BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1906_g1_i1 len=269 path=[247:0-89 337:90-268]

Length=269
                                                                      Score     E

ref|XP_009780941.1|  PREDICTED: trans-resveratrol di-O-methyltran...  85.9    6e-18   
gb|AAM23004.1|AF502433_1  orcinol O-methyltransferase                 85.1    1e-17   Rosa hybrid cultivar
gb|AEC13057.1|  orcinol O-methyltransferase-like protein              84.7    2e-17   
ref|XP_011091578.1|  PREDICTED: trans-resveratrol di-O-methyltran...  84.3    2e-17   
ref|XP_011091580.1|  PREDICTED: trans-resveratrol di-O-methyltran...  84.3    3e-17   
gb|AAM23005.1|AF502434_1  orcinol O-methyltransferase                 84.0    3e-17   Rosa hybrid cultivar
ref|XP_004303127.1|  PREDICTED: trans-resveratrol di-O-methyltran...  84.0    4e-17   
ref|XP_011091583.1|  PREDICTED: trans-resveratrol di-O-methyltran...  83.6    5e-17   
ref|XP_006371494.1|  hypothetical protein POPTR_0019s12300g           80.1    6e-17   
ref|XP_009602136.1|  PREDICTED: trans-resveratrol di-O-methyltran...  83.2    6e-17   
emb|CAN73270.1|  hypothetical protein VITISV_021918                   82.8    6e-17   Vitis vinifera
ref|XP_002278190.1|  PREDICTED: trans-resveratrol di-O-methyltran...  82.8    7e-17   Vitis vinifera
ref|XP_006428632.1|  hypothetical protein CICLE_v10012033mg           82.8    1e-16   
ref|XP_006480453.1|  PREDICTED: trans-resveratrol di-O-methyltran...  82.4    1e-16   
ref|XP_006446728.1|  hypothetical protein CICLE_v10015708mg           82.4    1e-16   
ref|XP_011002662.1|  PREDICTED: trans-resveratrol di-O-methyltran...  82.0    1e-16   
ref|XP_011002663.1|  PREDICTED: trans-resveratrol di-O-methyltran...  82.0    1e-16   
ref|XP_011091734.1|  PREDICTED: trans-resveratrol di-O-methyltran...  81.6    2e-16   
ref|XP_004248183.1|  PREDICTED: trans-resveratrol di-O-methyltran...  82.0    2e-16   
ref|XP_010088036.1|  8-hydroxyquercetin 8-O-methyltransferase         82.0    2e-16   
ref|XP_006428633.1|  hypothetical protein CICLE_v10013393mg           80.9    2e-16   
ref|XP_006469135.1|  PREDICTED: trans-resveratrol di-O-methyltran...  82.4    2e-16   
emb|CBI21926.3|  unnamed protein product                              80.9    2e-16   
gb|ABZ89567.1|  O-methyltransferase 3                                 81.6    3e-16   Humulus lupulus [common hop]
ref|XP_011091736.1|  PREDICTED: trans-resveratrol di-O-methyltran...  82.8    3e-16   
ref|XP_002278294.1|  PREDICTED: trans-resveratrol di-O-methyltran...  81.3    3e-16   Vitis vinifera
emb|CAN78992.1|  hypothetical protein VITISV_005827                   81.3    3e-16   Vitis vinifera
ref|XP_009594948.1|  PREDICTED: trans-resveratrol di-O-methyltran...  80.9    4e-16   
emb|CBI21929.3|  unnamed protein product                              80.1    5e-16   
ref|XP_006371493.1|  hypothetical protein POPTR_0019s12280g           79.7    5e-16   
emb|CAN69556.1|  hypothetical protein VITISV_027590                   80.1    7e-16   Vitis vinifera
ref|XP_003633249.1|  PREDICTED: trans-resveratrol di-O-methyltran...  80.5    7e-16   
ref|XP_003633248.1|  PREDICTED: trans-resveratrol di-O-methyltran...  80.5    7e-16   
ref|XP_006346269.1|  PREDICTED: trans-resveratrol di-O-methyltran...  80.5    7e-16   
gb|KDO41475.1|  hypothetical protein CISIN_1g0225151mg                79.0    7e-16   
ref|XP_011070200.1|  PREDICTED: trans-resveratrol di-O-methyltran...  81.3    8e-16   
ref|XP_006368013.1|  PREDICTED: trans-resveratrol di-O-methyltran...  80.1    9e-16   
emb|CBI21931.3|  unnamed protein product                              79.3    9e-16   
ref|XP_011002666.1|  PREDICTED: trans-resveratrol di-O-methyltran...  79.7    1e-15   
ref|NP_001267963.1|  O-methyltransferase                              79.3    2e-15   
ref|XP_003615966.1|  O-methyltransferase                              79.3    2e-15   
ref|XP_006366298.1|  PREDICTED: trans-resveratrol di-O-methyltran...  79.3    2e-15   
gb|KDO36159.1|  hypothetical protein CISIN_1g040309mg                 75.9    2e-15   
ref|XP_002278211.1|  PREDICTED: trans-resveratrol di-O-methyltran...  79.3    2e-15   Vitis vinifera
emb|CAN61955.1|  hypothetical protein VITISV_020020                   79.3    2e-15   Vitis vinifera
ref|XP_002278398.1|  PREDICTED: trans-resveratrol di-O-methyltran...  79.3    2e-15   Vitis vinifera
ref|XP_002278517.1|  PREDICTED: trans-resveratrol di-O-methyltran...  79.3    2e-15   Vitis vinifera
emb|CAN79968.1|  hypothetical protein VITISV_043678                   79.0    3e-15   Vitis vinifera
ref|XP_006346268.1|  PREDICTED: trans-resveratrol di-O-methyltran...  78.6    3e-15   
ref|XP_002525159.1|  o-methyltransferase, putative                    78.6    3e-15   Ricinus communis
ref|XP_003569832.1|  PREDICTED: LOW QUALITY PROTEIN: O-methyltran...  79.0    3e-15   
gb|KDP24057.1|  hypothetical protein JCGZ_25714                       77.8    3e-15   
ref|XP_002281368.2|  PREDICTED: trans-resveratrol di-O-methyltran...  78.6    4e-15   Vitis vinifera
gb|AEF97347.1|  O-methyltransferase                                   78.6    4e-15   
emb|CBI21932.3|  unnamed protein product                              79.0    4e-15   
ref|XP_011091579.1|  PREDICTED: trans-resveratrol di-O-methyltran...  78.2    4e-15   
emb|CBI22002.3|  unnamed protein product                              75.1    5e-15   
emb|CBI22005.3|  unnamed protein product                              77.4    5e-15   
gb|AFX68805.1|  O-metyltransferase                                    78.2    5e-15   
ref|XP_004252468.1|  PREDICTED: trans-resveratrol di-O-methyltran...  78.2    5e-15   
ref|XP_002326036.2|  hypothetical protein POPTR_0019s12290g           77.8    6e-15   Populus trichocarpa [western balsam poplar]
emb|CBI21924.3|  unnamed protein product                              76.3    6e-15   
emb|CAA11131.1|  O-methyltransferase                                  77.8    7e-15   Prunus dulcis [sweet almond]
emb|CDP20221.1|  unnamed protein product                              73.6    7e-15   
emb|CAQ76879.1|  resveratrol O-methyltransferase                      77.4    8e-15   Vitis vinifera
sp|B6VJS4.2|ROMT_VITVI  RecName: Full=Trans-resveratrol di-O-meth...  77.4    8e-15   Vitis vinifera
gb|ABQ02270.2|  O-methyltransferase                                   77.4    8e-15   Vitis vinifera
ref|XP_003615967.1|  O-methyltransferase                              77.4    8e-15   
ref|XP_006469138.1|  PREDICTED: trans-resveratrol di-O-methyltran...  78.6    1e-14   
ref|XP_006469069.1|  PREDICTED: trans-resveratrol di-O-methyltran...  77.0    1e-14   
ref|XP_004235335.1|  PREDICTED: trans-resveratrol di-O-methyltran...  78.2    1e-14   
ref|XP_002525160.1|  o-methyltransferase, putative                    77.0    1e-14   Ricinus communis
gb|EMS57517.1|  5-pentadecatrienyl resorcinol O-methyltransferase     76.6    1e-14   
gb|KDO37374.1|  hypothetical protein CISIN_1g023625mg                 76.3    1e-14   
ref|XP_002517827.1|  o-methyltransferase, putative                    76.6    2e-14   Ricinus communis
ref|XP_009764108.1|  PREDICTED: trans-resveratrol di-O-methyltran...  76.6    2e-14   
ref|XP_008229108.1|  PREDICTED: trans-resveratrol di-O-methyltran...  76.3    2e-14   
ref|NP_001268044.1|  trans-resveratrol di-O-methyltransferase         76.3    2e-14   
ref|XP_010052409.1|  PREDICTED: trans-resveratrol di-O-methyltran...  76.3    2e-14   
gb|EMT18419.1|  O-methyltransferase ZRP4                              77.4    2e-14   
emb|CDP19709.1|  unnamed protein product                              75.9    3e-14   
ref|XP_011100227.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...  75.9    3e-14   
emb|CDP15888.1|  unnamed protein product                              75.9    3e-14   
ref|XP_008455550.1|  PREDICTED: trans-resveratrol di-O-methyltran...  74.7    3e-14   
emb|CDP17644.1|  unnamed protein product                              75.5    4e-14   
ref|XP_010040912.1|  PREDICTED: trans-resveratrol di-O-methyltran...  75.5    4e-14   
ref|XP_010058047.1|  PREDICTED: trans-resveratrol di-O-methyltran...  75.5    4e-14   
ref|XP_010058046.1|  PREDICTED: trans-resveratrol di-O-methyltran...  75.5    5e-14   
gb|KCW75545.1|  hypothetical protein EUGRSUZ_E04305                   75.5    5e-14   
emb|CDM84119.1|  unnamed protein product                              75.5    5e-14   
ref|XP_002278316.1|  PREDICTED: trans-resveratrol di-O-methyltran...  75.1    6e-14   Vitis vinifera
emb|CDP21551.1|  unnamed protein product                              73.9    6e-14   
gb|KCW89599.1|  hypothetical protein EUGRSUZ_A01884                   75.1    6e-14   
ref|XP_010070255.1|  PREDICTED: trans-resveratrol di-O-methyltran...  75.1    6e-14   
emb|CAN70493.1|  hypothetical protein VITISV_002330                   75.1    6e-14   Vitis vinifera
ref|XP_010260367.1|  PREDICTED: trans-resveratrol di-O-methyltran...  75.1    6e-14   
ref|XP_008229106.1|  PREDICTED: trans-resveratrol di-O-methyltran...  75.1    8e-14   
emb|CBI21927.3|  unnamed protein product                              73.6    8e-14   
emb|CDP21231.1|  unnamed protein product                              70.9    8e-14   
ref|XP_010110665.1|  8-hydroxyquercetin 8-O-methyltransferase         75.1    8e-14   
emb|CBI21921.3|  unnamed protein product                              73.9    9e-14   
ref|XP_003544914.1|  PREDICTED: trans-resveratrol di-O-methyltran...  74.7    9e-14   
ref|XP_003544912.1|  PREDICTED: trans-resveratrol di-O-methyltran...  74.7    9e-14   
gb|KHN08844.1|  8-hydroxyquercetin 8-O-methyltransferase              74.3    1e-13   
ref|XP_011100228.1|  PREDICTED: trans-resveratrol di-O-methyltran...  74.7    1e-13   
ref|XP_003633245.1|  PREDICTED: trans-resveratrol di-O-methyltran...  74.3    1e-13   
emb|CAN67020.1|  hypothetical protein VITISV_040589                   73.6    1e-13   Vitis vinifera
ref|XP_004163430.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...  74.3    1e-13   
ref|XP_002538902.1|  o-methyltransferase, putative                    73.2    1e-13   Ricinus communis
emb|CDP19839.1|  unnamed protein product                              73.9    1e-13   
emb|CDP21787.1|  unnamed protein product                              74.3    1e-13   
ref|XP_002305103.1|  6a-hydroxymaackiain methyltransferase family...  74.3    1e-13   Populus trichocarpa [western balsam poplar]
ref|XP_007043718.1|  Flavonoid o-methyltransferase related            74.3    1e-13   
gb|KDP24062.1|  hypothetical protein JCGZ_25719                       73.9    1e-13   
ref|XP_010040590.1|  PREDICTED: trans-resveratrol di-O-methyltran...  73.6    1e-13   
emb|CDP21583.1|  unnamed protein product                              73.2    1e-13   
ref|XP_004303135.1|  PREDICTED: trans-resveratrol di-O-methyltran...  73.9    2e-13   
ref|XP_010110664.1|  8-hydroxyquercetin 8-O-methyltransferase         74.3    2e-13   
gb|KCW45078.1|  hypothetical protein EUGRSUZ_L01321                   73.6    2e-13   
emb|CDP21212.1|  unnamed protein product                              73.6    2e-13   
gb|KGN43480.1|  hypothetical protein Csa_7G039280                     74.3    2e-13   
emb|CBI30627.3|  unnamed protein product                              70.9    2e-13   
ref|XP_010093978.1|  Tabersonine 16-O-methyltransferase               73.6    2e-13   
ref|XP_007142077.1|  hypothetical protein PHAVU_008G250700g           73.6    2e-13   
ref|XP_009376908.1|  PREDICTED: trans-resveratrol di-O-methyltran...  73.6    3e-13   
ref|XP_008343875.1|  PREDICTED: trans-resveratrol di-O-methyltran...  73.6    3e-13   
ref|XP_010097399.1|  8-hydroxyquercetin 8-O-methyltransferase         73.6    3e-13   
gb|ACU19152.1|  unknown                                               72.4    3e-13   Glycine max [soybeans]
ref|XP_004151735.1|  PREDICTED: trans-resveratrol di-O-methyltran...  73.2    3e-13   
gb|KHN08846.1|  8-hydroxyquercetin 8-O-methyltransferase              72.0    3e-13   
emb|CDP19708.1|  unnamed protein product                              71.6    3e-13   
ref|XP_004169298.1|  PREDICTED: trans-resveratrol di-O-methyltran...  73.2    3e-13   
ref|XP_008229109.1|  PREDICTED: trans-resveratrol di-O-methyltran...  73.2    3e-13   
ref|XP_011027757.1|  PREDICTED: trans-resveratrol di-O-methyltran...  73.2    3e-13   
ref|XP_003557042.1|  PREDICTED: trans-resveratrol di-O-methyltran...  73.2    4e-13   
ref|XP_008455549.1|  PREDICTED: trans-resveratrol di-O-methyltran...  71.6    4e-13   
ref|XP_010097396.1|  8-hydroxyquercetin 8-O-methyltransferase         72.0    4e-13   
ref|XP_010938927.1|  PREDICTED: trans-resveratrol di-O-methyltran...  72.8    4e-13   
ref|XP_008245363.1|  PREDICTED: trans-resveratrol di-O-methyltran...  71.2    5e-13   
ref|XP_004293905.1|  PREDICTED: trans-resveratrol di-O-methyltran...  72.8    5e-13   
gb|AFK40900.1|  unknown                                               72.8    5e-13   
emb|CDP21661.1|  unnamed protein product                              72.8    5e-13   
gb|KDP24061.1|  hypothetical protein JCGZ_25718                       72.8    5e-13   
ref|XP_008778546.1|  PREDICTED: trans-resveratrol di-O-methyltran...  72.8    5e-13   
ref|XP_011100233.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...  72.4    5e-13   
emb|CDP19840.1|  unnamed protein product                              72.4    6e-13   
ref|XP_004151089.1|  PREDICTED: trans-resveratrol di-O-methyltran...  71.2    6e-13   
ref|XP_007142076.1|  hypothetical protein PHAVU_008G250600g           72.4    6e-13   
gb|KHN19130.1|  8-hydroxyquercetin 8-O-methyltransferase              70.9    7e-13   
gb|AJD20223.1|  norcoclaurine 6-O-methyltransferase                   72.4    7e-13   
ref|XP_004490696.1|  PREDICTED: trans-resveratrol di-O-methyltran...  72.0    7e-13   
dbj|BAA86059.1|  O-methyltransferase                                  72.4    7e-13   Pyrus pyrifolia [sha li]
ref|XP_003615968.1|  O-methyltransferase                              71.6    8e-13   
ref|XP_004490686.1|  PREDICTED: trans-resveratrol di-O-methyltran...  72.0    8e-13   
emb|CDP21836.1|  unnamed protein product                              72.0    8e-13   
ref|XP_006446726.1|  hypothetical protein CICLE_v10015705mg           72.0    8e-13   
gb|AFX68806.1|  O-metyltransferase                                    72.0    9e-13   
ref|XP_006376396.1|  hypothetical protein POPTR_0013s12670g           72.0    9e-13   
ref|XP_010070166.1|  PREDICTED: trans-resveratrol di-O-methyltran...  72.0    9e-13   
ref|XP_011092041.1|  PREDICTED: trans-resveratrol di-O-methyltran...  71.6    1e-12   
ref|XP_008455944.1|  PREDICTED: trans-resveratrol di-O-methyltran...  71.6    1e-12   
ref|XP_003615962.1|  O-methyltransferase                              71.6    1e-12   
sp|Q6VMW0.1|Q8OMT_MENPI  RecName: Full=8-hydroxyquercetin 8-O-met...  71.6    1e-12   Mentha x piperita
gb|KCW44789.1|  hypothetical protein EUGRSUZ_L01645                   71.6    1e-12   
gb|KCW74013.1|  hypothetical protein EUGRSUZ_E026382                  68.6    1e-12   
ref|XP_007142043.1|  hypothetical protein PHAVU_008G247600g           71.6    1e-12   
gb|EYU30782.1|  hypothetical protein MIMGU_mgv1a021078mg              71.6    1e-12   
ref|XP_009612081.1|  PREDICTED: trans-resveratrol di-O-methyltran...  71.6    1e-12   
ref|XP_004170025.1|  PREDICTED: trans-resveratrol di-O-methyltran...  69.3    1e-12   
ref|XP_002517834.1|  o-methyltransferase, putative                    71.6    1e-12   Ricinus communis
ref|XP_008455943.1|  PREDICTED: trans-resveratrol di-O-methyltran...  71.6    1e-12   
ref|XP_003615973.1|  O-methyltransferase                              71.6    1e-12   
ref|XP_002278092.1|  PREDICTED: trans-resveratrol di-O-methyltran...  71.2    1e-12   Vitis vinifera
ref|XP_010111158.1|  Tabersonine 16-O-methyltransferase               71.2    2e-12   
ref|XP_010032853.1|  PREDICTED: trans-resveratrol di-O-methyltran...  71.2    2e-12   
ref|XP_007025514.1|  Flavonoid o-methyltransferase related            71.2    2e-12   
ref|XP_002447425.1|  hypothetical protein SORBIDRAFT_06g000820        71.2    2e-12   Sorghum bicolor [broomcorn]
ref|XP_006431705.1|  hypothetical protein CICLE_v10003093mg           69.7    2e-12   
ref|XP_010023967.1|  PREDICTED: trans-resveratrol di-O-methyltran...  71.2    2e-12   
gb|EYU30737.1|  hypothetical protein MIMGU_mgv1a009866mg              70.9    2e-12   
ref|XP_008362623.1|  PREDICTED: trans-resveratrol di-O-methyltran...  71.2    2e-12   
gb|ABK96707.1|  unknown                                               70.9    2e-12   Populus trichocarpa x Populus deltoides
ref|XP_010023968.1|  PREDICTED: trans-resveratrol di-O-methyltran...  70.9    2e-12   
emb|CDP19711.1|  unnamed protein product                              70.9    2e-12   
gb|KCW74499.1|  hypothetical protein EUGRSUZ_E03211                   70.9    2e-12   
gb|AAB71213.1|  methyltransferase                                     70.9    2e-12   Prunus armeniaca
gb|KGN44538.1|  hypothetical protein Csa_7G328260                     70.5    2e-12   
emb|CDP20594.1|  unnamed protein product                              68.2    2e-12   
gb|KDO73905.1|  hypothetical protein CISIN_1g017835mg                 70.9    2e-12   
ref|XP_006474725.1|  PREDICTED: trans-resveratrol di-O-methyltran...  70.9    2e-12   
ref|XP_006452811.1|  hypothetical protein CICLE_v10008718mg           70.9    2e-12   
ref|XP_002517832.1|  o-methyltransferase, putative                    70.9    2e-12   Ricinus communis
ref|XP_010057348.1|  PREDICTED: trans-resveratrol di-O-methyltran...  70.9    3e-12   
ref|XP_004139732.1|  PREDICTED: trans-resveratrol di-O-methyltran...  70.9    3e-12   
ref|XP_004979195.1|  PREDICTED: O-methyltransferase ZRP4-like         70.5    3e-12   
gb|KDP21023.1|  hypothetical protein JCGZ_21494                       70.5    3e-12   
ref|XP_002437453.1|  hypothetical protein SORBIDRAFT_10g027360        70.5    3e-12   Sorghum bicolor [broomcorn]
ref|XP_008245137.1|  PREDICTED: trans-resveratrol di-O-methyltran...  70.1    3e-12   
ref|XP_002522586.1|  o-methyltransferase, putative                    70.1    4e-12   Ricinus communis
ref|NP_001057265.1|  Os06g0240800                                     70.1    4e-12   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001130621.1|  hypothetical protein                             70.5    4e-12   Zea mays [maize]
ref|XP_006364328.1|  PREDICTED: trans-resveratrol di-O-methyltran...  70.1    4e-12   
emb|CDP11862.1|  unnamed protein product                              67.8    4e-12   
ref|XP_004490687.1|  PREDICTED: trans-resveratrol di-O-methyltran...  70.1    5e-12   
gb|ACF84530.1|  unknown                                               69.7    5e-12   Zea mays [maize]
ref|XP_010916032.1|  PREDICTED: trans-resveratrol di-O-methyltran...  69.7    5e-12   
gb|EAZ00317.1|  hypothetical protein OsI_22334                        70.1    5e-12   Oryza sativa Indica Group [Indian rice]
emb|CDP15884.1|  unnamed protein product                              68.9    5e-12   
sp|P0DH60.1|M3OM2_PEA  RecName: Full=(+)-6a-hydroxymaackiain 3-O-...  69.7    5e-12   
gb|EAZ13570.1|  hypothetical protein OsJ_03485                        70.1    6e-12   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB89545.1|  putative O-methyltransferase                         70.1    6e-12   Oryza sativa Japonica Group [Japonica rice]
emb|CAD29555.1|  orcinol O-methyltransferase                          69.7    6e-12   Rosa hybrid cultivar
emb|CDP15886.1|  unnamed protein product                              69.7    6e-12   
gb|AGQ21572.1|  flavone 8-O-methyltransferase                         69.7    6e-12   
ref|XP_008364163.1|  PREDICTED: trans-resveratrol di-O-methyltran...  69.7    6e-12   
ref|XP_004232927.1|  PREDICTED: trans-resveratrol di-O-methyltran...  69.7    6e-12   
ref|NP_001148593.1|  O-methyltransferase ZRP4                         69.7    6e-12   Zea mays [maize]
gb|AFW78710.1|  O-methyltransferase ZRP4                              69.7    6e-12   
gb|ACF81837.1|  unknown                                               66.6    7e-12   Zea mays [maize]
ref|XP_011077108.1|  PREDICTED: chavicol O-methyltransferase-like     69.7    7e-12   
ref|XP_002537255.1|  o-methyltransferase, putative                    66.2    7e-12   Ricinus communis
sp|O24305.1|M3OM1_PEA  RecName: Full=(+)-6a-hydroxymaackiain 3-O-...  69.3    7e-12   Pisum sativum [garden pea]
ref|XP_002456368.1|  hypothetical protein SORBIDRAFT_03g034845        69.3    1e-11   Sorghum bicolor [broomcorn]
gb|AIY62760.1|  N-acetylserotonin O-methyltransferase                 68.9    1e-11   
ref|XP_002449557.1|  hypothetical protein SORBIDRAFT_05g019040        68.9    1e-11   Sorghum bicolor [broomcorn]
ref|XP_004984099.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...  68.9    1e-11   
ref|XP_008788394.1|  PREDICTED: trans-resveratrol di-O-methyltran...  68.9    1e-11   
ref|XP_004975403.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...  68.9    1e-11   
ref|XP_002517828.1|  o-methyltransferase, putative                    65.9    1e-11   Ricinus communis
ref|XP_008455485.1|  PREDICTED: trans-resveratrol di-O-methyltran...  68.9    1e-11   
gb|EAZ20360.1|  hypothetical protein OsJ_35968                        67.8    1e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008455942.1|  PREDICTED: trans-resveratrol di-O-methyltran...  68.6    1e-11   
gb|KHN07780.1|  Tabersonine 16-O-methyltransferase                    68.2    1e-11   
ref|XP_006388574.1|  hypothetical protein POPTR_0151s00220g           68.2    1e-11   
ref|XP_003527407.1|  PREDICTED: trans-resveratrol di-O-methyltran...  68.6    2e-11   
emb|CAJ65662.1|  putative orcinol O-methyltransferase                 68.6    2e-11   Rosa odorata [tea rose]
gb|EAY75851.1|  hypothetical protein OsI_03768                        66.6    2e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_009345025.1|  PREDICTED: trans-resveratrol di-O-methyltran...  68.6    2e-11   
ref|XP_010052398.1|  PREDICTED: trans-resveratrol di-O-methyltran...  68.6    2e-11   
ref|XP_004158564.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...  68.6    2e-11   
ref|XP_004151906.1|  PREDICTED: trans-resveratrol di-O-methyltran...  68.6    2e-11   
ref|XP_008364164.1|  PREDICTED: trans-resveratrol di-O-methyltran...  68.2    2e-11   
ref|XP_004232928.1|  PREDICTED: trans-resveratrol di-O-methyltran...  68.2    2e-11   
ref|XP_009798851.1|  PREDICTED: trans-resveratrol di-O-methyltran...  65.5    2e-11   
ref|XP_006366911.1|  PREDICTED: trans-resveratrol di-O-methyltran...  66.2    2e-11   
ref|XP_006471149.1|  PREDICTED: trans-resveratrol di-O-methyltran...  68.2    2e-11   
ref|XP_002522501.1|  o-methyltransferase, putative                    68.2    2e-11   Ricinus communis
emb|CBI38115.3|  unnamed protein product                              67.0    2e-11   
ref|XP_003568106.1|  PREDICTED: O-methyltransferase ZRP4-like         68.2    2e-11   
gb|KCW74498.1|  hypothetical protein EUGRSUZ_E03210                   65.1    2e-11   
ref|XP_006469137.1|  PREDICTED: trans-resveratrol di-O-methyltran...  68.2    2e-11   
emb|CAD29556.1|  orcinol O-methyltransferase                          67.8    2e-11   Rosa hybrid cultivar
ref|NP_001066710.1|  Os12g0444800                                     68.2    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011001214.1|  PREDICTED: trans-resveratrol di-O-methyltran...  68.2    2e-11   
ref|XP_002444017.1|  hypothetical protein SORBIDRAFT_07g005970        68.2    2e-11   Sorghum bicolor [broomcorn]
ref|XP_002454762.1|  hypothetical protein SORBIDRAFT_04g036900        68.2    3e-11   Sorghum bicolor [broomcorn]
ref|XP_006377432.1|  6a-hydroxymaackiain methyltransferase family...  68.2    3e-11   
ref|XP_006469063.1|  PREDICTED: trans-resveratrol di-O-methyltran...  68.2    3e-11   
gb|AAR02421.1|  putative O-methyltransferase                          67.8    3e-11   Catharanthus roseus [chatas]
ref|XP_002441380.1|  hypothetical protein SORBIDRAFT_09g025570        67.8    3e-11   Sorghum bicolor [broomcorn]
ref|XP_006365444.1|  PREDICTED: trans-resveratrol di-O-methyltran...  67.8    3e-11   
ref|XP_008649876.1|  PREDICTED: O-methyltransferase ZRP4-like         67.8    3e-11   
ref|XP_006376381.1|  6a-hydroxymaackiain methyltransferase family...  67.4    3e-11   
ref|XP_006364318.1|  PREDICTED: trans-resveratrol di-O-methyltran...  67.4    3e-11   
ref|XP_002442691.1|  hypothetical protein SORBIDRAFT_08g001250        67.0    3e-11   Sorghum bicolor [broomcorn]
pdb|1ZGJ|A  Chain A, Crystal Structure Of Isoflavanone 4'-O-Methy...  67.4    4e-11   
ref|XP_002438878.1|  hypothetical protein SORBIDRAFT_10g027650        67.8    4e-11   Sorghum bicolor [broomcorn]
emb|CAH05085.1|  orcinol O-methyltransferase 3                        67.4    4e-11   Rosa hybrid cultivar
ref|XP_002262833.1|  PREDICTED: trans-resveratrol di-O-methyltran...  67.4    4e-11   Vitis vinifera
sp|Q29U70.1|I4OMT_MEDTR  RecName: Full=Isoflavone 4'-O-methyltran...  67.4    4e-11   Medicago truncatula
ref|NP_001140810.1|  uncharacterized protein LOC100272885             67.4    4e-11   Zea mays [maize]
ref|XP_010920172.1|  PREDICTED: trans-resveratrol di-O-methyltran...  67.4    4e-11   
ref|XP_003536186.1|  PREDICTED: isoflavone 7-O-methyltransferase-...  67.4    4e-11   
ref|XP_002454761.1|  hypothetical protein SORBIDRAFT_04g036890        67.8    4e-11   Sorghum bicolor [broomcorn]
emb|CAH05086.1|  orcinol O-methyltransferase 4                        67.4    4e-11   Rosa hybrid cultivar
emb|CAJ65615.1|  putative orcinol O-methyltransferase                 67.4    4e-11   Rosa chinensis var. spontanea
gb|KDO75191.1|  hypothetical protein CISIN_1g018205mg                 67.4    4e-11   
emb|CAH05088.1|  putative orcinol O-methyltransferase                 67.4    4e-11   Rosa odorata var. gigantea
pdb|1ZGA|A  Chain A, Crystal Structure Of Isoflavanone 4'-o-methy...  67.4    4e-11   
ref|XP_006448856.1|  hypothetical protein CICLE_v10015723mg           67.4    4e-11   
pdb|1ZG3|A  Chain A, Crystal Structure Of The Isoflavanone 4'-o-m...  67.4    4e-11   
ref|XP_002438877.1|  hypothetical protein SORBIDRAFT_10g027640        67.4    4e-11   
ref|XP_006468348.1|  PREDICTED: trans-resveratrol di-O-methyltran...  67.4    4e-11   
ref|XP_003622357.1|  Isoflavone-7-O-methyltransferase                 67.4    4e-11   
gb|AFK37355.1|  unknown                                               65.5    4e-11   
ref|XP_011085639.1|  PREDICTED: chavicol O-methyltransferase-like     67.4    4e-11   
emb|CAJ65659.1|  putative orcinol O-methyltransferase                 67.0    4e-11   
emb|CAJ65629.1|  putative orcinol O-methyltransferase                 67.0    4e-11   
ref|XP_003527405.1|  PREDICTED: trans-resveratrol di-O-methyltran...  67.0    5e-11   
ref|XP_010052330.1|  PREDICTED: trans-resveratrol di-O-methyltran...  67.0    5e-11   
emb|CAJ65627.1|  putative orcinol O-methyltransferase                 67.0    5e-11   
emb|CAJ65636.1|  putative orcinol O-methyltransferase                 67.0    5e-11   
gb|KCW89593.1|  hypothetical protein EUGRSUZ_A018762                  64.3    5e-11   
emb|CAJ65631.1|  putative orcinol O-methyltransferase                 67.0    5e-11   
ref|XP_006468212.1|  PREDICTED: isoflavone 4'-O-methyltransferase...  67.0    5e-11   
gb|KEH30963.1|  isoflavone-7-O-methyltransferase                      67.0    6e-11   
gb|AEQ94124.1|  putative O-methyltransferase                          65.1    6e-11   
gb|KDO35791.1|  hypothetical protein CISIN_1g043665mg                 64.7    6e-11   
gb|EAZ42961.1|  hypothetical protein OsJ_27551                        66.6    6e-11   
ref|XP_006467714.1|  PREDICTED: isoflavone 4'-O-methyltransferase...  67.0    6e-11   
ref|XP_010052388.1|  PREDICTED: isoflavone 4'-O-methyltransferase...  64.7    6e-11   
gb|ACF82933.1|  unknown                                               66.6    7e-11   
ref|NP_001105689.1|  O-methyltransferase ZRP4                         66.6    7e-11   
ref|XP_006467715.1|  PREDICTED: isoflavone 4'-O-methyltransferase...  66.6    7e-11   
emb|CAG27621.1|  putative O-methyltransferase                         63.9    7e-11   
gb|KCW89583.1|  hypothetical protein EUGRSUZ_A01867                   65.1    7e-11   
ref|XP_009344934.1|  PREDICTED: trans-resveratrol di-O-methyltran...  66.6    8e-11   
dbj|BAF36052.1|  O-methyltransferase                                  66.6    8e-11   
ref|XP_002441374.1|  hypothetical protein SORBIDRAFT_09g025530        66.6    8e-11   
ref|XP_010070153.1|  PREDICTED: trans-resveratrol di-O-methyltran...  66.6    8e-11   
ref|XP_004249745.2|  PREDICTED: trans-resveratrol di-O-methyltran...  65.9    9e-11   
ref|XP_010320677.1|  PREDICTED: trans-resveratrol di-O-methyltran...  66.2    9e-11   
ref|XP_010320673.1|  PREDICTED: trans-resveratrol di-O-methyltran...  66.2    9e-11   
ref|XP_006376392.1|  hypothetical protein POPTR_0013s12620g           66.2    1e-10   
ref|XP_010243530.1|  PREDICTED: trans-resveratrol di-O-methyltran...  67.0    1e-10   
emb|CDP19713.1|  unnamed protein product                              66.2    1e-10   
gb|AFK38314.1|  unknown                                               66.2    1e-10   
gb|KCW74011.1|  hypothetical protein EUGRSUZ_E02635                   63.2    1e-10   
ref|XP_004229155.1|  PREDICTED: myricetin O-methyltransferase-lik...  66.2    1e-10   
gb|EEE69517.1|  hypothetical protein OsJ_28977                        65.9    1e-10   
ref|XP_009618299.1|  PREDICTED: trans-resveratrol di-O-methyltran...  66.2    1e-10   
ref|XP_002517833.1|  o-methyltransferase, putative                    66.2    1e-10   
emb|CAH05080.1|  putative orcinol O-methyltransferase                 65.9    1e-10   
gb|KHN30530.1|  Isoflavone 7-O-methyltransferase                      67.0    1e-10   
gb|KCW89595.1|  hypothetical protein EUGRSUZ_A01877                   66.2    1e-10   
ref|NP_001066711.2|  Os12g0445200                                     65.9    1e-10   
ref|XP_002441376.1|  hypothetical protein SORBIDRAFT_09g025540        65.9    1e-10   
ref|NP_001062931.1|  Os09g0344500                                     65.9    1e-10   
emb|CAH05084.1|  orcinol O-methyltransferase 3                        65.9    1e-10   
ref|XP_010070184.1|  PREDICTED: trans-resveratrol di-O-methyltran...  65.9    1e-10   
gb|KCW89582.1|  hypothetical protein EUGRSUZ_A01865                   64.3    1e-10   
ref|XP_008649874.1|  PREDICTED: O-methyltransferase ZRP4-like         65.9    1e-10   
emb|CAJ65617.1|  putative orcinol O-methyltransferase                 65.9    1e-10   
emb|CAH65866.1|  OSIGBa0132I10.2                                      65.9    1e-10   
gb|AAR09603.1|  O-methyltransferase                                   65.9    1e-10   
emb|CAJ65614.1|  putative orcinol O-methyltransferase                 65.9    1e-10   
emb|CAJ65599.1|  putative orcinol O-methyltransferase                 65.9    1e-10   
emb|CAH05081.1|  putative orcinol O-methyltransferase                 65.9    2e-10   
emb|CAJ65656.1|  putative orcinol O-methyltransferase                 65.5    2e-10   
emb|CAJ65639.1|  putative orcinol O-methyltransferase                 65.5    2e-10   
gb|ABA98340.1|  O-methyltransferase ZRP4, putative, expressed         65.9    2e-10   
gb|EAY82987.1|  hypothetical protein OsI_38209                        65.9    2e-10   
emb|CAJ65638.1|  putative orcinol O-methyltransferase                 65.5    2e-10   
emb|CAJ65621.1|  putative orcinol O-methyltransferase                 65.5    2e-10   
emb|CAJ65648.1|  putative orcinol O-methyltransferase                 65.5    2e-10   
ref|XP_004987341.1|  PREDICTED: O-methyltransferase ZRP4-like iso...  65.9    2e-10   
ref|XP_004961502.1|  PREDICTED: O-methyltransferase ZRP4-like iso...  65.9    2e-10   
emb|CAJ65634.1|  putative orcinol O-methyltransferase                 65.5    2e-10   
ref|XP_006376388.1|  6a-hydroxymaackiain methyltransferase family...  65.9    2e-10   
emb|CAJ65618.1|  putative orcinol O-methyltransferase                 65.5    2e-10   
gb|EAZ36630.1|  hypothetical protein OsJ_20976                        64.7    2e-10   
ref|XP_006376386.1|  hypothetical protein POPTR_0013s12560g           65.5    2e-10   
emb|CAJ65622.1|  putative orcinol O-methyltransferase                 65.5    2e-10   
ref|XP_008359464.1|  PREDICTED: trans-resveratrol di-O-methyltran...  65.5    2e-10   
ref|NP_001066698.2|  Os12g0441300                                     63.2    2e-10   
ref|XP_002437452.1|  hypothetical protein SORBIDRAFT_10g027340        65.5    2e-10   
ref|XP_004961504.1|  PREDICTED: O-methyltransferase ZRP4-like         65.5    2e-10   
ref|XP_006421000.1|  hypothetical protein CICLE_v100053481mg          63.9    2e-10   
emb|CAJ65664.1|  putative orcinol O-methyltransferase                 65.5    2e-10   
emb|CAJ65633.1|  putative orcinol O-methyltransferase                 65.5    2e-10   
dbj|BAD69125.1|  putative o-methyltransferase                         65.5    2e-10   
ref|XP_008359463.1|  PREDICTED: trans-resveratrol di-O-methyltran...  65.5    2e-10   
ref|NP_001174714.1|  Os06g0281300                                     65.5    2e-10   
ref|XP_002450325.1|  hypothetical protein SORBIDRAFT_05g003780        65.5    2e-10   
ref|XP_006446725.1|  hypothetical protein CICLE_v10015630mg           65.5    2e-10   
ref|XP_006351391.1|  PREDICTED: trans-resveratrol di-O-methyltran...  65.5    2e-10   
ref|XP_006449423.1|  hypothetical protein CICLE_v10015724mg           65.5    2e-10   
emb|CDP18321.1|  unnamed protein product                              63.5    2e-10   
ref|XP_003564176.2|  PREDICTED: O-methyltransferase ZRP4-like         65.5    2e-10   
ref|XP_002278149.1|  PREDICTED: trans-resveratrol di-O-methyltran...  65.1    2e-10   
emb|CAN73269.1|  hypothetical protein VITISV_021917                   65.1    2e-10   
emb|CBI21922.3|  unnamed protein product                              63.9    2e-10   
gb|AEN94899.1|  desoxyhemigossypol-6-O-methyltransferase              65.1    3e-10   
gb|ABA98018.1|  O-methyltransferase ZRP4, putative                    62.4    3e-10   
ref|XP_006365443.1|  PREDICTED: trans-resveratrol di-O-methyltran...  64.7    3e-10   
emb|CAJ65649.1|  putative orcinol O-methyltransferase                 64.7    3e-10   
gb|EAZ15132.1|  hypothetical protein OsJ_30546                        64.3    3e-10   
gb|AAL31646.1|AC079179_1  Putative o-methyltransferase ZRP4           65.1    3e-10   
gb|EAY77535.1|  hypothetical protein OsI_32574                        65.1    3e-10   
ref|XP_006489775.1|  PREDICTED: isoflavone 4'-O-methyltransferase...  63.9    3e-10   
ref|XP_009351009.1|  PREDICTED: trans-resveratrol di-O-methyltran...  65.1    3e-10   
ref|XP_010920173.1|  PREDICTED: trans-resveratrol di-O-methyltran...  64.7    3e-10   
ref|XP_002442690.1|  hypothetical protein SORBIDRAFT_08g001245        64.7    3e-10   
emb|CAJ65637.1|  putative orcinol O-methyltransferase                 64.7    3e-10   
ref|XP_008779862.1|  PREDICTED: trans-resveratrol di-O-methyltran...  62.8    3e-10   
gb|KCW89592.1|  hypothetical protein EUGRSUZ_A01875                   62.0    4e-10   
ref|XP_002517835.1|  o-methyltransferase, putative                    64.7    4e-10   
ref|XP_009351010.1|  PREDICTED: trans-resveratrol di-O-methyltran...  62.8    4e-10   
emb|CAH05089.1|  putative orcinol O-methyltransferase                 64.7    4e-10   
ref|XP_007132709.1|  hypothetical protein PHAVU_011G118100g           64.7    4e-10   
ref|XP_007132751.1|  hypothetical protein PHAVU_011G1221001g          62.8    4e-10   
ref|XP_007153628.1|  hypothetical protein PHAVU_003G051600g           64.3    4e-10   
ref|XP_008788395.1|  PREDICTED: trans-resveratrol di-O-methyltran...  64.7    4e-10   
emb|CAJ65601.1|  putative orcinol O-methyltransferase                 64.3    4e-10   
emb|CAH05087.1|  orcinol O-methyltransferase 4                        64.3    4e-10   
emb|CAJ65632.1|  putative orcinol O-methyltransferase                 64.3    4e-10   
emb|CAJ65630.1|  putative orcinol O-methyltransferase                 64.3    4e-10   
ref|XP_010916033.1|  PREDICTED: trans-resveratrol di-O-methyltran...  64.3    4e-10   
emb|CAJ65623.1|  putative orcinol O-methyltransferase                 64.3    4e-10   
emb|CAJ65663.1|  putative orcinol O-methyltransferase                 64.3    4e-10   
emb|CAJ65598.1|  putative orcinol O-methyltransferase                 64.3    4e-10   
emb|CAJ65602.1|  putative orcinol O-methyltransferase                 64.3    4e-10   
emb|CAJ65635.1|  putative orcinol O-methyltransferase                 64.3    5e-10   
emb|CAJ65628.1|  putative orcinol O-methyltransferase                 64.3    5e-10   
emb|CAJ65661.1|  putative orcinol O-methyltransferase                 64.3    5e-10   
emb|CAJ65608.1|  putative orcinol O-methyltransferase                 64.3    5e-10   
emb|CAH05090.1|  putative orcinol O-methyltransferase                 64.3    5e-10   
emb|CAJ65611.1|  putative orcinol O-methyltransferase                 64.3    5e-10   
ref|XP_009625456.1|  PREDICTED: trans-resveratrol di-O-methyltran...  64.3    5e-10   
emb|CAJ65641.1|  putative orcinol O-methyltransferase                 64.3    5e-10   
emb|CAJ65609.1|  putative orcinol O-methyltransferase                 64.3    5e-10   
dbj|BAJ93308.1|  predicted protein                                    61.6    5e-10   
emb|CAJ65626.1|  putative orcinol O-methyltransferase                 64.3    5e-10   
ref|NP_001175192.1|  Os07g0463600                                     64.3    5e-10   
emb|CAJ65665.1|  putative orcinol O-methyltransferase                 64.3    5e-10   
emb|CAJ65642.1|  putative orcinol O-methyltransferase                 64.3    5e-10   
emb|CAH05082.1|  putative orcinol O-methyltransferase                 64.3    5e-10   
emb|CAJ65613.1|  putative orcinol O-methyltransferase                 64.3    5e-10   
emb|CAJ65620.1|  putative orcinol O-methyltransferase                 64.3    5e-10   
emb|CAJ65625.1|  putative orcinol O-methyltransferase                 64.3    5e-10   
emb|CAJ65607.1|  putative orcinol O-methyltransferase                 64.3    5e-10   
emb|CAJ65604.1|  putative orcinol O-methyltransferase                 64.3    5e-10   
emb|CAJ65612.1|  putative orcinol O-methyltransferase                 64.3    5e-10   
ref|XP_006420638.1|  hypothetical protein CICLE_v10005279mg           64.3    5e-10   
gb|EAZ20367.1|  hypothetical protein OsJ_35978                        64.3    5e-10   
emb|CAJ65640.1|  putative orcinol O-methyltransferase                 64.3    5e-10   
emb|CAJ65605.1|  putative orcinol O-methyltransferase                 64.3    5e-10   
ref|XP_003574581.2|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...  64.3    5e-10   
emb|CAJ65624.1|  putative orcinol O-methyltransferase                 64.3    5e-10   
emb|CAJ65603.1|  putative orcinol O-methyltransferase                 64.3    5e-10   
ref|XP_006489814.1|  PREDICTED: trans-resveratrol di-O-methyltran...  64.3    6e-10   
ref|XP_006420643.1|  hypothetical protein CICLE_v10005276mg           64.3    6e-10   
emb|CAJ65666.1|  putative orcinol O-methyltransferase                 63.9    6e-10   
gb|EAY82991.1|  hypothetical protein OsI_38213                        64.3    6e-10   
gb|EAY82990.1|  hypothetical protein OsI_38212                        64.3    6e-10   
ref|XP_006420642.1|  hypothetical protein CICLE_v10005275mg           64.3    6e-10   
emb|CAJ65645.1|  putative orcinol O-methyltransferase                 63.9    6e-10   
emb|CAJ65610.1|  putative orcinol O-methyltransferase                 63.9    6e-10   
emb|CAJ65606.1|  putative orcinol O-methyltransferase                 63.9    6e-10   
ref|XP_006388573.1|  hypothetical protein POPTR_0151s00210g           64.3    6e-10   
ref|XP_008354304.1|  PREDICTED: trans-resveratrol di-O-methyltran...  64.3    6e-10   
ref|XP_008343876.1|  PREDICTED: trans-resveratrol di-O-methyltran...  64.3    6e-10   
gb|EMT25245.1|  O-methyltransferase ZRP4                              64.7    6e-10   
gb|KCW74501.1|  hypothetical protein EUGRSUZ_E03213                   63.9    6e-10   
emb|CAH05091.1|  putative orcinol O-methyltransferase                 63.9    6e-10   
ref|XP_003556407.1|  PREDICTED: isoflavone 7-O-methyltransferase-...  63.9    6e-10   
gb|ACU20151.1|  unknown                                               63.9    6e-10   
gb|EMS45261.1|  O-methyltransferase ZRP4                              62.4    7e-10   
gb|ACV65500.1|  deoxyhemigossypol-6-O-methyltransferase               63.9    7e-10   
ref|XP_010680776.1|  PREDICTED: trans-resveratrol di-O-methyltran...  63.9    7e-10   
ref|XP_009605623.1|  PREDICTED: myricetin O-methyltransferase-like    63.9    7e-10   
ref|XP_010057350.1|  PREDICTED: trans-resveratrol di-O-methyltran...  63.9    8e-10   
emb|CAJ65646.1|  putative orcinol O-methyltransferase                 63.5    8e-10   
ref|XP_006364329.1|  PREDICTED: uncharacterized protein LOC102587683  64.7    8e-10   
ref|XP_006656835.1|  PREDICTED: O-methyltransferase ZRP4-like         63.5    8e-10   
gb|EAZ07211.1|  hypothetical protein OsI_29456                        63.5    8e-10   
emb|CAJ65597.1|  putative orcinol O-methyltransferase                 63.5    8e-10   
emb|CAJ65647.1|  putative orcinol O-methyltransferase                 63.5    8e-10   
ref|XP_004979388.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...  63.9    8e-10   
emb|CAJ65657.1|  putative orcinol O-methyltransferase                 63.5    8e-10   
emb|CAJ65643.1|  putative orcinol O-methyltransferase                 63.5    8e-10   
emb|CAJ65660.1|  putative orcinol O-methyltransferase                 63.5    9e-10   
gb|KHG15351.1|  8-hydroxyquercetin 8-O-methyltransferase              63.5    9e-10   
ref|XP_009620258.1|  PREDICTED: trans-resveratrol di-O-methyltran...  60.8    9e-10   
gb|EAZ00519.1|  hypothetical protein OsI_22536                        63.5    9e-10   
ref|XP_010094995.1|  Tabersonine 16-O-methyltransferase               62.8    9e-10   
ref|XP_010916035.1|  PREDICTED: trans-resveratrol di-O-methyltran...  63.5    9e-10   
gb|EMS47465.1|  O-methyltransferase ZRP4                              63.5    9e-10   
ref|NP_001064058.1|  Os10g0118000                                     62.0    9e-10   
gb|AID51450.1|  isoflavone O-methyltransferase                        63.5    9e-10   
ref|XP_002441372.1|  hypothetical protein SORBIDRAFT_09g025510        63.5    1e-09   
gb|ACY41220.1|  O-methyltransferase-like protein                      63.5    1e-09   
emb|CAJ65600.1|  putative orcinol O-methyltransferase                 63.5    1e-09   
emb|CBI30626.3|  unnamed protein product                              61.2    1e-09   
gb|EAY77536.1|  hypothetical protein OsI_32576                        63.5    1e-09   
gb|EMT32848.1|  O-methyltransferase ZRP4                              60.8    1e-09   
ref|XP_008454865.1|  PREDICTED: trans-resveratrol di-O-methyltran...  63.5    1e-09   
ref|XP_006658538.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...  63.5    1e-09   
ref|XP_007143925.1|  hypothetical protein PHAVU_007G114000g           63.5    1e-09   
ref|NP_001147709.1|  LOC100281319                                     63.5    1e-09   
ref|XP_004973447.1|  PREDICTED: O-methyltransferase ZRP4-like         63.5    1e-09   
ref|NP_001064059.1|  Os10g0118200                                     63.5    1e-09   
gb|EMT31218.1|  O-methyltransferase ZRP4                              63.2    1e-09   
ref|XP_007132750.1|  hypothetical protein PHAVU_011G122000g           62.8    1e-09   
emb|CAH05079.1|  putative orcinol O-methyltransferase                 63.2    1e-09   
ref|XP_004951544.1|  PREDICTED: trans-resveratrol di-O-methyltran...  63.2    1e-09   
ref|XP_004983195.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...  63.2    1e-09   
ref|XP_007025515.1|  Flavonoid o-methyltransferase related, putative  63.2    1e-09   
dbj|BAK00087.1|  predicted protein                                    63.2    1e-09   
ref|NP_001140567.1|  hypothetical protein                             63.2    1e-09   
ref|XP_008792251.1|  PREDICTED: trans-resveratrol di-O-methyltran...  63.2    1e-09   
gb|EEC82964.1|  hypothetical protein OsI_27968                        61.2    1e-09   
dbj|BAJ99088.1|  predicted protein                                    63.2    1e-09   
gb|ABD83944.1|  IOMT 4                                                63.2    1e-09   
ref|XP_003536188.1|  PREDICTED: isoflavone 7-O-methyltransferase-...  62.8    1e-09   
gb|EMT16388.1|  O-methyltransferase ZRP4                              63.2    2e-09   
emb|CDP00481.1|  unnamed protein product                              63.5    2e-09   
dbj|BAJ89955.1|  predicted protein                                    63.2    2e-09   
ref|XP_008359605.1|  PREDICTED: trans-resveratrol di-O-methyltran...  61.6    2e-09   
ref|XP_010093977.1|  Tabersonine 16-O-methyltransferase               62.8    2e-09   



>ref|XP_009780941.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=363

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +SIETQI +D +M+ ++ GRER+ K W KLFSDAGFSDY++ PILGLRS+IEVYP
Sbjct  309  ESIETQIFFDMLMMVLVTGRERSEKGWAKLFSDAGFSDYKVTPILGLRSLIEVYP  363



>gb|AAM23004.1|AF502433_1 orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAD29458.1| orcinol O-methyltransferase [Rosa chinensis]
 emb|CAH05077.1| orcinol O-methyltransferase 1 [Rosa chinensis]
Length=367

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +SIETQ+ +D +M+ ++GG+ER  K+W KLF+DAGFSDY+I PI GLRS+IEVYP
Sbjct  313  ESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPISGLRSLIEVYP  367



>gb|AEC13057.1| orcinol O-methyltransferase-like protein [Rosa chinensis]
Length=367

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +SIETQ+ +D +M+ ++ G+ER  K+W KLF+DAGFSDY+I PILGLRS+IEVYP
Sbjct  313  ESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPILGLRSLIEVYP  367



>ref|XP_011091578.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=360

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KS+ET++ +D +M+ I+GGRER  K+W KLFSDAGFSDY I  +LGLRSIIEVYP
Sbjct  306  KSVETKLFFDMLMMTIVGGRERNEKEWAKLFSDAGFSDYRISSLLGLRSIIEVYP  360



>ref|XP_011091580.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=358

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KS+ETQ+ +D +M+ ++GG+ER  K+W KLFSDAGF++Y+I P+LG+RSIIEVYP
Sbjct  304  KSVETQLLFDMLMMTVVGGKERNQKEWAKLFSDAGFTNYKISPLLGIRSIIEVYP  358



>gb|AAM23005.1|AF502434_1 orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAD29459.1| orcinol O-methyltransferase [Rosa chinensis]
 emb|CAH05078.1| orcinol O-methyltransferase 2 [Rosa chinensis]
 dbj|BAQ20440.1| 3,5-dimethoxytoluene [Rosa hybrid cultivar]
Length=366

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +SIETQ+ +D +M+ ++ G+ER  K+W KLF+DAGFSDY+I PILGLRS+IEVYP
Sbjct  312  ESIETQLFFDMLMMALVRGQERNEKEWAKLFTDAGFSDYKITPILGLRSLIEVYP  366



>ref|XP_004303127.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=367

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S+ETQ+ +D +M+ ++ G+ER  K+W KLF+DAGFSDY+I PILGLRS+IEVYP
Sbjct  313  ESMETQLFFDMLMMALVTGKERNEKEWSKLFTDAGFSDYKITPILGLRSLIEVYP  367



>ref|XP_011091583.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S+ETQ+ +D +M+ ++GG+ER  K+W KLF DAGF DY I P+LGLRSIIEVYP
Sbjct  305  ESVETQLLFDMLMMTLVGGKERKEKEWAKLFYDAGFQDYRIYPVLGLRSIIEVYP  359



>ref|XP_006371494.1| hypothetical protein POPTR_0019s12300g [Populus trichocarpa]
 gb|ERP49291.1| hypothetical protein POPTR_0019s12300g [Populus trichocarpa]
Length=121

 Score = 80.1 bits (196),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +SIETQI +D +M+ ++ G+ER  K+W KLFSDAGFS+Y+I PILGLRSIIEV+P
Sbjct  67   ESIETQIFFDMLMMILVTGQERNEKEWAKLFSDAGFSNYKITPILGLRSIIEVFP  121



>ref|XP_009602136.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=361

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +SIETQI +D +M+ ++ GRER+ K W KLF DAGFSDY++ PILGLRS+IEVYP
Sbjct  307  ESIETQIFFDMLMMVLVTGRERSEKGWAKLFLDAGFSDYKVTPILGLRSLIEVYP  361



>emb|CAN73270.1| hypothetical protein VITISV_021918 [Vitis vinifera]
Length=328

 Score = 82.8 bits (203),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +SIETQ+ +D +M+ +L G+ER  KDWEKLF DAGFS Y+I P+LGLRS+IEVYP
Sbjct  274  ESIETQLFWDMLMMIVLTGQERNIKDWEKLFFDAGFSGYKITPMLGLRSLIEVYP  328



>ref|XP_002278190.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score = 82.8 bits (203),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +SIETQ+ +D +M+ +L G+ER  KDWEKLF DAGFS Y+I P+LGLRS+IEVYP
Sbjct  303  ESIETQLFWDMLMMIVLTGQERNIKDWEKLFFDAGFSGYKITPMLGLRSLIEVYP  357



>ref|XP_006428632.1| hypothetical protein CICLE_v10012033mg [Citrus clementina]
 gb|ESR41872.1| hypothetical protein CICLE_v10012033mg [Citrus clementina]
Length=362

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KSIETQ+ +D +M+ +L G ER  K+W KLF+ AGFSDY+IIPILGLRS+IEVYP
Sbjct  308  KSIETQLFFDMLMMVLLTGTERDEKEWTKLFTYAGFSDYKIIPILGLRSLIEVYP  362



>ref|XP_006480453.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=362

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KSIETQ+ +D +M+ +L G ER  K+W KLF+ AGFSDY+IIPILGLRS+IEVYP
Sbjct  308  KSIETQLFFDMLMMVLLTGTERDEKEWTKLFTYAGFSDYKIIPILGLRSLIEVYP  362



>ref|XP_006446728.1| hypothetical protein CICLE_v10015708mg [Citrus clementina]
 gb|ESR59968.1| hypothetical protein CICLE_v10015708mg [Citrus clementina]
Length=362

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +SIETQ+ +D +M+ ++ G ER  K+W KLF+DAGFSDY+I PILGLRS+IEVYP
Sbjct  308  ESIETQLFFDMLMMVLVTGTERDEKEWAKLFADAGFSDYKITPILGLRSLIEVYP  362



>ref|XP_011002662.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +SIETQI +D +M+ +  G+ER  K+W KLFSDAGFS+Y+I PILGLRSIIEV+P
Sbjct  303  ESIETQIFFDMLMMILFTGQERNEKEWAKLFSDAGFSNYKITPILGLRSIIEVFP  357



>ref|XP_011002663.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +SIETQI +D +M+ +  G+ER  K+W KLFSDAGFS+Y+I PILGLRSIIEV+P
Sbjct  303  ESIETQIFFDMLMMILFTGQERNEKEWAKLFSDAGFSNYKITPILGLRSIIEVFP  357



>ref|XP_011091734.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=337

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KS+ETQ+ +D +M+ ++GG+ER  K+W KLF DAGF++Y+I P+LG+RSIIEVYP
Sbjct  283  KSVETQLFFDMLMMTVVGGKERNQKEWAKLFFDAGFTNYKISPLLGIRSIIEVYP  337



>ref|XP_004248183.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=362

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +SIETQI +D +M+ ++ GRER+ + W K+FS+AGFSDY++ PILGLRS+IEVYP
Sbjct  308  ESIETQIFFDMLMMVLVTGRERSERGWAKIFSEAGFSDYKVTPILGLRSLIEVYP  362



>ref|XP_010088036.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXB31255.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=373

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KS ETQ+ +D MM+ +  G+ER  K+W KLF D+GFSDY+IIPILGLRS+IEVYP
Sbjct  319  KSYETQLFFDMMMMVLATGQERNEKEWAKLFQDSGFSDYKIIPILGLRSLIEVYP  373



>ref|XP_006428633.1| hypothetical protein CICLE_v10013393mg [Citrus clementina]
 gb|ESR41873.1| hypothetical protein CICLE_v10013393mg [Citrus clementina]
Length=280

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KSIETQ+ ++  M+ +L G ER  K+W K+F+D+GFSDY+IIPILGLRS+IE+YP
Sbjct  226  KSIETQLFFEMFMMVLLTGTERDEKEWAKIFADSGFSDYKIIPILGLRSLIEIYP  280



>ref|XP_006469135.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=402

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +SIETQ+ +D +M+ ++ G ER  K+W KLF+DAGFSDY+I PILGLRS+IEVYP
Sbjct  348  ESIETQLFFDMLMMVLVTGTERDEKEWAKLFADAGFSDYKITPILGLRSLIEVYP  402



>emb|CBI21926.3| unnamed protein product [Vitis vinifera]
Length=297

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KS+ETQ+ +D +M+ ++ GRER   +WEKLF DAGFS Y+I PILGLRS+IEVYP
Sbjct  243  KSVETQLYFDMVMMILVTGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  297



>gb|ABZ89567.1| O-methyltransferase 3 [Humulus lupulus]
Length=377

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S ETQ+ +D +M+ ++ GRER  K+W KLF DAGFS+Y+I PILGLRS+IEVYP
Sbjct  323  ESYETQLFFDMLMMALVTGRERNEKEWAKLFKDAGFSNYKITPILGLRSLIEVYP  377



>ref|XP_011091736.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=560

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KS+ETQ+  D +M+ IL GRER   +W KLFSDAGF++Y+I PILGLRSIIEVYP
Sbjct  506  KSVETQLFIDMLMMTILRGRERKEIEWAKLFSDAGFTNYKISPILGLRSIIEVYP  560



>ref|XP_002278294.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KS+ETQ+ +D +M+ ++ GRER   +WEKLF DAGFS Y+I PILGLRS+IEVYP
Sbjct  303  KSVETQLYFDMVMMILVTGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>emb|CAN78992.1| hypothetical protein VITISV_005827 [Vitis vinifera]
Length=357

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KS+ETQ+ +D +M+ ++ GRER   +WEKLF DAGFS Y+I PILGLRS+IEVYP
Sbjct  303  KSVETQLYFDMVMMILVTGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_009594948.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=359

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KS ETQ+  DT+M+  + G+ER  ++W KLF DAGFSDY+IIPILGLRS+IEVYP
Sbjct  305  KSFETQLFSDTLMMVHVSGKERNREEWVKLFCDAGFSDYKIIPILGLRSLIEVYP  359



>emb|CBI21929.3| unnamed protein product [Vitis vinifera]
Length=294

 Score = 80.1 bits (196),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KSIETQ+ +D  M+    GRER   +WEKLF DAGFS Y+I PILGLRS+IEVYP
Sbjct  240  KSIETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  294



>ref|XP_006371493.1| hypothetical protein POPTR_0019s12280g [Populus trichocarpa]
 gb|ERP49290.1| hypothetical protein POPTR_0019s12280g [Populus trichocarpa]
Length=283

 Score = 79.7 bits (195),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +SIETQI +D +M+ ++ G+ER  K+W KLFSDAGFS+++I PILGLRSIIEV+P
Sbjct  229  ESIETQIFFDMLMMILVTGQERNEKEWAKLFSDAGFSNFKITPILGLRSIIEVFP  283



>emb|CAN69556.1| hypothetical protein VITISV_027590 [Vitis vinifera]
Length=323

 Score = 80.1 bits (196),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KSIETQ+ +D  M+    GRER   +WEKLF DAGFS Y+I PILGLRS+IEVYP
Sbjct  269  KSIETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  323



>ref|XP_003633249.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KSIETQ+ +D  M+    GRER   +WEKLF DAGFS Y+I PILGLRS+IEVYP
Sbjct  303  KSIETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_003633248.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KSIETQ+ +D  M+    GRER   +WEKLF DAGFS Y+I PILGLRS+IEVYP
Sbjct  303  KSIETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_006346269.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=364

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KS ETQ+  D +M+ +L G+ER+ ++W KLF DAG+SDY+IIPILGLR +IEVYP
Sbjct  310  KSYETQLLIDILMMILLSGKERSQQEWAKLFFDAGYSDYKIIPILGLRCVIEVYP  364



>gb|KDO41475.1| hypothetical protein CISIN_1g0225151mg, partial [Citrus sinensis]
Length=227

 Score = 79.0 bits (193),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KSIETQ+ +D +M+ +L G ER  K+W KLF+ AGFSDY+IIPILGLRS+IEVYP
Sbjct  173  KSIETQLFFDMLMMVLLTGTERDEKEWTKLFTYAGFSDYKIIPILGLRSLIEVYP  227



>ref|XP_011070200.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=458

 Score = 81.3 bits (199),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KS+ETQ+ +DT+++ I  GRER+ K+W KLF DAGFS+Y+I P+LGLRSIIEVYP
Sbjct  404  KSVETQLFFDTLVMTIADGRERSQKEWAKLFFDAGFSNYKISPLLGLRSIIEVYP  458



>ref|XP_006368013.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=353

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KS ETQ+  D +M+  + G+ER  ++W KLFSDAGFSDY+I PILGLRS+IEVYP
Sbjct  299  KSFETQLFLDVLMMVHVSGKERNEQEWAKLFSDAGFSDYKISPILGLRSVIEVYP  353



>emb|CBI21931.3| unnamed protein product [Vitis vinifera]
Length=278

 Score = 79.3 bits (194),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KSIETQ+ +D  M+    GRER   +WEKLF DAGFS Y+I PILGLRS+IEVYP
Sbjct  224  KSIETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  278



>ref|XP_011002666.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            SIETQI +D +M+ ++ G+ER  K+W KLFSDA FS+Y+I PILGLRSIIEV+P
Sbjct  304  SIETQIFFDMLMMILVTGQERNEKEWAKLFSDASFSNYKITPILGLRSIIEVFP  357



>ref|NP_001267963.1| O-methyltransferase [Vitis vinifera]
 gb|AEP17010.1| O-methyltransferase [Vitis vinifera]
Length=357

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KSIETQ+ +D  M+    GRER   +WEKLF DAGFS Y+I PILGLRS+IEVYP
Sbjct  303  KSIETQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_003615966.1| O-methyltransferase [Medicago truncatula]
 gb|AES98924.1| orcinol O-methyltransferase [Medicago truncatula]
Length=360

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S+ETQ+ +D +M+ +L G+ER  K+W KL S AGFSDY+I PILGLRS+IE+YP
Sbjct  306  ESVETQLFFDMLMMVVLAGKERNKKEWIKLISSAGFSDYKITPILGLRSLIEIYP  360



>ref|XP_006366298.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=365

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +SIETQI +D +M+ ++ GRER+ + W K+F +AGFSDY++ PILGLRS+IEVYP
Sbjct  311  ESIETQIFFDMLMMVLVTGRERSERGWAKIFFEAGFSDYKVTPILGLRSLIEVYP  365



>gb|KDO36159.1| hypothetical protein CISIN_1g040309mg, partial [Citrus sinensis]
Length=100

 Score = 75.9 bits (185),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S+ETQ+C+D +M+ +  G+ER+  DW+KLF  AGFS Y+I PILG+RS+IE YP
Sbjct  46   ESMETQLCFDILMVSLFRGKERSVDDWKKLFLAAGFSHYKITPILGVRSLIEAYP  100



>ref|XP_002278211.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S+ETQ+ +D +M+ ++ G+ER  K+WEKLF DAGFS Y+I PILGLRS+IEVYP
Sbjct  303  ESMETQLFFDMLMMILVTGQERNEKEWEKLFLDAGFSGYKITPILGLRSLIEVYP  357



>emb|CAN61955.1| hypothetical protein VITISV_020020 [Vitis vinifera]
Length=357

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S+ETQ+ +D +M+ ++ G+ER  K+WEKLF DAGFS Y+I PILGLRS+IEVYP
Sbjct  303  ESMETQLFFDMLMMILVTGQERNEKEWEKLFLDAGFSGYKITPILGLRSLIEVYP  357



>ref|XP_002278398.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
 emb|CBI21930.3| unnamed protein product [Vitis vinifera]
Length=358

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            ++ETQ+ +D +M+ +L GRER  K+W+KLF D+GFS Y+I PILGLRS+IEVYP
Sbjct  305  NVETQLFFDMLMMVLLPGREREEKEWKKLFLDSGFSGYKITPILGLRSLIEVYP  358



>ref|XP_002278517.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=359

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            ++ETQ+ +D +M+ +L GRER  K+W+KLF D+GFS Y+I PILGLRS+IEVYP
Sbjct  306  NVETQLFFDMLMMVLLPGREREEKEWKKLFLDSGFSGYKITPILGLRSLIEVYP  359



>emb|CAN79968.1| hypothetical protein VITISV_043678 [Vitis vinifera]
Length=357

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KSIETQ+ +D  M+    GRER   +WEK+F DAGFS Y+I PILGLRS+IEVYP
Sbjct  303  KSIETQLFFDMTMMIFSAGRERDENEWEKIFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_006346268.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=353

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KS E+Q+  D +M+  + G+ER  ++W KLFSDAGFSDY+I PILGLRS+IEVYP
Sbjct  299  KSFESQLFLDVLMMVHVSGKERNEQEWAKLFSDAGFSDYKISPILGLRSVIEVYP  353



>ref|XP_002525159.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF37286.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +SIE+Q+ +D +M+ +  G++R  K+W KLF DAGFSDY+I PILGLRS+IEVYP
Sbjct  302  QSIESQLFFDMLMMTLQTGKQRNKKEWGKLFLDAGFSDYKITPILGLRSVIEVYP  356



>ref|XP_003569832.1| PREDICTED: LOW QUALITY PROTEIN: O-methyltransferase ZRP4-like 
[Brachypodium distachyon]
Length=371

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            ++ ETQ+ +D MM+G++G  ER  ++W K+F DAGFS Y+I+P+LG+RS+IEVYP
Sbjct  317  RATETQLLWDVMMMGVVGSPERDEREWSKIFDDAGFSGYKILPLLGIRSVIEVYP  371



>gb|KDP24057.1| hypothetical protein JCGZ_25714 [Jatropha curcas]
Length=307

 Score = 77.8 bits (190),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            SIETQ+ +D MM+ +  G+ER  ++W KLFSDAGFSDY+I   LGLRS+IEVYP
Sbjct  254  SIETQLFFDMMMMVLFNGKERNKEEWAKLFSDAGFSDYKITHKLGLRSVIEVYP  307



>ref|XP_002281368.2| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KS ETQ+ +D  M+    GRER   +WEKLF DAGFS Y+I PILGLRS+IEVYP
Sbjct  303  KSTETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>gb|AEF97347.1| O-methyltransferase [Vitis pseudoreticulata]
Length=357

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KS ETQ+ +D  M+    GRER   +WEKLF DAGFS Y+I PILGLRS+IEVYP
Sbjct  303  KSTETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>emb|CBI21932.3| unnamed protein product [Vitis vinifera]
Length=436

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            ++ETQ+ +D +M+ +L GRER  K+W+KLF D+GFS Y+I PILGLRS+IEVYP
Sbjct  383  NVETQLFFDMLMMVLLPGREREEKEWKKLFLDSGFSGYKITPILGLRSLIEVYP  436



>ref|XP_011091579.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=358

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S+ETQ+ +D +M+ +LGG+ER  K+W  LFS AGF  Y I PILGLRSIIE+YP
Sbjct  304  ESVETQLQFDMIMMTLLGGKERKEKEWANLFSGAGFQGYRIYPILGLRSIIEIYP  358



>emb|CBI22002.3| unnamed protein product [Vitis vinifera]
Length=114

 Score = 75.1 bits (183),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KS ETQ+ +D  M+    GRER   +WEKLF DAGFS Y+I PILGLRS+IEVYP
Sbjct  60   KSTETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  114



>emb|CBI22005.3| unnamed protein product [Vitis vinifera]
Length=309

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KS ETQ+ +D  M+    GRER   +WEKLF DAGFS Y+I PILGLRS+IEVYP
Sbjct  255  KSTETQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  309



>gb|AFX68805.1| O-metyltransferase [Vitis riparia]
Length=357

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KSIETQ+ +D  M     GRER   +WEKLF DAGFS Y+I PILGLRS+IEVYP
Sbjct  303  KSIETQLFFDMTMTIFAPGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_004252468.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=362

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KS ETQ+ +D +M+  + G+ER  +DW KLF  AGFSDY IIP+LGLRSIIEV+P
Sbjct  308  KSYETQLFFDMLMMVHVSGKERNQQDWAKLFCSAGFSDYNIIPMLGLRSIIEVFP  362



>ref|XP_002326036.2| hypothetical protein POPTR_0019s12290g [Populus trichocarpa]
 gb|EEF00418.2| hypothetical protein POPTR_0019s12290g [Populus trichocarpa]
Length=357

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            S ETQ+ +D +M+ ++ G+ER  K+W KLF+DAGFS+Y+I P+LGLRS+IEVYP
Sbjct  304  STETQLFFDMLMMILVTGKERNEKEWAKLFTDAGFSNYKINPVLGLRSLIEVYP  357



>emb|CBI21924.3| unnamed protein product [Vitis vinifera]
Length=187

 Score = 76.3 bits (186),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S+ETQ+ +D +M+ ++ G+ER  K+WEKLF DAGFS Y+I PILGLRS+IEVYP
Sbjct  133  ESMETQLFFDMLMMILVTGQERNEKEWEKLFLDAGFSGYKITPILGLRSLIEVYP  187



>emb|CAA11131.1| O-methyltransferase [Prunus dulcis]
Length=356

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +SIETQ+ +D +M+ +  G+ER  K+W KLFSDAGFSDY+I PI GLR +IEVYP
Sbjct  302  QSIETQLFFDMLMMVLFTGKERTEKEWAKLFSDAGFSDYKITPICGLRYLIEVYP  356



>emb|CDP20221.1| unnamed protein product [Coffea canephora]
Length=69

 Score = 73.6 bits (179),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVY  164
            ++IETQ+ +D +++ +L GR+R  KDW KLF++AGFSDY+I  +LGLRSIIEVY
Sbjct  14   EAIETQLFFDMLVMVLLKGRQRNEKDWAKLFTEAGFSDYKITAVLGLRSIIEVY  67



>emb|CAQ76879.1| resveratrol O-methyltransferase [Vitis vinifera]
Length=357

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KS ETQ+ +D  M+    GRER   +WEKLF DAGFS Y+I PILGLRS+IEVYP
Sbjct  303  KSTETQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>sp|B6VJS4.2|ROMT_VITVI RecName: Full=Trans-resveratrol di-O-methyltransferase; AltName: 
Full=Resveratrol O-methyltransferase; Short=ROMT; Short=VvROMT 
[Vitis vinifera]
Length=357

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KS ETQ+ +D  M+    GRER   +WEKLF DAGFS Y+I PILGLRS+IEVYP
Sbjct  303  KSTETQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>gb|ABQ02270.2| O-methyltransferase [Vitis vinifera]
Length=357

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KS ETQ+ +D  M+    GRER   +WEKLF DAGFS Y+I PILGLRS+IEVYP
Sbjct  303  KSTETQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_003615967.1| O-methyltransferase [Medicago truncatula]
 gb|AES98925.1| orcinol O-methyltransferase [Medicago truncatula]
Length=359

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 32/55 (58%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S+ETQ+ +D +M+ +L G+ER  K+W KL S AGF+DY+I PILGLRS+IE+YP
Sbjct  305  ESVETQLFFDMLMMALLTGKERNEKEWMKLISLAGFNDYKITPILGLRSMIEIYP  359



>ref|XP_006469138.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=551

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S+ETQ+C+D +M+ +  G+ER+  DW+KLF  AGFS Y+I PILG+RS+IE YP
Sbjct  497  ESMETQLCFDILMVSLFRGKERSVDDWKKLFLAAGFSHYKITPILGVRSLIEAYP  551



>ref|XP_006469069.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=353

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S+ETQ+C+D +M+ +  G+ER+  DW+KLF  AGFS Y+I P+LG+RS+IE YP
Sbjct  299  ESMETQLCFDILMVSLFRGKERSVDDWKKLFLAAGFSHYKITPMLGVRSLIEAYP  353



>ref|XP_004235335.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=445

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KS ETQ+  D +M+  + G+ER  ++W KLFS+AGFSDY+I PILGLRS+IEVYP
Sbjct  391  KSFETQLFSDVLMMVHVSGKERNEQEWAKLFSNAGFSDYKISPILGLRSVIEVYP  445



>ref|XP_002525160.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF37287.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 32/55 (58%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            + +ETQ  +D +++ +  G+E+  KDW KLF DAGFSDY+I PILGLRS+IEVYP
Sbjct  302  QDVETQFFFDILLMTLQTGKEKNNKDWGKLFMDAGFSDYKINPILGLRSVIEVYP  356



>gb|EMS57517.1| 5-pentadecatrienyl resorcinol O-methyltransferase [Triticum urartu]
Length=318

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            ++ ETQ+ +D MM+G++G  ER  ++W K+F DAGFS Y+I+ ILG+RS+IEVYP
Sbjct  264  RATETQLLWDVMMMGVVGSPERDEREWRKIFDDAGFSGYKILAILGIRSVIEVYP  318



>gb|KDO37374.1| hypothetical protein CISIN_1g023625mg [Citrus sinensis]
Length=279

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S+ETQ+C+D +M+ +  G+ER+  DW+KLF  AGFS Y+I P+LG+RS+IE YP
Sbjct  225  ESMETQLCFDILMVSLFRGKERSVDDWKKLFLAAGFSHYKITPMLGVRSLIEAYP  279



>ref|XP_002517827.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44345.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  9    IETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVY  164
            +ETQ+ YD +M+ +  G+ER  K+W KLF DAGFS+Y+I PILGLRS+IEVY
Sbjct  304  VETQLFYDMLMMALQTGKERNNKEWGKLFLDAGFSNYKITPILGLRSVIEVY  355



>ref|XP_009764108.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=360

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KS ETQ+  D +M+  + G+ER  ++W KLF DAGFSDY+I PILGLRS+IEVYP
Sbjct  306  KSFETQLFSDILMMVHVSGKERNREEWAKLFCDAGFSDYKINPILGLRSVIEVYP  360



>ref|XP_008229108.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=355

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S ETQ+ +D +M+ ++ G+ER  K+W KLFSDAGFS Y+I P LGLRS+IEVYP
Sbjct  301  ESGETQLFFDMLMMVLVKGKERNEKEWAKLFSDAGFSHYKITPCLGLRSLIEVYP  355



>ref|NP_001268044.1| trans-resveratrol di-O-methyltransferase [Vitis vinifera]
 gb|AEP17011.1| O-methyltransferase [Vitis vinifera]
Length=357

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KSIETQ+ +D  M+    GRER   +WEKLF  AGFS Y+I PILGLRS+IEVYP
Sbjct  303  KSIETQLFFDMTMMIFAPGRERDENEWEKLFLGAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_010052409.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW89598.1| hypothetical protein EUGRSUZ_A01881 [Eucalyptus grandis]
Length=358

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +++ETQ+ YD +M+ +  GRER   +W KLF  AGF DY+I P+LGLRS+IEVYP
Sbjct  304  ETVETQLFYDMLMMTLASGRERNEAEWAKLFVAAGFGDYKITPVLGLRSLIEVYP  358



>gb|EMT18419.1| O-methyltransferase ZRP4 [Aegilops tauschii]
Length=461

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            ++ ETQ+ +D MM+G++G  ER  ++W K+F DAGFS Y+I+ ILG+RS+IEVYP
Sbjct  407  RATETQLLWDVMMMGVVGSPERDEREWRKIFDDAGFSGYKILAILGIRSVIEVYP  461



>emb|CDP19709.1| unnamed protein product [Coffea canephora]
Length=348

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S+ETQ   D  ML   G +ER  K+W K+F DAGFSDY+++P+LG+R +IEVYP
Sbjct  294  ESVETQFVVDMQMLTCYGAKERTEKEWAKVFQDAGFSDYKVLPVLGVRCLIEVYP  348



>ref|XP_011100227.1| PREDICTED: 8-hydroxyquercetin 8-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            K+IETQ+ +D +M+ +  GRER  KDW +LF  AGF+ Y+I P+LGLRS+IE++P
Sbjct  305  KAIETQLFFDMLMMNVASGRERTEKDWAELFFAAGFTSYKITPVLGLRSLIELFP  359



>emb|CDP15888.1| unnamed protein product [Coffea canephora]
Length=362

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVY  164
            ++IETQ+ +D +M+  + GRER  KDWEKLF +AGF+ Y+I P+LGLRSIIEVY
Sbjct  307  EAIETQLFFDMLMMVHVKGRERNEKDWEKLFLEAGFNGYKITPVLGLRSIIEVY  360



>ref|XP_008455550.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
melo]
Length=267

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            SIETQ+ +D +M+ + GG+ER  K+W KL  +AGFS Y+I PILGLRS+IE+YP
Sbjct  214  SIETQLFHDMLMMVVTGGKEREEKEWAKLIKEAGFSAYKIFPILGLRSLIEIYP  267



>emb|CDP17644.1| unnamed protein product [Coffea canephora]
Length=347

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVY  164
            ++IETQ+ +D +M+ ++ GRER  KDW KLF +AGF+ Y+I P+LGLRSIIEVY
Sbjct  292  EAIETQLFFDMLMMVLVKGRERNEKDWAKLFFEAGFNGYKITPVLGLRSIIEVY  345



>ref|XP_010040912.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW44790.1| hypothetical protein EUGRSUZ_L01646 [Eucalyptus grandis]
Length=357

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  9    IETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +ETQ+ YD +M+ +  GRER   +W KLF  AGF DY+I P+LGLRS+IEVYP
Sbjct  304  VETQLFYDMLMMTLTSGRERNEAEWAKLFVAAGFGDYKITPVLGLRSLIEVYP  356



>ref|XP_010058047.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
Length=359

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  9    IETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +ETQ+ YD +M+ +  GRER   +W KLF  AGF DY+I P+LGLRS+IEVYP
Sbjct  306  VETQLFYDMLMMTLTSGRERNEAEWAKLFVAAGFGDYKITPVLGLRSLIEVYP  358



>ref|XP_010058046.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
Length=359

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  9    IETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +ETQ+ YD +M+ +  GRER   +W KLF  AGF DY+I P+LGLRS+IEVYP
Sbjct  306  VETQLFYDMLMMTLASGRERNEAEWAKLFVAAGFGDYKITPVLGLRSLIEVYP  358



>gb|KCW75545.1| hypothetical protein EUGRSUZ_E04305 [Eucalyptus grandis]
Length=359

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  9    IETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +ETQ+ YD +M+ +  GRER   +W KLF  AGF DY+I P+LGLRS+IEVYP
Sbjct  306  VETQLFYDMLMMTLASGRERNEAEWAKLFVAAGFGDYKITPVLGLRSLIEVYP  358



>emb|CDM84119.1| unnamed protein product [Triticum aestivum]
Length=360

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            ++ ETQ+ +D MM+G++G  ER   +W K+F DAGFS Y+I+ ILG+RS+IEVYP
Sbjct  306  RATETQLLWDVMMMGVVGSPERDEGEWRKIFDDAGFSGYKILAILGIRSVIEVYP  360



>ref|XP_002278316.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=359

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  9    IETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +ETQ+  D +M+ +  GRER  K+W+KLF D+GFS Y+I PILGLRS+IEVYP
Sbjct  307  VETQLFMDMLMMVLYPGREREEKEWKKLFLDSGFSGYKITPILGLRSLIEVYP  359



>emb|CDP21551.1| unnamed protein product [Coffea canephora]
Length=269

 Score = 73.9 bits (180),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVY  164
            ++IETQ+ +D +M+    GRER  KDWEKLF +AGF+ Y+I P+LGLRSIIEVY
Sbjct  214  EAIETQLFFDILMMVHAKGRERNEKDWEKLFLEAGFNGYKITPVLGLRSIIEVY  267



>gb|KCW89599.1| hypothetical protein EUGRSUZ_A01884 [Eucalyptus grandis]
Length=357

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  9    IETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +ETQ+ YD +M+ ++ GRER   +W KLF  AGF DY+I P LGLRS+IEVYP
Sbjct  304  VETQLFYDMLMMTLVSGRERNEAEWAKLFVTAGFGDYKITPALGLRSLIEVYP  356



>ref|XP_010070255.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
Length=359

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  9    IETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +ETQ+ YD +M+ ++ GRER   +W KLF  AGF DY+I P LGLRS+IEVYP
Sbjct  306  VETQLFYDMLMMTLVSGRERNEAEWAKLFVTAGFGDYKITPALGLRSLIEVYP  358



>emb|CAN70493.1| hypothetical protein VITISV_002330 [Vitis vinifera]
Length=363

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  9    IETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +ETQ+  D +M+ +  GRER  K+W+KLF D+GFS Y+I PILGLRS+IEVYP
Sbjct  311  VETQLFXDMLMMVLXPGREREEKEWKKLFLDSGFSGYKITPILGLRSLIEVYP  363



>ref|XP_010260367.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nelumbo 
nucifera]
Length=366

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  12   ETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            ETQ+ +D +M+G++ GRER+ ++ EKL  +AGF+ Y+IIPILGLRS+IEVYP
Sbjct  315  ETQLLFDMLMMGLVTGRERSKQELEKLLLEAGFTHYKIIPILGLRSLIEVYP  366



>ref|XP_008229106.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=391

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KSIETQ+ +D +M+  L G+ER+  +WEKLF  AGFS Y+I  ILGLRS+IEVYP
Sbjct  337  KSIETQLMWDILMMVDLNGKERSEAEWEKLFLTAGFSHYKITHILGLRSLIEVYP  391



>emb|CBI21927.3| unnamed protein product [Vitis vinifera]
Length=277

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  9    IETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +ETQ+  D +M+ +  GRER  K+W+KLF D+GFS Y+I PILGLRS+IEVYP
Sbjct  225  VETQLFMDMLMMVLYPGREREEKEWKKLFLDSGFSGYKITPILGLRSLIEVYP  277



>emb|CDP21231.1| unnamed protein product [Coffea canephora]
Length=69

 Score = 70.9 bits (172),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVY  164
            ++IETQ+ +  +M+ +  GR+R  KDW KLF++ GFSDY+I  +LGLRSIIEVY
Sbjct  14   EAIETQLLFHMLMMVLFKGRQRNEKDWAKLFTETGFSDYKITAVLGLRSIIEVY  67



>ref|XP_010110665.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXC27580.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=384

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 32/55 (58%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S ETQ+ +D +M+ +L GRER   +W KLF DAGFS Y+I PILG+RS+IEV+P
Sbjct  330  QSYETQLFFDMLMMVLLSGRERKETEWAKLFFDAGFSTYKITPILGVRSLIEVFP  384



>emb|CBI21921.3| unnamed protein product [Vitis vinifera]
Length=306

 Score = 73.9 bits (180),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            K++ETQ+  D +M+ ++ G+ER  K+WEKLF  AGF+ Y+I P LGLRS+IEVYP
Sbjct  252  KAVETQLFIDMLMMVVVAGKERNEKEWEKLFLAAGFTHYKITPALGLRSLIEVYP  306



>ref|XP_003544914.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X1 [Glycine max]
Length=358

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S+ETQ+ +D +M+ ++ G+ER+ K+W KL S AG+++Y+I P+LGLRS+IE+YP
Sbjct  304  ESVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNYKITPVLGLRSLIEIYP  358



>ref|XP_003544912.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
1 [Glycine max]
Length=358

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S+ETQ+ +D +M+ ++ G+ER+ K+W KL S AG+++Y+I P+LGLRS+IE+YP
Sbjct  304  ESVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNYKITPVLGLRSLIEIYP  358



>gb|KHN08844.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=329

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S+ETQ+ +D +M+ ++ G+ER+ K+W KL S AG+++Y+I P+LGLRS+IE+YP
Sbjct  275  ESVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNYKITPVLGLRSLIEIYP  329



>ref|XP_011100228.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=367

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            K+IETQ+ +D +++ +  GR+R  KDW +LFS AGF+ Y+I P+LGLRS+IE++P
Sbjct  313  KAIETQLFFDMLIMNLASGRQRTEKDWAELFSAAGFTSYKITPVLGLRSLIELFP  367



>ref|XP_003633245.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            K++ETQ+  D +M+ ++ G+ER  K+WEKLF  AGF+ Y+I P LGLRS+IEVYP
Sbjct  303  KAVETQLFIDMLMMVVVAGKERNEKEWEKLFLAAGFTHYKITPALGLRSLIEVYP  357



>emb|CAN67020.1| hypothetical protein VITISV_040589 [Vitis vinifera]
Length=280

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            K +ETQ+  D +M+ ++ G+ER  K+WEKLF  AGF+ Y+I P LGLRS+IEVYP
Sbjct  226  KEVETQLFMDMLMMVVVAGKERNEKEWEKLFLAAGFTHYKITPALGLRSLIEVYP  280



>ref|XP_004163430.1| PREDICTED: LOW QUALITY PROTEIN: trans-resveratrol di-O-methyltransferase-like 
[Cucumis sativus]
Length=354

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            S+ETQ+ +D +M+ ++GG+ER  K+W KL  +AGF  Y+I PI+G+RS++E+YP
Sbjct  301  SMETQLLFDMLMMTLVGGKEREEKEWAKLIKEAGFGSYKIFPIMGVRSLVEIYP  354



>ref|XP_002538902.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF23481.1| o-methyltransferase, putative [Ricinus communis]
Length=228

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  9    IETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVY  164
            +ETQ+ +D +M+ +  G+ER  K+W KLF DAGFS+Y+I PILGLRS+IEVY
Sbjct  176  VETQLFFDMLMMALQTGKERNNKEWGKLFLDAGFSNYKITPILGLRSVIEVY  227



>emb|CDP19839.1| unnamed protein product [Coffea canephora]
Length=334

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVY  164
            ++IETQ+CYD  ++ +  GR+   KDW KLFS+AGF DY+I  +LGLRSIIEVY
Sbjct  279  EAIETQLCYDMEVMALGKGRQINEKDWAKLFSEAGFCDYKITAVLGLRSIIEVY  332



>emb|CDP21787.1| unnamed protein product [Coffea canephora]
Length=365

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVY  164
            ++IETQ+ +D  ++ +L GR+R  KDW KLF++AGFSDY+I  +LGLRSIIEVY
Sbjct  310  ETIETQLFFDMEVMVLLKGRQRNEKDWAKLFTEAGFSDYKITAVLGLRSIIEVY  363



>ref|XP_002305103.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|EEE85614.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  12   ETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            ET++ +D +M+ +  G+ER+ K+WEKLF +AGFS Y+I P+ GLRS+IEVYP
Sbjct  308  ETKLLFDMLMMVVAAGKERSVKEWEKLFLEAGFSHYKITPLFGLRSLIEVYP  359



>ref|XP_007043718.1| Flavonoid o-methyltransferase related [Theobroma cacao]
 gb|EOX99549.1| Flavonoid o-methyltransferase related [Theobroma cacao]
Length=364

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            SIETQ+ +D +M+ ++ G+ER  ++W  LF  AGFSDY+I PI+GLRS+IEVYP
Sbjct  311  SIETQLFFDMLMMVLVTGKERNEEEWATLFLAAGFSDYKITPIMGLRSLIEVYP  364



>gb|KDP24062.1| hypothetical protein JCGZ_25719 [Jatropha curcas]
Length=358

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            K+ ET   YD  ML ++ G+ER  KDW KLF DAGFS+Y+I P+LGLRSIIEV+P
Sbjct  304  KATETIQLYDLEMLVLVSGQERNEKDWAKLFFDAGFSNYKINPVLGLRSIIEVFP  358



>ref|XP_010040590.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like, partial 
[Eucalyptus grandis]
Length=326

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  9    IETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +ETQ+ YD +M+ +  GRER   +W KLF  AGF DY+I P+LGLRS+IEVYP
Sbjct  273  VETQLFYDMLMMTLAVGRERNQAEWAKLFIAAGFGDYKITPVLGLRSLIEVYP  325



>emb|CDP21583.1| unnamed protein product [Coffea canephora]
Length=307

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVY  164
            ++IETQ+ +D +M+ +L GRER  KDW KLF  AGF+DY+I   LGLRSIIEVY
Sbjct  252  EAIETQLLFDMLMMVLLKGRERNEKDWAKLFFGAGFNDYKITAALGLRSIIEVY  305



>ref|XP_004303135.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=365

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KS ETQ+ +D +M+  L GRER  KDWEKLF  AGFS Y+I   LG+RS IEVYP
Sbjct  311  KSTETQLFWDMLMMVCLTGRERTEKDWEKLFLAAGFSHYKITHTLGIRSFIEVYP  365



>ref|XP_010110664.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXC27579.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=377

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +3

Query  12   ETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            ETQI +D +M+    GRER   +W KLFSDAGFS Y+I PILG+RS+IEV+P
Sbjct  326  ETQILFDMLMMVSFPGRERKETEWAKLFSDAGFSTYKITPILGVRSLIEVFP  377



>gb|KCW45078.1| hypothetical protein EUGRSUZ_L01321 [Eucalyptus grandis]
Length=331

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  9    IETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +ETQ+ YD +M+ +  GRER   +W KLF  AGF DY+I P+LGLRS+IEVYP
Sbjct  278  VETQLFYDMLMMTLAVGRERNQAEWAKLFIAAGFGDYKITPVLGLRSLIEVYP  330



>emb|CDP21212.1| unnamed protein product [Coffea canephora]
Length=324

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVY  164
            ++IETQ+ +D  ++ ++ GR+R  KDW KLF++AGFSDY+I  +LGLRSIIEVY
Sbjct  269  EAIETQLFFDMAVMVLVKGRQRNEKDWAKLFTEAGFSDYKITAVLGLRSIIEVY  322



>gb|KGN43480.1| hypothetical protein Csa_7G039280 [Cucumis sativus]
Length=380

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            S+ETQ+ +D +M+ ++GG+ER  K+W KL  +AGF  Y+I PI+G+RS++E+YP
Sbjct  327  SMETQLLFDMLMMTLVGGKEREEKEWAKLIKEAGFGSYKIFPIMGVRSLVEIYP  380



>emb|CBI30627.3| unnamed protein product [Vitis vinifera]
Length=114

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  12   ETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            E ++ +D +M+ ++ GRER  K+WEKLF +AGFS Y+I PI GLRS+IEV+P
Sbjct  63   EAKLLFDLLMMTVVTGRERNEKEWEKLFLEAGFSHYKINPIFGLRSLIEVFP  114



>ref|XP_010093978.1| Tabersonine 16-O-methyltransferase [Morus notabilis]
 gb|EXB54965.1| Tabersonine 16-O-methyltransferase [Morus notabilis]
Length=364

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KS ETQ+ +D +M+  L GRER  K+WE LF  AGFS Y+I PI+GLRS++EVYP
Sbjct  310  KSAETQLYFDMLMMVNLTGRERNQKEWESLFVAAGFSHYKITPIVGLRSLMEVYP  364



>ref|XP_007142077.1| hypothetical protein PHAVU_008G250700g [Phaseolus vulgaris]
 gb|ESW14071.1| hypothetical protein PHAVU_008G250700g [Phaseolus vulgaris]
Length=357

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S ETQ+ +D +M+    G+ER  K+W KLFS AGF++Y+I P++GLRS+IE+YP
Sbjct  303  ESFETQLFFDMLMMVFFTGKERNKKEWVKLFSSAGFNNYKITPVVGLRSLIEIYP  357



>ref|XP_009376908.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Pyrus 
x bretschneideri]
Length=382

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KSIETQ+ +D +M+  + G+ER+  +WEK+F  AGFS Y I  +LGLRS+IEVYP
Sbjct  328  KSIETQLMFDMLMMSTITGKERSESEWEKIFLAAGFSHYNITHMLGLRSLIEVYP  382



>ref|XP_008343875.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Malus 
domestica]
Length=382

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KSIETQ+ +D +M+  + G+ER+  +WEK+F  AGFS Y I  +LGLRS+IEVYP
Sbjct  328  KSIETQLMFDMLMMSTITGKERSESEWEKIFLAAGFSHYNITHMLGLRSLIEVYP  382



>ref|XP_010097399.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXB67905.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=384

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S ETQ+ +D +M+ +  GRER   +W KLFSDAGF+ Y+I PILG+RS+IEV+P
Sbjct  330  QSYETQLFFDMLMMVLYPGRERKETEWAKLFSDAGFNTYKITPILGVRSLIEVFP  384



>gb|ACU19152.1| unknown [Glycine max]
Length=282

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S+ETQ+ +D +M+ ++ G+ER+ K+W KL S AG+++Y+I P+ GLRS+IE+YP
Sbjct  228  ESVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNYKITPVFGLRSLIEIYP  282



>ref|XP_004151735.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
sativus]
Length=357

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            SIETQ+ YD +M+ + GG+ER  K+W KL  +AGF  Y+I PIL LRS+IE+YP
Sbjct  304  SIETQLLYDMLMMIVPGGKEREEKEWAKLIKEAGFRAYKIFPILDLRSLIEIYP  357



>gb|KHN08846.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=263

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S+ETQ+ +D +M+ ++ G+ER+ K+W KL S AG+++Y+I P+LGLRS+IE+YP
Sbjct  209  ESVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNYKITPVLGLRSLIEIYP  263



>emb|CDP19708.1| unnamed protein product [Coffea canephora]
Length=212

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVY  164
            ++IETQ+  D +M+ +L G++R  ++W KLFS+AGF+DY+I P+LGLRS++EVY
Sbjct  158  EAIETQLFSDMLMMVLLRGKQRNEREWAKLFSEAGFNDYKITPVLGLRSLVEVY  211



>ref|XP_004169298.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
sativus]
 gb|KGN43482.1| hypothetical protein Csa_7G039790 [Cucumis sativus]
Length=357

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            SIETQ+ YD +M+ + GG+ER  K+W KL  +AGF  Y+I PIL LRS+IE+YP
Sbjct  304  SIETQLLYDMLMMIVPGGKEREEKEWAKLIKEAGFRAYKIFPILDLRSLIEIYP  357



>ref|XP_008229109.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=354

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S ETQ+ +D  M+ +  G+ER  K+W KLFSDAGFS Y+I P LGLRS+IEVYP
Sbjct  300  ESGETQLFFDMEMMVLATGKERNEKEWAKLFSDAGFSHYKITPSLGLRSLIEVYP  354



>ref|XP_011027757.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  12   ETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            ET++ +D +M+ +  G+ER+ K+WEKLF +AGFS Y I P+ GLRS+IEVYP
Sbjct  308  ETKLLFDMLMMVVAAGKERSVKEWEKLFLEAGFSHYMITPLFGLRSLIEVYP  359



>ref|XP_003557042.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Glycine 
max]
Length=358

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S+ETQ+ +D +M+ ++ G+ER+ K+W KL S AG+++Y+I P+ GLRS+IE+YP
Sbjct  304  ESVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNYKITPVFGLRSLIEIYP  358



>ref|XP_008455549.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like, partial 
[Cucumis melo]
Length=266

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            SIE+Q+ +D +M+  +GG+ER  K+W KL  +AGFS Y+I PILGLRS+IE+YP
Sbjct  213  SIESQLFFDMLMMVEVGGKEREEKEWAKLVKEAGFSAYKIFPILGLRSLIEIYP  266



>ref|XP_010097396.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXB67902.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=305

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S ETQ+ +D +M+ ++ GRER   +W KLF DAGFS Y+I PILG++S+IEV+P
Sbjct  251  QSYETQLFFDMLMMVLVRGRERKETEWAKLFLDAGFSTYKITPILGVKSLIEVFP  305



>ref|XP_010938927.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Elaeis 
guineensis]
Length=362

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            K+ ETQ+ +D +M+   GG +R  K+W K+F DAGFS+Y+I P++GLRSIIEVYP
Sbjct  308  KTTETQLFFDMLMMVNSGGMQREEKEWSKIFFDAGFSNYKINPVMGLRSIIEVYP  362



>ref|XP_008245363.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=235

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  12   ETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            E ++ +D +M+ ++ GRER+ KDW+KLF +AGFS+Y++ PI GLRS+IEVYP
Sbjct  184  EAKLFFDLLMMVVVTGRERSEKDWKKLFLEAGFSNYKLTPIFGLRSLIEVYP  235



>ref|XP_004293905.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=355

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S E ++ +D +M+ ++ GRER  K+WEKL  +AGFS Y+I PI GLRS+IEVYP
Sbjct  301  ESTEAKLFFDMLMMVVVTGRERREKEWEKLILEAGFSKYQITPIFGLRSLIEVYP  355



>gb|AFK40900.1| unknown [Lotus japonicus]
Length=357

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KS+ETQ+ +D  M+ +  G+ER+ K+W  L S AGFSDY+I P+LGLRS++E+YP
Sbjct  303  KSVETQLLFDMGMMVLTTGKERSMKEWGILISSAGFSDYKISPVLGLRSVVEIYP  357



>emb|CDP21661.1| unnamed protein product [Coffea canephora]
Length=364

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVY  164
            ++IETQ+ YD   + ++ GR+R  KDW KLFS+AGF DY+I  +LGLRSIIEVY
Sbjct  310  EAIETQLFYDMGAMVLVKGRQRNEKDWAKLFSEAGFCDYKITAVLGLRSIIEVY  363



>gb|KDP24061.1| hypothetical protein JCGZ_25718 [Jatropha curcas]
Length=367

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            + ET++  D +M+ +  G+ER  K+W KLF DAGFSD++I P+LGLRS++EVYP
Sbjct  314  ATETELFLDMLMIVLYNGKERNKKEWAKLFFDAGFSDFKITPVLGLRSVVEVYP  367



>ref|XP_008778546.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Phoenix 
dactylifera]
Length=362

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KS ETQ+ +D +M+ + GG +R  + W K+F DAGFS Y+I P++GLRSIIEVYP
Sbjct  308  KSTETQLFFDMLMMVVSGGMQRDEEGWRKIFLDAGFSGYKIKPVMGLRSIIEVYP  362



>ref|XP_011100233.1| PREDICTED: 8-hydroxyquercetin 8-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            K+IETQ+ +D +M+ +  G ER  KDW KLFS AGF+ Y+I P  GLRS+IE++P
Sbjct  305  KAIETQLFFDMLMINLTSGIERTEKDWAKLFSAAGFTSYKITPAFGLRSLIELFP  359



>emb|CDP19840.1| unnamed protein product [Coffea canephora]
Length=363

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVY  164
            ++IETQ+ YD   + ++ GR+R   DW KLFS+AGFSDY+I  +LGLRSIIEVY
Sbjct  310  EAIETQLFYDMGAMVLVKGRQRNETDWAKLFSEAGFSDYKITAVLGLRSIIEVY  363



>ref|XP_004151089.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like, partial 
[Cucumis sativus]
Length=263

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            S+ETQ+ +D +M+ ++GG+ER  K+W KL  +AGF  Y+I PI+G+RS++E+YP
Sbjct  210  SMETQLLFDMLMMTLVGGKEREEKEWAKLIKEAGFGSYKIFPIMGVRSLVEIYP  263



>ref|XP_007142076.1| hypothetical protein PHAVU_008G250600g [Phaseolus vulgaris]
 gb|ESW14070.1| hypothetical protein PHAVU_008G250600g [Phaseolus vulgaris]
Length=357

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S ETQ+ +D MM+ +  G+ER  K+W KL S AGF++Y+I P++G+RS+IE+YP
Sbjct  303  ESFETQLFFDLMMMVLFNGKERNKKEWVKLISSAGFNNYKITPVMGIRSLIEIYP  357



>gb|KHN19130.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=246

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S+ETQ+ +D  M+ ++ G+ER+ K+W KL S AG+++Y+I P+LGLRS+IE+YP
Sbjct  192  ESVETQLFFDMQMMVLVTGKERSKKEWTKLISSAGYNNYKITPVLGLRSLIEIYP  246



>gb|AJD20223.1| norcoclaurine 6-O-methyltransferase [Podophyllum peltatum]
Length=373

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S ETQ+ +D +M+ ++ G+ER   +W+KLFSDAGF+ Y I PILGLRS IEV P
Sbjct  319  ESTETQLFFDMLMMVLITGKERTETEWKKLFSDAGFTGYTITPILGLRSFIEVLP  373



>ref|XP_004490696.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=359

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S +TQ+ +D +M  ++ G+ER  K+W KL S AGFSDY+IIPILGLRS+IEVYP
Sbjct  305  ESGKTQLFFDMLMTVLVKGKERNDKEWIKLISLAGFSDYKIIPILGLRSLIEVYP  359



>dbj|BAA86059.1| O-methyltransferase [Pyrus pyrifolia]
Length=383

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            SIETQ+ +D +M+ IL G+ER+  +WEK+F  AGF+ Y I   LGLRS+IEVYP
Sbjct  330  SIETQLMFDMLMMSILPGKERSKLEWEKIFFSAGFTHYNITHTLGLRSLIEVYP  383



>ref|XP_003615968.1| O-methyltransferase [Medicago truncatula]
 gb|AES98926.1| flavonoid O-methyltransferase-like protein [Medicago truncatula]
Length=326

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S +TQ+ +D +M+ +  G+ER  K+W KL S AGF+DY+I P+LGLRS+IE+YP
Sbjct  272  ESAKTQLFFDMLMMVLATGKERTKKEWVKLISSAGFNDYKITPVLGLRSVIEIYP  326



>ref|XP_004490686.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=358

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S++TQ+ +D +M+ ++ G+ER  K+W  L S +GFS+Y+I PILGLRS+IE+YP
Sbjct  304  ESLQTQLFFDMLMMVLVTGKERTKKEWVNLISSSGFSNYKITPILGLRSVIEIYP  358



>emb|CDP21836.1| unnamed protein product [Coffea canephora]
Length=365

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVY  164
            ++IETQ+ +D +++ +L  R+R  KDW KLF++AGFSDY+I  +LGLRSIIEVY
Sbjct  310  EAIETQLFFDMVVMVLLKRRQRNEKDWAKLFTEAGFSDYKITAVLGLRSIIEVY  363



>ref|XP_006446726.1| hypothetical protein CICLE_v10015705mg [Citrus clementina]
 gb|ESR59966.1| hypothetical protein CICLE_v10015705mg [Citrus clementina]
Length=362

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 32/55 (58%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S ETQ+ +D +M+ +  G ER  K+W KLF+DAGFSDY+I  ILGLRS+IEV P
Sbjct  308  ESTETQLFFDMLMMVLATGTERDEKEWAKLFADAGFSDYKITSILGLRSLIEVCP  362



>gb|AFX68806.1| O-metyltransferase [Sorghum bicolor]
Length=374

 Score = 72.0 bits (175),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/55 (58%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            K +ETQ+ YD  ++ I GG ER  ++W+K+F +AGF DY IIP+LGLRSIIE+YP
Sbjct  321  KLLETQVMYDLHLMKI-GGVERDEQEWKKIFLEAGFKDYNIIPVLGLRSIIELYP  374



>ref|XP_006376396.1| hypothetical protein POPTR_0013s12670g [Populus trichocarpa]
 gb|ERP54193.1| hypothetical protein POPTR_0013s12670g [Populus trichocarpa]
Length=359

 Score = 72.0 bits (175),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            SIETQ+ +D  M+ ++GG ER  K+W KLF DAGF +Y+I P+LG R++IE+YP
Sbjct  306  SIETQLFFDLQMMVVVGGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALIELYP  359



>ref|XP_010070166.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW89590.1| hypothetical protein EUGRSUZ_A01873 [Eucalyptus grandis]
Length=375

 Score = 72.0 bits (175),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  15   TQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            T++ YD M++G L G+ER  K+W KLF +AGFSDY++ P+ G RS+IEVYP
Sbjct  325  TKLFYDMMLMGCLTGKERNEKEWAKLFREAGFSDYKLTPLAGFRSLIEVYP  375



>ref|XP_011092041.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=355

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S+ETQ+  D +M+    G+ER  K+W  L SDAGFS Y I P+L LRSIIE+YP
Sbjct  301  ESVETQLLLDMLMMATFKGKERTEKEWADLISDAGFSGYRIYPVLPLRSIIEIYP  355



>ref|XP_008455944.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X2 [Cucumis melo]
Length=362

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S ETQ+ +D +M+  LGG+ER   +W+ LF +AGFS Y+II  LGLRS+IEVYP
Sbjct  307  ESTETQLLFDVLMMVNLGGKERNENEWKNLFMEAGFSGYKIISKLGLRSVIEVYP  361



>ref|XP_003615962.1| O-methyltransferase [Medicago truncatula]
 gb|AES98920.1| orcinol O-methyltransferase [Medicago truncatula]
Length=341

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S+ETQ+ +D  M+ +  G+ER  K+W KL S AGFSDY+I PILG  S+IE+YP
Sbjct  287  ESVETQLFFDMFMMVVFAGKERNEKEWIKLISSAGFSDYKITPILGSTSMIEIYP  341



>sp|Q6VMW0.1|Q8OMT_MENPI RecName: Full=8-hydroxyquercetin 8-O-methyltransferase; AltName: 
Full=Flavonol 8-O-methyltransferase [Mentha x piperita]
 gb|AAR09600.1| flavonoid 8-O-methyltransferase [Mentha x piperita]
Length=366

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            ++ ET++ +D  ML I+ G+ER+ K+W KLF DAGF++Y+I  +LGLRS+IEV+P
Sbjct  312  EATETKLFFDMQMLAIITGKERSEKEWGKLFFDAGFTNYKITRVLGLRSVIEVFP  366



>gb|KCW44789.1| hypothetical protein EUGRSUZ_L01645 [Eucalyptus grandis]
Length=349

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +3

Query  9    IETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +ETQ+ YD +M+ +  GRER   +W KLF  AGF DY+I  +LGLRS+IEVYP
Sbjct  296  VETQLFYDMLMMTVASGRERNEAEWAKLFVAAGFGDYKITLVLGLRSLIEVYP  348



>gb|KCW74013.1| hypothetical protein EUGRSUZ_E026382, partial [Eucalyptus grandis]
Length=102

 Score = 68.6 bits (166),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            ++  T++ +D +M+ ++ GRER  K+WE LFS AGFS ++I P+ GLRS+IEV+P
Sbjct  48   EATSTKLFFDMLMMTVVTGRERTEKEWEHLFSKAGFSQHKITPMFGLRSLIEVFP  102



>ref|XP_007142043.1| hypothetical protein PHAVU_008G247600g [Phaseolus vulgaris]
 gb|ESW14037.1| hypothetical protein PHAVU_008G247600g [Phaseolus vulgaris]
Length=357

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S ETQ+ +D +M+ +L G+ER  K+W KLFS AGF++Y+I P +G RS+IE+YP
Sbjct  303  ESFETQLFFDILMMVLLTGKERNKKEWVKLFSSAGFNNYKITPFVGSRSLIEIYP  357



>gb|EYU30782.1| hypothetical protein MIMGU_mgv1a021078mg [Erythranthe guttata]
Length=359

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            K+ ETQ+ +D +M+  + G+ER  K+W  LF  AGFS+Y+I P+LGLRSIIEV+P
Sbjct  305  KATETQLLFDMLMMIEVTGKERTEKEWANLFFSAGFSNYKITPVLGLRSIIEVFP  359



>ref|XP_009612081.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=350

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            S+  Q   D +M+ + G +ER  K+WEKLF++AGFS+YEI P LG RS+IE+YP
Sbjct  297  SVRAQHNMDLVMMVLFGAKERTKKEWEKLFTEAGFSEYEITPTLGTRSLIEIYP  350



>ref|XP_004170025.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
sativus]
Length=153

 Score = 69.3 bits (168),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            S +TQ+ +D +M+  +GG+ER  K+W +LF  AGF  Y+I PILGLRS+I++YP
Sbjct  100  STQTQLLWDMLMMASVGGKERDEKEWAQLFHKAGFGSYKIFPILGLRSLIKLYP  153



>ref|XP_002517834.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44352.1| o-methyltransferase, putative [Ricinus communis]
Length=362

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S ET   YD  M+ ++ G+ER  K+W KLF DAGFS Y I PILGLRSIIEV+P
Sbjct  308  QSTETIQLYDLEMMVLVSGQERTEKEWAKLFFDAGFSSYNINPILGLRSIIEVFP  362



>ref|XP_008455943.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X1 [Cucumis melo]
Length=397

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S ETQ+ +D +M+  LGG+ER   +W+ LF +AGFS Y+II  LGLRS+IEVYP
Sbjct  342  ESTETQLLFDVLMMVNLGGKERNENEWKNLFMEAGFSGYKIISKLGLRSVIEVYP  396



>ref|XP_003615973.1| O-methyltransferase [Medicago truncatula]
 gb|AES98931.1| orcinol O-methyltransferase [Medicago truncatula]
Length=363

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVY  164
            +S+ET++ +D +M+  L G+ER  K+W KL S AGF DY+I PILGLR++IE+Y
Sbjct  306  ESVETKLFFDMLMMVTLTGKERTKKEWVKLISSAGFCDYKITPILGLRAVIEIY  359



>ref|XP_002278092.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=361

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  12   ETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            E ++ +D +M+ ++ GRER  K+WEKLF +AGFS Y+I PI GLRS+IEV+P
Sbjct  310  EAKLLFDLLMMTVVTGRERNEKEWEKLFLEAGFSHYKINPIFGLRSLIEVFP  361



>ref|XP_010111158.1| Tabersonine 16-O-methyltransferase [Morus notabilis]
 gb|EXC30549.1| Tabersonine 16-O-methyltransferase [Morus notabilis]
Length=369

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  12   ETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            E ++ +D +M+ ++ GRER+ KDWEKLF +AGFS Y+I P+ GLRS+IEV+P
Sbjct  279  EGKLYFDLLMMILVTGRERSEKDWEKLFLEAGFSHYKITPLFGLRSLIEVFP  330



>ref|XP_010032853.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW52346.1| hypothetical protein EUGRSUZ_J01762 [Eucalyptus grandis]
Length=363

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            S ETQ+ +D  M+     +ER  K+W KLF+DAGFS YEI+  LGLRS+IE+YP
Sbjct  310  STETQLLFDISMMAFFNAKERDEKEWAKLFADAGFSGYEIVSHLGLRSLIEIYP  363



>ref|XP_007025514.1| Flavonoid o-methyltransferase related [Theobroma cacao]
 gb|EOY28136.1| Flavonoid o-methyltransferase related [Theobroma cacao]
Length=352

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  12   ETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            E ++ +D +M+ ++ GRER  +DW+KLF  AGF+DY+I P+ GLRS+IEVYP
Sbjct  301  EAKLFFDMLMMVVVTGRERTEQDWQKLFMAAGFTDYKISPLFGLRSLIEVYP  352



>ref|XP_002447425.1| hypothetical protein SORBIDRAFT_06g000820 [Sorghum bicolor]
 sp|A8QW53.1|OMT3_SORBI RecName: Full=5-pentadecatrienyl resorcinol O-methyltransferase; 
AltName: Full=O-methyltransferase 3; Short=SbOMT3 [Sorghum 
bicolor]
 gb|ABP01564.1| O-methyltransferase 3 [Sorghum bicolor]
 gb|EES11753.1| hypothetical protein SORBIDRAFT_06g000820 [Sorghum bicolor]
Length=374

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/55 (58%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            K +ETQ+ YD  ++ I GG ER  ++W+K+F +AGF DY+I+PILGLRSIIE+YP
Sbjct  321  KLLETQVIYDLHLMKI-GGVERDEQEWKKIFLEAGFKDYKIMPILGLRSIIELYP  374



>ref|XP_006431705.1| hypothetical protein CICLE_v10003093mg [Citrus clementina]
 gb|ESR44945.1| hypothetical protein CICLE_v10003093mg [Citrus clementina]
Length=242

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +++ETQ+C+D +M   L G+ER+  DW+KLF  AGFS Y+I P LGL S+IE YP
Sbjct  188  ETMETQLCFDMLMATFLKGKERSVYDWKKLFLAAGFSHYKITPNLGLWSLIEAYP  242



>ref|XP_010023967.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW60370.1| hypothetical protein EUGRSUZ_H03085 [Eucalyptus grandis]
Length=362

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S ETQ+ +D +M+     +ER  K+W KLF+DAGFS YEI+  LGLRS+IE+YP
Sbjct  308  ESTETQLFFDMLMMVTFNAKERDEKEWAKLFADAGFSGYEIVSHLGLRSLIEIYP  362



>gb|EYU30737.1| hypothetical protein MIMGU_mgv1a009866mg [Erythranthe guttata]
Length=329

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            K++E Q+ +D  M+  L G+ER+ K+W KLF DAGF++Y+I P  G+RS+IEVYP
Sbjct  275  KAMEDQLFFDMAMMAYLNGKERSEKEWVKLFFDAGFTNYKITPAFGVRSLIEVYP  329



>ref|XP_008362623.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X1 [Malus domestica]
Length=383

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            SIETQ+ +D +M+ IL G+ER+  +WEK+F  AGF+ Y I   LG RS+IEVYP
Sbjct  330  SIETQLMFDMLMMSILPGKERSKSEWEKIFFAAGFTHYNITHTLGFRSLIEVYP  383



>gb|ABK96707.1| unknown [Populus trichocarpa x Populus deltoides]
Length=359

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            SIETQ+ +D  M+ + GG ER  K+W KLF DAGF +Y+I P+LG R++IE+YP
Sbjct  306  SIETQLFFDLQMMVVAGGMERNEKEWAKLFFDAGFLNYKIYPVLGPRALIELYP  359



>ref|XP_010023968.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW60372.1| hypothetical protein EUGRSUZ_H03087 [Eucalyptus grandis]
Length=361

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S ETQ+ +D  M+  L G+ER  K+WEKLF DAGFS Y+II  LGLRS+IE+YP
Sbjct  308  RSTETQLFFDMWMMN-LNGKERNEKEWEKLFVDAGFSGYKIISHLGLRSLIEIYP  361



>emb|CDP19711.1| unnamed protein product [Coffea canephora]
Length=349

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +3

Query  6    SIETQICYDTMMLGILG-GRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            S ET+   D  ML +LG  +ER  K+W KLFSDAGFS Y++ P+LG+R +IEVYP
Sbjct  295  SFETEFSMDMQMLVMLGPAKERTEKEWSKLFSDAGFSSYKVYPVLGMRCLIEVYP  349



>gb|KCW74499.1| hypothetical protein EUGRSUZ_E03211 [Eucalyptus grandis]
Length=359

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            ++  T++ +D +M+ ++ GRER  K+WE+LFS+AGFS +++ P+ GLRS+IEV+P
Sbjct  305  EATSTKLFFDMLMMTVVTGRERTEKEWEQLFSNAGFSQHKVTPMFGLRSLIEVFP  359



>gb|AAB71213.1| methyltransferase [Prunus armeniaca]
Length=354

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S ETQ+ +D  M+ +  G+ER  K+W KLFSDAGFS Y+I P+ G +S+IEVYP
Sbjct  300  ESGETQLFFDMHMMVMSTGKERNEKEWAKLFSDAGFSQYKITPLFGFKSLIEVYP  354



>gb|KGN44538.1| hypothetical protein Csa_7G328260 [Cucumis sativus]
Length=347

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            S +TQ+ +D +M+  +GG+ER  K+W +LF  AGF  Y+I PILGLRS+I++YP
Sbjct  294  STQTQLLWDMLMMASVGGKERDEKEWAQLFHKAGFGSYKIFPILGLRSLIKLYP  347



>emb|CDP20594.1| unnamed protein product [Coffea canephora]
Length=121

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +3

Query  6    SIETQICYDTMMLGILG-GRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            S ET+   D  ML +LG  +ER  K+W KLFSDAGFS Y++ P+LG+R +IEVYP
Sbjct  67   SFETEFSLDMQMLVMLGPAKERTGKEWSKLFSDAGFSSYKVYPVLGMRCLIEVYP  121



>gb|KDO73905.1| hypothetical protein CISIN_1g017835mg [Citrus sinensis]
Length=365

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            K+ ETQ+  D +M+ ++ G ER  K+W KLF +AGFSDY+I  +LG+RS+IEVYP
Sbjct  311  KTTETQLFMDMLMMVLVKGEERNEKEWAKLFFEAGFSDYKITDVLGVRSLIEVYP  365



>ref|XP_006474725.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=365

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            K+ ETQ+  D +M+ ++ G ER  K+W KLF +AGFSDY+I  +LG+RS+IEVYP
Sbjct  311  KTTETQLFMDMLMMVLVKGEERNEKEWAKLFFEAGFSDYKITDVLGVRSLIEVYP  365



>ref|XP_006452811.1| hypothetical protein CICLE_v10008718mg [Citrus clementina]
 gb|ESR66051.1| hypothetical protein CICLE_v10008718mg [Citrus clementina]
Length=365

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            K+ ETQ+  D +M+ ++ G ER  K+W KLF +AGFSDY+I  +LG+RS+IEVYP
Sbjct  311  KTTETQLFMDMLMMVLVKGEERNEKEWAKLFFEAGFSDYKITDVLGVRSLIEVYP  365



>ref|XP_002517832.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44350.1| o-methyltransferase, putative [Ricinus communis]
Length=362

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  9    IETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP*R  173
            +E Q+C+D  M+ +L G+ER  ++W+KLF DAGFS+Y+I P+LG R++IE  P R
Sbjct  305  MEAQLCFDMQMMALLMGKERNEEEWKKLFFDAGFSNYKIYPVLGPRALIEFLPYR  359



>ref|XP_010057348.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
Length=371

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            ++  T++ +D +M+ ++ GRER  K+WE+LFS+AGFS +++ P+ GLRS+IEV+P
Sbjct  317  EATSTKLFFDMLMMTVVTGRERTEKEWEQLFSNAGFSQHKVTPMFGLRSLIEVFP  371



>ref|XP_004139732.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
sativus]
Length=367

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            S +TQ+ +D +M+  +GG+ER  K+W +LF  AGF  Y+I PILGLRS+I++YP
Sbjct  314  STQTQLLWDMLMMASVGGKERDEKEWAQLFHKAGFGSYKIFPILGLRSLIKLYP  367



>ref|XP_004979195.1| PREDICTED: O-methyltransferase ZRP4-like [Setaria italica]
Length=353

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            K  E Q  +D  ++  +GG ER  ++W+K+FS+AGFSDY+IIP+LG+RSIIEVYP
Sbjct  300  KHKEMQAMFDIYIM-FIGGMERDEQEWKKIFSEAGFSDYKIIPVLGVRSIIEVYP  353



>gb|KDP21023.1| hypothetical protein JCGZ_21494 [Jatropha curcas]
Length=358

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +3

Query  12   ETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            ET++ +D +M+ +  GRER  ++WE LF  AGFS ++I P+LGLRS+IEVYP
Sbjct  307  ETKLLFDMLMMSVTCGRERTEREWEGLFLKAGFSHFKITPLLGLRSLIEVYP  358



>ref|XP_002437453.1| hypothetical protein SORBIDRAFT_10g027360 [Sorghum bicolor]
 gb|EER88820.1| hypothetical protein SORBIDRAFT_10g027360 [Sorghum bicolor]
Length=372

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            K IETQ+ +D MM+ +  G ER   +W+ +F +AGF DY+IIP+LG+RSIIE+YP
Sbjct  319  KHIETQVLFDLMMMNV-NGVERDENEWKNIFFEAGFKDYKIIPLLGVRSIIELYP  372



>ref|XP_008245137.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=354

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/55 (58%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S ETQ+ +D  M+ +  G+ER  K+W  LFSDAGFS Y+I P LGLRS+IEVYP
Sbjct  300  ESGETQLFFDMEMMVLATGKERNEKEWAMLFSDAGFSHYKITPGLGLRSLIEVYP  354



>ref|XP_002522586.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF39886.1| o-methyltransferase, putative [Ricinus communis]
Length=355

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  12   ETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            ET++ +D +M+ ++ G ER  K+W++LF +AGFS Y+I P+LG+RS+IEVYP
Sbjct  304  ETKLLFDILMMVVVNGTERTEKEWKRLFLEAGFSHYKITPLLGVRSLIEVYP  355



>ref|NP_001057265.1| Os06g0240800 [Oryza sativa Japonica Group]
 dbj|BAD37886.1| putative O-methyltransferase [Oryza sativa Japonica Group]
 dbj|BAD37839.1| putative O-methyltransferase [Oryza sativa Japonica Group]
 dbj|BAF19179.1| Os06g0240800 [Oryza sativa Japonica Group]
 gb|EAZ36436.1| hypothetical protein OsJ_20767 [Oryza sativa Japonica Group]
Length=344

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = +3

Query  12   ETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            ETQ+ +D  M+GI GG ER   +W+K+F +AGFSDY+I PILG  S+IEVYP
Sbjct  294  ETQVLFDVYMMGI-GGGEREEHEWKKIFFEAGFSDYKIKPILGFISVIEVYP  344



>ref|NP_001130621.1| hypothetical protein [Zea mays]
 gb|ACF78916.1| unknown [Zea mays]
 gb|AFW64033.1| hypothetical protein ZEAMMB73_445874 [Zea mays]
Length=417

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            + +ETQI +D +M+ +  G ER  ++W+K+FS+AGF DY I+P+LG+RSIIE+YP
Sbjct  363  RHVETQILFDLLMMCV-NGVERDEQEWKKIFSEAGFQDYRIMPLLGVRSIIELYP  416



>ref|XP_006364328.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=354

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +3

Query  12   ETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            E ++ YD  M+ +L GRER  K+WEKLF +AGF  Y+I P+ GLRS+IE++P
Sbjct  303  EVKLIYDVAMIVLLTGRERTEKEWEKLFLEAGFMTYKITPLFGLRSLIEIFP  354



>emb|CDP11862.1| unnamed protein product [Coffea canephora]
Length=138

 Score = 67.8 bits (164),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            ++IETQ+ +D  ML + G +ER  K+W  LFSDA FS Y+I P+LG+  +IEVYP
Sbjct  84   EAIETQMSFDMQMLVLYGAKERTEKEWATLFSDADFSSYKIFPVLGIWCLIEVYP  138



>ref|XP_004490687.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=354

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +++ TQ+ +D +M+ +  G+ER  K+W  L S +GFSDY+I P+LGLRS+IE+YP
Sbjct  300  ETLGTQLFFDMLMMVLATGKERTKKEWVNLISSSGFSDYKITPVLGLRSVIEIYP  354



>gb|ACF84530.1| unknown [Zea mays]
Length=330

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            K  ETQ+ +D  ++ I  G ER   +W+K+ S+AGFSDY+IIP+LG+RSIIEVYP
Sbjct  277  KHKETQVLFDLFIMTI-NGAERDEHEWKKIISEAGFSDYKIIPVLGVRSIIEVYP  330



>ref|XP_010916032.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Elaeis 
guineensis]
Length=355

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +3

Query  12   ETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            ET + YD  M+   GG ER   +W K+F+DAGFSDY+I P+LG+ SIIE+YP
Sbjct  304  ETHLFYDVCMMIAFGGMERKEYEWRKIFNDAGFSDYKIFPLLGVYSIIELYP  355



>gb|EAZ00317.1| hypothetical protein OsI_22334 [Oryza sativa Indica Group]
Length=372

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = +3

Query  12   ETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            ETQ+ +D  M+GI GG ER   +W+K+F +AGFSDY+I PILG  S+IEVYP
Sbjct  322  ETQVLFDVYMMGI-GGGEREEHEWKKIFLEAGFSDYKIKPILGFISVIEVYP  372



>emb|CDP15884.1| unnamed protein product [Coffea canephora]
Length=282

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S+ETQ+  +  ML   G +ER+ K+W KLF DAGFSDY+ +P+LG+  +IEVYP
Sbjct  228  ESVETQVGVNMQMLMGYGAKERSEKEWAKLFQDAGFSDYKALPLLGVCCLIEVYP  282



>sp|P0DH60.1|M3OM2_PEA RecName: Full=(+)-6a-hydroxymaackiain 3-O-methyltransferase 2 
[Pisum sativum]
Length=360

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +3

Query  12   ETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            E Q+ YD +ML +  G+ER  K+WEKL  DAGFS Y+I PI G +S+IEVYP
Sbjct  309  ELQLEYDVVMLTMFLGKERTKKEWEKLIYDAGFSRYKITPICGFKSLIEVYP  360



>gb|EAZ13570.1| hypothetical protein OsJ_03485 [Oryza sativa Japonica Group]
Length=378

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +  ETQ+ +D MM+G++G  ER  +++ K+F DAGFS Y+I+ +LG+RS+IEVYP
Sbjct  324  RDTETQLLWDVMMMGVVGSPERDEREFCKIFHDAGFSGYKILHVLGIRSVIEVYP  378



>dbj|BAB89545.1| putative O-methyltransferase [Oryza sativa Japonica Group]
 dbj|BAB89679.1| putative O-methyltransferase [Oryza sativa Japonica Group]
Length=378

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +  ETQ+ +D MM+G++G  ER  +++ K+F DAGFS Y+I+ +LG+RS+IEVYP
Sbjct  324  RDTETQLLWDVMMMGVVGSPERDEREFCKIFHDAGFSGYKILHVLGIRSVIEVYP  378



>emb|CAD29555.1| orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=348

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILG  140
            +SIETQ+ +D +M+ ++GG+ER  K+W KLF+DAGFSDY+I PILG
Sbjct  303  ESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPILG  348



>emb|CDP15886.1| unnamed protein product [Coffea canephora]
Length=348

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            S+ETQ+  D  ML   G +ER  K+W KLF DAGFSDY+I+P LG+  +I VYP
Sbjct  295  SVETQVGVDMQMLMCYGAKERTEKEWAKLFQDAGFSDYKILPALGVCCLIAVYP  348



>gb|AGQ21572.1| flavone 8-O-methyltransferase [Ocimum basilicum]
Length=359

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +++ETQ+ +D MM+  L G+ER  ++W K+F  AGF  Y+I P+LGLRS+IEV+P
Sbjct  305  EAVETQLFFDMMMMTTLTGKERTEQEWAKIFFAAGFKTYKIYPLLGLRSLIEVFP  359



>ref|XP_008364163.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Malus 
domestica]
Length=358

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +3

Query  12   ETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVY  164
            E ++ +D +M+ ++ GRER+ KDW+KLF +AGFS Y++ PI GLRS+IEV+
Sbjct  307  EAKLLFDLLMMVVITGRERSEKDWKKLFLEAGFSSYKVTPIFGLRSLIEVF  357



>ref|XP_004232927.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=360

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  12   ETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            E ++ +D +M+ +  GR+R  K+WEKLF++AGF  Y+I P+LGLRS+I+V+P
Sbjct  309  EVKLIFDVLMMVVTTGRQRTEKEWEKLFTEAGFMSYKITPLLGLRSLIQVFP  360



>ref|NP_001148593.1| O-methyltransferase ZRP4 [Zea mays]
 gb|ACG32160.1| O-methyltransferase ZRP4 [Zea mays]
Length=359

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            K  ETQ+ +D  ++ I  G ER   +W+K+ S+AGFSDY+IIP+LG+RSIIEVYP
Sbjct  306  KHKETQVLFDLFIMTI-NGAERDEHEWKKIISEAGFSDYKIIPVLGVRSIIEVYP  359



>gb|AFW78710.1| O-methyltransferase ZRP4 [Zea mays]
Length=359

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            K  ETQ+ +D  ++ I  G ER   +W+K+ S+AGFSDY+IIP+LG+RSIIEVYP
Sbjct  306  KHKETQVLFDLFIMTI-NGAERDEHEWKKIISEAGFSDYKIIPVLGVRSIIEVYP  359



>gb|ACF81837.1| unknown [Zea mays]
Length=113

 Score = 66.6 bits (161),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            K  ETQ+ +D  ++ I  G ER   +W+K+ S+AGFSDY+IIP+LG+RSIIEVYP
Sbjct  60   KHKETQVLFDLFIMTI-NGAERDEHEWKKIISEAGFSDYKIIPVLGVRSIIEVYP  113



>ref|XP_011077108.1| PREDICTED: chavicol O-methyltransferase-like [Sesamum indicum]
Length=361

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            K +ET   +D  ++  L GRER  K+W KLF DAGF++Y+I P  GLRS+IEVYP
Sbjct  307  KEMETCFFFDIALMPYLTGRERTEKEWAKLFFDAGFTNYKITPAFGLRSLIEVYP  361



>ref|XP_002537255.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF25128.1| o-methyltransferase, putative [Ricinus communis]
Length=86

 Score = 66.2 bits (160),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S ET   YD  M+ ++  +ER  K+W KLF DAGFS Y I P+LGLRSIIEV+P
Sbjct  32   QSTETIQLYDLEMMVLVSDQERTEKEWAKLFFDAGFSSYNINPVLGLRSIIEVFP  86



>sp|O24305.1|M3OM1_PEA RecName: Full=(+)-6a-hydroxymaackiain 3-O-methyltransferase 1; 
AltName: Full=Isoflavone 4'-O-methyltransferase [Pisum sativum]
 gb|AAC49856.1| 6a-hydroxymaackiain methyltransferase [Pisum sativum]
Length=360

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +3

Query  12   ETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            E Q+ YD +ML +  G+ER  K+WEKL  DAGFS Y+I PI G +S+IEVYP
Sbjct  309  ELQLEYDVVMLTMFLGKERTKKEWEKLIYDAGFSRYKITPICGFKSLIEVYP  360



>ref|XP_002456368.1| hypothetical protein SORBIDRAFT_03g034845 [Sorghum bicolor]
 gb|EES01488.1| hypothetical protein SORBIDRAFT_03g034845 [Sorghum bicolor]
Length=380

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIE  158
            K+ ETQ+ +D MM+G++G  ER  ++W ++F DAGFS Y+I+ +LG+RS+IE
Sbjct  329  KATETQLLWDVMMMGVVGSPERDEREWRRIFQDAGFSGYKIVALLGIRSVIE  380



>gb|AIY62760.1| N-acetylserotonin O-methyltransferase [Malus zumi]
Length=358

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +3

Query  12   ETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVY  164
            E ++ +D +M+ ++ GRER+ KDW+KLF +AGFS Y++ PI GLRS+IEV+
Sbjct  307  EAKLLFDLLMMVVVTGRERSEKDWKKLFLEAGFSGYKVTPIFGLRSLIEVF  357



>ref|XP_002449557.1| hypothetical protein SORBIDRAFT_05g019040 [Sorghum bicolor]
 gb|EES08545.1| hypothetical protein SORBIDRAFT_05g019040 [Sorghum bicolor]
Length=379

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            K  ETQ+ +D +M+  L G ER  ++W+K+F +AGF DY+IIP+LG+RSI+E+YP
Sbjct  326  KHKETQVLFDLLMMA-LNGVERDEQEWKKIFLEAGFKDYKIIPVLGVRSIVELYP  379



>ref|XP_004984099.1| PREDICTED: 5-pentadecatrienyl resorcinol O-methyltransferase-like 
[Setaria italica]
Length=379

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            K  ETQ+ YD +++ I  G ER  ++W+K+F +AGF DY+IIP+LG+RS+IE+YP
Sbjct  326  KHAETQVLYDLLIMNI-NGVERDEQEWKKIFFEAGFKDYKIIPVLGVRSVIELYP  379



>ref|XP_008788394.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Phoenix 
dactylifera]
Length=370

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +3

Query  9    IETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVY  164
            +ETQ+ +D  M+    G++R   +W K+F+DAGF+DY+IIP LGLRS+IEVY
Sbjct  318  VETQLLFDMHMMVHTAGKQRNEGEWRKIFTDAGFTDYKIIPALGLRSVIEVY  369



>ref|XP_004975403.1| PREDICTED: 5-pentadecatrienyl resorcinol O-methyltransferase-like 
[Setaria italica]
Length=366

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            + +ETQ+ YD +++GI  G ER  ++W+K+F +AGF+DY+I+ ILG+RSIIE+YP
Sbjct  313  RHLETQVLYDLLIMGI-NGVERDEQEWKKIFLEAGFNDYKIMSILGVRSIIELYP  366



>ref|XP_002517828.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44346.1| o-methyltransferase, putative [Ricinus communis]
Length=105

 Score = 65.9 bits (159),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S ET   YD  M+ ++  +ER  K+W KLF DAGFS Y I P+LGLRSIIEV+P
Sbjct  51   QSTETIQLYDLEMMVLVSDQERTEKEWAKLFFDAGFSSYNINPVLGLRSIIEVFP  105



>ref|XP_008455485.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
melo]
Length=384

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            S+ETQ+ +D +M+ + GG+ER  + W +L  +AGF  Y+I PI+G+RS+IE+YP
Sbjct  331  SMETQLLFDMLMMTLAGGKEREEEKWAELIKEAGFRSYKIFPIMGVRSLIEIYP  384



>gb|EAZ20360.1| hypothetical protein OsJ_35968 [Oryza sativa Japonica Group]
Length=290

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            K  + QI YD  ++  + G ER  ++W+KLF +AGFSDY+I+PI+G RSIIEVYP
Sbjct  237  KHRDVQILYDAYIM-FINGAERDEQEWKKLFLEAGFSDYKIMPIMGFRSIIEVYP  290



>ref|XP_008455942.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
melo]
Length=350

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S ETQ+ +D +M+  LGG+E    +W+ LF +AGFS Y+II  LGLRS+IEVYP
Sbjct  295  ESTETQLLFDVLMMVNLGGKEMNENEWKNLFMEAGFSGYKIISKLGLRSVIEVYP  349



>gb|KHN07780.1| Tabersonine 16-O-methyltransferase [Glycine soja]
Length=323

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +SIETQ+  D +++ +  G+ER  K+W KL    GFSDY+I P+LGLRS+IE+YP
Sbjct  269  ESIETQLFIDMVVMVLYPGKERTEKEWAKLIFSTGFSDYKITPVLGLRSLIEIYP  323



>ref|XP_006388574.1| hypothetical protein POPTR_0151s00220g [Populus trichocarpa]
 gb|ERP47488.1| hypothetical protein POPTR_0151s00220g [Populus trichocarpa]
Length=326

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            SIETQ+ +D  M+  + G ER  K+W KLF DAGF +Y+I P+LG R++IE+YP
Sbjct  273  SIETQLLFDLQMMVAVSGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALIELYP  326



>ref|XP_003527407.1| PREDICTED: trans-resveratrol di-O-methyltransferase isoform 1 
[Glycine max]
Length=352

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +SIETQ+  D +++ +  G+ER  K+W KL    GFSDY+I P+LGLRS+IE+YP
Sbjct  298  ESIETQLFIDMVVMVLYPGKERTEKEWAKLIFSTGFSDYKITPVLGLRSLIEIYP  352



>emb|CAJ65662.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPIL  137
            +SIETQ+ +D +M+ ++GGRER  K+W KLF+DAGFSDY+I PIL
Sbjct  302  ESIETQLFFDMLMMALVGGRERNEKEWAKLFTDAGFSDYKITPIL  346



>gb|EAY75851.1| hypothetical protein OsI_03768 [Oryza sativa Indica Group]
Length=217

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +  E Q+ +D MM+G++G  ER  +++ K+F DAGFS Y+I+ +LG+RS+IEVYP
Sbjct  163  RDTEMQLLWDVMMMGVVGSPERDEREFRKIFHDAGFSGYKILHVLGIRSVIEVYP  217



>ref|XP_009345025.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Pyrus 
x bretschneideri]
Length=358

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +3

Query  12   ETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVY  164
            E ++ +D +M+ ++ GRER+ KDW+KLF +AGFS Y++ PI GLRS++EV+
Sbjct  307  EAKLLFDLLMMVVVTGRERSEKDWKKLFLEAGFSSYKVTPIFGLRSLLEVF  357



>ref|XP_010052398.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW89596.1| hypothetical protein EUGRSUZ_A01878 [Eucalyptus grandis]
Length=368

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            S+  ++C+D +M+ ++ G+ER  K+W  LF +AGF++Y I P+ G+RS+IEVYP
Sbjct  315  SMGIKLCFDMLMMTVVQGKERNEKEWANLFQEAGFTEYRITPLEGIRSLIEVYP  368



>ref|XP_004158564.1| PREDICTED: LOW QUALITY PROTEIN: trans-resveratrol di-O-methyltransferase-like 
[Cucumis sativus]
Length=363

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S ETQ+ +D +M+  L G+ER   +W+ LF +AGFS Y+II  LGLRS+IEVYP
Sbjct  308  ESTETQLLFDLLMMVNLNGKERNENEWKNLFMEAGFSGYKIISKLGLRSLIEVYP  362



>ref|XP_004151906.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
sativus]
 gb|KGN63210.1| hypothetical protein Csa_2G415520 [Cucumis sativus]
Length=363

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +S ETQ+ +D +M+  L G+ER   +W+ LF +AGFS Y+II  LGLRS+IEVYP
Sbjct  308  ESTETQLLFDLLMMVNLNGKERNENEWKNLFMEAGFSGYKIISKLGLRSLIEVYP  362



>ref|XP_008364164.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Malus 
domestica]
Length=358

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  12   ETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVY  164
            E ++ +D +M+ +  GRER+ KDW+KLF +AGFS Y++ PI GLRS+IEV+
Sbjct  307  EAKLLFDLLMMVVXTGRERSEKDWKKLFLEAGFSGYKVTPIFGLRSLIEVF  357



>ref|XP_004232928.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=357

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +3

Query  12   ETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            E ++ +D +M+ ++ GR+R  K+WEKLF +AGF  Y+I P+ GLRS+IEV+P
Sbjct  306  EVKLIFDVLMMVLVTGRQRTEKEWEKLFLEAGFMSYKITPLFGLRSLIEVFP  357



>ref|XP_009798851.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=114

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +3

Query  6    SIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVY  164
            S+  Q   D +M+ + G RER  K+WEKLF++AGFS+YEI P LG RS+IE+Y
Sbjct  62   SVRAQHNMDMVMM-VFGARERTKKEWEKLFTEAGFSEYEITPTLGTRSLIEIY  113



>ref|XP_006366911.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=188

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 3/55 (5%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            KS ETQ+ +D +M+  + G++R+ ++W  LFSDAGF+   IIPI GLRSIIEVYP
Sbjct  137  KSYETQLFFDMLMMVAVSGKQRSQQNWANLFSDAGFN---IIPIPGLRSIIEVYP  188



>ref|XP_006471149.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
 gb|KDO43219.1| hypothetical protein CISIN_1g043623mg [Citrus sinensis]
Length=359

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +3

Query  12   ETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVY  164
            E ++ YD +M+  + G ER+ K+WE+LF DAGF+ Y+I P+LGLRS IEVY
Sbjct  308  EAKLLYDALMMTCVPGIERSEKEWERLFFDAGFTSYKITPLLGLRSFIEVY  358



>ref|XP_002522501.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF39801.1| o-methyltransferase, putative [Ricinus communis]
Length=359

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +3

Query  12   ETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            ET++ +D +M+ +  G+ER  K+W +LF  AGFS ++I PILGLRS+IEVYP
Sbjct  308  ETKLLFDMLMMFVATGKERTEKEWGELFLKAGFSHFKITPILGLRSLIEVYP  359



>emb|CBI38115.3| unnamed protein product [Vitis vinifera]
Length=270

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            +++ETQ+ +D +M+ +L G++R   +W+KLF  AGF+ Y+I  +LG RS+IEVYP
Sbjct  216  QAVETQLFWDMLMMTVLTGKQRNENEWKKLFVTAGFTHYKISAVLGFRSLIEVYP  270



>ref|XP_003568106.1| PREDICTED: O-methyltransferase ZRP4-like [Brachypodium distachyon]
Length=381

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = +3

Query  12   ETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            E Q+ YD + L +  GRER   +WEK+F +AGFS Y+++P+LG+RSIIEVYP
Sbjct  331  EAQVVYD-LFLMVFEGREREEHEWEKIFLEAGFSGYKVMPVLGIRSIIEVYP  381



>gb|KCW74498.1| hypothetical protein EUGRSUZ_E03210 [Eucalyptus grandis]
Length=109

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  3    KSIETQICYDTMMLGILGGRERATKDWEKLFSDAGFSDYEIIPILGLRSIIEVYP  167
            ++  T++ +D +M+ ++ GRER  ++WE+LFS AGF  ++I P+ GLRS+IEV+P
Sbjct  55   EATATKLFFDMLMMTVVTGRERTQREWEELFSKAGFGRHKITPMFGLRSLIEVFP  109



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519803866020