPNHKNKLFA  149

Query  179  KTLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLT  358
            K LKPGD+F+FP GL+HF YNVG+T+A+  ++ +SQNPG +T+  + FGS PP+  DVL 
Sbjct  150  KILKPGDAFVFPKGLIHFQYNVGKTSAVAIASLNSQNPGIMTIPKAVFGSEPPVRADVLV  209

Query  359  KAFRLDKKTINYLQSQTW  412
            K+F++ +K + YLQS  W
Sbjct  210  KSFQVREKLVEYLQSLPW  227



>emb|CBI36790.3| unnamed protein product [Vitis vinifera]
Length=207

 Score =   172 bits (435),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 105/135 (78%), Gaps = 4/135 (3%)
 Frame = +2

Query  2    PGLNTMGLSIARIDFARNGLLPPHTHPRATEVVFVLEGTLLVSFVSSNPLNGQKNKLFSK  181
            PGLNT+G+S+ RID+A  G  PPHTHPRATE++ VLEGTLLV FV+SNP    +N+LFSK
Sbjct  76   PGLNTLGISLVRIDYAPYGQNPPHTHPRATEILTVLEGTLLVGFVTSNP----QNRLFSK  131

Query  182  TLKPGDSFIFPMGLVHFLYNVGRTNALLFSAFSSQNPGYVTLANSAFGSAPPISQDVLTK  361
             L  GD F+FP+GL+HF +N+G  NA+  +  SSQNPG +T+AN+ FGS PPI+ D L K
Sbjct  132  VLNKGDVFVFPIGLIHFQFNIGHMNAVAIAGLSSQNPGVITIANAVFGSNPPINPDFLAK  191

Query  362  AFRLDKKTINYLQSQ  406
            AF+LDKK + +LQ++
Sbjct  192  AFQLDKKVVEFLQAR  206



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1129260521844