BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19094_g1_i3 len=891 path=[1196:0-47 119:48-127 1321:128-234
1428:235-237 307:238-890]

Length=891
                                                                      Score     E

ref|XP_009621515.1|  PREDICTED: uncharacterized protein LOC104113120    239   8e-75   
ref|XP_006359347.1|  PREDICTED: uncharacterized protein LOC102580121    225   2e-69   
ref|XP_009776937.1|  PREDICTED: uncharacterized protein LOC104226604    224   6e-69   
ref|XP_004236812.1|  PREDICTED: uncharacterized protein LOC101255190    223   1e-68   
ref|XP_009758804.1|  PREDICTED: uncharacterized protein LOC104211441    223   2e-68   
ref|XP_006378677.1|  hypothetical protein POPTR_0010s19970g             214   6e-65   
ref|XP_011035999.1|  PREDICTED: uncharacterized protein LOC105133624    202   1e-60   
ref|XP_002526861.1|  conserved hypothetical protein                     202   2e-60   Ricinus communis
gb|KHG28537.1|  Periostin                                               201   6e-60   
ref|XP_002279437.1|  PREDICTED: uncharacterized protein LOC100244380    201   6e-60   Vitis vinifera
ref|XP_010037353.1|  PREDICTED: uncharacterized protein LOC104426105    201   6e-60   
ref|XP_008441441.1|  PREDICTED: uncharacterized protein LOC103485559    198   8e-59   
emb|CDP14055.1|  unnamed protein product                                197   3e-58   
ref|XP_004138432.1|  PREDICTED: uncharacterized protein LOC101206202    196   4e-58   
ref|XP_007014313.1|  Fasciclin domain-containing protein, putativ...    196   5e-58   
ref|XP_007141789.1|  hypothetical protein PHAVU_008G225800g             195   1e-57   
gb|KDP44820.1|  hypothetical protein JCGZ_01320                         193   2e-57   
ref|XP_009351454.1|  PREDICTED: uncharacterized protein LOC103942989    190   6e-55   
ref|XP_006595873.1|  PREDICTED: uncharacterized protein LOC100779091    187   1e-54   
ref|XP_008392923.1|  PREDICTED: uncharacterized protein LOC103455105    188   3e-54   
ref|XP_010256626.1|  PREDICTED: uncharacterized protein LOC104596980    184   3e-53   
ref|XP_008233723.1|  PREDICTED: uncharacterized protein LOC103332749    180   6e-52   
ref|XP_004490957.1|  PREDICTED: uncharacterized protein LOC101494335    179   2e-51   
ref|XP_006435680.1|  hypothetical protein CICLE_v10032806mg             177   8e-51   
gb|KDO69081.1|  hypothetical protein CISIN_1g039722mg                   177   1e-50   
ref|XP_006435681.1|  hypothetical protein CICLE_v10032806mg             177   1e-50   
ref|XP_010095066.1|  hypothetical protein L484_026374                   175   6e-50   
ref|XP_010690009.1|  PREDICTED: uncharacterized protein LOC104903636    173   5e-49   
ref|XP_003616579.1|  Fasciclin-like domain-containing protein           171   2e-48   
ref|XP_008813635.1|  PREDICTED: uncharacterized protein LOC103724222    165   1e-46   
ref|XP_011085134.1|  PREDICTED: uncharacterized protein LOC105167209    159   8e-44   
ref|XP_010943934.1|  PREDICTED: uncharacterized protein LOC105061...    156   9e-43   
ref|XP_009416186.1|  PREDICTED: uncharacterized protein LOC103996871    157   1e-42   
gb|EYU41264.1|  hypothetical protein MIMGU_mgv1a026175mg                152   2e-41   
ref|XP_010534568.1|  PREDICTED: uncharacterized protein LOC104810077    149   6e-40   
ref|NP_191141.1|  Fasciclin-like arabinogalactan family protein         149   8e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009116279.1|  PREDICTED: uncharacterized protein LOC103841488    143   1e-37   
ref|XP_010504452.1|  PREDICTED: uncharacterized protein LOC104781471    143   1e-37   
ref|XP_006403415.1|  hypothetical protein EUTSA_v10010736mg             141   8e-37   
emb|CDX72199.1|  BnaC08g26750D                                          140   1e-36   
emb|CDY27263.1|  BnaA09g35390D                                          140   1e-36   
ref|XP_002876337.1|  hypothetical protein ARALYDRAFT_907015             140   1e-36   
ref|XP_006379621.1|  hypothetical protein POPTR_0008s06530g             134   1e-34   
ref|XP_010427382.1|  PREDICTED: uncharacterized protein LOC104712...    133   9e-34   
ref|XP_010516171.1|  PREDICTED: uncharacterized protein LOC104791874    133   1e-33   
ref|XP_006848129.1|  hypothetical protein AMTR_s00029p00222940          135   3e-33   
ref|XP_006291866.1|  hypothetical protein CARUB_v10018041mg             129   3e-32   
gb|EMT12989.1|  hypothetical protein F775_02982                         132   5e-32   
gb|EPS69008.1|  hypothetical protein M569_05771                         127   1e-31   
ref|XP_003561841.1|  PREDICTED: uncharacterized protein LOC100826626    127   2e-31   
ref|XP_004987085.1|  PREDICTED: uncharacterized protein LOC101771764    127   4e-31   
ref|XP_006651204.1|  PREDICTED: uncharacterized protein LOC102715561    124   3e-30   
gb|AFW89067.1|  hypothetical protein ZEAMMB73_925141                    123   1e-29   
ref|NP_001142563.1|  uncharacterized protein LOC100274822               121   4e-29   Zea mays [maize]
ref|XP_002465583.1|  hypothetical protein SORBIDRAFT_01g041590          115   7e-27   Sorghum bicolor [broomcorn]
gb|EMS68779.1|  hypothetical protein TRIUR3_30410                       115   4e-26   
ref|NP_001173339.1|  Os03g0237950                                       106   3e-24   
gb|KHN13078.1|  hypothetical protein glysoja_037520                     103   1e-23   
gb|EEE58663.1|  hypothetical protein OsJ_10075                          106   1e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007218376.1|  hypothetical protein PRUPE_ppa011304mg           70.5    4e-11   
ref|XP_002975821.1|  hypothetical protein SELMODRAFT_442972           52.0    7e-05   
ref|XP_002973772.1|  hypothetical protein SELMODRAFT_442211           52.8    2e-04   



>ref|XP_009621515.1| PREDICTED: uncharacterized protein LOC104113120 [Nicotiana tomentosiformis]
Length=200

 Score =   239 bits (611),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 151/193 (78%), Gaps = 2/193 (1%)
 Frame = +1

Query  124  RRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKSTSKDA-K  300
            RRG    DP+KF+CVLVS VFTF+L +S+LK+HE+P+   N I S G  K+K     A  
Sbjct  3    RRGHFPKDPIKFVCVLVSTVFTFVLCLSVLKLHEIPVGTSNTINSSGVTKVKMNPLAAGA  62

Query  301  VGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGFSA  480
            +GK G MVI MLP DLGFTLFLPSE+AFERDLGL  NE L  EK +DT+A+LTRVLGFSA
Sbjct  63   IGKLGEMVIGMLPRDLGFTLFLPSEKAFERDLGLGPNE-LVGEKGNDTYAILTRVLGFSA  121

Query  481  LPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVVHVMNG  660
            +PR I+ ++V  G+EI YDS+SG+ L I KDS GSL+VN + SEMVDLRRGKIVVHVM+G
Sbjct  122  VPRAINSDDVQLGKEIDYDSISGYILYISKDSDGSLIVNRIASEMVDLRRGKIVVHVMDG  181

Query  661  VLMDAEFEQSVRP  699
            V+MD+EFEQSVRP
Sbjct  182  VIMDSEFEQSVRP  194



>ref|XP_006359347.1| PREDICTED: uncharacterized protein LOC102580121 [Solanum tuberosum]
Length=193

 Score =   225 bits (573),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/193 (60%), Positives = 150/193 (78%), Gaps = 4/193 (2%)
 Frame = +1

Query  124  RRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKSTSKDAKV  303
            RRG  T DP+KF+C++VSI  TF+L  S+LK++E+P   +N ++    KK +       V
Sbjct  3    RRGHFTKDPIKFLCIVVSIACTFVLCFSVLKLNEIPQGNEN-VIDLKLKKNRIDGGRGVV  61

Query  304  GKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGFSAL  483
            GKFG +VI MLP+DLGFTLFLPSE+AFERDLGLRL+E+   E  ++T+A+LTRVLGFSA+
Sbjct  62   GKFGEIVIGMLPQDLGFTLFLPSEKAFERDLGLRLDEN---ENENNTYAILTRVLGFSAV  118

Query  484  PRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVVHVMNGV  663
            P  I+ ++V  G+EI YDS+SG+T+ + KDS G L+VN + SEMVDLRRGKIVVHVM+GV
Sbjct  119  PARIYADDVQVGKEIDYDSISGYTVYVSKDSDGLLIVNRIASEMVDLRRGKIVVHVMDGV  178

Query  664  LMDAEFEQSVRPD  702
            +MD EFEQSVRPD
Sbjct  179  IMDPEFEQSVRPD  191



>ref|XP_009776937.1| PREDICTED: uncharacterized protein LOC104226604 [Nicotiana sylvestris]
Length=196

 Score =   224 bits (571),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 149/193 (77%), Gaps = 6/193 (3%)
 Frame = +1

Query  124  RRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIK-STSKDAK  300
            RRG    DP+KF+CVLVS VF F L +S+LK+ E+P+   NAI   G KK+K + +    
Sbjct  3    RRG----DPIKFVCVLVSSVFAFALCLSVLKLDEIPVGTSNAINLSGVKKLKVNPTAAGG  58

Query  301  VGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGFSA  480
            +GK G +VI MLP+DLGFTLFLPSE+AFERDLGL  N+ L  E  +DT+A+LTRV+GFSA
Sbjct  59   IGKLGEVVIGMLPQDLGFTLFLPSEKAFERDLGLGPND-LVGENGNDTYAILTRVMGFSA  117

Query  481  LPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVVHVMNG  660
            +PR I+ ++V  G+EI YDS+SG+ L I KDS GSL+VN + SEMVDLRRGKIVVHVM+G
Sbjct  118  VPRAINSDDVQLGKEIDYDSISGYILYISKDSDGSLIVNRIASEMVDLRRGKIVVHVMDG  177

Query  661  VLMDAEFEQSVRP  699
            V+MD+EFE SVRP
Sbjct  178  VIMDSEFEHSVRP  190



>ref|XP_004236812.1| PREDICTED: uncharacterized protein LOC101255190 [Solanum lycopersicum]
Length=192

 Score =   223 bits (568),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 149/195 (76%), Gaps = 9/195 (5%)
 Frame = +1

Query  124  RRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKSTSKDAK-  300
            RRG  T DP+KF+ ++VSI  TF+L  S+LK++E+    +N I    G K+K    D   
Sbjct  3    RRGHFTNDPIKFLYIVVSIACTFVLCFSVLKLNEITQGNENVI----GLKLKKNRLDGGR  58

Query  301  -VGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGFS  477
             +GKFG +VI MLP+DLGFTLFLPSEEAFERDLGLRL E+   E  +DT+A+LTRVLGFS
Sbjct  59   GIGKFGEIVIGMLPQDLGFTLFLPSEEAFERDLGLRLGEN---ENENDTYAILTRVLGFS  115

Query  478  ALPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVVHVMN  657
            A+PR I+ ++V  G+EI YDS+SG+T+ I K+S G L+VN + SEMVDLRRGKIVVHVM+
Sbjct  116  AVPRRIYADDVQVGKEIDYDSISGYTVYISKESDGLLIVNRIASEMVDLRRGKIVVHVMD  175

Query  658  GVLMDAEFEQSVRPD  702
            GV+MD EFEQSVRPD
Sbjct  176  GVIMDPEFEQSVRPD  190



>ref|XP_009758804.1| PREDICTED: uncharacterized protein LOC104211441 [Nicotiana sylvestris]
Length=196

 Score =   223 bits (567),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 149/193 (77%), Gaps = 6/193 (3%)
 Frame = +1

Query  124  RRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIK-STSKDAK  300
            RRG    DP+KF+CVLVS VF F+L +S+LK+ E+ +   NAI   G KK+K + +    
Sbjct  3    RRG----DPIKFVCVLVSSVFAFVLCLSVLKLDEILVGTSNAINLSGVKKLKVNPTAAGG  58

Query  301  VGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGFSA  480
            +GK G +VI MLP+DLGFTLFLPSE+AFERDLGL  N+ L  E  +DT+A+LTRV+GFSA
Sbjct  59   IGKLGEVVIGMLPQDLGFTLFLPSEKAFERDLGLGPND-LVGENGNDTYAILTRVMGFSA  117

Query  481  LPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVVHVMNG  660
            +PR I+  +V  G+EI YDS+SG+ L I KDS GSL+VN + SEMVDLRRGKIVVHVM+G
Sbjct  118  VPRAINSNDVQLGKEIDYDSISGYILYISKDSDGSLIVNRIASEMVDLRRGKIVVHVMDG  177

Query  661  VLMDAEFEQSVRP  699
            V+MD+EFEQSVRP
Sbjct  178  VIMDSEFEQSVRP  190



>ref|XP_006378677.1| hypothetical protein POPTR_0010s19970g [Populus trichocarpa]
 gb|ERP56474.1| hypothetical protein POPTR_0010s19970g [Populus trichocarpa]
Length=198

 Score =   214 bits (544),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 150/200 (75%), Gaps = 3/200 (2%)
 Frame = +1

Query  121  MRRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGK-KIKSTSKDA  297
            MRRG    + + F+ V++S+    ++ +S+L++ E+ L+  N +       +I+  SKD 
Sbjct  1    MRRGCFVKNLIAFVGVVISVCCLLVIMVSVLQLPEVSLR--NEVTGPNRTIRIRKVSKDE  58

Query  298  KVGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGFS  477
            ++G+FG M+IEMLPEDL FT+F+PSE+AF+RDL LRLN+SL  EK +DT+AV++R+LGFS
Sbjct  59   EIGRFGEMMIEMLPEDLAFTVFVPSEKAFQRDLRLRLNDSLVAEKRNDTYAVVSRILGFS  118

Query  478  ALPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVVHVMN  657
            A+P+ +    V S +E+ YDSLSGFTL I KD  G LVVN +RSE VDLRRG+IVVH+M+
Sbjct  119  AVPQTLSSATVSSSKEVFYDSLSGFTLYISKDLDGMLVVNRIRSEKVDLRRGQIVVHIMD  178

Query  658  GVLMDAEFEQSVRPDYSGGD  717
            GV+MDAEFEQ+V+PDY+  D
Sbjct  179  GVIMDAEFEQAVQPDYTEED  198



>ref|XP_011035999.1| PREDICTED: uncharacterized protein LOC105133624 [Populus euphratica]
 ref|XP_011036000.1| PREDICTED: uncharacterized protein LOC105133624 [Populus euphratica]
Length=198

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 147/199 (74%), Gaps = 1/199 (1%)
 Frame = +1

Query  121  MRRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKSTSKDAK  300
            MRRG    + + F+ V++SI    ++ +S+L++ E+ L+ +N        +I+   KD +
Sbjct  1    MRRGYFVKNLIAFVGVVISICCLLVIMVSVLQLPEVSLR-NNVTGPNRTIRIRKVYKDEE  59

Query  301  VGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGFSA  480
            +G+FG M++EMLPEDL FT+F+PSE+AF RDL L LN+SL  EK +DT+A+++R+LGFSA
Sbjct  60   IGRFGEMMLEMLPEDLAFTVFVPSEKAFHRDLRLLLNDSLVAEKRNDTYAIISRILGFSA  119

Query  481  LPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVVHVMNG  660
            +P+ +    V S +E+ YDSLSGFTL I KD  G LVVN +RSE VDLRRG+IVVH+M+G
Sbjct  120  VPQTLSSTTVSSSKEVFYDSLSGFTLYISKDLDGMLVVNRIRSEKVDLRRGQIVVHIMDG  179

Query  661  VLMDAEFEQSVRPDYSGGD  717
            V+MDAEFEQ+V+PDY+  D
Sbjct  180  VIMDAEFEQAVQPDYTEED  198



>ref|XP_002526861.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35492.1| conserved hypothetical protein [Ricinus communis]
Length=197

 Score =   202 bits (514),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 142/188 (76%), Gaps = 1/188 (1%)
 Frame = +1

Query  145  DPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKSTSKDAKVGKFGGMV  324
            +P+ F+ V+VS+    ++ IS+L++ E+ +  +  I  +   K +  SKD  +GKFG ++
Sbjct  9    NPIAFVGVVVSVCCFLVIMISVLRLPEVTVG-NKVIRPYRTFKSRKISKDEGIGKFGDLM  67

Query  325  IEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGFSALPRIIHLE  504
            IEMLPEDL FT+F+PSE+AFERDL LR N+SL  EK +DT+AV++R+LGFSA+PR +   
Sbjct  68   IEMLPEDLAFTVFVPSEKAFERDLRLRANDSLLAEKRNDTYAVVSRILGFSAIPRTLLSA  127

Query  505  NVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVVHVMNGVLMDAEFE  684
             V S +E+ YDSLSGF L + KD+ G L+VN +RSE VD+RR +++VHVM+GV+MDAEFE
Sbjct  128  AVYSNKELFYDSLSGFPLYVSKDADGMLIVNRIRSERVDVRRREVIVHVMDGVIMDAEFE  187

Query  685  QSVRPDYS  708
            QSV+PDY+
Sbjct  188  QSVQPDYT  195



>gb|KHG28537.1| Periostin [Gossypium arboreum]
Length=199

 Score =   201 bits (511),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 133/177 (75%), Gaps = 2/177 (1%)
 Frame = +1

Query  190  FILFISILKIHELPLKKDNAILSWGGKKIKSTSKDAKVGKFGGMVIEMLPEDLGFTLFLP  369
             +L IS+L++ ++    + A+  +    +KS+  D  VG FG M+I+MLPEDL FT+F+P
Sbjct  24   LVLIISMLRVPDVD-TGNGAMSIYDDTSLKSSGNDKSVGSFGNMMIDMLPEDLAFTVFVP  82

Query  370  SEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGFSALPRIIHLENV-VSGEEIRYDSLS  546
            SE AFERDL L  N SL EEK++DT+ V++RVLGFSA+PR++    V + GEE+ YDSLS
Sbjct  83   SETAFERDLRLSANNSLVEEKINDTYVVISRVLGFSAIPRVLDTAMVPIGGEEVSYDSLS  142

Query  547  GFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVVHVMNGVLMDAEFEQSVRPDYSGGD  717
            GF L + KD+ G LVVNGV+SE VD++RGK+VVHVM+GV+MDAEFEQSV PD+ G D
Sbjct  143  GFELFVSKDAGGVLVVNGVKSESVDMKRGKLVVHVMDGVIMDAEFEQSVEPDFDGDD  199



>ref|XP_002279437.1| PREDICTED: uncharacterized protein LOC100244380 [Vitis vinifera]
Length=193

 Score =   201 bits (511),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 148/196 (76%), Gaps = 8/196 (4%)
 Frame = +1

Query  121  MRRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKSTSKDAK  300
            MRRG    D + F+CV+V++    ++ +++L++ E+  ++++AI        +    D  
Sbjct  1    MRRGWCMKDSIAFVCVMVTVCSLMVVIVTMLRLPEVSTRQNSAI--------REGFNDES  52

Query  301  VGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGFSA  480
            +GKFG M++EMLP+DL FT+F+PSE+AF+RDL L++N SLA E+++DT+AVL+RVLGFSA
Sbjct  53   IGKFGEMMLEMLPQDLAFTIFVPSEKAFQRDLRLQVNRSLAAEQMNDTYAVLSRVLGFSA  112

Query  481  LPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVVHVMNG  660
            +PR ++ + ++ G+E+ +DSLSGF L I K+S G+++VN VRS  +D+R+G+IVVH+M+G
Sbjct  113  VPRPLYSKTMLFGKEMCFDSLSGFELCIWKESDGAIIVNRVRSARMDMRKGEIVVHIMDG  172

Query  661  VLMDAEFEQSVRPDYS  708
            V+MD EFEQS + DYS
Sbjct  173  VIMDFEFEQSFQLDYS  188



>ref|XP_010037353.1| PREDICTED: uncharacterized protein LOC104426105 [Eucalyptus grandis]
 gb|KCW49059.1| hypothetical protein EUGRSUZ_K02662 [Eucalyptus grandis]
Length=196

 Score =   201 bits (511),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 141/197 (72%), Gaps = 1/197 (1%)
 Frame = +1

Query  121  MRRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKSTSKDAK  300
            MRRG+   + + F+C +VS+    +L +S L++ E+    D A+ S    K    S++ +
Sbjct  1    MRRGRFAKNSIAFVCTVVSLCCFLVLILSTLRLPEVSSGND-AVGSHRTTKAGKFSENRR  59

Query  301  VGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGFSA  480
            +G FG M++EMLP+DL FT+F+PSE+AF RDL L   ES A E +++T+AV++RVLGFSA
Sbjct  60   LGTFGEMMVEMLPQDLAFTVFVPSEKAFGRDLQLNATESFAAENINNTYAVVSRVLGFSA  119

Query  481  LPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVVHVMNG  660
            +PR++  E V  G+EI YDSLSG+ L I K   G ++VNGV SE +D R+G+IVVH+M+G
Sbjct  120  VPRVLTSETVPVGKEISYDSLSGYALYISKAVNGRIIVNGVESESLDTRKGEIVVHIMDG  179

Query  661  VLMDAEFEQSVRPDYSG  711
            V+MDA+F+QSV+PDY G
Sbjct  180  VIMDADFKQSVQPDYEG  196



>ref|XP_008441441.1| PREDICTED: uncharacterized protein LOC103485559 [Cucumis melo]
Length=198

 Score =   198 bits (504),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 144/200 (72%), Gaps = 12/200 (6%)
 Frame = +1

Query  121  MRRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPL-----KKDNAILSWGGKKIKST  285
            M+R     +P+ F+ +++S+    I+ I+ L++ EL +      +D   L      I+  
Sbjct  1    MKRSFILKNPIAFVFMILSLCCVLIVLITTLRLPELTVGFKTGARDKVSL------IRKV  54

Query  286  SKDAKVGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESL-AEEKVDDTHAVLTR  462
             KD K+GKFG M+IEMLPEDL FT+F+PSE+AFER+L LR+NES  + EK+DDT+AV++R
Sbjct  55   LKDGKLGKFGEMMIEMLPEDLAFTVFIPSEKAFERELSLRVNESFTSTEKMDDTYAVISR  114

Query  463  VLGFSALPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIV  642
            +LGFSA+PR I+   V  G EI YD++SGFTL I KD  G LVVNGVRSEMVDL++  ++
Sbjct  115  ILGFSAVPRTIYSTLVDYGSEISYDAVSGFTLNISKDRDGRLVVNGVRSEMVDLKKKGVL  174

Query  643  VHVMNGVLMDAEFEQSVRPD  702
            VH+M+GV+MDA FEQSV+PD
Sbjct  175  VHIMDGVIMDAAFEQSVKPD  194



>emb|CDP14055.1| unnamed protein product [Coffea canephora]
Length=200

 Score =   197 bits (500),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 143/199 (72%), Gaps = 8/199 (4%)
 Frame = +1

Query  118  KMRRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKSTSKDA  297
            K RRG+   + V F+C ++ +    +LF+S+ ++       D  I S+  +  ++  +  
Sbjct  2    KARRGQFPKNQVAFVCAILCVSCALVLFVSVFRL------PDVTIASFRPENRRAVGRYE  55

Query  298  KVGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGFS  477
            K+GKFG MVIEMLPEDL FT+FLPSE+AFERDL L LN+SL  +K +DT+A+LTRVLGFS
Sbjct  56   KIGKFGEMVIEMLPEDLPFTVFLPSEKAFERDLRLHLNDSLVGDKANDTYAILTRVLGFS  115

Query  478  ALPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRS-EMVDL-RRGKIVVHV  651
            A+PR+I+  NV  G+E+ +DSL+GFTL I + + G LVVN +RS   V L +R KI+VH+
Sbjct  116  AVPRMINSVNVPYGQEVDFDSLAGFTLYISRGADGVLVVNRIRSNNNVGLQQRSKILVHI  175

Query  652  MNGVLMDAEFEQSVRPDYS  708
            M+GV+MDAEFEQSV PDY+
Sbjct  176  MDGVIMDAEFEQSVLPDYN  194



>ref|XP_004138432.1| PREDICTED: uncharacterized protein LOC101206202 [Cucumis sativus]
 ref|XP_004165969.1| PREDICTED: uncharacterized protein LOC101225787 [Cucumis sativus]
 gb|KGN45773.1| hypothetical protein Csa_6G010005 [Cucumis sativus]
Length=198

 Score =   196 bits (499),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 144/199 (72%), Gaps = 10/199 (5%)
 Frame = +1

Query  121  MRRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKK----IKSTS  288
            M+R     +P+ F+ +++S+    I+ I+ L++ EL +      +  G +     I+   
Sbjct  1    MKRSFILKNPIAFVFMILSLCCVLIVLITTLRLPELTVG-----VKAGARDKVSLIRKVL  55

Query  289  KDAKVGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESL-AEEKVDDTHAVLTRV  465
            KD ++GKFG M+IEMLPEDL FT+F+PSE+AFER+L LR+NES  + EK+DDT+AV++R+
Sbjct  56   KDDELGKFGEMMIEMLPEDLAFTVFIPSEKAFERELSLRVNESFTSTEKMDDTYAVISRI  115

Query  466  LGFSALPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVV  645
            LGFSA+PR I+   V  G EI YD++SGFTL I KD  G LVVNGVRSEMVDL++  ++V
Sbjct  116  LGFSAVPRTIYSTLVDYGSEIIYDAVSGFTLNISKDRNGRLVVNGVRSEMVDLKKKDVLV  175

Query  646  HVMNGVLMDAEFEQSVRPD  702
            H+M+GV+MDA FEQSV+PD
Sbjct  176  HIMDGVIMDASFEQSVKPD  194



>ref|XP_007014313.1| Fasciclin domain-containing protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007014314.1| Fasciclin domain-containing protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY31932.1| Fasciclin domain-containing protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY31933.1| Fasciclin domain-containing protein, putative isoform 1 [Theobroma 
cacao]
Length=206

 Score =   196 bits (499),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 139/204 (68%), Gaps = 0/204 (0%)
 Frame = +1

Query  106  N*GQKMRRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKST  285
            N  ++MRRG    + + F+ ++VS+    ++ IS+L + +  L      L      +K +
Sbjct  3    NQQKEMRRGYLFKNSIAFVLLVVSLCCFLVVIISMLNVPDAALGNAAMPLYKNLSILKVS  62

Query  286  SKDAKVGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRV  465
              D  +  FG M+I+MLP+DL FT+F+PSE AF RDL LR NESL  EK++D +AV++RV
Sbjct  63   DNDNPLSTFGNMMIQMLPQDLAFTVFIPSETAFTRDLRLRKNESLVGEKMNDAYAVISRV  122

Query  466  LGFSALPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVV  645
            LGFSA+PRI+    V +G E+  DSLSGFTL + KD  G L+VNGV+SE VD+RRGK VV
Sbjct  123  LGFSAIPRILDSATVPAGGEVSCDSLSGFTLFVSKDVGGVLMVNGVKSERVDIRRGKHVV  182

Query  646  HVMNGVLMDAEFEQSVRPDYSGGD  717
            HVM+GV+MDAEFEQSV PD+   D
Sbjct  183  HVMDGVIMDAEFEQSVEPDFDVDD  206



>ref|XP_007141789.1| hypothetical protein PHAVU_008G225800g [Phaseolus vulgaris]
 gb|ESW13783.1| hypothetical protein PHAVU_008G225800g [Phaseolus vulgaris]
Length=200

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 140/194 (72%), Gaps = 0/194 (0%)
 Frame = +1

Query  121  MRRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKSTSKDAK  300
            MRR +     + ++ +LV +   FI+ +++LK+ + P K+         +  K + KDA 
Sbjct  1    MRRRQVLKHSIAYVSMLVCVCCFFIVTVTVLKLPDAPTKESAMGFYPITRSRKVSPKDAN  60

Query  301  VGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGFSA  480
            +GKFG M+I+MLP+DL FT+F+PSEEAF+RDL L +N++L  ++ +DT+A+LTR+LGFSA
Sbjct  61   LGKFGEMMIDMLPQDLAFTVFVPSEEAFKRDLRLSVNDALKSDRFNDTYAILTRILGFSA  120

Query  481  LPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVVHVMNG  660
            +PR +   NV  GE + YDSLSGF+L I KD  G LVVN +RSE+VD+R+ +IVVH+M+G
Sbjct  121  VPRALSSANVKLGELVNYDSLSGFSLYISKDIDGMLVVNRIRSEIVDVRKKEIVVHLMDG  180

Query  661  VLMDAEFEQSVRPD  702
            V+MDAEFEQSV  D
Sbjct  181  VIMDAEFEQSVLSD  194



>gb|KDP44820.1| hypothetical protein JCGZ_01320 [Jatropha curcas]
Length=156

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 121/154 (79%), Gaps = 0/154 (0%)
 Frame = +1

Query  256  SWGGKKIKSTSKDAKVGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKV  435
            S+   K +  SKD  +G+FG M+IEMLPEDL FT+F+PSE AFERDL LR+N+SL  +K 
Sbjct  3    SYRTIKSRKVSKDEGIGRFGEMMIEMLPEDLAFTVFIPSERAFERDLKLRVNDSLVADKR  62

Query  436  DDTHAVLTRVLGFSALPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEM  615
            +DT+A+++R+LGFSA+PR +    V S +++ YDS+SGFTL I KD  G L+VN +RSE 
Sbjct  63   NDTYAIVSRILGFSAIPRTLSAAMVSSNKDVSYDSISGFTLYITKDVDGMLIVNRIRSER  122

Query  616  VDLRRGKIVVHVMNGVLMDAEFEQSVRPDYSGGD  717
            VD+RR +I+VH+M+GV+MDAEFEQSV+PDY+  D
Sbjct  123  VDIRRREIIVHIMDGVIMDAEFEQSVQPDYAEED  156



>ref|XP_009351454.1| PREDICTED: uncharacterized protein LOC103942989 [Pyrus x bretschneideri]
Length=254

 Score =   190 bits (482),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 136/194 (70%), Gaps = 3/194 (2%)
 Frame = +1

Query  115  QKMRRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKSTSKD  294
            Q M R +   +P+ F+   VSI    IL ISIL++ ++PL      ++    +  S +  
Sbjct  58   QTMSRTRILRNPIVFVFGFVSISCFVILTISILRLPDIPL---GPYVATKASRKASQNDK  114

Query  295  AKVGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGF  474
              +GKFG M +EMLPEDL FT+FLPSE AF RDL LR  +SL+ EK++DT+A+++RVLGF
Sbjct  115  LPIGKFGEMTLEMLPEDLPFTVFLPSERAFARDLRLRWKDSLSPEKMNDTYAIISRVLGF  174

Query  475  SALPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVVHVM  654
            S +PR I  +NV  G+E+ YDS+SGFTL + K+  G++VVNGVRSE VD+RR   VVHVM
Sbjct  175  STVPRSIASDNVPIGKELSYDSISGFTLWLSKEEDGAVVVNGVRSERVDVRRKASVVHVM  234

Query  655  NGVLMDAEFEQSVR  696
            +GV+MDAEF+Q+ +
Sbjct  235  DGVVMDAEFQQAFQ  248



>ref|XP_006595873.1| PREDICTED: uncharacterized protein LOC100779091 [Glycine max]
 gb|KHN20866.1| Hypothetical protein glysoja_009174 [Glycine soja]
Length=200

 Score =   187 bits (475),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 136/191 (71%), Gaps = 0/191 (0%)
 Frame = +1

Query  121  MRRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKSTSKDAK  300
            MR+ +     +  + +LV +   FI+ +++ K+ E P K          +  K + +D  
Sbjct  1    MRKRQVLKHSIAIVSMLVCVCCFFIVSVTVFKLPEAPRKDRQMGFYPTIRSRKVSLQDFN  60

Query  301  VGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGFSA  480
            +GKFG M+I+MLP+DL FT+F+PSE+AF+RDL L +++SL  +K +DT+A++TR+LGFSA
Sbjct  61   LGKFGEMMIDMLPQDLAFTVFVPSEDAFKRDLRLSVSDSLKPDKFNDTYAIVTRILGFSA  120

Query  481  LPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVVHVMNG  660
            +PRI+   NV SGE + YDSLSGF L + KD  G LVVN +RSE+VD+R+ +IVVHVM+G
Sbjct  121  VPRILSSANVQSGELVNYDSLSGFPLYVSKDIDGMLVVNRIRSEIVDVRKKEIVVHVMDG  180

Query  661  VLMDAEFEQSV  693
            V+MDAEFEQSV
Sbjct  181  VIMDAEFEQSV  191



>ref|XP_008392923.1| PREDICTED: uncharacterized protein LOC103455105 [Malus domestica]
Length=249

 Score =   188 bits (478),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 140/196 (71%), Gaps = 7/196 (4%)
 Frame = +1

Query  115  QKMRRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKSTSKD  294
            Q M R +   +P+ F+   VSI    IL ISIL++ ++P+    A      K  + +S++
Sbjct  54   QTMSRTRILRNPIVFVFGFVSISCFLILTISILRLPDIPIGPYAAT-----KTSRKSSQN  108

Query  295  AK--VGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVL  468
             K  +GKFG M +EMLPEDL FT+FLPSE AF RDL LR  +SL+ EK++DT+A+++RVL
Sbjct  109  DKLPIGKFGEMTLEMLPEDLPFTVFLPSERAFARDLRLRWKDSLSPEKMNDTYAIISRVL  168

Query  469  GFSALPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVVH  648
            GFS +PR I  ++V  G+E+ YDS+SGFTL + K+  G+++VNGVRSE VD+RR   VVH
Sbjct  169  GFSTVPRSIASDSVPIGKELSYDSISGFTLWLSKEEDGAVMVNGVRSERVDVRRKASVVH  228

Query  649  VMNGVLMDAEFEQSVR  696
            VM+GV+MDAEF+Q+V+
Sbjct  229  VMDGVVMDAEFQQAVQ  244



>ref|XP_010256626.1| PREDICTED: uncharacterized protein LOC104596980 [Nelumbo nucifera]
 ref|XP_010256627.1| PREDICTED: uncharacterized protein LOC104596980 [Nelumbo nucifera]
 ref|XP_010256628.1| PREDICTED: uncharacterized protein LOC104596980 [Nelumbo nucifera]
Length=205

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 126/172 (73%), Gaps = 0/172 (0%)
 Frame = +1

Query  202  ISILKIHELPLKKDNAILSWGGKKIKSTSKDAKVGKFGGMVIEMLPEDLGFTLFLPSEEA  381
            IS+L++ E+  + + A  S+   K+   S+  ++G+ G +++ MLP+DL FT+F+PSEEA
Sbjct  34   ISMLRLPEVSRESNAAWRSYRALKMGDVSEKKRLGQLGEIMVGMLPDDLAFTVFVPSEEA  93

Query  382  FERDLGLRLNESLAEEKVDDTHAVLTRVLGFSALPRIIHLENVVSGEEIRYDSLSGFTLL  561
            FERDL L  N+SL E+ V+DT + L+R+LGFSA+PR +    +  GEE+ +DS+SGFTL 
Sbjct  94   FERDLRLWANKSLLEQNVNDTQSTLSRLLGFSAVPRSLPSVAIPLGEEVYFDSISGFTLY  153

Query  562  IVKDSKGSLVVNGVRSEMVDLRRGKIVVHVMNGVLMDAEFEQSVRPDYSGGD  717
            I +D +  +V N VRSE VDLR+GKIVVH+MNGV+MD EFEQSVRPDY   D
Sbjct  154  ISRDPEKRIVANRVRSESVDLRKGKIVVHIMNGVIMDNEFEQSVRPDYESED  205



>ref|XP_008233723.1| PREDICTED: uncharacterized protein LOC103332749 [Prunus mume]
Length=196

 Score =   180 bits (457),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 136/197 (69%), Gaps = 7/197 (4%)
 Frame = +1

Query  121  MRRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKSTSKDAK  300
            M R +   +P+ F   +V +    I+ IS+L++ E+PL     +     K  K TS+D  
Sbjct  1    MSRSRILRNPIAFFWWVVLVCCFLIVTISMLRLPEIPL----GLQYPTTKTSKQTSEDDN  56

Query  301  --VGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKV-DDTHAVLTRVLG  471
              +GKFG M++EMLPEDL FT+F+PSEEAFERDL L  N+SL  EK+ DDT+A+++RVLG
Sbjct  57   LSIGKFGKMMLEMLPEDLAFTVFVPSEEAFERDLRLSPNKSLVGEKMNDDTYAIMSRVLG  116

Query  472  FSALPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVVHV  651
            FSA+PR +   NV   +E+ YDS+SGF L I K+  G+L VN VRS+ VDLR+   VVH+
Sbjct  117  FSAVPRRLASVNVPIDKELSYDSISGFVLYISKEEDGALTVNRVRSKRVDLRKKGSVVHI  176

Query  652  MNGVLMDAEFEQSVRPD  702
            M+G +MDAEF+QSV+P+
Sbjct  177  MDGAIMDAEFQQSVQPE  193



>ref|XP_004490957.1| PREDICTED: uncharacterized protein LOC101494335 [Cicer arietinum]
Length=200

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 134/180 (74%), Gaps = 5/180 (3%)
 Frame = +1

Query  169  LVSIVFTFI-LFISILKIHELPLKKDNAILSWGGKKI----KSTSKDAKVGKFGGMVIEM  333
            LV+I+ T   +FI ++  + LP  K+ +    G   I    K++ +D K+GKFG M++EM
Sbjct  13   LVTILVTICCIFIVMVTFYNLPEAKNKSNEKMGFDPITRSRKNSLQDFKLGKFGEMMVEM  72

Query  334  LPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGFSALPRIIHLENVV  513
            LP+DL FT+F+PSEEAF+RDL L LN+SL ++K +DT+A+++RVLGFSA+PR I   ++ 
Sbjct  73   LPQDLAFTIFVPSEEAFKRDLRLSLNDSLKQDKFNDTYAIVSRVLGFSAVPRTICSVDLR  132

Query  514  SGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVVHVMNGVLMDAEFEQSV  693
             GE + YDSLSGF L + KD  G +VVN +RSE+VD+R+ +IVVHV++GV+MDA+FEQSV
Sbjct  133  FGEVVSYDSLSGFPLYVSKDVGGIVVVNRIRSEIVDVRKREIVVHVLDGVIMDADFEQSV  192



>ref|XP_006435680.1| hypothetical protein CICLE_v10032806mg [Citrus clementina]
 ref|XP_006486364.1| PREDICTED: uncharacterized protein LOC102617887 isoform X4 [Citrus 
sinensis]
 gb|ESR48920.1| hypothetical protein CICLE_v10032806mg [Citrus clementina]
Length=174

 Score =   177 bits (448),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 114/140 (81%), Gaps = 0/140 (0%)
 Frame = +1

Query  298  KVGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGFS  477
            ++GKF  M+IEMLPEDL FT+F+PS +AF+R+L L++N+SL  + V++T+A+L+R+LGFS
Sbjct  35   EIGKFAEMMIEMLPEDLAFTIFVPSVKAFDRELKLQVNDSLVGDNVNNTYAILSRILGFS  94

Query  478  ALPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVVHVMN  657
            A+PR +    V  GEEI YDSLSG TL I K S G L+VN V SE +DL++GKIV+H+M+
Sbjct  95   AVPRTLSSIMVPFGEEISYDSLSGLTLYISKSSDGKLLVNRVESERLDLKKGKIVIHIMD  154

Query  658  GVLMDAEFEQSVRPDYSGGD  717
            GV+MDAEFEQSV+PDY+ GD
Sbjct  155  GVIMDAEFEQSVQPDYNEGD  174



>gb|KDO69081.1| hypothetical protein CISIN_1g039722mg [Citrus sinensis]
Length=196

 Score =   177 bits (449),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 114/140 (81%), Gaps = 0/140 (0%)
 Frame = +1

Query  298  KVGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGFS  477
            ++GKF  M+IEMLPEDL FT+F+PS +AF+R+L L++N+SL  + V++T+A+L+R+LGFS
Sbjct  57   EIGKFAEMMIEMLPEDLAFTIFVPSVKAFDRELKLQVNDSLVGDNVNNTYAILSRILGFS  116

Query  478  ALPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVVHVMN  657
            A+PR +    V  GEEI YDSLSG TL I K S G L+VN V SE +DL++GKIV+H+M+
Sbjct  117  AVPRTLSSIMVPFGEEISYDSLSGLTLYISKSSDGKLLVNRVESERLDLKKGKIVIHIMD  176

Query  658  GVLMDAEFEQSVRPDYSGGD  717
            GV+MDAEFEQSV+PDY+ GD
Sbjct  177  GVIMDAEFEQSVQPDYNEGD  196



>ref|XP_006435681.1| hypothetical protein CICLE_v10032806mg [Citrus clementina]
 ref|XP_006486361.1| PREDICTED: uncharacterized protein LOC102617887 isoform X1 [Citrus 
sinensis]
 ref|XP_006486362.1| PREDICTED: uncharacterized protein LOC102617887 isoform X2 [Citrus 
sinensis]
 ref|XP_006486363.1| PREDICTED: uncharacterized protein LOC102617887 isoform X3 [Citrus 
sinensis]
 gb|ESR48921.1| hypothetical protein CICLE_v10032806mg [Citrus clementina]
Length=196

 Score =   177 bits (449),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 114/140 (81%), Gaps = 0/140 (0%)
 Frame = +1

Query  298  KVGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGFS  477
            ++GKF  M+IEMLPEDL FT+F+PS +AF+R+L L++N+SL  + V++T+A+L+R+LGFS
Sbjct  57   EIGKFAEMMIEMLPEDLAFTIFVPSVKAFDRELKLQVNDSLVGDNVNNTYAILSRILGFS  116

Query  478  ALPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVVHVMN  657
            A+PR +    V  GEEI YDSLSG TL I K S G L+VN V SE +DL++GKIV+H+M+
Sbjct  117  AVPRTLSSIMVPFGEEISYDSLSGLTLYISKSSDGKLLVNRVESERLDLKKGKIVIHIMD  176

Query  658  GVLMDAEFEQSVRPDYSGGD  717
            GV+MDAEFEQSV+PDY+ GD
Sbjct  177  GVIMDAEFEQSVQPDYNEGD  196



>ref|XP_010095066.1| hypothetical protein L484_026374 [Morus notabilis]
 gb|EXB58172.1| hypothetical protein L484_026374 [Morus notabilis]
Length=205

 Score =   175 bits (444),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 138/199 (69%), Gaps = 5/199 (3%)
 Frame = +1

Query  121  MRRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKSTSKDAK  300
            M+R +   + + F+ ++V +   F++ IS L++ ++ L+     L       ++   +  
Sbjct  1    MKRDRFMRNSISFVWLVVLVGCLFVILISTLRLPQVQLESMPIGLYRTTNIRQALENENA  60

Query  301  VGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKV-----DDTHAVLTRV  465
            +GKFG M+IEMLPEDL FT+F+PSE AF+RDL L +NESL  EK      DD++A+++RV
Sbjct  61   IGKFGQMMIEMLPEDLAFTVFVPSERAFKRDLRLWVNESLVGEKKGGKMNDDSYAIVSRV  120

Query  466  LGFSALPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVV  645
            LGFSA+PR +  ++V  G+E+ YDS+SGF L I KD  G LVVN VRS+ VD+++ +I+V
Sbjct  121  LGFSAVPRTLVSDDVPFGKEVLYDSISGFVLYISKDVDGMLVVNRVRSQRVDIKKKEIIV  180

Query  646  HVMNGVLMDAEFEQSVRPD  702
            HVM+GV MDAEFE+SV+PD
Sbjct  181  HVMDGVAMDAEFEESVQPD  199



>ref|XP_010690009.1| PREDICTED: uncharacterized protein LOC104903636 [Beta vulgaris 
subsp. vulgaris]
Length=200

 Score =   173 bits (438),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 133/197 (68%), Gaps = 4/197 (2%)
 Frame = +1

Query  121  MRRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKSTSKDAK  300
            M+ GK     +  M +LVS+    ++ +S+  + +L   K    +    K     SK  K
Sbjct  1    MKIGKVFNQLILIMLMLVSLCCMIVVIMSMFTLPDLSTGK----IVESSKMEGRYSKGEK  56

Query  301  VGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGFSA  480
            +GKFG M+IEMLP DL FT+F+PSE+AFERDL LR N+S + E+ D+ +A ++ VLGFSA
Sbjct  57   LGKFGEMMIEMLPNDLAFTVFVPSEKAFERDLRLRANQSFSREEWDNVYATVSHVLGFSA  116

Query  481  LPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVVHVMNG  660
            +PR I+   +  G+++ YDS+SGFTL I K   G LVVN VR+E +D+++GK+VVH+M+G
Sbjct  117  IPRKIYAGLLPRGKDLSYDSVSGFTLYISKGFDGVLVVNRVRAERIDIKKGKVVVHIMDG  176

Query  661  VLMDAEFEQSVRPDYSG  711
            V+MDAEFEQSV P+  G
Sbjct  177  VIMDAEFEQSVLPNDDG  193



>ref|XP_003616579.1| Fasciclin-like domain-containing protein [Medicago truncatula]
 gb|AES99537.1| fasciclin domain protein [Medicago truncatula]
Length=200

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/191 (45%), Positives = 135/191 (71%), Gaps = 3/191 (2%)
 Frame = +1

Query  151  VKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGG--KKIKSTSKDAKVGKFGGMV  324
            +  + +L+++   FI+ I+   + E P  K N  + +    +  K + +D  +GKFG M+
Sbjct  11   IALITILLTVCCIFIIAITFFNLPE-PQNKTNRKMGFDSITRSRKISIQDFNLGKFGEMM  69

Query  325  IEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGFSALPRIIHLE  504
            +EMLP+DL FT+F+PSEEAF+RDL L +N+SL ++K +DT+A+++RVLGFS +PR +   
Sbjct  70   VEMLPQDLAFTVFVPSEEAFKRDLRLSVNDSLKQDKFNDTYAIVSRVLGFSVVPRTLCSV  129

Query  505  NVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVVHVMNGVLMDAEFE  684
            ++  GE + YDSLSGF L + KD  G +VVN ++S++VD+R+ +IVVHV++GV+MDA+FE
Sbjct  130  DLRFGEVVSYDSLSGFPLFVSKDVDGMIVVNRIKSKIVDVRKNEIVVHVLDGVIMDADFE  189

Query  685  QSVRPDYSGGD  717
            QSV  + +  D
Sbjct  190  QSVLSEETQED  200



>ref|XP_008813635.1| PREDICTED: uncharacterized protein LOC103724222 [Phoenix dactylifera]
Length=159

 Score =   165 bits (418),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 110/141 (78%), Gaps = 0/141 (0%)
 Frame = +1

Query  283  TSKDAKVGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTR  462
            +S++ K+G+ G M++ MLP DL FT+F+PSEEAFE  L LR ++SL E+K++DT+A ++R
Sbjct  17   SSEEVKLGELGEMMVAMLPSDLPFTIFVPSEEAFEHVLKLRASDSLTEQKMNDTYATVSR  76

Query  463  VLGFSALPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIV  642
            V+GFSA+P+ +    V   +EI +DS+SGF L   KD KG+LVVNGVRSE VD+R+ +I+
Sbjct  77   VMGFSAVPQHLPSGAVPLHKEISFDSISGFRLYAWKDVKGTLVVNGVRSECVDVRKAEII  136

Query  643  VHVMNGVLMDAEFEQSVRPDY  705
            VH+M+GV+MD EFEQS  PDY
Sbjct  137  VHIMSGVIMDVEFEQSFSPDY  157



>ref|XP_011085134.1| PREDICTED: uncharacterized protein LOC105167209 [Sesamum indicum]
Length=199

 Score =   159 bits (403),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 126/186 (68%), Gaps = 11/186 (6%)
 Frame = +1

Query  145  DPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKST-SKDAKVGKFGGM  321
            +PVK +C++VS+ F  I  IS L++  +   K   + S      KST S  +++GKFG  
Sbjct  13   NPVKLICIIVSVSFIIIQIISALQLTNISASK---VSSPKPTHTKSTLSGVSEIGKFGET  69

Query  322  VIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGFSALPRIIHL  501
            VI+MLPEDL FTLFLPSEEAF RDL L  N+S       ++HAVLTRVLGFSA+PR I  
Sbjct  70   VIKMLPEDLAFTLFLPSEEAFRRDLRLDQNDS-------NSHAVLTRVLGFSAVPRWIST  122

Query  502  ENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVVHVMNGVLMDAEF  681
              +  G+E  Y+S+SGF+L   KDS   +VVNGV S+   L+ G ++VHVM+GV+MDAEF
Sbjct  123  AELEHGKEKIYESISGFSLYASKDSNERVVVNGVVSKQRGLKMGNVLVHVMDGVVMDAEF  182

Query  682  EQSVRP  699
            EQSV+P
Sbjct  183  EQSVQP  188



>ref|XP_010943934.1| PREDICTED: uncharacterized protein LOC105061548 isoform X1 [Elaeis 
guineensis]
Length=197

 Score =   156 bits (395),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 107/141 (76%), Gaps = 0/141 (0%)
 Frame = +1

Query  283  TSKDAKVGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTR  462
            +S++  +G+ G M++ MLP DL FT+F+PSEEAFER L LR ++SL E+K++DT+A ++R
Sbjct  56   SSEEVILGELGEMMVAMLPNDLPFTIFVPSEEAFERVLKLRASDSLTEQKINDTYATISR  115

Query  463  VLGFSALPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIV  642
            ++GFSA+P+ +    V   +E  +DS+SGF L   KD KG+LVVNGVRS  VD+R+ +IV
Sbjct  116  IMGFSAVPQHLPSGAVPLHKEKSFDSISGFRLYAWKDVKGNLVVNGVRSVCVDVRKAEIV  175

Query  643  VHVMNGVLMDAEFEQSVRPDY  705
             H+M+GV+MDAEFEQS   DY
Sbjct  176  AHIMSGVIMDAEFEQSFSSDY  196



>ref|XP_009416186.1| PREDICTED: uncharacterized protein LOC103996871 [Musa acuminata 
subsp. malaccensis]
Length=226

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 134/199 (67%), Gaps = 7/199 (4%)
 Frame = +1

Query  115  QKMRRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELP-LKKDNAIL-SWGGKKIKSTS  288
            +K RR   +   V  MC+L  I+    L  S     ELP +   N+++ S        T 
Sbjct  31   KKWRRRCLSRISVYLMCLLAPILCLLCLINS-----ELPEVSLSNSVMGSPRNLTFTKTV  85

Query  289  KDAKVGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVL  468
            +   +G+ G M++ MLP+DL FT+F+PSEEAF R L LR ++S++++++++T+AV++RV+
Sbjct  86   EGVGLGELGDMMVAMLPDDLAFTIFVPSEEAFGRLLKLRSHDSVSKDRLNETYAVVSRVM  145

Query  469  GFSALPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVVH  648
            GFSA+P+ I  + +   +E+ ++S+SGF L   KD  G+LVVNG+RSE+VD+R+ +I+VH
Sbjct  146  GFSAVPQHIPSKVIPLHKEMTFESVSGFRLYAWKDLDGTLVVNGIRSEVVDIRKAEIIVH  205

Query  649  VMNGVLMDAEFEQSVRPDY  705
             M+GVLMDAEFEQS  PDY
Sbjct  206  KMDGVLMDAEFEQSFPPDY  224



>gb|EYU41264.1| hypothetical protein MIMGU_mgv1a026175mg [Erythranthe guttata]
Length=187

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 124/197 (63%), Gaps = 23/197 (12%)
 Frame = +1

Query  115  QKMRRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKSTSKD  294
            +K+R  KN   PVK +C++V++ F  +  IS L      L+  + I S     +K +   
Sbjct  5    RKIRASKN---PVKLICIIVTVSFIIVQIISAL------LQLTSTISSSPKPVMKPS---  52

Query  295  AKVGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGF  474
              +G+ G  VI MLPEDL FTLFLPSEEAF RDL L  N+S       D++A LTRVLGF
Sbjct  53   --IGELGETVIGMLPEDLAFTLFLPSEEAFRRDLRLDRNDS-------DSYATLTRVLGF  103

Query  475  SALPRIIHLENVVSGE--EIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVVH  648
            SA+PR I   ++      E  Y S+SGF L++ KD KG +VVNGV SE   LR+G +VV+
Sbjct  104  SAVPRWISTADLDLDLDLERVYGSISGFDLVVSKDLKGRVVVNGVASEKKGLRKGSVVVY  163

Query  649  VMNGVLMDAEFEQSVRP  699
            V++GVLMDAEF QSV+P
Sbjct  164  VIDGVLMDAEFRQSVQP  180



>ref|XP_010534568.1| PREDICTED: uncharacterized protein LOC104810077 [Tarenaya hassleriana]
Length=204

 Score =   149 bits (377),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 122/191 (64%), Gaps = 3/191 (2%)
 Frame = +1

Query  121  MRRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKSTSKDAK  300
            MR+     +PV F+C++++     +L +S+ ++ E P      ++    +     S+  +
Sbjct  1    MRKTHLLKNPVAFLCLIITACSLAVLIMSLTRLPETPPVTGGEVVLR--RTQADISESYE  58

Query  301  VGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGFSA  480
            +G FG M+IEMLPEDL FT F+PS+ AF   LGL  N+S   E  D+ +AV++RVLGFS 
Sbjct  59   LGVFGRMMIEMLPEDLVFTAFVPSDRAFATKLGLEPNKSRRAENEDNQYAVVSRVLGFSV  118

Query  481  LPRIIHLENVVSGEEIRYDSLSGFTLLIV-KDSKGSLVVNGVRSEMVDLRRGKIVVHVMN  657
            +P  +   +V  GE + Y+SL G+TL +  K  +G LVVNGV ++ + +R+GKI+VH+MN
Sbjct  119  VPYKVEEGDVGEGETVSYESLCGYTLNVWRKKDEGGLVVNGVETKKIGIRKGKILVHLMN  178

Query  658  GVLMDAEFEQS  690
            GV+MDAEF QS
Sbjct  179  GVIMDAEFAQS  189



>ref|NP_191141.1| Fasciclin-like arabinogalactan family protein [Arabidopsis thaliana]
 emb|CAB81607.1| putative protein [Arabidopsis thaliana]
 gb|AAX23870.1| hypothetical protein At3g55820 [Arabidopsis thaliana]
 gb|AAZ52730.1| hypothetical protein At3g55820 [Arabidopsis thaliana]
 gb|ABR46212.1| At3g55820 [Arabidopsis thaliana]
 gb|AEE79445.1| Fasciclin-like arabinogalactan family protein [Arabidopsis thaliana]
Length=204

 Score =   149 bits (376),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 130/198 (66%), Gaps = 13/198 (7%)
 Frame = +1

Query  121  MRRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKSTSKDAK  300
            M++     +PV F+ +L+++    IL  S LK+ E PL   N +     +K++    D +
Sbjct  1    MKKPHFLKNPVFFLFLLITVSSLTILIFSFLKLPETPLAAGNHL-----RKLRYELTD-E  54

Query  301  VGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLA------EEKVDDTHAVLTR  462
            +G FG M+IEMLPEDL FT F+PSE++F RDLGL+LN S        ++  D+T+AV++R
Sbjct  55   LGLFGKMMIEMLPEDLVFTAFVPSEKSFSRDLGLKLNTSRPIKSHEEDDDGDNTYAVVSR  114

Query  463  VLGFSALPRIIHLENVVSGEEIRYDSLSGFTLLIV-KDSKGSLVVNGVRSEMVDLRRGKI  639
            ++ F+ +P  +   ++ + E   Y+SLSGFTL I  K + G LVVNGV +E + L+RGKI
Sbjct  115  IMSFAVVPYKVEEVDIGNDETASYESLSGFTLQIWRKRNGGGLVVNGVETEKMGLKRGKI  174

Query  640  VVHVMNGVLMDAEFEQSV  693
            +VH+MNGV+MD++F QS+
Sbjct  175  IVHIMNGVVMDSDFAQSI  192



>ref|XP_009116279.1| PREDICTED: uncharacterized protein LOC103841488 [Brassica rapa]
Length=201

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 132/197 (67%), Gaps = 17/197 (9%)
 Frame = +1

Query  121  MRRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKSTSKDAK  300
            MRR     +PV F+ +L++     IL  S+L++ + P      I+  G  K+++   D +
Sbjct  1    MRRLLIKKNPVFFLFLLITTSSLTILIFSLLRLPDSP-----PIIFTG--KLRADLSD-E  52

Query  301  VGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGL------RLNESLAEEKVDDTHAVLTR  462
            +G FG M+IEMLPEDL FT F+PSE+AF+RDLG+      R ++SL +E  ++T+AV++R
Sbjct  53   LGFFGNMIIEMLPEDLVFTAFVPSEKAFDRDLGMTKPNNTRKSKSLEDE--ENTYAVVSR  110

Query  463  VLGFSALPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIV  642
            +LGF+ +P  +   +V   E   Y+SLSGFTL I + S G LVVNGV +E + L+RGKI+
Sbjct  111  ILGFAVVPYRVEAGDVGKDETASYESLSGFTLKIWRKS-GGLVVNGVETEKMGLKRGKIM  169

Query  643  VHVMNGVLMDAEFEQSV  693
            VH+M+GV+MD++F QSV
Sbjct  170  VHIMDGVIMDSDFAQSV  186



>ref|XP_010504452.1| PREDICTED: uncharacterized protein LOC104781471 [Camelina sativa]
Length=206

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 129/192 (67%), Gaps = 15/192 (8%)
 Frame = +1

Query  145  DPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKSTSKDAKVGKFGGMV  324
            +PV F+ +L+++    IL  S LK+ E PL   N +     +K++    D ++G FG M+
Sbjct  9    NPVFFLLLLIALSSLTILTFSFLKLPETPLAAGNHL-----RKLRYELTD-ELGYFGKMM  62

Query  325  IEMLPEDLGFTLFLPSEEAFERDLGLRLNESLA-------EEKVDDTHAVLTRVLGFSAL  483
            IEMLPEDL FT F+PS+++F RDLGLR N S         +++ D+T+AV++R++GF+ +
Sbjct  63   IEMLPEDLVFTAFVPSDQSFRRDLGLRSNNSRQIKSLEDDDDEGDNTYAVVSRIMGFAVV  122

Query  484  PRIIHLENVVSGEEIRYDSLSGFTLLIV-KDSKGSLVVNGVRSE-MVDLRRGKIVVHVMN  657
            P  +   ++ +GE   Y+SLSGFTL I  K + G LVVNG+ +E M  ++RGKI+VHVMN
Sbjct  123  PYKVEEADIRNGETASYESLSGFTLKIWRKRNSGGLVVNGIETEKMGFVKRGKIIVHVMN  182

Query  658  GVLMDAEFEQSV  693
            GV+MD++F QS+
Sbjct  183  GVVMDSDFAQSL  194



>ref|XP_006403415.1| hypothetical protein EUTSA_v10010736mg [Eutrema salsugineum]
 gb|ESQ44868.1| hypothetical protein EUTSA_v10010736mg [Eutrema salsugineum]
Length=200

 Score =   141 bits (355),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 124/193 (64%), Gaps = 6/193 (3%)
 Frame = +1

Query  121  MRRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKSTSKDAK  300
            MR+     +PV F+ +L++     IL  S L++ E P    + +     +K++    D +
Sbjct  1    MRKPHFMKNPVLFLFLLITASSLTILVFSFLRLPESPPVAGDYL---SLRKLRYDLSD-E  56

Query  301  VGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLA-EEKVDDTHAVLTRVLGFS  477
            +G FG M+IEMLPEDL FT F+PS+EAF RDLGL+LN S   E+  D+T+AV++R++ F+
Sbjct  57   LGFFGKMMIEMLPEDLVFTAFVPSDEAFSRDLGLKLNNSRRIEDDGDNTYAVVSRIMSFA  116

Query  478  ALPRIIHLENVVSGEEIRYDSLSGFTLLIVKD-SKGSLVVNGVRSEMVDLRRGKIVVHVM  654
             +P  +   ++   E   Y+SLSGFTL I K  + G LVVNGV +  + L+RGKIVVH M
Sbjct  117  VVPYKVEEGDIGKDETASYESLSGFTLKIWKKRNGGGLVVNGVETVKMGLKRGKIVVHAM  176

Query  655  NGVLMDAEFEQSV  693
            +GV+MD +F QSV
Sbjct  177  DGVIMDYDFAQSV  189



>emb|CDX72199.1| BnaC08g26750D [Brassica napus]
Length=204

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 127/197 (64%), Gaps = 14/197 (7%)
 Frame = +1

Query  121  MRRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKSTSKDAK  300
            MRR     +PV F+ +L++     IL  S+L++ E P      I+  G  K+++   D +
Sbjct  1    MRRLLIKKNPVFFLFLLITTSSLTILIFSLLRLPESP-----PIIFTG--KLRADLSD-E  52

Query  301  VGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGL----RLNESLAEEKVDDTHAVLTRVL  468
            +G FG M++EMLPEDL FT F+PSE AF RDLG+       ES   E  ++T+AV++R+L
Sbjct  53   LGFFGNMMVEMLPEDLVFTAFVPSENAFNRDLGMTKPNNTRESKPLEDEENTYAVVSRIL  112

Query  469  GFSALPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSK--GSLVVNGVRSEMVDLRRGKIV  642
            GF+ +P  +   ++   E   Y+SLSGFTL I + S+  G LVVNGV +E + L+RGKI+
Sbjct  113  GFAVVPYRVDEVDIGKDETASYESLSGFTLKIWRKSRNSGGLVVNGVETEKMGLKRGKIM  172

Query  643  VHVMNGVLMDAEFEQSV  693
            VH+M+GV+MD++F QSV
Sbjct  173  VHIMDGVIMDSDFAQSV  189



>emb|CDY27263.1| BnaA09g35390D [Brassica napus]
Length=201

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 130/197 (66%), Gaps = 17/197 (9%)
 Frame = +1

Query  121  MRRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKSTSKDAK  300
            MRR     +PV F+ +L++     IL  S+L++ E P      I+  G  K+++   D +
Sbjct  1    MRRLLIKKNPVFFLFLLITTSSLTILIFSLLRLPESP-----PIIITG--KLRADLSD-E  52

Query  301  VGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGL------RLNESLAEEKVDDTHAVLTR  462
            +G FG  ++EMLPEDL FT F+PSE+AF RDLG+      R ++SL +E  ++T+AV++R
Sbjct  53   LGFFGNTMVEMLPEDLVFTAFVPSEKAFNRDLGMTKPNNTRKSKSLEDE--ENTYAVVSR  110

Query  463  VLGFSALPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIV  642
            +LGF+ +P  +   +V   E   Y+SLSGFTL I + S G LVVNGV +E + L+RGKI+
Sbjct  111  ILGFAVVPYRVEAGDVGKDETASYESLSGFTLKIWRKS-GGLVVNGVETEKMGLKRGKIM  169

Query  643  VHVMNGVLMDAEFEQSV  693
            VH+M+GV+MD++F QSV
Sbjct  170  VHIMDGVIMDSDFSQSV  186



>ref|XP_002876337.1| hypothetical protein ARALYDRAFT_907015 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52596.1| hypothetical protein ARALYDRAFT_907015 [Arabidopsis lyrata subsp. 
lyrata]
Length=202

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 124/197 (63%), Gaps = 12/197 (6%)
 Frame = +1

Query  121  MRRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKSTSKDAK  300
            M++     +PV F+ +L++     IL  S LK+ E      N +  +G           +
Sbjct  1    MKKPHFLKNPVFFLFLLITASSLTILIFSFLKLPETTPATGNHLRKFG------DDLSDE  54

Query  301  VGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLA-----EEKVDDTHAVLTRV  465
            +G FG M+IEMLPEDL FT F+PSE++F RDLGL+LN+S       ++  D+T+AV++R+
Sbjct  55   LGFFGKMMIEMLPEDLVFTAFVPSEKSFSRDLGLKLNKSRPIKSPEDDDGDNTYAVVSRI  114

Query  466  LGFSALPRIIHLENVVSGEEIRYDSLSGFTLLIVKD-SKGSLVVNGVRSEMVDLRRGKIV  642
            + F+ +P  +   ++   E   Y+SLSGFTL I K  + G LVVNGV++E + L+RGKI+
Sbjct  115  MSFAVVPYKVEEVDIGKEETASYESLSGFTLKIWKKRNGGGLVVNGVKTEKMGLKRGKII  174

Query  643  VHVMNGVLMDAEFEQSV  693
             H+MNGV+MD++F QS+
Sbjct  175  AHIMNGVVMDSDFAQSL  191



>ref|XP_006379621.1| hypothetical protein POPTR_0008s06530g [Populus trichocarpa]
 gb|ERP57418.1| hypothetical protein POPTR_0008s06530g [Populus trichocarpa]
Length=157

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 110/196 (56%), Gaps = 41/196 (21%)
 Frame = +1

Query  121  MRRGKNTIDPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKSTSKDAK  300
            MRRG    + + F+ V++SI    ++ +S+ ++ E  L  +    S+   + +  SKD  
Sbjct  1    MRRGCFVKNSIAFVGVVISICCLSVIMVSVFQLPEASLI-NKVTGSYRTIRTRKVSKDEA  59

Query  301  VGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGFSA  480
            +GKFG M+IEMLPE+L FT+F+PS EAFERDL  RL  S+                    
Sbjct  60   IGKFGEMMIEMLPEELAFTVFVPSHEAFERDL--RLQSSM--------------------  97

Query  481  LPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVVHVMNG  660
            +P                  LSG TL I KD  G LVVN +RSE VDLRR +IVVHVM+ 
Sbjct  98   IP------------------LSGLTLYISKDGDGMLVVNRIRSEKVDLRRREIVVHVMDE  139

Query  661  VLMDAEFEQSVRPDYS  708
            VLMD EFEQ+V+PDY+
Sbjct  140  VLMDGEFEQAVQPDYT  155



>ref|XP_010427382.1| PREDICTED: uncharacterized protein LOC104712229 isoform X1 [Camelina 
sativa]
 ref|XP_010427383.1| PREDICTED: uncharacterized protein LOC104712229 isoform X2 [Camelina 
sativa]
Length=207

 Score =   133 bits (335),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 126/193 (65%), Gaps = 16/193 (8%)
 Frame = +1

Query  145  DPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKSTSKDAKVGKFGGMV  324
            +PV F+ +L+++    IL  S LK+ E PL   N I     +K++    D ++G FG M+
Sbjct  9    NPVFFLLLLITLSSLTILIFSFLKLPETPLAAGNHI-----RKLRYELTD-ELGYFGNMM  62

Query  325  IEMLPEDLGFTLFLPSEEAFERDLGLRLNES--------LAEEKVDDTHAVLTRVLGFSA  480
            IEMLPEDL FT F+PS+++F RDLGLR N S          +E  D+T+AV++R++GF+ 
Sbjct  63   IEMLPEDLVFTAFVPSDKSFRRDLGLRSNNSRQIKSLEDDDDEGDDNTYAVVSRIMGFAV  122

Query  481  LPRIIHLENVVSGEEIRYDSLSGFTLLIV-KDSKGSLVVNGVRSEMVDL-RRGKIVVHVM  654
            +P  +   ++   E   Y+SLSGFTL I  + + G LVVNG+ +E + L +RGKI+VHVM
Sbjct  123  VPYKVEEADIRKDETASYESLSGFTLKIWRRRNSGGLVVNGIETEKMGLIKRGKIIVHVM  182

Query  655  NGVLMDAEFEQSV  693
            NGV+MD++F QS+
Sbjct  183  NGVVMDSDFAQSL  195



>ref|XP_010516171.1| PREDICTED: uncharacterized protein LOC104791874 [Camelina sativa]
Length=207

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 126/193 (65%), Gaps = 16/193 (8%)
 Frame = +1

Query  145  DPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKSTSKDAKVGKFGGMV  324
            +PV F+ +L+++    IL  S LK+ E PL   N +     ++++    D +VG FG M+
Sbjct  9    NPVFFLLLLITLSSLTILIFSFLKLPETPLAAGNHL-----RELRYELTD-EVGYFGKMM  62

Query  325  IEMLPEDLGFTLFLPSEEAFERDLGLRLNES--------LAEEKVDDTHAVLTRVLGFSA  480
            IEMLPEDL FT F+PS+ AF RDLGL+ N S          +E  D+T+AV++R++GF+ 
Sbjct  63   IEMLPEDLVFTAFVPSDRAFRRDLGLKSNNSRQIKSLADDDDEDGDNTYAVVSRIMGFAV  122

Query  481  LPRIIHLENVVSGEEIRYDSLSGFTLLIV-KDSKGSLVVNGVRSE-MVDLRRGKIVVHVM  654
            +P  +   ++ +GE   Y+SLSGFTL I  K + G LVVNG+ +E M  ++RGKI+ H+M
Sbjct  123  VPYKVEEADIRNGETASYESLSGFTLKIWRKRNSGGLVVNGIETEKMGFVKRGKIIAHIM  182

Query  655  NGVLMDAEFEQSV  693
            NGV+MD++F QS+
Sbjct  183  NGVVMDSDFAQSL  195



>ref|XP_006848129.1| hypothetical protein AMTR_s00029p00222940 [Amborella trichopoda]
 gb|ERN09710.1| hypothetical protein AMTR_s00029p00222940 [Amborella trichopoda]
Length=334

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 114/176 (65%), Gaps = 2/176 (1%)
 Frame = +1

Query  181  VFTFILFISILKIHELPLKKDNA-ILSWGGKKIKSTSKDAKVGKFGGMVIEMLPEDLGFT  357
            V TF+  I + ++ +LP   +N   LS G   +    +D   G  G +++ ML EDL FT
Sbjct  158  VVTFLDAI-LSQVFKLPEASENGDPLSLGILNLHKRFQDYHFGVIGEIMLSMLNEDLPFT  216

Query  358  LFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGFSALPRIIHLENVVSGEEIRYD  537
            LFLPSE AFER L + +N +    K ++T  +L+RVLGFS +P  +  E+V    EI +D
Sbjct  217  LFLPSEAAFERLLKINVNGTSVYNKENNTDVILSRVLGFSVIPIKLRSEDVPLTREISFD  276

Query  538  SLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVVHVMNGVLMDAEFEQSVRPDY  705
            SL+GF L I++  +  L V+ VRSE VD+RRG+I+VHVM+GV+MDAEF QS++ DY
Sbjct  277  SLAGFELNIMRLPEKVLSVDNVRSERVDMRRGEIIVHVMDGVIMDAEFAQSMKDDY  332



>ref|XP_006291866.1| hypothetical protein CARUB_v10018041mg [Capsella rubella]
 gb|EOA24764.1| hypothetical protein CARUB_v10018041mg [Capsella rubella]
Length=204

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 122/191 (64%), Gaps = 15/191 (8%)
 Frame = +1

Query  145  DPVKFMCVLVSIVFTFILFISILKIHELPLKKDNAILSWGGKKIKSTSKDAKVGKFGGMV  324
            +PV F+ +L+++    IL  S LK+ E PL   N +      K ++   D ++G FG M+
Sbjct  9    NPVVFLLLLITLSSLTILIFSFLKLPETPLAAGNHLC-----KQRNELTD-ELGYFGKMM  62

Query  325  IEMLPEDLGFTLFLPSEEAFERDLGLRLN-----ESLAEEKVDDTHAVLTRVLGFSALPR  489
            I MLPEDL FT F+PS++AF RDLGL+ N      SL ++  D+T+AV++R++GF+ +P 
Sbjct  63   IGMLPEDLVFTAFVPSDKAFRRDLGLKSNNSRRINSLEDDDGDNTYAVVSRIMGFAVVPY  122

Query  490  IIHLENVVSGEEIRYDSLSGFTLLIVKDSKG---SLVVNGVRSEMVD-LRRGKIVVHVMN  657
             +   ++ + E   Y+SLSGF L I K  +     LVVNGV +E V  ++RGK +VH+MN
Sbjct  123  KVEEADIRNDETASYESLSGFKLKIWKKERNGGSGLVVNGVETEKVGFVKRGKTIVHIMN  182

Query  658  GVLMDAEFEQS  690
            GV+MD++F QS
Sbjct  183  GVVMDSDFAQS  193



>gb|EMT12989.1| hypothetical protein F775_02982 [Aegilops tauschii]
Length=347

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 95/137 (69%), Gaps = 4/137 (3%)
 Frame = +1

Query  295  AKVGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKV-DDTHAVLTRVLG  471
            A +G+FG M++ MLP DL FT F+PS E+F R LGLR N+S A  K  DDT+AV++RVLG
Sbjct  78   ASLGEFGEMMVSMLPRDLAFTAFMPSPESFRRVLGLRHNDSAAGLKASDDTYAVVSRVLG  137

Query  472  FSALPRIIHLENVV---SGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIV  642
            FSA+P  +   +V    +   +  DS+SG  +   +D  G+LVVNGVRSE VD+ R + V
Sbjct  138  FSAVPLRLRSGDVALRGTARLLDLDSVSGLKVHAWRDVDGALVVNGVRSECVDIVRDETV  197

Query  643  VHVMNGVLMDAEFEQSV  693
            VHVM GVLMDAEFE+S 
Sbjct  198  VHVMAGVLMDAEFERSA  214



>gb|EPS69008.1| hypothetical protein M569_05771, partial [Genlisea aurea]
Length=175

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 98/134 (73%), Gaps = 9/134 (7%)
 Frame = +1

Query  301  VGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGFSA  480
            +G+FG  VI+MLP+DL FTLFLPSE +F RDL  R+N++      D+T+A+LTR+LGFSA
Sbjct  45   IGEFGERVIQMLPDDLPFTLFLPSEPSFYRDL--RMNKT----DDDNTYAILTRILGFSA  98

Query  481  LPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGK-IVVHVMN  657
            +PR I   ++   +E  Y+S+SGF L + K S+  +V NG+ S  + +++ K +V+HVM+
Sbjct  99   VPRWISPADLDQEKEAVYNSISGFRLYLHKTSEEMVVANGIPS--IGMKKKKNLVIHVMD  156

Query  658  GVLMDAEFEQSVRP  699
            GV+MD EFEQSVRP
Sbjct  157  GVIMDPEFEQSVRP  170



>ref|XP_003561841.1| PREDICTED: uncharacterized protein LOC100826626 [Brachypodium 
distachyon]
Length=223

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 96/141 (68%), Gaps = 10/141 (7%)
 Frame = +1

Query  298  KVGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRL-NESLAEEKV-------DDTHAV  453
            ++G+FG M++ MLP DL FT F+PS E+F R L LR  N+S+A +         D T+AV
Sbjct  76   QLGEFGEMMVSMLPRDLAFTAFVPSPESFRRVLNLRPPNDSVARDGTKKKAASDDATYAV  135

Query  454  LTRVLGFSALPRIIHLENVVSGEEIRY-DSLSGFTLLIVKDS-KGSLVVNGVRSEMVDLR  627
            ++RVLGFSA+PR +   +V   E  R  DS+SG  +   +D   G+LVVNGVRSE VD+ 
Sbjct  136  VSRVLGFSAIPRALRSADVPLREPARLLDSVSGLRIYAWRDEVDGALVVNGVRSECVDIV  195

Query  628  RGKIVVHVMNGVLMDAEFEQS  690
            RG+ VVHVM GVLMDAEF++S
Sbjct  196  RGETVVHVMAGVLMDAEFQRS  216



>ref|XP_004987085.1| PREDICTED: uncharacterized protein LOC101771764 [Setaria italica]
Length=220

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 97/139 (70%), Gaps = 7/139 (5%)
 Frame = +1

Query  295  AKVGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGL---RLNESLAEEKVDDTHAVLTRV  465
            A +G+ G  ++ MLP+DL FT+F+PS  +F R LGL   R   + AE   D+T+AVL+RV
Sbjct  74   AGLGELGDAMVSMLPKDLPFTVFVPSPGSFRRVLGLQQGRNASAAAEGDNDNTYAVLSRV  133

Query  466  LGFSALPR-IIHLENVVSGEE---IRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRG  633
            LGFSA+PR ++  +    G     +  DS+SG  +   +D++G+LVVNGVRSE VD+ RG
Sbjct  134  LGFSAVPRRLLAADAPPRGTACLALALDSVSGLRIHASRDARGALVVNGVRSECVDVVRG  193

Query  634  KIVVHVMNGVLMDAEFEQS  690
            +IVVHV+ GVLMDAEFE+S
Sbjct  194  EIVVHVIAGVLMDAEFERS  212



>ref|XP_006651204.1| PREDICTED: uncharacterized protein LOC102715561 [Oryza brachyantha]
Length=235

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 93/139 (67%), Gaps = 9/139 (6%)
 Frame = +1

Query  301  VGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGFSA  480
            +G+FG M++ MLP  L FT+F+PS E+F R LGL  N+S+AE K D T+AV++RVLGFSA
Sbjct  90   LGEFGDMMVSMLPRSLAFTVFVPSPESFRRVLGLLPNDSVAEGKADATYAVVSRVLGFSA  149

Query  481  LPRIIHLENVVSGEEIRY--------DSLSGFTL-LIVKDSKGSLVVNGVRSEMVDLRRG  633
            +PR +   +V      R         +S+SG  +    +D  G+LVVNGV SE VD+ + 
Sbjct  150  VPRRLRAADVAPLRRRRQQVAVAPVLESVSGMRISAWRRDDDGALVVNGVPSECVDIVKD  209

Query  634  KIVVHVMNGVLMDAEFEQS  690
            + +VHVM GVLMDAEFE+S
Sbjct  210  QAIVHVMAGVLMDAEFERS  228



>gb|AFW89067.1| hypothetical protein ZEAMMB73_925141 [Zea mays]
Length=227

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 101/151 (67%), Gaps = 13/151 (9%)
 Frame = +1

Query  277  KSTSKDAKVGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLA----EEKVDDT  444
            + +S  A +G+ G  ++ MLP+DL FT+F+PS ++F R L L+ ++S A    +E   DT
Sbjct  73   RCSSAAASLGELGDAMVSMLPKDLPFTVFVPSVDSFTRVLRLQGSKSNASTGDQEAATDT  132

Query  445  ----HAVLTRVLGFSALPRIIHLENVV-----SGEEIRYDSLSGFTLLIVKDSKGSLVVN  597
                +A+L+RVLGFSA+PR +   +V      +G     DS+SG  L   +D++G+LVVN
Sbjct  133  DTNTYAILSRVLGFSAVPRRLLAADVPVPPRGAGAVRLLDSVSGLRLYASRDARGALVVN  192

Query  598  GVRSEMVDLRRGKIVVHVMNGVLMDAEFEQS  690
            GVRSE VD+ RG+ VVHV+ GVLMDAEFE+S
Sbjct  193  GVRSECVDIIRGETVVHVLAGVLMDAEFERS  223



>ref|NP_001142563.1| uncharacterized protein LOC100274822 [Zea mays]
 gb|ACG25076.1| hypothetical protein [Zea mays]
Length=227

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 101/151 (67%), Gaps = 13/151 (9%)
 Frame = +1

Query  277  KSTSKDAKVGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLA----EEKVDDT  444
            + +S  A +G+ G  ++ MLP+DL FT+F+PS ++F R L L+ ++S A    +E   DT
Sbjct  73   RCSSAAASLGELGDAMVSMLPKDLPFTVFVPSVDSFTRVLRLQGSKSNASTGDQEAATDT  132

Query  445  ----HAVLTRVLGFSALPRIIHLENVV-----SGEEIRYDSLSGFTLLIVKDSKGSLVVN  597
                +A+L+RVLGFSA+PR +   +V      +G     DS+SG  L   +D++G+LVVN
Sbjct  133  DTNTYAILSRVLGFSAVPRRLLAADVPVPPRGAGAVRLLDSVSGLRLYASRDARGALVVN  192

Query  598  GVRSEMVDLRRGKIVVHVMNGVLMDAEFEQS  690
            GVRSE VD+ RG+ VVHV+ GVLMDA+FE+S
Sbjct  193  GVRSECVDIIRGETVVHVLAGVLMDAKFERS  223



>ref|XP_002465583.1| hypothetical protein SORBIDRAFT_01g041590 [Sorghum bicolor]
 gb|EER92581.1| hypothetical protein SORBIDRAFT_01g041590 [Sorghum bicolor]
Length=249

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 97/157 (62%), Gaps = 18/157 (11%)
 Frame = +1

Query  295  AKVGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAE-------------EKV  435
            A +G+ G  ++ MLP DL FT+F+PS ++F R L L+ + S                +  
Sbjct  93   ASLGELGDAMVSMLPRDLPFTVFVPSADSFTRVLRLQGSSSSNASAAAAGGEEAAASDTD  152

Query  436  DDTHAVLTRVLGFSALPRIIHLENVV-----SGEEIRYDSLSGFTLLIVKDSKGSLVVNG  600
             +T+A+L+RVLGFSA+PR +   +V      +G     DS+SG  L   +D++G+LVVNG
Sbjct  153  GNTYAILSRVLGFSAVPRRLLAADVPPPPRGAGPVRLLDSVSGLRLYASRDARGALVVNG  212

Query  601  VRSEMVDLRRGKIVVHVMNGVLMDAEFEQSVRPDYSG  711
            VRSE VD+ RG+ VVHVM GVLMDAEFE+S   ++ G
Sbjct  213  VRSECVDIVRGETVVHVMAGVLMDAEFERSFSAEFDG  249



>gb|EMS68779.1| hypothetical protein TRIUR3_30410 [Triticum urartu]
Length=309

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 87/137 (64%), Gaps = 4/137 (3%)
 Frame = +1

Query  265  GKKIKSTSKDAKVGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKV-DD  441
            G      +  A +G+FG M++ MLP DL FT F+PS E+F R LGLR N+S    K  DD
Sbjct  90   GPPAHCGAMSASLGEFGDMMVSMLPRDLAFTAFVPSPESFRRVLGLRHNDSAVGLKASDD  149

Query  442  THAVLTRVLGFSALPRIIHLENVV---SGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSE  612
            T+AV++RVLGFSA+P  +   +V    +   +  DS+SG  +   +D  G+LVVNGVRSE
Sbjct  150  TYAVVSRVLGFSAVPLRLRSGDVALRGTARLLDLDSVSGLKVHAWRDVDGALVVNGVRSE  209

Query  613  MVDLRRGKIVVHVMNGV  663
             VD+ R + VVHVM GV
Sbjct  210  CVDIVRDETVVHVMAGV  226



>ref|NP_001173339.1| Os03g0237950 [Oryza sativa Japonica Group]
 gb|AAO06978.1| Unknown protein [Oryza sativa Japonica Group]
 gb|ABF94862.1| expressed protein [Oryza sativa Japonica Group]
 gb|EAY89186.1| hypothetical protein OsI_10682 [Oryza sativa Indica Group]
 dbj|BAH92067.1| Os03g0237950 [Oryza sativa Japonica Group]
Length=155

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 94/146 (64%), Gaps = 14/146 (10%)
 Frame = +1

Query  295  AKVGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGL-RLNESLAE-EKVDD--THAVLTR  462
            A +G+FG M++ MLP++L FT+F+PS E+F R L L R N+S       DD  T+AV++R
Sbjct  3    ASLGEFGDMMVSMLPKNLAFTVFVPSPESFRRVLKLQRPNDSATNGNGADDDATYAVVSR  62

Query  463  VLGFSALPRIIHLENVVSGEEIRY--------DSLSGFTL-LIVKDSKGSLVVNGVRSEM  615
            VLGFSA+PR +   +V      +         +S+SG  +    +D  G+LVVNGV SE 
Sbjct  63   VLGFSAVPRRLRAADVAPPRHRQQMVAVAPVLESVSGLRISAWRRDVDGALVVNGVPSEC  122

Query  616  VDLRRGK-IVVHVMNGVLMDAEFEQS  690
            VD+ + + I+VHVM GVLMDAEFE+S
Sbjct  123  VDIVKERDIIVHVMAGVLMDAEFERS  148



>gb|KHN13078.1| hypothetical protein glysoja_037520 [Glycine soja]
Length=103

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 81/125 (65%), Gaps = 31/125 (25%)
 Frame = +1

Query  319  MVIEMLPEDLGFTLFLPSEEAFERDLGLRLNESLAEEKVDDTHAVLTRVLGFSALPRIIH  498
            M+++MLP+DL FT+ +PSE+AF+RDL L +N+S   +K +DT+A+++R+LGFSA+P    
Sbjct  1    MMLDMLPQDLAFTVLVPSEDAFKRDLRLSVNDSFKPDKFNDTYAIVSRILGFSAVP----  56

Query  499  LENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVRSEMVDLRRGKIVVHVMNGVLMDAE  678
                                       G+L +  V+ E+VD+R+ +I+VHVM+GV+MDAE
Sbjct  57   ---------------------------GTLSLANVQLEIVDVRKKEILVHVMDGVIMDAE  89

Query  679  FEQSV  693
            FE+S+
Sbjct  90   FEESI  94



>gb|EEE58663.1| hypothetical protein OsJ_10075 [Oryza sativa Japonica Group]
Length=237

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 94/146 (64%), Gaps = 14/146 (10%)
 Frame = +1

Query  295  AKVGKFGGMVIEMLPEDLGFTLFLPSEEAFERDLGL-RLNESLAE-EKVDD--THAVLTR  462
            A +G+FG M++ MLP++L FT+F+PS E+F R L L R N+S       DD  T+AV++R
Sbjct  85   ASLGEFGDMMVSMLPKNLAFTVFVPSPESFRRVLKLQRPNDSATNGNGADDDATYAVVSR  144

Query  463  VLGFSALPRIIHLENVVSGEEIRY--------DSLSGFTL-LIVKDSKGSLVVNGVRSEM  615
            VLGFSA+PR +   +V      +         +S+SG  +    +D  G+LVVNGV SE 
Sbjct  145  VLGFSAVPRRLRAADVAPPRHRQQMVAVAPVLESVSGLRISAWRRDVDGALVVNGVPSEC  204

Query  616  VDLRRGK-IVVHVMNGVLMDAEFEQS  690
            VD+ + + I+VHVM GVLMDAEFE+S
Sbjct  205  VDIVKERDIIVHVMAGVLMDAEFERS  230



>ref|XP_007218376.1| hypothetical protein PRUPE_ppa011304mg [Prunus persica]
 gb|EMJ19575.1| hypothetical protein PRUPE_ppa011304mg [Prunus persica]
Length=216

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 84/164 (51%), Gaps = 11/164 (7%)
 Frame = -2

Query  623  KSTISDRTPLTTNEPFESFTINKVKPDNESYLISSPETTFSK*MILGKAENPstrvsta*  444
            +ST+ DRT LT N P  SF I    PD ESY  S    T ++  + G AENP+ R   A 
Sbjct  16   RSTLLDRTLLTVNAPSSSFEIYNTNPDIESYDSSLSIGTLTEASLRGTAENPNIRDIIAY  75

Query  443  vsstfss-AKLSFNRSPKSRSNASSDGRNKVNPRSSGNISITIPPNFPT--FASLEVDLI  273
            VSS   S  KLSF  S +SRS ASS+G N V  RSSGNIS  I PN P    +  EV L+
Sbjct  76   VSSFIFSPTKLSFGLSLRSRSKASSEGTNTVKARSSGNISSIIFPNLPIENLSFSEVCLL  135

Query  272  FLPPHERIALSFFN--GSSWILRIEMNRMKVKTIETSTHINFTG  147
                     + + N  G S  L IE+  +K +   T+   N  G
Sbjct  136  VF------VVGYCNPSGISGSLSIEIVTIKKQQTNTAHQTNAIG  173



>ref|XP_002975821.1| hypothetical protein SELMODRAFT_442972 [Selaginella moellendorffii]
 gb|EFJ23450.1| hypothetical protein SELMODRAFT_442972 [Selaginella moellendorffii]
Length=179

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 87/150 (58%), Gaps = 13/150 (9%)
 Frame = +1

Query  262  GGKKIKSTSKDAKVGKFGGMVIEMLPE---DLGFTLFLPSEEAFERDLGLRLNESLAEEK  432
            GG+ I S S+  ++G  G  +++ML     DL FT F+PSE   ++     L +   E+ 
Sbjct  29   GGQGIDSGSE--QLGPIGKSMVDMLGGQDLDLAFTSFVPSEAILDK-----LVKPSGEDS  81

Query  433  VDD--THAVLTRVLGFSALPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVR  606
              D    A+L+R+L  S++P  I   ++  GE+++ +++SG+ L +  D    LVVNG+R
Sbjct  82   NRDGNRQALLSRLLASSSVPSRISSTSLRPGEQLQVETISGYKLSLGVDVNRGLVVNGMR  141

Query  607  SEMVDLRRGK-IVVHVMNGVLMDAEFEQSV  693
                DLR G+ +VV+++ GV+MD E  +SV
Sbjct  142  CVARDLRIGEMLVVYIVKGVIMDPELRRSV  171



>ref|XP_002973772.1| hypothetical protein SELMODRAFT_442211 [Selaginella moellendorffii]
 gb|EFJ25432.1| hypothetical protein SELMODRAFT_442211 [Selaginella moellendorffii]
Length=795

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 87/150 (58%), Gaps = 13/150 (9%)
 Frame = +1

Query  262  GGKKIKSTSKDAKVGKFGGMVIEMLPE---DLGFTLFLPSEEAFERDLGLRLNESLAEEK  432
            GG+ I S S+  ++G  G  +++ML     DL FT F+PSE   ++     L +   E+ 
Sbjct  645  GGQGIDSASE--QLGPIGKSMVDMLGGQDLDLAFTSFVPSEAILDK-----LVKPSGEDS  697

Query  433  VDD--THAVLTRVLGFSALPRIIHLENVVSGEEIRYDSLSGFTLLIVKDSKGSLVVNGVR  606
              D    A+L+R+L  S++P  I   ++  GE+++ +++SG+ L +  D    LVVNG+R
Sbjct  698  NRDGNRQALLSRLLASSSVPSRISSTSLRPGEQLQVETISGYKLSLGVDVNRGLVVNGMR  757

Query  607  SEMVDLRRGK-IVVHVMNGVLMDAEFEQSV  693
                DLR G+ +VV+++ GV+MD E  +SV
Sbjct  758  CVARDLRIGEMLVVYIVKGVIMDPELRRSV  787



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1814529760516