BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19055_g1_i1 len=516 path=[546:0-150 696:151-152 27:153-177
722:178-242 787:243-321 866:322-338 883:339-515]

Length=516
                                                                      Score     E

ref|XP_009592212.1|  PREDICTED: uncharacterized protein LOC104089099  47.8    3e-04   



>ref|XP_009592212.1| PREDICTED: uncharacterized protein LOC104089099 [Nicotiana tomentosiformis]
Length=126

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 55/115 (48%), Gaps = 7/115 (6%)
 Frame = +1

Query  94   TSVSSTFIVQIENLMDDPLWAGCDLNGRILPKKEIKIGKHANFTVHLGSTDKLDVETMTC  273
            +S+++ + V + N+++ PL   C   G+ + +     G    F +++     L   T TC
Sbjct  19   SSLATLYPVSVANILNAPLTIHCIAQGQNVSRDNAPAG----FVLNMSIDTNLANPTATC  74

Query  274  DLRSGHYHGSFVMFDSPNWNVSSYCDPDSLCQWIIVPQEICLLHAFNCSVLHFWP  438
             L SG+ HG+FV+FDS       +   +  C W   P  + L+     S+++ WP
Sbjct  75   QLSSGNLHGNFVVFDSSKEPNRCF---NGRCLWQARPDGLYLVINGQFSLVYKWP  126



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 508786895526