BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19049_g1_i1 len=2351 path=[733:0-596 1330:597-730 1464:731-766
8895:767-773 8664:774-981 4765:982-1554 5338:1555-1596
5380:1597-2350]

Length=2351
                                                                      Score     E

ref|XP_009627765.1|  PREDICTED: uncharacterized protein LOC104118259    639   0.0      
ref|XP_009783706.1|  PREDICTED: uncharacterized protein LOC104232253    631   0.0      
ref|XP_009623066.1|  PREDICTED: uncharacterized protein LOC104114346    626   0.0      
ref|XP_009791161.1|  PREDICTED: uncharacterized protein LOC104238494    621   0.0      
ref|XP_011081835.1|  PREDICTED: uncharacterized protein LOC105164774    619   0.0      
ref|XP_006340268.1|  PREDICTED: uncharacterized protein LOC102587334    613   0.0      
ref|XP_004245262.1|  PREDICTED: uncharacterized protein LOC101258883    610   0.0      
ref|XP_010313606.1|  PREDICTED: uncharacterized protein LOC101255958    609   0.0      
emb|CDP16156.1|  unnamed protein product                                608   0.0      
ref|XP_006366208.1|  PREDICTED: uncharacterized protein LOC102587...    607   0.0      
ref|XP_006366207.1|  PREDICTED: uncharacterized protein LOC102587...    607   0.0      
ref|XP_002284175.1|  PREDICTED: uncharacterized protein LOC100267889    599   0.0      Vitis vinifera
gb|EYU21882.1|  hypothetical protein MIMGU_mgv1a005504mg                584   0.0      
ref|XP_002309560.2|  hypothetical protein POPTR_0006s25880g             583   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006450629.1|  hypothetical protein CICLE_v10008167mg             581   0.0      
ref|XP_010249715.1|  PREDICTED: uncharacterized protein LOC104592187    581   0.0      
ref|XP_008220035.1|  PREDICTED: uncharacterized protein LOC103320179    577   0.0      
ref|XP_010254104.1|  PREDICTED: uncharacterized protein LOC104595187    576   0.0      
ref|XP_006476094.1|  PREDICTED: uncharacterized protein LOC102623437    576   0.0      
gb|EYU21883.1|  hypothetical protein MIMGU_mgv1a005504mg                575   0.0      
ref|XP_011019654.1|  PREDICTED: uncharacterized protein LOC105122312    571   0.0      
ref|XP_007222835.1|  hypothetical protein PRUPE_ppa005114mg             570   0.0      
ref|XP_008347633.1|  PREDICTED: uncharacterized protein LOC103410...    569   0.0      
ref|XP_004291206.1|  PREDICTED: uncharacterized protein LOC101310663    569   0.0      
ref|XP_007137180.1|  hypothetical protein PHAVU_009G106400g             561   0.0      
ref|XP_009367912.1|  PREDICTED: uncharacterized protein LOC103957476    560   0.0      
ref|XP_007012055.1|  Sulfite exporter TauE/SafE family protein          559   0.0      
ref|XP_002516571.1|  conserved hypothetical protein                     558   0.0      Ricinus communis
ref|XP_011026589.1|  PREDICTED: uncharacterized protein LOC105127137    555   0.0      
gb|EPS70854.1|  hypothetical protein M569_03904                         555   0.0      
ref|XP_008393890.1|  PREDICTED: uncharacterized protein LOC103456039    553   0.0      
ref|XP_006833308.1|  hypothetical protein AMTR_s00109p00049700          551   0.0      
ref|XP_003523730.1|  PREDICTED: uncharacterized protein LOC100809318    550   0.0      
ref|XP_003527825.1|  PREDICTED: uncharacterized protein LOC100810784    549   0.0      
ref|XP_010915823.1|  PREDICTED: uncharacterized protein LOC105040818    546   0.0      
ref|XP_010109461.1|  hypothetical protein L484_001800                   546   0.0      
ref|XP_010049082.1|  PREDICTED: uncharacterized protein LOC104437756    543   0.0      
ref|XP_002284423.1|  PREDICTED: uncharacterized protein LOC100266912    543   0.0      Vitis vinifera
ref|XP_008799063.1|  PREDICTED: uncharacterized protein LOC103713782    543   0.0      
ref|XP_010048100.1|  PREDICTED: uncharacterized protein LOC104436943    539   0.0      
gb|KHN10230.1|  hypothetical protein glysoja_017834                     536   2e-180   
gb|KDP34212.1|  hypothetical protein JCGZ_07783                         537   3e-180   
ref|XP_003636475.1|  hypothetical protein MTR_042s0018                  535   2e-179   
ref|XP_002516035.1|  conserved hypothetical protein                     535   2e-179   Ricinus communis
ref|XP_004501773.1|  PREDICTED: uncharacterized protein LOC101498079    534   8e-179   
ref|XP_010526182.1|  PREDICTED: uncharacterized protein LOC104803...    533   1e-178   
ref|XP_010526181.1|  PREDICTED: uncharacterized protein LOC104803...    532   3e-178   
ref|XP_006405251.1|  hypothetical protein EUTSA_v10000151mg             532   4e-178   
ref|XP_010429580.1|  PREDICTED: uncharacterized protein LOC104714041    531   5e-178   
ref|XP_010249713.1|  PREDICTED: uncharacterized protein LOC104592186    529   6e-177   
ref|XP_010417351.1|  PREDICTED: uncharacterized protein LOC104703106    529   6e-177   
ref|XP_002878880.1|  hypothetical protein ARALYDRAFT_481426             528   9e-177   
ref|XP_010472594.1|  PREDICTED: uncharacterized protein LOC104752...    527   3e-176   
gb|KHN42580.1|  hypothetical protein glysoja_042801                     526   4e-176   
ref|XP_003636476.1|  hypothetical protein MTR_042s0018                  527   4e-176   
ref|NP_850068.1|  Sulfite exporter TauE/SafE family protein             525   2e-175   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010472595.1|  PREDICTED: uncharacterized protein LOC104752...    523   6e-175   
ref|XP_010062471.1|  PREDICTED: uncharacterized protein LOC104449877    521   5e-174   
ref|XP_010667904.1|  PREDICTED: uncharacterized protein LOC104884...    520   1e-173   
emb|CDX77007.1|  BnaC04g38020D                                          520   2e-173   
ref|XP_006294138.1|  hypothetical protein CARUB_v10023132mg             520   2e-173   
ref|XP_009140696.1|  PREDICTED: uncharacterized protein LOC103864686    518   1e-172   
emb|CDY35338.1|  BnaA04g15090D                                          518   1e-172   
ref|XP_009388715.1|  PREDICTED: uncharacterized protein LOC103975470    514   4e-171   
gb|KDP37239.1|  hypothetical protein JCGZ_06295                         514   5e-171   
ref|XP_010924740.1|  PREDICTED: uncharacterized protein LOC105047500    513   7e-171   
gb|EEC84400.1|  hypothetical protein OsI_30977                          512   1e-170   Oryza sativa Indica Group [Indian rice]
ref|XP_009409060.1|  PREDICTED: uncharacterized protein LOC103991...    512   2e-170   
ref|XP_009403527.1|  PREDICTED: uncharacterized protein LOC103987...    511   4e-170   
gb|EEE69518.1|  hypothetical protein OsJ_28979                          511   7e-170   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001062933.1|  Os09g0344800                                       511   7e-170   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009403528.1|  PREDICTED: uncharacterized protein LOC103987...    509   2e-169   
emb|CDY70121.1|  BnaC03g72820D                                          508   5e-169   
dbj|BAK01650.1|  predicted protein                                      506   2e-168   
ref|XP_008792340.1|  PREDICTED: uncharacterized protein LOC103708984    506   5e-168   
ref|XP_006660551.1|  PREDICTED: uncharacterized protein LOC102715329    505   7e-168   
ref|XP_009381051.1|  PREDICTED: uncharacterized protein LOC103969282    504   3e-167   
ref|XP_002324817.1|  hypothetical protein POPTR_0018s00760g             503   5e-167   Populus trichocarpa [western balsam poplar]
ref|XP_011001598.1|  PREDICTED: uncharacterized protein LOC105108...    503   1e-166   
ref|XP_011001600.1|  PREDICTED: uncharacterized protein LOC105108...    503   1e-166   
ref|XP_009409059.1|  PREDICTED: uncharacterized protein LOC103991...    503   2e-166   
ref|XP_003578003.1|  PREDICTED: uncharacterized protein LOC100827421    501   3e-166   
ref|XP_008466240.1|  PREDICTED: uncharacterized protein LOC103503714    494   1e-163   
ref|XP_006660104.1|  PREDICTED: uncharacterized protein LOC102707608    493   2e-163   
ref|XP_002303288.2|  hypothetical protein POPTR_0003s05180g             494   2e-163   Populus trichocarpa [western balsam poplar]
ref|NP_001061719.1|  Os08g0389700                                       493   3e-163   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004136295.1|  PREDICTED: uncharacterized protein LOC101214783    493   4e-163   
gb|EEC83519.1|  hypothetical protein OsI_29108                          493   5e-163   Oryza sativa Indica Group [Indian rice]
ref|XP_008228542.1|  PREDICTED: uncharacterized protein LOC103327945    493   7e-163   
gb|KDO79723.1|  hypothetical protein CISIN_1g011811mg                   491   7e-163   
ref|XP_004168635.1|  PREDICTED: uncharacterized LOC101214783            492   1e-162   
emb|CDX83221.1|  BnaA03g22850D                                          489   8e-162   
ref|XP_009133962.1|  PREDICTED: uncharacterized protein LOC103858367    489   8e-162   
ref|XP_011026588.1|  PREDICTED: uncharacterized protein LOC105127135    489   1e-161   
ref|XP_008380922.1|  PREDICTED: uncharacterized protein LOC103443804    489   2e-161   
ref|XP_002460084.1|  hypothetical protein SORBIDRAFT_02g022510          487   8e-161   Sorghum bicolor [broomcorn]
ref|XP_009353619.1|  PREDICTED: uncharacterized protein LOC103944866    487   1e-160   
ref|XP_004956625.1|  PREDICTED: uncharacterized protein LOC101768056    486   3e-160   
ref|XP_004232395.1|  PREDICTED: uncharacterized protein LOC101255155    486   5e-160   
emb|CDP02034.1|  unnamed protein product                                485   5e-160   
gb|KEH35985.1|  sulfite exporter TauE/SafE family protein               484   6e-160   
ref|XP_010070053.1|  PREDICTED: uncharacterized protein LOC104456870    485   6e-160   
gb|KDP38300.1|  hypothetical protein JCGZ_05186                         484   9e-160   
ref|XP_010048102.1|  PREDICTED: uncharacterized protein LOC104436...    484   9e-160   
ref|XP_007202022.1|  hypothetical protein PRUPE_ppa004997mg             484   2e-159   
ref|XP_009788571.1|  PREDICTED: uncharacterized protein LOC104236361    484   2e-159   
ref|XP_010048101.1|  PREDICTED: uncharacterized protein LOC104436...    484   2e-159   
ref|XP_006340601.1|  PREDICTED: uncharacterized protein LOC102601548    483   3e-159   
ref|XP_008241663.1|  PREDICTED: uncharacterized protein LOC103340075    483   6e-159   
ref|XP_008651296.1|  PREDICTED: uncharacterized protein LOC100279...    479   8e-158   
ref|XP_007216479.1|  hypothetical protein PRUPE_ppa024737mg             480   1e-157   
ref|XP_004302906.1|  PREDICTED: uncharacterized protein LOC101294092    479   1e-157   
ref|XP_009631525.1|  PREDICTED: uncharacterized protein LOC104121277    478   5e-157   
gb|KDO79521.1|  hypothetical protein CISIN_1g011797mg                   477   8e-157   
ref|XP_007046967.1|  Sulfite exporter TauE/SafE family protein, p...    476   2e-156   
ref|XP_006425693.1|  hypothetical protein CICLE_v10025446mg             476   2e-156   
ref|XP_008338105.1|  PREDICTED: uncharacterized protein LOC103401...    476   2e-156   
ref|XP_002521607.1|  conserved hypothetical protein                     476   2e-156   Ricinus communis
gb|AEI98632.1|  hypothetical protein 111018.19                          475   3e-156   
ref|XP_002516570.1|  conserved hypothetical protein                     474   5e-156   Ricinus communis
ref|XP_008342687.1|  PREDICTED: uncharacterized protein LOC103405461    473   9e-156   
ref|XP_010649158.1|  PREDICTED: uncharacterized protein LOC100253061    474   1e-155   
ref|XP_009371583.1|  PREDICTED: uncharacterized protein LOC103960...    474   1e-155   
ref|XP_008363111.1|  PREDICTED: uncharacterized protein LOC103426...    474   1e-155   
ref|XP_004512028.1|  PREDICTED: uncharacterized protein LOC101496...    476   1e-155   
ref|XP_009356692.1|  PREDICTED: uncharacterized protein LOC103947...    473   2e-155   
gb|EAZ42610.1|  hypothetical protein OsJ_27176                          472   3e-155   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008338104.1|  PREDICTED: uncharacterized protein LOC103401...    473   3e-155   
ref|XP_004512030.1|  PREDICTED: uncharacterized protein LOC101496...    474   4e-155   
ref|XP_006426964.1|  hypothetical protein CICLE_v10025511mg             473   4e-155   
ref|XP_009356691.1|  PREDICTED: uncharacterized protein LOC103947...    473   5e-155   
ref|XP_008363110.1|  PREDICTED: uncharacterized protein LOC103426...    473   5e-155   
ref|XP_003611976.1|  Membrane protein-like protein                      472   8e-155   
ref|XP_006465610.1|  PREDICTED: uncharacterized protein LOC102613...    472   9e-155   
ref|XP_002310222.2|  hypothetical protein POPTR_0007s12700g             472   1e-154   Populus trichocarpa [western balsam poplar]
ref|XP_003546436.1|  PREDICTED: uncharacterized protein LOC100816528    471   1e-154   
ref|XP_009371582.1|  PREDICTED: uncharacterized protein LOC103960...    471   2e-154   
ref|XP_008228544.1|  PREDICTED: uncharacterized protein LOC103327946    471   2e-154   
ref|XP_004512031.1|  PREDICTED: uncharacterized protein LOC101496...    473   2e-154   
ref|XP_004512029.1|  PREDICTED: uncharacterized protein LOC101496...    472   4e-154   
ref|XP_006833307.1|  hypothetical protein AMTR_s00109p00047950          469   4e-154   
ref|XP_010935066.1|  PREDICTED: uncharacterized protein LOC105055061    469   3e-153   
ref|XP_010263696.1|  PREDICTED: uncharacterized protein LOC104601887    467   7e-153   
ref|XP_006595132.1|  PREDICTED: uncharacterized protein LOC100789...    467   9e-153   
ref|XP_003517231.1|  PREDICTED: uncharacterized protein LOC100801441    466   1e-152   
ref|XP_009346009.1|  PREDICTED: uncharacterized protein LOC103937781    467   1e-152   
gb|KDO79522.1|  hypothetical protein CISIN_1g011797mg                   466   1e-152   
ref|XP_011025767.1|  PREDICTED: uncharacterized protein LOC105126564    465   4e-152   
tpg|DAA61110.1|  TPA: hypothetical protein ZEAMMB73_890925              462   7e-152   
gb|KHG02837.1|  ATP synthase subunit delta                              463   1e-151   
ref|XP_004287906.1|  PREDICTED: uncharacterized protein LOC101304510    463   3e-151   
ref|XP_003542098.1|  PREDICTED: uncharacterized protein LOC100789...    463   4e-151   
ref|XP_010254876.1|  PREDICTED: uncharacterized protein LOC104595...    462   4e-151   
ref|XP_010691331.1|  PREDICTED: uncharacterized protein LOC104904681    461   6e-151   
gb|KHM98753.1|  hypothetical protein glysoja_030806                     461   1e-150   
gb|KDO79725.1|  hypothetical protein CISIN_1g011811mg                   457   1e-150   
ref|XP_009592781.1|  PREDICTED: uncharacterized protein LOC104089...    461   1e-150   
ref|XP_006383214.1|  hypothetical protein POPTR_0005s12570g             461   2e-150   
dbj|BAJ87419.1|  predicted protein                                      460   4e-150   
ref|XP_003574412.1|  PREDICTED: uncharacterized protein LOC100846...    459   4e-150   
gb|ABR16333.1|  unknown                                                 461   5e-150   Picea sitchensis
ref|XP_010235080.1|  PREDICTED: uncharacterized protein LOC100846...    458   7e-150   
ref|XP_003523605.1|  PREDICTED: uncharacterized protein LOC100816633    459   1e-149   
ref|XP_006426963.1|  hypothetical protein CICLE_v10025503mg             457   3e-149   
ref|XP_007216108.1|  hypothetical protein PRUPE_ppa018715mg             455   6e-149   
ref|XP_006659358.1|  PREDICTED: uncharacterized protein LOC102716712    456   6e-149   
ref|XP_006465615.1|  PREDICTED: uncharacterized protein LOC102614...    456   2e-148   
ref|XP_003527721.1|  PREDICTED: uncharacterized protein LOC100789748    456   2e-148   
ref|XP_010999980.1|  PREDICTED: uncharacterized protein LOC105107666    454   6e-148   
ref|XP_008347634.1|  PREDICTED: uncharacterized protein LOC103410...    449   8e-148   
gb|KHN32619.1|  hypothetical protein glysoja_022301                     454   8e-148   
ref|XP_007156932.1|  hypothetical protein PHAVU_002G029400g             453   1e-147   
gb|EMT12794.1|  hypothetical protein F775_19997                         453   1e-147   
ref|XP_004959391.1|  PREDICTED: uncharacterized protein LOC101762929    452   2e-147   
ref|XP_010680799.1|  PREDICTED: uncharacterized protein LOC104895...    452   3e-147   
ref|XP_007150626.1|  hypothetical protein PHAVU_005G168100g             452   4e-147   
ref|XP_009800425.1|  PREDICTED: uncharacterized protein LOC104246...    451   8e-147   
ref|XP_010680798.1|  PREDICTED: uncharacterized protein LOC104895...    451   8e-147   
ref|XP_006465614.1|  PREDICTED: uncharacterized protein LOC102614...    451   1e-146   
emb|CDO98032.1|  unnamed protein product                                449   2e-146   
ref|XP_003574413.1|  PREDICTED: uncharacterized protein LOC100846...    448   1e-145   
ref|XP_009410875.1|  PREDICTED: uncharacterized protein LOC103992760    444   2e-145   
ref|XP_004509250.1|  PREDICTED: uncharacterized protein LOC101512581    447   3e-145   
ref|XP_008783526.1|  PREDICTED: uncharacterized protein LOC103702749    448   3e-145   
ref|XP_007046968.1|  DNA-directed RNA polymerase isoform 2              444   1e-144   
gb|EYU21457.1|  hypothetical protein MIMGU_mgv1a005411mg                444   5e-144   
ref|XP_007156036.1|  hypothetical protein PHAVU_003G253000g             444   6e-144   
ref|NP_001061712.1|  Os08g0387200                                       443   7e-144   Oryza sativa Japonica Group [Japonica rice]
gb|AET03944.2|  sulfite exporter TauE/SafE family protein               443   1e-143   
ref|XP_004235668.1|  PREDICTED: uncharacterized protein LOC101262796    443   1e-143   
gb|EAZ06861.1|  hypothetical protein OsI_29096                          442   2e-143   Oryza sativa Indica Group [Indian rice]
ref|XP_006343068.1|  PREDICTED: uncharacterized protein LOC102587...    443   2e-143   
ref|XP_011072363.1|  PREDICTED: uncharacterized protein LOC105157640    438   1e-141   
ref|XP_011011435.1|  PREDICTED: uncharacterized protein LOC105116...    437   2e-141   
gb|AFK35007.1|  unknown                                                 437   3e-141   
ref|XP_011011433.1|  PREDICTED: uncharacterized protein LOC105116...    437   3e-141   
ref|XP_003629468.1|  hypothetical protein MTR_8g077830                  436   9e-141   
ref|XP_007024174.1|  Sulfite exporter TauE/SafE family protein, p...    436   9e-141   
ref|XP_008795085.1|  PREDICTED: uncharacterized protein LOC103710932    433   1e-140   
gb|KEH35984.1|  sulfite exporter TauE/SafE family protein               432   3e-140   
ref|XP_009784620.1|  PREDICTED: uncharacterized protein LOC104233...    434   3e-140   
ref|XP_009613204.1|  PREDICTED: uncharacterized protein LOC104106373    433   1e-139   
ref|XP_002299704.2|  hypothetical protein POPTR_0001s18300g             432   1e-139   Populus trichocarpa [western balsam poplar]
ref|XP_009611253.1|  PREDICTED: uncharacterized protein LOC104104...    432   3e-139   
gb|EPS70855.1|  hypothetical protein M569_03905                         430   5e-139   
gb|ACJ85296.1|  unknown                                                 428   6e-138   Medicago truncatula
ref|XP_006585193.1|  PREDICTED: uncharacterized protein LOC100802321    427   1e-137   
ref|XP_004504238.1|  PREDICTED: uncharacterized protein LOC101507523    427   2e-137   
dbj|BAG89362.1|  unnamed protein product                                422   3e-137   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004498484.1|  PREDICTED: uncharacterized protein LOC101508...    426   3e-137   
ref|XP_009777896.1|  PREDICTED: uncharacterized protein LOC104227...    426   4e-137   
ref|XP_002516036.1|  conserved hypothetical protein                     424   1e-136   Ricinus communis
gb|EMT22888.1|  hypothetical protein F775_28607                         423   1e-136   
ref|XP_008353719.1|  PREDICTED: uncharacterized protein LOC103417306    440   9e-136   
gb|ABC47842.1|  membrane protein-like protein                           422   1e-135   Glycine max [soybeans]
ref|XP_009592782.1|  PREDICTED: uncharacterized protein LOC104089...    421   1e-135   
ref|XP_004498483.1|  PREDICTED: uncharacterized protein LOC101508...    421   2e-135   
ref|XP_011011436.1|  PREDICTED: uncharacterized protein LOC105116...    418   1e-134   
ref|XP_010113488.1|  hypothetical protein L484_026823                   419   1e-134   
gb|AAY63998.1|  unknown                                                 415   1e-134   Brassica napus [oilseed rape]
gb|KHN36120.1|  hypothetical protein glysoja_003243                     419   1e-134   
ref|XP_006580198.1|  PREDICTED: uncharacterized protein LOC100819316    420   1e-134   
ref|XP_003629897.1|  hypothetical protein MTR_8g088080                  420   2e-134   
gb|ACJ86264.1|  unknown                                                 420   2e-134   Medicago truncatula
ref|XP_002516037.1|  conserved hypothetical protein                     419   3e-134   Ricinus communis
ref|XP_009396550.1|  PREDICTED: uncharacterized protein LOC103981523    418   6e-134   
ref|XP_010667910.1|  PREDICTED: uncharacterized protein LOC104884...    413   8e-134   
ref|XP_009777903.1|  PREDICTED: uncharacterized protein LOC104227...    414   3e-133   
ref|XP_009800426.1|  PREDICTED: uncharacterized protein LOC104246...    414   7e-133   
ref|XP_003532779.1|  PREDICTED: uncharacterized protein LOC100801788    414   2e-132   
gb|KHN06458.1|  hypothetical protein glysoja_010802                     413   3e-132   
ref|XP_006580197.1|  PREDICTED: uncharacterized protein LOC100818778    411   2e-131   
gb|KHN48050.1|  hypothetical protein glysoja_015520                     409   8e-131   
ref|XP_007159526.1|  hypothetical protein PHAVU_002G244900g             407   5e-130   
gb|KEH40300.1|  sulfite exporter TauE/SafE family protein               405   2e-129   
ref|XP_008228546.1|  PREDICTED: uncharacterized protein LOC103327...    405   6e-129   
gb|EMS50771.1|  hypothetical protein TRIUR3_13143                       397   8e-128   
ref|XP_007217721.1|  hypothetical protein PRUPE_ppa005105mg             402   1e-127   
tpg|DAA39926.1|  TPA: hypothetical protein ZEAMMB73_327447              402   2e-127   
ref|XP_006580862.1|  PREDICTED: uncharacterized protein LOC100818240    399   3e-127   
ref|XP_009394307.1|  PREDICTED: uncharacterized protein LOC103979817    400   5e-127   
ref|XP_002460083.1|  hypothetical protein SORBIDRAFT_02g022500          398   1e-126   Sorghum bicolor [broomcorn]
ref|XP_007159577.1|  hypothetical protein PHAVU_002G249100g             399   1e-126   
ref|XP_006585192.1|  PREDICTED: uncharacterized protein LOC100801244    396   1e-126   
ref|XP_007159524.1|  hypothetical protein PHAVU_002G244800g             398   1e-126   
ref|XP_010314281.1|  PREDICTED: uncharacterized protein LOC101268...    398   2e-126   
ref|XP_009611256.1|  PREDICTED: uncharacterized protein LOC104104...    397   2e-126   
gb|AET04372.2|  sulfite exporter TauE/SafE family protein               397   5e-126   
ref|XP_009784625.1|  PREDICTED: uncharacterized protein LOC104233...    394   6e-126   
gb|AEI72271.1|  hypothetical protein                                    391   3e-125   
gb|KDP37236.1|  hypothetical protein JCGZ_06292                         391   1e-124   
gb|KDO79523.1|  hypothetical protein CISIN_1g011797mg                   388   3e-124   
ref|XP_006369186.1|  hypothetical protein POPTR_0001s18380g             391   4e-124   
ref|XP_006359451.1|  PREDICTED: uncharacterized protein LOC102590...    392   6e-124   
ref|XP_010235081.1|  PREDICTED: uncharacterized protein LOC100846...    388   1e-123   
ref|XP_009777900.1|  PREDICTED: uncharacterized protein LOC104227...    390   1e-123   
gb|KHN06459.1|  hypothetical protein glysoja_010803                     390   1e-123   
ref|XP_008670142.1|  PREDICTED: uncharacterized protein LOC103647377    385   1e-122   
ref|XP_007161546.1|  hypothetical protein PHAVU_001G078500g             385   1e-122   
ref|XP_010254877.1|  PREDICTED: uncharacterized protein LOC104595...    382   7e-122   
ref|XP_011009831.1|  PREDICTED: uncharacterized protein LOC105114838    385   5e-121   
ref|XP_009338073.1|  PREDICTED: uncharacterized protein LOC103930451    383   9e-121   
gb|KDO56901.1|  hypothetical protein CISIN_1g0116821mg                  379   1e-120   
ref|XP_009353615.1|  PREDICTED: uncharacterized protein LOC103944864    383   2e-120   
ref|XP_009338074.1|  PREDICTED: uncharacterized protein LOC103930452    382   4e-120   
ref|XP_010314287.1|  PREDICTED: uncharacterized protein LOC101268...    379   3e-119   
ref|XP_004305285.1|  PREDICTED: uncharacterized protein LOC101291554    379   4e-119   
gb|KDO56900.1|  hypothetical protein CISIN_1g0116821mg                  375   5e-119   
ref|XP_008380919.1|  PREDICTED: uncharacterized protein LOC103443803    379   5e-119   
ref|XP_010098073.1|  hypothetical protein L484_026205                   378   9e-119   
ref|XP_008342674.1|  PREDICTED: uncharacterized protein LOC103405448    375   1e-117   
ref|XP_006465613.1|  PREDICTED: uncharacterized protein LOC102613991    372   1e-117   
gb|KHN48052.1|  hypothetical protein glysoja_015522                     371   1e-116   
gb|AAC42255.1|  hypothetical protein                                    385   2e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004504239.1|  PREDICTED: uncharacterized protein LOC101507...    372   2e-116   
ref|XP_002298219.2|  hypothetical protein POPTR_0001s18390g             371   3e-116   Populus trichocarpa [western balsam poplar]
gb|KDO56902.1|  hypothetical protein CISIN_1g0116821mg                  367   6e-116   
ref|XP_007159523.1|  hypothetical protein PHAVU_002G244700g             369   8e-116   
gb|KEH40299.1|  sulfite exporter TauE/SafE family protein               369   2e-115   
ref|XP_007161342.1|  hypothetical protein PHAVU_001G061000g             368   6e-115   
ref|XP_002324818.2|  hypothetical protein POPTR_0018s00770g             362   8e-115   
ref|XP_008228549.1|  PREDICTED: uncharacterized protein LOC103327...    365   6e-114   
ref|XP_003629896.1|  hypothetical protein MTR_8g088070                  364   1e-113   
ref|XP_009611257.1|  PREDICTED: uncharacterized protein LOC104104...    363   3e-113   
ref|XP_008228548.1|  PREDICTED: uncharacterized protein LOC103327...    362   1e-112   
ref|XP_007216194.1|  hypothetical protein PRUPE_ppa015991mg             358   4e-112   
gb|KHG13748.1|  Flavonol synthase/flavanone 3-hydroxylase               354   9e-112   
ref|XP_007159528.1|  hypothetical protein PHAVU_002G2450000g            355   3e-111   
gb|KHN04837.1|  hypothetical protein glysoja_047520                     357   5e-111   
ref|XP_006425694.1|  hypothetical protein CICLE_v10025446mg             359   7e-111   
ref|XP_008228601.1|  PREDICTED: uncharacterized protein LOC103327990    354   4e-110   
gb|EMS53169.1|  hypothetical protein TRIUR3_09961                       362   1e-109   
ref|XP_009777901.1|  PREDICTED: uncharacterized protein LOC104227...    350   3e-108   
ref|XP_004504240.1|  PREDICTED: uncharacterized protein LOC101507...    349   5e-108   
ref|XP_007159525.1|  hypothetical protein PHAVU_002G244800g             342   2e-106   
ref|XP_006596173.1|  PREDICTED: uncharacterized protein LOC100781...    342   3e-105   
ref|XP_004302905.1|  PREDICTED: uncharacterized protein LOC101293605    342   8e-105   
ref|XP_011014738.1|  PREDICTED: uncharacterized protein LOC105118467    337   3e-104   
ref|XP_009611258.1|  PREDICTED: uncharacterized protein LOC104104...    334   6e-103   
ref|XP_007024175.1|  Sulfite exporter TauE/SafE family protein, p...    333   2e-102   
gb|ACJ86237.1|  unknown                                                 324   3e-101   
gb|KCW58608.1|  hypothetical protein EUGRSUZ_H01268                     325   2e-100   
ref|XP_009777905.1|  PREDICTED: uncharacterized protein LOC104227...    325   1e-99    
ref|NP_001145740.1|  uncharacterized protein LOC100279247               315   4e-97    
ref|XP_011018859.1|  PREDICTED: uncharacterized protein LOC105121770    321   6e-97    
ref|XP_008462667.1|  PREDICTED: uncharacterized protein LOC103500970    318   2e-96    
gb|KHG12656.1|  putative tripeptidyl-peptidase SED4                     319   3e-96    
ref|XP_006381336.1|  hypothetical protein POPTR_0006s11920g             318   4e-96    
ref|XP_007027567.1|  Sulfite exporter TauE/SafE family protein is...    318   8e-96    
ref|XP_009592783.1|  PREDICTED: uncharacterized protein LOC104089...    315   1e-95    
gb|KEH24085.1|  sulfite exporter TauE/SafE family protein               317   2e-95    
ref|XP_006596174.1|  PREDICTED: uncharacterized protein LOC100781...    315   3e-95    
ref|XP_010558974.1|  PREDICTED: uncharacterized protein LOC104827497    316   5e-95    
ref|XP_009143570.1|  PREDICTED: uncharacterized protein LOC103867...    316   5e-95    
gb|KDP29233.1|  hypothetical protein JCGZ_16622                         315   1e-94    
ref|NP_850267.1|  Sulfite exporter TauE/SafE family protein             313   3e-94    
ref|XP_002881456.1|  hypothetical protein ARALYDRAFT_902780             313   3e-94    
ref|XP_010527869.1|  PREDICTED: uncharacterized protein LOC104805133    313   4e-94    
ref|XP_003553577.1|  PREDICTED: uncharacterized protein LOC100807336    313   4e-94    
ref|XP_004494124.1|  PREDICTED: uncharacterized protein LOC101492516    313   6e-94    
ref|XP_006410835.1|  hypothetical protein EUTSA_v10016620mg             312   1e-93    
ref|XP_006838739.1|  hypothetical protein AMTR_s00002p00254220          311   3e-93    
ref|XP_004498087.1|  PREDICTED: uncharacterized protein LOC101512728    311   3e-93    
ref|XP_010243123.1|  PREDICTED: uncharacterized protein LOC104587275    311   3e-93    
gb|EYU41559.1|  hypothetical protein MIMGU_mgv1a005977mg                310   7e-93    
ref|XP_010509452.1|  PREDICTED: uncharacterized protein LOC104785865    310   8e-93    
ref|XP_010050180.1|  PREDICTED: uncharacterized protein LOC104438693    309   1e-92    
ref|XP_010505210.1|  PREDICTED: uncharacterized protein LOC104782082    309   1e-92    
ref|XP_004303051.1|  PREDICTED: uncharacterized protein LOC101313325    309   2e-92    
emb|CDX75027.1|  BnaA05g07730D                                          308   3e-92    
gb|KEH24086.1|  sulfite exporter TauE/SafE family protein               306   4e-92    
ref|XP_011094444.1|  PREDICTED: uncharacterized protein LOC105174142    307   9e-92    
emb|CDY33170.1|  BnaC04g08690D                                          307   9e-92    
gb|KHG04871.1|  hypothetical protein F383_28778                         305   2e-91    
ref|XP_006588810.1|  PREDICTED: uncharacterized protein LOC100788770    304   2e-90    
ref|XP_006594178.1|  PREDICTED: uncharacterized protein LOC100804918    303   3e-90    
ref|XP_010278281.1|  PREDICTED: uncharacterized protein LOC104612536    303   4e-90    
ref|XP_010936218.1|  PREDICTED: uncharacterized protein LOC105055...    303   5e-90    
emb|CDP15335.1|  unnamed protein product                                303   6e-90    
ref|XP_004246584.1|  PREDICTED: uncharacterized protein LOC101249675    302   7e-90    
ref|XP_002528632.1|  conserved hypothetical protein                     301   1e-89    
ref|XP_010526118.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    297   2e-89    
ref|XP_006294156.1|  hypothetical protein CARUB_v10023149mg             301   2e-89    
ref|XP_008790425.1|  PREDICTED: uncharacterized protein LOC103707634    301   2e-89    
ref|XP_006341192.1|  PREDICTED: uncharacterized protein LOC102602443    300   4e-89    
ref|XP_006481932.1|  PREDICTED: uncharacterized protein LOC102623178    300   5e-89    
gb|KDP37237.1|  hypothetical protein JCGZ_06293                         297   7e-89    
ref|XP_009340971.1|  PREDICTED: uncharacterized protein LOC103933044    299   9e-89    
gb|KDO57298.1|  hypothetical protein CISIN_1g048232mg                   299   1e-88    
ref|XP_011101500.1|  PREDICTED: uncharacterized protein LOC105179547    299   1e-88    
ref|XP_009143571.1|  PREDICTED: uncharacterized protein LOC103867...    295   2e-88    
ref|XP_006430350.1|  hypothetical protein CICLE_v10011694mg             298   2e-88    
ref|XP_007145273.1|  hypothetical protein PHAVU_007G225100g             298   2e-88    
gb|KEH24087.1|  sulfite exporter TauE/SafE family protein               295   3e-88    
ref|XP_010683928.1|  PREDICTED: uncharacterized protein LOC104898535    297   5e-88    
ref|XP_008357417.1|  PREDICTED: uncharacterized protein LOC103421160    290   5e-88    
ref|XP_006426967.1|  hypothetical protein CICLE_v10025511mg             290   7e-88    
ref|NP_001051136.1|  Os03g0726500                                       297   1e-87    
ref|XP_009603782.1|  PREDICTED: uncharacterized protein LOC104098687    296   2e-87    
gb|EAY91726.1|  hypothetical protein OsI_13369                          296   2e-87    
ref|XP_004981916.1|  PREDICTED: uncharacterized protein LOC101758770    296   3e-87    
ref|XP_008387475.1|  PREDICTED: uncharacterized protein LOC103449926    295   3e-87    
ref|XP_006410834.1|  hypothetical protein EUTSA_v10016620mg             292   3e-87    
ref|XP_009803774.1|  PREDICTED: uncharacterized protein LOC104249090    294   6e-87    
gb|KHN45702.1|  hypothetical protein glysoja_036851                     294   7e-87    
gb|KEH24089.1|  sulfite exporter TauE/SafE family protein               292   2e-86    
gb|KHN06457.1|  hypothetical protein glysoja_010801                     291   2e-86    
ref|XP_002463955.1|  hypothetical protein SORBIDRAFT_01g009520          293   3e-86    
ref|XP_006651766.1|  PREDICTED: uncharacterized protein LOC102721538    291   4e-86    
ref|XP_004143372.1|  PREDICTED: uncharacterized protein LOC101206149    290   2e-85    
ref|XP_002283988.1|  PREDICTED: uncharacterized protein LOC100240792    290   4e-85    
dbj|BAK00649.1|  predicted protein                                      290   5e-85    
ref|NP_001168709.1|  uncharacterized protein LOC100382501               290   7e-85    
ref|XP_009388390.1|  PREDICTED: uncharacterized protein LOC103975...    289   8e-85    
gb|KDO56903.1|  hypothetical protein CISIN_1g0454882mg                  283   1e-84    
ref|XP_002460081.1|  hypothetical protein SORBIDRAFT_02g022480          285   2e-84    
gb|KDO56896.1|  hypothetical protein CISIN_1g022146mg                   281   4e-84    
gb|EYU38596.1|  hypothetical protein MIMGU_mgv1a005752mg                286   6e-84    
ref|XP_009615566.1|  PREDICTED: uncharacterized protein LOC104108278    285   2e-83    
ref|XP_007027568.1|  Sulfite exporter TauE/SafE family protein is...    283   4e-83    
emb|CAN61520.1|  hypothetical protein VITISV_033969                     280   1e-82    
ref|XP_007202039.1|  hypothetical protein PRUPE_ppa005330mg             282   2e-82    
ref|XP_008241334.1|  PREDICTED: uncharacterized protein LOC103339...    282   3e-82    
ref|XP_008241333.1|  PREDICTED: uncharacterized protein LOC103339...    282   3e-82    
ref|XP_006359480.1|  PREDICTED: uncharacterized protein LOC102600300    281   9e-82    
ref|XP_003560372.1|  PREDICTED: uncharacterized protein LOC100844938    281   1e-81    
ref|XP_009760234.1|  PREDICTED: uncharacterized protein LOC104212618    280   2e-81    
ref|XP_009388389.1|  PREDICTED: uncharacterized protein LOC103975...    280   4e-81    
ref|XP_010516887.1|  PREDICTED: uncharacterized protein LOC104792440    278   9e-81    
gb|KHG01219.1|  hypothetical protein F383_22307                         273   2e-79    
gb|KHN48208.1|  hypothetical protein glysoja_007877                     269   9e-78    
ref|XP_007203428.1|  hypothetical protein PRUPE_ppa021619mg             265   5e-77    
gb|KHN02273.1|  60S ribosomal protein L24                               265   2e-74    
gb|KEH24090.1|  sulfite exporter TauE/SafE family protein               258   4e-74    
gb|ACU23197.1|  unknown                                                 252   1e-73    
gb|AFK45505.1|  unknown                                                 251   4e-73    
gb|KEH24088.1|  sulfite exporter TauE/SafE family protein               238   3e-67    
gb|EMS56955.1|  hypothetical protein TRIUR3_23950                       234   7e-65    
gb|EMT30170.1|  hypothetical protein F775_26300                         232   8e-65    
gb|AES60654.2|  sulfite exporter TauE/SafE family protein               234   6e-64    
ref|XP_003590403.1|  hypothetical protein MTR_1g061710                  234   1e-63    
ref|XP_010936219.1|  PREDICTED: uncharacterized protein LOC105055...    225   2e-62    
ref|XP_002990023.1|  hypothetical protein SELMODRAFT_184956             218   7e-60    
ref|XP_002974406.1|  hypothetical protein SELMODRAFT_414563             213   6e-58    
ref|XP_002985707.1|  hypothetical protein SELMODRAFT_446339             213   9e-58    
ref|XP_008347683.1|  PREDICTED: uncharacterized protein LOC103410796    199   2e-55    
gb|AAC12639.1|  hypothetical protein                                    193   4e-54    
gb|AAL27555.1|AF420410_1  hypothetical protein                          189   2e-51    
ref|XP_003537580.2|  PREDICTED: uncharacterized protein LOC100817312    185   3e-50    
gb|KHN41986.1|  hypothetical protein glysoja_003726                     184   3e-50    
ref|XP_007216305.1|  hypothetical protein PRUPE_ppa019587mg             186   6e-49    
ref|XP_010098870.1|  hypothetical protein L484_022637                   178   6e-48    
gb|EPS67474.1|  hypothetical protein M569_07301                         179   9e-48    
gb|AAD20139.1|  unknown protein                                         176   4e-46    
emb|CBI26542.3|  unnamed protein product                                174   6e-46    
ref|XP_007012056.1|  Membrane protein-like, putative                    181   6e-46    
gb|EMT09652.1|  hypothetical protein F775_10698                         176   7e-46    
ref|XP_010050772.1|  PREDICTED: uncharacterized protein LOC104439396    175   1e-44    
gb|EMT16950.1|  hypothetical protein F775_12779                         175   6e-44    
gb|EMS67478.1|  hypothetical protein TRIUR3_25439                       166   1e-43    
ref|XP_002968975.1|  hypothetical protein SELMODRAFT_170159             164   2e-41    
ref|XP_007203406.1|  hypothetical protein PRUPE_ppa021357mg             151   2e-39    
gb|EEE59848.1|  hypothetical protein OsJ_12424                          160   6e-39    
ref|XP_001774657.1|  predicted protein                                  154   3e-37    
tpg|DAA51123.1|  TPA: hypothetical protein ZEAMMB73_068409              142   8e-35    
gb|EEE68607.1|  hypothetical protein OsJ_27142                          140   3e-34    
gb|EMS49201.1|  hypothetical protein TRIUR3_18274                       140   4e-34    
ref|XP_001762486.1|  predicted protein                                  143   2e-33    
ref|XP_007217284.1|  hypothetical protein PRUPE_ppa017782mg             134   6e-33    
ref|XP_007161545.1|  hypothetical protein PHAVU_001G078400g             132   1e-32    
emb|CBI26552.3|  unnamed protein product                                119   6e-28    
ref|XP_003611978.1|  Membrane protein-like protein                      119   7e-28    
ref|XP_003636267.1|  Membrane protein-like protein                      119   8e-28    
gb|AES94936.2|  membrane-like protein, putative                         119   8e-28    
ref|XP_010923986.1|  PREDICTED: uncharacterized protein LOC105046...    127   1e-27    
ref|XP_010052454.1|  PREDICTED: uncharacterized protein LOC104441...    123   2e-26    
ref|XP_009599010.1|  PREDICTED: uncharacterized protein LOC104094736    122   3e-26    
emb|CDO99703.1|  unnamed protein product                                122   3e-26    
ref|XP_010647169.1|  PREDICTED: uncharacterized protein LOC100252...    122   4e-26    
gb|KDP37238.1|  hypothetical protein JCGZ_06294                         118   6e-26    
ref|NP_001044474.1|  Os01g0786800                                       120   9e-26    
dbj|BAD53257.1|  membrane protein-like                                  120   1e-25    
gb|EAY76095.1|  hypothetical protein OsI_04019                          120   1e-25    
tpg|DAA57319.1|  TPA: hypothetical protein ZEAMMB73_804983              120   2e-25    
ref|XP_007025919.1|  Sulfite exporter TauE/SafE family protein, p...    120   2e-25    
ref|NP_001144009.1|  uncharacterized protein LOC100276828 precursor     120   2e-25    
ref|XP_002275818.1|  PREDICTED: uncharacterized protein LOC100252...    119   3e-25    
ref|XP_010547009.1|  PREDICTED: uncharacterized protein LOC104818905    119   3e-25    
ref|XP_004309655.1|  PREDICTED: uncharacterized protein LOC101295...    119   4e-25    
ref|XP_010267808.1|  PREDICTED: uncharacterized protein LOC104604926    119   6e-25    
ref|XP_002442415.1|  hypothetical protein SORBIDRAFT_08g019640          112   1e-24    
ref|XP_009760398.1|  PREDICTED: uncharacterized protein LOC104212746    117   1e-24    
ref|XP_007203269.1|  hypothetical protein PRUPE_ppa019810mg             108   2e-24    
ref|XP_007216519.1|  hypothetical protein PRUPE_ppa024279mg             112   3e-24    
ref|XP_009105169.1|  PREDICTED: uncharacterized protein LOC103831...    116   3e-24    
gb|KHG03566.1|  hypothetical protein F383_09733                         116   4e-24    
ref|XP_006391970.1|  hypothetical protein EUTSA_v10023449mg             115   8e-24    
ref|XP_008793737.1|  PREDICTED: uncharacterized protein LOC103709964    115   1e-23    
ref|XP_009105161.1|  PREDICTED: uncharacterized protein LOC103831...    114   1e-23    
ref|XP_010092689.1|  hypothetical protein L484_019763                   114   1e-23    
ref|XP_004309654.1|  PREDICTED: uncharacterized protein LOC101295...    114   1e-23    
ref|XP_010052456.1|  PREDICTED: uncharacterized protein LOC104441146    114   1e-23    
emb|CDY52324.1|  BnaA01g36230D                                          114   1e-23    
gb|KDP20819.1|  hypothetical protein JCGZ_21290                         114   2e-23    
ref|XP_001784459.1|  predicted protein                                  113   2e-23    
ref|XP_002962601.1|  hypothetical protein SELMODRAFT_65204              113   2e-23    
ref|XP_010052455.1|  PREDICTED: uncharacterized protein LOC104441...    113   3e-23    
ref|XP_006391971.1|  hypothetical protein EUTSA_v10023449mg             113   3e-23    
ref|XP_002317274.1|  hypothetical protein POPTR_0011s03350g             113   4e-23    
ref|XP_002458616.1|  hypothetical protein SORBIDRAFT_03g036740          113   4e-23    
ref|XP_006343279.1|  PREDICTED: uncharacterized protein LOC102586118    113   4e-23    
ref|XP_002980486.1|  hypothetical protein SELMODRAFT_55219              112   5e-23    
ref|XP_008371202.1|  PREDICTED: uncharacterized protein LOC103434627    112   5e-23    
ref|XP_009772341.1|  PREDICTED: uncharacterized protein LOC104222...    112   6e-23    
ref|XP_006365887.1|  PREDICTED: uncharacterized protein LOC102604949    112   7e-23    
ref|XP_009772340.1|  PREDICTED: uncharacterized protein LOC104222...    112   7e-23    
gb|ABK22903.1|  unknown                                                 105   8e-23    
ref|XP_004232753.1|  PREDICTED: uncharacterized protein LOC101265...    112   8e-23    
ref|XP_006594653.1|  PREDICTED: uncharacterized protein LOC100790...    112   1e-22    
ref|XP_002518567.1|  conserved hypothetical protein                     112   1e-22    
ref|XP_010473389.1|  PREDICTED: uncharacterized protein LOC104752...    111   1e-22    
ref|XP_007211594.1|  hypothetical protein PRUPE_ppa005423mg             111   2e-22    
emb|CDY12912.1|  BnaA09g13620D                                          111   2e-22    
ref|XP_010316623.1|  PREDICTED: uncharacterized protein LOC101265...    110   2e-22    
ref|XP_009113117.1|  PREDICTED: uncharacterized protein LOC103838434    110   3e-22    
ref|XP_004234468.1|  PREDICTED: uncharacterized protein LOC101251260    110   3e-22    
ref|XP_010247017.1|  PREDICTED: uncharacterized protein LOC104590...    110   3e-22    
ref|XP_004970213.1|  PREDICTED: uncharacterized protein LOC101770...    110   3e-22    
ref|XP_002886512.1|  hypothetical protein ARALYDRAFT_475155             110   4e-22    
ref|XP_009617473.1|  PREDICTED: uncharacterized protein LOC104109...    109   5e-22    
emb|CDY61959.1|  BnaCnng38840D                                          108   1e-21    
gb|EAY76094.1|  hypothetical protein OsI_04018                          108   1e-21    
ref|XP_009617472.1|  PREDICTED: uncharacterized protein LOC104109...    108   1e-21    
ref|XP_004970214.1|  PREDICTED: uncharacterized protein LOC101770...    108   1e-21    
ref|XP_010247018.1|  PREDICTED: uncharacterized protein LOC104590...    108   2e-21    
tpg|DAA57320.1|  TPA: hypothetical protein ZEAMMB73_804983              107   2e-21    
dbj|BAD53256.1|  membrane protein-like                                  107   2e-21    
ref|XP_011086161.1|  PREDICTED: uncharacterized protein LOC105167962    107   2e-21    
ref|XP_010473387.1|  PREDICTED: uncharacterized protein LOC104752...    107   2e-21    
ref|XP_007148299.1|  hypothetical protein PHAVU_006G196700g             108   2e-21    



>ref|XP_009627765.1| PREDICTED: uncharacterized protein LOC104118259 [Nicotiana tomentosiformis]
Length=478

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/480 (80%), Positives = 429/480 (89%), Gaps = 2/480 (0%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             MAG GGK +I RPL+++SWSFLLA+ FVSAERSL+ E +A  + +  SD DYLST VNFL
Sbjct  1     MAGVGGKLKIFRPLLSISWSFLLAAIFVSAERSLRREAIA-QSATELSDADYLSTVVNFL  59

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             W+P ESGY H+WP+M+ GW+IV+G++IGF+GAAFGSVGGVGGGGIFVPMLSLVVGFDPKS
Sbjct  60    WKPNESGYHHVWPDMKFGWQIVLGTLIGFLGAAFGSVGGVGGGGIFVPMLSLVVGFDPKS  119

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             +TAISKCMIMGAAVS+V+YNLKLRHPT+DMPIIDYDLAVLIQPMLMLGISIGV FNV+FA
Sbjct  120   STAISKCMIMGAAVSTVYYNLKLRHPTIDMPIIDYDLAVLIQPMLMLGISIGVAFNVVFA  179

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPG  1099
             DWMVTVLLIVLF+GTSTKAFLRGVETWKKETI+KKE A+    +G+G + EYKLLP GP 
Sbjct  180   DWMVTVLLIVLFLGTSTKAFLRGVETWKKETIIKKE-AEAAKTSGTGEEAEYKLLPSGPA  238

Query  1100  NGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQ  1279
             NGT+  AK SSE++V ++ENV WKEFGLLCFVW++FLALQI K YT+TCS  YW VNLLQ
Sbjct  239   NGTEKDAKVSSEREVPVMENVCWKEFGLLCFVWIAFLALQIGKIYTATCSVWYWAVNLLQ  298

Query  1280  IPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggf  1459
             IPVS+GV+ FEA  LYKGWRKI SKG+ G+N R  QLIVYCFFG++AG+VGGLLGLGGGF
Sbjct  299   IPVSVGVSSFEAISLYKGWRKIQSKGEDGTNFRVMQLIVYCFFGILAGLVGGLLGLGGGF  358

Query  1460  imgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIG  1639
             IMGPLFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+  AVATVAAF+G
Sbjct  359   IMGPLFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYFVAVATVAAFVG  418

Query  1640  QHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  1819
             QHVVRRLI VLGRASLIIFILAFTIFVSAISLGGVGISNMI KI  HEYMGFENLCKY V
Sbjct  419   QHVVRRLIVVLGRASLIIFILAFTIFVSAISLGGVGISNMIGKIQRHEYMGFENLCKYEV  478



>ref|XP_009783706.1| PREDICTED: uncharacterized protein LOC104232253 [Nicotiana sylvestris]
Length=478

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/481 (80%), Positives = 427/481 (89%), Gaps = 4/481 (1%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             MAG GGK +ILRPL+++SWSFLLA+ FVSAERSLK E +A  N +  SD DYLST VNFL
Sbjct  1     MAGVGGKLKILRPLLSISWSFLLAAIFVSAERSLKREAIA-QNATELSDADYLSTVVNFL  59

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             W+P ESGY H+WP+M+ GW+IV+G+IIGF+GAAFGSVGGVGGGGIFVPMLSL+VGFDPKS
Sbjct  60    WKPNESGYHHVWPDMKFGWQIVVGTIIGFLGAAFGSVGGVGGGGIFVPMLSLIVGFDPKS  119

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             +TAISKCMIMGAAVS+V+YNLKLRHPT+DMPIIDYDLAVLIQPMLMLGISIGV FNV+FA
Sbjct  120   STAISKCMIMGAAVSTVYYNLKLRHPTIDMPIIDYDLAVLIQPMLMLGISIGVAFNVVFA  179

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANG-SGGQGEYKLLPGGP  1096
             DWMVTVLLIVLF+ TSTKAFLRGVETWKKETI+KKEA  + A N  +G + EYKLLP GP
Sbjct  180   DWMVTVLLIVLFLLTSTKAFLRGVETWKKETIIKKEA--EAAKNSETGDEAEYKLLPSGP  237

Query  1097  GNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLL  1276
              NGT+  AK +SE++V  +ENV WKEFGLLCFVW++FLALQI K YT+TCS  YW VNLL
Sbjct  238   ANGTEKDAKVTSEREVPFMENVCWKEFGLLCFVWIAFLALQIGKIYTATCSVWYWGVNLL  297

Query  1277  QIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglggg  1456
             QIPVS+GV+ FEA  LYKGWRKI SKG+ G+N R  QLIVYC FG++AG+VGGLLGLGGG
Sbjct  298   QIPVSVGVSSFEAISLYKGWRKIQSKGEDGTNFRVMQLIVYCLFGILAGLVGGLLGLGGG  357

Query  1457  fimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafI  1636
             FIMGPLFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+  AVATVAAF+
Sbjct  358   FIMGPLFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYFVAVATVAAFV  417

Query  1637  GQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  1816
             GQHVVRRLI VLGRASLIIFILAFTIFVSAISLGGVGISNMI KI  HEYMGFENLCKY 
Sbjct  418   GQHVVRRLIVVLGRASLIIFILAFTIFVSAISLGGVGISNMIGKIQRHEYMGFENLCKYE  477

Query  1817  V  1819
             V
Sbjct  478   V  478



>ref|XP_009623066.1| PREDICTED: uncharacterized protein LOC104114346 [Nicotiana tomentosiformis]
Length=483

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/481 (77%), Positives = 422/481 (88%), Gaps = 3/481 (1%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNV-SRNSDDDYLSTFVNF  556
             MAG G +W+I RPL+++SWSFLLA+ FVSAERSLK E+        + SD +YL+  VNF
Sbjct  1     MAGVGTRWKIFRPLLSISWSFLLAAIFVSAERSLKREQTYNNATHQQQSDANYLTDVVNF  60

Query  557   LWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPK  736
             LW+P ESGY H+WP+M+ GW+I++GSIIGF+GAAFGSVGGVGGGGIFVPMLSL+VGFDPK
Sbjct  61    LWKPNESGYQHVWPDMKFGWKIIVGSIIGFLGAAFGSVGGVGGGGIFVPMLSLIVGFDPK  120

Query  737   SATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIF  916
             S+TAISKCMIMGA+VS+V+YNLKLRHPT+DMPIIDYDLAVLIQPMLMLGISIGVTFNVIF
Sbjct  121   SSTAISKCMIMGASVSTVYYNLKLRHPTIDMPIIDYDLAVLIQPMLMLGISIGVTFNVIF  180

Query  917   ADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKK--EAAQQLAANGSGGQGEYKLLPG  1090
             ADWMVTVLLI+LFI TSTKAFLRGVETWKKETIM+K  EAA++   NG+G + EYKLLPG
Sbjct  181   ADWMVTVLLIILFIATSTKAFLRGVETWKKETIMQKEAEAAKKSGINGAGEEAEYKLLPG  240

Query  1091  GPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVN  1270
             G  + T+    +SSE +V I+ENV WKE GLL FVWV+FL LQI KNYT  C+ LYWVVN
Sbjct  241   GSNDDTEKKGTDSSEPEVPILENVCWKEVGLLSFVWVAFLGLQIGKNYTDNCTALYWVVN  300

Query  1271  LLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglg  1450
             LLQIPVSLGV+ +EA  LYKGWR+I SKGD G+N R  QLIVYCFFG++AG+VGGLLGLG
Sbjct  301   LLQIPVSLGVSSYEAISLYKGWRRIESKGDQGTNFRVLQLIVYCFFGVVAGMVGGLLGLG  360

Query  1451  ggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaa  1630
             GGFIMGP+FLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYA +  AVATVAA
Sbjct  361   GGFIMGPMFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAAYFVAVATVAA  420

Query  1631  fIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  1810
              +GQHVVRR+I +LGRASLIIFILAFTIFVSAISLGGVGISNMIEKI +HEYMGFENLCK
Sbjct  421   LVGQHVVRRMIVILGRASLIIFILAFTIFVSAISLGGVGISNMIEKIQHHEYMGFENLCK  480

Query  1811  Y  1813
             Y
Sbjct  481   Y  481



>ref|XP_009791161.1| PREDICTED: uncharacterized protein LOC104238494 [Nicotiana sylvestris]
Length=483

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/481 (77%), Positives = 421/481 (88%), Gaps = 3/481 (1%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNV-SRNSDDDYLSTFVNF  556
             MAG G +W+I RPL+++SWSFLLA+ FVSAERSLK E++       + SD +YL+  VNF
Sbjct  1     MAGVGTRWKIFRPLLSISWSFLLAAIFVSAERSLKREQIYNNATHQQQSDANYLTDVVNF  60

Query  557   LWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPK  736
             LW+P ESGY H+WP+M+ GW+IV+GSIIGF+GAAFGSVGGVGGGGIFVPMLSL+VGFDPK
Sbjct  61    LWKPNESGYQHVWPDMKFGWKIVVGSIIGFLGAAFGSVGGVGGGGIFVPMLSLIVGFDPK  120

Query  737   SATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIF  916
             S+TAISKCMIMG++VS+V+YNLKLRHPT+DMPIIDYDLAVLIQPMLMLGISIGVTFNVIF
Sbjct  121   SSTAISKCMIMGSSVSTVYYNLKLRHPTIDMPIIDYDLAVLIQPMLMLGISIGVTFNVIF  180

Query  917   ADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKK--EAAQQLAANGSGGQGEYKLLPG  1090
             ADWMVTVLLI+LFI TSTKAFLRGVETWKKETIMKK  EAA++   NG+G + +YKLLPG
Sbjct  181   ADWMVTVLLIILFIATSTKAFLRGVETWKKETIMKKEAEAAKKSGINGAGEEADYKLLPG  240

Query  1091  GPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVN  1270
             G  + T+    +SSE +V I+ENV WKE GLL FVWV+FL LQI KNYT  C+ LYWVVN
Sbjct  241   GSNDDTEKKGTDSSEPEVPILENVCWKEVGLLSFVWVAFLGLQIGKNYTDNCTALYWVVN  300

Query  1271  LLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglg  1450
             LLQIPVSLGV+ +EA  LYKGWR+I SKG+ G+N R  QLIVYCFFG++AG+VGGLLGLG
Sbjct  301   LLQIPVSLGVSSYEAISLYKGWRRIDSKGEQGTNFRVLQLIVYCFFGVVAGIVGGLLGLG  360

Query  1451  ggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaa  1630
             GGFIMGP+FLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYA +  AVATVAA
Sbjct  361   GGFIMGPMFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAAYFVAVATVAA  420

Query  1631  fIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  1810
              +GQHVVRR+I +LGRASLIIFILAFTIFVSAISLGGVGISNMI KI  HEYMGFENLCK
Sbjct  421   LVGQHVVRRMIVILGRASLIIFILAFTIFVSAISLGGVGISNMIGKIERHEYMGFENLCK  480

Query  1811  Y  1813
             Y
Sbjct  481   Y  481



>ref|XP_011081835.1| PREDICTED: uncharacterized protein LOC105164774 [Sesamum indicum]
Length=480

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/481 (77%), Positives = 420/481 (87%), Gaps = 2/481 (0%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             MA    KW+   P   + WSFLLAS FVSAERSLK E ++  + + +SD D+LSTFVNF+
Sbjct  1     MARNLEKWKAFGPFFTVLWSFLLASIFVSAERSLKQESLS-RSAAHDSDSDFLSTFVNFI  59

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             WQ  +SGY H+WP+++  W+IV+GSIIGF GAAFGSVGGVGGGGIFVPMLSL++GFDPKS
Sbjct  60    WQANKSGYHHVWPDLKFNWQIVVGSIIGFFGAAFGSVGGVGGGGIFVPMLSLIIGFDPKS  119

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             ATAISKCMIMGAAVS+V+YNLKLRHPT+DMPIIDYDLAVLIQPMLMLGISIGV FNV+FA
Sbjct  120   ATAISKCMIMGAAVSTVYYNLKLRHPTIDMPIIDYDLAVLIQPMLMLGISIGVAFNVVFA  179

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGG-QGEYKLLPGGP  1096
             DWMVTVLLI+LF+ TSTKAFL+GVETWKKETIMKKEAA++L  NG+G  + EYKLLPGGP
Sbjct  180   DWMVTVLLIILFLVTSTKAFLKGVETWKKETIMKKEAAKRLETNGAGKEEAEYKLLPGGP  239

Query  1097  GNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLL  1276
              N T+  AK+  E +VSIIENV WKEF LL FVW++FLALQI+K YT+TCSTLYWVVNLL
Sbjct  240   SNNTEKEAKDLEEPEVSIIENVCWKEFALLVFVWIAFLALQIIKEYTTTCSTLYWVVNLL  299

Query  1277  QIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglggg  1456
             Q+PVS GV+ +EA  LYKGWRKI SKGD G+N +  QL+ Y FFG++AG+VGGLLGLGGG
Sbjct  300   QVPVSFGVSGYEAVSLYKGWRKIGSKGDEGTNFKVHQLLTYGFFGVLAGMVGGLLGLGGG  359

Query  1457  fimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafI  1636
             FIMGPLFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+  AVAT+AAFI
Sbjct  360   FIMGPLFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYFVAVATIAAFI  419

Query  1637  GQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  1816
             GQHVVR+LI VLGRAS+IIFIL+FTIFVSAISLGGVGISNMI KI  HEYMGFENLCKY 
Sbjct  420   GQHVVRKLIIVLGRASIIIFILSFTIFVSAISLGGVGISNMIGKIQRHEYMGFENLCKYA  479

Query  1817  V  1819
             V
Sbjct  480   V  480



>ref|XP_006340268.1| PREDICTED: uncharacterized protein LOC102587334 [Solanum tuberosum]
Length=477

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/481 (78%), Positives = 418/481 (87%), Gaps = 5/481 (1%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             MAG GGK +ILRP++++ WSFLLA+ FVSAER +K  EV   N +  SD DYLS   NFL
Sbjct  1     MAGFGGKLKILRPVLSILWSFLLAAIFVSAERRIK-REVIEQNAAELSDADYLSAVANFL  59

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             W+P ESGY H+WP+M+ GW+IV+GS IGF+GAAFGSVGGVGGGGIFVPMLSL+VGFDPKS
Sbjct  60    WKPNESGYQHVWPDMKFGWQIVLGSTIGFLGAAFGSVGGVGGGGIFVPMLSLIVGFDPKS  119

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             ATAISKCMIMGAAVS+V+YNLKLRHPT+ MPIIDYDLAVLIQPMLMLGISIGVTFNVIFA
Sbjct  120   ATAISKCMIMGAAVSTVYYNLKLRHPTIAMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  179

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQ-LAANGSGGQGEYKLLPGGP  1096
             DWMVTVLLIVLF GTSTKAFLRGVETWKKETI+KKEAA + L  NG+  + EYKLLPGGP
Sbjct  180   DWMVTVLLIVLFFGTSTKAFLRGVETWKKETIVKKEAAAKLLGTNGTVDEAEYKLLPGGP  239

Query  1097  GNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLL  1276
              NG    AK + E QV I+ENV WKEFGLL FVWV++LALQI K YTSTCS  YWVVNLL
Sbjct  240   ANG---DAKGAVEPQVPIMENVCWKEFGLLSFVWVAYLALQIGKIYTSTCSAWYWVVNLL  296

Query  1277  QIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglggg  1456
             Q+PVS+GV+ +EA  LYKGWR+I SKGD G++ R  QLI YC FG++AG+VGGLLGLGGG
Sbjct  297   QVPVSVGVSFYEAISLYKGWRRIQSKGDDGTDFRVTQLIAYCSFGILAGMVGGLLGLGGG  356

Query  1457  fimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafI  1636
             FIMGPLFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+  AVAT+AAF+
Sbjct  357   FIMGPLFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYFVAVATIAAFV  416

Query  1637  GQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  1816
             GQHVVRRLI VLGRASLIIFILAFTIFVSAISLGGVGISNMI KI   EYMGFENLCKY 
Sbjct  417   GQHVVRRLIFVLGRASLIIFILAFTIFVSAISLGGVGISNMIGKIQRDEYMGFENLCKYR  476

Query  1817  V  1819
             +
Sbjct  477   I  477



>ref|XP_004245262.1| PREDICTED: uncharacterized protein LOC101258883 [Solanum lycopersicum]
Length=476

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/480 (77%), Positives = 416/480 (87%), Gaps = 8/480 (2%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             MAG G +W++ RPL+++SWSFLLA+ FVSAERSLK E VA  N +  SD D L++ V FL
Sbjct  1     MAGVGSRWKVFRPLLSISWSFLLAAIFVSAERSLKKEIVA-QNATHQSDADLLTSVVQFL  59

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             W+P ESGY H+WP+M+ GWEI++GSIIGF+GAAFGSVGGVGGGGIFVPMLSL+VGFDPKS
Sbjct  60    WKPDESGYQHVWPDMKFGWEIIVGSIIGFLGAAFGSVGGVGGGGIFVPMLSLIVGFDPKS  119

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             +TAISKCMIMGA+VS+V+YNLKLRHPT+DMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA
Sbjct  120   STAISKCMIMGASVSTVYYNLKLRHPTIDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  179

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKK--EAAQQLAANGSGGQGEYKLLPGG  1093
             DWMVTVLLI+LFIGTSTKAFLRGVETWKKETI+KK  EAA++  AN      EYKLLPG 
Sbjct  180   DWMVTVLLIILFIGTSTKAFLRGVETWKKETILKKETEAAKKSGAN----DAEYKLLPGD  235

Query  1094  PGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNL  1273
               N  +    E SE +V I+ENV WKE GLL FVWV+FL LQI KNYT  C+ LYWVVNL
Sbjct  236   -ANDAEKKKTEVSEPEVPIMENVCWKETGLLSFVWVAFLGLQIGKNYTDNCTPLYWVVNL  294

Query  1274  LQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgg  1453
             LQIPV+LGV+ +EA  LYKGWR+I SKG+ G+N R  QLIVYCFFG++AG+VGGLLGLGG
Sbjct  295   LQIPVALGVSSYEAVSLYKGWRRIESKGEDGTNFRVMQLIVYCFFGIVAGMVGGLLGLGG  354

Query  1454  gfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaaf  1633
             GFIMGP+FLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+  AVATVAA 
Sbjct  355   GFIMGPMFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYFVAVATVAAL  414

Query  1634  IGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             IGQHVVRR+I +LGRASLIIFILA TIFVSAISLGGVGISNMI KI  HEYMGFENLCKY
Sbjct  415   IGQHVVRRMIMILGRASLIIFILASTIFVSAISLGGVGISNMIGKIQRHEYMGFENLCKY  474



>ref|XP_010313606.1| PREDICTED: uncharacterized protein LOC101255958 [Solanum lycopersicum]
Length=477

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/481 (78%), Positives = 419/481 (87%), Gaps = 5/481 (1%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             M G GGK++ILRP++++ WSFLLA+ FVSAER +K  EV   N +  SD DYLS   NFL
Sbjct  1     MEGFGGKFKILRPVLSILWSFLLAAVFVSAERRIK-REVIEQNAAELSDADYLSAVANFL  59

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             W+P +SGY H+WP+M+ GW+IV+GS IGF+GAAFGSVGGVGGGGIFVPMLSL+VGFDPKS
Sbjct  60    WRPNKSGYQHVWPDMKFGWQIVLGSTIGFLGAAFGSVGGVGGGGIFVPMLSLIVGFDPKS  119

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             ATAISKCMIMGAAVS+V+YNLKLRHPT+ MPIIDYDLAVLIQPMLMLGISIGVTFNVIFA
Sbjct  120   ATAISKCMIMGAAVSTVYYNLKLRHPTIAMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  179

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQ-LAANGSGGQGEYKLLPGGP  1096
             DWMVTVLLIVLF GTSTKAFLRGV+TWKKETI+KKEAA + L  NG+  + EYKLLPGGP
Sbjct  180   DWMVTVLLIVLFFGTSTKAFLRGVDTWKKETIVKKEAASKLLRTNGTRDEAEYKLLPGGP  239

Query  1097  GNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLL  1276
              NG    AK ++E +V I+ENV WKEFGLLCFVWV+FLALQI K YTSTCS  YWVVNLL
Sbjct  240   ANG---AAKGAAEPRVPIVENVCWKEFGLLCFVWVAFLALQIGKIYTSTCSVWYWVVNLL  296

Query  1277  QIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglggg  1456
             Q+PVS+G++ +EA  LYKGWR+I SKGD G++ R  QLI YC FG++AG+VGGLLGLGGG
Sbjct  297   QVPVSVGISFYEAISLYKGWRRIQSKGDDGTDFRVTQLIAYCSFGILAGMVGGLLGLGGG  356

Query  1457  fimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafI  1636
             FIMGPLFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+  AVATVAAF+
Sbjct  357   FIMGPLFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYFVAVATVAAFV  416

Query  1637  GQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  1816
             GQHVVRRLI VLGRASLIIFILAFTIFVSAISLGGVGISNMI KI   EYMGFENLC Y 
Sbjct  417   GQHVVRRLIIVLGRASLIIFILAFTIFVSAISLGGVGISNMIGKIQRDEYMGFENLCNYR  476

Query  1817  V  1819
             +
Sbjct  477   I  477



>emb|CDP16156.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/481 (77%), Positives = 418/481 (87%), Gaps = 4/481 (1%)
 Frame = +2

Query  380   MAGAGGKWRIL-RPLVALSWSFLLASAFVSAERSLKNEEVA-GTNVSRNSDDDYLSTFVN  553
             MAG GGKW ++ RPL+ +  +FLLAS  VSAERS +NE  A   N + N      S  +N
Sbjct  1     MAGRGGKWDVVFRPLLPIVCNFLLASILVSAERSFRNEASASAQNSTGNPASANFSKLLN  60

Query  554   FLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDP  733
             FLWQ  +SGY H+WPE++ GW+IV+G+IIGF GAAFGSVGGVGGGGIFVPMLSL++GFDP
Sbjct  61    FLWQADKSGYQHVWPEIKFGWQIVVGTIIGFFGAAFGSVGGVGGGGIFVPMLSLIIGFDP  120

Query  734   KSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVI  913
             KS+TAISKCMIMGA++S+V+YNLKLRHPT+DMPIIDYDLAVLIQPMLMLGISIGV FNVI
Sbjct  121   KSSTAISKCMIMGASISTVYYNLKLRHPTIDMPIIDYDLAVLIQPMLMLGISIGVAFNVI  180

Query  914   FADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGG-QGEYKLLPG  1090
             FADWMVTVLLI+LFIGTSTKAFLRGVETWKKETIMKKEAA++L  NG+G  + EYKLLP 
Sbjct  181   FADWMVTVLLIILFIGTSTKAFLRGVETWKKETIMKKEAAKRLETNGNGQEEAEYKLLPS  240

Query  1091  GPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVN  1270
             GP N  +  AK   E++V I+ENV WKEFGLL FVW++FLALQI+KN+T TCS LYWVVN
Sbjct  241   GPSNDKEKDAKP-VEQEVPILENVCWKEFGLLVFVWIAFLALQIIKNHTDTCSALYWVVN  299

Query  1271  LLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglg  1450
             LLQIPVS GV+ FEA  LYKGWRKI+SKGD+G+N +  QLI YCFFG++AGVVGGLLGLG
Sbjct  300   LLQIPVSFGVSSFEAFSLYKGWRKIASKGDTGTNFKVHQLITYCFFGVLAGVVGGLLGLG  359

Query  1451  ggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaa  1630
             GGFIMGPLFLELGVPPQVSSATATFAMMFS+SMSVVEYYLLKRFPVPYAL+  AVATVAA
Sbjct  360   GGFIMGPLFLELGVPPQVSSATATFAMMFSASMSVVEYYLLKRFPVPYALYFIAVATVAA  419

Query  1631  fIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  1810
             FIGQH VRR+I +LGRASLIIFILAFTIFVSAISLGGVGISNMI KI +HEYMGFENLCK
Sbjct  420   FIGQHFVRRIIILLGRASLIIFILAFTIFVSAISLGGVGISNMIGKIEHHEYMGFENLCK  479

Query  1811  Y  1813
             Y
Sbjct  480   Y  480



>ref|XP_006366208.1| PREDICTED: uncharacterized protein LOC102587808 isoform X2 [Solanum 
tuberosum]
Length=474

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/478 (77%), Positives = 416/478 (87%), Gaps = 6/478 (1%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             MAG G +W++ RPL+++SWSFLLA+ FVSAERSLK E VA  N +  SD D L++ V FL
Sbjct  1     MAGVGSRWKVFRPLLSISWSFLLAAIFVSAERSLKKEIVA-QNATHQSDADLLTSVVQFL  59

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             W+P ESGY H+WPEM+ GW+I++GSIIGF+GAAFGSVGGVGGGGIFVPMLSL++GFDPKS
Sbjct  60    WKPNESGYQHVWPEMKFGWQIIVGSIIGFLGAAFGSVGGVGGGGIFVPMLSLIIGFDPKS  119

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             +TAISKCMIMGA+VS+V+YNLKLRHPT+DMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA
Sbjct  120   STAISKCMIMGASVSTVYYNLKLRHPTIDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  179

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPG  1099
             DWMVTVLLIVLF GTSTKAFLRGVETWKKETI+KKE     AA  SG   EYKLLPG   
Sbjct  180   DWMVTVLLIVLFFGTSTKAFLRGVETWKKETILKKETE---AAKKSGAN-EYKLLPGD-A  234

Query  1100  NGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQ  1279
             N  +    E+SE +V I+ENV WKE GLL FVWV+FLALQI KNYT  C+ LYWVVNLLQ
Sbjct  235   NDAEKKKTEASEPEVPIMENVCWKETGLLSFVWVAFLALQIGKNYTDNCTPLYWVVNLLQ  294

Query  1280  IPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggf  1459
             +PV+LGV+ +EA  LYKGWR+I SKG+ G+N R  QLIVYCFFG++AG+VGGLLGLGGGF
Sbjct  295   VPVALGVSSYEAVSLYKGWRRIESKGEDGTNFRVMQLIVYCFFGIVAGMVGGLLGLGGGF  354

Query  1460  imgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIG  1639
             IMGP+FLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+  AVATVAAF+G
Sbjct  355   IMGPMFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYFVAVATVAAFVG  414

Query  1640  QHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             QHVVRR+I +LGRASLIIFILA TIFVSAISLGGVGISNMI KI  HEYMGFENLCKY
Sbjct  415   QHVVRRMIMILGRASLIIFILASTIFVSAISLGGVGISNMIGKIQRHEYMGFENLCKY  472



>ref|XP_006366207.1| PREDICTED: uncharacterized protein LOC102587808 isoform X1 [Solanum 
tuberosum]
Length=476

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/480 (77%), Positives = 418/480 (87%), Gaps = 8/480 (2%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             MAG G +W++ RPL+++SWSFLLA+ FVSAERSLK E VA  N +  SD D L++ V FL
Sbjct  1     MAGVGSRWKVFRPLLSISWSFLLAAIFVSAERSLKKEIVA-QNATHQSDADLLTSVVQFL  59

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             W+P ESGY H+WPEM+ GW+I++GSIIGF+GAAFGSVGGVGGGGIFVPMLSL++GFDPKS
Sbjct  60    WKPNESGYQHVWPEMKFGWQIIVGSIIGFLGAAFGSVGGVGGGGIFVPMLSLIIGFDPKS  119

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             +TAISKCMIMGA+VS+V+YNLKLRHPT+DMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA
Sbjct  120   STAISKCMIMGASVSTVYYNLKLRHPTIDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  179

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKK--EAAQQLAANGSGGQGEYKLLPGG  1093
             DWMVTVLLIVLF GTSTKAFLRGVETWKKETI+KK  EAA++  AN      EYKLLPG 
Sbjct  180   DWMVTVLLIVLFFGTSTKAFLRGVETWKKETILKKETEAAKKSGAN----DAEYKLLPGD  235

Query  1094  PGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNL  1273
               N  +    E+SE +V I+ENV WKE GLL FVWV+FLALQI KNYT  C+ LYWVVNL
Sbjct  236   -ANDAEKKKTEASEPEVPIMENVCWKETGLLSFVWVAFLALQIGKNYTDNCTPLYWVVNL  294

Query  1274  LQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgg  1453
             LQ+PV+LGV+ +EA  LYKGWR+I SKG+ G+N R  QLIVYCFFG++AG+VGGLLGLGG
Sbjct  295   LQVPVALGVSSYEAVSLYKGWRRIESKGEDGTNFRVMQLIVYCFFGIVAGMVGGLLGLGG  354

Query  1454  gfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaaf  1633
             GFIMGP+FLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+  AVATVAAF
Sbjct  355   GFIMGPMFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYFVAVATVAAF  414

Query  1634  IGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             +GQHVVRR+I +LGRASLIIFILA TIFVSAISLGGVGISNMI KI  HEYMGFENLCKY
Sbjct  415   VGQHVVRRMIMILGRASLIIFILASTIFVSAISLGGVGISNMIGKIQRHEYMGFENLCKY  474



>ref|XP_002284175.1| PREDICTED: uncharacterized protein LOC100267889 [Vitis vinifera]
 emb|CBI20891.3| unnamed protein product [Vitis vinifera]
Length=478

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/483 (75%), Positives = 417/483 (86%), Gaps = 8/483 (2%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNS--DDDYLSTFVN  553
             MAG   KW +L  L     SF+LASAFVS ERS+K+E  +  NV++ +  + +YLS  VN
Sbjct  1     MAGFATKWLMLMILC----SFMLASAFVSGERSIKHE-ASTFNVTKEAGFNSNYLSKVVN  55

Query  554   FLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDP  733
             FLWQ   SGY H+WPEME GW+IV+GS+IGF GAAFGSVGGVGGGGIFVPMLSLV+GFDP
Sbjct  56    FLWQSDRSGYQHVWPEMEFGWQIVVGSVIGFFGAAFGSVGGVGGGGIFVPMLSLVIGFDP  115

Query  734   KSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVI  913
             KSATA+SKCMIMGAA S+V+YNLKLRHPTLDMPIIDYDLA+L QPMLM+GISIGV FNV+
Sbjct  116   KSATALSKCMIMGAAGSTVYYNLKLRHPTLDMPIIDYDLALLFQPMLMMGISIGVAFNVL  175

Query  914   FADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQG-EYKLLPG  1090
             FADWMVTVLLIVLF+GTSTKAFL+GVETWKKETIMK+EAA++L  NG+G +  EYK LP 
Sbjct  176   FADWMVTVLLIVLFLGTSTKAFLKGVETWKKETIMKREAAKRLGTNGNGTEEVEYKPLPS  235

Query  1091  GPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVN  1270
             GP NGTQ+   +S E +VSIIENVYWKE GLL FVWV+FLALQI KN T+TCS  YWV+N
Sbjct  236   GPSNGTQNATNKSKEPEVSIIENVYWKELGLLVFVWVAFLALQIAKNNTATCSMAYWVLN  295

Query  1271  LLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglg  1450
              +QIPVS+GV+L+EA  LYKG R I+SKGD+G+N R  QLI+YCF G++AG+VGGLLGLG
Sbjct  296   FMQIPVSVGVSLYEAVSLYKGRRIIASKGDAGTNFRVHQLILYCFCGVLAGIVGGLLGLG  355

Query  1451  ggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaa  1630
             GGFI+GPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA++L  VAT+AA
Sbjct  356   GGFILGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAVYLVLVATIAA  415

Query  1631  fIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  1810
             FIGQHVVRRLI++LGRASLIIFILAFTIF+SAISLGGVG+SNMI KI  HEYMGFENLC+
Sbjct  416   FIGQHVVRRLISILGRASLIIFILAFTIFISAISLGGVGLSNMIGKIERHEYMGFENLCR  475

Query  1811  YGV  1819
             Y V
Sbjct  476   YEV  478



>gb|EYU21882.1| hypothetical protein MIMGU_mgv1a005504mg [Erythranthe guttata]
Length=481

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/481 (74%), Positives = 407/481 (85%), Gaps = 1/481 (0%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNV-SRNSDDDYLSTFVNF  556
             MAG   +W+   P   + WSFLLAS FVSAERSLK E  +   + +R+SD D L++ VNF
Sbjct  1     MAGNLERWKAFGPFFTVVWSFLLASIFVSAERSLKKEYSSRIAIETRDSDSDILTSVVNF  60

Query  557   LWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPK  736
             LWQ   SGY H+WP+++  W+IV+GSIIGF+GAAFGSVGGVGGGGIFVPML+L++GFDPK
Sbjct  61    LWQGNNSGYHHVWPDLKFNWKIVVGSIIGFLGAAFGSVGGVGGGGIFVPMLTLIIGFDPK  120

Query  737   SATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIF  916
             SATAISKCMIMG AVS+V+YNLKLRHPT+DMPIIDYDLAVLIQPMLMLGISIGV FNV+F
Sbjct  121   SATAISKCMIMGGAVSTVYYNLKLRHPTIDMPIIDYDLAVLIQPMLMLGISIGVAFNVVF  180

Query  917   ADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGP  1096
             ADWMVTVLLI+LF+GTSTKAF +G+ETWKKETIMKKEAA++  ANG G +  YKLLPGGP
Sbjct  181   ADWMVTVLLIILFLGTSTKAFFKGLETWKKETIMKKEAAKRYEANGDGKEEAYKLLPGGP  240

Query  1097  GNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLL  1276
              N      K+  E  V IIENV WKE GLL FVW SFLALQI+K YT+TCS  YW VNLL
Sbjct  241   SNNAGKEFKDFEEPTVGIIENVCWKECGLLFFVWFSFLALQILKMYTTTCSVTYWTVNLL  300

Query  1277  QIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglggg  1456
             QIPVS+GV+ +EA  LYKGWRK+ SKGD G+N +  QL+VY FFG++AG+VGGLLGLGGG
Sbjct  301   QIPVSMGVSGYEALSLYKGWRKLGSKGDEGTNFKVHQLLVYGFFGILAGLVGGLLGLGGG  360

Query  1457  fimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafI  1636
             FIMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+  AVATVAAFI
Sbjct  361   FIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYFVAVATVAAFI  420

Query  1637  GQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  1816
             GQH VR+LI +LGRAS+IIFILA TIF+SAISLGGVGISNMI KI  +EYMGFENLCKY 
Sbjct  421   GQHFVRKLIIILGRASIIIFILASTIFISAISLGGVGISNMIGKIERNEYMGFENLCKYQ  480

Query  1817  V  1819
             V
Sbjct  481   V  481



>ref|XP_002309560.2| hypothetical protein POPTR_0006s25880g [Populus trichocarpa]
 gb|EEE93083.2| hypothetical protein POPTR_0006s25880g [Populus trichocarpa]
Length=479

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/483 (74%), Positives = 408/483 (84%), Gaps = 11/483 (2%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFV---  550
             MA  GGKWR LR ++ +  +FLLA  FVSAER LK E    T+   N   D +S++V   
Sbjct  1     MAEFGGKWRGLRSVLMVLLNFLLAFVFVSAERGLKRE---ATSTRMNETGDSVSSYVLKA  57

Query  551   -NFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGF  727
              NFLWQP   GY H+WPEM+ GW+IV+GSIIGF GAAFGSVGGVGGGGIFVPMLSLV+GF
Sbjct  58    VNFLWQPDHKGYQHVWPEMKFGWQIVLGSIIGFFGAAFGSVGGVGGGGIFVPMLSLVIGF  117

Query  728   DPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFN  907
             DPKSATAISKCMIMGAA+S+V+YNLKLRHPTLDMPIIDYDLA+LIQPMLMLGISIGV FN
Sbjct  118   DPKSATAISKCMIMGAAISTVYYNLKLRHPTLDMPIIDYDLALLIQPMLMLGISIGVAFN  177

Query  908   VIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANG-SGGQGEYKLL  1084
             V+FADWMVTVLLI+LF+GTSTKAFL+GVETWKKETIMK+EAA++L ++G S G+ EYK L
Sbjct  178   VVFADWMVTVLLIILFLGTSTKAFLKGVETWKKETIMKREAAKRLESDGASAGEVEYKPL  237

Query  1085  PGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWV  1264
             PGGP N  Q   K   E++VSI+ENVYWKE GLL FVWV+FL LQI K  TSTCST YWV
Sbjct  238   PGGPSNSPQ---KADKEEEVSILENVYWKELGLLVFVWVAFLVLQITKEGTSTCSTTYWV  294

Query  1265  VNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllg  1444
             +NLLQIPVS+GV+++EA  LYKG R I+SKG  G+N    QL++YC FG++AGVVGGLLG
Sbjct  295   LNLLQIPVSVGVSMYEAVSLYKGHRIIASKGTEGTNFTILQLVIYCLFGILAGVVGGLLG  354

Query  1445  lgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatv  1624
             LGGGFIMGPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPV YA++  AVAT 
Sbjct  355   LGGGFIMGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVSYAVYFVAVATF  414

Query  1625  aafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENL  1804
             AAFIGQH+VRRLI V GRASLIIFILA TIF+SAISLGGVG++NMI KIH HEYMGFENL
Sbjct  415   AAFIGQHIVRRLIIVFGRASLIIFILASTIFISAISLGGVGVANMIGKIHRHEYMGFENL  474

Query  1805  CKY  1813
             CKY
Sbjct  475   CKY  477



>ref|XP_006450629.1| hypothetical protein CICLE_v10008167mg [Citrus clementina]
 gb|ESR63869.1| hypothetical protein CICLE_v10008167mg [Citrus clementina]
Length=477

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/479 (75%), Positives = 410/479 (86%), Gaps = 5/479 (1%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             MA  G KW+ILR ++ +  +F LA   V AER LK E ++     R  D +YL   VNFL
Sbjct  1     MADLGAKWKILRSVMMIFLNFALAFVCVKAERGLKIETLSFNGTERQ-DSNYLLKAVNFL  59

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             WQP+ SGY H+WPE++ GWEIV+G+IIGF GAAFGSVGGVGGGGIFVPMLSL++GFDPKS
Sbjct  60    WQPEGSGYHHVWPELKFGWEIVLGTIIGFFGAAFGSVGGVGGGGIFVPMLSLIIGFDPKS  119

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             ATAISKCMIMGAAVS+V+YNLKLRHPTLDMPIIDYDLA+LIQPMLMLGISIGV FNVIFA
Sbjct  120   ATAISKCMIMGAAVSTVYYNLKLRHPTLDMPIIDYDLALLIQPMLMLGISIGVAFNVIFA  179

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSG-GQGEYKLLPGGP  1096
             DWMVTVLLIVLFIGTSTKAFL+GVETWK+ETI+KKEAA+ L +NG+G G+ EYK LP GP
Sbjct  180   DWMVTVLLIVLFIGTSTKAFLKGVETWKRETILKKEAARCLGSNGAGAGEVEYKSLPSGP  239

Query  1097  GNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLL  1276
              +G Q   K++ E +V+I+ENVYWKE GLL FVWV+FL LQI KN+T++CS +YWV++LL
Sbjct  240   RSGPQ---KDAMEPEVTILENVYWKELGLLVFVWVAFLGLQIAKNHTASCSIVYWVLDLL  296

Query  1277  QIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglggg  1456
             QIPVSL V+L+EA  LYKG R I+SKGD G + R  QL+ YC FG++AG+VGGLLGLGGG
Sbjct  297   QIPVSLVVSLYEAISLYKGRRVIASKGDDGKSFRVFQLVSYCAFGVLAGIVGGLLGLGGG  356

Query  1457  fimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafI  1636
             FIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+  AVAT+AAFI
Sbjct  357   FIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFVAVATIAAFI  416

Query  1637  GQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             GQHVVR+LI +LGRASLIIFILAF IFVSAISLGGVGISNMI K H HEYMGFENLCKY
Sbjct  417   GQHVVRKLIILLGRASLIIFILAFMIFVSAISLGGVGISNMIGKFHRHEYMGFENLCKY  475



>ref|XP_010249715.1| PREDICTED: uncharacterized protein LOC104592187 [Nelumbo nucifera]
Length=481

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/480 (74%), Positives = 413/480 (86%), Gaps = 3/480 (1%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             MA AG KW+ LR +  ++ SFLLAS F SAERSLK+   +G N +R+ + DYL   +NFL
Sbjct  1     MAEAGAKWQGLRSVAMVALSFLLASVFASAERSLKHG-ASGNNGTRDGESDYLLKIINFL  59

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             WQ  ESGY H+WPEM+ GW++++G+IIGF GAAFGSVGGVGGGGIFVPML+L++GFD KS
Sbjct  60    WQSGESGYQHVWPEMKFGWKVIVGTIIGFCGAAFGSVGGVGGGGIFVPMLTLIIGFDAKS  119

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             +TAISKCMIMGAA S+V+YNLKLRHPTLDMPIIDYDLA+L QPMLMLGISIGV FNVIFA
Sbjct  120   STAISKCMIMGAAASTVYYNLKLRHPTLDMPIIDYDLALLFQPMLMLGISIGVAFNVIFA  179

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGG-QGEYKLLPGGP  1096
             DWMVTVLLI+LFIGTSTKAFL+GVETWKKETI+KKEAA++L ++G+G  Q EYK LP GP
Sbjct  180   DWMVTVLLIILFIGTSTKAFLKGVETWKKETIVKKEAAKRLESDGTGNEQVEYKPLPSGP  239

Query  1097  GNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIV-KNYTSTCSTLYWVVNL  1273
             GNGTQ    +S E  VSIIENVYWKE GLL FVWV+FL LQIV K+ T+TCS  YWV+NL
Sbjct  240   GNGTQQGTIKSGEANVSIIENVYWKELGLLVFVWVAFLVLQIVIKDSTTTCSVPYWVLNL  299

Query  1274  LQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgg  1453
             LQIP+++ V+ +EA  LY+G R I+SKGD+G+N +  QLI+YC  G++AG+VGGLLGLGG
Sbjct  300   LQIPIAVVVSGYEAISLYRGRRVIASKGDAGTNWKVHQLILYCSCGVLAGMVGGLLGLGG  359

Query  1454  gfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaaf  1633
             GFI+GPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+  AVATVAAF
Sbjct  360   GFILGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFVAVATVAAF  419

Query  1634  IGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             IGQHVVR+LI +LGRASLIIFIL+ TIFVSA+SLGGVGISNMI KI  HEYMGFENLCKY
Sbjct  420   IGQHVVRKLIIILGRASLIIFILSLTIFVSAVSLGGVGISNMIGKIQRHEYMGFENLCKY  479



>ref|XP_008220035.1| PREDICTED: uncharacterized protein LOC103320179 [Prunus mume]
Length=476

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/478 (74%), Positives = 405/478 (85%), Gaps = 4/478 (1%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             MA  G K R LR +  +  +F LA  FVSAER LK  E +  N +  S+ DYL   V F 
Sbjct  1     MAVLGAKLRGLRSVSMVVLNFALAFVFVSAERGLK-LEASRFNGTEGSESDYLLRVVTFF  59

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             WQ + SGY H+WPEM+ GW+I++GSI+GF GAAFGSVGGVGGGGIFVPMLSL++GFDPKS
Sbjct  60    WQSERSGYQHVWPEMKFGWQIIVGSIVGFCGAAFGSVGGVGGGGIFVPMLSLIMGFDPKS  119

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             ATAISKCMIMGAA S+V+YNLKLRHPTLDMPIIDYDLA+LIQPMLMLGISIGV FNVIFA
Sbjct  120   ATAISKCMIMGAAASTVYYNLKLRHPTLDMPIIDYDLALLIQPMLMLGISIGVAFNVIFA  179

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPG  1099
             DWMVTVLLIVLFIGTSTKAFL+GVETWKKETI+K+EA + L + G+GG  EYK LP GP 
Sbjct  180   DWMVTVLLIVLFIGTSTKAFLKGVETWKKETILKREATRHLESTGAGGNVEYKPLPSGPV  239

Query  1100  NGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQ  1279
             N   D  KE+ E +VS+IENV WK+ GLL FVWV+FLALQI KN+T+TCS +YWVVNLLQ
Sbjct  240   N---DQQKETKELEVSVIENVCWKDLGLLVFVWVAFLALQIAKNHTTTCSPVYWVVNLLQ  296

Query  1280  IPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggf  1459
             IP+S GV+L+EA  LYKG R I+SKG+ G+  R  QL+VYC FG++AG+VGGLLGLGGGF
Sbjct  297   IPISFGVSLYEAVSLYKGRRVIASKGEQGTVWRVHQLVVYCIFGVLAGIVGGLLGLGGGF  356

Query  1460  imgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIG  1639
             +MGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+  AVAT+AAF+G
Sbjct  357   VMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYFVAVATIAAFVG  416

Query  1640  QHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             QH+VRRLI + GRASLIIFILAFTIFVSAISLGGVGISNMI KIH +EYMGFENLCKY
Sbjct  417   QHIVRRLIILFGRASLIIFILAFTIFVSAISLGGVGISNMIVKIHQNEYMGFENLCKY  474



>ref|XP_010254104.1| PREDICTED: uncharacterized protein LOC104595187 [Nelumbo nucifera]
Length=481

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/480 (74%), Positives = 406/480 (85%), Gaps = 3/480 (1%)
 Frame = +2

Query  380   MAGAGGKWRI-LRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNF  556
             MAG G +W+  LR    +S  FLLAS FVSAERSLK +E + +N +  S  +YL    NF
Sbjct  1     MAGTGARWQAPLRMATMISLGFLLASVFVSAERSLK-DEASRSNDTEVSLSNYLHKVANF  59

Query  557   LWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPK  736
             LWQ   SGY H+WP+M+ GW+IV+G+IIGF GAAFGSVGGVGGGGIFVPML+L++GFD K
Sbjct  60    LWQSDVSGYQHVWPDMKFGWQIVLGTIIGFFGAAFGSVGGVGGGGIFVPMLTLIIGFDAK  119

Query  737   SATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIF  916
             S+TAISKCMIMGAA S+V+YNLKLRHPTLDMPIIDYDLA+L QPMLMLGISIGV FNVIF
Sbjct  120   SSTAISKCMIMGAAGSTVYYNLKLRHPTLDMPIIDYDLALLFQPMLMLGISIGVAFNVIF  179

Query  917   ADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQG-EYKLLPGG  1093
             ADWMVTVLLIVLFIGTSTKAF RGV+TWKKETI+KKEAA++L +NGSG +  EYK L  G
Sbjct  180   ADWMVTVLLIVLFIGTSTKAFFRGVDTWKKETILKKEAARRLESNGSGNEEVEYKPLSSG  239

Query  1094  PGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNL  1273
             PGNG +   KE  E +  I++NVYWKE GLL FVWV+FL LQIVKN+T+TCS  YW++NL
Sbjct  240   PGNGPEKATKEYKEPEAPILKNVYWKELGLLVFVWVAFLVLQIVKNHTTTCSISYWILNL  299

Query  1274  LQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgg  1453
             LQIPVS GV+L+EA  LY G R I+S GD+G+N +  QLI+YC  G++AGVVGGLLGLGG
Sbjct  300   LQIPVSCGVSLYEAVSLYNGRRVIASNGDAGTNWKVHQLILYCCCGILAGVVGGLLGLGG  359

Query  1454  gfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaaf  1633
             GFI+GPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+  AVAT+AAF
Sbjct  360   GFILGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFVAVATIAAF  419

Query  1634  IGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             IGQHVVRRLI VLGRASLIIFIL+FTIFVSAISLGGVGISNMI KI  HEYMGFENLCKY
Sbjct  420   IGQHVVRRLIIVLGRASLIIFILSFTIFVSAISLGGVGISNMIYKIEKHEYMGFENLCKY  479



>ref|XP_006476094.1| PREDICTED: uncharacterized protein LOC102623437 [Citrus sinensis]
 gb|KDO79724.1| hypothetical protein CISIN_1g011811mg [Citrus sinensis]
Length=477

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/479 (74%), Positives = 408/479 (85%), Gaps = 5/479 (1%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             MA  G KW+ILR ++ +  +F LA   V AER LK E +      R  D +YL   VNFL
Sbjct  1     MADLGAKWKILRSVMMIFLNFALAFVCVKAERGLKIETLRFNGTERQ-DSNYLLKAVNFL  59

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             WQP+ SGY H+WPE++ GWEIV+G+IIGF GAAFGSVGGVGGGGIFVPMLSL++GFDPKS
Sbjct  60    WQPEGSGYHHVWPELKFGWEIVLGTIIGFFGAAFGSVGGVGGGGIFVPMLSLIIGFDPKS  119

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             ATAISKCMIMGAAVS+V+YNLKLRHPTLDMPIIDYDLA+LIQPMLMLGISIGV FNVIFA
Sbjct  120   ATAISKCMIMGAAVSTVYYNLKLRHPTLDMPIIDYDLALLIQPMLMLGISIGVAFNVIFA  179

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSG-GQGEYKLLPGGP  1096
             DWMVTVLLIVLFIGTSTKAFL+GVETWK+ETI+KKEAA+ L +NG+G G+ EYK LP GP
Sbjct  180   DWMVTVLLIVLFIGTSTKAFLKGVETWKRETILKKEAARCLGSNGAGAGEVEYKSLPSGP  239

Query  1097  GNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLL  1276
              +G Q   K++ E +V+I+EN+ WKE GLL FVWV+FL LQI KN+T++CS +YWV++LL
Sbjct  240   RSGPQ---KDAMEPEVTILENINWKELGLLVFVWVAFLGLQIAKNHTASCSIVYWVLDLL  296

Query  1277  QIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglggg  1456
             QIPVSL V+L+EA  LYKG R I+SKGD G + R  QL+ YC FG++AG+VGGLLGLGGG
Sbjct  297   QIPVSLVVSLYEAISLYKGRRVIASKGDDGKSFRVFQLVSYCAFGVLAGIVGGLLGLGGG  356

Query  1457  fimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafI  1636
             FIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+  AVAT+AAF+
Sbjct  357   FIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFVAVATIAAFV  416

Query  1637  GQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             GQHVVR+LI +LGRASLIIFILAF IFVSAISLGGVGISNMI K H HEYMGFENLCKY
Sbjct  417   GQHVVRKLIILLGRASLIIFILAFMIFVSAISLGGVGISNMIGKFHRHEYMGFENLCKY  475



>gb|EYU21883.1| hypothetical protein MIMGU_mgv1a005504mg [Erythranthe guttata]
Length=477

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/481 (74%), Positives = 405/481 (84%), Gaps = 5/481 (1%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNV-SRNSDDDYLSTFVNF  556
             MAG   +W+   P   + WSFLLAS FVSAERSLK E  +   + +R+SD D L++ VNF
Sbjct  1     MAGNLERWKAFGPFFTVVWSFLLASIFVSAERSLKKEYSSRIAIETRDSDSDILTSVVNF  60

Query  557   LWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPK  736
             LWQ   SGY H+WP+++  W+IV+GSIIGF+GAAFGSVGGVGGGGIFVPML+L++GFDPK
Sbjct  61    LWQGNNSGYHHVWPDLKFNWKIVVGSIIGFLGAAFGSVGGVGGGGIFVPMLTLIIGFDPK  120

Query  737   SATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIF  916
             SATAISKCMIMG AVS+V+YNLKLRHPT+DMPIIDYDLAVLIQPMLMLGISIGV FNV+F
Sbjct  121   SATAISKCMIMGGAVSTVYYNLKLRHPTIDMPIIDYDLAVLIQPMLMLGISIGVAFNVVF  180

Query  917   ADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGP  1096
             ADWMVTVLLI+LF+GTSTKAF +G+ETWKKETIMKKEAA++  AN    +  YKLLPGGP
Sbjct  181   ADWMVTVLLIILFLGTSTKAFFKGLETWKKETIMKKEAAKRYEAN----EEAYKLLPGGP  236

Query  1097  GNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLL  1276
              N      K+  E  V IIENV WKE GLL FVW SFLALQI+K YT+TCS  YW VNLL
Sbjct  237   SNNAGKEFKDFEEPTVGIIENVCWKECGLLFFVWFSFLALQILKMYTTTCSVTYWTVNLL  296

Query  1277  QIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglggg  1456
             QIPVS+GV+ +EA  LYKGWRK+ SKGD G+N +  QL+VY FFG++AG+VGGLLGLGGG
Sbjct  297   QIPVSMGVSGYEALSLYKGWRKLGSKGDEGTNFKVHQLLVYGFFGILAGLVGGLLGLGGG  356

Query  1457  fimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafI  1636
             FIMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+  AVATVAAFI
Sbjct  357   FIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYFVAVATVAAFI  416

Query  1637  GQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  1816
             GQH VR+LI +LGRAS+IIFILA TIF+SAISLGGVGISNMI KI  +EYMGFENLCKY 
Sbjct  417   GQHFVRKLIIILGRASIIIFILASTIFISAISLGGVGISNMIGKIERNEYMGFENLCKYQ  476

Query  1817  V  1819
             V
Sbjct  477   V  477



>ref|XP_011019654.1| PREDICTED: uncharacterized protein LOC105122312 [Populus euphratica]
 ref|XP_011019655.1| PREDICTED: uncharacterized protein LOC105122312 [Populus euphratica]
Length=479

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/483 (74%), Positives = 407/483 (84%), Gaps = 11/483 (2%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFV---  550
             MA  GGKWR LR ++ +  +FLLA  FVSAER LK E    T+   N   D +S++V   
Sbjct  1     MAEFGGKWRGLRSVLVVLLNFLLAFVFVSAERGLKRE---ATSTRMNETGDSVSSYVLKA  57

Query  551   -NFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGF  727
              NFLWQP + GY H+WPEM+ GW+IV+GSIIGF GAAFGSVGGVGGGGIFVPMLSLV+GF
Sbjct  58    VNFLWQPDQKGYQHVWPEMKFGWQIVLGSIIGFFGAAFGSVGGVGGGGIFVPMLSLVIGF  117

Query  728   DPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFN  907
             DPKSATAISKCMIMGAA+S+V+YNLKLRHPTL MP+IDYDLA+LIQPMLMLGIS+GV  N
Sbjct  118   DPKSATAISKCMIMGAAISTVYYNLKLRHPTLHMPLIDYDLALLIQPMLMLGISLGVALN  177

Query  908   VIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANG-SGGQGEYKLL  1084
             VIFADWMVTVLLI+LF+GTSTKAFL+GVETWKKETIMK+EAA++L +NG S G+ EYK L
Sbjct  178   VIFADWMVTVLLIILFLGTSTKAFLKGVETWKKETIMKREAAKRLESNGASAGEVEYKPL  237

Query  1085  PGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWV  1264
             PGGP N  Q   K   E++VSI+ENVYWKE GLL FVWV+FL LQI K  TSTCST YWV
Sbjct  238   PGGPSNSPQ---KADKEEEVSILENVYWKELGLLVFVWVAFLVLQITKEGTSTCSTAYWV  294

Query  1265  VNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllg  1444
             +NLLQIPVS+GV+++EA  LYKG R I+SKG   +N    QL++YC FG++AGVVGGLLG
Sbjct  295   LNLLQIPVSVGVSMYEAVSLYKGHRIIASKGTEDTNFTVLQLVIYCLFGILAGVVGGLLG  354

Query  1445  lgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatv  1624
             LGGGFIMGPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA++  AVAT 
Sbjct  355   LGGGFIMGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAVYFVAVATF  414

Query  1625  aafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENL  1804
             AAFIGQH+VRRLI + GRASLIIFILA TIF+SAISLGGVG++NMI KIH HEYMGFENL
Sbjct  415   AAFIGQHIVRRLIIMFGRASLIIFILASTIFISAISLGGVGVANMIGKIHRHEYMGFENL  474

Query  1805  CKY  1813
             CKY
Sbjct  475   CKY  477



>ref|XP_007222835.1| hypothetical protein PRUPE_ppa005114mg [Prunus persica]
 gb|EMJ24034.1| hypothetical protein PRUPE_ppa005114mg [Prunus persica]
Length=476

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/478 (74%), Positives = 405/478 (85%), Gaps = 4/478 (1%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             MA  G K + LR +  +  +F +A  FVSAER LK  E +  N +  S+ DYL   V F 
Sbjct  1     MAVLGAKLQGLRSVSMVMLNFAVAFVFVSAERGLK-LEASRFNGTEGSESDYLLRVVTFF  59

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             WQ + SGY H+WPEM+ GW+I+ GSI+GF GAAFGSVGGVGGGGIFVPMLSL++GFDPKS
Sbjct  60    WQSERSGYQHVWPEMKFGWQIIAGSIVGFCGAAFGSVGGVGGGGIFVPMLSLIMGFDPKS  119

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             ATAISKCMIMGAAVS+V+YNLKLRHPTL+MPIIDYDLA+LIQPMLMLGISIGV FNVIFA
Sbjct  120   ATAISKCMIMGAAVSTVYYNLKLRHPTLEMPIIDYDLALLIQPMLMLGISIGVAFNVIFA  179

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPG  1099
             DWMVTVLLIVLFIGTSTKAFL+GVETWKKETI+K+EA + L + G+GG  EYK LP GP 
Sbjct  180   DWMVTVLLIVLFIGTSTKAFLKGVETWKKETILKREATRHLESTGAGGNVEYKPLPSGPA  239

Query  1100  NGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQ  1279
             N   D  KE+ E +VS+IENV WK+ GLL FVWV+FLALQI KN+T+TCS +YWVVNLLQ
Sbjct  240   N---DQQKETKELEVSVIENVCWKDLGLLVFVWVAFLALQIAKNHTTTCSPVYWVVNLLQ  296

Query  1280  IPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggf  1459
             IP+S+GV+L+EA  LYKG R I+SKG+ G+  R  QL++YC FG++AG+VGGLLGLGGGF
Sbjct  297   IPISVGVSLYEAVSLYKGRRVIASKGEQGTVWRVHQLVIYCIFGVLAGIVGGLLGLGGGF  356

Query  1460  imgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIG  1639
             +MGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+  AVATVAA +G
Sbjct  357   VMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYFVAVATVAALVG  416

Query  1640  QHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             QH+VRRLI + GRASLIIFILAFTIFVSAISLGGVGISNMI KIH +EYMGFENLCKY
Sbjct  417   QHIVRRLIILFGRASLIIFILAFTIFVSAISLGGVGISNMIGKIHQNEYMGFENLCKY  474



>ref|XP_008347633.1| PREDICTED: uncharacterized protein LOC103410743 isoform X1 [Malus 
domestica]
Length=476

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/480 (73%), Positives = 406/480 (85%), Gaps = 4/480 (1%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             MA  G KW+ LR +  + + F  A  FVSAER L+ E  +  N +  S+ +YL   VNFL
Sbjct  1     MAAFGAKWQGLRSVAMVMFHFAAAFVFVSAERGLRXEG-SRFNGTEGSESNYLLKAVNFL  59

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             WQ ++SGY H+WPEM+ GW+I++GSI+GF GAAFGSVGGVGGGGIFVPMLSL++GFDPKS
Sbjct  60    WQSEKSGYHHVWPEMKFGWQIIVGSIVGFCGAAFGSVGGVGGGGIFVPMLSLIIGFDPKS  119

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             ATAISKCMIMGAA S+V+YNLKLRHPT++MPIIDYDLAVLIQPMLMLGISIGV FNVIFA
Sbjct  120   ATAISKCMIMGAAGSTVYYNLKLRHPTINMPIIDYDLAVLIQPMLMLGISIGVAFNVIFA  179

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPG  1099
             DWMVTVLLIVLFIGTSTKAF +GVETWKKETIMKKEAA+ L +  +G    YK LP GP 
Sbjct  180   DWMVTVLLIVLFIGTSTKAFFKGVETWKKETIMKKEAARHLESAAAGENVAYKPLPSGPA  239

Query  1100  NGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQ  1279
             N  Q   KE+ E++VS+IENV WKE GLL FVWV+FLALQI K  T+TCS  YWVVNLLQ
Sbjct  240   NEQQ---KETKEQEVSVIENVCWKELGLLVFVWVAFLALQIAKQXTTTCSPAYWVVNLLQ  296

Query  1280  IPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggf  1459
             IPVSLGV+++EA  LY+G R I+SKG+ G++ +  QL++YC FG+IAG+VGGLLGLGGGF
Sbjct  297   IPVSLGVSMYEAVSLYQGRRVIASKGEEGTDWKVHQLVIYCLFGVIAGIVGGLLGLGGGF  356

Query  1460  imgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIG  1639
             IMGPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA++LTAVATVAA +G
Sbjct  357   IMGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAVYLTAVATVAALVG  416

Query  1640  QHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  1819
             QH+VRRLI + GRASLIIFILAFTIFVSAISLGGVGISNMI KI+ +EYMGFENLCKY V
Sbjct  417   QHIVRRLIILFGRASLIIFILAFTIFVSAISLGGVGISNMIGKINRNEYMGFENLCKYDV  476



>ref|XP_004291206.1| PREDICTED: uncharacterized protein LOC101310663 [Fragaria vesca 
subsp. vesca]
Length=473

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/478 (73%), Positives = 404/478 (85%), Gaps = 7/478 (1%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             MA  G KWR +R +  + ++F +A   + AER L+ E  A  +    S +DYL   VNFL
Sbjct  1     MAVFGAKWRGVRSVCMVLFNFAVAFVCIKAERGLRLES-ARFDEDSVSGNDYLFRAVNFL  59

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             WQ  + GY H+WPEM+ GW+IV+GS IGF GAAFGSVGGVGGGGIFVPMLSL+VGFDPKS
Sbjct  60    WQSDKVGYRHVWPEMKFGWQIVVGSAIGFFGAAFGSVGGVGGGGIFVPMLSLIVGFDPKS  119

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             ATAISKCMIMGAAVS+V+YNLKLRHPTLDMPIIDYDLAVLIQPMLM+GISIGV FNVIFA
Sbjct  120   ATAISKCMIMGAAVSTVYYNLKLRHPTLDMPIIDYDLAVLIQPMLMMGISIGVAFNVIFA  179

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPG  1099
             DWMVTVLLIVLFIGTSTKAF +GV+TWKKETIMK+EAA+Q  +NG+GG  EYK LPGGP 
Sbjct  180   DWMVTVLLIVLFIGTSTKAFFKGVDTWKKETIMKREAAKQRESNGAGGDAEYKPLPGGPN  239

Query  1100  NGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQ  1279
             +  Q       + +VS++ENVYWKEFGLL FVWV+FLALQI K++TSTCS  YWVVNLLQ
Sbjct  240   SDQQK------DPEVSLVENVYWKEFGLLVFVWVAFLALQIAKHHTSTCSVAYWVVNLLQ  293

Query  1280  IPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggf  1459
             IPVSLGV+ +EA GLY+G + ISSKG+ G+N +  QLI+YC  G++AG+VGGLLGLGGGF
Sbjct  294   IPVSLGVSTYEAVGLYQGRKVISSKGEEGTNWQVHQLILYCLMGVVAGIVGGLLGLGGGF  353

Query  1460  imgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIG  1639
             IMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYA + TAVAT+AA  G
Sbjct  354   IMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAAYYTAVATIAAITG  413

Query  1640  QHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             QHVVRRLI + GRASLIIFILAF IF+SAISLGGVG+SNMI KI+++EYMGFENLCKY
Sbjct  414   QHVVRRLITIFGRASLIIFILAFMIFISAISLGGVGVSNMIWKINHNEYMGFENLCKY  471



>ref|XP_007137180.1| hypothetical protein PHAVU_009G106400g [Phaseolus vulgaris]
 gb|ESW09174.1| hypothetical protein PHAVU_009G106400g [Phaseolus vulgaris]
Length=468

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/476 (72%), Positives = 401/476 (84%), Gaps = 11/476 (2%)
 Frame = +2

Query  392   GGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPK  571
             G  W +L      +W F +ASA    ERS+   E A  NV+ N  +++L   VNFLWQ +
Sbjct  2     GSTWIVL---FCFAWIFAMASA----ERSIMKMEGASFNVTENHAENFLMRAVNFLWQSQ  54

Query  572   ESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAI  751
             ESGY H+WP+++ GWEIV+G+ +GF GAAFGSVGGVGGGGIFVPMLSL+VGFDPKSATAI
Sbjct  55    ESGYRHVWPDLKFGWEIVVGTFVGFCGAAFGSVGGVGGGGIFVPMLSLIVGFDPKSATAI  114

Query  752   SKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMV  931
             SKCMIMGAAVS+V+YNLKLRHPTL+MPIIDYDLA+LIQPMLMLGISIGV FNV+F DW+V
Sbjct  115   SKCMIMGAAVSTVYYNLKLRHPTLNMPIIDYDLALLIQPMLMLGISIGVAFNVVFPDWIV  174

Query  932   TVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQ  1111
             T+LLIVLF+GTSTKAFL+GVETWKKETIMKKEAA++  +NGSG + EYK +PGGP NG  
Sbjct  175   TILLIVLFLGTSTKAFLKGVETWKKETIMKKEAARRQDSNGSGAEVEYKPIPGGP-NGV-  232

Query  1112  DTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVK-NYTSTCSTLYWVVNLLQIPV  1288
              T K+S E +V+IIENVYWKEFGLL FVWV+FLALQIVK  YT+TCSTLYWV+NLLQ+PV
Sbjct  233   -TVKDSKEHEVTIIENVYWKEFGLLVFVWVAFLALQIVKETYTTTCSTLYWVLNLLQVPV  291

Query  1289  SLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimg  1468
             S+GV  +EA  L+ G R I+S G+ G +    QL +YC FG++AGVVGG+LGLGGGF+MG
Sbjct  292   SVGVTAYEAAALFSGRRVIASTGEEGKDFTVLQLTIYCVFGILAGVVGGMLGLGGGFVMG  351

Query  1469  plflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHV  1648
             PLFLELGVPPQVSSATATFAM FSSSMSV+EYYLLKRFPVPYA++ T VA +AAF+GQH+
Sbjct  352   PLFLELGVPPQVSSATATFAMTFSSSMSVIEYYLLKRFPVPYAVYFTLVAVIAAFVGQHI  411

Query  1649  VRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  1816
             VR+LI VLGRASLIIFILA TIF SA+SLGGVGI NM+ KI NHEYMGF+NLCKYG
Sbjct  412   VRKLIIVLGRASLIIFILASTIFASAVSLGGVGIVNMVHKIQNHEYMGFDNLCKYG  467



>ref|XP_009367912.1| PREDICTED: uncharacterized protein LOC103957476 [Pyrus x bretschneideri]
Length=475

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/480 (73%), Positives = 401/480 (84%), Gaps = 5/480 (1%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             M   G KW  LR +  +   F +A  FVSAER L+ E  +  N +  S+ +Y    VNFL
Sbjct  1     MVAFGAKWHGLRSVAMVMLHFGVAFVFVSAERGLRLEG-SRFNGTEGSESNYFFKAVNFL  59

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             WQ ++SGY H+WPEM+ GW+IV+GSI+GF GAAFGSVGGVGGGGIFVPMLSL++GFDPKS
Sbjct  60    WQSEKSGYHHVWPEMKFGWQIVVGSIVGFCGAAFGSVGGVGGGGIFVPMLSLIIGFDPKS  119

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             ATAISKCMIMGAA S+V+YNLKL+HPT+DMPIIDYDLAVLIQPMLMLGISIGV FNVIFA
Sbjct  120   ATAISKCMIMGAAASTVYYNLKLKHPTIDMPIIDYDLAVLIQPMLMLGISIGVAFNVIFA  179

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPG  1099
             DWMVTVLLIVLFIGTSTKAF +GVETWKKETIMKKEAA+ L  + +     YK LP GP 
Sbjct  180   DWMVTVLLIVLFIGTSTKAFFKGVETWKKETIMKKEAARCL-ESAAAENVAYKPLPSGPA  238

Query  1100  NGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQ  1279
             N   +  KE+ E +VSIIENV WKE GLL FVWV+FLALQI K  T+TCS  YWVVNLLQ
Sbjct  239   N---EQEKETKEPEVSIIENVCWKELGLLVFVWVAFLALQIAKQRTTTCSPAYWVVNLLQ  295

Query  1280  IPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggf  1459
             IPVSLGV+++EA  LY+G R I+SKG+ G++ +  QL++YC FG+IAG+VGGLLGLGGGF
Sbjct  296   IPVSLGVSMYEAVSLYQGRRVIASKGEEGTDWKVHQLVIYCLFGVIAGIVGGLLGLGGGF  355

Query  1460  imgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIG  1639
             IMGPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA++LTAVATVAA +G
Sbjct  356   IMGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAVYLTAVATVAALVG  415

Query  1640  QHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  1819
             QH+VRRLI + GRASLIIFILAFTIFVSA+SLGGVGISNMI KI+ HEYMGFENLCKY V
Sbjct  416   QHIVRRLIILFGRASLIIFILAFTIFVSAVSLGGVGISNMIGKINQHEYMGFENLCKYDV  475



>ref|XP_007012055.1| Sulfite exporter TauE/SafE family protein [Theobroma cacao]
 gb|EOY29674.1| Sulfite exporter TauE/SafE family protein [Theobroma cacao]
Length=483

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/489 (71%), Positives = 403/489 (82%), Gaps = 19/489 (4%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             MA  G K  +L+ ++    +F LA   VSAERSLKN + A     + S+ ++    +NFL
Sbjct  1     MARFGVKRSVLKSIMLNLLNFALAFMLVSAERSLKNGDSA-----KESETNFFLKAINFL  55

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             W+  +SGY H+WPEME GW+IV+GSIIGF GAAFGSVGGVGGGGIFVPML+L++GFD KS
Sbjct  56    WRSDQSGYQHVWPEMEFGWQIVLGSIIGFFGAAFGSVGGVGGGGIFVPMLNLIIGFDAKS  115

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             +TAISKCMIMGAA S+V+YNLKLRHPTLDMPIIDYDLA+LIQPMLMLGISIGV FNVIFA
Sbjct  116   STAISKCMIMGAAASTVYYNLKLRHPTLDMPIIDYDLALLIQPMLMLGISIGVAFNVIFA  175

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGS-----------GGQ  1066
             DWMVT+LLI+LFIGTSTKAF +GVETWKKETI+KKEAA++L +N S            G 
Sbjct  176   DWMVTILLIILFIGTSTKAFFKGVETWKKETILKKEAARRLVSNVSPYISHMISDTGSGD  235

Query  1067  GEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTC  1246
              EYK LP GP +   D  K++++K+V++ ENV WKE GLLCFVWV+FL LQI KN+T+TC
Sbjct  236   VEYKPLPSGPNS---DPPKDNTDKEVTVWENVCWKELGLLCFVWVAFLVLQIAKNHTATC  292

Query  1247  STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  1426
             S  YWV+NLLQIPVS GV+L+EA  LYKGWR I+SKGD G+N R  QL+ YC FG++AG+
Sbjct  293   SVAYWVLNLLQIPVSFGVSLYEAVSLYKGWRVIASKGDEGTNWRVHQLVTYCAFGVLAGI  352

Query  1427  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  1606
             VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+ 
Sbjct  353   VGGLLGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYF  412

Query  1607  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  1786
             TAVAT+AA IGQH+VR+LI V GRASLIIFILAFTIFVSA+SLGGVGISNMI KI  HEY
Sbjct  413   TAVATIAALIGQHIVRKLIIVFGRASLIIFILAFTIFVSAVSLGGVGISNMIGKIERHEY  472

Query  1787  MGFENLCKY  1813
             MGFENLC Y
Sbjct  473   MGFENLCMY  481



>ref|XP_002516571.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45912.1| conserved hypothetical protein [Ricinus communis]
Length=476

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/475 (72%), Positives = 394/475 (83%), Gaps = 5/475 (1%)
 Frame = +2

Query  389   AGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQP  568
              GGKWR LR ++ +S +FLLA   VSAER ++ E              Y    V+FLWQP
Sbjct  5     GGGKWRGLRSVLMVSLNFLLAFVLVSAERGMRREFTGTPQTEGEGLSTYFVKAVDFLWQP  64

Query  569   KESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATA  748
              ++GY H+WPEM  GW+IV+G+IIGF GAAFGSVGGVGGGGIFVPMLSL++GFDPKSATA
Sbjct  65    DQTGYRHVWPEMRFGWQIVLGTIIGFFGAAFGSVGGVGGGGIFVPMLSLIIGFDPKSATA  124

Query  749   ISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWM  928
             ISKCMIMGAA S+V+YNLKLRHPTLDMPIIDYDL +LIQPMLMLGISIGV FNVIFADWM
Sbjct  125   ISKCMIMGAAASTVYYNLKLRHPTLDMPIIDYDLTLLIQPMLMLGISIGVAFNVIFADWM  184

Query  929   VTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGT  1108
             VTVLLI+LFIGTSTKAF +GVETWKKETIMKKEAA++L ANG+  + EYK LP GP  G 
Sbjct  185   VTVLLIILFIGTSTKAFFKGVETWKKETIMKKEAAKRLEANGA--EVEYKPLPSGPSTGP  242

Query  1109  QDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPV  1288
             +   KE+ E +V+++ENVYWKE GLL FVWV+FL L I KN+   CS  YWVVNLLQIPV
Sbjct  243   E---KEAKEPEVTLLENVYWKELGLLVFVWVAFLILHIAKNHLPACSIEYWVVNLLQIPV  299

Query  1289  SLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimg  1468
             SLGV+ +EA  LYKG R I+SKG  G+N +  QL++YC  G++AGVVGGLLGLGGGFIMG
Sbjct  300   SLGVSGYEAVSLYKGRRIIASKGKEGTNFKVHQLVLYCSCGVLAGVVGGLLGLGGGFIMG  359

Query  1469  plflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHV  1648
             PLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+  +VAT+AA IGQH+
Sbjct  360   PLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFVSVATIAALIGQHI  419

Query  1649  VRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             VRR+I + GRASLIIFILAFTIFVSAISLGGVGISNMI KI ++EYMGFENLCKY
Sbjct  420   VRRMIIMFGRASLIIFILAFTIFVSAISLGGVGISNMIWKIQHNEYMGFENLCKY  474



>ref|XP_011026589.1| PREDICTED: uncharacterized protein LOC105127137 [Populus euphratica]
Length=479

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/480 (71%), Positives = 392/480 (82%), Gaps = 5/480 (1%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEV-AGTNVSRNSDDDYLSTFVNF  556
             MA  GGKWR L+ ++ +  +FLLA  FVSAER L  E   A T+ + +S   Y    V+F
Sbjct  1     MAEFGGKWRGLKSVLMVLINFLLAFVFVSAERGLTREATSARTDETGDSVSSYALKAVSF  60

Query  557   LWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPK  736
             LWQP + GY H+WPEM+ GW+IV+GS IGF+ AAFGSVGGVGGGGIFVPML L++GFDPK
Sbjct  61    LWQPDQQGYQHVWPEMKFGWQIVLGSTIGFLSAAFGSVGGVGGGGIFVPMLRLIIGFDPK  120

Query  737   SATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIF  916
             SATAISKCMIMGAAVSSV+YNLKLRHPT+DMP+IDYDLA+LIQPMLMLGIS+GV  NVIF
Sbjct  121   SATAISKCMIMGAAVSSVYYNLKLRHPTIDMPLIDYDLALLIQPMLMLGISLGVALNVIF  180

Query  917   ADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGS-GGQGEYKLLPGG  1093
             ADWMVTVLLIVLF  TSTKAF +GVETW+KETIMK+EAA+ L +NG+  G+ EYK LPGG
Sbjct  181   ADWMVTVLLIVLFTVTSTKAFFKGVETWRKETIMKREAAKHLESNGADAGEVEYKPLPGG  240

Query  1094  PGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNL  1273
             P +  Q   KE+ E ++++ ENVYWKE GLL FVWV+FL LQI K  TSTCS  YWV+NL
Sbjct  241   PSDSPQ---KETKELEITVFENVYWKELGLLVFVWVAFLVLQIAKESTSTCSIGYWVLNL  297

Query  1274  LQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgg  1453
              QIPVS+GV L+E   LY G R I+SKGD G+N R  QL+ YC  G++AGVVGGLLGLGG
Sbjct  298   SQIPVSVGVTLYEVVSLYTGRRVIASKGDDGTNFRVLQLMTYCALGVMAGVVGGLLGLGG  357

Query  1454  gfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaaf  1633
             GFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA++   VA  AA 
Sbjct  358   GFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAVYFVVVAAFAAL  417

Query  1634  IGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             IGQH+VRRLI V GRASLIIFILAFTIFVSAI LGG GISN+I KIH+ EYMGFENLCK+
Sbjct  418   IGQHIVRRLIIVFGRASLIIFILAFTIFVSAILLGGFGISNIIGKIHHQEYMGFENLCKH  477



>gb|EPS70854.1| hypothetical protein M569_03904, partial [Genlisea aurea]
Length=479

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/478 (71%), Positives = 405/478 (85%), Gaps = 11/478 (2%)
 Frame = +2

Query  398   KWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDD------DYLSTFVNFL  559
             KW+   P + + WSFL AS +VSAERSL+    AG+  SR+S        D  S+ V+FL
Sbjct  7     KWKAFAPCLTVLWSFLCASIYVSAERSLR----AGSYSSRDSAGISSSDSDLSSSLVDFL  62

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             W+P+ESGY H+WP++EL W++V+GS+IGF+GAAFGSVGGVGGGGIFVPML+L++GFD KS
Sbjct  63    WRPQESGYHHVWPDLELNWKLVVGSMIGFLGAAFGSVGGVGGGGIFVPMLTLIIGFDAKS  122

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             ATAISKCM+MGAAVS+VHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIF 
Sbjct  123   ATAISKCMVMGAAVSTVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFP  182

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPG  1099
             DWMVTVLLIVLFIGTST++FL+GVETWKKET MK+ AA++L  N    + EY+LL GGP 
Sbjct  183   DWMVTVLLIVLFIGTSTRSFLKGVETWKKETAMKQAAARRLEMN-DDKEPEYRLLNGGPR  241

Query  1100  NGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQ  1279
             + T D A +  E +V ++ENV WKEFGLL FVW +FL LQI+K +T TCS L+WVVNLLQ
Sbjct  242   DNTGDKANDMEEPEVGVLENVCWKEFGLLAFVWFAFLVLQIIKTHTPTCSALFWVVNLLQ  301

Query  1280  IPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggf  1459
             IPV++GV+ +EA GLY GW+K+ SKGD G+NL+  QL++Y  FG++AGVVGGLLGLGGGF
Sbjct  302   IPVAVGVSGYEAVGLYMGWKKLGSKGDDGTNLKPQQLLIYALFGILAGVVGGLLGLGGGF  361

Query  1460  imgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIG  1639
             IMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLL+RFPVPY ++L  VAT+AAF+G
Sbjct  362   IMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLRRFPVPYGVYLAVVATMAAFVG  421

Query  1640  QHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             QHVV RLI V+GRAS+IIFIL+FTIFVSAISLGGVGISNM+ KI  HEYMGF+NLC Y
Sbjct  422   QHVVGRLIVVMGRASIIIFILSFTIFVSAISLGGVGISNMVGKIAGHEYMGFDNLCSY  479



>ref|XP_008393890.1| PREDICTED: uncharacterized protein LOC103456039 [Malus domestica]
 ref|XP_008352023.1| PREDICTED: uncharacterized protein LOC103415470 [Malus domestica]
Length=489

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/493 (71%), Positives = 400/493 (81%), Gaps = 17/493 (3%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             M   G KW  LR +  +   F  A  FVSAER L+ E  +  N +  S+ +Y    VNFL
Sbjct  1     MVAFGAKWHGLRSVAMVMLHFGAAFVFVSAERGLRLEG-SRFNGTEGSESNYFFKAVNFL  59

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             WQ ++SGY H+WPEM+ GW+IV+GSI+GF GAAFGSVGGVGGGGIFVPMLSL++GFDPKS
Sbjct  60    WQSEKSGYHHVWPEMKFGWQIVVGSIVGFCGAAFGSVGGVGGGGIFVPMLSLIIGFDPKS  119

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             ATAISKCMIMGAA S+V+YNLKL+HPT+DMPIIDYDLAVLIQPMLMLGISIGV FNVIFA
Sbjct  120   ATAISKCMIMGAAASTVYYNLKLKHPTIDMPIIDYDLAVLIQPMLMLGISIGVAFNVIFA  179

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAA-------------NGSG  1060
             DWMVTVLLIVLFIGTSTKAF +GVETWKK TIMKKEAA++L +               + 
Sbjct  180   DWMVTVLLIVLFIGTSTKAFFKGVETWKKXTIMKKEAARRLXSAVDFYNHAXYVLVRSAA  239

Query  1061  GQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTS  1240
                 YK LP GP N   +  KE+ E +VSIIENV WKE GLL FVWV+FLALQI K  T+
Sbjct  240   ENVAYKPLPSGPAN---EQEKETKEPEVSIIENVCWKELGLLVFVWVAFLALQIAKQRTT  296

Query  1241  TCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmia  1420
             TCS  YWVVNLLQIPVSLGV+++EA  LY+G R I+SKG+ G++ +  QL++YC FG+IA
Sbjct  297   TCSPAYWVVNLLQIPVSLGVSMYEAVSLYQGRRVIASKGEEGTDWKVHQLVIYCLFGVIA  356

Query  1421  gvvggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYal  1600
             G+VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA+
Sbjct  357   GIVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAV  416

Query  1601  fltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNH  1780
             +LTAVATVAA +GQH+VRRLI + GRASLIIFILAFTIFVSAISLGGVGISNM+ KI+ H
Sbjct  417   YLTAVATVAALVGQHIVRRLIILFGRASLIIFILAFTIFVSAISLGGVGISNMVGKINRH  476

Query  1781  EYMGFENLCKYGV  1819
             EYMGFENLCKY V
Sbjct  477   EYMGFENLCKYDV  489



>ref|XP_006833308.1| hypothetical protein AMTR_s00109p00049700 [Amborella trichopoda]
 gb|ERM98586.1| hypothetical protein AMTR_s00109p00049700 [Amborella trichopoda]
Length=477

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/485 (69%), Positives = 400/485 (82%), Gaps = 17/485 (4%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSL-----KNEEVAGTNVSRNSDDDYLST  544
             MA     WR  R    + + FLLAS FVSAER+L     + EE+ G         ++   
Sbjct  1     MAQTENIWRRSRDFAVILFGFLLASVFVSAERNLVLRSPEKEEMHG---------NFALK  51

Query  545   FVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVG  724
              VNFLWQP +S Y+H+WPEME GW IV+G+IIGF GAAFGSVGGVGGGGIFVPML+L++G
Sbjct  52    LVNFLWQPNQSNYEHVWPEMEFGWRIVLGTIIGFFGAAFGSVGGVGGGGIFVPMLTLIIG  111

Query  725   FDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTF  904
             FDPKS+TAISKCMIMGAA S+V+YNLKLRHPTLD+PIIDYDLA+L QPMLMLGISIGVTF
Sbjct  112   FDPKSSTAISKCMIMGAAGSTVYYNLKLRHPTLDLPIIDYDLALLFQPMLMLGISIGVTF  171

Query  905   NVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGG--QGEYK  1078
             NVIFADWMVTVLLI+LFIGTSTKAF++GVETWKKETI+K+EAA++L    S G  + EY 
Sbjct  172   NVIFADWMVTVLLIILFIGTSTKAFMKGVETWKKETILKEEAAKRLEGYESNGGEEVEYT  231

Query  1079  LLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLY  1258
              LP GPGNG+  + K S + +VS+IENVYWKE  LL  VWV+FL LQ++K  T+TCS  Y
Sbjct  232   PLPSGPGNGSAQS-KASRDAEVSVIENVYWKELSLLVSVWVAFLVLQLMKTNTTTCSVEY  290

Query  1259  WVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggl  1438
             WV+NLLQ+PV++GV+L+EA  LYKGWR I+SKG++G+N +  QL++YCF G++AG+VGGL
Sbjct  291   WVLNLLQVPVAVGVSLYEAVSLYKGWRVIASKGNAGTNWKIRQLVLYCFCGILAGMVGGL  350

Query  1439  lglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltava  1618
             LGLGGGFI+GPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA++   VA
Sbjct  351   LGLGGGFILGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAVYFALVA  410

Query  1619  tvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFE  1798
             + AA +GQHVVR++I +LGRASLIIFILAFTIFVSAI+LGGVGISNMI KI N EYMGFE
Sbjct  411   SGAALVGQHVVRKIIILLGRASLIIFILAFTIFVSAITLGGVGISNMIHKIQNREYMGFE  470

Query  1799  NLCKY  1813
             NLC Y
Sbjct  471   NLCSY  475



>ref|XP_003523730.1| PREDICTED: uncharacterized protein LOC100809318 [Glycine max]
Length=472

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/463 (73%), Positives = 391/463 (84%), Gaps = 11/463 (2%)
 Frame = +2

Query  440   FLLASAF--VSAERSLKNEEVAGTNV-SRNSDDDYLSTFVNFLWQPKESGYDHIWPEMEL  610
             F  AS F  VSAERS+   EV   NV SR     +L+  +NFLWQ  ESGY H+WP+ME 
Sbjct  16    FCFASVFAIVSAERSIVKMEVPRFNVTSREPQQSFLTKALNFLWQSGESGYQHVWPDMEF  75

Query  611   GWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSV  790
             GWEIV+G+ +GF GAAFGSVGGVGGGGIFVPMLSL++GFDPKS+TAISKCMIMGAAVS+V
Sbjct  76    GWEIVLGTFVGFCGAAFGSVGGVGGGGIFVPMLSLIIGFDPKSSTAISKCMIMGAAVSTV  135

Query  791   HYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTST  970
             +YNLKLRHPTL+MPIIDYDLA+LIQPMLMLGISIGV FNV+F DW+VT+LLIVLF+GTST
Sbjct  136   YYNLKLRHPTLNMPIIDYDLALLIQPMLMLGISIGVVFNVVFPDWIVTILLIVLFLGTST  195

Query  971   KAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSI  1150
             KAF +GVETWKKETIMKKEAA++  +NGSG   EYK LP GP        K++ E+++SI
Sbjct  196   KAFFKGVETWKKETIMKKEAAKRQESNGSGAVVEYKPLPSGP-------EKDTKEQEMSI  248

Query  1151  IENVYWKEFGLLCFVWVSFLALQIVK-NYTSTCSTLYWVVNLLQIPVSLGVALFEATGLY  1327
             IENVYWKEFGLL FVWVSFLALQI K NYT+TCSTLYWV+NLLQ+PVS+GV  +EA  L+
Sbjct  249   IENVYWKEFGLLVFVWVSFLALQIAKENYTTTCSTLYWVLNLLQVPVSVGVTAYEAAALF  308

Query  1328  KGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVs  1507
              G R I+S G+ G +    QL++YC FG++AGVVGG+LGLGGGF+MGPLFLELGVPPQVS
Sbjct  309   SGRRVIASTGEQGKDFTVLQLMIYCVFGVLAGVVGGMLGLGGGFVMGPLFLELGVPPQVS  368

Query  1508  satatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASL  1687
             SATATFAM FSSSMSV+EYYLLKRFPVPYAL+   VAT+AAF+GQH+VR+LI + GRASL
Sbjct  369   SATATFAMTFSSSMSVIEYYLLKRFPVPYALYFILVATIAAFVGQHIVRKLIILFGRASL  428

Query  1688  IIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  1816
             IIFILA TIFVSA+SLGGVGI NM+ KI NHEYMGFE+LCKYG
Sbjct  429   IIFILASTIFVSAVSLGGVGIVNMVHKIQNHEYMGFEDLCKYG  471



>ref|XP_003527825.1| PREDICTED: uncharacterized protein LOC100810784 [Glycine max]
 gb|KHN18202.1| hypothetical protein glysoja_025092 [Glycine soja]
Length=477

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/464 (72%), Positives = 394/464 (85%), Gaps = 8/464 (2%)
 Frame = +2

Query  440   FLLAS--AFVSAERSLKNEEVAGTNV--SRNSDDDYLSTFVNFLWQPKESGYDHIWPEME  607
             F  AS  A V++ERS+   EVA  NV  SR     +L+  +NFLWQ  ESGY H+WP+ME
Sbjct  16    FCFASVVAIVASERSIMKMEVARFNVTTSREPQQSFLTKALNFLWQSGESGYQHVWPDME  75

Query  608   LGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSS  787
              GW+IV+G+ +GF GAAFGSVGGVGGGGIFVPMLSL+VGFD KS+TAISKCMIMGAAVS+
Sbjct  76    FGWQIVVGTFVGFCGAAFGSVGGVGGGGIFVPMLSLIVGFDQKSSTAISKCMIMGAAVST  135

Query  788   VHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTS  967
             V+YNLKLRHPTL+MPIIDYDLA+LIQPMLMLGISIGV FNV+F DW+VT+LLIVLF+GTS
Sbjct  136   VYYNLKLRHPTLNMPIIDYDLALLIQPMLMLGISIGVVFNVVFPDWIVTILLIVLFLGTS  195

Query  968   TKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVS  1147
             TKAF +G+ETWKKETIMKKEAA++  +NGSG + EYK LP GP NG  +  K++ E++V+
Sbjct  196   TKAFFKGIETWKKETIMKKEAAKRQESNGSGAEVEYKPLPSGP-NGANE--KDTKEQEVT  252

Query  1148  IIENVYWKEFGLLCFVWVSFLALQIVK-NYTSTCSTLYWVVNLLQIPVSLGVALFEATGL  1324
             IIENVYWKEFGLL FVWVSFLALQI K NYT+TCST YWV+NLLQ+PVS+GV  +EA  L
Sbjct  253   IIENVYWKEFGLLVFVWVSFLALQIAKENYTTTCSTFYWVLNLLQVPVSVGVTAYEAAAL  312

Query  1325  YKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQV  1504
             + G R I+S G+ G +    QLI+YC FG++AGVVGG+LGLGGGF+MGPLFLELGVPPQV
Sbjct  313   FSGRRVIASTGEQGKDFTVLQLIIYCVFGVLAGVVGGMLGLGGGFVMGPLFLELGVPPQV  372

Query  1505  ssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRAS  1684
             SSATATFAM FSSSMSV+EYYLLKRFP+PYAL+   VAT+AAF+GQH+VR+LI + GRAS
Sbjct  373   SSATATFAMTFSSSMSVIEYYLLKRFPIPYALYFVLVATIAAFVGQHIVRKLIILFGRAS  432

Query  1685  LIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  1816
             LIIFILA TIFVSA+SLGGVGI NM+ KI NHEYMGFE+LCKYG
Sbjct  433   LIIFILASTIFVSAVSLGGVGIVNMVHKIDNHEYMGFEDLCKYG  476



>ref|XP_010915823.1| PREDICTED: uncharacterized protein LOC105040818 [Elaeis guineensis]
Length=475

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/480 (72%), Positives = 400/480 (83%), Gaps = 14/480 (3%)
 Frame = +2

Query  395   GKWRI--LRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSD---DDYLSTFVNFL  559
             GKWR   L P+V +  S LL +A  SA+R  K+E + G +VS   +    DYL   VNFL
Sbjct  3     GKWRKKWLWPVVVICLSVLLTAAMASADRGQKSEAL-GDDVSVEEEMGASDYLLKVVNFL  61

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             WQP ES Y H+WP M  GW+I++GSIIGF+GAAFGSVGGVGGGGIFVPML+LV+GFDPKS
Sbjct  62    WQPNESSYQHVWPPMTFGWKIIVGSIIGFLGAAFGSVGGVGGGGIFVPMLTLVIGFDPKS  121

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             +TAISKCMIMGAA S+V+YNLKLRHPTLDMPIIDYDLA+L QPMLMLGISIGV FNV+FA
Sbjct  122   STAISKCMIMGAAGSTVYYNLKLRHPTLDMPIIDYDLALLFQPMLMLGISIGVAFNVLFA  181

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPG  1099
             DWMVTVLLI+LF+GTS+KAF++GVETWKKET+MKKEAA++   NGS  + EYK LP GPG
Sbjct  182   DWMVTVLLILLFLGTSSKAFMKGVETWKKETLMKKEAAKRADTNGS-EEIEYKALPTGPG  240

Query  1100  NGTQDTAKESSEKQ--VSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNL  1273
             N     AKES  +Q  V++++NV WKE GLL FVW++FLALQIVK YTS CS  YW++NL
Sbjct  241   N-----AKESKTRQLEVTVLQNVCWKELGLLMFVWMTFLALQIVKEYTSNCSKSYWILNL  295

Query  1274  LQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgg  1453
             LQIPVS+GV  +EA  LY+G R I+SKGD G+N R  QL++YC  G++AG+VGGLLGLGG
Sbjct  296   LQIPVSVGVTAYEAVSLYRGKRVIASKGDEGTNWRVLQLVLYCATGILAGMVGGLLGLGG  355

Query  1454  gfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaaf  1633
             GFI+GPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA +  AVATVAAF
Sbjct  356   GFILGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAAYFVAVATVAAF  415

Query  1634  IGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             +GQH VR+LI +LGRASLIIFILAFTIFVSAISLGGVGISNMI KI  HEYMGFENLCKY
Sbjct  416   VGQHAVRKLINILGRASLIIFILAFTIFVSAISLGGVGISNMIHKIQRHEYMGFENLCKY  475



>ref|XP_010109461.1| hypothetical protein L484_001800 [Morus notabilis]
 gb|EXC22697.1| hypothetical protein L484_001800 [Morus notabilis]
Length=478

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/482 (71%), Positives = 395/482 (82%), Gaps = 6/482 (1%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             M   G + R  R    +  + LLA  FVSAER LK+E  +  +    S  ++L    NFL
Sbjct  1     MDAIGARRRGQRSTSMVLLNILLAFVFVSAERGLKSE-FSRLDGKEGSQSNFLQKAANFL  59

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             WQ   SGY H+WP+M+ GW+IV+G+IIGF GAAFGSVGGVGGGGIFVPMLSL++GFD KS
Sbjct  60    WQSDASGYQHVWPDMKFGWQIVLGTIIGFFGAAFGSVGGVGGGGIFVPMLSLIIGFDAKS  119

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             ATAISKCMIMG AVS+V+YNLKLRHPTLDMPIIDYDLA+LIQPMLM+GISIGV FNVIFA
Sbjct  120   ATAISKCMIMGGAVSTVYYNLKLRHPTLDMPIIDYDLALLIQPMLMMGISIGVAFNVIFA  179

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKK-EAAQQLAANG-SGGQGEYKLLPGG  1093
             DWMVTVLLI+LFIGTSTKAF +GVETWKKETIMKK EA ++L ++G + G  EYK LP G
Sbjct  180   DWMVTVLLIILFIGTSTKAFFKGVETWKKETIMKKVEATKRLESDGINAGGAEYKPLPAG  239

Query  1094  PGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNL  1273
             P N ++   KE  E +V+I+ENV WKEFGLL FVW ++L LQI KNYTSTCST YWV+NL
Sbjct  240   PSNNSE---KEDKEPEVTILENVRWKEFGLLVFVWFAYLGLQIAKNYTSTCSTAYWVLNL  296

Query  1274  LQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgg  1453
             +QIPVS+GV L+EA  LYKG R I+SKG+ G+N +  QL +YC  G++AG+VGGLLGLGG
Sbjct  297   MQIPVSVGVTLYEAISLYKGRRIIASKGEDGTNFKVHQLALYCACGVLAGIVGGLLGLGG  356

Query  1454  gfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaaf  1633
             GFIMGPLFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYA++L  VAT+AA 
Sbjct  357   GFIMGPLFLELGVPPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAVYLVLVATLAAV  416

Query  1634  IGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             +GQH+VRRLI + GRASLIIFILAFTIFVSAISLGGVGIS+MI  I  H YMGFENLCKY
Sbjct  417   VGQHIVRRLIILFGRASLIIFILAFTIFVSAISLGGVGISDMIGMIERHAYMGFENLCKY  476

Query  1814  GV  1819
              V
Sbjct  477   KV  478



>ref|XP_010049082.1| PREDICTED: uncharacterized protein LOC104437756 [Eucalyptus grandis]
 gb|KCW81533.1| hypothetical protein EUGRSUZ_C02892 [Eucalyptus grandis]
Length=477

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/479 (70%), Positives = 395/479 (82%), Gaps = 5/479 (1%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             MA    KW   R L  +++  LLA  F SA+RS K+E  A +   +    ++LS  V+FL
Sbjct  1     MASFRAKWVTCR-LSVVAFHLLLAFFFASAQRSFKHEVPALSRSEQGPLPNFLSRAVDFL  59

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             WQ  ++GY H+WPEM+ GW+IV+G++IGF+GAAFGSVGGVGGGGIFVPMLSL++GFDPKS
Sbjct  60    WQSDQTGYQHVWPEMKFGWQIVVGTVIGFLGAAFGSVGGVGGGGIFVPMLSLIMGFDPKS  119

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             ATAISKCMIMGAA S+V+YNLKL+HPTLDMPIIDYDLA+LIQPMLMLGISIGV FNVIFA
Sbjct  120   ATAISKCMIMGAAGSTVYYNLKLKHPTLDMPIIDYDLALLIQPMLMLGISIGVAFNVIFA  179

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQG-EYKLLPGGP  1096
             DWMVTVLLI+LFIGTSTKAF +GVETW KETI+KKEAA++L ++ +G Q  EYK LP GP
Sbjct  180   DWMVTVLLIILFIGTSTKAFFKGVETWNKETILKKEAAKRLVSDDTGNQEVEYKPLPSGP  239

Query  1097  GNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLL  1276
             GN +Q  ++ES   +V+I+ENVYW E GLL  VWV+FL +QI KN+T+TCS  YWV+NLL
Sbjct  240   GNVSQRNSRES---EVTILENVYWMELGLLVLVWVAFLGIQIAKNHTATCSVGYWVLNLL  296

Query  1277  QIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglggg  1456
             Q+P+S  V+L+EA  LYKG R ISSKGD  +  +  QL+ YC  G++AG+VGGLLGLGGG
Sbjct  297   QVPISFSVSLYEAISLYKGRRVISSKGDHETTFQVHQLVFYCACGVLAGIVGGLLGLGGG  356

Query  1457  fimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafI  1636
             FIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLL RFPVPYAL+   VATVAA  
Sbjct  357   FIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLNRFPVPYALYFVIVATVAALF  416

Query  1637  GQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             GQH+VR+LI V GRASLIIFILAFTIFVSAISLGGVGISNM+ KI  HEYMGFENLCKY
Sbjct  417   GQHIVRKLIIVFGRASLIIFILAFTIFVSAISLGGVGISNMVGKIERHEYMGFENLCKY  475



>ref|XP_002284423.1| PREDICTED: uncharacterized protein LOC100266912 [Vitis vinifera]
 emb|CBI36119.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/480 (71%), Positives = 398/480 (83%), Gaps = 3/480 (1%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFL-LASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNF  556
             MAG G KW  LR +  +  +FL +AS  VSAER+LK E  +  + SR  +   ++  VNF
Sbjct  1     MAGIGSKWWGLRRVALILVTFLGVASVLVSAERTLKQES-SSHDGSREVEPGLMTKIVNF  59

Query  557   LWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPK  736
             LW P  S Y+H+WP+M+ GW+I++G+IIGF GAAFGSVGGVGGGGIFVPML+LV+GFD K
Sbjct  60    LWDPNLSAYEHVWPDMKFGWQIIVGTIIGFFGAAFGSVGGVGGGGIFVPMLTLVIGFDAK  119

Query  737   SATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIF  916
             S+TAISKCMIMGAA S+V+YNLKLRHPTLDMPIIDYDLA+L QPML+LGISIGV FNVIF
Sbjct  120   SSTAISKCMIMGAAASTVYYNLKLRHPTLDMPIIDYDLALLFQPMLVLGISIGVAFNVIF  179

Query  917   ADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQ-GEYKLLPGG  1093
             ADWMVTVLLIVLFIGTSTKAF +GVETWKKETI+KKEAA++L +NG+G + GEYK LP G
Sbjct  180   ADWMVTVLLIVLFIGTSTKAFFKGVETWKKETIIKKEAAKRLESNGNGSEDGEYKALPAG  239

Query  1094  PGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNL  1273
             P +GTQ       +K+VSIIENV WKE GLL  VWV  L LQI KNYTSTCS  YW +NL
Sbjct  240   PNDGTQRDTNAPKDKEVSIIENVCWKELGLLFAVWVIILGLQIGKNYTSTCSAGYWTLNL  299

Query  1274  LQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgg  1453
             LQ+PV++GV+ +EA  LYKG R I+SKG+ G+N +   LI YC  G++AG+VGGLLGLGG
Sbjct  300   LQVPVAVGVSGYEAVCLYKGRRVIASKGEEGTNWKVHNLIFYCGVGVLAGIVGGLLGLGG  359

Query  1454  gfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaaf  1633
             GFI+GPLFLELG+PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+  AVATVAAF
Sbjct  360   GFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYFVAVATVAAF  419

Query  1634  IGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             +GQHVVR+LI +LGRASLIIFIL+FTIFVSAISLGGVGI +MIEKI   +YMGFENLC Y
Sbjct  420   LGQHVVRKLINILGRASLIIFILSFTIFVSAISLGGVGIKDMIEKIEQKDYMGFENLCTY  479



>ref|XP_008799063.1| PREDICTED: uncharacterized protein LOC103713782 [Phoenix dactylifera]
Length=477

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/476 (71%), Positives = 392/476 (82%), Gaps = 8/476 (2%)
 Frame = +2

Query  398   KWRI--LRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNS--DDDYLSTFVNFLWQ  565
             KWR   L P V +S SFLL +A  SAER  K+E +   +         DY+    NFLWQ
Sbjct  4     KWRNKWLWPAVVMSLSFLLTAAMASAERGPKSEALGDDSFVEEEMGASDYVLKVANFLWQ  63

Query  566   PKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSAT  745
             P ES Y H+WP M+ GW+I++GSIIGF GAAFGSVGGVGGGGIFVPML+L++GFDPKS+T
Sbjct  64    PNESSYQHVWPPMKFGWKIIVGSIIGFFGAAFGSVGGVGGGGIFVPMLTLIIGFDPKSST  123

Query  746   AISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADW  925
             AISKCMIMGAA S+V+YNLKL+HPTLDMPIIDYDLA+L QPMLMLGISIGV FNV+FADW
Sbjct  124   AISKCMIMGAAGSTVYYNLKLKHPTLDMPIIDYDLALLFQPMLMLGISIGVAFNVLFADW  183

Query  926   MVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNG  1105
             MVTVLLI+LF+GTS+KAF++GVETWKKET+MKKEAA++   +GS  + EYK LP GPGN 
Sbjct  184   MVTVLLIILFLGTSSKAFMKGVETWKKETLMKKEAAKRAETSGS-EEIEYKALPTGPGNT  242

Query  1106  TQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIP  1285
              +   + S   +VS+++NV WKE GLL FVW++FLALQI+K YTS CS  YW++NLLQIP
Sbjct  243   KEPKTRRS---EVSVLQNVCWKELGLLVFVWMAFLALQIMKEYTSNCSKSYWILNLLQIP  299

Query  1286  VSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfim  1465
             VS+GV  +EA  LY+G R ISSKGD  +N R  QL +YC  G++AGVVGGLLGLGGGFI+
Sbjct  300   VSVGVTSYEAVSLYRGKRVISSKGDEETNWRILQLFLYCATGVLAGVVGGLLGLGGGFIL  359

Query  1466  gplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQH  1645
             GPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA +  AV TVAAFIGQH
Sbjct  360   GPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAAYFVAVVTVAAFIGQH  419

Query  1646  VVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             VVR+LI +LGRASLIIFILAFTIFVSAISLGGVGISNMI+KI  HEYMGFENLCKY
Sbjct  420   VVRKLINILGRASLIIFILAFTIFVSAISLGGVGISNMIQKIQRHEYMGFENLCKY  475



>ref|XP_010048100.1| PREDICTED: uncharacterized protein LOC104436943 [Eucalyptus grandis]
 gb|KCW80234.1| hypothetical protein EUGRSUZ_C01581 [Eucalyptus grandis]
Length=480

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/477 (72%), Positives = 392/477 (82%), Gaps = 5/477 (1%)
 Frame = +2

Query  389   AGGKWRILRPLVALSWSFLLASAFVSAERSLK-NEEVAGTNVSRNSDDDYLSTFVNFLWQ  565
              G +WR LR +  +  +   A    SAER LK  +E +   V       +LS   NFLWQ
Sbjct  5     GGAQWRGLRSVAVIFVNLAFALLLASAERGLKLKDEPSSRVVDGPPVPGFLSRAANFLWQ  64

Query  566   PKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSAT  745
                 GY H+WPEMELGW+IV+GSI+GF+GAAFGSVGGVGGGGIFVPML+L+VGFDPKSAT
Sbjct  65    SDGGGYQHVWPEMELGWQIVVGSIVGFLGAAFGSVGGVGGGGIFVPMLTLIVGFDPKSAT  124

Query  746   AISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADW  925
             AISKCMIMGAA S+V+YNLKLRHPT+DMPIIDYDLA+LIQPMLMLGIS+GV FNVIFADW
Sbjct  125   AISKCMIMGAAGSTVYYNLKLRHPTIDMPIIDYDLALLIQPMLMLGISLGVAFNVIFADW  184

Query  926   MVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGG-QGEYKLLPGGPGN  1102
             MVTVLLIVLF+GTSTKAFL+GVETWKKET+MKKEAA++L + G+GG + EYK LPGGPGN
Sbjct  185   MVTVLLIVLFMGTSTKAFLKGVETWKKETLMKKEAAKKLNSVGNGGTEVEYKPLPGGPGN  244

Query  1103  GTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQI  1282
                   K++   + +++ENV WKE GLL FVW +FL LQI K  T+TCS  YWV+NLLQ+
Sbjct  245   SPHQGMKKT---EYTVLENVCWKELGLLVFVWAAFLVLQIAKTQTTTCSIGYWVLNLLQV  301

Query  1283  PVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfi  1462
             PVS+GV+L+EA  LYKG R I+SKGD G+ L+  QL +YC  G++AGVVGGLLGLGGGFI
Sbjct  302   PVSVGVSLYEAVSLYKGRRVIASKGDYGTGLKVSQLALYCACGVLAGVVGGLLGLGGGFI  361

Query  1463  mgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQ  1642
             MGPLFLELGVPP+VSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+   VAT AA +GQ
Sbjct  362   MGPLFLELGVPPEVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFVMVATFAALVGQ  421

Query  1643  HVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             H+VRRLI VLGRASLIIFILAFTIFVSAISLGGVGISNMI K H HEYMGFENLCKY
Sbjct  422   HIVRRLIIVLGRASLIIFILAFTIFVSAISLGGVGISNMIGKFHRHEYMGFENLCKY  478



>gb|KHN10230.1| hypothetical protein glysoja_017834 [Glycine soja]
Length=439

 Score =   536 bits (1382),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 326/444 (73%), Positives = 380/444 (86%), Gaps = 9/444 (2%)
 Frame = +2

Query  491   EVAGTNVS-RNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgs  667
             EV   NV+ R     +L+  +NFLWQ  ESGY H+WP+ME GWEIV+G+ +GF GAAFGS
Sbjct  2     EVPRFNVTTREPQQSFLTKALNFLWQSGESGYQHVWPDMEFGWEIVLGTFVGFCGAAFGS  61

Query  668   vggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYD  847
             VGGVGGGGIFVPMLSL++GFDPKS+TAISKCMIMGAAVS+V+YNLKLRHPTL+MPIIDYD
Sbjct  62    VGGVGGGGIFVPMLSLIIGFDPKSSTAISKCMIMGAAVSTVYYNLKLRHPTLNMPIIDYD  121

Query  848   LAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKE  1027
             LA+LIQPMLMLGISIGV FNV+F DW+VT+LLIVLF+GTSTKAF +GVETWKKETIMKKE
Sbjct  122   LALLIQPMLMLGISIGVVFNVVFPDWIVTILLIVLFLGTSTKAFFKGVETWKKETIMKKE  181

Query  1028  AAQQLAANGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSF  1207
             AA++  +NGSG   EYK LP GP        K++ E+++SIIENVYWKEFGLL FVWVSF
Sbjct  182   AAKRQESNGSGAVVEYKPLPSGP-------EKDTKEQEMSIIENVYWKEFGLLVFVWVSF  234

Query  1208  LALQIVK-NYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAG  1384
             LALQI K NYT+TCSTLYWV+NLLQ+PVS+GV  +EA  L+ G R I+S G+ G +    
Sbjct  235   LALQIAKENYTTTCSTLYWVLNLLQVPVSVGVTAYEAAALFSGRRVIASTGEQGKDFTVL  294

Query  1385  QLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEY  1564
             QL++YC FG++AGVVGG+LGLGGGF+MGPLFLELGVPPQVSSATATFAM FSSSMSV+EY
Sbjct  295   QLMIYCVFGVLAGVVGGMLGLGGGFVMGPLFLELGVPPQVSSATATFAMTFSSSMSVIEY  354

Query  1565  YLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGV  1744
             YLLKRFPVPYAL+   VAT+AAF+GQH+VR+LI + GRASLIIFILA TIFVSA+SLGGV
Sbjct  355   YLLKRFPVPYALYFILVATIAAFVGQHIVRKLIILFGRASLIIFILASTIFVSAVSLGGV  414

Query  1745  GISNMIEKIHNHEYMGFENLCKYG  1816
             GI NM+ KI NHEYMGFE+LCKYG
Sbjct  415   GIVNMVHKIQNHEYMGFEDLCKYG  438



>gb|KDP34212.1| hypothetical protein JCGZ_07783 [Jatropha curcas]
Length=477

 Score =   537 bits (1384),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 335/481 (70%), Positives = 404/481 (84%), Gaps = 9/481 (2%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRN--SDDDYLSTFVN  553
             MA  GGKWR LR ++ +S++ L+A   VSA+R LK  E++G  V++   S   YL   V+
Sbjct  1     MAEFGGKWRGLRSVLMVSFNILVAFMLVSADRGLK-REISGVQVTQEEASLSSYLVKAVD  59

Query  554   FLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDP  733
             FLWQP ++ Y H+WP+M+ GW+IV+G+IIGF GAAFGSVGGVGGGGIF+PML+L+VGFDP
Sbjct  60    FLWQPDQTSYKHVWPDMKFGWQIVLGTIIGFFGAAFGSVGGVGGGGIFIPMLTLIVGFDP  119

Query  734   KSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVI  913
             KSATAISKCMIMGAAVS+V+YNLKLRHP +DMPIIDYDL +LIQPMLM+G+SIGV FNVI
Sbjct  120   KSATAISKCMIMGAAVSTVYYNLKLRHPIIDMPIIDYDLVLLIQPMLMMGMSIGVAFNVI  179

Query  914   FADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGS-GGQGEYKLLPG  1090
             FADWMVT+LLI+LFIG S KAF +GVETWKKETIMK EAA++L +NGS GG+ EYK LP 
Sbjct  180   FADWMVTILLIILFIGISIKAFFKGVETWKKETIMKNEAAKRLESNGSGGGEVEYKPLPS  239

Query  1091  GPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVN  1270
             GP +      K +  ++V + +NVYWKEFGLLCFVWV++L LQIVK++ +TCS  YWVVN
Sbjct  240   GPND-----EKNTKLQEVPVFQNVYWKEFGLLCFVWVAYLILQIVKSHMATCSMEYWVVN  294

Query  1271  LLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglg  1450
             LLQ+PVS GV+ +EA  LYKG RK+ SKGD+ +NL+A QL++YC  G++AG+VGGLLGLG
Sbjct  295   LLQVPVSFGVSTYEAVSLYKGRRKLGSKGDAATNLKALQLVLYCSCGVLAGIVGGLLGLG  354

Query  1451  ggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaa  1630
             GGFIMGPLFLELG+PP+V+SATAT  M FSSSMSVVEYYLL RFPVPYA++  AVATVAA
Sbjct  355   GGFIMGPLFLELGIPPEVTSATATLGMTFSSSMSVVEYYLLNRFPVPYAVYFIAVATVAA  414

Query  1631  fIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  1810
              +GQH++ +LIA+ GRASLIIFILAFTIFVSAISLGGVGISNMI KIH HEYMGFENLCK
Sbjct  415   LVGQHIMSKLIAIFGRASLIIFILAFTIFVSAISLGGVGISNMIGKIHRHEYMGFENLCK  474

Query  1811  Y  1813
             Y
Sbjct  475   Y  475



>ref|XP_003636475.1| hypothetical protein MTR_042s0018 [Medicago truncatula]
 gb|KEH35983.1| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=470

 Score =   535 bits (1378),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 333/474 (70%), Positives = 391/474 (82%), Gaps = 17/474 (4%)
 Frame = +2

Query  407   ILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVS---RNSDDDYLSTFVNFLWQPKES  577
             IL  ++ L  SFL+    VS ER L   ++   NV+   +  +  +L+  VNFLW+   S
Sbjct  9     ILWMMLLLFGSFLI----VSGERKLVKIQLPSFNVTTQPQKHEQSFLTKAVNFLWKSDGS  64

Query  578   GYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISK  757
             GY H+WPEME GW+IV+GS IGF GAAFGSVGGVGGGGIFVPMLSL++GFDPKS+TAISK
Sbjct  65    GYQHVWPEMEFGWQIVLGSFIGFCGAAFGSVGGVGGGGIFVPMLSLIIGFDPKSSTAISK  124

Query  758   CMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTV  937
             CMIMGAA+S+V+YNL+LRHPTLDMPIIDYDLA+LIQPMLMLGISIGV FNV+F DW+VT+
Sbjct  125   CMIMGAALSTVYYNLRLRHPTLDMPIIDYDLALLIQPMLMLGISIGVVFNVVFPDWLVTI  184

Query  938   LLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDT  1117
             LLIVLF+GTSTKAF +G+ETW KETIMKKEAA++  +NGS   GEYK LP GP    +  
Sbjct  185   LLIVLFLGTSTKAFFKGLETWNKETIMKKEAARRQESNGS---GEYKALPTGPNVAIEK-  240

Query  1118  AKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVK-NYTSTCSTLYWVVNLLQIPVSL  1294
                  E +VSIIENVYWKEFGLL FVW+SFLALQI K NYT+TCS  YW++NLLQIP+++
Sbjct  241   -----ENKVSIIENVYWKEFGLLAFVWISFLALQIAKQNYTTTCSAAYWILNLLQIPIAV  295

Query  1295  GVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgpl  1474
             GV  +EAT L+ G R I+S GD G     GQL++YC FG++AG+VGGLLGLGGGF+MGPL
Sbjct  296   GVTAYEATALFTGRRVIASTGDQGKAFTVGQLVIYCVFGVLAGIVGGLLGLGGGFVMGPL  355

Query  1475  flELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVR  1654
             FLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+L+ VAT+AA +GQH+VR
Sbjct  356   FLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYLSLVATIAALVGQHIVR  415

Query  1655  RLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  1816
             RLI + GRASLIIFILA TIF+SAISLGGVGISNM+ KI NHEYMGFEN+CKYG
Sbjct  416   RLIILFGRASLIIFILAGTIFISAISLGGVGISNMVHKIANHEYMGFENICKYG  469



>ref|XP_002516035.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46455.1| conserved hypothetical protein [Ricinus communis]
Length=483

 Score =   535 bits (1379),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 328/481 (68%), Positives = 398/481 (83%), Gaps = 3/481 (1%)
 Frame = +2

Query  380   MAGAGGKWRIL--RPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVN  553
             MA  G +W+ L  R + A    F+   +      + + +E +    S + +  +L   VN
Sbjct  1     MAMIGSEWKSLSLRYVKASLICFIGVVSMTIVSEARQQQEGSSDRNSEDVESAFLMRVVN  60

Query  554   FLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDP  733
             FLWQ  + GY H+WP+M+ GW+IV+GSIIGF GAAFGSVGGVGGGGIFVPML+L++GFD 
Sbjct  61    FLWQKGQLGYTHVWPDMKFGWQIVVGSIIGFFGAAFGSVGGVGGGGIFVPMLTLIIGFDA  120

Query  734   KSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVI  913
             KS+TAISKCMI GAA S+V+YNLKLRHPTLDMPIIDYDLA+L QP+L+LGISIGV FNVI
Sbjct  121   KSSTAISKCMITGAAASTVYYNLKLRHPTLDMPIIDYDLALLFQPVLVLGISIGVAFNVI  180

Query  914   FADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQG-EYKLLPG  1090
             FADWM+TVLLI+LFIGTSTKAFL+GVETWKKETI+KKEAA++LA+NG   +  EYK LPG
Sbjct  181   FADWMITVLLIILFIGTSTKAFLKGVETWKKETIIKKEAARRLASNGGASEEVEYKPLPG  240

Query  1091  GPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVN  1270
             GP NGT   + E   ++VSIIENV WKE G+L  VW+  LAL+I KNYT+TCS +YWV N
Sbjct  241   GPTNGTGPESNEPKREEVSIIENVRWKELGILFAVWLIILALEITKNYTTTCSVVYWVCN  300

Query  1271  LLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglg  1450
             LLQIPV+LGV+ ++A  LYKG R+I+SKG++G+N R  QL++YC  G++AG+VGGLLGLG
Sbjct  301   LLQIPVALGVSSYQAVSLYKGKRRIASKGEAGTNWRVHQLVLYCACGVLAGMVGGLLGLG  360

Query  1451  ggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaa  1630
             GGFI+GPLFLELGVPPQVSSATATFAM FS+SMSV+EYYLLKRFPVPYAL+  AV+T+AA
Sbjct  361   GGFILGPLFLELGVPPQVSSATATFAMTFSASMSVIEYYLLKRFPVPYALYFVAVSTIAA  420

Query  1631  fIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  1810
             F+GQHVVRRLI++LGRASLIIFIL+FTIFVSAISLGGVGI+NMIEKI NHEYMGF+N+C 
Sbjct  421   FVGQHVVRRLISILGRASLIIFILSFTIFVSAISLGGVGIANMIEKIENHEYMGFDNICS  480

Query  1811  Y  1813
             Y
Sbjct  481   Y  481



>ref|XP_004501773.1| PREDICTED: uncharacterized protein LOC101498079 [Cicer arietinum]
Length=484

 Score =   534 bits (1375),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 333/481 (69%), Positives = 396/481 (82%), Gaps = 15/481 (3%)
 Frame = +2

Query  401   WRILRPLVALSWSFLLASAFVSA------ERSLKNEEVAGTNVS--RNSDDDYLSTFVNF  556
             WR ++ + ++ W  LL   FVS+      ER L   EV+  NV+  ++   ++L+  VNF
Sbjct  9     WRCVK-MGSILWMLLLLFCFVSSFGIVSGERRLMKIEVSSFNVTTQKHEQHNFLTKAVNF  67

Query  557   LWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPK  736
             LWQ   SGY H+WP+M+ GW++V+GS IGF GAAFGSVGGVGGGGIFVPMLSLV+GFDPK
Sbjct  68    LWQTDGSGYQHVWPDMKFGWQLVLGSFIGFCGAAFGSVGGVGGGGIFVPMLSLVIGFDPK  127

Query  737   SATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIF  916
             S+TAISKCMI GAA+S+V+YNL+LRHPTL+MPIIDYDLA+LIQPMLMLGISIGV FNV+F
Sbjct  128   SSTAISKCMIFGAALSTVYYNLRLRHPTLNMPIIDYDLALLIQPMLMLGISIGVVFNVVF  187

Query  917   ADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGP  1096
              DW+VT+LLIVLF+GTSTKAFL+GVETW KETIMKKE A++  + GSG   EYK LP GP
Sbjct  188   PDWLVTILLIVLFLGTSTKAFLKGVETWNKETIMKKETARRNESIGSGADAEYKALPTGP  247

Query  1097  GNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVK-NYTSTCSTLYWVVNL  1273
              NG    A E  + +V+I+ENVYWKEFGLL FVWVSFLALQI K NYT+TCST YWV+NL
Sbjct  248   -NG----ATEKEDTKVTILENVYWKEFGLLVFVWVSFLALQITKQNYTTTCSTAYWVLNL  302

Query  1274  LQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgg  1453
             LQIP+S+GV  +EAT L+ G R I+S GD G      QL++YC FG++AG+VGGLLGLGG
Sbjct  303   LQIPISVGVTGYEATALFTGKRVIASTGDQGKEFTVFQLVIYCVFGVLAGIVGGLLGLGG  362

Query  1454  gfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaaf  1633
             GF+MGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+L  VAT+AA 
Sbjct  363   GFVMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYLGLVATIAAV  422

Query  1634  IGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             +GQH+VR+LI + GRASLIIFILA TIF+SAISLGGVGISNM+ KI +HEYMGFEN+CKY
Sbjct  423   VGQHIVRKLIILFGRASLIIFILAGTIFISAISLGGVGISNMVHKIASHEYMGFENICKY  482

Query  1814  G  1816
             G
Sbjct  483   G  483



>ref|XP_010526182.1| PREDICTED: uncharacterized protein LOC104803812 isoform X2 [Tarenaya 
hassleriana]
Length=477

 Score =   533 bits (1373),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 342/481 (71%), Positives = 403/481 (84%), Gaps = 5/481 (1%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             MAG G KWR++R +V ++ +F LA AFVSAER+L+ E  +  +  +    +Y    VNFL
Sbjct  1     MAGFGSKWRVMRSVVVIAVNFALAFAFVSAERNLRGEASSVDSEMQGVFHNYFLRAVNFL  60

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             W+    GY H+WPEME  WEIV+G+++GF GAAFGSVGGVGGGGIFVPMLSL++GFDPKS
Sbjct  61    WKSDGRGYHHVWPEMEFNWEIVVGTLVGFFGAAFGSVGGVGGGGIFVPMLSLIIGFDPKS  120

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             ATAISKCMIMGAAVS+V+YN++LRHPTLDMPIIDYDLA+LIQPMLMLGISIGV FNVIFA
Sbjct  121   ATAISKCMIMGAAVSTVYYNIRLRHPTLDMPIIDYDLALLIQPMLMLGISIGVAFNVIFA  180

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANG-SGGQGEYKLLPGGP  1096
             DWMVTVLLI+LF+GTSTKAFL+G ETWKKETI KKEAA++L ++G SG + EY+ LP  P
Sbjct  181   DWMVTVLLIILFLGTSTKAFLKGCETWKKETIEKKEAAKRLESSGASGAEVEYRPLPAAP  240

Query  1097  GNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLL  1276
              +      KE    +V+++ENV WKE GLL  VWV FLALQI K +T+TCS LYWV+NLL
Sbjct  241   DSNPGKAKKE----EVTVLENVCWKELGLLVLVWVVFLALQIAKQHTTTCSALYWVINLL  296

Query  1277  QIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglggg  1456
             QIPVS+GV+ +EA  LY+G R I+SKG++G+N    QL++YC FG++AG+VGGLLGLGGG
Sbjct  297   QIPVSVGVSAYEAVALYQGRRVIASKGETGTNFTVAQLLLYCTFGVLAGIVGGLLGLGGG  356

Query  1457  fimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafI  1636
             FIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYY+LKRFPVPYAL+  AVATVAAF+
Sbjct  357   FIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYILKRFPVPYALYFVAVATVAAFV  416

Query  1637  GQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  1816
             GQHVVRRLIAVLGRASLIIFILAF IF+SAISLGGVGISNM+ KI  HEYMGFENLC Y 
Sbjct  417   GQHVVRRLIAVLGRASLIIFILAFMIFISAISLGGVGISNMVGKIQRHEYMGFENLCMYD  476

Query  1817  V  1819
             +
Sbjct  477   I  477



>ref|XP_010526181.1| PREDICTED: uncharacterized protein LOC104803812 isoform X1 [Tarenaya 
hassleriana]
Length=478

 Score =   532 bits (1371),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 342/482 (71%), Positives = 402/482 (83%), Gaps = 6/482 (1%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             MAG G KWR++R +V ++ +F LA AFVSAER+L+ E  +  +  +    +Y    VNFL
Sbjct  1     MAGFGSKWRVMRSVVVIAVNFALAFAFVSAERNLRGEASSVDSEMQGVFHNYFLRAVNFL  60

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             W+    GY H+WPEME  WEIV+G+++GF GAAFGSVGGVGGGGIFVPMLSL++GFDPKS
Sbjct  61    WKSDGRGYHHVWPEMEFNWEIVVGTLVGFFGAAFGSVGGVGGGGIFVPMLSLIIGFDPKS  120

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             ATAISKCMIMGAAVS+V+YN++LRHPTLDMPIIDYDLA+LIQPMLMLGISIGV FNVIFA
Sbjct  121   ATAISKCMIMGAAVSTVYYNIRLRHPTLDMPIIDYDLALLIQPMLMLGISIGVAFNVIFA  180

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQL--AANGSGGQGEYKLLPGG  1093
             DWMVTVLLI+LF+GTSTKAFL+G ETWKKETI KKEAA++L  +A  SG + EY+ LP  
Sbjct  181   DWMVTVLLIILFLGTSTKAFLKGCETWKKETIEKKEAAKRLESSAGASGAEVEYRPLPAA  240

Query  1094  PGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNL  1273
             P +      KE    +V+++ENV WKE GLL  VWV FLALQI K +T+TCS LYWV+NL
Sbjct  241   PDSNPGKAKKE----EVTVLENVCWKELGLLVLVWVVFLALQIAKQHTTTCSALYWVINL  296

Query  1274  LQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgg  1453
             LQIPVS+GV+ +EA  LY+G R I+SKG++G+N    QL++YC FG++AG+VGGLLGLGG
Sbjct  297   LQIPVSVGVSAYEAVALYQGRRVIASKGETGTNFTVAQLLLYCTFGVLAGIVGGLLGLGG  356

Query  1454  gfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaaf  1633
             GFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYY+LKRFPVPYAL+  AVATVAAF
Sbjct  357   GFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYILKRFPVPYALYFVAVATVAAF  416

Query  1634  IGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             +GQHVVRRLIAVLGRASLIIFILAF IF+SAISLGGVGISNM+ KI  HEYMGFENLC Y
Sbjct  417   VGQHVVRRLIAVLGRASLIIFILAFMIFISAISLGGVGISNMVGKIQRHEYMGFENLCMY  476

Query  1814  GV  1819
              +
Sbjct  477   DI  478



>ref|XP_006405251.1| hypothetical protein EUTSA_v10000151mg [Eutrema salsugineum]
 gb|ESQ46704.1| hypothetical protein EUTSA_v10000151mg [Eutrema salsugineum]
Length=478

 Score =   532 bits (1370),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 332/480 (69%), Positives = 387/480 (81%), Gaps = 6/480 (1%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDD-DYLSTFVNF  556
             MA      R LR L+ L  +  LA AFVSAERS K + +   + +R SD+  +     NF
Sbjct  1     MAELRSNRRSLRSLIVLFLNLALAFAFVSAERSFKGKSLKFYSQTRESDEPSFFLRAANF  60

Query  557   LWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPK  736
             LW+  ++GY H+WPE E  W+IV+G+++GF GAAFGSVGGVGGGGIFVPMLSL++GFDPK
Sbjct  61    LWESDQTGYHHVWPEFEFNWQIVLGTLVGFFGAAFGSVGGVGGGGIFVPMLSLIIGFDPK  120

Query  737   SATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIF  916
             SATA+SKCMIMGA+VS+V+YNL+LRHPTLDMPIIDYDLA+LIQPMLMLGIS+GV FNVIF
Sbjct  121   SATAMSKCMIMGASVSTVYYNLRLRHPTLDMPIIDYDLALLIQPMLMLGISVGVAFNVIF  180

Query  917   ADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANG-SGGQGEYKLLPGG  1093
              DWMVTVLLI+LF+GTSTKAFL+G ETWKKETI K+EAA++L +NG SG + EY  LP  
Sbjct  181   PDWMVTVLLIILFLGTSTKAFLKGSETWKKETIEKQEAAKRLESNGVSGTEVEYMPLPAA  240

Query  1094  PGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNL  1273
             P    ++  KE    +VSIIENVYWKE GLL FVWV FLALQI K   +TCS  YWV+NL
Sbjct  241   PSTNNRNNKKE----EVSIIENVYWKELGLLVFVWVVFLALQITKQNLATCSVAYWVINL  296

Query  1274  LQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgg  1453
             LQIPV++GV+ +EA  LY+G R I+S G   SN   GQL++YC FG++AG+VGGLLGLGG
Sbjct  297   LQIPVAVGVSGYEAVALYQGRRIIASNGQGDSNFTVGQLLLYCTFGVLAGIVGGLLGLGG  356

Query  1454  gfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaaf  1633
             GFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+   VAT+AA 
Sbjct  357   GFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFVGVATIAAL  416

Query  1634  IGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             +GQHV+RRLI VLGRASLIIFILA  IF+SAISLGGVGI NMI K   HEYMGFENLCKY
Sbjct  417   VGQHVIRRLITVLGRASLIIFILASMIFISAISLGGVGIVNMIGKYQRHEYMGFENLCKY  476



>ref|XP_010429580.1| PREDICTED: uncharacterized protein LOC104714041 [Camelina sativa]
Length=475

 Score =   531 bits (1369),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 335/480 (70%), Positives = 387/480 (81%), Gaps = 7/480 (1%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             MA    KW  LR ++ +  +F LA AFVSAERSL   +        N    +    VNFL
Sbjct  1     MAELKSKWLGLRSVLLVFLNFALAFAFVSAERSLIKGK--AQRFGSNESSSFFLRAVNFL  58

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             W+  ++GY H+WPE E  W+IV+G+++GF GAAFGSVGGVGGGGIFVPMLSL++GFDPKS
Sbjct  59    WESDQTGYHHVWPEFEFNWQIVLGTLVGFFGAAFGSVGGVGGGGIFVPMLSLIIGFDPKS  118

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             ATAISKCMIMGA+VS+V+YNL+LRHPTLDMPIIDYDLA+LIQPMLMLGISIGV FNV+F 
Sbjct  119   ATAISKCMIMGASVSTVYYNLRLRHPTLDMPIIDYDLALLIQPMLMLGISIGVAFNVLFP  178

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANG-SGGQGEYKLLPGGP  1096
             DW+VTVLLI+LF+GTSTKAFL+G ETW KETI KKEAA++L +NG SG + EY  LP  P
Sbjct  179   DWLVTVLLIILFLGTSTKAFLKGSETWNKETIQKKEAAKRLESNGVSGTEVEYVPLPAAP  238

Query  1097  GNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLL  1276
                  +  KE    +VSI+ENVYWKE GLL FVWV FLALQI K   +TCS  YWV+NLL
Sbjct  239   STNPGNKKKE----EVSILENVYWKELGLLVFVWVVFLALQISKQNLATCSVAYWVINLL  294

Query  1277  QIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglggg  1456
             QIPV++GV+ +EA  LY+G R I+SKG   SN   GQL++YC FG++AG+VGGLLGLGGG
Sbjct  295   QIPVAVGVSGYEAVALYQGRRIIASKGQGDSNFTVGQLVLYCTFGILAGIVGGLLGLGGG  354

Query  1457  fimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafI  1636
             FIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+L  VAT+AA +
Sbjct  355   FIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYLVGVATIAALV  414

Query  1637  GQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  1816
             GQHVVRRLI+ LGRASLIIFILA TIF+SAISLGGVGI NMI KI  HEYMGFENLCKYG
Sbjct  415   GQHVVRRLISALGRASLIIFILASTIFISAISLGGVGIVNMIGKIQRHEYMGFENLCKYG  474



>ref|XP_010249713.1| PREDICTED: uncharacterized protein LOC104592186 [Nelumbo nucifera]
Length=480

 Score =   529 bits (1362),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 335/484 (69%), Positives = 397/484 (82%), Gaps = 12/484 (2%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNS-----DDDYLST  544
             M+G   KW+ L+ +  +  S LL S F SAER+LK++       SRN        +YL  
Sbjct  1     MSGTEAKWKTLQWVATVVLSLLLVSVFASAERTLKDD------ASRNKGTAEVHSNYLVQ  54

Query  545   FVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVG  724
                F+WQ  +SGY H+WP M+ GWEIV+G+IIGF GAAFGSVGGVGGGGIFVPML+L++G
Sbjct  55    IKTFIWQAGKSGYHHVWPPMKFGWEIVLGTIIGFCGAAFGSVGGVGGGGIFVPMLTLIIG  114

Query  725   FDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTF  904
             FD KS+TAISKCMIMGA+ S+V+ NL+LRHPTLDMPIIDYDLA+L QPMLMLGISIGV F
Sbjct  115   FDAKSSTAISKCMIMGASASTVYCNLRLRHPTLDMPIIDYDLAMLFQPMLMLGISIGVAF  174

Query  905   NVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANG-SGGQGEYKL  1081
             NVIFA+WM+TVLLIVLF+G STK+F +G+ETWKKETI KKEAA++L +NG S  Q E+K+
Sbjct  175   NVIFANWMLTVLLIVLFLGLSTKSFFKGIETWKKETIKKKEAAKRLESNGTSNEQVEHKI  234

Query  1082  LPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYW  1261
              P    NG Q   KES E++V I++NVYWKE GLL FVWV+FL LQIVKN+T+TCST+YW
Sbjct  235   PPSSTSNGPQKETKESREREVPILKNVYWKELGLLVFVWVAFLILQIVKNHTTTCSTIYW  294

Query  1262  VVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggll  1441
             V+NLLQIPV++GV+L+E   LYKGW+ I SKGD G+N R  QLI+YC  G++AGVVGGLL
Sbjct  295   VLNLLQIPVAVGVSLYEGVSLYKGWKVIGSKGDKGTNWRVHQLILYCCCGILAGVVGGLL  354

Query  1442  glgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavat  1621
             GLGGGFI+GPLFLE+GVPP+VSSATATFAMMFSSSMSVVEYYLLKRFP+PYAL+ TAVAT
Sbjct  355   GLGGGFILGPLFLEMGVPPEVSSATATFAMMFSSSMSVVEYYLLKRFPIPYALYFTAVAT  414

Query  1622  vaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFEN  1801
             VAAF+GQ VVRRLI +LGRASLIIFIL+ TIFVSAISLGG+GIS MI KI  HEYMG EN
Sbjct  415   VAAFVGQRVVRRLIILLGRASLIIFILSLTIFVSAISLGGIGISRMIHKIERHEYMGLEN  474

Query  1802  LCKY  1813
             LC Y
Sbjct  475   LCNY  478



>ref|XP_010417351.1| PREDICTED: uncharacterized protein LOC104703106 [Camelina sativa]
Length=481

 Score =   529 bits (1362),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 335/484 (69%), Positives = 390/484 (81%), Gaps = 9/484 (2%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERS-LKNEEV---AGTNVSRNSDDDYLSTF  547
             MA    KW  LR ++ +  SF LA AFVSAERS +K +++   +      N    +    
Sbjct  1     MAELKSKWLGLRSVILVFLSFALAFAFVSAERSFIKRKDLRFYSDETRENNESSSFFLKA  60

Query  548   VNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGF  727
             VNFLW+  ++GY H+WPE E  W+IV+G+++GF GAAFGSVGGVGGGGIFVPMLSL++GF
Sbjct  61    VNFLWESDQTGYHHVWPEFEFNWQIVLGTLVGFFGAAFGSVGGVGGGGIFVPMLSLIIGF  120

Query  728   DPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFN  907
             DPKSATAISKCMIMGA+VS+V+YNL+LRHPTLDMPIIDYDLA+LIQPMLMLGISIGV FN
Sbjct  121   DPKSATAISKCMIMGASVSTVYYNLRLRHPTLDMPIIDYDLALLIQPMLMLGISIGVAFN  180

Query  908   VIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANG-SGGQGEYKLL  1084
             V+F DW+VTVLLI+LF+GTSTKAFL+G ETW KETI KKEAA++L +NG SG + EY  L
Sbjct  181   VLFPDWLVTVLLIILFLGTSTKAFLKGSETWNKETIEKKEAAKRLESNGVSGTEVEYIPL  240

Query  1085  PGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWV  1264
             P  P     +  KE    +VSI+ENVYWKE GLL FVWV FLALQI K   +TCS  YWV
Sbjct  241   PAAPTTNPGNKKKE----EVSILENVYWKELGLLVFVWVVFLALQISKQNLATCSVAYWV  296

Query  1265  VNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllg  1444
             +NLLQIPV++GV+ +EA  LY+G R I+SKG   SN   GQL++YC FG++AG+VGGLLG
Sbjct  297   INLLQIPVAVGVSGYEAVALYQGRRIIASKGQGDSNFTVGQLVLYCTFGILAGIVGGLLG  356

Query  1445  lgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatv  1624
             LGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+L  VAT+
Sbjct  357   LGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYLVGVATI  416

Query  1625  aafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENL  1804
             AA +GQHVVRRLI+ LGRASLIIFILA  IF+SAISLGGVGI NMI KI  HEYMGFENL
Sbjct  417   AALVGQHVVRRLISALGRASLIIFILASMIFISAISLGGVGIVNMIGKIQRHEYMGFENL  476

Query  1805  CKYG  1816
             CKYG
Sbjct  477   CKYG  480



>ref|XP_002878880.1| hypothetical protein ARALYDRAFT_481426 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55139.1| hypothetical protein ARALYDRAFT_481426 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score =   528 bits (1361),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 339/486 (70%), Positives = 390/486 (80%), Gaps = 15/486 (3%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDD------DYLS  541
             MA    KW  LR ++ +  +F LA AFVSAER +    + G ++  NSD+       +  
Sbjct  1     MAKLRSKWLGLRSVIMVLINFSLAFAFVSAERRI----IKGKSLRLNSDETRENESSFFL  56

Query  542   TFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVV  721
               VNFLW+  + GY H+WPE E  W+IV+G+++GF GAAFGSVGGVGGGGIFVPMLSLV+
Sbjct  57    KAVNFLWESDQIGYRHVWPEFEFNWQIVLGTLVGFFGAAFGSVGGVGGGGIFVPMLSLVI  116

Query  722   GFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVT  901
             GFDPKSATAISKCMIMGA+VS+V+YNL+LRHPTLDMPIIDYDLA+LIQPMLMLGISIGV 
Sbjct  117   GFDPKSATAISKCMIMGASVSTVYYNLRLRHPTLDMPIIDYDLALLIQPMLMLGISIGVA  176

Query  902   FNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANG-SGGQGEYK  1078
             FNVIF DW+VTVLLI+LF+GTSTKAFL+G ETW KETI KKEAA++L +NG SG + EY 
Sbjct  177   FNVIFPDWLVTVLLIILFLGTSTKAFLKGSETWNKETIEKKEAAKRLESNGVSGAEVEYV  236

Query  1079  LLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLY  1258
              LP  P     +  KE    +VSIIENVYWKE GLL FVWV FLALQI K   + CS  Y
Sbjct  237   PLPAAPSTNPGNKKKE----EVSIIENVYWKELGLLVFVWVVFLALQISKQNLANCSVAY  292

Query  1259  WVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggl  1438
             WV+NLLQIPV++GV+ +EA  LY+G R I+SKG   SN   GQL++YC FG++AG+VGGL
Sbjct  293   WVINLLQIPVAVGVSGYEAVALYQGRRIIASKGQGDSNFTVGQLVMYCTFGILAGIVGGL  352

Query  1439  lglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltava  1618
             LGLGGGFIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+L  VA
Sbjct  353   LGLGGGFIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYLVGVA  412

Query  1619  tvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFE  1798
             T+AAF+GQHVVRRLIA LGRASLIIFILA  IF+SAISLGGVGI NMI KI  HEYMGFE
Sbjct  413   TIAAFVGQHVVRRLIAALGRASLIIFILASMIFISAISLGGVGIVNMIGKIQRHEYMGFE  472

Query  1799  NLCKYG  1816
             NLCKYG
Sbjct  473   NLCKYG  478



>ref|XP_010472594.1| PREDICTED: uncharacterized protein LOC104752213 isoform X1 [Camelina 
sativa]
Length=475

 Score =   527 bits (1357),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 333/480 (69%), Positives = 384/480 (80%), Gaps = 7/480 (1%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             MA    KW  LR ++ +  +F LA AFVSAER     +        N    +    VNFL
Sbjct  1     MAELKSKWLGLRSVILVFLNFALAFAFVSAERRFIKGK--AQRFDSNESSSFFLKAVNFL  58

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             W+  ++GY H+WPE E  W+IV+G+++GF GAAFGSVGGVGGGGIFVPMLSL++GFDPKS
Sbjct  59    WESDQTGYHHVWPEFEFNWQIVLGTLVGFFGAAFGSVGGVGGGGIFVPMLSLIIGFDPKS  118

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             ATAISKCMIMGA+VS+V+YNLKLRHPTLDMPIIDYDLA+LIQPMLMLGISIGV FNV+F 
Sbjct  119   ATAISKCMIMGASVSTVYYNLKLRHPTLDMPIIDYDLALLIQPMLMLGISIGVAFNVLFP  178

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANG-SGGQGEYKLLPGGP  1096
             DW+VTVLLI+LF+GTSTKAFL+G ETW KETI KKEAA++L +NG SG + EY  LP  P
Sbjct  179   DWLVTVLLIILFLGTSTKAFLKGSETWNKETIEKKEAAKRLESNGVSGTEVEYIPLPAAP  238

Query  1097  GNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLL  1276
                  +  KE    +VSI+ENVYWKE GLL FVWV FLALQI K   +TCS  YWV+NLL
Sbjct  239   TTNPGNKKKE----EVSILENVYWKELGLLVFVWVVFLALQISKQNLATCSVAYWVINLL  294

Query  1277  QIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglggg  1456
             QIPV++GV+ +EA  LY+G R I+SKG   SN   GQL++YC FG++AG+VGGLLGLGGG
Sbjct  295   QIPVAVGVSGYEAVALYQGRRIIASKGQGDSNFTVGQLVLYCTFGILAGIVGGLLGLGGG  354

Query  1457  fimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafI  1636
             FIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+L  VAT+AA +
Sbjct  355   FIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYLVGVATIAAIV  414

Query  1637  GQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  1816
             GQHVVRRLI+ LGRASLIIFILA  IF+SAISLGGVGI NMI KI  HEYMGFENLCKYG
Sbjct  415   GQHVVRRLISALGRASLIIFILASMIFISAISLGGVGIVNMIGKIQRHEYMGFENLCKYG  474



>gb|KHN42580.1| hypothetical protein glysoja_042801 [Glycine soja]
Length=469

 Score =   526 bits (1356),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 316/453 (70%), Positives = 383/453 (85%), Gaps = 4/453 (1%)
 Frame = +2

Query  458   FVSAERS-LKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGS  634
             FV  +R+ LK E     + S+  +  ++S  VNFLWQP ESGY H+WP+ME GW+I++G+
Sbjct  18    FVWGDRTILKVEGPMLLDNSQRYEGSFISKAVNFLWQPGESGYQHVWPDMEFGWQIILGT  77

Query  635   IIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRH  814
             I+GF GAAFGSVGGVGGGGIFVPMLSL++GFD KS+TAISKCMIMGAA+S+V+YNL LRH
Sbjct  78    IVGFFGAAFGSVGGVGGGGIFVPMLSLIIGFDAKSSTAISKCMIMGAALSTVYYNLNLRH  137

Query  815   PTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVE  994
             PTLD+PIIDYDLA+LIQPMLMLGISIGV FNV+ ADWMVT+LL+VLF+GTSTKAF +GVE
Sbjct  138   PTLDLPIIDYDLALLIQPMLMLGISIGVAFNVVVADWMVTMLLLVLFLGTSTKAFFKGVE  197

Query  995   TWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKE  1174
             TWKKETIMK+E A++ A NG G + EY  +P GPG+   D AK++  ++VS++ENVYWKE
Sbjct  198   TWKKETIMKEEDARKQATNGVGSEVEYTPIPSGPGS---DIAKDTRNEEVSMLENVYWKE  254

Query  1175  FGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSK  1354
             FGLL FVWVSFL +QI  N TS CST+YWV+N+LQIP+S+GV+ +EA  LYKG R+ISS 
Sbjct  255   FGLLVFVWVSFLGIQIAMNQTSKCSTIYWVLNMLQIPISVGVSGYEAASLYKGRRQISSV  314

Query  1355  GDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfamm  1534
             GD G    + QL +YC FG++AG+VGGLLG+GGGF+MGPLFLELGVPPQVSSATATFAM 
Sbjct  315   GDQGKTFTSQQLTIYCIFGVLAGIVGGLLGIGGGFVMGPLFLELGVPPQVSSATATFAMT  374

Query  1535  fsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTI  1714
             FSSSMSVVEYYLLKRFPVPYAL+  AVA ++A +GQH+VR+LI VLGRASLIIF+LAFTI
Sbjct  375   FSSSMSVVEYYLLKRFPVPYALYFIAVAAISAIVGQHIVRKLIDVLGRASLIIFVLAFTI  434

Query  1715  FVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
              VSA+SLGGVGI  M++KI NHEYMGF++LC Y
Sbjct  435   LVSAVSLGGVGIVAMVKKIENHEYMGFDDLCTY  467



>ref|XP_003636476.1| hypothetical protein MTR_042s0018 [Medicago truncatula]
Length=480

 Score =   527 bits (1357),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 333/484 (69%), Positives = 391/484 (81%), Gaps = 27/484 (6%)
 Frame = +2

Query  407   ILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVS---RNSDDDYLSTFVNFLWQPKES  577
             IL  ++ L  SFL+    VS ER L   ++   NV+   +  +  +L+  VNFLW+   S
Sbjct  9     ILWMMLLLFGSFLI----VSGERKLVKIQLPSFNVTTQPQKHEQSFLTKAVNFLWKSDGS  64

Query  578   GYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISK  757
             GY H+WPEME GW+IV+GS IGF GAAFGSVGGVGGGGIFVPMLSL++GFDPKS+TAISK
Sbjct  65    GYQHVWPEMEFGWQIVLGSFIGFCGAAFGSVGGVGGGGIFVPMLSLIIGFDPKSSTAISK  124

Query  758   CMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTV  937
             CMIMGAA+S+V+YNL+LRHPTLDMPIIDYDLA+LIQPMLMLGISIGV FNV+F DW+VT+
Sbjct  125   CMIMGAALSTVYYNLRLRHPTLDMPIIDYDLALLIQPMLMLGISIGVVFNVVFPDWLVTI  184

Query  938   LLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDT  1117
             LLIVLF+GTSTKAF +G+ETW KETIMKKEAA++  +NGS   GEYK LP GP    +  
Sbjct  185   LLIVLFLGTSTKAFFKGLETWNKETIMKKEAARRQESNGS---GEYKALPTGPNVAIEK-  240

Query  1118  AKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVK-NYTSTCSTLYWVVNLLQIPVSL  1294
                  E +VSIIENVYWKEFGLL FVW+SFLALQI K NYT+TCS  YW++NLLQIP+++
Sbjct  241   -----ENKVSIIENVYWKEFGLLAFVWISFLALQIAKQNYTTTCSAAYWILNLLQIPIAV  295

Query  1295  GVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgpl  1474
             GV  +EAT L+ G R I+S GD G     GQL++YC FG++AG+VGGLLGLGGGF+MGPL
Sbjct  296   GVTAYEATALFTGRRVIASTGDQGKAFTVGQLVIYCVFGVLAGIVGGLLGLGGGFVMGPL  355

Query  1475  flELGVPPQ----------VssatatfammfsssmsVVEYYLLKRFPVPYalfltavatv  1624
             FLELGVPPQ          VSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+L+ VAT+
Sbjct  356   FLELGVPPQVSFKLQYINHVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYLSLVATI  415

Query  1625  aafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENL  1804
             AA +GQH+VRRLI + GRASLIIFILA TIF+SAISLGGVGISNM+ KI NHEYMGFEN+
Sbjct  416   AALVGQHIVRRLIILFGRASLIIFILAGTIFISAISLGGVGISNMVHKIANHEYMGFENI  475

Query  1805  CKYG  1816
             CKYG
Sbjct  476   CKYG  479



>ref|NP_850068.1| Sulfite exporter TauE/SafE family protein [Arabidopsis thaliana]
 gb|AAM97053.1| unknown protein [Arabidopsis thaliana]
 gb|AAN72117.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC42374.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63445.1| At2g25737 [Arabidopsis thaliana]
 gb|AEC07746.1| Sulfite exporter TauE/SafE family protein [Arabidopsis thaliana]
Length=476

 Score =   525 bits (1352),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 333/474 (70%), Positives = 387/474 (82%), Gaps = 6/474 (1%)
 Frame = +2

Query  398   KWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKES  577
             KW  LR +     +F LA AFVSAER  K+  ++ T+ +R ++  +    +NFLW+  + 
Sbjct  7     KWLGLRSVTIFLINFSLAFAFVSAERRGKSLRLS-TDETRENESSFFLKAINFLWESDQI  65

Query  578   GYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISK  757
             GY H+WPE E  W+IV+G+++GF GAAFGSVGGVGGGGIFVPMLSL++GFDPKSATAISK
Sbjct  66    GYRHVWPEFEFNWQIVLGTLVGFFGAAFGSVGGVGGGGIFVPMLSLIIGFDPKSATAISK  125

Query  758   CMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTV  937
             CMIMGA+VS+V+YNL+LRHPTLDMPIIDYDLA+LIQPMLMLGISIGV FNVIF DW+VTV
Sbjct  126   CMIMGASVSTVYYNLRLRHPTLDMPIIDYDLALLIQPMLMLGISIGVAFNVIFPDWLVTV  185

Query  938   LLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANG-SGGQGEYKLLPGGPGNGTQD  1114
             LLIVLF+GTSTKAFL+G ETW KETI KKEAA++L +NG SG + EY  LP  P     +
Sbjct  186   LLIVLFLGTSTKAFLKGSETWNKETIEKKEAAKRLESNGVSGTEVEYVPLPAAPSTNPGN  245

Query  1115  TAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSL  1294
               KE    +VSIIENVYWKE GLL FVW+ FLALQI K   + CS  YWV+NLLQIPV++
Sbjct  246   KKKE----EVSIIENVYWKELGLLVFVWIVFLALQISKQNLANCSVAYWVINLLQIPVAV  301

Query  1295  GVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgpl  1474
             GV+ +EA  LY+G R I+SKG   SN   GQL++YC FG+IAG+VGGLLGLGGGFIMGPL
Sbjct  302   GVSGYEAVALYQGRRIIASKGQGDSNFTVGQLVMYCTFGIIAGIVGGLLGLGGGFIMGPL  361

Query  1475  flELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVR  1654
             FLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+L  VAT+AA++GQHVVR
Sbjct  362   FLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYLVGVATIAAWVGQHVVR  421

Query  1655  RLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  1816
             RLIA +GRASLIIFILA  IF+SAISLGGVGI NMI KI  HEYMGFENLCKYG
Sbjct  422   RLIAAIGRASLIIFILASMIFISAISLGGVGIVNMIGKIQRHEYMGFENLCKYG  475



>ref|XP_010472595.1| PREDICTED: uncharacterized protein LOC104752213 isoform X2 [Camelina 
sativa]
Length=472

 Score =   523 bits (1348),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 331/479 (69%), Positives = 383/479 (80%), Gaps = 8/479 (2%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             MA    KW  LR ++ +  +F LA AFVSAER     +        N    +    VNFL
Sbjct  1     MAELKSKWLGLRSVILVFLNFALAFAFVSAERRFIKGK--AQRFDSNESSSFFLKAVNFL  58

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             W+  ++GY H+WPE E  W+IV+G+++GF GAAFGSVGGVGGGGIFVPMLSL++GFDPKS
Sbjct  59    WESDQTGYHHVWPEFEFNWQIVLGTLVGFFGAAFGSVGGVGGGGIFVPMLSLIIGFDPKS  118

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             ATAISKCMIMGA+VS+V+YNLKLRHPTLDMPIIDYDLA+LIQPMLMLGISIGV FNV+F 
Sbjct  119   ATAISKCMIMGASVSTVYYNLKLRHPTLDMPIIDYDLALLIQPMLMLGISIGVAFNVLFP  178

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPG  1099
             DW+VTVLLI+LF+GTSTKAFL+G ETW KETI KKEAA++L +NG+  + EY  LP  P 
Sbjct  179   DWLVTVLLIILFLGTSTKAFLKGSETWNKETIEKKEAAKRLESNGT--EVEYIPLPAAPT  236

Query  1100  NGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQ  1279
                 +  KE    +VSI+ENVYWKE GLL FVWV FLALQI K   +TCS  YWV+NLLQ
Sbjct  237   TNPGNKKKE----EVSILENVYWKELGLLVFVWVVFLALQISKQNLATCSVAYWVINLLQ  292

Query  1280  IPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggf  1459
             IPV++GV+ +EA  LY+G R I+SKG   SN   GQL++YC FG++AG+VGGLLGLGGGF
Sbjct  293   IPVAVGVSGYEAVALYQGRRIIASKGQGDSNFTVGQLVLYCTFGILAGIVGGLLGLGGGF  352

Query  1460  imgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIG  1639
             IMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+L  VAT+AA +G
Sbjct  353   IMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYLVGVATIAAIVG  412

Query  1640  QHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  1816
             QHVVRRLI+ LGRASLIIFILA  IF+SAISLGGVGI NMI KI  HEYMGFENLCKYG
Sbjct  413   QHVVRRLISALGRASLIIFILASMIFISAISLGGVGIVNMIGKIQRHEYMGFENLCKYG  471



>ref|XP_010062471.1| PREDICTED: uncharacterized protein LOC104449877 [Eucalyptus grandis]
 gb|KCW69612.1| hypothetical protein EUGRSUZ_F03030 [Eucalyptus grandis]
Length=480

 Score =   521 bits (1343),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 331/482 (69%), Positives = 390/482 (81%), Gaps = 12/482 (2%)
 Frame = +2

Query  380   MAGAGGKW---RILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDD--DYLST  544
             MAG G +W   R    +V +S   + AS FVSA+   + E  +    SR S+   D    
Sbjct  1     MAGTGKEWWGWRCFAMIVIIS--LVGASVFVSAKEDGRKEGPS----SRKSESKMDLAKA  54

Query  545   FVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVG  724
              +NFLWQ  + GY  +WPEME GW+IV+GSIIGF GAAFGSVGGVGGGGIFVPML+L++G
Sbjct  55    VLNFLWQKGKLGYTRVWPEMEFGWKIVVGSIIGFFGAAFGSVGGVGGGGIFVPMLTLIIG  114

Query  725   FDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTF  904
             FD KS+TAISKCMIMGAA S+V+YNLKLRHPTL++PIIDYDLA+L QPML+LGISIGV F
Sbjct  115   FDAKSSTAISKCMIMGAAASTVYYNLKLRHPTLELPIIDYDLALLFQPMLVLGISIGVAF  174

Query  905   NVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGG-QGEYKL  1081
             NVIFADWM+TVLLI+LF+GTSTKAFL+GVETWKKETI+KKEAA++L  NG+   + EY  
Sbjct  175   NVIFADWMITVLLIILFLGTSTKAFLKGVETWKKETILKKEAARRLETNGNAAEEAEYSP  234

Query  1082  LPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYW  1261
             LPG P NG +  +KE+   +  I ENVYWKE GLL  VWV+ LAL+I KNYT+TCS LYW
Sbjct  235   LPGEPDNGNETESKETKRTEAPIRENVYWKELGLLVLVWVAILALEIGKNYTTTCSALYW  294

Query  1262  VVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggll  1441
             V+NLLQIPV+ GV+ +EA  LY G R I+S+G+  +N +  QL++YC FG+ AG+VGGLL
Sbjct  295   VLNLLQIPVAFGVSGYEAYNLYTGRRVIASRGEVAANWKISQLVMYCAFGIAAGMVGGLL  354

Query  1442  glgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavat  1621
             GLGGGFI+GPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+  AVAT
Sbjct  355   GLGGGFILGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFVAVAT  414

Query  1622  vaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFEN  1801
             +AAF GQHVVRR+IA+LGRASLIIFILAFTIFVSAISLGGVGI NMIE I N EYMGFE+
Sbjct  415   IAAFTGQHVVRRIIAILGRASLIIFILAFTIFVSAISLGGVGIVNMIEDIENKEYMGFED  474

Query  1802  LC  1807
             LC
Sbjct  475   LC  476



>ref|XP_010667904.1| PREDICTED: uncharacterized protein LOC104884897 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=478

 Score =   520 bits (1340),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 322/479 (67%), Positives = 390/479 (81%), Gaps = 13/479 (3%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             ++G   KW+IL  +  ++ SFLL +   SAE+   N +   ++++ ++ DD L+ F NF 
Sbjct  10    LSGGLLKWKILISISMVALSFLLLA---SAEKRTLNSD--NSSITTSTADDLLAQFANFF  64

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             W   +SGY H+WP+M+ GW+IV+GS+IGF GAAFGSVGGVGGGGIFVPML L++GFDPKS
Sbjct  65    WNSDQSGYHHVWPDMKFGWQIVVGSLIGFCGAAFGSVGGVGGGGIFVPMLCLIIGFDPKS  124

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             ATAISKCMIMGAA S+V YN+KL+HPTLDMPIIDYDLA+L QPMLMLGISIGVTFNVIFA
Sbjct  125   ATAISKCMIMGAAASTVFYNMKLKHPTLDMPIIDYDLALLFQPMLMLGISIGVTFNVIFA  184

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQG-EYKLLPGGP  1096
             DWMVTVLLI+LFIGTS KA  +G+ETW+KET++K E  ++LA+NG+GG+G +YK LPGGP
Sbjct  185   DWMVTVLLIILFIGTSIKALFKGIETWRKETLIKLEETRRLASNGAGGEGIDYKPLPGGP  244

Query  1097  GNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLL  1276
                      E+ E +VS  E  Y KE GLL FVWV+FL LQIVK  TS+CS  YWV+NLL
Sbjct  245   N-------METKETEVSSGEYYYTKELGLLIFVWVTFLVLQIVKEQTSSCSIAYWVLNLL  297

Query  1277  QIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglggg  1456
             Q+PV++GV+L+EA GLYKG R ISSKGD  +     QL++YC  G++AG+VGGLLGLGGG
Sbjct  298   QVPVAIGVSLYEAVGLYKGRRIISSKGDVSTTWEVHQLVLYCCCGILAGIVGGLLGLGGG  357

Query  1457  fimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafI  1636
             FI+ PLFLELGVPPQVSSATATFAM FS+SMSVVEYYLLKRFP+ YAL+  AVA VAAF+
Sbjct  358   FILIPLFLELGVPPQVSSATATFAMAFSASMSVVEYYLLKRFPITYALYFMAVAIVAAFV  417

Query  1637  GQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             GQH+VR+LI +LGRASLIIFILAF+IFVSA+SLGGVGISNMI+  H H YMGFENLCKY
Sbjct  418   GQHLVRKLIILLGRASLIIFILAFSIFVSAVSLGGVGISNMIKMFHRHHYMGFENLCKY  476



>emb|CDX77007.1| BnaC04g38020D [Brassica napus]
Length=470

 Score =   520 bits (1338),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 329/473 (70%), Positives = 388/473 (82%), Gaps = 12/473 (3%)
 Frame = +2

Query  398   KWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKES  577
             K R LR ++ L  +F LA AFVSAER + + +      +R SD+   S F++FLW+P ++
Sbjct  7     KCRGLRSVIVLFTNFALAFAFVSAERGIFDSK------ARESDEPP-SFFLDFLWEPDQT  59

Query  578   GYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISK  757
             GY H+WPE E  W+IV+G+++GF GAAFGSVGGVGGGGIFVPMLSL++GFDPKSATA+SK
Sbjct  60    GYHHVWPEFEFNWQIVLGTLVGFFGAAFGSVGGVGGGGIFVPMLSLIIGFDPKSATALSK  119

Query  758   CMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTV  937
             CMI+GA+VS+V+YNL+LRHPTLDMPIIDYDLA+LIQPMLMLGIS+GV FNV+F DWMVTV
Sbjct  120   CMIVGASVSTVYYNLRLRHPTLDMPIIDYDLALLIQPMLMLGISVGVAFNVMFPDWMVTV  179

Query  938   LLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANG-SGGQGEYKLLPGGPGNGTQD  1114
             LLI+LF+GTSTKAFL+G ETW KETI K EAA++L ++G S  + EY  LP  P     +
Sbjct  180   LLIILFLGTSTKAFLKGRETWNKETIEKMEAAKRLESDGVSATEVEYMPLPAAPSTNPGN  239

Query  1115  TAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSL  1294
               K    ++VSIIENVYWKE GLL FVW+ FLALQI K    TCS  YWV+NLLQIPV++
Sbjct  240   NKK----REVSIIENVYWKELGLLVFVWIVFLALQIAKKNMPTCSVGYWVINLLQIPVAV  295

Query  1295  GVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgpl  1474
             GV+ +EA  LY+G R I+S G  GSN   GQLI+YC FG++AGVVGGLLGLGGGFIMGPL
Sbjct  296   GVSGYEAVALYQGRRIIASNGQGGSNFTIGQLILYCSFGVLAGVVGGLLGLGGGFIMGPL  355

Query  1475  flELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVR  1654
             FLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+L  VAT+AA +GQHVVR
Sbjct  356   FLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYLVGVATIAALVGQHVVR  415

Query  1655  RLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             RLIAVLGRASLIIFILA TIF+SAISLGGVGI NM+ K+  HEYMGFENLCKY
Sbjct  416   RLIAVLGRASLIIFILASTIFISAISLGGVGIVNMMGKLQRHEYMGFENLCKY  468



>ref|XP_006294138.1| hypothetical protein CARUB_v10023132mg [Capsella rubella]
 gb|EOA27036.1| hypothetical protein CARUB_v10023132mg [Capsella rubella]
Length=472

 Score =   520 bits (1338),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 326/473 (69%), Positives = 381/473 (81%), Gaps = 11/473 (2%)
 Frame = +2

Query  410   LRPLVALSWSFLLASAFVSAERSL---KNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESG  580
             LR ++     F LA A VSAERS    K +    ++ +R  +  +L   VNFLW+  + G
Sbjct  6     LRSVILGFLCFALAFALVSAERSFIKEKAQRFGDSDETREKESSFLIKAVNFLWESNQIG  65

Query  581   YDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKC  760
             Y H+WPE E  W+IV+G+++GF GAAFGSVGGVGGGGIFVPMLSL++GFDPKSATAISKC
Sbjct  66    YHHVWPEFEFNWQIVLGTLVGFFGAAFGSVGGVGGGGIFVPMLSLIIGFDPKSATAISKC  125

Query  761   MIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVL  940
             MIMGA+VS+V+YNL+LRHPTLDMPIIDYDLA+LIQPMLMLGIS+GV FNVIF DW+VTVL
Sbjct  126   MIMGASVSTVYYNLRLRHPTLDMPIIDYDLALLIQPMLMLGISVGVAFNVIFPDWLVTVL  185

Query  941   LIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANG-SGGQGEYKLLPGGPGNGTQDT  1117
             LI+LF+GTSTKAF++G ETW KETI KKEAA++L +NG SG + EY  LP  P       
Sbjct  186   LIILFLGTSTKAFMKGSETWNKETIQKKEAAKRLESNGVSGTEVEYVALPAAP-------  238

Query  1118  AKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLG  1297
             +  + ++ V I+ENVYWKE GLL FVW  FLALQI K   +TCS  YWV+NLLQIPV++G
Sbjct  239   STNAKKEVVGILENVYWKELGLLVFVWFVFLALQISKQNLATCSVAYWVINLLQIPVAIG  298

Query  1298  VALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplf  1477
             V+ +EA  LY+G R I+SKG   SN   GQL++YC FG++AG+VGGLLGLGGGFIMGPLF
Sbjct  299   VSGYEAVALYQGRRIIASKGQGDSNFTVGQLVLYCTFGILAGIVGGLLGLGGGFIMGPLF  358

Query  1478  lELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRR  1657
             LELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+L  VAT+AA +GQHVVRR
Sbjct  359   LELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYLVGVATIAALVGQHVVRR  418

Query  1658  LIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  1816
             LIA LGRASLIIFILA  IF SAISLGGVGI+NMI KI  HEYMGFENLCKYG
Sbjct  419   LIAALGRASLIIFILASMIFTSAISLGGVGIANMIGKIQRHEYMGFENLCKYG  471



>ref|XP_009140696.1| PREDICTED: uncharacterized protein LOC103864686 [Brassica rapa]
Length=470

 Score =   518 bits (1333),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 329/473 (70%), Positives = 386/473 (82%), Gaps = 12/473 (3%)
 Frame = +2

Query  398   KWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKES  577
             K R LR ++ L  +F LA AFVSAER     +      +R SD+   S F++FLW+P ++
Sbjct  7     KCRGLRSVIVLFTNFALAFAFVSAERGFFYSK------ARESDEP-PSFFLDFLWEPDQT  59

Query  578   GYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISK  757
             GY H+WPE E  W+IV+G+++GF GAAFGSVGGVGGGGIFVPMLSL++GFDPKSATA+SK
Sbjct  60    GYHHVWPEFEFNWQIVLGTLVGFFGAAFGSVGGVGGGGIFVPMLSLIIGFDPKSATALSK  119

Query  758   CMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTV  937
             CMI+GA+VS+V+YNL+LRHPTLDMPIIDYDLA+LIQPMLMLGIS+GV FNV+F DWMVTV
Sbjct  120   CMIVGASVSTVYYNLRLRHPTLDMPIIDYDLALLIQPMLMLGISVGVAFNVMFPDWMVTV  179

Query  938   LLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANG-SGGQGEYKLLPGGPGNGTQD  1114
             LLI+LF+GTSTKAFL+G ETW KETI K EAA++L ++G S  + EY  LP  P     +
Sbjct  180   LLIILFLGTSTKAFLKGRETWNKETIEKMEAAKRLESDGVSATEVEYMPLPAAPSTNPGN  239

Query  1115  TAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSL  1294
               K    ++VSIIENVYWKE GLL FVW+ FLALQI K    TCS  YWV+NLLQIPV++
Sbjct  240   NKK----REVSIIENVYWKELGLLVFVWIVFLALQIAKKNMPTCSVGYWVINLLQIPVAV  295

Query  1295  GVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgpl  1474
             GV+ +EA  LY+G R I+S G  GSN   GQLI+YC FG++AGVVGGLLGLGGGFIMGPL
Sbjct  296   GVSGYEAVALYQGRRIIASNGQGGSNFTIGQLILYCSFGVLAGVVGGLLGLGGGFIMGPL  355

Query  1475  flELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVR  1654
             FLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+L  VAT+AA +GQHVVR
Sbjct  356   FLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYLVGVATIAALVGQHVVR  415

Query  1655  RLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             RLIAVLGRASLIIFILA TIF+SAISLGGVGI NM+ K+  HEYMGFENLCKY
Sbjct  416   RLIAVLGRASLIIFILASTIFISAISLGGVGIVNMMGKLQRHEYMGFENLCKY  468



>emb|CDY35338.1| BnaA04g15090D [Brassica napus]
Length=470

 Score =   518 bits (1333),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 329/473 (70%), Positives = 386/473 (82%), Gaps = 12/473 (3%)
 Frame = +2

Query  398   KWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKES  577
             K R LR ++ L  +F LA AFVSAER     +      +R SD+   S F++FLW+P ++
Sbjct  7     KCRGLRSVIVLFTNFALAFAFVSAERGFFYSK------ARESDEP-PSFFLDFLWEPDQT  59

Query  578   GYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISK  757
             GY H+WPE E  W+IV+G+++GF GAAFGSVGGVGGGGIFVPMLSL++GFDPKSATA+SK
Sbjct  60    GYHHVWPEFEFNWQIVLGTLVGFFGAAFGSVGGVGGGGIFVPMLSLIIGFDPKSATALSK  119

Query  758   CMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTV  937
             CMI+GA+VS+V+YNL+LRHPTLDMPIIDYDLA+LIQPMLMLGIS+GV FNV+F DWMVTV
Sbjct  120   CMIVGASVSTVYYNLRLRHPTLDMPIIDYDLALLIQPMLMLGISVGVAFNVMFPDWMVTV  179

Query  938   LLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANG-SGGQGEYKLLPGGPGNGTQD  1114
             LLI+LF+GTSTKAFL+G ETW KETI K EAA++L ++G S  + EY  LP  P     +
Sbjct  180   LLIILFLGTSTKAFLKGRETWNKETIEKMEAAKRLESDGVSATEVEYMPLPAAPNTNPGN  239

Query  1115  TAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSL  1294
               K    ++VSIIENVYWKE GLL FVW+ FLALQI K    TCS  YWV+NLLQIPV++
Sbjct  240   NKK----REVSIIENVYWKELGLLVFVWIVFLALQIAKKNMPTCSVGYWVINLLQIPVAV  295

Query  1295  GVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgpl  1474
             GV+ +EA  LY+G R I+S G  GSN   GQLI+YC FG++AGVVGGLLGLGGGFIMGPL
Sbjct  296   GVSGYEAVALYQGRRIIASNGQGGSNFTIGQLILYCSFGVLAGVVGGLLGLGGGFIMGPL  355

Query  1475  flELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVR  1654
             FLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+L  VAT+AA +GQHVVR
Sbjct  356   FLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYLVGVATIAALVGQHVVR  415

Query  1655  RLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             RLIAVLGRASLIIFILA TIF+SAISLGGVGI NM+ K+  HEYMGFENLCKY
Sbjct  416   RLIAVLGRASLIIFILASTIFISAISLGGVGIVNMMGKLQRHEYMGFENLCKY  468



>ref|XP_009388715.1| PREDICTED: uncharacterized protein LOC103975470 [Musa acuminata 
subsp. malaccensis]
Length=477

 Score =   514 bits (1324),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 317/432 (73%), Positives = 370/432 (86%), Gaps = 3/432 (1%)
 Frame = +2

Query  527   DDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPM  706
              DYL   V+FLWQ   S Y H+WP+M+ GWEIV+GSIIGF+G+AFGSVGGVGGGGI+VPM
Sbjct  48    SDYLLKVVDFLWQSDGSSYQHVWPDMKFGWEIVVGSIIGFLGSAFGSVGGVGGGGIYVPM  107

Query  707   LSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGI  886
             L+L++GFD KS+TAISKCMIMGAA S+V YN+K+RHPTLDMPIIDYDLA+L QPMLMLGI
Sbjct  108   LTLIIGFDAKSSTAISKCMIMGAAGSTVWYNMKMRHPTLDMPIIDYDLALLFQPMLMLGI  167

Query  887   SIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQ  1066
             SIGV FNV+FADWMVT+LLI+LFIGTSTKAFL+GVETWKKETIMKKEAA    +NG   +
Sbjct  168   SIGVIFNVVFADWMVTILLIILFIGTSTKAFLKGVETWKKETIMKKEAAMLKESNGR-EE  226

Query  1067  GEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVK-NYTST  1243
              EY  LP GPG+ T    K +  + V ++ENVYWKE GLLCFVWVSFL LQ++K NYTST
Sbjct  227   VEYSALPSGPGS-TSTKEKAALRRVVPVLENVYWKELGLLCFVWVSFLILQVLKQNYTST  285

Query  1244  CSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiag  1423
             CST YW++N LQIP+SLGV+ +EA  LY+G R ISSKGD G+N    QL+ YC  G++AG
Sbjct  286   CSTWYWILNFLQIPISLGVSGYEAVSLYRGKRVISSKGDEGTNFTVLQLVFYCSIGVLAG  345

Query  1424  vvggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalf  1603
             VVGGLLGLGGGF++GP+FLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+
Sbjct  346   VVGGLLGLGGGFVLGPVFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALY  405

Query  1604  ltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHE  1783
               +VA VAAF+GQ+VV+RLI +LGRASLIIFILAFTIFVSA+SLGGVGISNM++KI +H 
Sbjct  406   FISVALVAAFVGQYVVKRLIDILGRASLIIFILAFTIFVSAVSLGGVGISNMVQKIQHHG  465

Query  1784  YMGFENLCKYGV  1819
             YMGFENLCKY V
Sbjct  466   YMGFENLCKYEV  477



>gb|KDP37239.1| hypothetical protein JCGZ_06295 [Jatropha curcas]
Length=482

 Score =   514 bits (1323),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 328/482 (68%), Positives = 393/482 (82%), Gaps = 6/482 (1%)
 Frame = +2

Query  380   MAGAGGKWRIL--RPLVALSWSFL-LASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFV  550
             MAG   +W  L  R L A+   FL +AS  V AE  L  E +   N S   +  ++   +
Sbjct  1     MAGVRLQWWGLNFRSLGAVFICFLGVASIIVVAETRLNREGLVA-NESEEVESGFMLRVI  59

Query  551   NFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFD  730
             NFLWQ  + GY H+WP+M+ GW IV+G+IIGF GAAFGSVGGVGGGGIFVPML+L++GFD
Sbjct  60    NFLWQEGQLGYTHVWPDMKFGWRIVVGTIIGFFGAAFGSVGGVGGGGIFVPMLTLIIGFD  119

Query  731   PKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNV  910
              KS+TAISK MI GAA S+V+YNL+LRHPTLDMPIIDYDLA+L QP+L+LGISIGV  NV
Sbjct  120   AKSSTAISKFMITGAAASTVYYNLRLRHPTLDMPIIDYDLALLFQPVLVLGISIGVILNV  179

Query  911   IFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANG-SGGQGEYKLLP  1087
             I ADWM+TVLLI+LFIGTSTKAFL+GVETWKKETI+KKEAA++L +NG    + EYKLL 
Sbjct  180   ILADWMITVLLIILFIGTSTKAFLKGVETWKKETIIKKEAARRLLSNGDDNDEVEYKLLA  239

Query  1088  GGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVV  1267
             GG  NG    +KE  E +VS+ ENV W+E G+L  VWV  LALQI KNYTSTCS  YWV+
Sbjct  240   GGSSNGAGPESKEKKE-EVSLFENVQWRELGVLFAVWVIILALQISKNYTSTCSAAYWVL  298

Query  1268  NLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllgl  1447
             N+LQ PV+LGV++++A  LYKG RKI SKG++G+NL+  QL++YC  G++AGVVGGLLGL
Sbjct  299   NILQFPVALGVSVYQAVNLYKGRRKIKSKGEAGTNLKVHQLVLYCCCGVLAGVVGGLLGL  358

Query  1448  gggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatva  1627
             GGGFI+GPLFLELGVP QVSSATATFAM FS+SMSV+EYYLLKRFPVPYAL+  +V+TVA
Sbjct  359   GGGFILGPLFLELGVPAQVSSATATFAMTFSASMSVIEYYLLKRFPVPYALYFVSVSTVA  418

Query  1628  afIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             AF+GQHVVRRLI++LGRAS+IIFILAFTIFVSAISLGGVGI+NM+EKI NH+YMGFENLC
Sbjct  419   AFVGQHVVRRLISILGRASIIIFILAFTIFVSAISLGGVGIANMVEKIENHQYMGFENLC  478

Query  1808  KY  1813
              Y
Sbjct  479   TY  480



>ref|XP_010924740.1| PREDICTED: uncharacterized protein LOC105047500 [Elaeis guineensis]
Length=478

 Score =   513 bits (1322),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 327/480 (68%), Positives = 383/480 (80%), Gaps = 11/480 (2%)
 Frame = +2

Query  392   GGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAG--TNVSRNSDDDYLSTF---VNF  556
             GG+WR +   V  ++ F LASA VSAER  K   + G   +VS + +    S     V F
Sbjct  2     GGRWRRVGTSVVSAFGFFLASAVVSAERGFK---IGGLLDDVSADGETFVFSDLLKVVGF  58

Query  557   LWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPK  736
             LWQ   S Y H+WP ME GW +VIGS+IGF GAAFGSVGGVGGGGIFVPML+L+VGFDPK
Sbjct  59    LWQADGSHYHHVWPPMEFGWRLVIGSLIGFFGAAFGSVGGVGGGGIFVPMLTLIVGFDPK  118

Query  737   SATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIF  916
             S+TA+SKCMIMGAA S+V+YNLKLRHPTLD PIIDYDLA+LIQPMLMLGISIGV FNV+F
Sbjct  119   SSTALSKCMIMGAAGSTVYYNLKLRHPTLDTPIIDYDLALLIQPMLMLGISIGVIFNVVF  178

Query  917   ADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQG-EYKLLPGG  1093
              DWMVT+LLIVLF+GTSTKAFL+G+E+W KET+MKKEAA++   +  G Q  EYK L  G
Sbjct  179   PDWMVTILLIVLFLGTSTKAFLKGLESWNKETVMKKEAAKRSQPSSGGNQEVEYKPLATG  238

Query  1094  PGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNL  1273
             P N  + T   ++E +V +++NV WKE GLL FVW++FL LQI KNYT+ CS  +WV+NL
Sbjct  239   PSNAGEVTV--TAEPEVPVLQNVCWKELGLLVFVWIAFLILQITKNYTAICSIWFWVLNL  296

Query  1274  LQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgg  1453
             LQIPVS+ V L+EA  LY G R I+SKG  G+N +  QL +YC   +IAG+VGGLLGLGG
Sbjct  297   LQIPVSMAVTLYEAISLYNGKRVIASKGHEGTNWKVHQLFIYCSLAVIAGIVGGLLGLGG  356

Query  1454  gfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaaf  1633
             GFI+GPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLL RFPVPYAL+   VA VAAF
Sbjct  357   GFILGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLDRFPVPYALYFITVAAVAAF  416

Query  1634  IGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             +GQHVVRRLI ++GRASLIIFILAFTIFVSAISLGGVGISNMI KI +HEYMGFENLC+Y
Sbjct  417   VGQHVVRRLIILMGRASLIIFILAFTIFVSAISLGGVGISNMIRKIKDHEYMGFENLCRY  476



>gb|EEC84400.1| hypothetical protein OsI_30977 [Oryza sativa Indica Group]
Length=465

 Score =   512 bits (1318),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 317/426 (74%), Positives = 366/426 (86%), Gaps = 4/426 (1%)
 Frame = +2

Query  536   LSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSL  715
             L    NFLWQ   + Y H+WPEMELGW+IV+GS+IGF GAAFGSVGGVGGGGIFVPML+L
Sbjct  42    LRKVANFLWQTDGNSYHHVWPEMELGWQIVLGSLIGFFGAAFGSVGGVGGGGIFVPMLTL  101

Query  716   VVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIG  895
             ++GFDPKS+TAISKCMIMGAAVS+V+YNLKL+HPTLDMP+IDYDLA+LIQPMLMLGISIG
Sbjct  102   IIGFDPKSSTAISKCMIMGAAVSTVYYNLKLKHPTLDMPVIDYDLALLIQPMLMLGISIG  161

Query  896   VTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEY  1075
             V FNV+F DW+VTVLLI+LF+GTSTKAFL+GVETWKKETI+K+EAA++L       + EY
Sbjct  162   VIFNVLFPDWLVTVLLIILFLGTSTKAFLKGVETWKKETIIKREAAKRLEQTSE--EPEY  219

Query  1076  KLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTL  1255
               LP GPG    D AK  S++  S+++N+YWKEFGLL FVW++FL LQ+ KNYT+TCS+ 
Sbjct  220   APLPTGPG-AVAD-AKRPSDEAASLMKNIYWKEFGLLAFVWMAFLVLQVTKNYTATCSSW  277

Query  1256  YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  1435
             YW++NLLQIPVS+GV L+EA GL  G R +SSKG+  + L+  QL +YCFFG+ AGVVGG
Sbjct  278   YWILNLLQIPVSVGVTLYEALGLMSGKRVLSSKGNEQTTLKFHQLCIYCFFGITAGVVGG  337

Query  1436  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  1615
             LLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYAL+   V
Sbjct  338   LLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLNRFPVPYALYFVIV  397

Query  1616  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  1795
             A +AA IGQHVVRRLI  LGRASLIIFILAF IFVSAISLGGVGISNMI KI+ HEYMGF
Sbjct  398   AFIAAIIGQHVVRRLINWLGRASLIIFILAFMIFVSAISLGGVGISNMIHKINQHEYMGF  457

Query  1796  ENLCKY  1813
             ENLCKY
Sbjct  458   ENLCKY  463



>ref|XP_009409060.1| PREDICTED: uncharacterized protein LOC103991359 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=474

 Score =   512 bits (1318),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 322/452 (71%), Positives = 375/452 (83%), Gaps = 10/452 (2%)
 Frame = +2

Query  470   ERSLKNEEVAGTNVSRNSD---DDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSII  640
             +R L+  E AG       +    DY+   VNFLW+P ES Y H+WP M+ GWEIV+G+II
Sbjct  27    DRGLR-PEAAGAEAVETEEVGVSDYVLKVVNFLWRPDESSYQHVWPSMKFGWEIVVGTII  85

Query  641   gfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPT  820
             GF+G+AFGSVGGVGGGGI+VPML+L++GFD KS+TAISKCMIMGAA S+V YNLKLRHPT
Sbjct  86    GFLGSAFGSVGGVGGGGIYVPMLTLIIGFDAKSSTAISKCMIMGAAGSTVWYNLKLRHPT  145

Query  821   LDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETW  1000
             LDMPIIDYDLA+L QPMLMLGISIGV FNV+FADWMVTVLLI+LFIGTSTKAFL+GVETW
Sbjct  146   LDMPIIDYDLALLFQPMLMLGISIGVAFNVLFADWMVTVLLIILFIGTSTKAFLKGVETW  205

Query  1001  KKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFG  1180
             KKETIMKKEAA    +NG   + EYK LP GPG  +    K++  K+  I ENV WKE G
Sbjct  206   KKETIMKKEAAMLKESNGR-DEIEYKALPSGPGGAS----KKALRKEAPITENVCWKELG  260

Query  1181  LLCFVWVSFLALQIVK-NYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKG  1357
             LL FVW+SFL LQ++K NYTSTCS  YW++NLLQ+PVSLGV+ +EA  LY+G R ISSKG
Sbjct  261   LLSFVWISFLILQVLKQNYTSTCSLWYWILNLLQVPVSLGVSGYEAVSLYRGKRIISSKG  320

Query  1358  DSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfammf  1537
               G+N    QL+ YC  G++AGVVGGLLGLGGGFI+GP+FLELGVPPQVSSATATFAM F
Sbjct  321   GDGTNFTVIQLVFYCLIGVLAGVVGGLLGLGGGFILGPVFLELGVPPQVSSATATFAMTF  380

Query  1538  sssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIF  1717
             SSSMSVVEYYLLKRFP+PYAL+  +VA VAAF+GQH+V+RLI +LGRASLIIFILA TIF
Sbjct  381   SSSMSVVEYYLLKRFPIPYALYFVSVALVAAFVGQHLVKRLIEILGRASLIIFILASTIF  440

Query  1718  VSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             +SAISLGGVGISNM++KI +HEYMGFENLCKY
Sbjct  441   ISAISLGGVGISNMVQKIQHHEYMGFENLCKY  472



>ref|XP_009403527.1| PREDICTED: uncharacterized protein LOC103987063 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=475

 Score =   511 bits (1316),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 319/451 (71%), Positives = 378/451 (84%), Gaps = 7/451 (2%)
 Frame = +2

Query  470   ERSLKNEEVAGTNVSRNSD--DDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIg  643
             +R LK EE A   V+       DY+   V+FLWQP +S Y H+WP M+LGW+IV+G+IIG
Sbjct  27    DRGLKPEEAAADVVAVEEVGLSDYVLKVVDFLWQPDKSSYQHVWPPMKLGWQIVVGTIIG  86

Query  644   fmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTL  823
             F+G+AFGSVGGVGGGGI+VPML+L++GFD KS+TA+SKCMIMGAA S+V YNLKLRHPTL
Sbjct  87    FLGSAFGSVGGVGGGGIYVPMLTLIIGFDAKSSTAMSKCMIMGAAGSTVWYNLKLRHPTL  146

Query  824   DMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWK  1003
             DMPIIDYDLA+L QPMLMLGISIGV FNVIFADWMVTVLLI+LFIGTS+KAFL+GVETWK
Sbjct  147   DMPIIDYDLALLFQPMLMLGISIGVAFNVIFADWMVTVLLIILFIGTSSKAFLKGVETWK  206

Query  1004  KETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGL  1183
             KETIMKKEAA    +N    + EY  LP GPGN    ++ ++  K+V ++ENV WKE GL
Sbjct  207   KETIMKKEAAMLKESNAGREEIEYNALPSGPGN----SSTKARRKEVPVMENVCWKELGL  262

Query  1184  LCFVWVSFLALQIVK-NYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGD  1360
             L FVW++FL LQ++K NYTSTCS  YW++NLLQ+PVSLGV+ +EA  LYKG R ISSKG+
Sbjct  263   LSFVWITFLILQVLKQNYTSTCSLWYWILNLLQVPVSLGVSGYEAVSLYKGKRIISSKGE  322

Query  1361  SGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfammfs  1540
              G++     L+ YC  G++AGVVGGLLGLGGGFI+GP+FLELGVPPQVSSATATFAM FS
Sbjct  323   EGTSFTVLHLVFYCCIGILAGVVGGLLGLGGGFILGPVFLELGVPPQVSSATATFAMTFS  382

Query  1541  ssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFV  1720
             SSMSVVEYYLLKRFP+PYAL+  AVA VAA +GQH+V+RLI +LGRASLIIFILAFTIFV
Sbjct  383   SSMSVVEYYLLKRFPIPYALYFVAVALVAALVGQHIVKRLIEILGRASLIIFILAFTIFV  442

Query  1721  SAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             SAISLGGVGISNM++KI +HEYMGF+NLCKY
Sbjct  443   SAISLGGVGISNMVQKIQHHEYMGFDNLCKY  473



>gb|EEE69518.1| hypothetical protein OsJ_28979 [Oryza sativa Japonica Group]
Length=481

 Score =   511 bits (1316),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 315/426 (74%), Positives = 366/426 (86%), Gaps = 4/426 (1%)
 Frame = +2

Query  536   LSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSL  715
             L    NFLWQ   + Y H+WPEMELGW+IV+GS+IGF GAAFGSVGGVGGGGIFVPML+L
Sbjct  58    LRKVANFLWQTDGNSYHHVWPEMELGWQIVLGSLIGFFGAAFGSVGGVGGGGIFVPMLTL  117

Query  716   VVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIG  895
             ++GFDPKS+TAISKCMIMGAAVS+V+YNLKL+HPTLDMP+IDYDLA+LIQPMLMLGISIG
Sbjct  118   IIGFDPKSSTAISKCMIMGAAVSTVYYNLKLKHPTLDMPVIDYDLALLIQPMLMLGISIG  177

Query  896   VTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEY  1075
             V FNV+F DW+VTVLLI+LF+GTSTKAFL+GVETWKKETI+K+EAA++L       + EY
Sbjct  178   VIFNVLFPDWLVTVLLIILFLGTSTKAFLKGVETWKKETIIKREAAKRLEQTSE--EPEY  235

Query  1076  KLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTL  1255
               LP GPG    D AK  S++  S+++N+YWKEFGLL FVW++FL LQ+ KNYT+TCS+ 
Sbjct  236   APLPTGPG-AVAD-AKRPSDEAASLMKNIYWKEFGLLAFVWMAFLVLQVTKNYTATCSSW  293

Query  1256  YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  1435
             YW++NLLQIPVS+GV ++EA GL  G R +SSKG+  + L+  QL +YCFFG+ AGVVGG
Sbjct  294   YWILNLLQIPVSVGVTMYEALGLMSGKRVLSSKGNEQTTLKFHQLCIYCFFGITAGVVGG  353

Query  1436  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  1615
             LLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYAL+   V
Sbjct  354   LLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLNRFPVPYALYFVIV  413

Query  1616  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  1795
             A +AA IGQHVVRRLI  LGRASLIIFILAF IFVSAISLGGVGISNMI +I+ HEYMGF
Sbjct  414   AFIAAIIGQHVVRRLINWLGRASLIIFILAFMIFVSAISLGGVGISNMIHRINQHEYMGF  473

Query  1796  ENLCKY  1813
             ENLCKY
Sbjct  474   ENLCKY  479



>ref|NP_001062933.1| Os09g0344800 [Oryza sativa Japonica Group]
 dbj|BAD29095.1| membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAF24847.1| Os09g0344800 [Oryza sativa Japonica Group]
 dbj|BAG88213.1| unnamed protein product [Oryza sativa Japonica Group]
Length=481

 Score =   511 bits (1316),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 315/426 (74%), Positives = 366/426 (86%), Gaps = 4/426 (1%)
 Frame = +2

Query  536   LSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSL  715
             L    NFLWQ   + Y H+WPEMELGW+IV+GS+IGF GAAFGSVGGVGGGGIFVPML+L
Sbjct  58    LRKVANFLWQTDGNSYHHVWPEMELGWQIVLGSLIGFFGAAFGSVGGVGGGGIFVPMLTL  117

Query  716   VVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIG  895
             ++GFDPKS+TAISKCMIMGAAVS+V+YNLKL+HPTLDMP+IDYDLA+LIQPMLMLGISIG
Sbjct  118   IIGFDPKSSTAISKCMIMGAAVSTVYYNLKLKHPTLDMPVIDYDLALLIQPMLMLGISIG  177

Query  896   VTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEY  1075
             V FNV+F DW+VTVLLI+LF+GTSTKAFL+GVETWKKETI+K+EAA++L       + EY
Sbjct  178   VIFNVLFPDWLVTVLLIILFLGTSTKAFLKGVETWKKETIIKREAAKRLEQTSE--EPEY  235

Query  1076  KLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTL  1255
               LP GPG    D AK  S++  S+++N+YWKEFGLL FVW++FL LQ+ KNYT+TCS+ 
Sbjct  236   APLPTGPG-AVAD-AKRPSDEAASLMKNIYWKEFGLLAFVWMAFLVLQVTKNYTATCSSW  293

Query  1256  YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  1435
             YW++NLLQIPVS+GV ++EA GL  G R +SSKG+  + L+  QL +YCFFG+ AGVVGG
Sbjct  294   YWILNLLQIPVSVGVTMYEALGLMSGKRVLSSKGNEQTTLKFHQLCIYCFFGITAGVVGG  353

Query  1436  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  1615
             LLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYAL+   V
Sbjct  354   LLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLNRFPVPYALYFVIV  413

Query  1616  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  1795
             A +AA IGQHVVRRLI  LGRASLIIFILAF IFVSAISLGGVGISNMI +I+ HEYMGF
Sbjct  414   AFIAAIIGQHVVRRLINWLGRASLIIFILAFMIFVSAISLGGVGISNMIHRINQHEYMGF  473

Query  1796  ENLCKY  1813
             ENLCKY
Sbjct  474   ENLCKY  479



>ref|XP_009403528.1| PREDICTED: uncharacterized protein LOC103987063 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=474

 Score =   509 bits (1312),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 320/451 (71%), Positives = 379/451 (84%), Gaps = 8/451 (2%)
 Frame = +2

Query  470   ERSLKNEEVAGTNVSRNSD--DDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIg  643
             +R LK EE A   V+       DY+   V+FLWQP +S Y H+WP M+LGW+IV+G+IIG
Sbjct  27    DRGLKPEEAAADVVAVEEVGLSDYVLKVVDFLWQPDKSSYQHVWPPMKLGWQIVVGTIIG  86

Query  644   fmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTL  823
             F+G+AFGSVGGVGGGGI+VPML+L++GFD KS+TA+SKCMIMGAA S+V YNLKLRHPTL
Sbjct  87    FLGSAFGSVGGVGGGGIYVPMLTLIIGFDAKSSTAMSKCMIMGAAGSTVWYNLKLRHPTL  146

Query  824   DMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWK  1003
             DMPIIDYDLA+L QPMLMLGISIGV FNVIFADWMVTVLLI+LFIGTS+KAFL+GVETWK
Sbjct  147   DMPIIDYDLALLFQPMLMLGISIGVAFNVIFADWMVTVLLIILFIGTSSKAFLKGVETWK  206

Query  1004  KETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGL  1183
             KETIMKKEAA    +NG   + EY  LP GPGN    ++ ++  K+V ++ENV WKE GL
Sbjct  207   KETIMKKEAAMLKESNGR-EEIEYNALPSGPGN----SSTKARRKEVPVMENVCWKELGL  261

Query  1184  LCFVWVSFLALQIVK-NYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGD  1360
             L FVW++FL LQ++K NYTSTCS  YW++NLLQ+PVSLGV+ +EA  LYKG R ISSKG+
Sbjct  262   LSFVWITFLILQVLKQNYTSTCSLWYWILNLLQVPVSLGVSGYEAVSLYKGKRIISSKGE  321

Query  1361  SGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfammfs  1540
              G++     L+ YC  G++AGVVGGLLGLGGGFI+GP+FLELGVPPQVSSATATFAM FS
Sbjct  322   EGTSFTVLHLVFYCCIGILAGVVGGLLGLGGGFILGPVFLELGVPPQVSSATATFAMTFS  381

Query  1541  ssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFV  1720
             SSMSVVEYYLLKRFP+PYAL+  AVA VAA +GQH+V+RLI +LGRASLIIFILAFTIFV
Sbjct  382   SSMSVVEYYLLKRFPIPYALYFVAVALVAALVGQHIVKRLIEILGRASLIIFILAFTIFV  441

Query  1721  SAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             SAISLGGVGISNM++KI +HEYMGF+NLCKY
Sbjct  442   SAISLGGVGISNMVQKIQHHEYMGFDNLCKY  472



>emb|CDY70121.1| BnaC03g72820D [Brassica napus]
Length=463

 Score =   508 bits (1308),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 324/471 (69%), Positives = 375/471 (80%), Gaps = 19/471 (4%)
 Frame = +2

Query  404   RILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGY  583
             R LR +  L  +  LA AFVSAER LK               D  +   +FLW+  ++GY
Sbjct  9     RGLRSVTVLFLNLALAFAFVSAERILK--------------FDSQTRETSFLWESDQTGY  54

Query  584   DHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCM  763
              H+WPE E  W+IV+G+++GF GAAFGSVGGVGGGGIFVPMLSL++GFDPKSATA+SKCM
Sbjct  55    HHVWPEFEFNWQIVLGTLVGFFGAAFGSVGGVGGGGIFVPMLSLIIGFDPKSATAMSKCM  114

Query  764   IMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLL  943
             IMGA+VS+V+YNL+LRHPTLDMPIIDYDLA+LIQPMLMLGIS+GV FNV+F DWMVTVLL
Sbjct  115   IMGASVSTVYYNLRLRHPTLDMPIIDYDLALLIQPMLMLGISVGVAFNVMFPDWMVTVLL  174

Query  944   IVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANG-SGGQGEYKLLPGGPGNGTQDTA  1120
             I+LF+GTSTKAFL+G ETW KETI K EAA++L +NG S  + EY  LP  P     +  
Sbjct  175   IILFLGTSTKAFLKGCETWNKETIEKMEAAKRLESNGVSATEVEYVPLPAAPSTNNGNNK  234

Query  1121  KESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGV  1300
             K+    QVSIIENVYWKE GLL FVWV FLALQI K   +TCS  YWV+NLLQIPV++GV
Sbjct  235   KQ----QVSIIENVYWKELGLLVFVWVVFLALQIAKQNMATCSIAYWVINLLQIPVAVGV  290

Query  1301  ALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplfl  1480
             + +EA  LY+G R I+S G   SN   GQL++YC FG++AG+VGGLLGLGGGFIMGPLFL
Sbjct  291   SGYEAVALYQGRRIIASNGQGDSNFTVGQLVLYCTFGILAGIVGGLLGLGGGFIMGPLFL  350

Query  1481  ELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRL  1660
             ELGVPPQVSSATATFAM FSSSMSV+EYYLLKRFPVPYAL+L  VATVAA +GQHVVRRL
Sbjct  351   ELGVPPQVSSATATFAMTFSSSMSVIEYYLLKRFPVPYALYLVGVATVAALVGQHVVRRL  410

Query  1661  IAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             IAV+GRASLIIFILA  IF+SAISLGGVGI NMI K   HEYMGFEN+CKY
Sbjct  411   IAVIGRASLIIFILASMIFISAISLGGVGIVNMIGKFQRHEYMGFENICKY  461



>dbj|BAK01650.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=471

 Score =   506 bits (1304),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 313/435 (72%), Positives = 363/435 (83%), Gaps = 4/435 (1%)
 Frame = +2

Query  509   VSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggg  688
             V+   +   L+   NF+WQ   + Y H+WP ME GW++V+GS+IGF GA+FGSVGGVGGG
Sbjct  39    VAAPDEISLLNKIANFMWQTDGNSYQHVWPPMEFGWKMVLGSLIGFFGASFGSVGGVGGG  98

Query  689   gIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQP  868
             GIFVPML+L++GFDPKS+TAISKCMI GAAVS+V+YNLKL+HPTLDMP+IDYDLA+LIQP
Sbjct  99    GIFVPMLTLIIGFDPKSSTAISKCMITGAAVSTVYYNLKLKHPTLDMPVIDYDLALLIQP  158

Query  869   MLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAA  1048
             MLMLGISIGV FNVIF DW+VTVLLIVLF+GTSTKAFL+GVETWKKETI+K+EAA++L  
Sbjct  159   MLMLGISIGVIFNVIFPDWLVTVLLIVLFLGTSTKAFLKGVETWKKETIIKREAAKRLEQ  218

Query  1049  NGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVK  1228
                  + EY  LP GPG    D   +S E   S+++N+YWKEFGLL FVW++FLA+QI K
Sbjct  219   TSE--EPEYAPLPTGPG-AVADVKPQSDEAP-SLMKNIYWKEFGLLTFVWLAFLAIQITK  274

Query  1229  NYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFF  1408
             NY  TCST YWV+N LQIPVS+GV ++EA GL  G R +SSKGD  + L+  QL +YCFF
Sbjct  275   NYAPTCSTWYWVLNFLQIPVSVGVTMYEALGLMNGKRVLSSKGDEQTTLKFHQLCIYCFF  334

Query  1409  gmiagvvggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPV  1588
             G+ AG+VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFS+SMSVVEYYLL RFPV
Sbjct  335   GVTAGLVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSASMSVVEYYLLNRFPV  394

Query  1589  PYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEK  1768
             PYA +  AVA VAA IGQHVVRRLI+ LGRASLIIFILAF IFVSAISLGGVGISNMI K
Sbjct  395   PYAAYFVAVAFVAAIIGQHVVRRLISWLGRASLIIFILAFMIFVSAISLGGVGISNMIHK  454

Query  1769  IHNHEYMGFENLCKY  1813
             I  HEYMGFENLCKY
Sbjct  455   IEQHEYMGFENLCKY  469



>ref|XP_008792340.1| PREDICTED: uncharacterized protein LOC103708984 [Phoenix dactylifera]
Length=478

 Score =   506 bits (1303),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 327/480 (68%), Positives = 385/480 (80%), Gaps = 11/480 (2%)
 Frame = +2

Query  392   GGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAG--TNVSRNSDD---DYLSTFVNF  556
             GG+WR L   V  ++ F LASA VSAER LK   + G   +VS + +     YL   V F
Sbjct  2     GGRWRRLGTWVVGAFGFFLASAVVSAERGLK---IGGLLDDVSADGETFVFSYLLKAVGF  58

Query  557   LWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPK  736
             LWQ   S Y H+WP ME GW +VIGS+IGF GAAFGSVGGVGGGGIFVPML+L+VGFDPK
Sbjct  59    LWQADGSYYHHVWPPMEFGWRLVIGSLIGFFGAAFGSVGGVGGGGIFVPMLTLIVGFDPK  118

Query  737   SATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIF  916
             S+TA+SKCMIMGAA S+V+YNLKLRHPTLD PIIDYDLA+LIQPMLMLGISIGV FNVIF
Sbjct  119   SSTALSKCMIMGAAGSTVYYNLKLRHPTLDAPIIDYDLALLIQPMLMLGISIGVIFNVIF  178

Query  917   ADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQ-GEYKLLPGG  1093
              DWMVT+LLIVLF+GTSTKAF++GVE+WKKET+MKKEAA++   +  G Q  EYK L  G
Sbjct  179   PDWMVTILLIVLFLGTSTKAFMKGVESWKKETVMKKEAAKRSQPSSGGNQEEEYKPLATG  238

Query  1094  PGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNL  1273
             P N  +     ++E +V +++NV WKE GLL FVW+SFL LQI KNYT+ CS  +WV+NL
Sbjct  239   PSNDGEVAV--TAELEVPVLQNVCWKELGLLVFVWISFLILQITKNYTAICSIWFWVLNL  296

Query  1274  LQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgg  1453
             LQIPVS+ V L+EA  LY G R I+S G  G+N +  QL +YC  G++AG+VGGLLGLGG
Sbjct  297   LQIPVSMAVTLYEAISLYNGKRVIASNGHEGTNWKVHQLFIYCSLGVLAGIVGGLLGLGG  356

Query  1454  gfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaaf  1633
             GFI+GPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLL RFPVPYAL+   VA VAA+
Sbjct  357   GFILGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLNRFPVPYALYFVTVAAVAAY  416

Query  1634  IGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             +GQ+VVRRLI ++GRASLIIFILAFTIF+SAISLGGVGISN+I KI +HEYMGFENLC+Y
Sbjct  417   VGQNVVRRLIILMGRASLIIFILAFTIFISAISLGGVGISNIIRKIKHHEYMGFENLCRY  476



>ref|XP_006660551.1| PREDICTED: uncharacterized protein LOC102715329 [Oryza brachyantha]
Length=470

 Score =   505 bits (1301),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 317/435 (73%), Positives = 368/435 (85%), Gaps = 4/435 (1%)
 Frame = +2

Query  509   VSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggg  688
             V+   +   L    NFLWQ   + Y H+WP MELG ++V+G++IGF GAAFGSVGGVGGG
Sbjct  38    VTTPEEMGLLRKVANFLWQTDGNSYHHVWPPMELGCQVVLGTLIGFFGAAFGSVGGVGGG  97

Query  689   gIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQP  868
             GIFVPML+L++GFDPKS+TAISKCMIMGAAVS+V+YNLKL+HPTLDMP+IDYDLA+LIQP
Sbjct  98    GIFVPMLTLIIGFDPKSSTAISKCMIMGAAVSTVYYNLKLKHPTLDMPVIDYDLALLIQP  157

Query  869   MLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAA  1048
             MLMLGISIGV FNVIF DWMVTVLLI+LF+GTSTKAF++GVETWKKETI+K+EAA++L  
Sbjct  158   MLMLGISIGVIFNVIFPDWMVTVLLIILFLGTSTKAFMKGVETWKKETIIKREAAKRL--  215

Query  1049  NGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVK  1228
               +  + EY+ LP GPG    DT K  S++  S+++N+YWKEFGLL FVW+SFL LQ+ K
Sbjct  216   EQASEEPEYEPLPTGPG-AAADT-KMPSDEAASLMKNIYWKEFGLLTFVWISFLVLQVTK  273

Query  1229  NYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFF  1408
             NYT+TCS+ YW++NLLQIPVS+GV L+EA GL  G R +SSKG   + L+  QL +YCFF
Sbjct  274   NYTATCSSWYWILNLLQIPVSVGVTLYEALGLMSGKRVLSSKGTEQTTLKFHQLCIYCFF  333

Query  1409  gmiagvvggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPV  1588
             G+ AGVVGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLL RFPV
Sbjct  334   GITAGVVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLNRFPV  393

Query  1589  PYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEK  1768
             PYAL+  AVA +AA IGQHVVRRLI  LGRASLIIFILAF IFVSAISLGGVGISNMI K
Sbjct  394   PYALYFVAVAFIAAIIGQHVVRRLINWLGRASLIIFILAFMIFVSAISLGGVGISNMIHK  453

Query  1769  IHNHEYMGFENLCKY  1813
             I  HEYMGFENLCKY
Sbjct  454   IQQHEYMGFENLCKY  468



>ref|XP_009381051.1| PREDICTED: uncharacterized protein LOC103969282 [Musa acuminata 
subsp. malaccensis]
Length=475

 Score =   504 bits (1297),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 316/430 (73%), Positives = 368/430 (86%), Gaps = 6/430 (1%)
 Frame = +2

Query  527   DDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPM  706
              DY+   V+FLW+P ES Y H+WP M+ GWEIV+GSIIGF+G+AFGSVGGVGGGGI+VPM
Sbjct  49    SDYVLKVVDFLWRPDESSYRHVWPPMKFGWEIVVGSIIGFLGSAFGSVGGVGGGGIYVPM  108

Query  707   LSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGI  886
             L+L++GFD KS+TAISKCMIMGAA S+V YNLKLRHPTLDMPIIDYDLA+L QPMLMLGI
Sbjct  109   LTLIIGFDAKSSTAISKCMIMGAAGSTVWYNLKLRHPTLDMPIIDYDLALLFQPMLMLGI  168

Query  887   SIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQ  1066
             SIGV FNVIFADWMVTVLLI+LF+ TSTKAFL+GVETW KETIMKKEAA    +NG   +
Sbjct  169   SIGVAFNVIFADWMVTVLLIILFLTTSTKAFLKGVETWNKETIMKKEAAMLKESNGR-DE  227

Query  1067  GEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVK-NYTST  1243
              EYK+LP GP N +    K++  K+  I+ENVYWKE GLL FVW++FL LQ++K NYTST
Sbjct  228   IEYKVLPSGPENAS----KKALRKEAPIMENVYWKELGLLSFVWIAFLILQVLKQNYTST  283

Query  1244  CSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiag  1423
             CS  YW++N LQ+PVSLGV+ +EA  LY+G R ISSKG+ G+N    QL+ YC  G++AG
Sbjct  284   CSPWYWILNFLQVPVSLGVSGYEAVSLYRGKRIISSKGEKGTNFTVVQLVFYCLIGVLAG  343

Query  1424  vvggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalf  1603
             +VGGLLGLGGGFI+GP+FLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+
Sbjct  344   MVGGLLGLGGGFILGPVFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALY  403

Query  1604  ltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHE  1783
             L AVA VAA +GQHVV+RLI +LGRASLIIFILA TIFVSAISLGGVGISNM++KI +HE
Sbjct  404   LVAVALVAAIVGQHVVKRLIEILGRASLIIFILASTIFVSAISLGGVGISNMVQKIQHHE  463

Query  1784  YMGFENLCKY  1813
             YMGFENLCKY
Sbjct  464   YMGFENLCKY  473



>ref|XP_002324817.1| hypothetical protein POPTR_0018s00760g [Populus trichocarpa]
 gb|EEF03382.1| hypothetical protein POPTR_0018s00760g [Populus trichocarpa]
Length=474

 Score =   503 bits (1296),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 310/478 (65%), Positives = 390/478 (82%), Gaps = 7/478 (1%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             MA  G K+  LRP   L ++F+LASAF+SAERS+K+  V+  + +   + +YL   ++FL
Sbjct  1     MAFLGAKFLSLRPAAILFFTFMLASAFISAERSIKHG-VSRLSEAEELEPNYLVKIISFL  59

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             WQ  ESGY H+WPE+   W+ VIG+IIGF GAAFGSVGGVGGGGIFVPML+L++GFDPKS
Sbjct  60    WQSDESGYQHVWPELSFNWQAVIGTIIGFFGAAFGSVGGVGGGGIFVPMLTLIIGFDPKS  119

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             ATAISKCMIMGAAVS+V++NL+LRHPTLD+P+IDYDL +LIQPMLMLGISIGVTFNVIF 
Sbjct  120   ATAISKCMIMGAAVSTVYHNLRLRHPTLDLPVIDYDLVLLIQPMLMLGISIGVTFNVIFP  179

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPG  1099
             DW++TV LI+L IGTS KAF +G++TWK ETI+K+ AA++  + G   + EYK LP G G
Sbjct  180   DWVITVTLIILCIGTSVKAFFKGLDTWKIETILKEVAAKRFESTGGSEEVEYKPLPDGQG  239

Query  1100  NGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQ  1279
             N   D  K S   +V+I++N+YWKE GLL FVWVS+LA+QI KNYT+ CST +WV+NLLQ
Sbjct  240   N---DPPKAS---KVTILQNIYWKELGLLVFVWVSYLAVQIAKNYTAPCSTTFWVLNLLQ  293

Query  1280  IPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggf  1459
             IP+S+GV L+EA GLYKG R+ISSKGD   + +  +L+++   G++AG+VGGLLG+GGGF
Sbjct  294   IPISIGVFLYEAIGLYKGRRRISSKGDEIMDWQVHRLLMFSVCGVVAGIVGGLLGIGGGF  353

Query  1460  imgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIG  1639
             +MGPLFLE+G+PPQVSS TATF M+FSSSMSVVEYYLL RFPVPYAL+  AVA +AAFIG
Sbjct  354   VMGPLFLEMGIPPQVSSGTATFGMLFSSSMSVVEYYLLDRFPVPYALYFIAVAVIAAFIG  413

Query  1640  QHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             Q+++ +LI + GRASLIIF+LAFTIF+SAI+LGGVGI+  I  +  HEYMGFENLCKY
Sbjct  414   QNIITKLITISGRASLIIFVLAFTIFISAIALGGVGITRTIGMVERHEYMGFENLCKY  471



>ref|XP_011001598.1| PREDICTED: uncharacterized protein LOC105108832 isoform X1 [Populus 
euphratica]
Length=489

 Score =   503 bits (1295),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 315/464 (68%), Positives = 380/464 (82%), Gaps = 5/464 (1%)
 Frame = +2

Query  437   SFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGW  616
             S  +AS    AE  L+ +  +    S   +   L   +NFLWQ    GY H+WP+M+ GW
Sbjct  24    SLGMASMVAIAEARLRKQVSSVHGSSPQVEAGLLMRVLNFLWQKGLYGYTHVWPDMKFGW  83

Query  617   EIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHY  796
              IV+G+IIGF GAA GSVGGVGGGGIFVPML+L++GFD KS+TAISKCMI GAA S+V+Y
Sbjct  84    RIVVGTIIGFFGAALGSVGGVGGGGIFVPMLTLIIGFDAKSSTAISKCMITGAAASTVYY  143

Query  797   NLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKA  976
             NLK RHPTLD+P+IDYDLA+L QPML+LGISIGV FNVIFADWM+TVLLI+LFIGTSTKA
Sbjct  144   NLKRRHPTLDLPVIDYDLALLFQPMLVLGISIGVAFNVIFADWMITVLLIILFIGTSTKA  203

Query  977   FLRGVETWKKETIMKKEAAQQLAANGS-----GGQGEYKLLPGGPGNGTQDTAKESSEKQ  1141
             FL+GVETWKKET++K+EAA++L +NG+       + EYK LPGGP    +   K   +++
Sbjct  204   FLKGVETWKKETLLKQEAARRLESNGNLDDDDNEEVEYKPLPGGPSGEGEAENKGPKKEE  263

Query  1142  VSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATG  1321
             VSI+ENVYWKE GLL  VW + LAL+I KNYT+TCS  YW +NLLQIPV++GV+ +EA  
Sbjct  264   VSIMENVYWKELGLLFAVWCAILALEIAKNYTTTCSMAYWALNLLQIPVAVGVSSYEAVS  323

Query  1322  LYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQ  1501
             LYKG RKI+SKG++G+N RA QL++YC  G++AG+VGGLLGLGGGFI+GPLFL+LG+PPQ
Sbjct  324   LYKGRRKIASKGETGTNWRAHQLVLYCACGVLAGMVGGLLGLGGGFILGPLFLDLGIPPQ  383

Query  1502  VssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRA  1681
             VSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+  AVATVAAF+GQ VVR+LI +LGRA
Sbjct  384   VSSATATFAMTFSASMSVVEYYLLKRFPVPYALYFVAVATVAAFVGQFVVRKLINLLGRA  443

Query  1682  SLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             SLIIFIL+FTIFVSAISLGGVGI NMIEKI +HEYMGFEN+C Y
Sbjct  444   SLIIFILSFTIFVSAISLGGVGIENMIEKIEHHEYMGFENICSY  487



>ref|XP_011001600.1| PREDICTED: uncharacterized protein LOC105108832 isoform X2 [Populus 
euphratica]
Length=485

 Score =   503 bits (1294),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 314/460 (68%), Positives = 378/460 (82%), Gaps = 1/460 (0%)
 Frame = +2

Query  437   SFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGW  616
             S  +AS    AE  L+ +  +    S   +   L   +NFLWQ    GY H+WP+M+ GW
Sbjct  24    SLGMASMVAIAEARLRKQVSSVHGSSPQVEAGLLMRVLNFLWQKGLYGYTHVWPDMKFGW  83

Query  617   EIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHY  796
              IV+G+IIGF GAA GSVGGVGGGGIFVPML+L++GFD KS+TAISKCMI GAA S+V+Y
Sbjct  84    RIVVGTIIGFFGAALGSVGGVGGGGIFVPMLTLIIGFDAKSSTAISKCMITGAAASTVYY  143

Query  797   NLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKA  976
             NLK RHPTLD+P+IDYDLA+L QPML+LGISIGV FNVIFADWM+TVLLI+LFIGTSTKA
Sbjct  144   NLKRRHPTLDLPVIDYDLALLFQPMLVLGISIGVAFNVIFADWMITVLLIILFIGTSTKA  203

Query  977   FLRGVETWKKETIMKKEAAQQLAANGSGGQG-EYKLLPGGPGNGTQDTAKESSEKQVSII  1153
             FL+GVETWKKET++K+EAA++L +N    +  EYK LPGGP    +   K   +++VSI+
Sbjct  204   FLKGVETWKKETLLKQEAARRLESNDDDNEEVEYKPLPGGPSGEGEAENKGPKKEEVSIM  263

Query  1154  ENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKG  1333
             ENVYWKE GLL  VW + LAL+I KNYT+TCS  YW +NLLQIPV++GV+ +EA  LYKG
Sbjct  264   ENVYWKELGLLFAVWCAILALEIAKNYTTTCSMAYWALNLLQIPVAVGVSSYEAVSLYKG  323

Query  1334  WRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssa  1513
              RKI+SKG++G+N RA QL++YC  G++AG+VGGLLGLGGGFI+GPLFL+LG+PPQVSSA
Sbjct  324   RRKIASKGETGTNWRAHQLVLYCACGVLAGMVGGLLGLGGGFILGPLFLDLGIPPQVSSA  383

Query  1514  tatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLII  1693
             TATFAM FS+SMSVVEYYLLKRFPVPYAL+  AVATVAAF+GQ VVR+LI +LGRASLII
Sbjct  384   TATFAMTFSASMSVVEYYLLKRFPVPYALYFVAVATVAAFVGQFVVRKLINLLGRASLII  443

Query  1694  FILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             FIL+FTIFVSAISLGGVGI NMIEKI +HEYMGFEN+C Y
Sbjct  444   FILSFTIFVSAISLGGVGIENMIEKIEHHEYMGFENICSY  483



>ref|XP_009409059.1| PREDICTED: uncharacterized protein LOC103991359 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=499

 Score =   503 bits (1294),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 323/476 (68%), Positives = 376/476 (79%), Gaps = 33/476 (7%)
 Frame = +2

Query  470   ERSLKNEEVAGTNVSRNSD---DDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSII  640
             +R L+  E AG       +    DY+   VNFLW+P ES Y H+WP M+ GWEIV+G+II
Sbjct  27    DRGLR-PEAAGAEAVETEEVGVSDYVLKVVNFLWRPDESSYQHVWPSMKFGWEIVVGTII  85

Query  641   gfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPT  820
             GF+G+AFGSVGGVGGGGI+VPML+L++GFD KS+TAISKCMIMGAA S+V YNLKLRHPT
Sbjct  86    GFLGSAFGSVGGVGGGGIYVPMLTLIIGFDAKSSTAISKCMIMGAAGSTVWYNLKLRHPT  145

Query  821   LDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETW  1000
             LDMPIIDYDLA+L QPMLMLGISIGV FNV+FADWMVTVLLI+LFIGTSTKAFL+GVETW
Sbjct  146   LDMPIIDYDLALLFQPMLMLGISIGVAFNVLFADWMVTVLLIILFIGTSTKAFLKGVETW  205

Query  1001  KKETIMKKEAAQQLAANG----------------------SGGQG--EYKLLPGGPGNGT  1108
             KKETIMKKEAA    +NG                        G+   EYK LP GPG  +
Sbjct  206   KKETIMKKEAAMLKESNGMLINYLLKYTKFIGTNCSSMSCHAGRDEIEYKALPSGPGGAS  265

Query  1109  QDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVK-NYTSTCSTLYWVVNLLQIP  1285
                 K++  K+  I ENV WKE GLL FVW+SFL LQ++K NYTSTCS  YW++NLLQ+P
Sbjct  266   ----KKALRKEAPITENVCWKELGLLSFVWISFLILQVLKQNYTSTCSLWYWILNLLQVP  321

Query  1286  VSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfim  1465
             VSLGV+ +EA  LY+G R ISSKG  G+N    QL+ YC  G++AGVVGGLLGLGGGFI+
Sbjct  322   VSLGVSGYEAVSLYRGKRIISSKGGDGTNFTVIQLVFYCLIGVLAGVVGGLLGLGGGFIL  381

Query  1466  gplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQH  1645
             GP+FLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+  +VA VAAF+GQH
Sbjct  382   GPVFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYFVSVALVAAFVGQH  441

Query  1646  VVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             +V+RLI +LGRASLIIFILA TIF+SAISLGGVGISNM++KI +HEYMGFENLCKY
Sbjct  442   LVKRLIEILGRASLIIFILASTIFISAISLGGVGISNMVQKIQHHEYMGFENLCKY  497



>ref|XP_003578003.1| PREDICTED: uncharacterized protein LOC100827421 [Brachypodium 
distachyon]
Length=469

 Score =   501 bits (1290),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 308/442 (70%), Positives = 367/442 (83%), Gaps = 5/442 (1%)
 Frame = +2

Query  488   EEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgs  667
              + A T V +  +   L+   NFLWQ   + Y H+WP ME GW++V+G++IGF GA+FGS
Sbjct  31    SQAAATEV-QPEEISLLNKIANFLWQSDGNSYHHVWPPMEFGWKVVLGTLIGFFGASFGS  89

Query  668   vggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYD  847
             VGGVGGGGIFVPML+L++GFDPKS+TAISKCMI GAAVS+V+YNLKL+HPTLDMP+IDYD
Sbjct  90    VGGVGGGGIFVPMLTLIIGFDPKSSTAISKCMITGAAVSTVYYNLKLKHPTLDMPVIDYD  149

Query  848   LAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKE  1027
             LA+LIQPMLMLGISIGV FNVIF DW+VTVLLI+LF+GTSTKAFL+G+ETWKKETI+K+E
Sbjct  150   LALLIQPMLMLGISIGVIFNVIFPDWLVTVLLIILFLGTSTKAFLKGLETWKKETILKRE  209

Query  1028  AAQQLAANGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSF  1207
             AA++L       + EY  LP GPG       K  S++  S+++N+YW+EFGLL  VW+SF
Sbjct  210   AAKRLEQTSE--EPEYAPLPTGPGAAAD--VKIPSDEAPSLMKNIYWREFGLLTLVWLSF  265

Query  1208  LALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQ  1387
             LA+QI KNYTSTCST YW++N LQIPVS+GV L+EA GL  G R +SSKG   + L+  Q
Sbjct  266   LAIQITKNYTSTCSTWYWILNFLQIPVSVGVTLYEALGLMNGKRVLSSKGGEQTTLKFHQ  325

Query  1388  LIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYY  1567
             L +YCFFG+ AG+VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFS+SMSVVEYY
Sbjct  326   LCIYCFFGVTAGLVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSASMSVVEYY  385

Query  1568  LLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVG  1747
             LL RFPVPYA++  AVA +AA IGQH VR+LI+ LGRASLIIFILAF IFVSAISLGGVG
Sbjct  386   LLNRFPVPYAVYFVAVAFIAAIIGQHAVRKLISWLGRASLIIFILAFMIFVSAISLGGVG  445

Query  1748  ISNMIEKIHNHEYMGFENLCKY  1813
             +SNMI+KI  HEYMGFENLCKY
Sbjct  446   VSNMIQKIQRHEYMGFENLCKY  467



>ref|XP_008466240.1| PREDICTED: uncharacterized protein LOC103503714 [Cucumis melo]
 ref|XP_008466242.1| PREDICTED: uncharacterized protein LOC103503714 [Cucumis melo]
Length=471

 Score =   494 bits (1273),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 311/476 (65%), Positives = 377/476 (79%), Gaps = 10/476 (2%)
 Frame = +2

Query  386   GAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQ  565
             G GG     R ++   ++F +  A VS ER +K E         + D +     +NFLWQ
Sbjct  4     GFGGICAGFRSMMLTMFNFAVVLALVSGERKMKLE-------GSSEDLNLFRGALNFLWQ  56

Query  566   PKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSAT  745
               ++GY H+WPEM  GW+IV+GS+IGFMGAAFGSVGGVGGGGI+VPMLSL++GFDPKS+T
Sbjct  57    SDKTGYHHVWPEMVFGWQIVVGSVIGFMGAAFGSVGGVGGGGIYVPMLSLIIGFDPKSST  116

Query  746   AISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADW  925
             AISKCMIMGAA S+V+YNLKLRHPTL++PIIDYDL +LI PMLMLGISIGV FNVIFADW
Sbjct  117   AISKCMIMGAAASTVYYNLKLRHPTLELPIIDYDLVLLIMPMLMLGISIGVVFNVIFADW  176

Query  926   MVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNG  1105
             MVTVLLIVLF+ TSTK+FL+GVETWKKETIMK EAA++  +N       Y  LP GP   
Sbjct  177   MVTVLLIVLFLATSTKSFLKGVETWKKETIMKTEAARRAESNDIQADTAYAPLPSGP---  233

Query  1106  TQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIP  1285
             +Q     +++++V I+ENVYWKE GLL  VW +FLA+QI K ++  CS  YW++N LQIP
Sbjct  234   SQRPETNNTDQEVPILENVYWKETGLLFLVWFAFLAIQIAKKHSPNCSWEYWLLNFLQIP  293

Query  1286  VSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfim  1465
             ++ GV+ +EA  LYKG RKI+S G+  ++ R  QL++YCF G+IAGVVGGLLGLGGGFIM
Sbjct  294   IAFGVSGYEAVSLYKGKRKIASLGNQKTDFRIYQLVLYCFLGIIAGVVGGLLGLGGGFIM  353

Query  1466  gplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQH  1645
             GPLFLELG+PPQVSSA+ATF M FSSSMSV++YYLL RFPVPYAL+ T VA VAAF+GQH
Sbjct  354   GPLFLELGIPPQVSSASATFGMTFSSSMSVIQYYLLNRFPVPYALYFTIVAAVAAFVGQH  413

Query  1646  VVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             V+RRLI ++GRASLIIFIL+FTIFVSA+SLGGVGIS MI +I  HEYMGFENLCKY
Sbjct  414   VIRRLINLIGRASLIIFILSFTIFVSALSLGGVGISKMIRQIQRHEYMGFENLCKY  469



>ref|XP_006660104.1| PREDICTED: uncharacterized protein LOC102707608 [Oryza brachyantha]
Length=446

 Score =   493 bits (1269),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 312/430 (73%), Positives = 362/430 (84%), Gaps = 5/430 (1%)
 Frame = +2

Query  530   DYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPML  709
              YL    +FLW   E+ Y H+WP MELGW+I++G++IGF GAAFGSVGGVGGGGIFVPML
Sbjct  22    SYLRKVASFLWS-GETAYQHVWPPMELGWQIILGTLIGFFGAAFGSVGGVGGGGIFVPML  80

Query  710   SLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGIS  889
             +L++GFD KS+TAISKCMIMGAAVS+V+YNLKL+HPTLDMPIIDYDLAVLIQPMLMLGIS
Sbjct  81    TLIIGFDAKSSTAISKCMIMGAAVSTVYYNLKLKHPTLDMPIIDYDLAVLIQPMLMLGIS  140

Query  890   IGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQG  1069
             IGV FNVIF DW+VTVLLI+LF+GTS KAFLRG++TWKKETI+++EAA++L    +  + 
Sbjct  141   IGVIFNVIFPDWLVTVLLIILFLGTSIKAFLRGIDTWKKETILQREAAKRL--EHTSEEP  198

Query  1070  EYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCS  1249
             EY  LP GP   T ++ K S E + SI +NVYWKEFGLL FVWV+FL LQ+ KNY  TCS
Sbjct  199   EYTPLPTGPA-ATAESKKPSDEAE-SIWQNVYWKEFGLLAFVWVAFLVLQVTKNYMPTCS  256

Query  1250  TLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvv  1429
             T YWV+N+LQIPVS+GV ++E  GL +G R ISSKG   +NL+  QL+VYCFFGM+AGVV
Sbjct  257   TWYWVLNILQIPVSIGVTMYEGLGLMQGRRVISSKGTEQTNLKFHQLLVYCFFGMMAGVV  316

Query  1430  ggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalflt  1609
             GGLLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYALF T
Sbjct  317   GGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLNRFPVPYALFFT  376

Query  1610  avatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYM  1789
               A  AA +GQHVVR+LI  LGRASLIIFIL+F IFVSAISLGGVGISNM+ KI  HEYM
Sbjct  377   VTAFFAAIVGQHVVRKLINWLGRASLIIFILSFMIFVSAISLGGVGISNMVGKISRHEYM  436

Query  1790  GFENLCKYGV  1819
             GF+N+C Y V
Sbjct  437   GFDNICNYDV  446



>ref|XP_002303288.2| hypothetical protein POPTR_0003s05180g [Populus trichocarpa]
 gb|EEE78267.2| hypothetical protein POPTR_0003s05180g [Populus trichocarpa]
Length=485

 Score =   494 bits (1272),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 324/479 (68%), Positives = 386/479 (81%), Gaps = 5/479 (1%)
 Frame = +2

Query  392   GGKWR--ILRPL--VALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             G KWR   LR +    L  S  +AS    AE  L+ +      +S   +       +NFL
Sbjct  5     GSKWRGLSLRMIGGATLIVSLGIASMVAIAEARLRKQVSTVHGISPQVEPGLFMRVLNFL  64

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             WQ    GY H+WP+M+ GW+IV+G+IIGF GAA GSVGGVGGGGIFVPML+L++GFD KS
Sbjct  65    WQKGLYGYTHVWPDMKFGWKIVVGTIIGFFGAALGSVGGVGGGGIFVPMLTLIIGFDAKS  124

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             +TAISKCMI GAA S+V+YNLKLRHPTLDMP+IDYDLA+L QPML+LGISIGV FNVIFA
Sbjct  125   STAISKCMITGAAASTVYYNLKLRHPTLDMPVIDYDLALLFQPMLVLGISIGVAFNVIFA  184

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQG-EYKLLPGGP  1096
             DWM+TVLLI+LFIGTSTKAFL+GVETWKKETI+K+EAA++L +N    +  EY+ LPGGP
Sbjct  185   DWMITVLLIILFIGTSTKAFLKGVETWKKETILKQEAARRLESNDDDNEEVEYQPLPGGP  244

Query  1097  GNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLL  1276
               G     KE  ++ VSIIENVYWKE GLL  VW + LAL+I KNYT+TCS  YW +NLL
Sbjct  245   SGGGGAENKEPKKEAVSIIENVYWKELGLLFAVWGAILALEIGKNYTTTCSMAYWALNLL  304

Query  1277  QIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglggg  1456
             QIPV++GV+ +EA  LYKG RKI+SKG++G+N RA QL++YC  G++AG+VGGLLGLGGG
Sbjct  305   QIPVAVGVSSYEAVSLYKGTRKIASKGETGTNWRAHQLVLYCACGVLAGIVGGLLGLGGG  364

Query  1457  fimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafI  1636
             FI+GPLFLELG+ PQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+  AVATV+AF+
Sbjct  365   FILGPLFLELGISPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYFVAVATVSAFV  424

Query  1637  GQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             GQ VVR+LI +LGRASLIIFILAFTIFVSAISLGGVGI NMIEKI +H+YMGFEN+C Y
Sbjct  425   GQFVVRKLINLLGRASLIIFILAFTIFVSAISLGGVGIVNMIEKIEHHDYMGFENICSY  483



>ref|NP_001061719.1| Os08g0389700 [Oryza sativa Japonica Group]
 dbj|BAD05341.1| membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAD05726.1| membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAF23633.1| Os08g0389700 [Oryza sativa Japonica Group]
Length=465

 Score =   493 bits (1270),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 314/437 (72%), Positives = 366/437 (84%), Gaps = 5/437 (1%)
 Frame = +2

Query  509   VSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggg  688
             V+   +  Y+   VNFLW   E+ Y H+WP ME GW+IV+G +IGF GAAFGSVGGVGGG
Sbjct  34    VAAPEEVGYMRKVVNFLWS-GEASYHHVWPPMEFGWKIVLGILIGFFGAAFGSVGGVGGG  92

Query  689   gIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQP  868
             GIFVPML+L++GFD KS+TAISKCMIMGAAVS+V+YNLKL+HPTLDMP+IDYDLA+LIQP
Sbjct  93    GIFVPMLTLIIGFDAKSSTAISKCMIMGAAVSTVYYNLKLKHPTLDMPVIDYDLALLIQP  152

Query  869   MLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAA  1048
             MLMLGISIGV FNVIF DW++TVLLI+LF+GTSTKAFL+GVETWKKETI+K+EAA++L  
Sbjct  153   MLMLGISIGVLFNVIFPDWLITVLLIILFLGTSTKAFLKGVETWKKETILKREAAKRLEQ  212

Query  1049  NGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVK  1228
                  + EY  LP GP N T ++ K  S++  S+ +NVYWKEFGLL FVW++FL LQ+ K
Sbjct  213   IAE--EPEYSPLPTGP-NATAES-KAPSDEAASLWQNVYWKEFGLLAFVWIAFLVLQVTK  268

Query  1229  NYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFF  1408
             NY  TCST YWV+N LQIPVS+GV ++E  GL +G R ISSKGD  +NL+  QL+VYCFF
Sbjct  269   NYMPTCSTWYWVLNFLQIPVSVGVTMYEGLGLMQGRRVISSKGDEQTNLKFHQLLVYCFF  328

Query  1409  gmiagvvggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPV  1588
             GM+AGVVGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLL RFPV
Sbjct  329   GMMAGVVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLDRFPV  388

Query  1589  PYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEK  1768
             PYALF T VA  AA IGQH+VR+LI  LGRASLIIFIL+F IF+SAISLGGVGISNMI K
Sbjct  389   PYALFFTVVAFFAAIIGQHIVRKLINWLGRASLIIFILSFMIFISAISLGGVGISNMIGK  448

Query  1769  IHNHEYMGFENLCKYGV  1819
             I  HEYMGF+N+C Y V
Sbjct  449   IARHEYMGFDNICNYDV  465



>ref|XP_004136295.1| PREDICTED: uncharacterized protein LOC101214783 [Cucumis sativus]
 gb|KGN60205.1| hypothetical protein Csa_3G889130 [Cucumis sativus]
Length=471

 Score =   493 bits (1269),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 308/476 (65%), Positives = 377/476 (79%), Gaps = 10/476 (2%)
 Frame = +2

Query  386   GAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQ  565
             G GG     R +    ++F +  A VS ER +K E         + D +     +NFLWQ
Sbjct  4     GFGGICAGFRSMALTMFNFAVVLALVSGERKMKLE-------GSSEDLNLFQGALNFLWQ  56

Query  566   PKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSAT  745
               ++GY H+WPEM  GW+IV+GS+IGFMGAAFGSVGGVGGGGI+VPMLSL++GFDPKS+T
Sbjct  57    SDKTGYHHVWPEMAFGWQIVVGSVIGFMGAAFGSVGGVGGGGIYVPMLSLIIGFDPKSST  116

Query  746   AISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADW  925
             AISKCMIMGAA S+V+YNLKLRHPTL++PIIDYDL +LI PMLMLGIS+GV FNVIFADW
Sbjct  117   AISKCMIMGAAASTVYYNLKLRHPTLELPIIDYDLVLLIMPMLMLGISVGVVFNVIFADW  176

Query  926   MVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNG  1105
             MVTVLLIVLF+ TSTK+FL+GVETWKKETIMK EAA++  +N       Y  LP GP + 
Sbjct  177   MVTVLLIVLFLATSTKSFLKGVETWKKETIMKTEAARRAESNDIQADTAYAPLPSGPSHR  236

Query  1106  TQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIP  1285
              +     +++++V I+ENVYWKE GLL  VW +FLA+QI K ++  CS  YW++N LQ+P
Sbjct  237   PET---NNTDREVPILENVYWKEMGLLLLVWFAFLAIQITKKHSPNCSWEYWLLNFLQVP  293

Query  1286  VSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfim  1465
             ++ GV+ +EA GLYKG RKI+S G+  ++ R  QL++YCF G+IAGVVGGLLGLGGGFIM
Sbjct  294   IAFGVSGYEAVGLYKGKRKIASLGNQKTDFRIYQLVLYCFMGIIAGVVGGLLGLGGGFIM  353

Query  1466  gplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQH  1645
             GPLFLELG+PPQVSSA+ATF M FSSSMSV++YYLL RFPVPYAL+ T VA VAAF+GQH
Sbjct  354   GPLFLELGIPPQVSSASATFGMTFSSSMSVIQYYLLNRFPVPYALYFTIVAAVAAFVGQH  413

Query  1646  VVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             V+R+LI ++GRASLIIFIL+FTIFVSA+SLGGVGIS MI +I  HEYMGFENLCKY
Sbjct  414   VIRKLILLIGRASLIIFILSFTIFVSALSLGGVGISKMIGQIQRHEYMGFENLCKY  469



>gb|EEC83519.1| hypothetical protein OsI_29108 [Oryza sativa Indica Group]
Length=466

 Score =   493 bits (1268),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 313/437 (72%), Positives = 366/437 (84%), Gaps = 5/437 (1%)
 Frame = +2

Query  509   VSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggg  688
             V+   +  Y+   VNFLW   E+ Y H+WP ME GW+I++G +IGF GAAFGSVGGVGGG
Sbjct  35    VAAPEEVGYMRKVVNFLWS-GEASYHHVWPPMEFGWKIILGILIGFFGAAFGSVGGVGGG  93

Query  689   gIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQP  868
             GIFVPML+L++GFD KS+TAISKCMIMGAAVS+V+YNLKL+HPTLDMP+IDYDLA+LIQP
Sbjct  94    GIFVPMLTLIIGFDAKSSTAISKCMIMGAAVSTVYYNLKLKHPTLDMPVIDYDLALLIQP  153

Query  869   MLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAA  1048
             MLMLGISIGV FNVIF DW++TVLLI+LF+GTSTKAFL+GVETWKKETI+K+EAA++L  
Sbjct  154   MLMLGISIGVLFNVIFPDWLITVLLIILFLGTSTKAFLKGVETWKKETIIKREAAKRLEQ  213

Query  1049  NGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVK  1228
                  + EY  LP GP N T ++ K  S++  S+ +NVYWKEFGLL FVW++FL LQ+ K
Sbjct  214   ITE--EPEYSPLPTGP-NATAES-KAPSDEAASLWQNVYWKEFGLLAFVWIAFLVLQVTK  269

Query  1229  NYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFF  1408
             NY  TCST YWV+N LQIPVS+GV ++E  GL +G R ISSKGD  +NL+  QL+VYCFF
Sbjct  270   NYMPTCSTWYWVLNFLQIPVSVGVTMYEGLGLMQGRRVISSKGDEQTNLKFHQLLVYCFF  329

Query  1409  gmiagvvggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPV  1588
             GM+AGVVGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLL RFPV
Sbjct  330   GMMAGVVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLDRFPV  389

Query  1589  PYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEK  1768
             PYALF T VA  AA IGQH+VR+LI  LGRASLIIFIL+F IF+SAISLGGVGISNMI K
Sbjct  390   PYALFFTTVAFFAAIIGQHIVRKLINWLGRASLIIFILSFMIFISAISLGGVGISNMIGK  449

Query  1769  IHNHEYMGFENLCKYGV  1819
             I  HEYMGF+N+C Y V
Sbjct  450   IARHEYMGFDNICNYDV  466



>ref|XP_008228542.1| PREDICTED: uncharacterized protein LOC103327945 [Prunus mume]
 ref|XP_008228543.1| PREDICTED: uncharacterized protein LOC103327945 [Prunus mume]
Length=479

 Score =   493 bits (1269),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 304/478 (64%), Positives = 380/478 (79%), Gaps = 2/478 (0%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALS-WSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNF  556
             MA  G +W  LR   A+    FLLA++ V++ +    ++ +  + S     DY    +NF
Sbjct  1     MAQVGLEWWSLRRRAAMVVIGFLLAASVVASAQETSEQDASSYSGSDKFQPDYFDRVLNF  60

Query  557   LWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPK  736
             LWQP   GY+H+WPE++  W+IV+ ++IGF+GAAFG+VGGVGGGGIFVPML+L++GFD K
Sbjct  61    LWQPGRLGYEHVWPELKFDWKIVVCTVIGFIGAAFGTVGGVGGGGIFVPMLTLIIGFDEK  120

Query  737   SATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIF  916
             S+TAISKCMI G A +SV YNL+LRHPTLD+PIIDYDLA+L+QPMLMLGISIGV+FNVIF
Sbjct  121   SSTAISKCMITGGAAASVFYNLRLRHPTLDLPIIDYDLALLLQPMLMLGISIGVSFNVIF  180

Query  917   ADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANG-SGGQGEYKLLPGG  1093
             ADWM+TVLLI+ F+GTSTKAFL+GVE W +ET+MK+E A+ + ++G S  + EY+ L  G
Sbjct  181   ADWMITVLLIIFFLGTSTKAFLKGVEAWNRETVMKQEFARLMQSDGNSSDEVEYRRLASG  240

Query  1094  PGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNL  1273
             P N      KES   +VSIIENVYWKE  LL  VWV  LALQI KNYT+TCS  YWV+NL
Sbjct  241   PNNVILLGTKESKRTEVSIIENVYWKELLLLVAVWVIILALQIAKNYTTTCSAEYWVLNL  300

Query  1274  LQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgg  1453
             LQIPV+ GV+ +EA  LYKG R I+SK +S ++ +  QL++YC  G+IAG+VGGLLGLGG
Sbjct  301   LQIPVAFGVSTYEAVNLYKGRRVIASKEESVTDWKVHQLVLYCACGIIAGIVGGLLGLGG  360

Query  1454  gfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaaf  1633
             GFI+GPLFLELG+PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYA++   +++++A 
Sbjct  361   GFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYAVYFAVMSSLSAL  420

Query  1634  IGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             +GQHVVRR+I+VLGRAS+IIFILA TIFVSAISLGGVGI+ MI KI   EYMGFEN+C
Sbjct  421   VGQHVVRRVISVLGRASIIIFILASTIFVSAISLGGVGIAAMIGKIERKEYMGFENIC  478



>gb|KDO79723.1| hypothetical protein CISIN_1g011811mg [Citrus sinensis]
Length=425

 Score =   491 bits (1263),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 311/479 (65%), Positives = 357/479 (75%), Gaps = 57/479 (12%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             MA  G KW+ILR ++ +  +F LA   V AER LK E +      R  D +YL   VNFL
Sbjct  1     MADLGAKWKILRSVMMIFLNFALAFVCVKAERGLKIETLRFNGTERQ-DSNYLLKAVNFL  59

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             WQP+ SGY H+W                                             P S
Sbjct  60    WQPEGSGYHHVW---------------------------------------------PVS  74

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
                    MIMGAAVS+V+YNLKLRHPTLDMPIIDYDLA+LIQPMLMLGISIGV FNVIFA
Sbjct  75    -------MIMGAAVSTVYYNLKLRHPTLDMPIIDYDLALLIQPMLMLGISIGVAFNVIFA  127

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSG-GQGEYKLLPGGP  1096
             DWMVTVLLIVLFIGTSTKAFL+GVETWK+ETI+KKEAA+ L +NG+G G+ EYK LP GP
Sbjct  128   DWMVTVLLIVLFIGTSTKAFLKGVETWKRETILKKEAARCLGSNGAGAGEVEYKSLPSGP  187

Query  1097  GNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLL  1276
              +G Q   K++ E +V+I+EN+ WKE GLL FVWV+FL LQI KN+T++CS +YWV++LL
Sbjct  188   RSGPQ---KDAMEPEVTILENINWKELGLLVFVWVAFLGLQIAKNHTASCSIVYWVLDLL  244

Query  1277  QIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglggg  1456
             QIPVSL V+L+EA  LYKG R I+SKGD G + R  QL+ YC FG++AG+VGGLLGLGGG
Sbjct  245   QIPVSLVVSLYEAISLYKGRRVIASKGDDGKSFRVFQLVSYCAFGVLAGIVGGLLGLGGG  304

Query  1457  fimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafI  1636
             FIMGPLFLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+  AVAT+AAF+
Sbjct  305   FIMGPLFLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFVAVATIAAFV  364

Query  1637  GQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             GQHVVR+LI +LGRASLIIFILAF IFVSAISLGGVGISNMI K H HEYMGFENLCKY
Sbjct  365   GQHVVRKLIILLGRASLIIFILAFMIFVSAISLGGVGISNMIGKFHRHEYMGFENLCKY  423



>ref|XP_004168635.1| PREDICTED: uncharacterized LOC101214783 [Cucumis sativus]
Length=471

 Score =   492 bits (1267),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 308/476 (65%), Positives = 376/476 (79%), Gaps = 10/476 (2%)
 Frame = +2

Query  386   GAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQ  565
             G GG     R +    ++F +  A VS ER +K E         + D +     +NFLWQ
Sbjct  4     GFGGICAGFRSMALTMFNFAVVLALVSGERKMKLE-------GSSEDLNLFQGALNFLWQ  56

Query  566   PKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSAT  745
               ++GY H+WPEM  GW+IV+GS+IGFMGAAFGSVGGVGGGGI+VPMLSL++GFDPKS+T
Sbjct  57    SDKTGYHHVWPEMAFGWQIVVGSVIGFMGAAFGSVGGVGGGGIYVPMLSLIIGFDPKSST  116

Query  746   AISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADW  925
             AISKCMIMGAA S+V+YNLKLRHPTL++PIIDYDL +LI PMLMLGIS+GV FNVIFADW
Sbjct  117   AISKCMIMGAAASTVYYNLKLRHPTLELPIIDYDLVLLIMPMLMLGISVGVVFNVIFADW  176

Query  926   MVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNG  1105
             MVTVLLIVLF+ TSTK+FL+GVETWKKETIMK EAA++  +N       Y  LP GP + 
Sbjct  177   MVTVLLIVLFLATSTKSFLKGVETWKKETIMKTEAARRAESNDIQADTAYAPLPSGPSHR  236

Query  1106  TQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIP  1285
              +      ++++V I+ENVYWKE GLL  VW +FLA+QI K ++  CS  YW++N LQ+P
Sbjct  237   PET---NYTDREVPILENVYWKEMGLLLLVWFAFLAIQITKKHSPNCSWEYWLLNFLQVP  293

Query  1286  VSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfim  1465
             ++ GV+ +EA GLYKG RKI+S G+  ++ R  QL++YCF G+IAGVVGGLLGLGGGFIM
Sbjct  294   IAFGVSGYEAVGLYKGKRKIASLGNQKTDFRIYQLVLYCFMGIIAGVVGGLLGLGGGFIM  353

Query  1466  gplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQH  1645
             GPLFLELG+PPQVSSA+ATF M FSSSMSV++YYLL RFPVPYAL+ T VA VAAF+GQH
Sbjct  354   GPLFLELGIPPQVSSASATFGMTFSSSMSVIQYYLLNRFPVPYALYFTIVAAVAAFVGQH  413

Query  1646  VVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             V+R+LI ++GRASLIIFIL+FTIFVSA+SLGGVGIS MI +I  HEYMGFENLCKY
Sbjct  414   VIRKLILLIGRASLIIFILSFTIFVSALSLGGVGISKMIGQIQRHEYMGFENLCKY  469



>emb|CDX83221.1| BnaA03g22850D [Brassica napus]
Length=462

 Score =   489 bits (1260),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 304/419 (73%), Positives = 352/419 (84%), Gaps = 5/419 (1%)
 Frame = +2

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             W+  ++GY H+WPE E  W++V+G+++GF GAAFGSVGGVGGGGIFVPMLSL++GFDPKS
Sbjct  46    WESDQTGYHHVWPEFEFNWQVVLGTLVGFFGAAFGSVGGVGGGGIFVPMLSLIIGFDPKS  105

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             ATA+SKCMIMGA+VS+V+YNL+LRHPTLDMPIIDYDLA+LIQPMLMLGIS+GV FNV+F 
Sbjct  106   ATAMSKCMIMGASVSTVYYNLRLRHPTLDMPIIDYDLALLIQPMLMLGISVGVAFNVMFP  165

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANG-SGGQGEYKLLPGGP  1096
             DWMVTVLLI+LF+GTSTKAFL+G ETW KETI K EAA++L +NG S    EY  LP  P
Sbjct  166   DWMVTVLLIILFLGTSTKAFLKGCETWNKETIEKMEAAKRLESNGVSATDVEYVPLPAAP  225

Query  1097  GNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLL  1276
                  +  K+    QVSIIENVYWKE GLL FVWV FLALQI K   +TCS  YWV+NLL
Sbjct  226   STNNGNNKKQ----QVSIIENVYWKELGLLVFVWVVFLALQIAKQNMATCSIAYWVINLL  281

Query  1277  QIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglggg  1456
             QIPV++GV+ +EA  LY+G R I+S G   SN   GQL++YC FG++AG+VGGLLGLGGG
Sbjct  282   QIPVAVGVSGYEAVALYQGRRIIASNGQGDSNFTVGQLVLYCTFGILAGIVGGLLGLGGG  341

Query  1457  fimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafI  1636
             FIMGPLFLELGVPPQVSSATATFAM FSSSMSV+EYYLLKRFPVPYAL+L  VATVAA +
Sbjct  342   FIMGPLFLELGVPPQVSSATATFAMTFSSSMSVIEYYLLKRFPVPYALYLVGVATVAALV  401

Query  1637  GQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             GQHVVR+LIAV+GRASLIIFILA  IF+SAISLGGVGI NMI K   HEYMGFEN+CKY
Sbjct  402   GQHVVRKLIAVIGRASLIIFILASMIFISAISLGGVGIVNMIGKFQRHEYMGFENICKY  460



>ref|XP_009133962.1| PREDICTED: uncharacterized protein LOC103858367 [Brassica rapa]
Length=462

 Score =   489 bits (1260),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 304/419 (73%), Positives = 352/419 (84%), Gaps = 5/419 (1%)
 Frame = +2

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             W+  ++GY H+WPE E  W++V+G+++GF GAAFGSVGGVGGGGIFVPMLSL++GFDPKS
Sbjct  46    WESDQTGYHHVWPEFEFNWQVVLGTLVGFFGAAFGSVGGVGGGGIFVPMLSLIIGFDPKS  105

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             ATA+SKCMIMGA+VS+V+YNL+LRHPTLDMPIIDYDLA+LIQPMLMLGIS+GV FNV+F 
Sbjct  106   ATAMSKCMIMGASVSTVYYNLRLRHPTLDMPIIDYDLALLIQPMLMLGISVGVAFNVMFP  165

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANG-SGGQGEYKLLPGGP  1096
             DWMVTVLLI+LF+GTSTKAFL+G ETW KETI K EAA++L +N  S  + EY  LP  P
Sbjct  166   DWMVTVLLIILFLGTSTKAFLKGCETWNKETIEKMEAAKRLESNSVSATEVEYVPLPAAP  225

Query  1097  GNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLL  1276
                  +  K+    QVSIIENVYWKE GLL FVWV FLALQI K   +TCS  YWV+NLL
Sbjct  226   STNNGNNKKQ----QVSIIENVYWKELGLLVFVWVVFLALQIAKQNMATCSIAYWVINLL  281

Query  1277  QIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglggg  1456
             QIPV++GV+ +EA  LY+G R I+S G   SN   GQL++YC FG++AG+VGGLLGLGGG
Sbjct  282   QIPVAVGVSGYEAVALYQGRRIIASNGQGDSNFTVGQLVLYCTFGILAGIVGGLLGLGGG  341

Query  1457  fimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafI  1636
             FIMGPLFLELGVPPQVSSATATFAM FSSSMSV+EYYLLKRFPVPYAL+L  VATVAA +
Sbjct  342   FIMGPLFLELGVPPQVSSATATFAMTFSSSMSVIEYYLLKRFPVPYALYLVGVATVAALV  401

Query  1637  GQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             GQHVVRRLIAV+GRASLIIFILA  IF+SAISLGGVGI NMI K   HEYMGFEN+CKY
Sbjct  402   GQHVVRRLIAVIGRASLIIFILASMIFISAISLGGVGIVNMIGKFQRHEYMGFENICKY  460



>ref|XP_011026588.1| PREDICTED: uncharacterized protein LOC105127135 [Populus euphratica]
Length=475

 Score =   489 bits (1260),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 306/479 (64%), Positives = 386/479 (81%), Gaps = 8/479 (2%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             MA  G ++  LRP   L + F+LAS F+SAERS+K+E V+  + +   + +YL   ++FL
Sbjct  1     MAFLGARFLSLRPSAILFFIFMLASVFISAERSIKHE-VSRLSEAEELEPNYLVKIISFL  59

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             WQ  ESGY H+WPE+   W+ VIG+IIGF GAAFGSVGGVGGGGIFVPML L++GFDPKS
Sbjct  60    WQSDESGYQHVWPELSFSWQAVIGTIIGFFGAAFGSVGGVGGGGIFVPMLILIIGFDPKS  119

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             ATAISKC+IMGAAVS+V++NL+LRHPTLD+P+IDYDL +LIQPMLMLGISIGVTFNVIF 
Sbjct  120   ATAISKCIIMGAAVSTVYHNLRLRHPTLDLPVIDYDLVLLIQPMLMLGISIGVTFNVIFP  179

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQG-EYKLLPGGP  1096
             DW++TV LI+L IGTS KAF +G++ WK ET++K++AA+   +   G +  EYK LP G 
Sbjct  180   DWVITVALIILCIGTSVKAFFKGLDIWKIETLLKEDAAKLFESTAGGSEEVEYKPLPDGQ  239

Query  1097  GNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLL  1276
             GN     +K      V+I++N+YWKE GLL FVWVS+LA+QI KNYT+TCST +WV+NLL
Sbjct  240   GNNPPKASK------VTILQNIYWKELGLLVFVWVSYLAVQIAKNYTATCSTTFWVLNLL  293

Query  1277  QIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglggg  1456
             QIPVS+GV L+EA GLYKG R+ISSKGD   + +  +L+++   G++AG+VGGLLG+GGG
Sbjct  294   QIPVSIGVFLYEAIGLYKGRRRISSKGDEIMDWQVHRLLMFSACGVVAGIVGGLLGIGGG  353

Query  1457  fimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafI  1636
             FIMGPLFLE+G+PPQV+S TATF M+FSSSMSVVEYYLL RFPVPYAL+  AVA +AAFI
Sbjct  354   FIMGPLFLEMGIPPQVTSGTATFGMLFSSSMSVVEYYLLDRFPVPYALYFIAVAIIAAFI  413

Query  1637  GQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             GQ+++ +LI + GRASLIIF+LAFTIF+SAI+LGGVGI+  I  +  HEYMGFENLCKY
Sbjct  414   GQNIITKLITLSGRASLIIFVLAFTIFISAIALGGVGITRTIGMMERHEYMGFENLCKY  472



>ref|XP_008380922.1| PREDICTED: uncharacterized protein LOC103443804 [Malus domestica]
Length=474

 Score =   489 bits (1259),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 303/475 (64%), Positives = 378/475 (80%), Gaps = 9/475 (2%)
 Frame = +2

Query  392   GGKWRILR-PLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQP  568
             G ++R LR   + ++   +LAS   SA+ +L+ ++        ++   YL+  +NFLWQ 
Sbjct  6     GFRFRDLRWAAIVVTGVLVLASIAASAQETLQQDD--------SATQHYLNRMLNFLWQR  57

Query  569   KESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATA  748
                GY+H+WPEM+  W IV+G+IIGF+GAAFG+VGGVGGGGIFVPML+L++GFD KS+TA
Sbjct  58    GRLGYEHVWPEMKFDWRIVVGTIIGFIGAAFGTVGGVGGGGIFVPMLTLIIGFDEKSSTA  117

Query  749   ISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWM  928
             IS CMI G A ++V YNL+LRHPTLD+PIIDYDLA+L+QPMLMLGISIGV+FNVIFA+WM
Sbjct  118   ISNCMITGGAAATVFYNLRLRHPTLDLPIIDYDLALLVQPMLMLGISIGVSFNVIFANWM  177

Query  929   VTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGT  1108
             +TVLL++ FIGTSTKAFL+GVETWKKETI+ KE A+ + +NGS    E +  P   G  +
Sbjct  178   ITVLLMIFFIGTSTKAFLKGVETWKKETILIKEVARLMQSNGSSSDDEVEYRPLASGLSS  237

Query  1109  QDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPV  1288
                 KES   +VSI+ENVYWKE  LL  VWV  LALQI KNYT+TCS  YWV+NLLQIPV
Sbjct  238   VLATKESKRIEVSIMENVYWKELLLLVAVWVIILALQIAKNYTTTCSAEYWVLNLLQIPV  297

Query  1289  SLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimg  1468
             +LGV+ +EA  LYKG R I S  +SG++ +  QL +YC  G+ AG+VGGLLGLGGGFI+G
Sbjct  298   ALGVSTYEAVNLYKGHRVIESMEESGTDWKVRQLFLYCGGGITAGIVGGLLGLGGGFILG  357

Query  1469  plflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHV  1648
             PLFLELG+PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+   VA+++A +GQHV
Sbjct  358   PLFLELGLPPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYFALVASLSALVGQHV  417

Query  1649  VRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             VR++I+VLGRAS+I+FILA TIFVSAISLGGVGI++M+EKI N EYMGFEN+C Y
Sbjct  418   VRKVISVLGRASIIVFILASTIFVSAISLGGVGIASMVEKIENKEYMGFENICTY  472



>ref|XP_002460084.1| hypothetical protein SORBIDRAFT_02g022510 [Sorghum bicolor]
 gb|EER96605.1| hypothetical protein SORBIDRAFT_02g022510 [Sorghum bicolor]
Length=470

 Score =   487 bits (1254),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 302/435 (69%), Positives = 360/435 (83%), Gaps = 2/435 (0%)
 Frame = +2

Query  509   VSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggg  688
             V+   +        N +W+   + Y H+WP MELGW+IV+GS+IGF GAAFGSVGGVGGG
Sbjct  36    VAPEEEMSLFRKVANLMWKSDGNSYQHVWPTMELGWQIVLGSLIGFFGAAFGSVGGVGGG  95

Query  689   gIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQP  868
             GIFVPML+L++GFDPKS+TAISKCMIMGA+VS+V+YNLKL+HPTLDMP+IDYDLAVLIQP
Sbjct  96    GIFVPMLTLIIGFDPKSSTAISKCMIMGASVSTVYYNLKLKHPTLDMPVIDYDLAVLIQP  155

Query  869   MLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAA  1048
             MLMLGISIGV FNVIF DW+VTVLLI+LF+GTSTKAFL+G+ETWKKETI+++EAA++L  
Sbjct  156   MLMLGISIGVIFNVIFPDWLVTVLLIILFLGTSTKAFLKGIETWKKETIIQREAAKRL-E  214

Query  1049  NGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVK  1228
               +G + EY  LP GPG    +    SS++  S+I+N++WKE GLL FVWV+FL LQ+ K
Sbjct  215   QIAGEEAEYAPLPTGPG-AAANKKTLSSDEAPSLIKNIHWKEVGLLSFVWVAFLVLQVTK  273

Query  1229  NYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFF  1408
             NYT+TCS  YWV+NLLQ+PVS+GV L+E  GL  G R +SSKG   + ++  Q++VY  F
Sbjct  274   NYTATCSPWYWVLNLLQVPVSVGVTLYEGFGLMSGKRVLSSKGSEQTTMKFHQVVVYGLF  333

Query  1409  gmiagvvggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPV  1588
             G+ AG+VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLL RFPV
Sbjct  334   GIAAGLVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLNRFPV  393

Query  1589  PYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEK  1768
             PYA++ T VA  AA IGQH VR+LI  LGRASLIIFILAF IFVSA+SLGGVGISNM+ K
Sbjct  394   PYAVYFTIVAFAAALIGQHAVRKLINWLGRASLIIFILAFMIFVSALSLGGVGISNMVHK  453

Query  1769  IHNHEYMGFENLCKY  1813
             I  HEYMGFENLCKY
Sbjct  454   IARHEYMGFENLCKY  468



>ref|XP_009353619.1| PREDICTED: uncharacterized protein LOC103944866 [Pyrus x bretschneideri]
Length=474

 Score =   487 bits (1253),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 299/471 (63%), Positives = 376/471 (80%), Gaps = 8/471 (2%)
 Frame = +2

Query  401   WRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESG  580
             W + R  + ++   ++AS   SA+ +L+ ++        ++   YL+  +NFLWQ    G
Sbjct  10    WGLRRAAIVVTGVLVIASIAASAQETLQQDD--------SATQHYLNRMLNFLWQKGRLG  61

Query  581   YDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKC  760
             Y+H+WPEM+ GW IV+G+IIGF+GAAFG+VGGVGGGG FVPML+L++GFD KS+TAISKC
Sbjct  62    YEHVWPEMKFGWRIVVGTIIGFIGAAFGTVGGVGGGGFFVPMLTLIIGFDEKSSTAISKC  121

Query  761   MIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVL  940
             MI G A ++V YNL+LRHPTLD+PIIDYDLA+L+QPMLMLGISIGV+FNVIFA+WM+TVL
Sbjct  122   MITGGAAATVFYNLRLRHPTLDLPIIDYDLALLVQPMLMLGISIGVSFNVIFANWMITVL  181

Query  941   LIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTA  1120
             L++ FIGTSTKAFL+GVETWKKETI+ KE A+ + +NGS    E +  P   G  +    
Sbjct  182   LMIFFIGTSTKAFLKGVETWKKETILIKEVARLMQSNGSSSDDEVEYRPLASGPSSLLAT  241

Query  1121  KESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGV  1300
             KES   +VSI+ENVYWKE  LL  VWV  LALQI KNYT+TCS  YWV+NLLQIPV+LGV
Sbjct  242   KESKRTEVSIMENVYWKELLLLVAVWVIILALQIAKNYTTTCSAEYWVLNLLQIPVALGV  301

Query  1301  ALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplfl  1480
             + +EA  LYKG R I+S  + G++ +  +L +YC  G+ AG+VGGLLGLGGGFI+GPLFL
Sbjct  302   STYEAVNLYKGHRVIASMEELGTDWKVHRLFLYCGGGITAGIVGGLLGLGGGFILGPLFL  361

Query  1481  ELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRL  1660
             ELG+PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+   VA+++A +GQHVVR++
Sbjct  362   ELGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYFALVASLSALVGQHVVRKV  421

Query  1661  IAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             I+VLGRAS+I+FILA TIFVSAISLGGVGI++M+EKI N EYMGFEN+C Y
Sbjct  422   ISVLGRASIIVFILASTIFVSAISLGGVGIASMVEKIENKEYMGFENICTY  472



>ref|XP_004956625.1| PREDICTED: uncharacterized protein LOC101768056 [Setaria italica]
Length=468

 Score =   486 bits (1250),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 301/426 (71%), Positives = 358/426 (84%), Gaps = 4/426 (1%)
 Frame = +2

Query  536   LSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSL  715
             L    N +W    + Y H+WP M+ GW IV+G++IGF GAAFGSVGGVGGGGIFVPML+L
Sbjct  45    LRKIANLMWNSGNT-YQHVWPPMKFGWRIVLGTLIGFFGAAFGSVGGVGGGGIFVPMLTL  103

Query  716   VVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIG  895
             ++GFDPKS+TAISKCMIMGAAVS+V+YNLKL+HPTLDMP+IDYDLA+LIQPMLMLGISIG
Sbjct  104   IIGFDPKSSTAISKCMIMGAAVSTVYYNLKLKHPTLDMPMIDYDLALLIQPMLMLGISIG  163

Query  896   VTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEY  1075
             V FNVIF DW+VTVLLIVLF+GTSTKAFL+G+ETWKKETI+++EAA++L    +GG+ EY
Sbjct  164   VIFNVIFPDWLVTVLLIVLFLGTSTKAFLKGIETWKKETIIQREAAKRLET--AGGEAEY  221

Query  1076  KLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTL  1255
               LP GP +    T   +S++  S+++N+ WKEFGLL FVWV+FL LQ+ KNYTSTCST 
Sbjct  222   APLPTGP-DAAAGTKALTSDEAASMMDNIQWKEFGLLSFVWVAFLVLQVTKNYTSTCSTW  280

Query  1256  YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  1435
             YWV+NLLQ+PVS+GV ++E  GL  G R +SSKG   S L+  Q+ +Y FFG+ AG+VGG
Sbjct  281   YWVLNLLQVPVSVGVTMYEGLGLMSGKRVLSSKGSEQSTLKLYQIFIYGFFGIAAGLVGG  340

Query  1436  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  1615
             LLGLGGGF+MGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYA+F   V
Sbjct  341   LLGLGGGFVMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLNRFPVPYAVFFVVV  400

Query  1616  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  1795
             A  AA IGQH+VR+L+  LGRASLIIFILAF IFVSA+SLGGVGISNM+ KI +HEYMGF
Sbjct  401   AFFAAIIGQHIVRKLVNWLGRASLIIFILAFMIFVSALSLGGVGISNMVNKIAHHEYMGF  460

Query  1796  ENLCKY  1813
             ENLCKY
Sbjct  461   ENLCKY  466



>ref|XP_004232395.1| PREDICTED: uncharacterized protein LOC101255155 [Solanum lycopersicum]
Length=486

 Score =   486 bits (1250),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 306/473 (65%), Positives = 381/473 (81%), Gaps = 20/473 (4%)
 Frame = +2

Query  428   LSWS-FLLASAFVSAER-SLKN--EEVAGTNVSRNSDDD-----YLSTFVNFLWQPKESG  580
             L W  F+++ A ++AER +LK+  E  A  N+S   +++     +    V+FLW  K S 
Sbjct  22    LCWGLFIISEAGINAERLTLKDKLEPAATYNISYVENNEMRPQTFAVRLVHFLWSGK-SS  80

Query  581   YDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKC  760
             Y+H+WPEME GW +++GSI+GF GAA GSVGGVGGGGIFVPML+L++GFDPKS+TAISKC
Sbjct  81    YEHVWPEMEFGWRVIVGSIVGFFGAALGSVGGVGGGGIFVPMLTLIIGFDPKSSTAISKC  140

Query  761   MIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVL  940
             MIMGAA S+V+YN++LRHPTLDMPIIDYDLA+L+QPMLMLGISIGV FNVIFADWMVTVL
Sbjct  141   MIMGAAGSTVYYNMRLRHPTLDMPIIDYDLALLLQPMLMLGISIGVAFNVIFADWMVTVL  200

Query  941   LIVLFIGTSTKAFLRGVETWKKETIMKKEAAQ-QLAAN-GSGGQGEYKLLPGGPGNGTQD  1114
             LI+LFIGTSTKA  +G+ETWKKET+MKKEA + QL +      +GEYKLLP GP     D
Sbjct  201   LIILFIGTSTKALFKGIETWKKETLMKKEATKIQLESEYKPESEGEYKLLPSGPLASVDD  260

Query  1115  TAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSL  1294
             T        V ++ NVYWKE GLL FVWV+FLA+Q+VK YT TCS  YW++NLLQ+PV++
Sbjct  261   T--------VPMLRNVYWKELGLLMFVWVAFLAIQVVKTYTVTCSIGYWILNLLQVPVAV  312

Query  1295  GVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgpl  1474
              V+L+EA  LYKG R I+SKG   +N +   L  YC  G++AG+VGGLLGLGGGFI+GPL
Sbjct  313   SVSLYEAVCLYKGTRVIASKGKEITNWKPHLLFFYCCCGIVAGIVGGLLGLGGGFILGPL  372

Query  1475  flELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVR  1654
             FLELG+PPQV+SAT+TF+M FSSSMSVV+YYLLKRFPVPYA +  ++AT+AA +GQHV+R
Sbjct  373   FLELGIPPQVASATSTFSMTFSSSMSVVQYYLLKRFPVPYATYFVSIATIAAVVGQHVIR  432

Query  1655  RLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             R+IA+LGRAS+IIFILA TIF SAISLGGVGI+NMIEK+ N++YMGF+NLC +
Sbjct  433   RVIALLGRASIIIFILAMTIFTSAISLGGVGIANMIEKLKNNDYMGFDNLCYH  485



>emb|CDP02034.1| unnamed protein product [Coffea canephora]
Length=479

 Score =   485 bits (1249),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 300/462 (65%), Positives = 368/462 (80%), Gaps = 12/462 (3%)
 Frame = +2

Query  434   WSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELG  613
             W    AS   SAER LK  E  G  V +     ++   V+FLWQ  +S Y H+WPEME G
Sbjct  25    WILFTASDIGSAERLLKTVE-PGHIVEKEMRQGFIVRLVHFLWQSGKSSYQHVWPEMEFG  83

Query  614   WEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVH  793
             W++V+G+++GF+GAA GSVGGVGGGGIFVPMLSL++GFDPKS+TAISKCMIMGAA S+V+
Sbjct  84    WKLVVGTVVGFLGAALGSVGGVGGGGIFVPMLSLIIGFDPKSSTAISKCMIMGAAGSTVY  143

Query  794   YNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTK  973
             YNL+LRHPTLD+P+IDYDLA+L QPMLMLGISIGV FNVIFADWMVTVLLI+LFIGTS+K
Sbjct  144   YNLRLRHPTLDLPLIDYDLALLFQPMLMLGISIGVAFNVIFADWMVTVLLILLFIGTSSK  203

Query  974   AFLRGVETWKKETIMKKEAAQQLAANGSGGQG---EYKLLPGGPGNGTQDTAKESSEKQV  1144
             AF +G+ETW KET MK EAA+   ++    +G   EYK LPGGP           ++++V
Sbjct  204   AFFKGLETWNKETKMKLEAAEVAQSDSKFNEGPGNEYKPLPGGPA--------AHADEKV  255

Query  1145  SIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGL  1324
              ++ N+YWKE  LL FVW++FLA+QI+K YT TCS  YW +N LQ+P++  V+L+EAT L
Sbjct  256   PLLYNIYWKELCLLLFVWMAFLAIQIMKTYTQTCSAKYWTLNFLQVPIAASVSLYEATCL  315

Query  1325  YKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQV  1504
             YKG R I+SKG   +  +   + +YC  G++AGVVGGLLGLGGGF++GPLFLELGVPPQV
Sbjct  316   YKGTRTIASKGKEITVWKPNLIFLYCCLGIVAGVVGGLLGLGGGFVLGPLFLELGVPPQV  375

Query  1505  ssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRAS  1684
             +SAT+TFAM FSSSMSVV+YYLL RFPVPYA +   VATVAA +GQHVVRR+IA+LGRAS
Sbjct  376   ASATSTFAMTFSSSMSVVQYYLLNRFPVPYATYFVLVATVAALVGQHVVRRIIAILGRAS  435

Query  1685  LIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  1810
             LIIFILA TIFVSAISLGGVGI++MIEK+ NHEYMGF+NLC+
Sbjct  436   LIIFILALTIFVSAISLGGVGIASMIEKLQNHEYMGFDNLCR  477



>gb|KEH35985.1| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=456

 Score =   484 bits (1247),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 305/430 (71%), Positives = 358/430 (83%), Gaps = 13/430 (3%)
 Frame = +2

Query  461   VSAERSLKNEEVAGTNVS---RNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIG  631
             VS ER L   ++   NV+   +  +  +L+  VNFLW+   SGY H+WPEME GW+IV+G
Sbjct  23    VSGERKLVKIQLPSFNVTTQPQKHEQSFLTKAVNFLWKSDGSGYQHVWPEMEFGWQIVLG  82

Query  632   SIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLR  811
             S IGF GAAFGSVGGVGGGGIFVPMLSL++GFDPKS+TAISKCMIMGAA+S+V+YNL+LR
Sbjct  83    SFIGFCGAAFGSVGGVGGGGIFVPMLSLIIGFDPKSSTAISKCMIMGAALSTVYYNLRLR  142

Query  812   HPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGV  991
             HPTLDMPIIDYDLA+LIQPMLMLGISIGV FNV+F DW+VT+LLIVLF+GTSTKAF +G+
Sbjct  143   HPTLDMPIIDYDLALLIQPMLMLGISIGVVFNVVFPDWLVTILLIVLFLGTSTKAFFKGL  202

Query  992   ETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWK  1171
             ETW KETIMKKEAA++  +NGS   GEYK LP GP    +       E +VSIIENVYWK
Sbjct  203   ETWNKETIMKKEAARRQESNGS---GEYKALPTGPNVAIEK------ENKVSIIENVYWK  253

Query  1172  EFGLLCFVWVSFLALQIVK-NYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKIS  1348
             EFGLL FVW+SFLALQI K NYT+TCS  YW++NLLQIP+++GV  +EAT L+ G R I+
Sbjct  254   EFGLLAFVWISFLALQIAKQNYTTTCSAAYWILNLLQIPIAVGVTAYEATALFTGRRVIA  313

Query  1349  SKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfa  1528
             S GD G     GQL++YC FG++AG+VGGLLGLGGGF+MGPLFLELGVPPQVSSATATFA
Sbjct  314   STGDQGKAFTVGQLVIYCVFGVLAGIVGGLLGLGGGFVMGPLFLELGVPPQVSSATATFA  373

Query  1529  mmfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAF  1708
             M FSSSMSVVEYYLLKRFPVPYAL+L+ VAT+AA +GQH+VRRLI + GRASLIIFILA 
Sbjct  374   MTFSSSMSVVEYYLLKRFPVPYALYLSLVATIAALVGQHIVRRLIILFGRASLIIFILAG  433

Query  1709  TIFVSAISLG  1738
             TIF+SAISLG
Sbjct  434   TIFISAISLG  443



>ref|XP_010070053.1| PREDICTED: uncharacterized protein LOC104456870 [Eucalyptus grandis]
 gb|KCW58607.1| hypothetical protein EUGRSUZ_H01268 [Eucalyptus grandis]
Length=481

 Score =   485 bits (1249),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 298/466 (64%), Positives = 370/466 (79%), Gaps = 16/466 (3%)
 Frame = +2

Query  434   WSFLLASAFVS-----AERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWP  598
             W  L  S  +S     AER L +++V    V   +   +L   VNFLWQ  +S Y+ +WP
Sbjct  21    WFLLFTSLIISGHAARAERPLLHDKVLEVPVEDTARPGFLVRAVNFLWQIGKSSYEPVWP  80

Query  599   EMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAA  778
             EME GW++V+GSIIGF GAA GSVGGVGGGGIFVPML+L++GFDPKS+TAISKCMIMGAA
Sbjct  81    EMEFGWKLVVGSIIGFFGAALGSVGGVGGGGIFVPMLTLIIGFDPKSSTAISKCMIMGAA  140

Query  779   VSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFI  958
              S+V+YNL+LRHPTLD+P+IDYDLA+L QPMLMLGISIGV FNV+FADWMVTVLLI+LFI
Sbjct  141   GSTVYYNLRLRHPTLDIPLIDYDLALLFQPMLMLGISIGVAFNVMFADWMVTVLLIILFI  200

Query  959   GTSTKAFLRGVETWKKETIMKKEAAQQLAANGS---GGQGEYKLLPGGPGNGTQDTAKES  1129
             GTSTKA  +G++TWKKET+M+KE A+ + A      G + +YK LP GP          S
Sbjct  201   GTSTKALFKGIDTWKKETLMRKEQAKLMEAEAKQYEGSKEDYKPLPSGPA--------AS  252

Query  1130  SEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALF  1309
              +++VS+ +N+YWKE  LL F+WV+FLA+QIVK YT TCS  YW++N LQ+P++  V LF
Sbjct  253   RDEKVSLAKNIYWKELSLLLFIWVAFLAVQIVKTYTKTCSVKYWILNSLQVPIACSVTLF  312

Query  1310  EATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELG  1489
             EA  LY+G R I+SKG   +N +  Q+++YC  G+IAG+VGGLLGLGGGFI+GPLFLELG
Sbjct  313   EAIALYRGTRVIASKGKEITNWKLHQILLYCSCGIIAGMVGGLLGLGGGFILGPLFLELG  372

Query  1490  VPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAV  1669
             +PPQV+SAT+TFAM FSSSMSVV+YY+LKRFPVP+A +   VATVAA +GQHVVR++IA+
Sbjct  373   IPPQVASATSTFAMTFSSSMSVVQYYILKRFPVPFASYFVLVATVAAIVGQHVVRKIIAI  432

Query  1670  LGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             LGR S+IIFILA TIFVSAISLGGVGISNM+EK+ N EYMGFE+LC
Sbjct  433   LGRTSIIIFILALTIFVSAISLGGVGISNMVEKLENQEYMGFESLC  478



>gb|KDP38300.1| hypothetical protein JCGZ_05186 [Jatropha curcas]
Length=469

 Score =   484 bits (1247),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 296/459 (64%), Positives = 368/459 (80%), Gaps = 9/459 (2%)
 Frame = +2

Query  434   WSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELG  613
             +  ++  +F +AER LK E+     V +  +  +L    +FLWQ  +S YD +WPEME G
Sbjct  18    FGLMVMGSFTNAERLLK-EQKPKILVEKEMEPSFLQKMAHFLWQSGKSSYDPVWPEMEFG  76

Query  614   WEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVH  793
             W+IV+GSI+GF+GAA GSVGGVGGGGIFVPML+L++GFDPKS+TAISKCMIMGAA S+V+
Sbjct  77    WKIVVGSIVGFLGAALGSVGGVGGGGIFVPMLTLIIGFDPKSSTAISKCMIMGAAGSTVY  136

Query  794   YNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTK  973
             YNL+LRHPTLDMP+IDYDLA+L QPMLMLGISIGV FNV+FADWMVTVLLI+LFIGTSTK
Sbjct  137   YNLRLRHPTLDMPLIDYDLALLFQPMLMLGISIGVAFNVMFADWMVTVLLIILFIGTSTK  196

Query  974   AFLRGVETWKKETIMKKEAAQQLAANGSGGQGE-YKLLPGGPGNGTQDTAKESSEKQVSI  1150
             A  +G++TWKKET+MKKEAA+QL +    G G+ YK LP GP          S+++++ +
Sbjct  197   ALFKGIDTWKKETMMKKEAAKQLESESKPGDGQDYKPLPSGP-------TALSNDEEIPL  249

Query  1151  IENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYK  1330
             ++N+YWKE  LL +VW+ FLA+QIVK+Y  TCS  YW++N LQIP++  V +FEA  L K
Sbjct  250   LQNIYWKEVALLVYVWLGFLAVQIVKSYAKTCSMTYWILNALQIPIAASVTIFEAICLRK  309

Query  1331  GWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVss  1510
             G R I+SKG   +N +  Q+ +YC  G+IAG+VGGLLGLGGGFI+GPLFLELG+PPQV+S
Sbjct  310   GTRVIASKGKEITNWKFHQIFLYCSCGIIAGMVGGLLGLGGGFILGPLFLELGIPPQVAS  369

Query  1511  atatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLI  1690
             AT+TFAM+FSSSMSVV+YY L RFPVPYA +   VAT AA  GQHVVRR+IAVLGR S+I
Sbjct  370   ATSTFAMVFSSSMSVVQYYFLNRFPVPYATYFVIVATFAALAGQHVVRRIIAVLGRTSII  429

Query  1691  IFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             IFILA TIFVSAISLGGVGI++M+EK+ N EYMGFENLC
Sbjct  430   IFILALTIFVSAISLGGVGIADMVEKLENEEYMGFENLC  468



>ref|XP_010048102.1| PREDICTED: uncharacterized protein LOC104436944 isoform X2 [Eucalyptus 
grandis]
Length=472

 Score =   484 bits (1247),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 298/469 (64%), Positives = 378/469 (81%), Gaps = 10/469 (2%)
 Frame = +2

Query  413   RPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHI  592
             R ++ + +  L+A  FVSA+RSL+ E + G       + +Y    V++LW+  +S Y H+
Sbjct  12    RLVLMVLFQVLVAMVFVSADRSLRLESM-GLGGMEKPESNYFLRAVDYLWKLNQSSYQHV  70

Query  593   WPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMG  772
             WPEM  GW IV+G++IG  GAAFGSVGGVGGGGIFVPMLSLV+GFDPKS+TAISKCMIMG
Sbjct  71    WPEMSFGWRIVVGTVIGIFGAAFGSVGGVGGGGIFVPMLSLVIGFDPKSSTAISKCMIMG  130

Query  773   AAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVL  952
             AA+S+V YNLKLRHPTLD+P+IDYDL +LIQPMLMLGISIGV FN+IFADWMVT+L+I+L
Sbjct  131   AAISTVVYNLKLRHPTLDIPLIDYDLVLLIQPMLMLGISIGVVFNLIFADWMVTILIILL  190

Query  953   FIGTSTKAFLRGVETWKKETIMKKEAAQQL-AANGSGGQGEYKLLPGGPGNGTQDTAKES  1129
              +GTSTKAF + +ETW++ET++K+EAA++L +++ S  Q E +LLP  P + T+ T    
Sbjct  191   SLGTSTKAFFKALETWRRETVLKEEAAKRLESSDDSNAQLEQRLLP-QPASSTKKT----  245

Query  1130  SEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALF  1309
                QVS++EN+ WKE  L+ FVWV++L LQI  N T+TCST YWV+N LQ+PVS+GV  +
Sbjct  246   ---QVSLLENIRWKEVALITFVWVAYLILQISMNQTATCSTAYWVLNFLQVPVSIGVFAY  302

Query  1310  EATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELG  1489
             EA  LYKGWR I+SKG+ G   +  +L+ YC  G++AG++GGLLG+GGGF+MGPLFLELG
Sbjct  303   EAISLYKGWRVIASKGEKGKKWQVRELLAYCGCGVLAGIIGGLLGIGGGFVMGPLFLELG  362

Query  1490  VPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAV  1669
             +PP+VSSATATF M +SSSMSVVEYYLLKRFPVPYAL+   VATVAAF+GQH+VR+LI +
Sbjct  363   IPPEVSSATATFGMTYSSSMSVVEYYLLKRFPVPYALYFILVATVAAFVGQHIVRKLIII  422

Query  1670  LGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  1816
              GRAS+IIFIL+FTIFVSAI LGGVG+SNMI KI  HEYMGF+NLC +G
Sbjct  423   TGRASIIIFILSFTIFVSAILLGGVGLSNMIGKIERHEYMGFDNLCNFG  471



>ref|XP_007202022.1| hypothetical protein PRUPE_ppa004997mg [Prunus persica]
 gb|EMJ03221.1| hypothetical protein PRUPE_ppa004997mg [Prunus persica]
Length=482

 Score =   484 bits (1246),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 299/460 (65%), Positives = 370/460 (80%), Gaps = 12/460 (3%)
 Frame = +2

Query  437   SFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGW  616
             + L+ S   SAER LK+E+     + ++  + +    VNFLWQ   S Y  +WPEM+ GW
Sbjct  29    NLLMTSEVASAERPLKDEK-PTKFIEQDIHEAFFVKVVNFLWQAGGSSYQPVWPEMKFGW  87

Query  617   EIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHY  796
             +IV+GSI+GF GAA GSVGGVGGGGIFVPML+L++GFDPKS+TAISKCMIMGAA S+V++
Sbjct  88    KIVVGSIVGFFGAALGSVGGVGGGGIFVPMLALIIGFDPKSSTAISKCMIMGAAGSTVYF  147

Query  797   NLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKA  976
             NL+LRHPTLDMP+IDYDLA+L QPMLMLGISIGV FNV+FADWMVTVLLI+LF+GT+ KA
Sbjct  148   NLRLRHPTLDMPLIDYDLALLFQPMLMLGISIGVAFNVMFADWMVTVLLIILFLGTAAKA  207

Query  977   FLRGVETWKKETIMKKEAAQQLAANGSGGQG---EYKLLPGGPGNGTQDTAKESSEKQVS  1147
              ++GV+TWKKET+MKKEA +QL +    G G   +YK LPGGP +  QD       +QV 
Sbjct  208   LMKGVDTWKKETMMKKEAEKQLESESKPGDGSGEDYKPLPGGPAS-LQD-------EQVP  259

Query  1148  IIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLY  1327
             I  NVYWKE  +L +VWV+FL +QIVK YT TCST++WV+N LQ+P+++ V LFEA  L 
Sbjct  260   ISHNVYWKELSMLVYVWVAFLIVQIVKTYTETCSTMFWVLNSLQVPIAVSVTLFEAICLC  319

Query  1328  KGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVs  1507
             KG R I+SKG   +N +  Q+ +YC  G++AG+VGGLLGLGGGFI+GPLFLELG+PPQV+
Sbjct  320   KGTRVIASKGKEITNWKLHQIFLYCSCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVA  379

Query  1508  satatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASL  1687
             SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++IAVLGRAS+
Sbjct  380   SATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKIIAVLGRASI  439

Query  1688  IIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             +IFILA TIFVSAISLGGVGI+NM+EK+ N EYMGFEN C
Sbjct  440   VIFILALTIFVSAISLGGVGIANMVEKMENQEYMGFENFC  479



>ref|XP_009788571.1| PREDICTED: uncharacterized protein LOC104236361 [Nicotiana sylvestris]
Length=479

 Score =   484 bits (1246),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 308/484 (64%), Positives = 377/484 (78%), Gaps = 16/484 (3%)
 Frame = +2

Query  374   F*MAGAGGKWRILRPLVA----LSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLS  541
             F MA    K R+   L+     + W     S   +AER LK EE     V +     +  
Sbjct  3     FNMANEEVKQRVKALLITAVWIICWGLFTISDVGNAERLLKTEEPTYV-VEKEMRQGFAL  61

Query  542   TFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVV  721
               + FLW  K S Y+H+WPEM+ GW+I++GSI+GF GAA GSVGGVGGGGIFVPML+L++
Sbjct  62    RLLRFLWNGK-STYEHVWPEMKFGWKIIVGSIVGFFGAALGSVGGVGGGGIFVPMLTLII  120

Query  722   GFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVT  901
             GFDPKS+TAISKCMIMGAA S+V+YN++LRHP+LDMPIIDYDLA+L+QPMLMLGISIGV 
Sbjct  121   GFDPKSSTAISKCMIMGAAGSTVYYNMRLRHPSLDMPIIDYDLALLLQPMLMLGISIGVA  180

Query  902   FNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAA--NGSGGQGEY  1075
             FNVIFADWMVTVLLI+LF+GTS+KA  +G+ETWKKET+MKKEAA+QL +    S  +GEY
Sbjct  181   FNVIFADWMVTVLLIILFVGTSSKALFKGIETWKKETLMKKEAAKQLESEFKPSESEGEY  240

Query  1076  KLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTL  1255
             + LP GP     DT        V ++ NVYWKE GLL FVWV+FLA+QIVK YT TCS  
Sbjct  241   RPLPTGPLANVDDT--------VPMLRNVYWKELGLLMFVWVAFLAIQIVKTYTVTCSIE  292

Query  1256  YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  1435
             YW++N LQIPV++ V+L+EA  LYKG R I+SKG   ++ +   L  YC  G++AG+VGG
Sbjct  293   YWILNFLQIPVAVSVSLYEAVCLYKGTRVIASKGKEITSWKPHLLFFYCCCGIVAGIVGG  352

Query  1436  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  1615
             LLGLGGGFI+GPLFLELG+PPQV+SAT+TF+M FSSSMSVV+YYLLKRFPVPYA +  +V
Sbjct  353   LLGLGGGFILGPLFLELGIPPQVASATSTFSMTFSSSMSVVQYYLLKRFPVPYAAYFVSV  412

Query  1616  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  1795
             AT+AA +GQHVVRR+IA+LGRAS+IIFILA TIFVSAISLGGVGI+NMIEK+ N +YMGF
Sbjct  413   ATIAALVGQHVVRRVIALLGRASIIIFILAMTIFVSAISLGGVGIANMIEKLENKDYMGF  472

Query  1796  ENLC  1807
             +NLC
Sbjct  473   DNLC  476



>ref|XP_010048101.1| PREDICTED: uncharacterized protein LOC104436944 isoform X1 [Eucalyptus 
grandis]
 gb|KCW80235.1| hypothetical protein EUGRSUZ_C01582 [Eucalyptus grandis]
Length=474

 Score =   484 bits (1246),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 299/471 (63%), Positives = 377/471 (80%), Gaps = 12/471 (3%)
 Frame = +2

Query  413   RPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHI  592
             R ++ + +  L+A  FVSA+RSL+ E + G       + +Y    V++LW+  +S Y H+
Sbjct  12    RLVLMVLFQVLVAMVFVSADRSLRLESM-GLGGMEKPESNYFLRAVDYLWKLNQSSYQHV  70

Query  593   WPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMG  772
             WPEM  GW IV+G++IG  GAAFGSVGGVGGGGIFVPMLSLV+GFDPKS+TAISKCMIMG
Sbjct  71    WPEMSFGWRIVVGTVIGIFGAAFGSVGGVGGGGIFVPMLSLVIGFDPKSSTAISKCMIMG  130

Query  773   AAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVL  952
             AA+S+V YNLKLRHPTLD+P+IDYDL +LIQPMLMLGISIGV FN+IFADWMVT+L+I+L
Sbjct  131   AAISTVVYNLKLRHPTLDIPLIDYDLVLLIQPMLMLGISIGVVFNLIFADWMVTILIILL  190

Query  953   FIGTSTKAFLRGVETWKKETIMKKEAAQQL---AANGSGGQGEYKLLPGGPGNGTQDTAK  1123
              +GTSTKAF + +ETW++ET++K+EAA++L   A + S  Q E +LLP  P + T+ T  
Sbjct  191   SLGTSTKAFFKALETWRRETVLKEEAAKRLESSAEDDSNAQLEQRLLP-QPASSTKKT--  247

Query  1124  ESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVA  1303
                  QVS++EN+ WKE  L+ FVWV++L LQI  N T+TCST YWV+N LQ+PVS+GV 
Sbjct  248   -----QVSLLENIRWKEVALITFVWVAYLILQISMNQTATCSTAYWVLNFLQVPVSIGVF  302

Query  1304  LFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflE  1483
              +EA  LYKGWR I+SKG+ G   +  +L+ YC  G++AG++GGLLG+GGGF+MGPLFLE
Sbjct  303   AYEAISLYKGWRVIASKGEKGKKWQVRELLAYCGCGVLAGIIGGLLGIGGGFVMGPLFLE  362

Query  1484  LGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLI  1663
             LG+PP+VSSATATF M +SSSMSVVEYYLLKRFPVPYAL+   VATVAAF+GQH+VR+LI
Sbjct  363   LGIPPEVSSATATFGMTYSSSMSVVEYYLLKRFPVPYALYFILVATVAAFVGQHIVRKLI  422

Query  1664  AVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  1816
              + GRAS+IIFIL+FTIFVSAI LGGVG+SNMI KI  HEYMGF+NLC +G
Sbjct  423   IITGRASIIIFILSFTIFVSAILLGGVGLSNMIGKIERHEYMGFDNLCNFG  473



>ref|XP_006340601.1| PREDICTED: uncharacterized protein LOC102601548 [Solanum tuberosum]
Length=476

 Score =   483 bits (1243),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 306/473 (65%), Positives = 379/473 (80%), Gaps = 20/473 (4%)
 Frame = +2

Query  428   LSWS-FLLASAFVSAER-SLKN--EEVAGTNVSRNSDDD-----YLSTFVNFLWQPKESG  580
             L W  F+++   ++AER +LK+  E  A  N+S   +++     +    V+FLW  K S 
Sbjct  12    LCWGLFIISDVGINAERLTLKDKLEPTATYNISYVENNEMRPHGFAVRLVHFLWSGKSS-  70

Query  581   YDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKC  760
             Y+H+WPEME GW +++GSI+GF GAA GSVGGVGGGGIFVPML+L++GFDPKS+TAISKC
Sbjct  71    YEHVWPEMEFGWRVIVGSIVGFFGAALGSVGGVGGGGIFVPMLTLIIGFDPKSSTAISKC  130

Query  761   MIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVL  940
             MIMGAA S+V+YN++LRHPTLDMPIIDYDLA+L+QPMLMLGISIGV FNVIFADWMVTVL
Sbjct  131   MIMGAAGSTVYYNMRLRHPTLDMPIIDYDLALLLQPMLMLGISIGVAFNVIFADWMVTVL  190

Query  941   LIVLFIGTSTKAFLRGVETWKKETIMKKEAAQ-QLAAN-GSGGQGEYKLLPGGPGNGTQD  1114
             LI+LF+GTSTKA  +G+ETWKKETIMKKEA + QL +      +GEYKLLP GP     D
Sbjct  191   LIILFVGTSTKALFKGIETWKKETIMKKEATKMQLESEYKPESEGEYKLLPTGPLACVDD  250

Query  1115  TAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSL  1294
             T        V ++ NVYWKE GLL FVWV+FLA+QIVK YT TCS  YW++NLLQ+PV++
Sbjct  251   T--------VPMLRNVYWKELGLLMFVWVAFLAIQIVKTYTVTCSIGYWILNLLQVPVAV  302

Query  1295  GVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgpl  1474
              V+L+EA  LYKG R I+SKG   +N +   L  YC  G++AG+VGGLLGLGGGFI+GPL
Sbjct  303   SVSLYEAICLYKGTRVIASKGKEITNWKPHLLFFYCCCGIVAGIVGGLLGLGGGFILGPL  362

Query  1475  flELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVR  1654
             FLELG+PPQV+SAT+TF+M FSSSMSVV+YYLLKRFPVPYA +  ++AT+AA +GQHV+R
Sbjct  363   FLELGIPPQVASATSTFSMTFSSSMSVVQYYLLKRFPVPYATYFVSIATIAAVVGQHVIR  422

Query  1655  RLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             R+IA+LGRAS+IIFILA TIF SAISLGGVGI+NMIEK+ N +YMGF+NLC +
Sbjct  423   RVIALLGRASIIIFILAMTIFTSAISLGGVGIANMIEKLENQDYMGFDNLCYH  475



>ref|XP_008241663.1| PREDICTED: uncharacterized protein LOC103340075 [Prunus mume]
Length=482

 Score =   483 bits (1242),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 298/460 (65%), Positives = 370/460 (80%), Gaps = 12/460 (3%)
 Frame = +2

Query  437   SFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGW  616
             + L+ S   SAER LK+E+     + ++  + +    VNFLWQ   S Y  +WPEM+ GW
Sbjct  29    NLLMTSEVASAERPLKDEK-PTKFIEQDIHEAFFVKVVNFLWQAGGSSYQPVWPEMKFGW  87

Query  617   EIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHY  796
             +IV+GSI+GF GAA GSVGGVGGGGIFVPML+L++GFDPKS+TAISKCMIMGAA S+V++
Sbjct  88    KIVVGSIVGFFGAALGSVGGVGGGGIFVPMLALIIGFDPKSSTAISKCMIMGAAGSTVYF  147

Query  797   NLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKA  976
             NL+LRHPTLDMP+IDYDLA+L QPMLMLGISIGV FNV+FADWMVTVLLI+LF+GT+ KA
Sbjct  148   NLRLRHPTLDMPLIDYDLALLFQPMLMLGISIGVAFNVMFADWMVTVLLIILFLGTAAKA  207

Query  977   FLRGVETWKKETIMKKEAAQQLAANGSGGQG---EYKLLPGGPGNGTQDTAKESSEKQVS  1147
              ++G+ETWKKET+MKKEA +QL +    G G   +YK LPGGP +  QD       +QV 
Sbjct  208   LMKGIETWKKETMMKKEAEKQLESESKPGDGSGEDYKPLPGGPAS-LQD-------EQVP  259

Query  1148  IIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLY  1327
             I  NVYWKE  +L +VWV+FL +QIVK YT TCST++WV+N LQ+P+++ V LFEA  L 
Sbjct  260   ISHNVYWKELLMLVYVWVAFLIVQIVKTYTETCSTMFWVLNSLQVPIAVSVTLFEAICLC  319

Query  1328  KGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVs  1507
             KG R I+SKG   +N +  Q+ +YC  G++AG+VGGLLGLGGGFI+GPLFLELG+PPQV+
Sbjct  320   KGTRVIASKGKEITNWKLHQIFLYCSCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVA  379

Query  1508  satatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASL  1687
             SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++IAV+GRAS+
Sbjct  380   SATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKIIAVVGRASI  439

Query  1688  IIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             +IFILA TIFVSAISLGGVGI+NM+EK+ N EYMGFEN C
Sbjct  440   VIFILALTIFVSAISLGGVGIANMVEKMENQEYMGFENFC  479



>ref|XP_008651296.1| PREDICTED: uncharacterized protein LOC100279247 isoform X1 [Zea 
mays]
 tpg|DAA61108.1| TPA: hypothetical protein ZEAMMB73_890925 [Zea mays]
Length=470

 Score =   479 bits (1234),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 298/426 (70%), Positives = 353/426 (83%), Gaps = 2/426 (0%)
 Frame = +2

Query  536   LSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSL  715
             L    N +W    + Y H+WP ME GW+IV+GS+IGF GAAFGSVGGVGGGGIFVPML+L
Sbjct  45    LRKVANLMWNGDGNSYQHVWPPMEFGWQIVLGSLIGFFGAAFGSVGGVGGGGIFVPMLTL  104

Query  716   VVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIG  895
             ++GFDPKS+TAISKCMIMGA+VS+V+YNLKL+HPTLDMP+IDYDLAVL+QPMLMLGISIG
Sbjct  105   IIGFDPKSSTAISKCMIMGASVSTVYYNLKLKHPTLDMPVIDYDLAVLMQPMLMLGISIG  164

Query  896   VTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEY  1075
             V FNVIF DW+VTVLLI+LF+GTSTKAFL+G+ETWKKET++++EAA+ L    +G + EY
Sbjct  165   VIFNVIFPDWLVTVLLIILFLGTSTKAFLKGIETWKKETVIQREAAKLLEQT-AGEEAEY  223

Query  1076  KLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTL  1255
               LP GP       A  S E   S+I+N++WK+ GLL FVWV+FL LQ+ KNYT+TCS  
Sbjct  224   AALPTGPDVAANKKALTSDEAP-SLIKNIHWKKVGLLSFVWVAFLVLQVTKNYTATCSPW  282

Query  1256  YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  1435
             YWV+NLLQ+PVS+GV L+E  GL  G R +SSKG   + ++  Q++VY  FG+ AG+VGG
Sbjct  283   YWVLNLLQVPVSVGVTLYEGFGLMSGKRVLSSKGSGQTTMKFHQVVVYGLFGIAAGLVGG  342

Query  1436  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  1615
             LLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYA++   V
Sbjct  343   LLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLNRFPVPYAVYFIVV  402

Query  1616  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  1795
             A VAA IGQHVVR+LI  LGRASLIIFILAF IFVSAISLGGVG+SNM+ KI  HEYMGF
Sbjct  403   AFVAAIIGQHVVRKLINWLGRASLIIFILAFMIFVSAISLGGVGVSNMVHKIERHEYMGF  462

Query  1796  ENLCKY  1813
             E+LCKY
Sbjct  463   EDLCKY  468



>ref|XP_007216479.1| hypothetical protein PRUPE_ppa024737mg [Prunus persica]
 gb|EMJ17678.1| hypothetical protein PRUPE_ppa024737mg [Prunus persica]
Length=489

 Score =   480 bits (1235),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 305/483 (63%), Positives = 381/483 (79%), Gaps = 7/483 (1%)
 Frame = +2

Query  386   GAGGKWRILR--PLVALSWSFLLASAF-VSAERSLKNEEVAGTNVSRNSDDDYLSTFVNF  556
               G +W  LR   ++ ++   +LASA   S E+   +           SD D  +   NF
Sbjct  5     AVGAEWSGLRWTAILLVTGFLVLASAQGTSLEQDDASSRYINGTQKFQSDTDLFTRVFNF  64

Query  557   LWQ--PKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFD  730
             LWQ  P    Y+H+WPEM+LGW+IV+G++IGF GAAFG+VGGVGGGGIFVPML+L++GFD
Sbjct  65    LWQQDPGLWSYEHVWPEMKLGWKIVVGTVIGFFGAAFGTVGGVGGGGIFVPMLTLIIGFD  124

Query  731   PKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNV  910
              KS+TAISKCMI GAA SSV YNL+LRHPTLD+P+IDYDLA+L QPML+LGISIGV FNV
Sbjct  125   QKSSTAISKCMITGAAFSSVIYNLRLRHPTLDLPLIDYDLALLFQPMLVLGISIGVAFNV  184

Query  911   IFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAA-QQLAANGSGGQG-EYKLL  1084
             IFADWM+TVLLI+ FIGTST+AF +G+ETWKKETI+K+EAA +Q+ +NG   +  EYK L
Sbjct  185   IFADWMITVLLIITFIGTSTRAFYKGIETWKKETIIKEEAARRQMQSNGDPREEVEYKPL  244

Query  1085  PGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWV  1264
             PGGP  GT    +E    +V IIEN+YWKE  +L  VWV  L LQI KNYT+TCS  YW 
Sbjct  245   PGGPSIGTPTEIREPKRTEVPIIENLYWKELLVLVAVWVIILVLQISKNYTTTCSATYWA  304

Query  1265  VNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllg  1444
             +NLLQ+PV+ GV ++EA  LY G R I+SKG+S ++ +  QL++Y   G+IAG+VGGLLG
Sbjct  305   LNLLQLPVAFGVTIYEAVNLYTGRRVIASKGESNTDWKVHQLVLYSACGIIAGIVGGLLG  364

Query  1445  lgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatv  1624
             LGGGFI+GP+FLELG+PPQVSSATATFAM FS+SMSV+EYYLL+RFPVPYAL+L AVAT+
Sbjct  365   LGGGFILGPVFLELGIPPQVSSATATFAMTFSASMSVIEYYLLRRFPVPYALYLAAVATL  424

Query  1625  aafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENL  1804
             +A +GQHVVR+++ +LGRAS+IIFILAFTIFVSAISLGGVGI++M+EKI + EYMGFEN+
Sbjct  425   SAIVGQHVVRKVVMILGRASIIIFILAFTIFVSAISLGGVGIADMVEKIEHKEYMGFENI  484

Query  1805  CKY  1813
             C Y
Sbjct  485   CTY  487



>ref|XP_004302906.1| PREDICTED: uncharacterized protein LOC101294092 [Fragaria vesca 
subsp. vesca]
Length=479

 Score =   479 bits (1233),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 298/472 (63%), Positives = 375/472 (79%), Gaps = 8/472 (2%)
 Frame = +2

Query  416   PLVALSWS-------FLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKE  574
             P   L WS       FL+ +  + + +    ++ +  + +      YL+  ++F+W+P +
Sbjct  7     PWCGLRWSMGVVVAGFLVVALVIGSVQDTIQQDASTYSGAEKFQSGYLNRVLSFVWRPGQ  66

Query  575   SGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAIS  754
              GY  +WPEME GW IV+G+IIGF+GAAFG+VGGVGGGGIFVPML+L++GFD KS+TA+S
Sbjct  67    LGYVAVWPEMEFGWRIVVGTIIGFIGAAFGTVGGVGGGGIFVPMLTLIIGFDDKSSTALS  126

Query  755   KCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVT  934
             KCMI G A ++V YNL+LRHPTLD+PIIDYDLA+L+QPMLMLGISIGV+FNVIFADWM+T
Sbjct  127   KCMITGGAAATVFYNLRLRHPTLDLPIIDYDLALLVQPMLMLGISIGVSFNVIFADWMIT  186

Query  935   VLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQG-EYKLLPGGPGNGTQ  1111
             VLLIV+F+GTSTKAF +GVE+WK+ETI+KKE A+++  NGSG +  EY+ LPG P N + 
Sbjct  187   VLLIVIFLGTSTKAFFKGVESWKRETILKKEVARRMQLNGSGSEEVEYRPLPGTPINSSL  246

Query  1112  DTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVS  1291
                 ES  K+V IIEN+YWKE GLL  VW+  LALQI K YT+TCS  YWV+NL+QIPV+
Sbjct  247   SGRNESKRKEVPIIENIYWKELGLLVAVWILILALQIAKYYTTTCSVAYWVLNLMQIPVA  306

Query  1292  LGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgp  1471
              G + +EA  LY G R ISS+  S  + +   L++YC  G+IAG+VGGLLGLGGGFI+GP
Sbjct  307   FGASSYEAVRLYYGQRVISSQDVSSMDWKVHHLVLYCGCGIIAGIVGGLLGLGGGFILGP  366

Query  1472  lflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVV  1651
             LFLELG+PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+ TAVA+ AA +GQHVV
Sbjct  367   LFLELGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYFTAVASFAALVGQHVV  426

Query  1652  RRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             R++I +LGRAS+IIFILA TIFVSAISLGGVGI++ I+KI N+EYMGFEN+C
Sbjct  427   RKVINILGRASIIIFILAATIFVSAISLGGVGIADTIQKIENNEYMGFENIC  478



>ref|XP_009631525.1| PREDICTED: uncharacterized protein LOC104121277 [Nicotiana tomentosiformis]
Length=480

 Score =   478 bits (1229),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 298/462 (65%), Positives = 366/462 (79%), Gaps = 11/462 (2%)
 Frame = +2

Query  428   LSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEME  607
             + W     S   +AER LK EE     V +     +    +  +W  K S Y+H+WPEM+
Sbjct  25    ICWGLFTISDVGNAERLLKTEEPTYV-VEKEMRQGFALRLLRLMWNGK-SSYEHVWPEMK  82

Query  608   LGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSS  787
              GW I++GSI+GF GAA GSVGGVGGGGIFVPML+L++GFDPKS+TAISKCMIMGAA S+
Sbjct  83    FGWRIIVGSIVGFFGAALGSVGGVGGGGIFVPMLTLIIGFDPKSSTAISKCMIMGAAGST  142

Query  788   VHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTS  967
             V+YN++LRHP+LDMPIIDYDLA+L+QPMLMLGISIGV FNVIFADWMVTVLLI+LF+GTS
Sbjct  143   VYYNMRLRHPSLDMPIIDYDLALLLQPMLMLGISIGVAFNVIFADWMVTVLLIILFVGTS  202

Query  968   TKAFLRGVETWKKETIMKKEAAQQLAA--NGSGGQGEYKLLPGGPGNGTQDTAKESSEKQ  1141
             TKA  +G+ETWKKET+MK+EAA+QL +    S  +GEY+ LP GP     D         
Sbjct  203   TKALFKGIETWKKETLMKREAAKQLESEFKPSESEGEYRPLPIGPSAYNVD-------DT  255

Query  1142  VSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATG  1321
             V ++ NVYWKE GLL FVWV+FLA+QIVK YT TCS  YW++N LQ+PV++ V+L+EA  
Sbjct  256   VPMLRNVYWKELGLLMFVWVAFLAIQIVKTYTVTCSIEYWILNFLQVPVAVSVSLYEAVC  315

Query  1322  LYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQ  1501
             LYKG R I+SKG   ++ +   L  YC  G++AG+VGGLLGLGGGFI+GPLFLELG+PPQ
Sbjct  316   LYKGTRVIASKGKEITSWKPHLLFFYCCCGIVAGIVGGLLGLGGGFILGPLFLELGIPPQ  375

Query  1502  VssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRA  1681
             V+SAT+TF+M FSSSMSVV+YYLLKRFPVPYA +  +VAT+AA +GQHVVRR+IA+LGRA
Sbjct  376   VASATSTFSMTFSSSMSVVQYYLLKRFPVPYAAYFVSVATIAALVGQHVVRRVIALLGRA  435

Query  1682  SLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             S+IIFILA TIFVSAISLGGVGI+NMIEK+ N +YMGF+NLC
Sbjct  436   SIIIFILAMTIFVSAISLGGVGIANMIEKLENKDYMGFDNLC  477



>gb|KDO79521.1| hypothetical protein CISIN_1g011797mg [Citrus sinensis]
Length=477

 Score =   477 bits (1228),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 292/452 (65%), Positives = 360/452 (80%), Gaps = 11/452 (2%)
 Frame = +2

Query  464   SAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIg  643
             +AER LK+++       + +   +L    +FLWQ  ES Y+ +WPEM+ GW++V+GSI+G
Sbjct  32    NAERLLKDKDPQVFADEKETRPGFLCRVAHFLWQSGESSYEPVWPEMQFGWKVVVGSIVG  91

Query  644   fmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTL  823
             F GAA GSVGGVGGGGIFVPML+L++GFDPKSATAISKCMIMGAA S+V+YNL+LRHPTL
Sbjct  92    FFGAALGSVGGVGGGGIFVPMLTLIIGFDPKSATAISKCMIMGAAGSTVYYNLRLRHPTL  151

Query  824   DMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWK  1003
             DMP+IDYDLA+L QPMLMLGISIGV FNV+FADWMVTVLLI+LFIGTSTKA  +G++TWK
Sbjct  152   DMPLIDYDLALLFQPMLMLGISIGVAFNVMFADWMVTVLLIILFIGTSTKALFKGIDTWK  211

Query  1004  KETIMKKEAAQQLAANGSGGQ---GEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKE  1174
             KET+MKKEAA+ L +          +YK LP GP            +++V II+N+YWKE
Sbjct  212   KETMMKKEAAKVLESESKAADVDGQDYKQLPSGPST--------VHDEEVPIIKNIYWKE  263

Query  1175  FGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSK  1354
               LL +VW+ FLA+Q+ K Y   CS  YW++N LQ+P+++ VALFEA  LYKG R I+SK
Sbjct  264   LSLLLYVWLGFLAVQLAKEYVVPCSITYWILNALQVPIAVSVALFEAICLYKGTRVIASK  323

Query  1355  GDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfamm  1534
             G   +N +  Q++ YCF G++AG+VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM 
Sbjct  324   GKEITNWKIHQIVFYCFCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMT  383

Query  1535  fsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTI  1714
             FSSSMSVV+YYLL RFPVPYA F T VAT AAF GQHVVR++IAVLGRAS+I+FILA TI
Sbjct  384   FSSSMSVVQYYLLDRFPVPYAAFFTLVATFAAFAGQHVVRKIIAVLGRASIIVFILALTI  443

Query  1715  FVSAISLGGVGISNMIEKIHNHEYMGFENLCK  1810
             FVSAISLGG GI NM++K+ N EYMGFENLC+
Sbjct  444   FVSAISLGGFGIENMVKKLKNQEYMGFENLCQ  475



>ref|XP_007046967.1| Sulfite exporter TauE/SafE family protein, putative isoform 1 
[Theobroma cacao]
 gb|EOX91124.1| Sulfite exporter TauE/SafE family protein, putative isoform 1 
[Theobroma cacao]
Length=476

 Score =   476 bits (1225),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 302/475 (64%), Positives = 370/475 (78%), Gaps = 18/475 (4%)
 Frame = +2

Query  413   RPLVALSWSFLLASAFVS----AERSLK---NEEVAGTNVSRNSDDDYLSTFVNFLWQPK  571
             R L  ++W   L    +S    AER LK   N+ V   N + N+    L    NFLWQ  
Sbjct  9     RSLAIMAWVVFLVLVMMSNVGIAERLLKDKRNQRVFKDNENENTRG-LLVRVANFLWQGG  67

Query  572   ESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAI  751
             +S Y+ +WPE+E GW+IV+GSI+GF+GAA GSVGGVGGGGIFVPML+L++GFDPKS+TAI
Sbjct  68    KSSYEPVWPELEFGWKIVVGSIVGFLGAALGSVGGVGGGGIFVPMLTLIIGFDPKSSTAI  127

Query  752   SKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMV  931
             SKCMIMGAA S+V+YNL+LRHPTL+MP+IDYDLA+L QPMLMLGISIGV  NV+FADWMV
Sbjct  128   SKCMIMGAAGSTVYYNLRLRHPTLEMPLIDYDLALLFQPMLMLGISIGVALNVMFADWMV  187

Query  932   TVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAA--QQLAANGSGGQGEYKLLPGGPGNG  1105
             TVLLI+LFIGTSTKA  +G++TWKKET+MKKEAA  +  +    G   +YK LP GPG  
Sbjct  188   TVLLIILFIGTSTKALFKGIDTWKKETMMKKEAAKLESESKPADGAAQDYKRLPSGPGTL  247

Query  1106  TQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIP  1285
               D        +V ++ N+YWKE  LL +VW+ FL +QIVK Y  TCS +YW+VN LQIP
Sbjct  248   PDD--------EVPLLRNIYWKELSLLMYVWIGFLIVQIVKEYVPTCSVVYWIVNSLQIP  299

Query  1286  VSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfim  1465
             ++  V LFEA  LYKG R I+SKG   +N +  Q+++YC  G+IAG+VGGLLGLGGGFI+
Sbjct  300   IAASVTLFEAICLYKGTRVIASKGKEVTNWKIYQILLYCSCGIIAGMVGGLLGLGGGFIL  359

Query  1466  gplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQH  1645
             GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQH
Sbjct  360   GPLFLELGIPPQVASATSTFAMVFSSSMSVVQYYLLNRFPVPYAAYFVLVATIAAFTGQH  419

Query  1646  VVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  1810
             VVR++IAVLGRAS+IIFILA TIF+SAISLGGVGI++M+EK+ N EYMGFENLCK
Sbjct  420   VVRKIIAVLGRASIIIFILALTIFISAISLGGVGIADMVEKLENEEYMGFENLCK  474



>ref|XP_006425693.1| hypothetical protein CICLE_v10025446mg [Citrus clementina]
 ref|XP_006466780.1| PREDICTED: uncharacterized protein LOC102622706 [Citrus sinensis]
 gb|ESR38933.1| hypothetical protein CICLE_v10025446mg [Citrus clementina]
Length=477

 Score =   476 bits (1225),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 291/452 (64%), Positives = 360/452 (80%), Gaps = 11/452 (2%)
 Frame = +2

Query  464   SAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIg  643
             +AER LK+++       + +   +L    +FLWQ  ES Y+ +WPEM+ GW++V+GSI+G
Sbjct  32    NAERLLKDKDPQVFADEKETRPGFLCRVAHFLWQSGESSYEPVWPEMQFGWKVVVGSIVG  91

Query  644   fmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTL  823
             F GAA GSVGGVGGGGIFVPML+L++GFDPKSATAISKCMIMGAA S+V+YNL+LRHPTL
Sbjct  92    FFGAALGSVGGVGGGGIFVPMLTLIIGFDPKSATAISKCMIMGAAGSTVYYNLRLRHPTL  151

Query  824   DMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWK  1003
             DMP+IDYDLA+L QPMLMLGISIGV FNV+FADWMVTVLLI+LFIGTSTKA  +G++TWK
Sbjct  152   DMPLIDYDLALLFQPMLMLGISIGVAFNVMFADWMVTVLLIILFIGTSTKALFKGIDTWK  211

Query  1004  KETIMKKEAAQQLAANGSGGQ---GEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKE  1174
             KET+MKKEAA+ L +          +YK LP GP            +++V +I+N+YWKE
Sbjct  212   KETMMKKEAAKVLESESKAADVDGQDYKQLPSGPST--------LHDEEVPVIKNIYWKE  263

Query  1175  FGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSK  1354
               LL +VW+ FLA+Q+ K Y   CS  YW++N LQ+P+++ VALFEA  LYKG R I+SK
Sbjct  264   LSLLLYVWLGFLAVQLAKEYVVPCSITYWILNALQVPIAVSVALFEAICLYKGTRVIASK  323

Query  1355  GDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfamm  1534
             G   +N +  Q++ YCF G++AG+VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM 
Sbjct  324   GKEITNWKIHQIVFYCFCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMT  383

Query  1535  fsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTI  1714
             FSSSMSVV+YYLL RFPVPYA F T VAT AAF GQHVVR++IAVLGRAS+I+FILA TI
Sbjct  384   FSSSMSVVQYYLLDRFPVPYAAFFTLVATFAAFAGQHVVRKIIAVLGRASIIVFILALTI  443

Query  1715  FVSAISLGGVGISNMIEKIHNHEYMGFENLCK  1810
             FVSAISLGG GI NM++K+ N EYMGFENLC+
Sbjct  444   FVSAISLGGFGIENMVKKLKNQEYMGFENLCQ  475



>ref|XP_008338105.1| PREDICTED: uncharacterized protein LOC103401168 isoform X2 [Malus 
domestica]
Length=484

 Score =   476 bits (1226),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 293/461 (64%), Positives = 370/461 (80%), Gaps = 12/461 (3%)
 Frame = +2

Query  437   SFLLASAFVSAERSLKNEEVAG-TNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELG  613
             + L+ +   SA+R L++E +    +V +++ + +    VNFLWQ   S Y  +WPEM+  
Sbjct  29    NLLIITEVASADRPLRDEIIKPEKSVQKDTHESFFVRVVNFLWQAGGSSYQPVWPEMKFD  88

Query  614   WEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVH  793
             W+IV+GSI+GF GAA GSVGGVGGGGIFVPML+L+VGFDPKS+TAISKCMIMGAA S+V+
Sbjct  89    WKIVVGSIVGFFGAALGSVGGVGGGGIFVPMLALIVGFDPKSSTAISKCMIMGAAGSTVY  148

Query  794   YNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTK  973
             +NL+LRHPTLDMP+IDYDLA+L QPMLMLGISIGV FNV+FADWMVTVLLI+LF+GT+ K
Sbjct  149   FNLRLRHPTLDMPLIDYDLALLFQPMLMLGISIGVAFNVMFADWMVTVLLIILFLGTAAK  208

Query  974   AFLRGVETWKKETIMKKEAAQQLAANGSGGQG---EYKLLPGGPGNGTQDTAKESSEKQV  1144
             A ++GVETWKKET+MK+EA + L +    G+G   +YK LP  P +  QD       +QV
Sbjct  209   ALMKGVETWKKETMMKEEAEKLLESESKPGEGSGEDYKPLPSSP-DSLQD-------EQV  260

Query  1145  SIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGL  1324
              I+ N+YWKE  LL +VWV+FL +QIVK YT TCST++W++N LQ+P+++ V LFEA  L
Sbjct  261   PIMRNIYWKELSLLMYVWVAFLIVQIVKTYTKTCSTMFWIMNSLQVPIAISVTLFEAICL  320

Query  1325  YKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQV  1504
              KG R I+SKG   +N +  Q+ +YC  G++AG+VGGLLGLGGGFI+GPLFLELG+PPQV
Sbjct  321   CKGTRVIASKGKEITNWKLHQIFLYCSCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQV  380

Query  1505  ssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRAS  1684
             +SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++IAVLGRAS
Sbjct  381   ASATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKIIAVLGRAS  440

Query  1685  LIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             ++IFILA TIFVSAISLGGVGI+NM+EK+ N EYMGFEN C
Sbjct  441   IVIFILALTIFVSAISLGGVGIANMVEKMENQEYMGFENFC  481



>ref|XP_002521607.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40878.1| conserved hypothetical protein [Ricinus communis]
Length=478

 Score =   476 bits (1225),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 297/456 (65%), Positives = 364/456 (80%), Gaps = 12/456 (3%)
 Frame = +2

Query  452   SAFVSAERSL-KNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVI  628
             S F SAER L K +      V    +  +L    +FLWQ  +S Y+ +WPEME  ++IV+
Sbjct  30    SNFTSAERLLFKEQNHTKVLVDHEKEKSFLQKAAHFLWQSGKSSYEPVWPEMEFNYKIVV  89

Query  629   GSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKL  808
             G+I+GF+GAA GSVGGVGGGGIFVPML+L++GFDPKS+TAISKCMIMGAA S+V+YN++L
Sbjct  90    GTIVGFLGAALGSVGGVGGGGIFVPMLTLLIGFDPKSSTAISKCMIMGAAGSTVYYNMRL  149

Query  809   RHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRG  988
             RHPTLDMP+IDYDLA+L QPMLMLGISIGV FNV+FADWMVTVLLI+LFIGTSTKA  +G
Sbjct  150   RHPTLDMPLIDYDLALLFQPMLMLGISIGVAFNVMFADWMVTVLLIILFIGTSTKALFKG  209

Query  989   VETWKKETIMKKEAAQQLAANGSGGQGE---YKLLPGGPGNGTQDTAKESSEKQVSIIEN  1159
             ++TWKKE++MKKEAA+QL +      GE   YK LP GP       A E  E  +S+ +N
Sbjct  210   IDTWKKESMMKKEAARQLESESKPNDGEGQDYKPLPSGP------VALEDEE--ISLFQN  261

Query  1160  VYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWR  1339
             +YWKE  LL +VWV FLA+QIVK+Y  TCS  YW++N LQ+P++  V LFEA  L KG R
Sbjct  262   IYWKELALLVYVWVGFLAVQIVKSYVRTCSVAYWILNALQVPIAASVTLFEAICLRKGTR  321

Query  1340  KISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssata  1519
              I+S+G   +N +  Q+++YC  G+IAG+VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+
Sbjct  322   VIASRGKEITNWKYHQILLYCSCGIIAGMVGGLLGLGGGFILGPLFLELGIPPQVASATS  381

Query  1520  tfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFI  1699
             TFAM+FSSSMSVV+YYLLKRFPVPYA F   VATVAA +GQHVVR++IA+LGRAS+IIFI
Sbjct  382   TFAMVFSSSMSVVQYYLLKRFPVPYATFFVLVATVAALVGQHVVRKIIAILGRASIIIFI  441

Query  1700  LAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             LA TIFVSAISLGGVGI +M+EK+ N EYMGFENLC
Sbjct  442   LALTIFVSAISLGGVGIVDMVEKLTNEEYMGFENLC  477



>gb|AEI98632.1| hypothetical protein 111018.19 [Coffea canephora]
Length=465

 Score =   475 bits (1223),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 297/458 (65%), Positives = 360/458 (79%), Gaps = 20/458 (4%)
 Frame = +2

Query  434   WSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELG  613
             W    AS   SAER LK  E  G  V +     ++   V+FLWQ  +S Y H+WPEME G
Sbjct  25    WILFTASDIGSAERLLKTVE-PGHIVEKEMRQGFIVRLVHFLWQSGKSSYQHVWPEMEFG  83

Query  614   WEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVH  793
             W++V+G+++GF+GAA GSVGGVGGGGIFVPMLSL++GFDPKS+TAISKCMIMGAA S+V+
Sbjct  84    WKLVVGTVVGFLGAALGSVGGVGGGGIFVPMLSLIIGFDPKSSTAISKCMIMGAAGSTVY  143

Query  794   YNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTK  973
             YNL+LRHPTLD+P+IDYDLA+L QPMLMLGISIGV FNVIFADWMVTVLLI+LFIGTS+K
Sbjct  144   YNLRLRHPTLDLPLIDYDLALLFQPMLMLGISIGVAFNVIFADWMVTVLLILLFIGTSSK  203

Query  974   AFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSII  1153
             AF +G+ETW KET MK            G   EYK LPGGP           ++++V ++
Sbjct  204   AFFKGLETWNKETKMKL-----------GPGNEYKPLPGGPA--------AHADEKVPLL  244

Query  1154  ENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKG  1333
              N+YWKE  LL FVW++FLA+QI+K YT TCS  YW +N LQ+P++  V+L+EAT LYKG
Sbjct  245   YNIYWKELCLLLFVWIAFLAIQIMKTYTQTCSAKYWTLNFLQVPIAASVSLYEATCLYKG  304

Query  1334  WRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssa  1513
              R I+SKG   +  +   + +YC  G++AGVVGGLLGLGGGF++GPLFLELGVPPQV+SA
Sbjct  305   TRTIASKGKEITVWKPNLIFLYCCLGIVAGVVGGLLGLGGGFVLGPLFLELGVPPQVASA  364

Query  1514  tatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLII  1693
             T+TFAM FSSSMSVV+YYLL RFPVPYA +   VATVAA +GQHVVRR+IA+LGRASLII
Sbjct  365   TSTFAMTFSSSMSVVQYYLLNRFPVPYATYFVLVATVAALVGQHVVRRIIAILGRASLII  424

Query  1694  FILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             FILA TIFVSAISLGGVGI++MIEK+ NHEYMGF+NLC
Sbjct  425   FILALTIFVSAISLGGVGIASMIEKLQNHEYMGFDNLC  462



>ref|XP_002516570.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45911.1| conserved hypothetical protein [Ricinus communis]
Length=465

 Score =   474 bits (1221),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 302/478 (63%), Positives = 373/478 (78%), Gaps = 15/478 (3%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             MA  G K+ +L+  V + +   L     +   S+K+E+V   +      +       + L
Sbjct  1     MAVFGAKFLVLKCTVIVLFFSFLFLLVSAERLSIKHEQVPRLS---GEKEKEKQEAESSL  57

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             WQ   SGY H+WP MELGW++V+GSIIGF GAAFGSVGGVGGGGIFVPML+L++GFDPKS
Sbjct  58    WQSDGSGYQHVWPGMELGWQVVVGSIIGFFGAAFGSVGGVGGGGIFVPMLTLIIGFDPKS  117

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             ATAISKCMIMGAA+S+V+YNLKLRHPTLD+PI+DYDL +LIQP ++LGIS GVT NV F 
Sbjct  118   ATAISKCMIMGAAMSTVYYNLKLRHPTLDLPIVDYDLVLLIQPAVLLGISTGVTLNVFFP  177

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPG  1099
             DW VTVLLI+L IGTS KA+ +GV+TW KET +K+EAA+Q           YKLLPGGP 
Sbjct  178   DWAVTVLLIILLIGTSVKAYFKGVDTWNKETTLKEEAAKQ-----------YKLLPGGPS  226

Query  1100  NGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQ  1279
             N      K + E++V ++EN++WKEF LL F WV++LALQI KNYT+TCST YWV+NLLQ
Sbjct  227   N-VNPRQKHTREREVPVLENIHWKEFALLVFDWVAYLALQIAKNYTATCSTAYWVLNLLQ  285

Query  1280  IPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggf  1459
             +PVS+GV L+ A GLY+G R+I+SKGD G NL+A QL+ +C +G++AG+VGGLLGLGGGF
Sbjct  286   VPVSVGVFLYAAVGLYRGRRRIASKGDEGMNLKAYQLLAFCAYGVMAGIVGGLLGLGGGF  345

Query  1460  imgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIG  1639
             IMGPLFLELG+PPQV+SATATF M FSSSMSV EYYLL RFPVPYAL+  AVAT+AAF G
Sbjct  346   IMGPLFLELGIPPQVTSATATFGMAFSSSMSVAEYYLLSRFPVPYALYFIAVATIAAFAG  405

Query  1640  QHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             QH++ +LIA+ GRASLIIF+LAFTIFVSA++LGGVGISN+I KI   E M F+NLC Y
Sbjct  406   QHIITKLIAITGRASLIIFVLAFTIFVSALTLGGVGISNIIGKIEKGESMEFQNLCNY  463



>ref|XP_008342687.1| PREDICTED: uncharacterized protein LOC103405461 [Malus domestica]
Length=428

 Score =   473 bits (1216),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 286/425 (67%), Positives = 356/425 (84%), Gaps = 3/425 (1%)
 Frame = +2

Query  548   VNFLWQ-PKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVG  724
             +NFLWQ  +   Y+H+WPEM +GW+IV+G+IIGF+G+AFG+VGGVGGGGIFVPML+L++G
Sbjct  2     LNFLWQLGRLFSYEHVWPEMTIGWKIVVGTIIGFLGSAFGTVGGVGGGGIFVPMLTLIIG  61

Query  725   FDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTF  904
             FD KS+TAISKCMI GAA+SSV YNL+LRHPTLD+P+IDYDLA+L QPML+LGISIGV F
Sbjct  62    FDQKSSTAISKCMITGAAISSVFYNLRLRHPTLDLPLIDYDLALLFQPMLVLGISIGVAF  121

Query  905   NVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAAN--GSGGQGEYK  1078
             NVIFA+WM+TVLLI+ F+ TS++AF +G+ETWKKETI+KKEAA+++ +N   +  + EYK
Sbjct  122   NVIFANWMITVLLIITFLATSSRAFFKGIETWKKETIVKKEAARRMQSNCDDASAEVEYK  181

Query  1079  LLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLY  1258
              LPGGP NGT     ES   +VSI EN+YWKE  +L  VW+  L LQI KNYT+TCS  Y
Sbjct  182   PLPGGPSNGTPTETGESKRTEVSIFENLYWKELLILFAVWIIILVLQIAKNYTTTCSAAY  241

Query  1259  WVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggl  1438
             W  NLLQIPV+ GV +FEA  LYKG R I+S+ +S +N    QL++    G+ AG+VGGL
Sbjct  242   WAYNLLQIPVAFGVTIFEAVKLYKGHRVIASRAESNTNWTVNQLVLCSACGITAGIVGGL  301

Query  1439  lglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltava  1618
             LGLGGGFI+GP+FLELG+PPQVSSATATFAM FS+SMSVVEYYLLKRFP+PYAL+ TAVA
Sbjct  302   LGLGGGFILGPVFLELGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPIPYALYFTAVA  361

Query  1619  tvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFE  1798
             T +A +GQ+VVR+++++ GRAS+IIFILAFTIFVSAISLGGVGI++MIEKI + EYMGFE
Sbjct  362   TFSALVGQYVVRKVVSIFGRASIIIFILAFTIFVSAISLGGVGIADMIEKIKHKEYMGFE  421

Query  1799  NLCKY  1813
             N+C Y
Sbjct  422   NICTY  426



>ref|XP_010649158.1| PREDICTED: uncharacterized protein LOC100253061 [Vitis vinifera]
 emb|CBI17534.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   474 bits (1221),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 292/461 (63%), Positives = 368/461 (80%), Gaps = 13/461 (3%)
 Frame = +2

Query  440   FLLASAFVSAERSLKNEEVAGTN-VSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGW  616
              ++ S   +AER LK ++    + V++N +  +LS  V+FLWQ  +S Y H+WP+M+ GW
Sbjct  26    LVMMSGVGNAERLLKADDRPAEHLVNKNKEPGFLSKVVHFLWQSGKSSYQHVWPDMKFGW  85

Query  617   EIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHY  796
             ++V+ SIIGF GAA GSVGGVGGGGIFVPML+L+VGFDPKS+TAISKCMIMGAA S+V+Y
Sbjct  86    KLVVASIIGFFGAALGSVGGVGGGGIFVPMLTLIVGFDPKSSTAISKCMIMGAAGSTVYY  145

Query  797   NLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKA  976
             N++LRHPTLDMPIIDYDLA+L QPMLMLGISIGV FNVIFADWMVTVLLI+LF+GTSTKA
Sbjct  146   NMRLRHPTLDMPIIDYDLALLFQPMLMLGISIGVAFNVIFADWMVTVLLIILFLGTSTKA  205

Query  977   FLRGVETWKKETIMKKEAAQQLAA----NGSGGQGEYKLLPGGPGNGTQDTAKESSEKQV  1144
               +G+ETWKKETIMKKEAA+ L A      + G G+Y+ LP GP     D         V
Sbjct  206   LFKGIETWKKETIMKKEAARLLEAETKPTDNTGGGDYRPLPSGPATIRDD--------HV  257

Query  1145  SIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGL  1324
              +I N+ WKE  LL +VWV+FLA+QIVK YT TCS  YWV+N LQ+P++  V+++EA  L
Sbjct  258   PVIYNICWKELALLVYVWVAFLAVQIVKTYTVTCSIEYWVLNCLQVPIAASVSIYEAVCL  317

Query  1325  YKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQV  1504
             YKG R I+SKG   +N +  Q+ +YC  G++AG+VGGLLGLGGGFI+GPLFLELG+PPQV
Sbjct  318   YKGTRVIASKGKEVTNWKIHQIFLYCSCGIVAGLVGGLLGLGGGFILGPLFLELGIPPQV  377

Query  1505  ssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRAS  1684
             +SAT+TF+M FSSSMSVV+Y+LL+RFPVPYA +   VAT+AA +GQHVVR++I ++GRAS
Sbjct  378   ASATSTFSMAFSSSMSVVQYHLLRRFPVPYASYFVLVATIAALVGQHVVRKVIKLVGRAS  437

Query  1685  LIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             +IIFILA TIF+SAISLGGVGI  M+EK+ N+EYMGF++LC
Sbjct  438   IIIFILALTIFISAISLGGVGIMTMVEKLANNEYMGFDDLC  478



>ref|XP_009371583.1| PREDICTED: uncharacterized protein LOC103960817 isoform X2 [Pyrus 
x bretschneideri]
Length=484

 Score =   474 bits (1221),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 293/461 (64%), Positives = 369/461 (80%), Gaps = 12/461 (3%)
 Frame = +2

Query  437   SFLLASAFVSAERSLKNEEVAGTN-VSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELG  613
             + L+ +   SA+R L++E +     V ++  + +    VNFLWQ   S Y  +WPEM+  
Sbjct  29    NLLIITEVASADRPLRDEIIKPEKFVQKDIHESFFVRVVNFLWQAGGSSYQPVWPEMKFD  88

Query  614   WEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVH  793
             W+IV+GSI+GF GAA GSVGGVGGGGIFVPML+L+VGFDPKS+TAISKCMIMGAA S+V+
Sbjct  89    WKIVLGSIVGFFGAALGSVGGVGGGGIFVPMLALIVGFDPKSSTAISKCMIMGAAGSTVY  148

Query  794   YNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTK  973
             +NL+LRHPTLDMP+IDYDLA+L QPMLMLGISIGV FNV+FADWMVTVLLI+LF+GT+ K
Sbjct  149   FNLRLRHPTLDMPLIDYDLALLFQPMLMLGISIGVAFNVMFADWMVTVLLIILFLGTAAK  208

Query  974   AFLRGVETWKKETIMKKEAAQQLAANGSGGQG---EYKLLPGGPGNGTQDTAKESSEKQV  1144
             A ++G+ETWKKET+MK+EA + L +    G+G   +YK LP GP +  QD       +QV
Sbjct  209   ALMKGMETWKKETMMKEEAEKLLESESKPGEGSGEDYKPLPSGP-DSLQD-------EQV  260

Query  1145  SIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGL  1324
              I+ N+YWKE  LL +VWV+FL +QIVK YT TCST++W++N LQ+P+++ V LFEA  L
Sbjct  261   PIMRNIYWKELSLLMYVWVAFLIVQIVKTYTKTCSTMFWIMNSLQVPIAISVTLFEAICL  320

Query  1325  YKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQV  1504
              KG R I+SKG   +N +  Q+ +YC  G++AG+VGGLLGLGGGFI+GPLFLELG+PPQV
Sbjct  321   CKGTRVIASKGKEITNWKLHQIFLYCSCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQV  380

Query  1505  ssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRAS  1684
             +SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++IAVLGRAS
Sbjct  381   ASATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKIIAVLGRAS  440

Query  1685  LIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             ++IFILA TIFVSAISLGGVGI+NM+EK+ N EYMGFEN C
Sbjct  441   IVIFILALTIFVSAISLGGVGIANMVEKMENQEYMGFENFC  481



>ref|XP_008363111.1| PREDICTED: uncharacterized protein LOC103426807 isoform X2 [Malus 
domestica]
Length=475

 Score =   474 bits (1220),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 293/451 (65%), Positives = 359/451 (80%), Gaps = 13/451 (3%)
 Frame = +2

Query  464   SAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIg  643
             SAER LK+E +          +   +  +NFLWQ   S Y  +WPEM+ GW+IV+GS++G
Sbjct  32    SAERPLKDEIIKPKIFVEQ--EAIFARVINFLWQAGGSSYQPVWPEMKFGWKIVVGSVVG  89

Query  644   fmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTL  823
             F GAA GSVGGVGGGGIFVPML+L+VGFDPKS+TAISKCMIMGAA S+V++NL+LRHPTL
Sbjct  90    FFGAALGSVGGVGGGGIFVPMLALIVGFDPKSSTAISKCMIMGAAGSTVYFNLRLRHPTL  149

Query  824   DMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWK  1003
             DMP+IDYDLA+L QPMLMLGISIGV FNV+FADWMVTVLLI+LF+GT+ KA ++GVETWK
Sbjct  150   DMPLIDYDLALLFQPMLMLGISIGVAFNVVFADWMVTVLLIILFLGTAAKALMKGVETWK  209

Query  1004  KETIMKKEAAQQLAANGSGGQG---EYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKE  1174
             KET+MKKEA   L +     +G   +YK LP GP +        S +++V I  N+YWKE
Sbjct  210   KETMMKKEAENMLESETKQDEGSGEDYKPLPSGPAS--------SQDEEVPITRNIYWKE  261

Query  1175  FGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSK  1354
               LL +VWV+FL +QIVK YT TCST +W++N LQ+P++L V LFEA  L KG R I+SK
Sbjct  262   LSLLMYVWVAFLIVQIVKTYTETCSTTFWIMNSLQVPIALSVTLFEAICLRKGTRVIASK  321

Query  1355  GDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfamm  1534
             G   +N +  Q+ +YC  G++AG+VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+
Sbjct  322   GKEITNWKLHQIFLYCSCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAML  381

Query  1535  fsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTI  1714
             FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++IAVLGRAS+IIFILA TI
Sbjct  382   FSSSMSVVQYYLLNRFPVPYAAYFVVVATIAAFTGQHVVRKIIAVLGRASIIIFILALTI  441

Query  1715  FVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             FVSAISLGGVGI+NM+EK+ N EYMGFEN C
Sbjct  442   FVSAISLGGVGIANMVEKMENREYMGFENFC  472



>ref|XP_004512028.1| PREDICTED: uncharacterized protein LOC101496928 isoform X1 [Cicer 
arietinum]
Length=524

 Score =   476 bits (1224),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 292/447 (65%), Positives = 361/447 (81%), Gaps = 10/447 (2%)
 Frame = +2

Query  467   AERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgf  646
             AER LK +E +  N         L   ++FLW+   S Y+ +WPEM+  W+I++GSI+GF
Sbjct  85    AERVLKEKEQSA-NFVEKERQGVLKAMIDFLWENGRSSYEPVWPEMKFDWKIIVGSIVGF  143

Query  647   mgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLD  826
             +GAA GSVGGVGGGGIFVPML+L++GFDPKS+TAISKCMIMGAA+S+V+YN++LRHPTLD
Sbjct  144   LGAALGSVGGVGGGGIFVPMLALIIGFDPKSSTAISKCMIMGAALSTVYYNMRLRHPTLD  203

Query  827   MPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKK  1006
             MP+IDYDLA+L QPMLMLGISIGV  NV+FADWMVTVLLI+LFI TSTKA  +G++TWKK
Sbjct  204   MPLIDYDLALLFQPMLMLGISIGVICNVMFADWMVTVLLIILFIATSTKALFKGIDTWKK  263

Query  1007  ETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLL  1186
             ET+MKKEAA+QL      G+ +YK LP GP N  QD       ++V +++N+YWKE  LL
Sbjct  264   ETMMKKEAAKQLEEEPKSGE-DYKALPSGPTN-IQD-------EEVPLLKNIYWKELSLL  314

Query  1187  CFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSG  1366
              +VWV+FL +QI K YT TCS  YWV+N LQ+P+++ VALFEA  LYKG R I SKG   
Sbjct  315   VYVWVAFLLVQIAKTYTGTCSIEYWVINFLQVPIAISVALFEAVCLYKGTRVIGSKGKEI  374

Query  1367  SNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfammfsss  1546
             +N +  Q+ +YCF G++AG+VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TF+M+FSSS
Sbjct  375   TNWKIHQIFLYCFCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMLFSSS  434

Query  1547  msVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSA  1726
             MSVV+YYLL RFPVPYA F   VAT+AAF+GQHVVR++IA+LGRAS+IIFILA TIF+SA
Sbjct  435   MSVVQYYLLDRFPVPYASFFVLVATIAAFVGQHVVRKIIAILGRASIIIFILASTIFISA  494

Query  1727  ISLGGVGISNMIEKIHNHEYMGFENLC  1807
             ISLGGVGI NMI K+ N EYMGFEN C
Sbjct  495   ISLGGVGIENMIVKMENQEYMGFENFC  521



>ref|XP_009356692.1| PREDICTED: uncharacterized protein LOC103947501 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009349999.1| PREDICTED: uncharacterized protein LOC103941518 isoform X2 [Pyrus 
x bretschneideri]
Length=475

 Score =   473 bits (1218),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 291/450 (65%), Positives = 359/450 (80%), Gaps = 13/450 (3%)
 Frame = +2

Query  467   AERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgf  646
             AER LK+E +          +   +  +NFLWQ   S Y  +WPEM+ GW+IV+GS++GF
Sbjct  33    AERPLKDEIIKAEIFVEQ--EPIFARVINFLWQAGGSSYQPVWPEMKFGWKIVVGSVVGF  90

Query  647   mgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLD  826
              GAA GSVGGVGGGGIFVPML+L+VGFDPKS+TAISKCMIMGAA S+V++NL+LRHPTLD
Sbjct  91    FGAALGSVGGVGGGGIFVPMLALIVGFDPKSSTAISKCMIMGAAGSTVYFNLRLRHPTLD  150

Query  827   MPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKK  1006
             MP+IDYDLA+L QPMLMLGISIGV FNV+FADWMVTVLLI+LF+GT+ KA ++GVETWKK
Sbjct  151   MPLIDYDLALLFQPMLMLGISIGVAFNVVFADWMVTVLLIILFLGTAAKALMKGVETWKK  210

Query  1007  ETIMKKEAAQQLAANGSGGQG---EYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEF  1177
             ET+MKKEA   L +     +G   +YK LP GP +        S +++V I +N+YWKE 
Sbjct  211   ETMMKKEAENMLESETKQDEGSGEDYKPLPSGPAS--------SQDEEVPITQNIYWKEL  262

Query  1178  GLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKG  1357
              LL +VWV+FL +QIVK YT TCST +W++N LQ+P++L V LFEA  L KG R I+SKG
Sbjct  263   SLLMYVWVAFLIVQIVKTYTETCSTTFWIMNSLQVPIALSVTLFEAICLRKGTRVIASKG  322

Query  1358  DSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfammf  1537
                +N +  Q+ +YC  G++AG+VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+F
Sbjct  323   KEITNWKLHQIFLYCSCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMLF  382

Query  1538  sssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIF  1717
             SSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++IAVLGRAS++IFILA TIF
Sbjct  383   SSSMSVVQYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKIIAVLGRASIVIFILALTIF  442

Query  1718  VSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             VSAISLGGVGI+NM+EK+ N EYMGFEN C
Sbjct  443   VSAISLGGVGIANMVEKMENQEYMGFENFC  472



>gb|EAZ42610.1| hypothetical protein OsJ_27176 [Oryza sativa Japonica Group]
Length=442

 Score =   472 bits (1214),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 306/426 (72%), Positives = 356/426 (84%), Gaps = 12/426 (3%)
 Frame = +2

Query  542   TFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVV  721
             TF + +  P+E         ME GW+IV+G +IGF GAAFGSVGGVGGGGIFVPML+L++
Sbjct  29    TFADAVAAPEEP--------MEFGWKIVLGKLIGFFGAAFGSVGGVGGGGIFVPMLTLII  80

Query  722   GFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVT  901
             GFD KS+TAISKCMIMGAAVS+V+YNLKL+HPTLDMP+IDYDLA+LIQPMLMLGISIGV 
Sbjct  81    GFDAKSSTAISKCMIMGAAVSTVYYNLKLKHPTLDMPVIDYDLALLIQPMLMLGISIGVL  140

Query  902   FNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKL  1081
             FNVIF DW++TVLLI+LF+GTSTKAFL+GVETWKKETI+K+EAA++L       + EY  
Sbjct  141   FNVIFPDWLITVLLIILFLGTSTKAFLKGVETWKKETILKREAAKRLEQIAE--EPEYSP  198

Query  1082  LPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYW  1261
             LP GP N T ++ K  S++  S+ +NVYWKEFGLL FVW++FL LQ+ KNY  TCST YW
Sbjct  199   LPTGP-NATAES-KAPSDEAASLWQNVYWKEFGLLAFVWIAFLVLQVTKNYMPTCSTWYW  256

Query  1262  VVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggll  1441
             V+N LQIPVS+GV ++E  GL +G R ISSKGD  +NL+  QL+VYCFFGM+AGVVGGLL
Sbjct  257   VLNFLQIPVSVGVTMYEGLGLMQGRRVISSKGDEQTNLKFHQLLVYCFFGMMAGVVGGLL  316

Query  1442  glgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavat  1621
             GLGGGFIMGPLFLELG+PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYALF T VA 
Sbjct  317   GLGGGFIMGPLFLELGIPPQVSSATATFAMMFSSSMSVVEYYLLDRFPVPYALFFTVVAF  376

Query  1622  vaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFEN  1801
              AA IGQH+VR+LI  LGRASLIIFIL+F IF+SAISLGGVGISNMI KI  HEYMGF+N
Sbjct  377   FAAIIGQHIVRKLINWLGRASLIIFILSFMIFISAISLGGVGISNMIGKIARHEYMGFDN  436

Query  1802  LCKYGV  1819
             +C Y V
Sbjct  437   ICNYDV  442



>ref|XP_008338104.1| PREDICTED: uncharacterized protein LOC103401168 isoform X1 [Malus 
domestica]
Length=486

 Score =   473 bits (1218),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 293/463 (63%), Positives = 368/463 (79%), Gaps = 14/463 (3%)
 Frame = +2

Query  437   SFLLASAFVSAERSLKNEEVAG-TNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELG  613
             + L+ +   SA+R L++E +    +V +++ + +    VNFLWQ   S Y  +WPEM+  
Sbjct  29    NLLIITEVASADRPLRDEIIKPEKSVQKDTHESFFVRVVNFLWQAGGSSYQPVWPEMKFD  88

Query  614   WEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVH  793
             W+IV+GSI+GF GAA GSVGGVGGGGIFVPML+L+VGFDPKS+TAISKCMIMGAA S+V+
Sbjct  89    WKIVVGSIVGFFGAALGSVGGVGGGGIFVPMLALIVGFDPKSSTAISKCMIMGAAGSTVY  148

Query  794   YNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTK  973
             +NL+LRHPTLDMP+IDYDLA+L QPMLMLGISIGV FNV+FADWMVTVLLI+LF+GT+ K
Sbjct  149   FNLRLRHPTLDMPLIDYDLALLFQPMLMLGISIGVAFNVMFADWMVTVLLIILFLGTAAK  208

Query  974   AFLRGVETWKKETIMKKEAAQQLAANGSGGQGE-----YKLLPGGPGNGTQDTAKESSEK  1138
             A ++GVETWKKET+MK+EA + L +    G  E     YK LP  P +  QD       +
Sbjct  209   ALMKGVETWKKETMMKEEAEKLLESESKPGVAEGSGEDYKPLPSSP-DSLQD-------E  260

Query  1139  QVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEAT  1318
             QV I+ N+YWKE  LL +VWV+FL +QIVK YT TCST++W++N LQ+P+++ V LFEA 
Sbjct  261   QVPIMRNIYWKELSLLMYVWVAFLIVQIVKTYTKTCSTMFWIMNSLQVPIAISVTLFEAI  320

Query  1319  GLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPP  1498
              L KG R I+SKG   +N +  Q+ +YC  G++AG+VGGLLGLGGGFI+GPLFLELG+PP
Sbjct  321   CLCKGTRVIASKGKEITNWKLHQIFLYCSCGIVAGMVGGLLGLGGGFILGPLFLELGIPP  380

Query  1499  QVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGR  1678
             QV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++IAVLGR
Sbjct  381   QVASATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKIIAVLGR  440

Query  1679  ASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             AS++IFILA TIFVSAISLGGVGI+NM+EK+ N EYMGFEN C
Sbjct  441   ASIVIFILALTIFVSAISLGGVGIANMVEKMENQEYMGFENFC  483



>ref|XP_004512030.1| PREDICTED: uncharacterized protein LOC101496928 isoform X3 [Cicer 
arietinum]
Length=523

 Score =   474 bits (1221),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 292/447 (65%), Positives = 360/447 (81%), Gaps = 11/447 (2%)
 Frame = +2

Query  467   AERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgf  646
             AER LK +E +  N         L   ++FLW+   S Y+ +WPEM+  W+I++GSI+GF
Sbjct  85    AERVLKEKEQSA-NFVEKERQGVLKAMIDFLWENGRSSYEPVWPEMKFDWKIIVGSIVGF  143

Query  647   mgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLD  826
             +GAA GSVGGVGGGGIFVPML+L++GFDPKS+TAISKCMIMGAA+S+V+YN++LRHPTLD
Sbjct  144   LGAALGSVGGVGGGGIFVPMLALIIGFDPKSSTAISKCMIMGAALSTVYYNMRLRHPTLD  203

Query  827   MPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKK  1006
             MP+IDYDLA+L QPMLMLGISIGV  NV+FADWMVTVLLI+LFI TSTKA  +G++TWKK
Sbjct  204   MPLIDYDLALLFQPMLMLGISIGVICNVMFADWMVTVLLIILFIATSTKALFKGIDTWKK  263

Query  1007  ETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLL  1186
             ET+MKKEAA+QL        G+YK LP GP N  QD       ++V +++N+YWKE  LL
Sbjct  264   ETMMKKEAAKQLEEEPKS--GDYKALPSGPTN-IQD-------EEVPLLKNIYWKELSLL  313

Query  1187  CFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSG  1366
              +VWV+FL +QI K YT TCS  YWV+N LQ+P+++ VALFEA  LYKG R I SKG   
Sbjct  314   VYVWVAFLLVQIAKTYTGTCSIEYWVINFLQVPIAISVALFEAVCLYKGTRVIGSKGKEI  373

Query  1367  SNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfammfsss  1546
             +N +  Q+ +YCF G++AG+VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TF+M+FSSS
Sbjct  374   TNWKIHQIFLYCFCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMLFSSS  433

Query  1547  msVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSA  1726
             MSVV+YYLL RFPVPYA F   VAT+AAF+GQHVVR++IA+LGRAS+IIFILA TIF+SA
Sbjct  434   MSVVQYYLLDRFPVPYASFFVLVATIAAFVGQHVVRKIIAILGRASIIIFILASTIFISA  493

Query  1727  ISLGGVGISNMIEKIHNHEYMGFENLC  1807
             ISLGGVGI NMI K+ N EYMGFEN C
Sbjct  494   ISLGGVGIENMIVKMENQEYMGFENFC  520



>ref|XP_006426964.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 ref|XP_006426965.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 ref|XP_006426966.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 gb|ESR40204.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 gb|ESR40205.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 gb|ESR40206.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
Length=477

 Score =   473 bits (1216),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 301/480 (63%), Positives = 370/480 (77%), Gaps = 6/480 (1%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLL-ASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNF  556
             M+G G +W   R   A     LL AS  VSA+ +LK E  +   +      + +    + 
Sbjct  1     MSGVGSEWYQWRLSAAAFIGLLLVASVSVSAQSTLKPEATSANKIDHVEPKNVIKVPTHK  60

Query  557   LWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPK  736
             +     SGY H+WP+++ GW+IV+ SIIGF GAA GSVGGVGGGGIFVPML+L++GFDPK
Sbjct  61    I----RSGYKHVWPDIKFGWKIVVSSIIGFFGAACGSVGGVGGGGIFVPMLNLIIGFDPK  116

Query  737   SATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIF  916
             S+ A+SKCMI G AV++V YNL+ RHPTLDMP+IDYDLA+L QPML+LGISIGV FNVIF
Sbjct  117   SSVALSKCMITGTAVATVVYNLRQRHPTLDMPVIDYDLALLFQPMLVLGISIGVAFNVIF  176

Query  917   ADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQG-EYKLLPGG  1093
             ADWM+TVLLI+LFIG S KAFL+GVETWKKETI K EAA++L  + +G Q  E+K  P  
Sbjct  177   ADWMITVLLIILFIGMSAKAFLKGVETWKKETITKVEAAKRLELDRNGDQAEEFKCEPEN  236

Query  1094  PGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNL  1273
               N T    KE  + +VSI++N+YWKE GLL  VWV  LALQI KNYT+TCS LYWV+N 
Sbjct  237   LSNTTPKETKEPVKSEVSILKNIYWKELGLLVAVWVIVLALQIAKNYTATCSVLYWVLNF  296

Query  1274  LQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgg  1453
             LQIPV+ GV+ +EA  LYKG R I+SKGD G+N R  QL+ YC  G+ AGVVGGLLGLGG
Sbjct  297   LQIPVAGGVSAYEAVALYKGRRTIASKGDVGTNWRPHQLVFYCACGITAGVVGGLLGLGG  356

Query  1454  gfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaaf  1633
             GFI+GPLFLELG+PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+   V+TVAAF
Sbjct  357   GFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYFFGVSTVAAF  416

Query  1634  IGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             +GQHVVR+LI +LGRAS+IIF L+ TIFVSA+SLGG+G++ M+++I   EYMGF+++C Y
Sbjct  417   VGQHVVRKLINILGRASIIIFTLSLTIFVSALSLGGIGLAKMVQRIDRKEYMGFDSICSY  476



>ref|XP_009356691.1| PREDICTED: uncharacterized protein LOC103947501 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009349998.1| PREDICTED: uncharacterized protein LOC103941518 isoform X1 [Pyrus 
x bretschneideri]
Length=477

 Score =   473 bits (1216),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 294/454 (65%), Positives = 361/454 (80%), Gaps = 19/454 (4%)
 Frame = +2

Query  467   AERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgf  646
             AER LK+E +          +   +  +NFLWQ   S Y  +WPEM+ GW+IV+GS++GF
Sbjct  33    AERPLKDEIIKAEIFVEQ--EPIFARVINFLWQAGGSSYQPVWPEMKFGWKIVVGSVVGF  90

Query  647   mgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLD  826
              GAA GSVGGVGGGGIFVPML+L+VGFDPKS+TAISKCMIMGAA S+V++NL+LRHPTLD
Sbjct  91    FGAALGSVGGVGGGGIFVPMLALIVGFDPKSSTAISKCMIMGAAGSTVYFNLRLRHPTLD  150

Query  827   MPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKK  1006
             MP+IDYDLA+L QPMLMLGISIGV FNV+FADWMVTVLLI+LF+GT+ KA ++GVETWKK
Sbjct  151   MPLIDYDLALLFQPMLMLGISIGVAFNVVFADWMVTVLLIILFLGTAAKALMKGVETWKK  210

Query  1007  ETIMKKEA-------AQQLAANGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENVY  1165
             ET+MKKEA        +Q  A GSG   +YK LP GP +        S +++V I +N+Y
Sbjct  211   ETMMKKEAENMLESETKQDVAEGSG--EDYKPLPSGPAS--------SQDEEVPITQNIY  260

Query  1166  WKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKI  1345
             WKE  LL +VWV+FL +QIVK YT TCST +W++N LQ+P++L V LFEA  L KG R I
Sbjct  261   WKELSLLMYVWVAFLIVQIVKTYTETCSTTFWIMNSLQVPIALSVTLFEAICLRKGTRVI  320

Query  1346  SSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatf  1525
             +SKG   +N +  Q+ +YC  G++AG+VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TF
Sbjct  321   ASKGKEITNWKLHQIFLYCSCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTF  380

Query  1526  ammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILA  1705
             AM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++IAVLGRAS++IFILA
Sbjct  381   AMLFSSSMSVVQYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKIIAVLGRASIVIFILA  440

Query  1706  FTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
              TIFVSAISLGGVGI+NM+EK+ N EYMGFEN C
Sbjct  441   LTIFVSAISLGGVGIANMVEKMENQEYMGFENFC  474



>ref|XP_008363110.1| PREDICTED: uncharacterized protein LOC103426807 isoform X1 [Malus 
domestica]
Length=477

 Score =   473 bits (1216),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 296/455 (65%), Positives = 361/455 (79%), Gaps = 19/455 (4%)
 Frame = +2

Query  464   SAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIg  643
             SAER LK+E +          +   +  +NFLWQ   S Y  +WPEM+ GW+IV+GS++G
Sbjct  32    SAERPLKDEIIKPKIFVEQ--EAIFARVINFLWQAGGSSYQPVWPEMKFGWKIVVGSVVG  89

Query  644   fmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTL  823
             F GAA GSVGGVGGGGIFVPML+L+VGFDPKS+TAISKCMIMGAA S+V++NL+LRHPTL
Sbjct  90    FFGAALGSVGGVGGGGIFVPMLALIVGFDPKSSTAISKCMIMGAAGSTVYFNLRLRHPTL  149

Query  824   DMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWK  1003
             DMP+IDYDLA+L QPMLMLGISIGV FNV+FADWMVTVLLI+LF+GT+ KA ++GVETWK
Sbjct  150   DMPLIDYDLALLFQPMLMLGISIGVAFNVVFADWMVTVLLIILFLGTAAKALMKGVETWK  209

Query  1004  KETIMKKEA-------AQQLAANGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENV  1162
             KET+MKKEA        +Q  A GSG   +YK LP GP +        S +++V I  N+
Sbjct  210   KETMMKKEAENMLESETKQDVAEGSG--EDYKPLPSGPAS--------SQDEEVPITRNI  259

Query  1163  YWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRK  1342
             YWKE  LL +VWV+FL +QIVK YT TCST +W++N LQ+P++L V LFEA  L KG R 
Sbjct  260   YWKELSLLMYVWVAFLIVQIVKTYTETCSTTFWIMNSLQVPIALSVTLFEAICLRKGTRV  319

Query  1343  ISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatat  1522
             I+SKG   +N +  Q+ +YC  G++AG+VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+T
Sbjct  320   IASKGKEITNWKLHQIFLYCSCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATST  379

Query  1523  fammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFIL  1702
             FAM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++IAVLGRAS+IIFIL
Sbjct  380   FAMLFSSSMSVVQYYLLNRFPVPYAAYFVVVATIAAFTGQHVVRKIIAVLGRASIIIFIL  439

Query  1703  AFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             A TIFVSAISLGGVGI+NM+EK+ N EYMGFEN C
Sbjct  440   ALTIFVSAISLGGVGIANMVEKMENREYMGFENFC  474



>ref|XP_003611976.1| Membrane protein-like protein [Medicago truncatula]
 ref|XP_003636269.1| Membrane protein-like protein [Medicago truncatula]
 gb|AES94934.1| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=470

 Score =   472 bits (1214),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 289/447 (65%), Positives = 361/447 (81%), Gaps = 11/447 (2%)
 Frame = +2

Query  467   AERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgf  646
             AER LK +E A           +L   V+FLW+  +S Y+ +WPEM+  W+I++GSIIGF
Sbjct  33    AERVLKEKEPA--KFVEKETKGFLKAMVDFLWESGKSSYEPVWPEMKFDWKIIVGSIIGF  90

Query  647   mgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLD  826
             +GAA GSVGGVGGGGIFVPML+L++GFDPKS+TAISKCMIMGAA+S+V+YN++LR+PTLD
Sbjct  91    LGAALGSVGGVGGGGIFVPMLALIIGFDPKSSTAISKCMIMGAALSTVYYNMRLRNPTLD  150

Query  827   MPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKK  1006
             MP+IDYDLA+L QPMLMLGISIGV  NV+FADWMVTVLLI+LFIGTSTKA ++G+ TWKK
Sbjct  151   MPLIDYDLALLFQPMLMLGISIGVICNVMFADWMVTVLLIILFIGTSTKALIKGINTWKK  210

Query  1007  ETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLL  1186
             ET++KKE A+QL      G+ +YK LP GPG        E  ++ V +++N+YWKE  LL
Sbjct  211   ETMLKKETAKQLEEEPKTGE-DYKPLPKGPG--------EIQDEVVPLLKNIYWKELSLL  261

Query  1187  CFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSG  1366
              +VWV+FL +QIVK YT TCS  YW++N LQ+P+++ V LFEA  +YKG R I SKG   
Sbjct  262   VYVWVAFLIVQIVKTYTKTCSIEYWILNFLQVPIAISVTLFEAVCIYKGTRVIKSKGKEV  321

Query  1367  SNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfammfsss  1546
              N++  Q+++YC  G+IAG+VGGLLGLGGGFI+GPLFLE+G+PPQV+SAT+TF+M+FSSS
Sbjct  322   KNMKIYQILLYCSIGVIAGMVGGLLGLGGGFILGPLFLEMGIPPQVASATSTFSMLFSSS  381

Query  1547  msVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSA  1726
             MSVV+YY L RFPVPYA +   VAT+AAF GQHVVRR+IA+LGRAS+IIFILA TIF+SA
Sbjct  382   MSVVQYYYLDRFPVPYASYFVLVATIAAFAGQHVVRRIIAILGRASIIIFILASTIFISA  441

Query  1727  ISLGGVGISNMIEKIHNHEYMGFENLC  1807
             ISLGGVGI NMI K+ NHEYMGFENLC
Sbjct  442   ISLGGVGIQNMIVKLENHEYMGFENLC  468



>ref|XP_006465610.1| PREDICTED: uncharacterized protein LOC102613305 isoform X1 [Citrus 
sinensis]
 ref|XP_006465611.1| PREDICTED: uncharacterized protein LOC102613305 isoform X2 [Citrus 
sinensis]
 ref|XP_006465612.1| PREDICTED: uncharacterized protein LOC102613305 isoform X3 [Citrus 
sinensis]
Length=477

 Score =   472 bits (1214),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 299/480 (62%), Positives = 370/480 (77%), Gaps = 6/480 (1%)
 Frame = +2

Query  380   MAGAGGKWRILR-PLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNF  556
             M+G G +W   R    A     L+AS  VSA+ +LK E  +   +      + +    + 
Sbjct  1     MSGVGSEWYQWRFSAAAFIGLLLVASVSVSAQSTLKPEATSANKIDHVEPKNVIKVPTHK  60

Query  557   LWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPK  736
             +     SGY H+WP+++ GW+IV+ SIIGF GAA GSVGGVGGGGIFVPML+L++GFDPK
Sbjct  61    I----RSGYKHVWPDIKFGWKIVVSSIIGFFGAACGSVGGVGGGGIFVPMLNLIIGFDPK  116

Query  737   SATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIF  916
             S+ A+SKCMI G AV++V YNL+ RHPTLDMP+IDYDLA+L QPML+LGISIGV FNVIF
Sbjct  117   SSVALSKCMITGTAVATVVYNLRQRHPTLDMPVIDYDLALLFQPMLVLGISIGVAFNVIF  176

Query  917   ADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQG-EYKLLPGG  1093
             ADWM+TVLLI+LFIG S KAFL+GVETWKKETI K EAA++L  + +G Q  E+K  P  
Sbjct  177   ADWMITVLLIILFIGMSAKAFLKGVETWKKETITKVEAAKRLELDRNGDQAEEFKCEPEN  236

Query  1094  PGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNL  1273
               N T    KE  + +VSI++N+YWKE GLL  VWV  LALQI KNYT+TCS LYW +N 
Sbjct  237   LSNTTPKETKEPVKSEVSILKNIYWKELGLLVAVWVIVLALQIAKNYTATCSVLYWALNF  296

Query  1274  LQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgg  1453
             LQIPV+ GV+ +EA  LYKG R I+SKGD G+N R  QL+ YC  G+ AGVVGGLLGLGG
Sbjct  297   LQIPVAGGVSAYEAVALYKGRRTIASKGDVGTNWRPHQLVFYCACGITAGVVGGLLGLGG  356

Query  1454  gfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaaf  1633
             GFI+GPLFLELG+PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+  AV+T+AAF
Sbjct  357   GFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYFFAVSTIAAF  416

Query  1634  IGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             +GQHVVR+LI +LGRAS+IIF L+ TIFVSA+SLGG+G++ M+++I   EYMGF+++C Y
Sbjct  417   VGQHVVRKLINILGRASIIIFTLSLTIFVSALSLGGIGLAKMVQRIDRKEYMGFDSICSY  476



>ref|XP_002310222.2| hypothetical protein POPTR_0007s12700g [Populus trichocarpa]
 gb|EEE90672.2| hypothetical protein POPTR_0007s12700g [Populus trichocarpa]
Length=477

 Score =   472 bits (1214),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 293/458 (64%), Positives = 365/458 (80%), Gaps = 12/458 (3%)
 Frame = +2

Query  443   LLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEI  622
             +L +   SAER LK++E A T V +     Y+   ++FL+Q  +S Y+ +WP+M+  W +
Sbjct  26    VLMTNMASAERLLKDKE-AETLVKKEMSPGYIVKMIHFLFQGGKSSYEPVWPDMKFDWRV  84

Query  623   VIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNL  802
             V+G+I+GF GAA GSVGGVGGGGIFVPML+L++GFDPKS+TAISKCMIMGAA ++V+YNL
Sbjct  85    VVGTIVGFFGAALGSVGGVGGGGIFVPMLTLIIGFDPKSSTAISKCMIMGAAGATVYYNL  144

Query  803   KLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFL  982
             +LRHPTLDMPIIDYDLA+L QPMLMLGISIGV FNV+FADWMVTVLLI+LFIGTSTKA  
Sbjct  145   RLRHPTLDMPIIDYDLALLFQPMLMLGISIGVAFNVMFADWMVTVLLIILFIGTSTKALF  204

Query  983   RGVETWKKETIMKKEAAQQLAAN---GSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSII  1153
             +G++TWKKE++MKKEAA+QL +    G G + EY+ LP GP     D        +V + 
Sbjct  205   KGIDTWKKESVMKKEAAKQLESESKPGDGAEEEYQPLPSGPVVLHDD--------EVPLR  256

Query  1154  ENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKG  1333
             EN+ WKE  LL +VWV+FL +QIV+    TCS +YW++N LQ+P++  V LFEA  L KG
Sbjct  257   ENIRWKELALLVYVWVAFLVVQIVQTNVPTCSVMYWILNSLQVPIAASVTLFEAICLCKG  316

Query  1334  WRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssa  1513
              R I+SKG   +N +  Q+++YC  G+IAG+VGGLLGLGGGFI+GPLFLELG+PPQV+SA
Sbjct  317   TRVIASKGKEITNWKLHQVLLYCSCGIIAGIVGGLLGLGGGFILGPLFLELGIPPQVASA  376

Query  1514  tatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLII  1693
             T+TFAM FSSSMSVVEYYLL RFPVPYA +   VAT+AAF GQHV+RR+IA+LGRAS+II
Sbjct  377   TSTFAMAFSSSMSVVEYYLLNRFPVPYAAYFVLVATIAAFAGQHVIRRIIAILGRASIII  436

Query  1694  FILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             FILA TIFVSAISLGGVGI+NM+EK+ N EYMGFENLC
Sbjct  437   FILALTIFVSAISLGGVGIANMVEKLENDEYMGFENLC  474



>ref|XP_003546436.1| PREDICTED: uncharacterized protein LOC100816528 [Glycine max]
Length=476

 Score =   471 bits (1213),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 300/480 (63%), Positives = 374/480 (78%), Gaps = 10/480 (2%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             M G+  +W +    + L++S LL SA VSA   + ++++  T     ++  +L   +NFL
Sbjct  3     MNGSPRRWDVR---LVLTFSLLLISASVSALEHVNHKKIDPTT----AETSFLGKVMNFL  55

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             W    SGY+H WPE+E GW I+ G+IIGF+G+AFG+VGGVGGGGIFV MLSL++GFD KS
Sbjct  56    WSSSGSGYEHTWPEIEFGWRIITGTIIGFVGSAFGTVGGVGGGGIFVTMLSLIIGFDAKS  115

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             ATAISKCMI G A ++V YNL+ +HPTLDMP+IDYDLA+L QP+L+LGISIGV FNVIFA
Sbjct  116   ATAISKCMITGGAAATVFYNLRQKHPTLDMPVIDYDLALLFQPVLVLGISIGVAFNVIFA  175

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGE--YKLLPGG  1093
             DWM+TVLL+++F+G +TKAFL+GVETWKKETI+KKE A+Q   NG+    E  Y+ LPGG
Sbjct  176   DWMITVLLLIIFVGIATKAFLKGVETWKKETIIKKETARQSQFNGTERTAEVAYEPLPGG  235

Query  1094  PGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNL  1273
             P        K+S E   SI+ENV WK  G+L  VWV  LA +I K++T+TCS  YWV+NL
Sbjct  236   PNTSNHKEPKKSKETG-SILENVRWKALGVLFTVWVLILASEIAKSHTTTCSVEYWVLNL  294

Query  1274  LQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgg  1453
             LQ+PV+LG   ++A  LY G R I+SKGD  +  RA QLI+YC  G+ AG+VGGLLGLGG
Sbjct  295   LQVPVALGATSYQAVLLYTGKRVIASKGDQRTQWRAHQLIMYCSCGICAGIVGGLLGLGG  354

Query  1454  gfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaaf  1633
             GFI+GPLFLELG+PPQVSSATATFAM FS+SMSVVEYYLLKRFP+PY L+  AV+T AAF
Sbjct  355   GFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPIPYTLYFVAVSTFAAF  414

Query  1634  IGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             +GQ +VR+L+A+LGRASLIIFIL+ TIFVSAISLGGVGISNMI++I N EYMGFENLC Y
Sbjct  415   VGQVLVRKLVAILGRASLIIFILSSTIFVSAISLGGVGISNMIQRIANKEYMGFENLCTY  474



>ref|XP_009371582.1| PREDICTED: uncharacterized protein LOC103960817 isoform X1 [Pyrus 
x bretschneideri]
Length=486

 Score =   471 bits (1213),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 293/463 (63%), Positives = 367/463 (79%), Gaps = 14/463 (3%)
 Frame = +2

Query  437   SFLLASAFVSAERSLKNEEVAGTN-VSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELG  613
             + L+ +   SA+R L++E +     V ++  + +    VNFLWQ   S Y  +WPEM+  
Sbjct  29    NLLIITEVASADRPLRDEIIKPEKFVQKDIHESFFVRVVNFLWQAGGSSYQPVWPEMKFD  88

Query  614   WEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVH  793
             W+IV+GSI+GF GAA GSVGGVGGGGIFVPML+L+VGFDPKS+TAISKCMIMGAA S+V+
Sbjct  89    WKIVLGSIVGFFGAALGSVGGVGGGGIFVPMLALIVGFDPKSSTAISKCMIMGAAGSTVY  148

Query  794   YNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTK  973
             +NL+LRHPTLDMP+IDYDLA+L QPMLMLGISIGV FNV+FADWMVTVLLI+LF+GT+ K
Sbjct  149   FNLRLRHPTLDMPLIDYDLALLFQPMLMLGISIGVAFNVMFADWMVTVLLIILFLGTAAK  208

Query  974   AFLRGVETWKKETIMKKEAAQQLAANGSGGQGE-----YKLLPGGPGNGTQDTAKESSEK  1138
             A ++G+ETWKKET+MK+EA + L +    G  E     YK LP GP +  QD       +
Sbjct  209   ALMKGMETWKKETMMKEEAEKLLESESKPGVAEGSGEDYKPLPSGP-DSLQD-------E  260

Query  1139  QVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEAT  1318
             QV I+ N+YWKE  LL +VWV+FL +QIVK YT TCST++W++N LQ+P+++ V LFEA 
Sbjct  261   QVPIMRNIYWKELSLLMYVWVAFLIVQIVKTYTKTCSTMFWIMNSLQVPIAISVTLFEAI  320

Query  1319  GLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPP  1498
              L KG R I+SKG   +N +  Q+ +YC  G++AG+VGGLLGLGGGFI+GPLFLELG+PP
Sbjct  321   CLCKGTRVIASKGKEITNWKLHQIFLYCSCGIVAGMVGGLLGLGGGFILGPLFLELGIPP  380

Query  1499  QVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGR  1678
             QV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++IAVLGR
Sbjct  381   QVASATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKIIAVLGR  440

Query  1679  ASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             AS++IFILA TIFVSAISLGGVGI+NM+EK+ N EYMGFEN C
Sbjct  441   ASIVIFILALTIFVSAISLGGVGIANMVEKMENQEYMGFENFC  483



>ref|XP_008228544.1| PREDICTED: uncharacterized protein LOC103327946 [Prunus mume]
Length=489

 Score =   471 bits (1213),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 303/481 (63%), Positives = 376/481 (78%), Gaps = 7/481 (1%)
 Frame = +2

Query  392   GGKWRILR--PLVALSWSFLLASAF-VSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLW  562
             G +W  LR   ++ ++   +LASA   S E+   +           SD+D  +   NFLW
Sbjct  7     GAEWSGLRWTAILLVTGFLVLASAQGTSLEQDDASSRYINGTQKFQSDNDLFTRVFNFLW  66

Query  563   Q--PKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPK  736
             Q  P    Y+H+WPEM+LGW+IV+GS+IGF GAAFG+VGGVGGGGIFVPML+L++GFD K
Sbjct  67    QQGPGLWSYEHVWPEMKLGWKIVVGSVIGFFGAAFGTVGGVGGGGIFVPMLTLIIGFDQK  126

Query  737   SATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIF  916
             S+TAISKCMI GAA SSV YNL+LRHPTL++P+IDYDLA+L QPML+LGISIGV  NVI 
Sbjct  127   SSTAISKCMITGAAFSSVVYNLRLRHPTLELPLIDYDLALLFQPMLVLGISIGVALNVIL  186

Query  917   ADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAA-QQLAANGSGGQG-EYKLLPG  1090
             ADWM+TVLLI+ FIGTST+AF +GVETWKKETIMK+EAA +Q+ +NG   +  EYK LPG
Sbjct  187   ADWMITVLLIITFIGTSTRAFFKGVETWKKETIMKEEAARRQMQSNGDPREEVEYKPLPG  246

Query  1091  GPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVN  1270
             GP   T    +E    +V IIEN+YWKE  +L  VWV  LALQI KNYT+TCS  YW +N
Sbjct  247   GPSIDTSTEIREPKRTEVPIIENLYWKELLVLVAVWVIILALQISKNYTTTCSAAYWALN  306

Query  1271  LLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglg  1450
             LLQIPV+  V  +EA  LY G R I+SKG+S ++ +  QL++Y   G++AG+VGGLLGLG
Sbjct  307   LLQIPVAFSVTTYEAVNLYLGHRVITSKGESHTDWKVHQLVLYSACGIVAGIVGGLLGLG  366

Query  1451  ggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaa  1630
             GGFI+GP+FLELG+PPQVSSATATFAM FS+SMSV+EYYLL RFPVPYAL+L AVAT++A
Sbjct  367   GGFILGPVFLELGIPPQVSSATATFAMTFSASMSVIEYYLLHRFPVPYALYLAAVATLSA  426

Query  1631  fIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  1810
              +GQHVVR+++ +LGRAS+IIFILAFTIFVSAISLGGVGI++ +EKI + EYMGFEN+C 
Sbjct  427   VVGQHVVRKVVMILGRASIIIFILAFTIFVSAISLGGVGIADTVEKIEHKEYMGFENICT  486

Query  1811  Y  1813
             Y
Sbjct  487   Y  487



>ref|XP_004512031.1| PREDICTED: uncharacterized protein LOC101496928 isoform X4 [Cicer 
arietinum]
Length=522

 Score =   473 bits (1216),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 291/447 (65%), Positives = 360/447 (81%), Gaps = 12/447 (3%)
 Frame = +2

Query  467   AERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgf  646
             AER LK +E +  N         L   ++FLW+   S Y+ +WPEM+  W+I++GSI+GF
Sbjct  85    AERVLKEKEQSA-NFVEKERQGVLKAMIDFLWENGRSSYEPVWPEMKFDWKIIVGSIVGF  143

Query  647   mgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLD  826
             +GAA GSVGGVGGGGIFVPML+L++GFDPKS+TAISKCMIMGAA+S+V+YN++LRHPTLD
Sbjct  144   LGAALGSVGGVGGGGIFVPMLALIIGFDPKSSTAISKCMIMGAALSTVYYNMRLRHPTLD  203

Query  827   MPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKK  1006
             MP+IDYDLA+L QPMLMLGISIGV  NV+FADWMVTVLLI+LFI TSTKA  +G++TWKK
Sbjct  204   MPLIDYDLALLFQPMLMLGISIGVICNVMFADWMVTVLLIILFIATSTKALFKGIDTWKK  263

Query  1007  ETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLL  1186
             ET+MKKEAA+QL       + +YK LP GP N  QD       ++V +++N+YWKE  LL
Sbjct  264   ETMMKKEAAKQLEEE---PKSDYKALPSGPTN-IQD-------EEVPLLKNIYWKELSLL  312

Query  1187  CFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSG  1366
              +VWV+FL +QI K YT TCS  YWV+N LQ+P+++ VALFEA  LYKG R I SKG   
Sbjct  313   VYVWVAFLLVQIAKTYTGTCSIEYWVINFLQVPIAISVALFEAVCLYKGTRVIGSKGKEI  372

Query  1367  SNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfammfsss  1546
             +N +  Q+ +YCF G++AG+VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TF+M+FSSS
Sbjct  373   TNWKIHQIFLYCFCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMLFSSS  432

Query  1547  msVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSA  1726
             MSVV+YYLL RFPVPYA F   VAT+AAF+GQHVVR++IA+LGRAS+IIFILA TIF+SA
Sbjct  433   MSVVQYYLLDRFPVPYASFFVLVATIAAFVGQHVVRKIIAILGRASIIIFILASTIFISA  492

Query  1727  ISLGGVGISNMIEKIHNHEYMGFENLC  1807
             ISLGGVGI NMI K+ N EYMGFEN C
Sbjct  493   ISLGGVGIENMIVKMENQEYMGFENFC  519



>ref|XP_004512029.1| PREDICTED: uncharacterized protein LOC101496928 isoform X2 [Cicer 
arietinum]
Length=523

 Score =   472 bits (1214),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 291/447 (65%), Positives = 359/447 (80%), Gaps = 11/447 (2%)
 Frame = +2

Query  467   AERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgf  646
             AER LK +E +  N         L   ++FLW+   S Y+ +WPEM+  W+I++GSI+GF
Sbjct  85    AERVLKEKEQSA-NFVEKERQGVLKAMIDFLWENGRSSYEPVWPEMKFDWKIIVGSIVGF  143

Query  647   mgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLD  826
             +GAA GSVGGVGGGGIFVPML+L++GFDPKS+TAISKCMIMGAA+S+V+YN++LRHPTLD
Sbjct  144   LGAALGSVGGVGGGGIFVPMLALIIGFDPKSSTAISKCMIMGAALSTVYYNMRLRHPTLD  203

Query  827   MPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKK  1006
             MP+IDYDLA+L QPMLMLGISIGV  NV+FADWMVTVLLI+LFI TSTKA  +G++TWKK
Sbjct  204   MPLIDYDLALLFQPMLMLGISIGVICNVMFADWMVTVLLIILFIATSTKALFKGIDTWKK  263

Query  1007  ETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLL  1186
             ET+MKKEAA+QL         +YK LP GP N  QD       ++V +++N+YWKE  LL
Sbjct  264   ETMMKKEAAKQLEEEPKS--EDYKALPSGPTN-IQD-------EEVPLLKNIYWKELSLL  313

Query  1187  CFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSG  1366
              +VWV+FL +QI K YT TCS  YWV+N LQ+P+++ VALFEA  LYKG R I SKG   
Sbjct  314   VYVWVAFLLVQIAKTYTGTCSIEYWVINFLQVPIAISVALFEAVCLYKGTRVIGSKGKEI  373

Query  1367  SNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfammfsss  1546
             +N +  Q+ +YCF G++AG+VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TF+M+FSSS
Sbjct  374   TNWKIHQIFLYCFCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFSMLFSSS  433

Query  1547  msVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSA  1726
             MSVV+YYLL RFPVPYA F   VAT+AAF+GQHVVR++IA+LGRAS+IIFILA TIF+SA
Sbjct  434   MSVVQYYLLDRFPVPYASFFVLVATIAAFVGQHVVRKIIAILGRASIIIFILASTIFISA  493

Query  1727  ISLGGVGISNMIEKIHNHEYMGFENLC  1807
             ISLGGVGI NMI K+ N EYMGFEN C
Sbjct  494   ISLGGVGIENMIVKMENQEYMGFENFC  520



>ref|XP_006833307.1| hypothetical protein AMTR_s00109p00047950 [Amborella trichopoda]
 gb|ERM98585.1| hypothetical protein AMTR_s00109p00047950 [Amborella trichopoda]
Length=451

 Score =   469 bits (1207),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 298/454 (66%), Positives = 363/454 (80%), Gaps = 7/454 (2%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             MA     WR  R    + + FLL S FVSAER+L    V  T        +     ++FL
Sbjct  1     MAQTENIWRRSRYFAVILFGFLLVSLFVSAERNL----VHRTPEKEEMHGNLALKLIDFL  56

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             WQ   + Y+H+WPEM+ GW I++GSIIGF GAAFGS+GGVGGGGIFVPML+L++GFD KS
Sbjct  57    WQQNVTNYEHVWPEMDFGWRIILGSIIGFFGAAFGSIGGVGGGGIFVPMLTLIIGFDAKS  116

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             +TAISKCMIMGAA S+V+YNLKLRHPTLD+PIIDYDLA+L QPMLMLGISIGV FNVIFA
Sbjct  117   STAISKCMIMGAAGSTVYYNLKLRHPTLDVPIIDYDLALLFQPMLMLGISIGVAFNVIFA  176

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGG--QGEYKLLPGG  1093
             DWMVTVLLI+LF G STKAF++GVETWKKET +KKEAA+ L ++ S G  + EY  LP G
Sbjct  177   DWMVTVLLIILFFGISTKAFMKGVETWKKETTLKKEAAEHLESSKSNGGEEVEYTPLPSG  236

Query  1094  PGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNL  1273
             P NG+  +   S + +VS+IENVYWKE GLL FVWV+FL LQI+K  T+TCS  YWV+N 
Sbjct  237   PDNGSAQS-NASRDAEVSVIENVYWKELGLLVFVWVAFLVLQIMKTNTTTCSVEYWVLNF  295

Query  1274  LQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgg  1453
             LQ+P+++GV+L+EA  LYKGWR I+S GD+G+N +  QL++YCF G++AG+VGGLLG+GG
Sbjct  296   LQVPIAMGVSLYEAVSLYKGWRVIASNGDAGTNWKIHQLVLYCFCGILAGIVGGLLGVGG  355

Query  1454  gfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaaf  1633
             G I+GP+FLELGVPPQVSSATATFAM+FSSSMSVVEYYLLKRFPVPYA +   VA VAAF
Sbjct  356   GSILGPIFLELGVPPQVSSATATFAMIFSSSMSVVEYYLLKRFPVPYAAYFVLVAAVAAF  415

Query  1634  IGQHVVRRLIAVLGRASLIIFILAFTIFVSAISL  1735
             +GQHVVR++I +LGRASLIIFIL+F IF+S I+L
Sbjct  416   VGQHVVRKIIILLGRASLIIFILSFVIFMSTITL  449



>ref|XP_010935066.1| PREDICTED: uncharacterized protein LOC105055061 [Elaeis guineensis]
Length=495

 Score =   469 bits (1206),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 295/465 (63%), Positives = 368/465 (79%), Gaps = 12/465 (3%)
 Frame = +2

Query  452   SAFVSAERSLKN--EEVAGTNVSRNS----DDDY---LSTFVNFLWQPKESGYDHIWPEM  604
             S  V A R L +   E+  +++S N     + DY   LS   + L+   +S Y H+WP+M
Sbjct  25    SEVVLANRPLASSAHEMGSSSISTNHNKIMEKDYKYILSNIFHSLFDNGDSSYTHVWPDM  84

Query  605   ELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVS  784
             E GW +V+GSIIGF+GAA GS+GGVGGGGIFVPML+L++GFDPK++TA+SKCMIMGAA S
Sbjct  85    EFGWRVVLGSIIGFLGAALGSIGGVGGGGIFVPMLTLIIGFDPKTSTAVSKCMIMGAAGS  144

Query  785   SVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGT  964
             +V+YNL+LRHPTLD+PIIDYDLA+L QPMLMLGISIGV FNVIF DWMVTVLLI+LF+GT
Sbjct  145   TVYYNLRLRHPTLDLPIIDYDLALLFQPMLMLGISIGVAFNVIFPDWMVTVLLIILFLGT  204

Query  965   STKAFLRGVETWKKETIMKKEAAQQLAANGS-GGQGEYKLLPGGPGNGTQDTAKESSEKQ  1141
             STKA  +G+ETWKKE+I+KKEAA+ L +  +   + EYK LPG P    Q T   S + +
Sbjct  205   STKALFKGIETWKKESILKKEAAKLLTSQSNESPKLEYKPLPGAPAANAQVTL--SPDDE  262

Query  1142  VSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATG  1321
             V I EN+YWKEF LL FVWV+FLA+QIVK Y +TCS  YW++N+LQ+P++L V L+EA  
Sbjct  263   VPIKENIYWKEFMLLLFVWVAFLAVQIVKTYATTCSIEYWILNVLQVPIALSVTLYEAIN  322

Query  1322  LYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQ  1501
             L KG R I+S+G      +  QL++YCF G++AG+VGGLLGLGGGFI+GPLFLE+GVPPQ
Sbjct  323   LCKGTRTIASRGKQDMRWKMHQLLLYCFCGVLAGIVGGLLGLGGGFILGPLFLEMGVPPQ  382

Query  1502  VssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRA  1681
             V+SAT+TFAM FSSSMSV++YYLL RFPVPYA +   +ATVAAF GQH+VRRLI +LGRA
Sbjct  383   VASATSTFAMTFSSSMSVIQYYLLDRFPVPYAAYFVFLATVAAFTGQHIVRRLIVLLGRA  442

Query  1682  SLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  1816
             SLIIFILA TIFVSAISLGGVGI++M+EK+   E+MGFENLC + 
Sbjct  443   SLIIFILALTIFVSAISLGGVGIAHMVEKLERKEHMGFENLCYHS  487



>ref|XP_010263696.1| PREDICTED: uncharacterized protein LOC104601887 [Nelumbo nucifera]
Length=473

 Score =   467 bits (1201),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 296/473 (63%), Positives = 367/473 (78%), Gaps = 15/473 (3%)
 Frame = +2

Query  413   RPLVALSWSFLLASAFVS----AERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESG  580
             R + A +W  +L    VS    AER  ++     +      ++ ++   VNFLWQ  +S 
Sbjct  9     RAVEATAWVVVLGIIMVSRVGGAERLSRHVCGEVSAEEETGEEGFMVRLVNFLWQSGKSI  68

Query  581   YDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKC  760
             Y H+WPEME GW +V+GSIIGF GAA GSVGGVGGGGIFVPML+L++GFDPKS+TAISKC
Sbjct  69    YHHVWPEMEFGWRLVLGSIIGFFGAAVGSVGGVGGGGIFVPMLTLIIGFDPKSSTAISKC  128

Query  761   MIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVL  940
             MIMGAA S+V+YNL+ RHPTL++PIIDYDLA+L QPMLMLGISIGV FNV+FADWMVTVL
Sbjct  129   MIMGAAGSTVYYNLRHRHPTLELPIIDYDLALLFQPMLMLGISIGVAFNVMFADWMVTVL  188

Query  941   LIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQG---EYKLLPGGPGNGTQ  1111
             LI+LF+GTSTKA  +G+ETWKKETIMKKEAA+ L +      G   EYK LP GP     
Sbjct  189   LIILFLGTSTKALFKGIETWKKETIMKKEAAKLLESESKPTDGPGLEYKPLPSGPNPLLD  248

Query  1112  DTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVS  1291
             D        +V +I+N+YWKE  LL  VWV+FLA+QIVK Y  TCS  YW++NL+Q+P++
Sbjct  249   D--------EVPLIDNIYWKELTLLVLVWVAFLAVQIVKTYAKTCSLEYWLLNLIQVPIA  300

Query  1292  LGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgp  1471
               V+L+EA  LY+G R I+SKG   +N +   L +YCF G++AG+VGGLLGLGGGFI+GP
Sbjct  301   ASVSLYEAICLYRGKRVIASKGKELTNWKVPLLFLYCFCGIVAGIVGGLLGLGGGFILGP  360

Query  1472  lflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVV  1651
             LFLEL VPPQV+SAT+TF M+FSSSMSVV+YYLLKRFPVPYA +   VAT+AAF GQHVV
Sbjct  361   LFLELEVPPQVASATSTFVMVFSSSMSVVQYYLLKRFPVPYASYFVLVATIAAFTGQHVV  420

Query  1652  RRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  1810
             R+LI +LGRAS+IIFILA TIFVSA+SLGGVGI+NM+E + ++EYMGFE+LC+
Sbjct  421   RKLITLLGRASIIIFILAMTIFVSALSLGGVGIANMLEMLEHNEYMGFESLCQ  473



>ref|XP_006595132.1| PREDICTED: uncharacterized protein LOC100789733 isoform X2 [Glycine 
max]
Length=480

 Score =   467 bits (1201),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 292/456 (64%), Positives = 360/456 (79%), Gaps = 3/456 (1%)
 Frame = +2

Query  452   SAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIG  631
             S  VSA + + ++ +  T V   +   +L   VNFLW    SGY H WP++E GW I+ G
Sbjct  24    SVSVSALQHVSHKNINPTTV-ETTQTSFLGKVVNFLWSSSGSGYQHTWPDIEFGWRIITG  82

Query  632   SIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLR  811
             +IIGF+G+AFG+VGGVGGGGIFV MLSL++GFD KSATAISKCMI G A ++V YNLK +
Sbjct  83    TIIGFLGSAFGTVGGVGGGGIFVTMLSLIIGFDAKSATAISKCMITGGAAATVFYNLKQK  142

Query  812   HPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGV  991
             HPTLDMP+IDYDLA+L QP+L+LGISIGV FNVIFADWM+TVLL+++F+G +TKAFL+GV
Sbjct  143   HPTLDMPVIDYDLALLFQPVLVLGISIGVAFNVIFADWMITVLLLIIFVGIATKAFLKGV  202

Query  992   ETWKKETIMKKEAAQQLAANGSGGQGE--YKLLPGGPGNGTQDTAKESSEKQVSIIENVY  1165
             ETWKKETI+KKE A+Q   NG+    E  Y+ LPGGP     +  K+S E   S++ENV 
Sbjct  203   ETWKKETIIKKETARQSQFNGTERSEEVAYEPLPGGPNTSNHNEPKKSKETTGSVLENVR  262

Query  1166  WKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKI  1345
             WK  G+L  VWV  LA +I K++T+TCS  YW++NLLQ+PV+LG   ++A  LY G R I
Sbjct  263   WKALGVLFTVWVLILASEIAKSHTTTCSVEYWILNLLQVPVALGATSYQAVLLYTGKRVI  322

Query  1346  SSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatf  1525
             +SKGD  +  RA QL++YC  G+ AG+VGGLLGLGGGFI+GPLFLELG+PPQVSSATATF
Sbjct  323   ASKGDQRTQWRAHQLVLYCSCGICAGIVGGLLGLGGGFILGPLFLELGIPPQVSSATATF  382

Query  1526  ammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILA  1705
             AM FS+SMSVVEYYLLKRFP+PY L+  AV+T AAF+GQ +VR+L+A+LGRASLIIFIL+
Sbjct  383   AMTFSASMSVVEYYLLKRFPIPYTLYFVAVSTFAAFVGQVLVRKLVAILGRASLIIFILS  442

Query  1706  FTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
              TIFVSAISLGGVGISNMI+KI N EYMGFENLC Y
Sbjct  443   GTIFVSAISLGGVGISNMIQKIANKEYMGFENLCTY  478



>ref|XP_003517231.1| PREDICTED: uncharacterized protein LOC100801441 [Glycine max]
Length=470

 Score =   466 bits (1199),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 290/447 (65%), Positives = 360/447 (81%), Gaps = 11/447 (2%)
 Frame = +2

Query  467   AERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgf  646
             A+R LK +E+ G +V +      L   VNFLW+  +S Y+ +WP M+ GW I++GSIIGF
Sbjct  32    ADRILKEKEL-GNDVPKERQG-ILKAIVNFLWEEGKSSYEPVWPNMKFGWRIIVGSIIGF  89

Query  647   mgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLD  826
             +GAA GSVGGVGGGGIFVPML+L++GFDPKS+TAISKCMIMGA++S+V+YNL+LRHPTLD
Sbjct  90    LGAALGSVGGVGGGGIFVPMLALIIGFDPKSSTAISKCMIMGASISTVYYNLRLRHPTLD  149

Query  827   MPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKK  1006
             MP+IDYDLA++ QPMLMLGISIGV  NV+FADWMVTVLLI+LFI TSTKA  +G++TWKK
Sbjct  150   MPLIDYDLALIFQPMLMLGISIGVICNVMFADWMVTVLLIILFIATSTKATYKGIDTWKK  209

Query  1007  ETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLL  1186
             ETI KKEA++ L A    G  +YK LP GP         ES  ++  +++N+YWKE  LL
Sbjct  210   ETIAKKEASKLLEAEPKSGD-DYKSLPSGP--------TESLFEEAPLLKNIYWKELSLL  260

Query  1187  CFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSG  1366
              +VWV+F  +QIVK YT  CS  +W++N LQ+PV++ V LFEA GLYKG R I+SKG   
Sbjct  261   AYVWVAFFIVQIVKEYTKPCSIQFWLLNFLQVPVAVSVTLFEAIGLYKGTRVIASKGKEV  320

Query  1367  SNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfammfsss  1546
             +N +  Q+ +YC  G++AG+VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSS
Sbjct  321   TNWKIHQICLYCSTGIMAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSS  380

Query  1547  msVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSA  1726
             MSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++I VLGRAS+IIFILA TIF+SA
Sbjct  381   MSVVQYYLLDRFPVPYASYFALVATIAAFTGQHVVRKVIVVLGRASIIIFILALTIFISA  440

Query  1727  ISLGGVGISNMIEKIHNHEYMGFENLC  1807
             ISLGGVGI N+IEKI NHEYMGFE+LC
Sbjct  441   ISLGGVGIENIIEKIENHEYMGFEDLC  467



>ref|XP_009346009.1| PREDICTED: uncharacterized protein LOC103937781 [Pyrus x bretschneideri]
Length=489

 Score =   467 bits (1201),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 285/433 (66%), Positives = 355/433 (82%), Gaps = 3/433 (1%)
 Frame = +2

Query  524   DDDYLSTFVNFLWQ-PKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFV  700
                + +  +NFLWQ  +   Y+H+WPEM +GW+IV+G+IIGF+G+AFG+VGGVGGGGIFV
Sbjct  55    SHKFQTRMLNFLWQLGRLFSYEHVWPEMTIGWKIVVGTIIGFLGSAFGTVGGVGGGGIFV  114

Query  701   PMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLML  880
             PML+L++GFD KS+TAISKCMI GAA+SSV YNL+LRHPT D+P+IDYDLA+L QPML+L
Sbjct  115   PMLTLIIGFDQKSSTAISKCMITGAAISSVFYNLRLRHPTADLPLIDYDLALLFQPMLVL  174

Query  881   GISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSG  1060
             GISIGV FNVIFA+WM+TVLLI+ F+ TS++AF +G+ETWKKETI+KKEAA+++ +NG  
Sbjct  175   GISIGVAFNVIFANWMITVLLIITFLATSSRAFFKGIETWKKETIVKKEAARRMQSNGDD  234

Query  1061  GQGE--YKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNY  1234
                E  YK LP GP NGT     ES   +VSI EN+YWKE  +L  VW+  LALQI KNY
Sbjct  235   ATAEVYYKPLPSGPSNGTPTETGESKRTEVSIFENLYWKELLILFAVWIIILALQIAKNY  294

Query  1235  TSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgm  1414
             T++CS  YW  NLLQIPV+ GV +FEA  LYKG R I+S+ +  +N    QL++    G+
Sbjct  295   TTSCSAAYWAYNLLQIPVAFGVTIFEAVKLYKGDRVIASRAELNTNWTVNQLVLCSACGI  354

Query  1415  iagvvggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPY  1594
             IAG+VGGLLGLGGGFI+GP+FLELG+PPQVSSATATFAM FS+S+SVVEYYLLKRFP+PY
Sbjct  355   IAGIVGGLLGLGGGFILGPVFLELGIPPQVSSATATFAMTFSASLSVVEYYLLKRFPIPY  414

Query  1595  alfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIH  1774
             AL+ TAVAT +A +GQ+VVR++++ LGRAS+IIFILAFTIFVSAISLGGVGI +MIEKI 
Sbjct  415   ALYFTAVATFSALVGQYVVRKVVSFLGRASIIIFILAFTIFVSAISLGGVGIVDMIEKIK  474

Query  1775  NHEYMGFENLCKY  1813
             + EYMGFEN+C Y
Sbjct  475   HKEYMGFENICTY  487



>gb|KDO79522.1| hypothetical protein CISIN_1g011797mg [Citrus sinensis]
Length=474

 Score =   466 bits (1200),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 290/452 (64%), Positives = 357/452 (79%), Gaps = 14/452 (3%)
 Frame = +2

Query  464   SAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIg  643
             +AER LK+++       + +   +L    +FLWQ  ES Y+ +WP    GW++V+GSI+G
Sbjct  32    NAERLLKDKDPQVFADEKETRPGFLCRVAHFLWQSGESSYEPVWP---FGWKVVVGSIVG  88

Query  644   fmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTL  823
             F GAA GSVGGVGGGGIFVPML+L++GFDPKSATAISKCMIMGAA S+V+YNL+LRHPTL
Sbjct  89    FFGAALGSVGGVGGGGIFVPMLTLIIGFDPKSATAISKCMIMGAAGSTVYYNLRLRHPTL  148

Query  824   DMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWK  1003
             DMP+IDYDLA+L QPMLMLGISIGV FNV+FADWMVTVLLI+LFIGTSTKA  +G++TWK
Sbjct  149   DMPLIDYDLALLFQPMLMLGISIGVAFNVMFADWMVTVLLIILFIGTSTKALFKGIDTWK  208

Query  1004  KETIMKKEAAQQLAANGSGGQ---GEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKE  1174
             KET+MKKEAA+ L +          +YK LP GP            +++V II+N+YWKE
Sbjct  209   KETMMKKEAAKVLESESKAADVDGQDYKQLPSGPST--------VHDEEVPIIKNIYWKE  260

Query  1175  FGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSK  1354
               LL +VW+ FLA+Q+ K Y   CS  YW++N LQ+P+++ VALFEA  LYKG R I+SK
Sbjct  261   LSLLLYVWLGFLAVQLAKEYVVPCSITYWILNALQVPIAVSVALFEAICLYKGTRVIASK  320

Query  1355  GDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfamm  1534
             G   +N +  Q++ YCF G++AG+VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM 
Sbjct  321   GKEITNWKIHQIVFYCFCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMT  380

Query  1535  fsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTI  1714
             FSSSMSVV+YYLL RFPVPYA F T VAT AAF GQHVVR++IAVLGRAS+I+FILA TI
Sbjct  381   FSSSMSVVQYYLLDRFPVPYAAFFTLVATFAAFAGQHVVRKIIAVLGRASIIVFILALTI  440

Query  1715  FVSAISLGGVGISNMIEKIHNHEYMGFENLCK  1810
             FVSAISLGG GI NM++K+ N EYMGFENLC+
Sbjct  441   FVSAISLGGFGIENMVKKLKNQEYMGFENLCQ  472



>ref|XP_011025767.1| PREDICTED: uncharacterized protein LOC105126564 [Populus euphratica]
Length=477

 Score =   465 bits (1196),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 289/458 (63%), Positives = 364/458 (79%), Gaps = 12/458 (3%)
 Frame = +2

Query  443   LLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEI  622
             +L +   SAER LK++E A T V ++    Y+    +FL+Q  +S Y+ +WP+M+  W I
Sbjct  26    VLMTNMASAERLLKDKE-AETLVKKDMSPGYIVKMFHFLFQGGKSSYEPVWPDMKFDWRI  84

Query  623   VIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNL  802
              +G+I+GF GAA GSVGGVGGGGIFVPML+L++GFDPKS+TAISKCMIMGAA ++V+YNL
Sbjct  85    TVGTIVGFFGAALGSVGGVGGGGIFVPMLTLIIGFDPKSSTAISKCMIMGAAGATVYYNL  144

Query  803   KLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFL  982
             +LRHPTL+MPIIDYDLA+L QPMLMLGIS+GV FNV+FADWMVTVLLI+LF+GTSTKA  
Sbjct  145   RLRHPTLEMPIIDYDLALLFQPMLMLGISVGVAFNVMFADWMVTVLLIILFLGTSTKALF  204

Query  983   RGVETWKKETIMKKEAAQQLAAN---GSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSII  1153
             +G++TWKKE++MKKEAA+QL +    G   + EY+ LP GP     D        +V++ 
Sbjct  205   KGIDTWKKESVMKKEAAKQLESESKPGDDAEEEYQPLPSGPVVLHDD--------EVTLR  256

Query  1154  ENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKG  1333
             EN+ WKE  LL +VWV+FL +QIV+    TCS +YW++NLLQ+P++  V LFEA  L KG
Sbjct  257   ENIRWKELALLVYVWVAFLLVQIVQTNVPTCSVMYWILNLLQVPIAASVTLFEAISLCKG  316

Query  1334  WRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssa  1513
              R I+SKG   +N +   +++YC  G+IAG+VGGLLGLGGGFI+GPLFLELG+PPQV+SA
Sbjct  317   TRVIASKGKEITNWKLHLVLLYCSCGIIAGIVGGLLGLGGGFILGPLFLELGIPPQVASA  376

Query  1514  tatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLII  1693
             T+TFAM FSSSMSVVEYYLL RFPVPYA +   VAT+AAF GQHV+RR+IA+LGRAS+II
Sbjct  377   TSTFAMAFSSSMSVVEYYLLNRFPVPYAAYFVLVATIAAFAGQHVIRRIIAILGRASIII  436

Query  1694  FILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             FILA TIFVSAISLGGVGI+NM+EK+ N EYMGFENLC
Sbjct  437   FILALTIFVSAISLGGVGIANMVEKLENDEYMGFENLC  474



>tpg|DAA61110.1| TPA: hypothetical protein ZEAMMB73_890925 [Zea mays]
Length=404

 Score =   462 bits (1188),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 291/404 (72%), Positives = 343/404 (85%), Gaps = 2/404 (0%)
 Frame = +2

Query  602   MELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAV  781
             ME GW+IV+GS+IGF GAAFGSVGGVGGGGIFVPML+L++GFDPKS+TAISKCMIMGA+V
Sbjct  1     MEFGWQIVLGSLIGFFGAAFGSVGGVGGGGIFVPMLTLIIGFDPKSSTAISKCMIMGASV  60

Query  782   SSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIG  961
             S+V+YNLKL+HPTLDMP+IDYDLAVL+QPMLMLGISIGV FNVIF DW+VTVLLI+LF+G
Sbjct  61    STVYYNLKLKHPTLDMPVIDYDLAVLMQPMLMLGISIGVIFNVIFPDWLVTVLLIILFLG  120

Query  962   TSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTAKESSEKQ  1141
             TSTKAFL+G+ETWKKET++++EAA+ L    +G + EY  LP GP       A  S E  
Sbjct  121   TSTKAFLKGIETWKKETVIQREAAKLLEQT-AGEEAEYAALPTGPDVAANKKALTSDEAP  179

Query  1142  VSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATG  1321
              S+I+N++WK+ GLL FVWV+FL LQ+ KNYT+TCS  YWV+NLLQ+PVS+GV L+E  G
Sbjct  180   -SLIKNIHWKKVGLLSFVWVAFLVLQVTKNYTATCSPWYWVLNLLQVPVSVGVTLYEGFG  238

Query  1322  LYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQ  1501
             L  G R +SSKG   + ++  Q++VY  FG+ AG+VGGLLGLGGGFIMGPLFLELG+PPQ
Sbjct  239   LMSGKRVLSSKGSGQTTMKFHQVVVYGLFGIAAGLVGGLLGLGGGFIMGPLFLELGIPPQ  298

Query  1502  VssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRA  1681
             VSSATATFAMMFSSSMSVVEYYLL RFPVPYA++   VA VAA IGQHVVR+LI  LGRA
Sbjct  299   VSSATATFAMMFSSSMSVVEYYLLNRFPVPYAVYFIVVAFVAAIIGQHVVRKLINWLGRA  358

Query  1682  SLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             SLIIFILAF IFVSAISLGGVG+SNM+ KI  HEYMGFE+LCKY
Sbjct  359   SLIIFILAFMIFVSAISLGGVGVSNMVHKIERHEYMGFEDLCKY  402



>gb|KHG02837.1| ATP synthase subunit delta [Gossypium arboreum]
Length=469

 Score =   463 bits (1192),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 297/479 (62%), Positives = 370/479 (77%), Gaps = 18/479 (4%)
 Frame = +2

Query  392   GGKWRILRPLVALSW--SFLLASAFVS-AERSLKNEEVAGTNVSRNSDDDYLSTFVNFLW  562
             GG    LR L  ++W  S +L  + V  AER LK+      N              NFLW
Sbjct  2     GGIQVNLRGLAMVAWILSLVLVMSDVGIAERLLKHRR----NQENEETQGLFLRVANFLW  57

Query  563   QPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSA  742
             Q  +S Y+ +WPEM+ GW+IV+GSI+GF+GAA GSVGGVGGGGIFVPMLSL++GFDPKS+
Sbjct  58    QDGKSAYEPVWPEMKFGWKIVVGSIVGFLGAALGSVGGVGGGGIFVPMLSLIIGFDPKSS  117

Query  743   TAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFAD  922
             TAISKCMIMGAA S+V+YNL+LRHPTL+MP+IDYDLA+L QPMLMLGISIGV  NV+FAD
Sbjct  118   TAISKCMIMGAAGSTVYYNLRLRHPTLEMPLIDYDLALLFQPMLMLGISIGVALNVMFAD  177

Query  923   WMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQ---QLAANGSGGQGEYKLLPGG  1093
             WMVTVLLI+LFIGTSTKA  +G++TWKKETI+KKEAA+   + +    G   +YK LP G
Sbjct  178   WMVTVLLIILFIGTSTKALFKGIDTWKKETILKKEAAKVESEESKPADGASQDYKPLPSG  237

Query  1094  PGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNL  1273
             PGN T+D        +V +++N+YWKE   L +VW+ FL +QI+K Y  TCS +YW+V  
Sbjct  238   PGNQTED--------EVPLLQNIYWKELSSLVYVWIGFLIVQIIKEYLPTCSVMYWIVTS  289

Query  1274  LQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgg  1453
             LQIP++  V +FEA  L KG R I+SKG   +N +  Q+++YC  G+IAG+VGGLLGLGG
Sbjct  290   LQIPIAASVTIFEAICLCKGTRVIASKGKEITNWKMHQILLYCSCGIIAGMVGGLLGLGG  349

Query  1454  gfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaaf  1633
             GFI+GPLFLELG+PPQV+SAT+TF+M+FSSSMSVV+YYLL RFPVPYA +   VAT+AA 
Sbjct  350   GFILGPLFLELGIPPQVASATSTFSMVFSSSMSVVQYYLLDRFPVPYAAYFVLVATMAAI  409

Query  1634  IGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  1810
              GQHVVRR+IAV+GRAS+IIFILA TIF+SAISLGGVGI++M++K+ N EYMGFENLCK
Sbjct  410   AGQHVVRRIIAVIGRASIIIFILALTIFISAISLGGVGIADMVKKLANKEYMGFENLCK  468



>ref|XP_004287906.1| PREDICTED: uncharacterized protein LOC101304510 [Fragaria vesca 
subsp. vesca]
Length=478

 Score =   463 bits (1191),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 289/460 (63%), Positives = 361/460 (78%), Gaps = 11/460 (2%)
 Frame = +2

Query  437   SFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGW  616
             S L+ S  VS ER LK+++     V  +         +  LWQ   S Y  +WPEM+ GW
Sbjct  24    SLLMVSEVVSGERPLKDDQKPRNFVEEDIKQGAFLRMMKLLWQTGGSSYQPVWPEMKFGW  83

Query  617   EIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHY  796
             +I++G+I+GF GAA GSVGGVGGGGIFVPML+L++GFDPKS+TAISKCMIMGAA S+V++
Sbjct  84    KIIVGTIVGFFGAALGSVGGVGGGGIFVPMLALIIGFDPKSSTAISKCMIMGAAGSTVYF  143

Query  797   NLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKA  976
             NL+LRHPTLDMP+IDYDLA+L QPMLMLGISIGV FNV+FADWMVTVLLI+LF GT+ KA
Sbjct  144   NLRLRHPTLDMPLIDYDLALLFQPMLMLGISIGVAFNVMFADWMVTVLLIILFFGTAGKA  203

Query  977   FLRGVETWKKETIMKKEAAQQLAANGSGGQG---EYKLLPGGPGNGTQDTAKESSEKQVS  1147
              ++G+ETWKKET+MKKEA +QL +    G G   +YK LP GP +  QD       + V 
Sbjct  204   LMKGIETWKKETMMKKEAERQLESESKPGDGSGEDYKPLPSGPIS-LQD-------EHVP  255

Query  1148  IIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLY  1327
             I  NV+WKE  LL +VWV+FL +QIVK YT TCST++WV+N +Q+P++  V +FE+  L+
Sbjct  256   ISRNVHWKELLLLVYVWVAFLIVQIVKTYTETCSTMFWVLNSMQVPIAASVTVFESICLW  315

Query  1328  KGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVs  1507
             KG R I+SKG   +N +  QL +YC  G++AG+VGGLLGLGGGFI+GPLFLELG+PPQV+
Sbjct  316   KGTRVIASKGKEITNWKLHQLFLYCSCGIVAGMVGGLLGLGGGFILGPLFLELGIPPQVA  375

Query  1508  satatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASL  1687
             SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++IAV+GRAS+
Sbjct  376   SATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKVIAVVGRASI  435

Query  1688  IIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             +IFILA TI VSAISLGGVGI+NM+EK+ N EYMGFEN C
Sbjct  436   VIFILALTILVSAISLGGVGIANMVEKMENQEYMGFENFC  475



>ref|XP_003542098.1| PREDICTED: uncharacterized protein LOC100789733 isoform X1 [Glycine 
max]
Length=487

 Score =   463 bits (1191),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 293/463 (63%), Positives = 361/463 (78%), Gaps = 10/463 (2%)
 Frame = +2

Query  452   SAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIG  631
             S  VSA + + ++ +  T V   +   +L   VNFLW    SGY H WP++E GW I+ G
Sbjct  24    SVSVSALQHVSHKNINPTTV-ETTQTSFLGKVVNFLWSSSGSGYQHTWPDIEFGWRIITG  82

Query  632   SIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLR  811
             +IIGF+G+AFG+VGGVGGGGIFV MLSL++GFD KSATAISKCMI G A ++V YNLK +
Sbjct  83    TIIGFLGSAFGTVGGVGGGGIFVTMLSLIIGFDAKSATAISKCMITGGAAATVFYNLKQK  142

Query  812   HPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGV  991
             HPTLDMP+IDYDLA+L QP+L+LGISIGV FNVIFADWM+TVLL+++F+G +TKAFL+GV
Sbjct  143   HPTLDMPVIDYDLALLFQPVLVLGISIGVAFNVIFADWMITVLLLIIFVGIATKAFLKGV  202

Query  992   ETWKKETIMKKEAAQQLAANGSGGQGE--YKLLPGGPGNGTQDTAKESSEKQV-------  1144
             ETWKKETI+KKE A+Q   NG+    E  Y+ LPGGP     +  K+S E  V       
Sbjct  203   ETWKKETIIKKETARQSQFNGTERSEEVAYEPLPGGPNTSNHNEPKKSKETTVRLRHHKG  262

Query  1145  SIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGL  1324
             S++ENV WK  G+L  VWV  LA +I K++T+TCS  YW++NLLQ+PV+LG   ++A  L
Sbjct  263   SVLENVRWKALGVLFTVWVLILASEIAKSHTTTCSVEYWILNLLQVPVALGATSYQAVLL  322

Query  1325  YKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQV  1504
             Y G R I+SKGD  +  RA QL++YC  G+ AG+VGGLLGLGGGFI+GPLFLELG+PPQV
Sbjct  323   YTGKRVIASKGDQRTQWRAHQLVLYCSCGICAGIVGGLLGLGGGFILGPLFLELGIPPQV  382

Query  1505  ssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRAS  1684
             SSATATFAM FS+SMSVVEYYLLKRFP+PY L+  AV+T AAF+GQ +VR+L+A+LGRAS
Sbjct  383   SSATATFAMTFSASMSVVEYYLLKRFPIPYTLYFVAVSTFAAFVGQVLVRKLVAILGRAS  442

Query  1685  LIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             LIIFIL+ TIFVSAISLGGVGISNMI+KI N EYMGFENLC Y
Sbjct  443   LIIFILSGTIFVSAISLGGVGISNMIQKIANKEYMGFENLCTY  485



>ref|XP_010254876.1| PREDICTED: uncharacterized protein LOC104595716 isoform X1 [Nelumbo 
nucifera]
Length=471

 Score =   462 bits (1189),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 287/462 (62%), Positives = 360/462 (78%), Gaps = 11/462 (2%)
 Frame = +2

Query  434   WSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELG  613
             W  ++     +AER L+  +          +D Y+   +N L Q + S Y H+WPEM+L 
Sbjct  18    WGVMMVCQVGAAERLLRGVDQQVLVEKEIREDGYMVRLINLLRQNENSTYHHVWPEMKLE  77

Query  614   WEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVH  793
             W +V+GSIIGF GAA GSVGGVGGGGIFVPML+L++GFD KS+TAISKCMIMGAA S+V+
Sbjct  78    WRLVLGSIIGFFGAALGSVGGVGGGGIFVPMLTLIIGFDAKSSTAISKCMIMGAAGSAVY  137

Query  794   YNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTK  973
             YNL++RHPTLD+P+ID+DLA+L QPMLMLGISIGV FNVIFA+WMVT+LLI+LF+GTSTK
Sbjct  138   YNLRIRHPTLDLPVIDFDLALLFQPMLMLGISIGVAFNVIFAEWMVTLLLIILFLGTSTK  197

Query  974   AFLRGVETWKKETIMKKEAAQQLAANGSGGQG---EYKLLPGGPGNGTQDTAKESSEKQV  1144
             A  +G+ETWKKETIMKKEAA+ L        G   +YK LPGGP +   D        QV
Sbjct  198   ALFKGIETWKKETIMKKEAARLLEPETKPTDGPGLDYKPLPGGPSSALDD--------QV  249

Query  1145  SIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGL  1324
              +++N+YWKE  LL  VWV+ LA+QIVK Y  TCS  YW++NLLQ+P+++ V+L+EA  L
Sbjct  250   PVMDNIYWKELTLLVSVWVAILAVQIVKTYAKTCSFEYWLLNLLQVPIAVSVSLYEAVCL  309

Query  1325  YKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQV  1504
             YKG R I+SKG   +NL+   L  YC  G++AGVVGGLLGLGGGFI+GPLFLELG+PPQV
Sbjct  310   YKGKRVIASKGKEVTNLKVHLLFFYCLCGIVAGVVGGLLGLGGGFILGPLFLELGIPPQV  369

Query  1505  ssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRAS  1684
             +S+T+TF M+FSSSMSV++YYLLKRFPVPYA +   +ATVAAF GQHVVR+LI + GRAS
Sbjct  370   ASSTSTFVMVFSSSMSVIQYYLLKRFPVPYAAYFVLIATVAAFTGQHVVRKLIRLFGRAS  429

Query  1685  LIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  1810
             LIIFILA TIFVSAI LGGVGI++M+EK+ ++EYMGFE+LC+
Sbjct  430   LIIFILALTIFVSAIGLGGVGIADMVEKLEHNEYMGFESLCQ  471



>ref|XP_010691331.1| PREDICTED: uncharacterized protein LOC104904681 [Beta vulgaris 
subsp. vulgaris]
Length=463

 Score =   461 bits (1187),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 300/461 (65%), Positives = 365/461 (79%), Gaps = 19/461 (4%)
 Frame = +2

Query  440   FLLASAFVSA-ERSLKNEEVAGTNVSRNSDD-DYLSTFVNFLWQPKESGYDHIWPEMELG  613
             FLL   FVSA E +LK  EVA   +     +   L   +NFLWQ  ++ Y+H+WPE+E  
Sbjct  19    FLLV--FVSANEETLK--EVASAEIEMEEIEVSLLRKTINFLWQSGQNTYEHVWPELEFD  74

Query  614   WEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVH  793
             W IV+GS+IGF GA+FGSVGGVGGGGIFVPML+L++GFD KS+TAISKCMIMGAAVS+V+
Sbjct  75    WRIVVGSLIGFFGASFGSVGGVGGGGIFVPMLTLIIGFDSKSSTAISKCMIMGAAVSTVY  134

Query  794   YNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTK  973
             YNLK RHPT+DMP+IDYDLA+L QP+L+LGISIGV FNVIFADWM+TVLLI+LF+ TSTK
Sbjct  135   YNLKQRHPTMDMPVIDYDLALLFQPVLVLGISIGVAFNVIFADWMITVLLIILFLFTSTK  194

Query  974   AFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSII  1153
             AFL+GV+ WKKETIM KE AQ+L+   +G  G+YK+LP  P            +++VSI 
Sbjct  195   AFLKGVDAWKKETIMFKETAQRLS---NGDSGDYKVLPAVP----------DKKEEVSIR  241

Query  1154  ENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKG  1333
             ENV+W   G+L  VW + L L+I + YT+TC+ L+WV NL QIP++LG + +EA  LY G
Sbjct  242   ENVHWPSVGILFAVWFAILGLEIAQKYTTTCTVLFWVTNLAQIPIALGASGYEAYMLYTG  301

Query  1334  WRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssa  1513
              R I+S+GD+  N +  QL++  F GM AG+VGGLLGLGGGFI+GPLFLELG+PPQVSSA
Sbjct  302   KRVIASRGDAAGNWKVYQLVLCLFTGMSAGMVGGLLGLGGGFILGPLFLELGIPPQVSSA  361

Query  1514  tatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLII  1693
             TATFAMMFSSSMSVVEYYLLKRFPVPYA +  AVAT AA +GQ +VRRLIA++GRASLII
Sbjct  362   TATFAMMFSSSMSVVEYYLLKRFPVPYAAYFVAVATFAALVGQILVRRLIAIIGRASLII  421

Query  1694  FILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  1816
             FILAFTIFVSAISLGGVGISNM+ KI  HEYMGF++LC Y 
Sbjct  422   FILAFTIFVSAISLGGVGISNMVYKIQQHEYMGFDSLCAYA  462



>gb|KHM98753.1| hypothetical protein glysoja_030806 [Glycine soja]
Length=479

 Score =   461 bits (1187),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 300/483 (62%), Positives = 374/483 (77%), Gaps = 13/483 (3%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFL  559
             M G+  +W +    + L++S LL SA VSA   + ++++  T     ++  +L   +NFL
Sbjct  3     MNGSPRRWDVR---LVLTFSLLLISASVSALEHVNHKKIDPTT----AETSFLGKVMNFL  55

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             W    SGY+H WPE+E GW I+ G+IIGF+G+AFG+VGGVGGGGIFV MLSL++GFD KS
Sbjct  56    WSSSGSGYEHTWPEIEFGWRIITGTIIGFVGSAFGTVGGVGGGGIFVTMLSLIIGFDAKS  115

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             ATAISKCMI G A ++V YNL+ +HPTLDMP+IDYDLA+L QP+L+LGISIGV FNVIFA
Sbjct  116   ATAISKCMITGGAAATVFYNLRQKHPTLDMPVIDYDLALLFQPVLVLGISIGVAFNVIFA  175

Query  920   DWMVTVLLIVLFIGT-STKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGE--YKLLPG  1090
             DWM+TVLL+++F+G  +TKAFL+GVETWKKETI+KKE A+Q   NG+    E  Y+ LPG
Sbjct  176   DWMITVLLLIIFVGRIATKAFLKGVETWKKETIIKKETARQSQFNGTERTAEVAYEPLPG  235

Query  1091  GPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVN  1270
             GP        K+S E   SI+ENV WK  G+L  VWV  LA +I K++T+TCS  YWV+N
Sbjct  236   GPNTSNHKEPKKSKETG-SILENVRWKALGVLFTVWVLILASEIAKSHTTTCSVEYWVLN  294

Query  1271  LLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglg  1450
             LLQ+PV+LG   ++A  LY G R I+SKGD  +  RA QLI+YC  G+ AG+VGGLLGLG
Sbjct  295   LLQVPVALGATSYQAVLLYTGKRVIASKGDQRTQWRAHQLIMYCSCGICAGIVGGLLGLG  354

Query  1451  ggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaa  1630
             GGFI+GPLFLELG+PPQVSSATATFAM FS+SMSVVEYYLLKRFP+PY L+  AV+T AA
Sbjct  355   GGFILGPLFLELGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPIPYTLYFVAVSTFAA  414

Query  1631  fIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLG--GVGISNMIEKIHNHEYMGFENL  1804
             F+GQ +VR+L+A+LGRASLIIFIL+ TIFVSAISLG  GVGISNMI++I N EYMGFENL
Sbjct  415   FVGQVLVRKLVAILGRASLIIFILSSTIFVSAISLGKCGVGISNMIQRIANKEYMGFENL  474

Query  1805  CKY  1813
             C Y
Sbjct  475   CTY  477



>gb|KDO79725.1| hypothetical protein CISIN_1g011811mg [Citrus sinensis]
Length=365

 Score =   457 bits (1176),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 276/353 (78%), Positives = 313/353 (89%), Gaps = 4/353 (1%)
 Frame = +2

Query  758   CMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTV  937
             CMIMGAAVS+V+YNLKLRHPTLDMPIIDYDLA+LIQPMLMLGISIGV FNVIFADWMVTV
Sbjct  14    CMIMGAAVSTVYYNLKLRHPTLDMPIIDYDLALLIQPMLMLGISIGVAFNVIFADWMVTV  73

Query  938   LLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSG-GQGEYKLLPGGPGNGTQD  1114
             LLIVLFIGTSTKAFL+GVETWK+ETI+KKEAA+ L +NG+G G+ EYK LP GP +G Q 
Sbjct  74    LLIVLFIGTSTKAFLKGVETWKRETILKKEAARCLGSNGAGAGEVEYKSLPSGPRSGPQ-  132

Query  1115  TAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSL  1294
               K++ E +V+I+EN+ WKE GLL FVWV+FL LQI KN+T++CS +YWV++LLQIPVSL
Sbjct  133   --KDAMEPEVTILENINWKELGLLVFVWVAFLGLQIAKNHTASCSIVYWVLDLLQIPVSL  190

Query  1295  GVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgpl  1474
              V+L+EA  LYKG R I+SKGD G + R  QL+ YC FG++AG+VGGLLGLGGGFIMGPL
Sbjct  191   VVSLYEAISLYKGRRVIASKGDDGKSFRVFQLVSYCAFGVLAGIVGGLLGLGGGFIMGPL  250

Query  1475  flELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVR  1654
             FLELGVPPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+  AVAT+AAF+GQHVVR
Sbjct  251   FLELGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFVAVATIAAFVGQHVVR  310

Query  1655  RLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             +LI +LGRASLIIFILAF IFVSAISLGGVGISNMI K H HEYMGFENLCKY
Sbjct  311   KLIILLGRASLIIFILAFMIFVSAISLGGVGISNMIGKFHRHEYMGFENLCKY  363



>ref|XP_009592781.1| PREDICTED: uncharacterized protein LOC104089559 isoform X1 [Nicotiana 
tomentosiformis]
Length=473

 Score =   461 bits (1186),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 281/461 (61%), Positives = 367/461 (80%), Gaps = 3/461 (1%)
 Frame = +2

Query  440   FLLASAFVSAERSLKNEEVAGTNVSRNSDDDY-LSTFVNFLWQPKESGYDHIWPEMELGW  616
              +LA A V +   + +E     N + +S D Y      + LW+  E  Y H+WPE+E GW
Sbjct  12    LVLALAIVVSAEQIPHEATLSNNGTIHSTDSYYFFDLFSLLWKKSEMHYHHVWPELEFGW  71

Query  617   EIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHY  796
              +++GS+IGF GAAFGSVGGVGGGGIFVPML+L++GFDPK++TAISKCMI GAA ++V+Y
Sbjct  72    RVIVGSVIGFFGAAFGSVGGVGGGGIFVPMLTLIIGFDPKTSTAISKCMITGAAGATVYY  131

Query  797   NLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKA  976
             +LKLRHP L++PIIDYDL +L QPML+LGISIGV  NVIFA+WMVT+LLI+LF+  STKA
Sbjct  132   SLKLRHPLLELPIIDYDLVLLFQPMLLLGISIGVVLNVIFAEWMVTMLLIILFLAASTKA  191

Query  977   FLRGVETWKKETIMKKEAAQQLAANGSGGQG-EYKLLPGGPGNGTQDTAKESSE-KQVSI  1150
             F +G+ETWKKETI+KKEA ++L +NG+GG+   YK++PGGP NG+ +   E  +  +VSI
Sbjct  192   FFKGIETWKKETIIKKEAVRRLTSNGAGGEEVAYKIIPGGPNNGSTNYTNEVYKATEVSI  251

Query  1151  IENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYK  1330
             ++N+YWK+  +L  VW+  LAL I KNY  TCST YW++NLLQ+PV++G + +EA  LYK
Sbjct  252   VDNMYWKDITILIAVWIVILALHIFKNYAPTCSTTYWILNLLQLPVAVGASAYEAVCLYK  311

Query  1331  GWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVss  1510
             G R I S G+     +  QLI+YC  G++AG+VGGLLGLGGGFI+GPLFLELG+PPQVSS
Sbjct  312   GSRMIMSSGEIVITWKVHQLILYCCCGILAGIVGGLLGLGGGFILGPLFLELGIPPQVSS  371

Query  1511  atatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLI  1690
             ATA F M+FSSSMSV++YYLL+RFPVPYAL+  AVA++AA +GQHVVRR+I+++GRAS+I
Sbjct  372   ATAAFVMIFSSSMSVIQYYLLRRFPVPYALYFIAVASIAALVGQHVVRRIISIVGRASVI  431

Query  1691  IFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             IFILAFTIFVSAISLGGVGI++ I+KI   ++MGF+N+C Y
Sbjct  432   IFILAFTIFVSAISLGGVGIADTIKKIEEGQHMGFDNICAY  472



>ref|XP_006383214.1| hypothetical protein POPTR_0005s12570g [Populus trichocarpa]
 gb|ERP61011.1| hypothetical protein POPTR_0005s12570g [Populus trichocarpa]
Length=477

 Score =   461 bits (1186),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 286/459 (62%), Positives = 363/459 (79%), Gaps = 12/459 (3%)
 Frame = +2

Query  443   LLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEI  622
             +L +   SAER LK++E    +  +     Y+   ++FL+Q  +S Y+ +WP+M+  W I
Sbjct  26    VLMTNMASAERLLKDKE-PEASAEKEMSPGYIVKVLHFLFQGGKSSYEPVWPDMKFDWRI  84

Query  623   VIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNL  802
             V+G+I+GF+GAA GSVGGVGGGGIFVPML+L++GFDPKS+TAISKCMIMGAA ++V+YNL
Sbjct  85    VVGTIVGFLGAALGSVGGVGGGGIFVPMLTLIIGFDPKSSTAISKCMIMGAAGATVYYNL  144

Query  803   KLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFL  982
             +LRHPTLDMP+IDYDL +L QPMLMLGISIGV+F+V+FADWMVTVLLI+LFIGTSTKA  
Sbjct  145   RLRHPTLDMPLIDYDLTLLFQPMLMLGISIGVSFSVMFADWMVTVLLIILFIGTSTKALF  204

Query  983   RGVETWKKETIMKKEAAQQLAANG---SGGQGEYKLLPGGPGNGTQDTAKESSEKQVSII  1153
             +G++TWKKET+M+K+AA+QL +      G + +YK LP GP     D        +V + 
Sbjct  205   KGIDTWKKETMMRKDAAKQLESESKPEDGAEEDYKPLPSGPVVLPDD--------EVPLR  256

Query  1154  ENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKG  1333
             EN+YWKE  LL +VW  FL +QIV+ Y  TCS  YW++N LQ+P++  V LFEA  L KG
Sbjct  257   ENIYWKEVALLFYVWAGFLVVQIVQTYFPTCSVTYWILNSLQVPIAASVTLFEAICLCKG  316

Query  1334  WRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssa  1513
              R I+SKG   +N +  Q+++YC  G+IAG+VGGLLGLGGGFI+GPLFLELG+PPQV+SA
Sbjct  317   TRVIASKGKEITNWKLHQILLYCSCGIIAGMVGGLLGLGGGFILGPLFLELGIPPQVASA  376

Query  1514  tatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLII  1693
             T+TFAM FSSSMSVVEYYLL RFPVPYA +   VAT++AF+GQHVVR++IA LGRASLII
Sbjct  377   TSTFAMAFSSSMSVVEYYLLNRFPVPYAAYFALVATISAFVGQHVVRKIIAFLGRASLII  436

Query  1694  FILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  1810
             FILA TIFVSA+SLGGVGI+NM+EK+ N EYMGFENLC+
Sbjct  437   FILALTIFVSAVSLGGVGIANMVEKLENEEYMGFENLCQ  475



>dbj|BAJ87419.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=474

 Score =   460 bits (1183),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 293/439 (67%), Positives = 353/439 (80%), Gaps = 9/439 (2%)
 Frame = +2

Query  524   DDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVP  703
             +  YL    N LWQ   + Y H+WP ++LGW+IV+GS IGF GAAFGS+GGVGGGG+FVP
Sbjct  38    EASYLRKLANSLWQSDGTSYHHVWPPLKLGWKIVLGSFIGFFGAAFGSIGGVGGGGVFVP  97

Query  704   MLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLG  883
             ML+L++GFDPKS+ A+SKCMIMGAAVS+V+ N+KL+HPTLDMP+IDYDLA+LIQPMLMLG
Sbjct  98    MLTLIIGFDPKSSAAMSKCMIMGAAVSTVYCNVKLKHPTLDMPVIDYDLALLIQPMLMLG  157

Query  884   ISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGG  1063
             +SIGV  NVIF DW+VTVLLI+LFI TSTKAFL+ VETWKKETI    A ++  +  +  
Sbjct  158   VSIGVICNVIFPDWLVTVLLIILFIVTSTKAFLKAVETWKKETITIAVATKR--SEETSE  215

Query  1064  QGEYKLLPGGPGNGTQ-------DTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQI  1222
             + EY  L  G    +Q       D  +   ++ VSI +NVYWKE GLL FVWV+FLALQ+
Sbjct  216   EQEYMQLSAGLDAASQSEILSDHDQNETPPDEAVSIWKNVYWKEVGLLGFVWVAFLALQL  275

Query  1223  VKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYC  1402
              KNY +TCS  YWV+NLLQIPVS+GVA++EA GL +G R ISSK +  ++LRA QL+VYC
Sbjct  276   AKNYMATCSISYWVLNLLQIPVSVGVAMYEAVGLMQGRRVISSKRNEENSLRAHQLLVYC  335

Query  1403  FFgmiagvvggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRF  1582
             F G+ AGVV GLLG+GGG IMGPLFLELGVPPQV+SATATFAMMFS+SMSVVEYYLL RF
Sbjct  336   FLGVTAGVVAGLLGVGGGSIMGPLFLELGVPPQVASATATFAMMFSASMSVVEYYLLNRF  395

Query  1583  PVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMI  1762
             PVPYAL+LT +A +AA IGQ VVR+LI +LGRAS+IIFIL+F IF+SA+SLGGVGISN I
Sbjct  396   PVPYALYLTILAFLAAIIGQRVVRKLIDLLGRASIIIFILSFMIFISALSLGGVGISNTI  455

Query  1763  EKIHNHEYMGFENLCKYGV  1819
              KI   EYMGFEN+CKYGV
Sbjct  456   HKIARREYMGFENICKYGV  474



>ref|XP_003574412.1| PREDICTED: uncharacterized protein LOC100846223 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235079.1| PREDICTED: uncharacterized protein LOC100846223 isoform X1 [Brachypodium 
distachyon]
Length=468

 Score =   459 bits (1182),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 302/475 (64%), Positives = 371/475 (78%), Gaps = 11/475 (2%)
 Frame = +2

Query  392   GGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDD-DYLSTFVNFLWQP  568
             G +W     + AL  S  + +A V A+R       A T  +   +D  +L    +++WQ 
Sbjct  2     GRQWH---AVAALCISCTVMAAAVGADR---GRLFASTAAAPEPEDVSFLRKVASYMWQK  55

Query  569   KESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATA  748
               + Y H+WP M+ GW+IV+GS  GF+G AFGS+GGVGGGGIFVPML+L++GFDPKSA A
Sbjct  56    DGTTYHHVWPPMKFGWKIVLGSFFGFIGGAFGSIGGVGGGGIFVPMLTLIIGFDPKSAAA  115

Query  749   ISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWM  928
             +SKCMIMGAAVS+V+ NLKL+HPTLDMP+IDYDL +LIQPMLMLG+SIGV  NVIF +W+
Sbjct  116   MSKCMIMGAAVSTVYCNLKLKHPTLDMPVIDYDLVLLIQPMLMLGVSIGVICNVIFPNWL  175

Query  929   VTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGT  1108
             VTVLLI+LF+ TSTKAFL+GVETWKKETI+ KEA ++  +     + EY  LP GP +  
Sbjct  176   VTVLLIILFLVTSTKAFLKGVETWKKETIIIKEAEKR--SEQISEETEYTPLPTGPDSPA  233

Query  1109  QDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPV  1288
             +      S++ VSI +NV+WKEFGLL FVWV+FLALQ+ KNY +TCST YWV+NLLQIPV
Sbjct  234   ETITP--SDEAVSIWKNVHWKEFGLLVFVWVAFLALQVTKNYIATCSTWYWVLNLLQIPV  291

Query  1289  SLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimg  1468
             S+GVA++EA GL +G R ISSK +  ++L+  QL++YCF G++AGVV GLLG+GGG IMG
Sbjct  292   SVGVAMYEAVGLLQGKRVISSKANDQTSLKVHQLLLYCFLGLMAGVVAGLLGVGGGSIMG  351

Query  1469  plflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHV  1648
             PLFLELGVPPQVSSATATFAMMFSSSMSVVEY+LL RFPVPYALF T +A  AA +GQ V
Sbjct  352   PLFLELGVPPQVSSATATFAMMFSSSMSVVEYFLLNRFPVPYALFFTVLAFFAAIVGQRV  411

Query  1649  VRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             VR+LI +LGRASLI+FIL+  IFVSA SLGGVGISNMI KI  HEYMGFEN+CKY
Sbjct  412   VRKLIGLLGRASLIVFILSMMIFVSAFSLGGVGISNMIHKITRHEYMGFENICKY  466



>gb|ABR16333.1| unknown [Picea sitchensis]
Length=505

 Score =   461 bits (1185),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 305/504 (61%), Positives = 373/504 (74%), Gaps = 27/504 (5%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSR-----------NSD  526
             MAG G KW ++  +VA ++  LLA    SAER+  +   A +   R           N+ 
Sbjct  1     MAGGGRKWLLVVVMVA-TFGLLLAVTLSSAERTFLDGNSASSETERSMEKIVDPVEGNTL  59

Query  527   DDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPM  706
               +L    NFLW+   S Y  +WPEM+ GW IVIGSI+GF GAA GSVGGVGGGGIFVPM
Sbjct  60    KYHLLKARNFLWRSNISDYQRVWPEMKFGWRIVIGSIVGFFGAAVGSVGGVGGGGIFVPM  119

Query  707   LSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGI  886
             L+L++GFD KS+TAISKCMIMGAA S+V+YNLKL+HPTLD+PIIDYDLA+L QPMLMLGI
Sbjct  120   LTLIIGFDAKSSTAISKCMIMGAAGSTVYYNLKLKHPTLDLPIIDYDLAMLFQPMLMLGI  179

Query  887   SIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGG-  1063
             SIGV FNVIFADWMVTVLLI+LF+GTSTKAFL+GVETWK+ETI+KKEA +    N +   
Sbjct  180   SIGVAFNVIFADWMVTVLLIILFLGTSTKAFLKGVETWKQETILKKEAERVRVENVTADV  239

Query  1064  ------QGEYKLLPGGP--------GNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWV  1201
                   + ++K LP  P         N   +  +  ++   +I  NV WKE G+L  VW+
Sbjct  240   EPEEHQEVDFKPLPSEPVPNEESNGNNEGSNNERLPTDVTNTIWFNVRWKELGILVVVWI  299

Query  1202  SFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRA  1381
              FL LQ+VK  ++TCS  YWV+NLLQIPV++ V+L+EA GLYKG + ++SKG++G N + 
Sbjct  300   IFLVLQVVKAKSTTCSVEYWVLNLLQIPVAMSVSLYEAIGLYKGTKAVASKGEAGINWKI  359

Query  1382  GQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfammfsssmsVVE  1561
              QL++Y F G++AGVVGGLLGLGGGFI+GPL LELGVPPQVSSATATF M FSSSMSVVE
Sbjct  360   SQLVLYFFCGILAGVVGGLLGLGGGFILGPLLLELGVPPQVSSATATFVMTFSSSMSVVE  419

Query  1562  YYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGG  1741
             YY LKRFPVPYA +L  V  +AAF+GQHV+RRL+ +LGRASLIIFILAF IF+SAI+LGG
Sbjct  420   YYFLKRFPVPYAAYLFGVCVIAAFMGQHVIRRLVILLGRASLIIFILAFVIFLSAITLGG  479

Query  1742  VGISNMIEKIHNHEYMGFENLCKY  1813
             VGI  MI K  N +YMGFENLC Y
Sbjct  480   VGIVKMIHKFENGDYMGFENLCSY  503



>ref|XP_010235080.1| PREDICTED: uncharacterized protein LOC100846223 isoform X2 [Brachypodium 
distachyon]
Length=451

 Score =   458 bits (1179),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 297/455 (65%), Positives = 363/455 (80%), Gaps = 8/455 (2%)
 Frame = +2

Query  452   SAFVSAERSLKNEEVAGTNVSRNSDD-DYLSTFVNFLWQPKESGYDHIWPEMELGWEIVI  628
             +A V A+R       A T  +   +D  +L    +++WQ   + Y H+WP M+ GW+IV+
Sbjct  2     AAAVGADR---GRLFASTAAAPEPEDVSFLRKVASYMWQKDGTTYHHVWPPMKFGWKIVL  58

Query  629   GSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKL  808
             GS  GF+G AFGS+GGVGGGGIFVPML+L++GFDPKSA A+SKCMIMGAAVS+V+ NLKL
Sbjct  59    GSFFGFIGGAFGSIGGVGGGGIFVPMLTLIIGFDPKSAAAMSKCMIMGAAVSTVYCNLKL  118

Query  809   RHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRG  988
             +HPTLDMP+IDYDL +LIQPMLMLG+SIGV  NVIF +W+VTVLLI+LF+ TSTKAFL+G
Sbjct  119   KHPTLDMPVIDYDLVLLIQPMLMLGVSIGVICNVIFPNWLVTVLLIILFLVTSTKAFLKG  178

Query  989   VETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYW  1168
             VETWKKETI+ KEA ++  +     + EY  LP GP +  +      S++ VSI +NV+W
Sbjct  179   VETWKKETIIIKEAEKR--SEQISEETEYTPLPTGPDSPAETIT--PSDEAVSIWKNVHW  234

Query  1169  KEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKIS  1348
             KEFGLL FVWV+FLALQ+ KNY +TCST YWV+NLLQIPVS+GVA++EA GL +G R IS
Sbjct  235   KEFGLLVFVWVAFLALQVTKNYIATCSTWYWVLNLLQIPVSVGVAMYEAVGLLQGKRVIS  294

Query  1349  SKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfa  1528
             SK +  ++L+  QL++YCF G++AGVV GLLG+GGG IMGPLFLELGVPPQVSSATATFA
Sbjct  295   SKANDQTSLKVHQLLLYCFLGLMAGVVAGLLGVGGGSIMGPLFLELGVPPQVSSATATFA  354

Query  1529  mmfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAF  1708
             MMFSSSMSVVEY+LL RFPVPYALF T +A  AA +GQ VVR+LI +LGRASLI+FIL+ 
Sbjct  355   MMFSSSMSVVEYFLLNRFPVPYALFFTVLAFFAAIVGQRVVRKLIGLLGRASLIVFILSM  414

Query  1709  TIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
              IFVSA SLGGVGISNMI KI  HEYMGFEN+CKY
Sbjct  415   MIFVSAFSLGGVGISNMIHKITRHEYMGFENICKY  449



>ref|XP_003523605.1| PREDICTED: uncharacterized protein LOC100816633 [Glycine max]
 gb|KHN04486.1| hypothetical protein glysoja_019573 [Glycine soja]
Length=474

 Score =   459 bits (1180),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 281/463 (61%), Positives = 365/463 (79%), Gaps = 14/463 (3%)
 Frame = +2

Query  431   SWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMEL  610
             SWS ++A     AER LK+++     V        +++ ++F W   E   D +WPEM+ 
Sbjct  21    SWSLIMAYNVCLAERVLKDQKPESFVVKER--QGVMNSIIDFFWNDGEPTNDRVWPEMKF  78

Query  611   GWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSV  790
             GW IV+GSI+GF GAA GSVGGVGGGGIF+PML+LV+GFD KS+TA+SKCMIMGAAVS+V
Sbjct  79    GWRIVVGSIVGFFGAALGSVGGVGGGGIFIPMLTLVIGFDAKSSTALSKCMIMGAAVSTV  138

Query  791   HYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTST  970
             +YNL+ RHPTLD+P+IDYDLA+L QPMLMLGISIGV FNV+FADWMVTVLLI+LFI TST
Sbjct  139   YYNLRFRHPTLDLPVIDYDLALLFQPMLMLGISIGVAFNVMFADWMVTVLLIILFIATST  198

Query  971   KAFLRGVETWKKETIMKKEAAQQLAANGSGG---QGEYKLLPGGPGNGTQDTAKESSEKQ  1141
             KA  +G++TWKKETIMKKEAA+ L ++ S G   + +YK LP G        + +  +++
Sbjct  199   KALFKGIDTWKKETIMKKEAAKMLESDSSPGYVSEEDYKSLPAG--------SADPRDEE  250

Query  1142  VSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATG  1321
             V +++N+YWKE  +L +VWV+FL +QI+K YT TCS LYWV+N LQ+P+++ V L+EA  
Sbjct  251   VPLLKNIYWKELLVLAYVWVAFLIVQIIKTYTKTCSILYWVLNSLQVPIAISVTLYEAIC  310

Query  1322  LYKGWRKISSKGDSGSN-LRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPP  1498
             L  G R I+SKG   ++ ++  ++ +YC  G+IAG+V GLLGLGGGFI+GPLFLELG+PP
Sbjct  311   LCNGTRVIASKGKENTDWMKLHKICLYCSCGIIAGIVSGLLGLGGGFILGPLFLELGIPP  370

Query  1499  QVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGR  1678
             QV+SAT+TFAM+FSSSMSVV+YYLL+RFPVPYA +   VAT+AA  GQHVVR++IA+ GR
Sbjct  371   QVASATSTFAMVFSSSMSVVQYYLLERFPVPYASYFILVATIAALTGQHVVRKIIAIFGR  430

Query  1679  ASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             AS+IIF+LAFTIF+SAISLGGVGI NM+EK+ N+EYMGF N+C
Sbjct  431   ASIIIFVLAFTIFLSAISLGGVGIENMVEKMENNEYMGFANIC  473



>ref|XP_006426963.1| hypothetical protein CICLE_v10025503mg [Citrus clementina]
 gb|ESR40203.1| hypothetical protein CICLE_v10025503mg [Citrus clementina]
Length=479

 Score =   457 bits (1177),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 306/484 (63%), Positives = 376/484 (78%), Gaps = 15/484 (3%)
 Frame = +2

Query  380   MAGAGG---KWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFV  550
             M+G G    +WR+L    A     ++AS  VSA+ +LK E       S+N +D      V
Sbjct  1     MSGVGSECFRWRLLA--AAFIGLLVVASVSVSAQSNLKPEAT-----SKNKNDHVEPNIV  53

Query  551   NFLWQPK-ESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGF  727
               +  PK  SGY H+WP+++ GW IV+G+IIGF G A GSVGGVGGGGIFVPML+L+VGF
Sbjct  54    IKVSAPKSRSGYKHVWPDIKFGWRIVVGTIIGFFGTACGSVGGVGGGGIFVPMLNLIVGF  113

Query  728   DPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFN  907
             D KS+ A+SKCMI G AVS+V YNL+ RHPTLD+P+IDYDLA+L QP+L+LGISIGV FN
Sbjct  114   DAKSSAAVSKCMITGGAVSAVVYNLRQRHPTLDIPVIDYDLALLFQPLLVLGISIGVAFN  173

Query  908   VIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLA--ANGSGGQG-EYK  1078
             VIFADWM+TVLLIVLF+  ST+AFL+GVETWKKETI K+EAA+QL     G+G Q  E K
Sbjct  174   VIFADWMITVLLIVLFLVLSTRAFLKGVETWKKETITKREAAKQLELIVLGNGYQTEECK  233

Query  1079  LLPGGPGNGTQ-DTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTL  1255
               P    NGT  +  +E  + +VSIIEN+YWKEFGLL  VW   LALQI KNYT+TCS L
Sbjct  234   CDPEYLSNGTTPEETREPKKSKVSIIENIYWKEFGLLVAVWAIILALQIAKNYTTTCSVL  293

Query  1256  YWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvgg  1435
             YWV+NLLQIPV+ GV+ +EA  LYKG RKI+SKGD G+  RA QL+ YC  G+ AG+VGG
Sbjct  294   YWVLNLLQIPVAGGVSAYEAVALYKGRRKIASKGDEGTKWRASQLVFYCACGITAGMVGG  353

Query  1436  llglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltav  1615
             LLGLGGGFI+GPLFLELG+PPQVSSATA FA+ FSSSMSVVEYYLLKRFPVPYAL+  A+
Sbjct  354   LLGLGGGFILGPLFLELGIPPQVSSATALFAITFSSSMSVVEYYLLKRFPVPYALYFFAL  413

Query  1616  atvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGF  1795
             + +AAF+GQHVV++LI +LGRAS+IIF L+F IFVSA+SLGGVG++ MI++I + EYMGF
Sbjct  414   SIIAAFVGQHVVKKLIKILGRASIIIFTLSFIIFVSALSLGGVGLAKMIKRIEHKEYMGF  473

Query  1796  ENLC  1807
             +N+C
Sbjct  474   DNIC  477



>ref|XP_007216108.1| hypothetical protein PRUPE_ppa018715mg [Prunus persica]
 gb|EMJ17307.1| hypothetical protein PRUPE_ppa018715mg [Prunus persica]
Length=439

 Score =   455 bits (1171),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 291/478 (61%), Positives = 362/478 (76%), Gaps = 40/478 (8%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALS-WSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNF  556
             M   G +W  LR   A+    FLLA++ V++ +    ++ +  + S      Y    +NF
Sbjct  1     MGQVGLEWWSLRRRAAMVVIGFLLAASVVASAQETLEQDASSYSGSDKFQPYYFDRVLNF  60

Query  557   LWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPK  736
             LWQP   GY+H+WPE++  W IV+G++IGF+GA+FG+VGGVGGGGIFVPML+L++GFD K
Sbjct  61    LWQPGRLGYEHVWPELKFDWIIVVGTVIGFIGASFGTVGGVGGGGIFVPMLTLIIGFDEK  120

Query  737   SATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIF  916
             S+TAISKCMI G A +SV YNL+LRHPTLD+PIIDYDLA+L+QPMLMLGISIGV+FNVIF
Sbjct  121   SSTAISKCMITGGAAASVFYNLRLRHPTLDLPIIDYDLALLLQPMLMLGISIGVSFNVIF  180

Query  917   ADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGP  1096
             ADWM+TVLLI+ F+GTSTKAFL+GVE WK+ET+M                          
Sbjct  181   ADWMITVLLIIFFLGTSTKAFLKGVEAWKRETVM--------------------------  214

Query  1097  GNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLL  1276
                          KQVSIIENVYWKE  LL  VWV  LALQI KNYT+TCS  YWV+NLL
Sbjct  215   -------------KQVSIIENVYWKELLLLVAVWVIILALQIAKNYTTTCSAEYWVLNLL  261

Query  1277  QIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglggg  1456
             QIPV+ GV+ +EA  LYKG R I+SK +SG++ +  QL++YC  G++AG+VGGLLGLGGG
Sbjct  262   QIPVAFGVSTYEAVNLYKGRRVIASKEESGTDWKVHQLVLYCACGILAGIVGGLLGLGGG  321

Query  1457  fimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafI  1636
             FI+GPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA++   +++++A +
Sbjct  322   FILGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAVYFAVMSSLSALV  381

Query  1637  GQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  1810
             GQHVVR++I+VLGRAS+IIFILA TIFVSAISLGGVGI++MI KI + EYMGFEN+C 
Sbjct  382   GQHVVRKVISVLGRASIIIFILASTIFVSAISLGGVGIADMIGKIEHKEYMGFENICN  439



>ref|XP_006659358.1| PREDICTED: uncharacterized protein LOC102716712 [Oryza brachyantha]
Length=468

 Score =   456 bits (1174),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 284/434 (65%), Positives = 345/434 (79%), Gaps = 7/434 (2%)
 Frame = +2

Query  512   SRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvgggg  691
             +R     YL    NFLWQ  ES Y H+WP ME GW IV+G+ +GF+GAAFGS+ GVGGGG
Sbjct  40    ARPEGVSYLRKAANFLWQSDESSY-HVWPPMEFGWRIVLGTFVGFIGAAFGSIAGVGGGG  98

Query  692   IFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPM  871
              FVPML+L++GFD KS+ AISKCMIMGAAVS+V+ NLKL+HPTLDMP+IDYDLA+LIQPM
Sbjct  99    FFVPMLTLIIGFDAKSSVAISKCMIMGAAVSTVYCNLKLKHPTLDMPVIDYDLALLIQPM  158

Query  872   LMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAAN  1051
             LMLGISIGV FNVIF DW+VT+LLI+LFIGTSTKAFL+G+ETWKKETIMK+E A+Q    
Sbjct  159   LMLGISIGVIFNVIFPDWLVTILLIILFIGTSTKAFLKGIETWKKETIMKREEAKQSEQT  218

Query  1052  GSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKN  1231
                    Y+ LP GP    +  +K  S+  VSI++NVYWKEFGLL FVW++FL LQI KN
Sbjct  219   SE----MYRPLPTGPEAPAR--SKTPSDHAVSILQNVYWKEFGLLAFVWITFLVLQITKN  272

Query  1232  YTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFg  1411
             Y  TCST YW++NLLQIPVS+GV ++E  GL +G R ISS G+  +NL+  QL++YCFFG
Sbjct  273   YIPTCSTWYWLLNLLQIPVSVGVTMYEGIGLVQGRRVISSNGNEQTNLKFHQLLMYCFFG  332

Query  1412  miagvvggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVP  1591
             + AG+V GLLG+GGG I+GP+FL+LGVPPQV+SATATF+MMFSSSMS +EYY L RFPVP
Sbjct  333   ITAGIVAGLLGVGGGSILGPMFLDLGVPPQVASATATFSMMFSSSMSAIEYYFLDRFPVP  392

Query  1592  YalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKI  1771
             YAL+LT VA  +A +GQ VVR+LI  LGRAS+I+F L+  I +S   LGG+GISN I KI
Sbjct  393   YALYLTVVAFFSAIVGQRVVRKLINWLGRASIIVFTLSTMIILSTFPLGGIGISNWIGKI  452

Query  1772  HNHEYMGFENLCKY  1813
               HEYMGFEN+CKY
Sbjct  453   ERHEYMGFENICKY  466



>ref|XP_006465615.1| PREDICTED: uncharacterized protein LOC102614288 isoform X2 [Citrus 
sinensis]
Length=477

 Score =   456 bits (1172),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 300/473 (63%), Positives = 370/473 (78%), Gaps = 10/473 (2%)
 Frame = +2

Query  398   KWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPK-E  574
             +WR+L    A     ++AS  VSA+ +LK E       S N +D      V  +  PK  
Sbjct  10    RWRLLA--AAFIGLLVVASVSVSAQSNLKPEAT-----SENKNDHVEPNIVIKVSAPKSR  62

Query  575   SGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAIS  754
             SGY H+WP+++ GW IV+G+IIGF G A GSVGGVGGGGIFVPML+L+VGFD KS+ A+S
Sbjct  63    SGYKHVWPDIKFGWRIVVGTIIGFFGTACGSVGGVGGGGIFVPMLNLIVGFDAKSSAAVS  122

Query  755   KCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVT  934
             KCM+ G AVS+V YNL+ RHPTLD+P+IDYDLA+L QP+L+LGISIGV FNVIFADWM+T
Sbjct  123   KCMVTGGAVSAVVYNLRQRHPTLDIPVIDYDLALLFQPLLVLGISIGVAFNVIFADWMIT  182

Query  935   VLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQG-EYKLLPGGPGNGTQ  1111
             VLLIVLF+  ST+AFL+GVETWKKETI K+EAA+QL   G+G Q  E K  P    N T 
Sbjct  183   VLLIVLFLVLSTRAFLKGVETWKKETITKREAAKQLELIGNGYQTEECKCDPEYLSNDTT  242

Query  1112  -DTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPV  1288
              +  +E  + +VSIIEN+YWKEFGLL  VW   LALQI KNYT+TCS LYWV+NLLQIPV
Sbjct  243   PEETREPKKSKVSIIENIYWKEFGLLVAVWAIILALQIAKNYTTTCSVLYWVLNLLQIPV  302

Query  1289  SLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimg  1468
             + GV+ +EA  LYKG RKI+SKGD G+  RA QL+ YC  G+ AG+VGGLLGLGGGFI+G
Sbjct  303   AGGVSAYEAVALYKGRRKIASKGDEGTKWRASQLVFYCACGITAGMVGGLLGLGGGFILG  362

Query  1469  plflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHV  1648
             PLFLELG+PPQVSSATA FA+ FSSSMSVVEYYLLKRFPVPYAL+  A++ +AAF+GQHV
Sbjct  363   PLFLELGIPPQVSSATALFAITFSSSMSVVEYYLLKRFPVPYALYFFALSIIAAFVGQHV  422

Query  1649  VRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             +++LI +LGRAS+IIF L+F IFVSA+SLGGVG++ MI++I + EYMGF+N+C
Sbjct  423   LKKLIKILGRASIIIFTLSFIIFVSAVSLGGVGLAKMIKRIEHKEYMGFDNIC  475



>ref|XP_003527721.1| PREDICTED: uncharacterized protein LOC100789748 [Glycine max]
 gb|ABC47859.1| membrane protein-like protein [Glycine max]
 gb|KHN22333.1| hypothetical protein glysoja_022089 [Glycine soja]
Length=491

 Score =   456 bits (1173),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 285/481 (59%), Positives = 372/481 (77%), Gaps = 17/481 (4%)
 Frame = +2

Query  428   LSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEME  607
             +SWS ++A     AER LK+++    +         +++ ++F     E   D +WPEM+
Sbjct  21    VSWSLIMAYNVSLAERVLKDQK--SESFVAKERQGVMNSIIDFFRNDGEPTNDRVWPEMK  78

Query  608   LGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSS  787
              GW IV+GSI+GF GAA GSVGGVGGGGIF+PML+LV+GFD KS+TA+SKCMIMGAAVS+
Sbjct  79    FGWRIVVGSIVGFFGAALGSVGGVGGGGIFIPMLTLVIGFDAKSSTALSKCMIMGAAVST  138

Query  788   VHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTS  967
             V+YNL+ RHPTLD+P+IDYDLA+L QPMLMLGISIGV FNV+FADWMVTVLLI+LFI TS
Sbjct  139   VYYNLRFRHPTLDLPVIDYDLALLFQPMLMLGISIGVAFNVMFADWMVTVLLIILFIATS  198

Query  968   TKAFLRGVETWKKETIMKKEAAQQLAANGSGG---QGEYKLLPGGPGNGTQDTAKESSEK  1138
             TKA  +G++TWKKETIMKKEAA+ L ++ S G   + +YK LP G        + +  ++
Sbjct  199   TKALFKGIDTWKKETIMKKEAAKMLESDSSPGYVSEEDYKSLPAG--------SADPRDE  250

Query  1139  QVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEAT  1318
             +V +++N+YWKE  +L +VWV+FL +QI+K YT TCS LYWV+N LQ+P+++ V L+EA 
Sbjct  251   EVPLLKNIYWKELLVLVYVWVAFLIVQIIKTYTKTCSILYWVLNSLQVPIAISVTLYEAI  310

Query  1319  GLYKGWRKISSKGDSGSN-LRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVP  1495
              L  G R ISSKG   ++ ++  ++ +YC  G+IAG+V GLLGLGGGFI+GPLFLELG+P
Sbjct  311   CLCNGTRVISSKGKENTDWMKLHKICLYCSCGIIAGIVSGLLGLGGGFILGPLFLELGIP  370

Query  1496  PQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLG  1675
             PQV+SAT+TFAM+FSSSMSVV+YYLL+RFPVPYA +   VAT+AA  GQHVVR++IA+ G
Sbjct  371   PQVASATSTFAMVFSSSMSVVQYYLLERFPVPYASYFILVATIAALTGQHVVRKIIAIFG  430

Query  1676  RASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY---GV*NLYRTTFY  1846
             RAS+IIF+LAFTIF+SAISLGGVGI NM+EK+ N+EYMGF N+C     GV   YR+  +
Sbjct  431   RASIIIFVLAFTIFLSAISLGGVGIENMVEKMENNEYMGFANICHVNLGGVFPTYRSGSF  490

Query  1847  L  1849
             L
Sbjct  491   L  491



>ref|XP_010999980.1| PREDICTED: uncharacterized protein LOC105107666 [Populus euphratica]
Length=477

 Score =   454 bits (1168),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 283/458 (62%), Positives = 358/458 (78%), Gaps = 12/458 (3%)
 Frame = +2

Query  443   LLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEI  622
             +L +  VSAER LK++E    +  +     Y+   ++FL+Q  +S Y+ +WP M+  W I
Sbjct  26    VLMANMVSAERMLKDKE-PEASAEKEMSHGYIVKVLHFLFQGGKSSYEPVWPVMKFDWRI  84

Query  623   VIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNL  802
             V+G+ +GF+GAA GSVGGVGGGGIFVPML+L++GFDPKS+TAISKCMIMGA+ ++V+YNL
Sbjct  85    VVGTAVGFLGAALGSVGGVGGGGIFVPMLTLIIGFDPKSSTAISKCMIMGASGATVYYNL  144

Query  803   KLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFL  982
             +LRHPTL+MPIIDYDLA+L QPMLMLGIS+GV FNV+FADWMVTVLLI+LFIGTSTKA  
Sbjct  145   RLRHPTLEMPIIDYDLALLFQPMLMLGISVGVAFNVMFADWMVTVLLIILFIGTSTKALF  204

Query  983   RGVETWKKETIMKKEAAQQLAANG---SGGQGEYKLLPGGPGNGTQDTAKESSEKQVSII  1153
             +G++TWKKET++KK+ A+QL +      G + +YK LP GP     D        +V + 
Sbjct  205   KGIDTWKKETMIKKDVAKQLESESKPEDGAEEDYKPLPSGPVVLPDD--------EVPLR  256

Query  1154  ENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKG  1333
             EN+YWKE  LL +VW  FL +QIV+    TCS  YW++N LQ+P++  V LFEA  L KG
Sbjct  257   ENIYWKEVALLFYVWAGFLVVQIVQTNVPTCSVTYWILNSLQVPIAASVTLFEAICLCKG  316

Query  1334  WRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssa  1513
              R I+SKG   +N +  Q+++YC  G+IAG+VGGLLGLGGGFI+GPLFLELG+PPQV+SA
Sbjct  317   TRVIASKGKEITNWKLHQILLYCSCGIIAGMVGGLLGLGGGFILGPLFLELGIPPQVASA  376

Query  1514  tatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLII  1693
             T+TFAM FSSSMSVVEYYLL RFPVPYA +   VAT++A +GQHVVR++IA LGRASLII
Sbjct  377   TSTFAMAFSSSMSVVEYYLLNRFPVPYAAYFALVATISALVGQHVVRKIIAFLGRASLII  436

Query  1694  FILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             FILA TIFVSA+SLGGVGI+NM+EK+ N EYMGFENLC
Sbjct  437   FILALTIFVSAVSLGGVGIANMVEKLENEEYMGFENLC  474



>ref|XP_008347634.1| PREDICTED: uncharacterized protein LOC103410743 isoform X2 [Malus 
domestica]
Length=360

 Score =   449 bits (1156),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 274/357 (77%), Positives = 312/357 (87%), Gaps = 3/357 (1%)
 Frame = +2

Query  749   ISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWM  928
             +++ MIMGAA S+V+YNLKLRHPT++MPIIDYDLAVLIQPMLMLGISIGV FNVIFADWM
Sbjct  7     LNQGMIMGAAGSTVYYNLKLRHPTINMPIIDYDLAVLIQPMLMLGISIGVAFNVIFADWM  66

Query  929   VTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGT  1108
             VTVLLIVLFIGTSTKAF +GVETWKKETIMKKEAA+ L +  +G    YK LP GP N  
Sbjct  67    VTVLLIVLFIGTSTKAFFKGVETWKKETIMKKEAARHLESAAAGENVAYKPLPSGPANEQ  126

Query  1109  QDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPV  1288
             Q   KE+ E++VS+IENV WKE GLL FVWV+FLALQI K  T+TCS  YWVVNLLQIPV
Sbjct  127   Q---KETKEQEVSVIENVCWKELGLLVFVWVAFLALQIAKQXTTTCSPAYWVVNLLQIPV  183

Query  1289  SLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimg  1468
             SLGV+++EA  LY+G R I+SKG+ G++ +  QL++YC FG+IAG+VGGLLGLGGGFIMG
Sbjct  184   SLGVSMYEAVSLYQGRRVIASKGEEGTDWKVHQLVIYCLFGVIAGIVGGLLGLGGGFIMG  243

Query  1469  plflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHV  1648
             PLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA++LTAVATVAA +GQH+
Sbjct  244   PLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAVYLTAVATVAALVGQHI  303

Query  1649  VRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  1819
             VRRLI + GRASLIIFILAFTIFVSAISLGGVGISNMI KI+ +EYMGFENLCKY V
Sbjct  304   VRRLIILFGRASLIIFILAFTIFVSAISLGGVGISNMIGKINRNEYMGFENLCKYDV  360



>gb|KHN32619.1| hypothetical protein glysoja_022301 [Glycine soja]
Length=490

 Score =   454 bits (1169),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 294/466 (63%), Positives = 361/466 (77%), Gaps = 13/466 (3%)
 Frame = +2

Query  452   SAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIG  631
             S  VSA + L ++ +  T V   +   +L   VNFLW    SGY H WP++E GW I+ G
Sbjct  24    SVSVSALQHLSHKNINPTTV-ETTQTSFLGKVVNFLWSSSGSGYQHTWPDIEFGWRIITG  82

Query  632   SIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLR  811
             +IIGF+G+AFG+VGGVGGGGIFV MLSL++GFD KSATAISKCMI G A ++V YNLK +
Sbjct  83    TIIGFLGSAFGTVGGVGGGGIFVTMLSLIIGFDAKSATAISKCMITGGAAATVFYNLKQK  142

Query  812   HPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGT-STKAFLRG  988
             HPTLDMP+IDYDLA+L QP+L+LGISIGV FNVIFADWM+TVLL+++F+G  +TKAFL+G
Sbjct  143   HPTLDMPVIDYDLALLFQPVLVLGISIGVAFNVIFADWMITVLLLIIFVGRIATKAFLKG  202

Query  989   VETWKKETIMKKEAAQQLAANGSGGQGE--YKLLPGGPGNGTQDTAKESSEKQV------  1144
             VETWKKETI+KKE A+Q   NG+    E  Y+ LPGGP     +  K+S E  V      
Sbjct  203   VETWKKETIIKKETARQSQFNGTERSEEVAYEPLPGGPNTSNHNEPKKSKETTVRLRHHK  262

Query  1145  -SIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATG  1321
              S++ENV WK  G+L  VWV  LA +I K++T+TCS  YW++NLLQ+PV+LG   ++A  
Sbjct  263   GSVLENVRWKALGVLFTVWVLILASEIAKSHTTTCSVEYWILNLLQVPVALGATSYQAVL  322

Query  1322  LYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQ  1501
             LY G R I+SKGD  +  RA QL++YC  G+ AG+VGGLLGLGGGFI+GPLFLELG+PPQ
Sbjct  323   LYTGKRVIASKGDQRTQWRAHQLVLYCSCGICAGIVGGLLGLGGGFILGPLFLELGIPPQ  382

Query  1502  VssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRA  1681
             VSSATATFAM FS+SMSVVEYYLLKRFP+PY L+  AV+T AAF+GQ +VR+L+A+LGRA
Sbjct  383   VSSATATFAMTFSASMSVVEYYLLKRFPIPYTLYFVAVSTFAAFVGQVLVRKLVAILGRA  442

Query  1682  SLIIFILAFTIFVSAISLG--GVGISNMIEKIHNHEYMGFENLCKY  1813
             SLIIFIL+ TIFVSAISLG  GVGISNMI+KI N EYMGFENLC Y
Sbjct  443   SLIIFILSGTIFVSAISLGKCGVGISNMIQKIANKEYMGFENLCTY  488



>ref|XP_007156932.1| hypothetical protein PHAVU_002G029400g [Phaseolus vulgaris]
 gb|ESW28926.1| hypothetical protein PHAVU_002G029400g [Phaseolus vulgaris]
Length=470

 Score =   453 bits (1166),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 279/447 (62%), Positives = 352/447 (79%), Gaps = 11/447 (2%)
 Frame = +2

Query  467   AERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgf  646
             A+R LK +E+   N  +      L    NFLW+  +S Y+ +WP M+ GW I++GSIIGF
Sbjct  32    ADRMLKEKELG--NDGKKERQGVLEAIANFLWEEGKSSYEPVWPNMKFGWRIIVGSIIGF  89

Query  647   mgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLD  826
              GAA GSVGGVGGGGIFVPML+L++GFDPKS+TAISKCMIMGA+VS+V+YNL+LRHPTLD
Sbjct  90    SGAALGSVGGVGGGGIFVPMLALIIGFDPKSSTAISKCMIMGASVSTVYYNLRLRHPTLD  149

Query  827   MPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKK  1006
             MP+IDYDLA++ QPMLMLGISIGV  NV+FADWMVTVLLI+LF+ TSTKA  +G++ WKK
Sbjct  150   MPLIDYDLALIFQPMLMLGISIGVICNVMFADWMVTVLLIILFVATSTKATYKGIDAWKK  209

Query  1007  ETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLL  1186
             ETI KKEA++ L A    G  +YK +P GP +   + A         +++N+YWKE  LL
Sbjct  210   ETIAKKEASKLLQAEPESGD-DYKSIPSGPTDALFEEA--------PLLKNIYWKELSLL  260

Query  1187  CFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSG  1366
              +VWV+F  +QIVK Y+  CS  +W++N LQ+P+++ V LFEA  LYKG R I+SKG   
Sbjct  261   VYVWVAFFIVQIVKEYSKPCSIQFWILNFLQVPIAISVTLFEAISLYKGTRVIASKGKEI  320

Query  1367  SNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfammfsss  1546
             ++ +  Q+ +YC  G++AG+VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSS
Sbjct  321   THWKIHQICLYCSTGIMAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSS  380

Query  1547  msVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSA  1726
             MSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++I VLGRAS+IIFILA TIF+SA
Sbjct  381   MSVVQYYLLDRFPVPYASYFALVATLAAFTGQHVVRKIIVVLGRASIIIFILALTIFISA  440

Query  1727  ISLGGVGISNMIEKIHNHEYMGFENLC  1807
             +SLGGVGI N+IEKI  HEYMGFE+LC
Sbjct  441   LSLGGVGIENIIEKIEKHEYMGFEDLC  467



>gb|EMT12794.1| hypothetical protein F775_19997 [Aegilops tauschii]
Length=468

 Score =   453 bits (1166),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 292/442 (66%), Positives = 350/442 (79%), Gaps = 15/442 (3%)
 Frame = +2

Query  509   VSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggg  688
             V+   +  YL    + LWQ   + Y H+WP M+LGW+IV+GS IGF GAAFGS+GGVGGG
Sbjct  33    VAPPEEASYLRKLASSLWQSDGTAYHHVWPPMKLGWKIVLGSFIGFFGAAFGSIGGVGGG  92

Query  689   gIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQP  868
             GIFVPML+L++GFDPKS+ A+SKCMIMGAAVS+V+ NLKL+HPTLDMP+IDYDL +LIQP
Sbjct  93    GIFVPMLTLIIGFDPKSSAAMSKCMIMGAAVSTVYCNLKLKHPTLDMPVIDYDLVLLIQP  152

Query  869   MLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAA  1048
             MLMLG+SIGV  NVIF DW+VTVLLI+LFI TSTKAFL+ +ETWKKETI+   +A     
Sbjct  153   MLMLGVSIGVICNVIFPDWLVTVLLIILFIVTSTKAFLKAIETWKKETIIITLSA-----  207

Query  1049  NGSGGQGEYKLLPGGPGNGT-------QDTAKESSEKQVSIIENVYWKEFGLLCFVWVSF  1207
                G + EY  L  G    +        D  +  S+K+VSI +NVYWKE GLL FVWV+F
Sbjct  208   ---GEEQEYMPLSAGLDAASPSEILSDHDRNETPSDKEVSIWKNVYWKEVGLLAFVWVAF  264

Query  1208  LALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQ  1387
             L LQ+ KNY +TCS  YWV+NLLQIPVS+GVA++EA GL +G R ISSK +  ++LRA Q
Sbjct  265   LVLQVAKNYMATCSIWYWVLNLLQIPVSVGVAMYEAVGLVQGRRVISSKRNEQNSLRAHQ  324

Query  1388  LIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYY  1567
             L VYCF G+ AGVV GLLG+GGG IMGPLFLELGVPPQV+SATATFAMMFSSSMSVVEYY
Sbjct  325   LFVYCFLGVTAGVVAGLLGVGGGSIMGPLFLELGVPPQVASATATFAMMFSSSMSVVEYY  384

Query  1568  LLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVG  1747
             LL RFPVPYA++LT +A  AA +GQ VVR+LI +LGRAS+I+FIL+F IF+SA+SLGGVG
Sbjct  385   LLNRFPVPYAVYLTILAFFAAIVGQRVVRKLIDLLGRASIIVFILSFMIFISALSLGGVG  444

Query  1748  ISNMIEKIHNHEYMGFENLCKY  1813
             ISN I KI  HEYMGFEN+CKY
Sbjct  445   ISNTIHKIERHEYMGFENICKY  466



>ref|XP_004959391.1| PREDICTED: uncharacterized protein LOC101762929 [Setaria italica]
Length=459

 Score =   452 bits (1163),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 283/421 (67%), Positives = 345/421 (82%), Gaps = 15/421 (4%)
 Frame = +2

Query  566   PKESG----YDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDP  733
             P+E G    Y H+WP MELGW IV+GS+IGF GAA GSVGGVGGGGIFVPML+L++GFDP
Sbjct  47    PEEMGDGKAYHHVWPPMELGWRIVLGSLIGFFGAACGSVGGVGGGGIFVPMLALIIGFDP  106

Query  734   KSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVI  913
             KS+TAISKCMIMG +VS+V+YNLKL+HPTLDMP+IDYDLA+L+QPMLMLG+SIGV FNVI
Sbjct  107   KSSTAISKCMIMGGSVSTVYYNLKLKHPTLDMPLIDYDLALLMQPMLMLGVSIGVIFNVI  166

Query  914   FADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGG  1093
             F +W++T LLI+LF+GTS+KA+L+G+ETWKKETI ++EA +         + E   +P G
Sbjct  167   FPNWLITALLIILFLGTSSKAYLKGIETWKKETIKEREAVK---------RQEQISIPTG  217

Query  1094  PGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNL  1273
             PG      AK  S+K  S+++NVYWKEFGLL FVWV+FL LQI KNY ++CS  YWV+N 
Sbjct  218   PGAAPATEAKIPSDKATSVLKNVYWKEFGLLAFVWVAFLGLQITKNYVASCSAWYWVLNS  277

Query  1274  LQIPVSLGVALFEATGLYKGWRKISSKG--DSGSNLRAGQLIVYCFFgmiagvvggllgl  1447
             LQIPV++GV ++EA GL  G R ++SKG     S LR  QL VYC FG++AG++GGLLG+
Sbjct  278   LQIPVAIGVTMYEAHGLMTGKRVLASKGSQQQQSTLRVRQLSVYCLFGILAGLIGGLLGM  337

Query  1448  gggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatva  1627
             GGGFIMGPLFLELG+PPQVSSATATF MMFSSSMSVVEYYLL RFPVPYA + TAVA VA
Sbjct  338   GGGFIMGPLFLELGIPPQVSSATATFTMMFSSSMSVVEYYLLHRFPVPYAAYFTAVAFVA  397

Query  1628  afIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             A +GQH VR+LIA LGRASLIIFILA  IFVSA++LGGVGISN++ ++  H+YMGFE+LC
Sbjct  398   AIVGQHCVRKLIAWLGRASLIIFILASMIFVSALTLGGVGISNIVHRMERHQYMGFESLC  457

Query  1808  K  1810
             +
Sbjct  458   R  458



>ref|XP_010680799.1| PREDICTED: uncharacterized protein LOC104895862 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=475

 Score =   452 bits (1164),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 284/462 (61%), Positives = 353/462 (76%), Gaps = 9/462 (2%)
 Frame = +2

Query  428   LSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEME  607
             + +S +L ++   AER LK   ++  +  +   +  LS   +FLW+  E  Y  +WP+ME
Sbjct  18    ICFSVVLLNSIARAERPLKENFISLVDKEQVMKEGLLSKMYHFLWKSGEPSYQPVWPDME  77

Query  608   LGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSS  787
              GW IV+GS IGF+GAA GSVGGVGGGGIFVPML+L++GFDPKS+TAISKCMIMGAA S+
Sbjct  78    FGWRIVVGSFIGFLGAALGSVGGVGGGGIFVPMLTLIIGFDPKSSTAISKCMIMGAAAST  137

Query  788   VHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTS  967
             V+ NL L+HPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLI+LF+ TS
Sbjct  138   VYCNLSLKHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIILFLVTS  197

Query  968   TKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGE--YKLLPGGPGNGTQDTAKESSEKQ  1141
              KA L+GV TW KE+ MKK  A     +   G+ E  YK L  GP     D        +
Sbjct  198   IKALLKGVNTWNKESEMKKIVASMHVPDAKSGESEADYKPLASGPPAPAHD-------DK  250

Query  1142  VSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATG  1321
             V ++ N+YWKE  LL FVW+ FL +Q++K YT TCS  YW+++ LQ+P+++ V+LFE   
Sbjct  251   VPMLSNIYWKELSLLSFVWLGFLVIQLLKRYTVTCSVQYWLLDSLQVPIAVSVSLFEGVC  310

Query  1322  LYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQ  1501
             LYKG + I+SKG   + L+  Q+  YC  G++AG+VGGLLGLGGGFI+GPLFLELG+PPQ
Sbjct  311   LYKGTKVIASKGKEITVLKVHQIFFYCLCGVVAGMVGGLLGLGGGFILGPLFLELGIPPQ  370

Query  1502  VssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRA  1681
             V+SAT+TF+M+FSSSMSVV+YY+LKRFPVPYA +   VAT+AA +GQHVVRRLI +LGRA
Sbjct  371   VASATSTFSMIFSSSMSVVQYYILKRFPVPYAAYFVLVATLAAIVGQHVVRRLITLLGRA  430

Query  1682  SLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             S+IIFILA TI VSAI+LGGVGI NMI+K+ NHEYMGFEN C
Sbjct  431   SIIIFILASTILVSAITLGGVGIVNMIQKLENHEYMGFENFC  472



>ref|XP_007150626.1| hypothetical protein PHAVU_005G168100g [Phaseolus vulgaris]
 gb|ESW22620.1| hypothetical protein PHAVU_005G168100g [Phaseolus vulgaris]
Length=480

 Score =   452 bits (1163),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 284/455 (62%), Positives = 363/455 (80%), Gaps = 4/455 (1%)
 Frame = +2

Query  461   VSAERSLKNEEVAGTNVSRNSDD-DYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSI  637
             +S  +++ ++ +  T V    +   +LS  +NFLW    SGY H WP++E GW IV GSI
Sbjct  26    LSVHQNINDKTMNSTTVEMAEEGAGFLSKVLNFLWS-SGSGYQHTWPDIEFGWRIVTGSI  84

Query  638   IgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHP  817
             IGF+G+AFG+VGGVGGGGIFV MLS+++GFD KSATAISKCMI G A S+V YNLK +HP
Sbjct  85    IGFLGSAFGTVGGVGGGGIFVTMLSIIIGFDQKSATAISKCMITGGAASTVFYNLKQKHP  144

Query  818   TLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVET  997
             TLDMP+IDYDLA+L QP+L+LGISIGV FNVIFADWM+TVLLI++FIG +TKA L+GVET
Sbjct  145   TLDMPVIDYDLALLFQPVLVLGISIGVAFNVIFADWMITVLLIIIFIGIATKALLKGVET  204

Query  998   WKKETIMKKEAAQQLAANGSGGQGE--YKLLPGGPGNGTQDTAKESSEKQVSIIENVYWK  1171
             WKKETI+KKE+A+Q   NG+    E  Y+ LPGGP   + +TA + S+++ S++ N+ WK
Sbjct  205   WKKETIIKKESARQSQLNGTERTEEVAYEPLPGGPPAASNNTASKKSDQKRSLVGNIRWK  264

Query  1172  EFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISS  1351
               G+L  VW+  LA +I K++T+TCST YW++NLLQ+PV+LGV  F+A  LYKG   I+S
Sbjct  265   TLGMLFTVWIVILACEIGKSHTTTCSTDYWILNLLQVPVALGVTTFQAVRLYKGKAVIAS  324

Query  1352  KGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfam  1531
             KGD  +  RA QLI+YC  G+ AG+VGGLLGLGGGFI+GPLFLELG+PPQVSSATATFAM
Sbjct  325   KGDQQTQWRAHQLILYCACGICAGMVGGLLGLGGGFILGPLFLELGIPPQVSSATATFAM  384

Query  1532  mfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFT  1711
              FS+SMSVVEYYLL RFP+PY L+  AV+T AAF+GQ +V++L+A+LGRASLIIFIL+ T
Sbjct  385   TFSASMSVVEYYLLNRFPIPYTLYFVAVSTFAAFVGQVLVKKLVALLGRASLIIFILSGT  444

Query  1712  IFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  1816
             IFVSA+SLG VGI++M++K+ + EYMGFENLC Y 
Sbjct  445   IFVSALSLGSVGIASMVQKLAHKEYMGFENLCTYA  479



>ref|XP_009800425.1| PREDICTED: uncharacterized protein LOC104246320 isoform X1 [Nicotiana 
sylvestris]
Length=473

 Score =   451 bits (1161),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 277/453 (61%), Positives = 357/453 (79%), Gaps = 2/453 (0%)
 Frame = +2

Query  461   VSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSII  640
             VSAE+      ++    + ++D  Y     N L +  E  Y H+WPE+E GW +++GS+I
Sbjct  20    VSAEKIPHEATLSNNGTTHSTDSYYFFDLFNLLQKMSEMHYHHVWPELECGWRVIVGSVI  79

Query  641   gfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPT  820
             GF GAAFGSVGGVGGGGIFVPML+L++GFDPK++TAISKCMI GAA ++V+Y+LKLRHP 
Sbjct  80    GFFGAAFGSVGGVGGGGIFVPMLTLIIGFDPKTSTAISKCMITGAAGATVYYSLKLRHPL  139

Query  821   LDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETW  1000
             L++PIIDYDLA+L QPML+LGISIGV  NVIFA+WMVT LLI+LF   STKAF +GVETW
Sbjct  140   LELPIIDYDLALLFQPMLLLGISIGVVLNVIFAEWMVTTLLIILFSAASTKAFFKGVETW  199

Query  1001  KKETIMKKEAAQQLAANGSGGQG-EYKLLPGGPGNGTQDTAKESSE-KQVSIIENVYWKE  1174
             KKETI+KKEA ++L +N +GG+   YK++PGGP NG+ +   E  +  +VSI +N+YWK+
Sbjct  200   KKETIIKKEAVRRLTSNVAGGEEVAYKIIPGGPNNGSTNFTNEVYKATEVSIFDNMYWKD  259

Query  1175  FGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSK  1354
                L  VW+  L L I KNY  TCST YW++NL Q+PV++G + +EA  LYKG R I S 
Sbjct  260   ISRLVAVWIIILVLHISKNYAPTCSTTYWILNLSQVPVAVGASAYEAVCLYKGSRTIMSS  319

Query  1355  GDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfamm  1534
             G++    +  QLI+YC  G++AG+VGGLLGLGGGFI+GPLFLELG+PPQVSSATA F M+
Sbjct  320   GETVITWKVHQLILYCCCGILAGIVGGLLGLGGGFILGPLFLELGIPPQVSSATAAFVMI  379

Query  1535  fsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTI  1714
             FSSSMSV++YYLL+RFPVPYAL+  AVA +AA +GQHVVRR+I+++GRAS+IIFILAFTI
Sbjct  380   FSSSMSVIQYYLLRRFPVPYALYFIAVAGIAALVGQHVVRRIISIVGRASVIIFILAFTI  439

Query  1715  FVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             FVSAISLGGVGI++ I+KI   ++MGF+N+C Y
Sbjct  440   FVSAISLGGVGIADTIKKIEEGQHMGFDNICAY  472



>ref|XP_010680798.1| PREDICTED: uncharacterized protein LOC104895862 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=476

 Score =   451 bits (1161),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 284/463 (61%), Positives = 354/463 (76%), Gaps = 10/463 (2%)
 Frame = +2

Query  428   LSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEME  607
             + +S +L ++   AER LK   ++  +  +   +  LS   +FLW+  E  Y  +WP+ME
Sbjct  18    ICFSVVLLNSIARAERPLKENFISLVDKEQVMKEGLLSKMYHFLWKSGEPSYQPVWPDME  77

Query  608   LGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSS  787
              GW IV+GS IGF+GAA GSVGGVGGGGIFVPML+L++GFDPKS+TAISKCMIMGAA S+
Sbjct  78    FGWRIVVGSFIGFLGAALGSVGGVGGGGIFVPMLTLIIGFDPKSSTAISKCMIMGAAAST  137

Query  788   VHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTS  967
             V+ NL L+HPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLI+LF+ TS
Sbjct  138   VYCNLSLKHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIILFLVTS  197

Query  968   TKAFLRGVETWKKETIMKKEAAQQL---AANGSGGQGEYKLLPGGPGNGTQDTAKESSEK  1138
              KA L+GV TW KE+ MKK  A      A +G   + +YK L  GP     D        
Sbjct  198   IKALLKGVNTWNKESEMKKIVASMHVPDAKSGEESEADYKPLASGPPAPAHD-------D  250

Query  1139  QVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEAT  1318
             +V ++ N+YWKE  LL FVW+ FL +Q++K YT TCS  YW+++ LQ+P+++ V+LFE  
Sbjct  251   KVPMLSNIYWKELSLLSFVWLGFLVIQLLKRYTVTCSVQYWLLDSLQVPIAVSVSLFEGV  310

Query  1319  GLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPP  1498
              LYKG + I+SKG   + L+  Q+  YC  G++AG+VGGLLGLGGGFI+GPLFLELG+PP
Sbjct  311   CLYKGTKVIASKGKEITVLKVHQIFFYCLCGVVAGMVGGLLGLGGGFILGPLFLELGIPP  370

Query  1499  QVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGR  1678
             QV+SAT+TF+M+FSSSMSVV+YY+LKRFPVPYA +   VAT+AA +GQHVVRRLI +LGR
Sbjct  371   QVASATSTFSMIFSSSMSVVQYYILKRFPVPYAAYFVLVATLAAIVGQHVVRRLITLLGR  430

Query  1679  ASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             AS+IIFILA TI VSAI+LGGVGI NMI+K+ NHEYMGFEN C
Sbjct  431   ASIIIFILASTILVSAITLGGVGIVNMIQKLENHEYMGFENFC  473



>ref|XP_006465614.1| PREDICTED: uncharacterized protein LOC102614288 isoform X1 [Citrus 
sinensis]
Length=479

 Score =   451 bits (1160),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 300/475 (63%), Positives = 370/475 (78%), Gaps = 12/475 (3%)
 Frame = +2

Query  398   KWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPK-E  574
             +WR+L    A     ++AS  VSA+ +LK E       S N +D      V  +  PK  
Sbjct  10    RWRLLA--AAFIGLLVVASVSVSAQSNLKPEAT-----SENKNDHVEPNIVIKVSAPKSR  62

Query  575   SGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAIS  754
             SGY H+WP+++ GW IV+G+IIGF G A GSVGGVGGGGIFVPML+L+VGFD KS+ A+S
Sbjct  63    SGYKHVWPDIKFGWRIVVGTIIGFFGTACGSVGGVGGGGIFVPMLNLIVGFDAKSSAAVS  122

Query  755   KCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVT  934
             KCM+ G AVS+V YNL+ RHPTLD+P+IDYDLA+L QP+L+LGISIGV FNVIFADWM+T
Sbjct  123   KCMVTGGAVSAVVYNLRQRHPTLDIPVIDYDLALLFQPLLVLGISIGVAFNVIFADWMIT  182

Query  935   VLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLA--ANGSGGQG-EYKLLPGGPGNG  1105
             VLLIVLF+  ST+AFL+GVETWKKETI K+EAA+QL     G+G Q  E K  P    N 
Sbjct  183   VLLIVLFLVLSTRAFLKGVETWKKETITKREAAKQLELIVLGNGYQTEECKCDPEYLSND  242

Query  1106  TQ-DTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQI  1282
             T  +  +E  + +VSIIEN+YWKEFGLL  VW   LALQI KNYT+TCS LYWV+NLLQI
Sbjct  243   TTPEETREPKKSKVSIIENIYWKEFGLLVAVWAIILALQIAKNYTTTCSVLYWVLNLLQI  302

Query  1283  PVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfi  1462
             PV+ GV+ +EA  LYKG RKI+SKGD G+  RA QL+ YC  G+ AG+VGGLLGLGGGFI
Sbjct  303   PVAGGVSAYEAVALYKGRRKIASKGDEGTKWRASQLVFYCACGITAGMVGGLLGLGGGFI  362

Query  1463  mgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQ  1642
             +GPLFLELG+PPQVSSATA FA+ FSSSMSVVEYYLLKRFPVPYAL+  A++ +AAF+GQ
Sbjct  363   LGPLFLELGIPPQVSSATALFAITFSSSMSVVEYYLLKRFPVPYALYFFALSIIAAFVGQ  422

Query  1643  HVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             HV+++LI +LGRAS+IIF L+F IFVSA+SLGGVG++ MI++I + EYMGF+N+C
Sbjct  423   HVLKKLIKILGRASIIIFTLSFIIFVSAVSLGGVGLAKMIKRIEHKEYMGFDNIC  477



>emb|CDO98032.1| unnamed protein product [Coffea canephora]
Length=460

 Score =   449 bits (1156),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 289/449 (64%), Positives = 359/449 (80%), Gaps = 9/449 (2%)
 Frame = +2

Query  398   KWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKES  577
             KW+ LRP+  ++  +L+A+  VSAE     E+V   N    +   Y S   N+LWQ    
Sbjct  8     KWKNLRPIAGVAIVYLVAAVVVSAEHI--PEQVISEN--NGTAKVYAS---NYLWQNGVM  60

Query  578   GYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISK  757
              Y H+WPEM+  W+IV+G++IGF  AA GSVGGVGGGGIFVPML+L++GFDPKS+TAISK
Sbjct  61    NYRHVWPEMKFSWQIVVGTVIGFFAAALGSVGGVGGGGIFVPMLALIIGFDPKSSTAISK  120

Query  758   CMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTV  937
             CMI GAA ++V+YN++LRHPTLD+PIIDYDLA+L QPML+LGISIGV FNVIFADWMVT+
Sbjct  121   CMITGAAGATVYYNIRLRHPTLDLPIIDYDLALLFQPMLVLGISIGVAFNVIFADWMVTI  180

Query  938   LLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQG-EYKLLPGGPGNGTQD  1114
             LLI+LFIGTSTKAFL+GVETWKKETIMK+EAA+ LA+ G+ G+   YKLLPGGP      
Sbjct  181   LLIILFIGTSTKAFLKGVETWKKETIMKQEAAKFLASGGTSGEPVSYKLLPGGPSGSISI  240

Query  1115  TAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVK-NYTSTCSTLYWVVNLLQIPVS  1291
                   + +VSII+N+ WKEF +L  VW S L LQI K  YT TCST YW++NLLQIP++
Sbjct  241   KQNVIEKSEVSIIDNIRWKEFCILIGVWGSILFLQITKEEYTKTCSTTYWILNLLQIPIA  300

Query  1292  LGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgp  1471
             +G + +EA GLYKG + I+S+G +G++    QL+  C  G++AG+VGGLLGLGGGFI+GP
Sbjct  301   IGASAYEAIGLYKGKKVIASRGQAGADWSIYQLVFCCLCGILAGIVGGLLGLGGGFILGP  360

Query  1472  lflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVV  1651
             LFLELGVPPQVSSATATFAM FSSSMSV++YYLL+RFPVPYA++  +VATVAA +GQHVV
Sbjct  361   LFLELGVPPQVSSATATFAMTFSSSMSVIQYYLLRRFPVPYAVYFVSVATVAALVGQHVV  420

Query  1652  RRLIAVLGRASLIIFILAFTIFVSAISLG  1738
             R++I++LGRASLIIFILAFTIFVSAISLG
Sbjct  421   RKMISILGRASLIIFILAFTIFVSAISLG  449



>ref|XP_003574413.1| PREDICTED: uncharacterized protein LOC100846525 isoform X1 [Brachypodium 
distachyon]
Length=461

 Score =   448 bits (1152),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 279/414 (67%), Positives = 344/414 (83%), Gaps = 5/414 (1%)
 Frame = +2

Query  572   ESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAI  751
              + Y H+WP M++GW +++GS I F GAAFGS+GGVGGGGIFVPML+L++GFD KS+ AI
Sbjct  51    RTTYHHVWPPMKVGWRVLLGSFIVFFGAAFGSIGGVGGGGIFVPMLTLIIGFDTKSSAAI  110

Query  752   SKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMV  931
             SKCMIMGAA+S+V+ NLKL+HP+LDMP+IDYDLA+LIQPMLMLG+SIGV  NVIF DW+V
Sbjct  111   SKCMIMGAALSTVYCNLKLKHPSLDMPLIDYDLALLIQPMLMLGVSIGVICNVIFPDWLV  170

Query  932   TVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQ  1111
             TVLLI LF+ TSTKAFL+GVETWKKET+ K+EA +QL    +  Q EY L P G  +   
Sbjct  171   TVLLISLFLVTSTKAFLKGVETWKKETLTKREATKQL--EQTSEQWEYTLPPSGADDA--  226

Query  1112  DTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVS  1291
               +K  S++ VSI +N+YWKEFGLL FVW++FL LQI K+Y +TCST YWV+N+LQIPVS
Sbjct  227   -ASKAPSDEAVSIWKNIYWKEFGLLAFVWIAFLVLQITKDYVATCSTWYWVLNILQIPVS  285

Query  1292  LGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgp  1471
             +GV +++A GL +G R ISSK ++ ++L+A QL VYC  G+ AG +GGLLG+GGG IMGP
Sbjct  286   VGVTMYQAVGLAQGKRVISSKANNQTSLKAYQLFVYCSLGLTAGSMGGLLGVGGGIIMGP  345

Query  1472  lflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVV  1651
             LFLELGVPPQVSSAT+TFAMMFS+SMSVVEYYLLKRFPVPYA F T VA +AA +GQ VV
Sbjct  346   LFLELGVPPQVSSATSTFAMMFSASMSVVEYYLLKRFPVPYAAFFTIVAFLAAIVGQGVV  405

Query  1652  RRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             R++I+ LGRASLIIF+L+F IF+SA+SLGGVG SNMI KI  HEY+GFEN+CKY
Sbjct  406   RKMISWLGRASLIIFVLSFMIFISALSLGGVGTSNMIHKITQHEYLGFENICKY  459



>ref|XP_009410875.1| PREDICTED: uncharacterized protein LOC103992760 [Musa acuminata 
subsp. malaccensis]
Length=373

 Score =   444 bits (1142),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 259/371 (70%), Positives = 317/371 (85%), Gaps = 1/371 (0%)
 Frame = +2

Query  704   MLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLG  883
             MLSL+VGFDPKS+TA+SKCMIMGAA S+V++NLKLRHP LD+P+IDYDLAVLIQPMLMLG
Sbjct  1     MLSLIVGFDPKSSTAMSKCMIMGAAGSTVYFNLKLRHPILDVPLIDYDLAVLIQPMLMLG  60

Query  884   ISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGG  1063
             ISIGV FNVIF DWMVT+LLIVLF+G+STKAF++GV+TWKKET++KK+A ++L  NG G 
Sbjct  61    ISIGVIFNVIFPDWMVTILLIVLFLGSSTKAFMKGVDTWKKETVLKKDAYKRLVTNGGGS  120

Query  1064  QG-EYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTS  1240
             +  EY+ LP GP +  +   + ++E +V +++NV WKE GLL FVWV FL LQ+ KN+T+
Sbjct  121   EEVEYRSLPLGPSDIDRKGVEMTAESEVPVLQNVSWKELGLLVFVWVLFLVLQVTKNHTA  180

Query  1241  TCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmia  1420
             TCST YW++N LQIPVS+ V L EA  LYKG R I+S+GD G+N +  QL V+C  G+IA
Sbjct  181   TCSTWYWILNFLQIPVSVAVTLHEAISLYKGERVIASRGDEGTNWKVSQLFVFCLSGIIA  240

Query  1421  gvvggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYal  1600
             G+VGGLLGLGGGFI+GPLFLELG+PPQVSSATATFAM FSSS+SVVEYYLL RFPVPYA+
Sbjct  241   GIVGGLLGLGGGFILGPLFLELGIPPQVSSATATFAMTFSSSLSVVEYYLLNRFPVPYAV  300

Query  1601  fltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNH  1780
             +   VATVAAF+GQHVVRRL+ ++GRASLIIFILA  IF+SAISLGGVGI NMI+KI ++
Sbjct  301   YFIFVATVAAFVGQHVVRRLVILIGRASLIIFILASMIFISAISLGGVGIVNMIKKIEDN  360

Query  1781  EYMGFENLCKY  1813
             +YMGFENLC+Y
Sbjct  361   DYMGFENLCRY  371



>ref|XP_004509250.1| PREDICTED: uncharacterized protein LOC101512581 [Cicer arietinum]
Length=472

 Score =   447 bits (1150),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 277/467 (59%), Positives = 359/467 (77%), Gaps = 15/467 (3%)
 Frame = +2

Query  428   LSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYL-STFVNFLWQPKESGYDHIWPEM  604
             +SWS ++      AER L+++E     + +      + +  ++F     +S YD +WPEM
Sbjct  17    VSWSLIMIYHVSLAERILEDKESENLVIMKERQGGVIINRVIDFFSYSGKSSYDRVWPEM  76

Query  605   ELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVS  784
             + GW IV+GSI+GF GAA GSVGGVGGGGIF+PML+L++GFDPKS+T ISKCMI GAA S
Sbjct  77    KFGWRIVVGSIVGFFGAALGSVGGVGGGGIFIPMLTLIIGFDPKSSTPISKCMITGAAGS  136

Query  785   SVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGT  964
             + +YNL+LRHPTLDMP+IDYDLA+L QPMLMLGISIGV FNV+FADWMVT+LLI+LFIGT
Sbjct  137   TAYYNLRLRHPTLDMPLIDYDLALLFQPMLMLGISIGVAFNVMFADWMVTILLIILFIGT  196

Query  965   STKAFLRGVETWKKETIMKKEAAQQLAANGSGG---QGEYKLLPGGPGNGTQDTAKESSE  1135
             STKA ++GV+TWKKETIMKKEAA+ L ++ + G   + +YK LP               +
Sbjct  197   STKALIKGVDTWKKETIMKKEAAKILESSSTTGYVSEEDYKSLPA-----------YQQD  245

Query  1136  KQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEA  1315
             ++V ++ N+YWKE  +L +VWV+FL +QI K Y+ TCS  YW++N LQ+P+++ V +FEA
Sbjct  246   EEVPLLNNIYWKELSILVYVWVAFLIVQIFKTYSKTCSIEYWILNSLQVPIAISVTVFEA  305

Query  1316  TGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVP  1495
               L KG R I+SKG   +  +  Q+ +YC  G+IAG+V GLLGLGGGFI+GPLFLELG+P
Sbjct  306   ICLSKGSRVIASKGKEITGWKFHQICLYCLCGIIAGMVSGLLGLGGGFILGPLFLELGIP  365

Query  1496  PQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLG  1675
             PQV+SAT+TF M+FSSSMSVV+YYLL RFPVPYA +L  VAT+AA  GQHVVR+++A+ G
Sbjct  366   PQVASATSTFVMVFSSSMSVVQYYLLDRFPVPYASYLVLVATIAALTGQHVVRKMVAIFG  425

Query  1676  RASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  1816
             RAS+IIFILAFTIFVSAISLGGVGI NM+EK+ N +YMGF+NLC + 
Sbjct  426   RASIIIFILAFTIFVSAISLGGVGIENMVEKMENEDYMGFDNLCHHS  472



>ref|XP_008783526.1| PREDICTED: uncharacterized protein LOC103702749 [Phoenix dactylifera]
Length=506

 Score =   448 bits (1153),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 282/434 (65%), Positives = 346/434 (80%), Gaps = 4/434 (1%)
 Frame = +2

Query  518   NSDDDY-LSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggI  694
               D  Y L+   + L+   +S Y H+WP+ME GW +V+GS IGF+GAA GS+GGVGGGGI
Sbjct  66    EKDHKYILANIFHSLFDNGDSSYTHVWPDMEFGWRVVLGSTIGFLGAALGSIGGVGGGGI  125

Query  695   FVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPML  874
             FVPML+L++GFDPK++TAISKCMIMGAA S+V+YNL+LRHPTL++PIIDYDLA+L QPML
Sbjct  126   FVPMLTLIIGFDPKTSTAISKCMIMGAAGSTVYYNLRLRHPTLELPIIDYDLALLFQPML  185

Query  875   MLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANG  1054
             MLGISIGV FNVIF DWMVTVLLI+LF+GTSTKA  +G+ETWKKE+I+KKEAA+ L +  
Sbjct  186   MLGISIGVAFNVIFPDWMVTVLLIILFLGTSTKALFKGIETWKKESILKKEAAKLLTSQS  245

Query  1055  SGGQG-EYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKN  1231
             +  Q   YK LPG P    Q     S + +V I EN+YWKEF LL FVWV+FLA+QI+K 
Sbjct  246   NESQKLAYKPLPGAPAANAQ--VLSSPDDEVPIKENIYWKEFMLLLFVWVAFLAVQIIKT  303

Query  1232  YTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFg  1411
             Y +TCS  YWV+N LQ+P++L V L EA  L KG R I+S+G      +  QL+ YC  G
Sbjct  304   YATTCSIEYWVLNALQVPIALSVTLCEAINLCKGKRTIASRGKQDIRWKMHQLLFYCCCG  363

Query  1412  miagvvggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVP  1591
             ++AG+VGGLLGLGGGFI+GPLFLE+GVPPQV+SAT+TFAM FSSSMSV++YYLL RFPVP
Sbjct  364   VLAGIVGGLLGLGGGFILGPLFLEMGVPPQVASATSTFAMTFSSSMSVIQYYLLDRFPVP  423

Query  1592  YalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKI  1771
             YA +   +ATVAAF  QH+VRRLI +LGRASLIIFILA TIFVSAISLGGVGI++M+EK+
Sbjct  424   YAAYFVFLATVAAFTSQHIVRRLIVLLGRASLIIFILALTIFVSAISLGGVGIAHMVEKL  483

Query  1772  HNHEYMGFENLCKY  1813
                E+MGFENLC +
Sbjct  484   ERKEHMGFENLCYH  497



>ref|XP_007046968.1| DNA-directed RNA polymerase isoform 2 [Theobroma cacao]
 gb|EOX91125.1| DNA-directed RNA polymerase isoform 2 [Theobroma cacao]
Length=443

 Score =   444 bits (1142),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 290/473 (61%), Positives = 354/473 (75%), Gaps = 47/473 (10%)
 Frame = +2

Query  413   RPLVALSWSFLLASAFVS----AERSLK---NEEVAGTNVSRNSDDDYLSTFVNFLWQPK  571
             R L  ++W   L    +S    AER LK   N+ V   N + N+    L    NFLWQ  
Sbjct  9     RSLAIMAWVVFLVLVMMSNVGIAERLLKDKRNQRVFKDNENENTRG-LLVRVANFLWQGG  67

Query  572   ESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAI  751
             +S Y+ +WPE+E GW+IV+GSI+GF+GAA GSVGGVGGGGIFVPML+L++GFDPKS+TAI
Sbjct  68    KSSYEPVWPELEFGWKIVVGSIVGFLGAALGSVGGVGGGGIFVPMLTLIIGFDPKSSTAI  127

Query  752   SKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMV  931
             SKCMIMGAA S+V+YNL+LRHPTL+MP+IDYDLA+L QPMLMLGISIGV  NV+FADWMV
Sbjct  128   SKCMIMGAAGSTVYYNLRLRHPTLEMPLIDYDLALLFQPMLMLGISIGVALNVMFADWMV  187

Query  932   TVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQ  1111
             TVLLI+LFIGTSTKA  +G++TWKKET+MKK                             
Sbjct  188   TVLLIILFIGTSTKALFKGIDTWKKETMMKK-----------------------------  218

Query  1112  DTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVS  1291
                       V ++ N+YWKE  LL +VW+ FL +QIVK Y  TCS +YW+VN LQIP++
Sbjct  219   ----------VPLLRNIYWKELSLLMYVWIGFLIVQIVKEYVPTCSVVYWIVNSLQIPIA  268

Query  1292  LGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgp  1471
               V LFEA  LYKG R I+SKG   +N +  Q+++YC  G+IAG+VGGLLGLGGGFI+GP
Sbjct  269   ASVTLFEAICLYKGTRVIASKGKEVTNWKIYQILLYCSCGIIAGMVGGLLGLGGGFILGP  328

Query  1472  lflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVV  1651
             LFLELG+PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVV
Sbjct  329   LFLELGIPPQVASATSTFAMVFSSSMSVVQYYLLNRFPVPYAAYFVLVATIAAFTGQHVV  388

Query  1652  RRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  1810
             R++IAVLGRAS+IIFILA TIF+SAISLGGVGI++M+EK+ N EYMGFENLCK
Sbjct  389   RKIIAVLGRASIIIFILALTIFISAISLGGVGIADMVEKLENEEYMGFENLCK  441



>gb|EYU21457.1| hypothetical protein MIMGU_mgv1a005411mg [Erythranthe guttata]
Length=484

 Score =   444 bits (1143),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 293/485 (60%), Positives = 370/485 (76%), Gaps = 9/485 (2%)
 Frame = +2

Query  380   MAGAGGKWRI-LRPLVALSWSFLLASAFVSAERSLKNEE--VAGTNVS--RNSDDDYLST  544
             MA  G + R   R   AL  +F++  + V A  S +N E  ++ TNV+  RNS+ +Y + 
Sbjct  1     MAEVGAECRKGFRGRKALILTFVILLSCVVAVSSQENLEQVISRTNVAVDRNSEPNYFTR  60

Query  545   FVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVG  724
              + FL   +     H+WP+ME GW IV G++IGF GAA GSVGGVGGGGIFVPML+L++G
Sbjct  61    IITFL---RGISLPHVWPDMEFGWRIVAGTVIGFFGAALGSVGGVGGGGIFVPMLTLIIG  117

Query  725   FDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTF  904
             FDPKS+TAISKCMI GAAV++V+YNLKLRHPT D+PIIDYDLA+L QPML+LGISIGV F
Sbjct  118   FDPKSSTAISKCMITGAAVATVYYNLKLRHPTRDLPIIDYDLALLFQPMLVLGISIGVFF  177

Query  905   NVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQ-LAANGSGGQGEYKL  1081
             NVIFA+WMVTVLLI+LFI TSTKAFL+G+ETWKKETI+KKEAA++ L+ + +     YK 
Sbjct  178   NVIFAEWMVTVLLIILFIVTSTKAFLKGIETWKKETIIKKEAARRSLSDSNANEDASYKP  237

Query  1082  LPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYW  1261
             L  GP N T+    E    +VSII+NV+WK+F +L  VW+    L I K+YT+TCS  YW
Sbjct  238   LLSGPTNETRMQLNEHKASKVSIIDNVHWKKFSILVVVWLIICLLHITKDYTTTCSAAYW  297

Query  1262  VVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggll  1441
             ++ LLQIPV++G + ++A  LYKGW+ I + G+SG      QLI+ C  G++AG+VGGLL
Sbjct  298   ILTLLQIPVAVGASGYQAVCLYKGWKVIEATGESGVRWTIPQLILCCCCGILAGIVGGLL  357

Query  1442  glgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavat  1621
             GLGGGFI+GPLFLELG+PPQVSSATAT  MMFSSSMSV++YYLL RFP  YAL+   VAT
Sbjct  358   GLGGGFILGPLFLELGIPPQVSSATATLVMMFSSSMSVIQYYLLHRFPPSYALYFVIVAT  417

Query  1622  vaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFEN  1801
              AA +GQHVVR+++++L RASLIIFILAFTIFVSAISLG VGISN+I ++   EYM F +
Sbjct  418   FAALVGQHVVRKMVSILRRASLIIFILAFTIFVSAISLGWVGISNIIGEVEGQEYMWFYD  477

Query  1802  LCKYG  1816
             +CKYG
Sbjct  478   ICKYG  482



>ref|XP_007156036.1| hypothetical protein PHAVU_003G253000g [Phaseolus vulgaris]
 gb|ESW28030.1| hypothetical protein PHAVU_003G253000g [Phaseolus vulgaris]
Length=471

 Score =   444 bits (1141),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 276/465 (59%), Positives = 361/465 (78%), Gaps = 15/465 (3%)
 Frame = +2

Query  428   LSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPK-ESGYDHIWPEM  604
             LSWS ++A    SAER LK++     +++    +  L + ++F W    +   D +WPEM
Sbjct  14    LSWSLIMAYNVSSAERVLKDQN--HESLAATEREGVLFSIIDFFWNDGGDPSKDRVWPEM  71

Query  605   ELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVS  784
             + GW IV+GS++GF GAA GSVGGVGGGGIF+PML+L++GFD KS+TAISKCMIMGAAVS
Sbjct  72    KFGWRIVVGSVVGFFGAALGSVGGVGGGGIFIPMLTLIIGFDAKSSTAISKCMIMGAAVS  131

Query  785   SVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGT  964
             +V+YNL+ RHPTLD+P+IDYDLA+L QPMLMLGISIGV FNV+FADWMVTVLLI+LFI T
Sbjct  132   TVYYNLRFRHPTLDLPVIDYDLALLFQPMLMLGISIGVAFNVMFADWMVTVLLIILFIAT  191

Query  965   STKAFLRGVETWKKETIMKKEAAQQLAANGS---GGQGEYKLLPGGPGNGTQDTAKESSE  1135
             STKA  +G++TWKKET+MKKEAA+ L ++          YK LP G          +  +
Sbjct  192   STKALFKGIDTWKKETLMKKEAAKMLESDSPPEYDSDEHYKPLPAG--------LTDPRD  243

Query  1136  KQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEA  1315
             ++V +++N+YWKE  +L +VWV+FL +QI+K Y+ TCS LYWV+N LQ+P+++ V L+EA
Sbjct  244   EKVPLLKNIYWKELLVLVYVWVAFLIVQIIKTYSKTCSILYWVLNSLQVPIAVSVTLYEA  303

Query  1316  TGLYKGWRKISSKGDSGSNLRA-GQLIVYCFFgmiagvvggllglgggfimgplflELGV  1492
               L  G R I+SK    ++ +   ++ +YC  G+IAG+V GLLGLGGGFI+GPLFLELG+
Sbjct  304   ICLCNGTRVIASKEKEITDWKKLHKICLYCSCGIIAGIVSGLLGLGGGFILGPLFLELGI  363

Query  1493  PPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVL  1672
             PPQV+SAT+TFAM+FSSSMSVV+YYLL+RFPVPYA +   +AT+AA  GQHVVR++IA+ 
Sbjct  364   PPQVASATSTFAMVFSSSMSVVQYYLLERFPVPYASYFILIATIAALTGQHVVRKIIAIF  423

Query  1673  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             GRAS+IIF+LAFTIF+SAISLGGVGI NM+EKI N+EYMGF N+C
Sbjct  424   GRASIIIFVLAFTIFLSAISLGGVGIENMVEKIENNEYMGFANIC  468



>ref|NP_001061712.1| Os08g0387200 [Oryza sativa Japonica Group]
 dbj|BAD05436.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23626.1| Os08g0387200 [Oryza sativa Japonica Group]
 gb|EAZ42600.1| hypothetical protein OsJ_27163 [Oryza sativa Japonica Group]
Length=469

 Score =   443 bits (1140),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 275/429 (64%), Positives = 347/429 (81%), Gaps = 10/429 (2%)
 Frame = +2

Query  530   DYLSTFVNFLWQPK-ESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPM  706
              +L    NFLW+   E+ Y H+WP ME GW+IV+GS +GF+GAAFGS+GGVGGGG F+PM
Sbjct  48    SHLRKVANFLWRSGGENSYHHVWPPMEFGWQIVLGSFVGFIGAAFGSIGGVGGGGFFMPM  107

Query  707   LSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGI  886
             L+L++GFD KS+ AISKCMIMGAAVS+V+ NLK +HPTLDMP+IDYDLA+LIQPMLMLGI
Sbjct  108   LTLIIGFDAKSSVAISKCMIMGAAVSTVYCNLKRKHPTLDMPVIDYDLALLIQPMLMLGI  167

Query  887   SIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQ  1066
             SIGV FNVIF DW+VTVLLI+LF+GTSTKAFL+G+ETWKKETI+K+EA ++  +  +  +
Sbjct  168   SIGVIFNVIFPDWLVTVLLIILFLGTSTKAFLKGIETWKKETIIKREAEKR--SEQTSEE  225

Query  1067  GEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTC  1246
              EY+ +P          +K  S++ VSI+ NVYWKEFGLL FVW++FLALQ+ KNY  TC
Sbjct  226   LEYRPVPA-------SESKPPSDEAVSILHNVYWKEFGLLAFVWIAFLALQVTKNYMPTC  278

Query  1247  STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  1426
             ST YWV+NLLQIPVS+GV ++E  GL +G R ISS G+  +NL+  QL++YCFFG+ AG+
Sbjct  279   STWYWVLNLLQIPVSVGVTMYEGLGLMQGRRVISSNGNEQTNLKFHQLLMYCFFGITAGI  338

Query  1427  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  1606
             V GLLG+GGG I+GP+FL+LGVPPQV+SATATF+MMFS+SMS VEYY L RFPVPYAL+L
Sbjct  339   VAGLLGVGGGSILGPMFLDLGVPPQVASATATFSMMFSASMSAVEYYFLDRFPVPYALYL  398

Query  1607  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  1786
             T VA  +A +GQ +VR++I  LGRAS+IIF L+  IF+S I LGG+GI N I KI  HEY
Sbjct  399   TVVAFFSAIVGQRMVRKVINWLGRASIIIFTLSIMIFLSTIPLGGIGIVNWIGKIERHEY  458

Query  1787  MGFENLCKY  1813
             MGFE++CK+
Sbjct  459   MGFEDICKF  467



>gb|AET03944.2| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=473

 Score =   443 bits (1139),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 280/470 (60%), Positives = 362/470 (77%), Gaps = 29/470 (6%)
 Frame = +2

Query  428   LSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEME  607
             +SWS ++      AER L++E+     + + S          F W   ES Y+ +WPEM+
Sbjct  21    VSWSLIMIYHVSLAERVLEDEKPEIVVMKKTS----------FFWYSGESSYERVWPEMK  70

Query  608   LGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSS  787
              GW IV+GSI+GF GAA GSVGGVGGGGIF+PML+L++GFDPKS+TA+SKCMI GAA S+
Sbjct  71    FGWRIVVGSIVGFFGAALGSVGGVGGGGIFIPMLTLIIGFDPKSSTALSKCMITGAAGST  130

Query  788   VHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTS  967
             V+YNL+LRHPTLDMP+IDYDLA+L QPMLMLGISIGV FNV+FADWMVT+LLI+LFIGTS
Sbjct  131   VYYNLRLRHPTLDMPLIDYDLALLFQPMLMLGISIGVAFNVMFADWMVTILLIILFIGTS  190

Query  968   TKAFLRGVETWKKETIMKKEA---AQQLAANGS----GGQGEYKLLPGGPGNGTQDTAKE  1126
             TKA ++G++TWKKETIMKKEA   A Q+  +GS      + +YK LP            +
Sbjct  191   TKALVKGIDTWKKETIMKKEAFEEAAQMLESGSTPDYASEEDYKSLPA-----------D  239

Query  1127  SSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVAL  1306
               +++V +++N++WKE  +L +VWV+FL +QI+K Y+ TCS  YW++N LQ+P+++ V L
Sbjct  240   LQDEEVPLLDNIHWKELSVLMYVWVAFLIVQILKTYSKTCSIEYWLLNSLQVPIAISVTL  299

Query  1307  FEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflEL  1486
             FEA  L KG R I+S+G      +  ++ +YCF G+IAG+V GLLGLGGGFI+GPLFLEL
Sbjct  300   FEAICLCKGTRVIASRGKE-ITWKFHKICLYCFCGIIAGMVSGLLGLGGGFILGPLFLEL  358

Query  1487  GVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIA  1666
             G+PPQV+SAT+TFAM+FSSSMSVV+YY L RFP+PYA +L  VAT+AA  GQHVVR++IA
Sbjct  359   GIPPQVASATSTFAMVFSSSMSVVQYYHLDRFPIPYASYLVLVATIAALTGQHVVRKIIA  418

Query  1667  VLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  1816
             + GRAS+I+FILAFTIFVSAISLGGVGI NM+EK+ N EYMGF+NLC +G
Sbjct  419   IFGRASIIVFILAFTIFVSAISLGGVGIGNMVEKMENEEYMGFDNLCHHG  468



>ref|XP_004235668.1| PREDICTED: uncharacterized protein LOC101262796 [Solanum lycopersicum]
 ref|XP_010318541.1| PREDICTED: uncharacterized protein LOC101262796 [Solanum lycopersicum]
Length=482

 Score =   443 bits (1139),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 284/481 (59%), Positives = 369/481 (77%), Gaps = 4/481 (1%)
 Frame = +2

Query  380   MAGAGGKWRILRPL-VALSWSFLLASAFVSAERSLKNEEVAGTNVSRNS-DDDYLSTFVN  553
             MA  G K   LR   VA+S    LA A V + + +  E     N + +S +  YL    N
Sbjct  1     MAKTGFKLEGLRKFTVAVSGLVFLALAIVVSGKQVPYETTLSNNGTTHSYESSYLFDLFN  60

Query  554   FLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDP  733
              LW+  E  Y H+WPE E GW +++GS+IGF GAAFGSVGGVGGGGIFVP+L+L++GFDP
Sbjct  61    ILWRKSEINYHHVWPEPEFGWRLIVGSVIGFFGAAFGSVGGVGGGGIFVPVLTLIIGFDP  120

Query  734   KSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVI  913
             K++TAISKCMI GAA ++V+Y LKLRHP+LD+PIIDYDLA+L QPML+LGIS+GV  NV+
Sbjct  121   KTSTAISKCMITGAACATVYYCLKLRHPSLDLPIIDYDLALLFQPMLLLGISVGVVLNVL  180

Query  914   FADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSG-GQGEYKLLPG  1090
             FA+WMVT+LLI+LF+  STKAF +GVETW+KETI+KKEAA+ L +N +G  +  YKL+PG
Sbjct  181   FAEWMVTILLIILFLAASTKAFFKGVETWRKETIIKKEAARCLTSNDAGVEEVAYKLIPG  240

Query  1091  GPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVN  1270
             GP N +   + E  +K+VSI +N+YWK+   L  VW+  L L + KNY  TCST YW ++
Sbjct  241   GPKNDST-FSNEVYKKEVSIFDNMYWKDTARLIAVWIIILFLHVSKNYAPTCSTAYWTLS  299

Query  1271  LLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglg  1450
             LLQ+P+++G + +EA  LYKG R I S G++  + +  QLI+YC  G++AG+VGGLLGLG
Sbjct  300   LLQLPIAVGASAYEAVCLYKGSRMILSSGEALISWKVHQLILYCCCGILAGIVGGLLGLG  359

Query  1451  ggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaa  1630
             GGFI+GPLFLELG+PPQVSSATA F M+FSSSMSV++YYLL RFPVPYAL+  AVA++AA
Sbjct  360   GGFILGPLFLELGIPPQVSSATAAFVMIFSSSMSVIQYYLLGRFPVPYALYFIAVASIAA  419

Query  1631  fIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  1810
              +GQHVVRR+I+++GRAS+IIFILA TIFVSAISLGG GI++ I+KI   + MGF+N+C 
Sbjct  420   LVGQHVVRRIISIVGRASVIIFILALTIFVSAISLGGFGIADTIKKIEEGQQMGFDNICA  479

Query  1811  Y  1813
             Y
Sbjct  480   Y  480



>gb|EAZ06861.1| hypothetical protein OsI_29096 [Oryza sativa Indica Group]
Length=469

 Score =   442 bits (1138),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 276/429 (64%), Positives = 347/429 (81%), Gaps = 10/429 (2%)
 Frame = +2

Query  530   DYLSTFVNFLWQPK-ESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPM  706
              +L    NFLW+   E+ Y H+WP ME GW+IV+GS +GF+GAAFGS+GGVGGGG FVPM
Sbjct  48    SHLRKVANFLWRSGGENSYHHVWPPMEFGWQIVLGSFVGFIGAAFGSIGGVGGGGFFVPM  107

Query  707   LSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGI  886
             L+L++GFD KS+ AISKCMIMGAAVS+V+ NLK +HPTLDMP+IDYDLA+LIQPMLMLGI
Sbjct  108   LTLIIGFDAKSSVAISKCMIMGAAVSTVYCNLKRKHPTLDMPVIDYDLALLIQPMLMLGI  167

Query  887   SIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQ  1066
             SIGV FNVIF DW+VTVLLI+LF+GTSTKAFL+G+ETWKKETI+K+EA ++  +  +  +
Sbjct  168   SIGVIFNVIFPDWLVTVLLIILFLGTSTKAFLKGIETWKKETIIKREAEKR--SEQTSEE  225

Query  1067  GEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTC  1246
              EY+ +P          +K  S++ VSI+ NVYWKEFGLL FVW++FLALQ+ KNY  TC
Sbjct  226   LEYRPVPA-------SESKPPSDEAVSILHNVYWKEFGLLAFVWIAFLALQVTKNYMPTC  278

Query  1247  STLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagv  1426
             ST YWV+NLLQIPVS+GV ++E  GL +G R ISS G+  +NL+  QL++YCFFG+ AG+
Sbjct  279   STWYWVLNLLQIPVSVGVTMYEGLGLMQGRRVISSNGNEQTNLKFHQLLMYCFFGITAGI  338

Query  1427  vggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfl  1606
             V GLLG+GGG I+GP+FL+LGVPPQV+SATATF+MMFS+SMS VEYY L RFPVPYAL+L
Sbjct  339   VAGLLGVGGGSILGPMFLDLGVPPQVASATATFSMMFSASMSAVEYYFLDRFPVPYALYL  398

Query  1607  tavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEY  1786
             T VA  +A +GQ +VR++I  LGRAS+IIF L+  IF+S I LGG+GI N I KI  HEY
Sbjct  399   TVVAFFSAIVGQRMVRKVINWLGRASIIIFTLSIMIFLSTIPLGGIGIVNWIGKIERHEY  458

Query  1787  MGFENLCKY  1813
             MGFE++CK+
Sbjct  459   MGFEDICKF  467



>ref|XP_006343068.1| PREDICTED: uncharacterized protein LOC102587876 isoform X1 [Solanum 
tuberosum]
 ref|XP_006343069.1| PREDICTED: uncharacterized protein LOC102587876 isoform X2 [Solanum 
tuberosum]
 ref|XP_006343070.1| PREDICTED: uncharacterized protein LOC102587876 isoform X3 [Solanum 
tuberosum]
Length=483

 Score =   443 bits (1139),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 280/481 (58%), Positives = 371/481 (77%), Gaps = 3/481 (1%)
 Frame = +2

Query  380   MAGAGGKWRILRPL-VALSWSFLLASAFVSAERSLKNEEVAGTNVSRNS-DDDYLSTFVN  553
             MA    K + LR   VA+S   +LA   V++   +  E     N + +S +  YL    N
Sbjct  1     MAKTEFKLKGLRKYGVAVSGLLVLALTTVASAEQIPYETTLSNNGTTHSYESSYLFDLFN  60

Query  554   FLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDP  733
               W+  E  Y H+WPE+E GW +++GS+IGF GAAFGSVGGVGGGGIFVP+L+L++GFDP
Sbjct  61    IFWRKSEIHYHHVWPELEFGWRLIVGSVIGFFGAAFGSVGGVGGGGIFVPVLTLIIGFDP  120

Query  734   KSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVI  913
             K++TAISKCMI GAA ++V+Y LKLRHP+LD+PIIDYDLA+L QPML+LGISIGV  N++
Sbjct  121   KTSTAISKCMITGAAGATVYYCLKLRHPSLDLPIIDYDLALLFQPMLLLGISIGVALNIL  180

Query  914   FADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSG-GQGEYKLLPG  1090
             FA+WMVT+LLI+LF+  STKAF +GVETW+KETI+KKEAA++L +N +G  +  YKL+PG
Sbjct  181   FAEWMVTILLIILFLAASTKAFFKGVETWRKETIIKKEAARRLTSNDAGVEEVAYKLIPG  240

Query  1091  GPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVN  1270
             GP N +  + +    K+VSI +N+YWK+   L  VW+  L L + KNY  TCST YW ++
Sbjct  241   GPKNDSTFSNEVYKAKEVSIFDNMYWKDTTRLIAVWIIILFLHVSKNYAPTCSTTYWTLS  300

Query  1271  LLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglg  1450
             LLQ+P+++G + +EA  LYKG R I S G++    +  QLI+YC  G++AG+VGGLLGLG
Sbjct  301   LLQLPIAVGASAYEAVCLYKGSRVILSSGEAVITWKVHQLILYCCCGILAGIVGGLLGLG  360

Query  1451  ggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaa  1630
             GGFI+GPLFLELG+PPQVSSATA F M+FSSSMSV++YYLL RFPVPYAL+  AVA++AA
Sbjct  361   GGFILGPLFLELGIPPQVSSATAAFVMIFSSSMSVIQYYLLGRFPVPYALYFIAVASIAA  420

Query  1631  fIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  1810
              +GQHVVR++I+++GRAS+IIFILAFTIFVSAISLGG GI++ I+KI+  ++MGF+N+C 
Sbjct  421   LVGQHVVRKIISIVGRASVIIFILAFTIFVSAISLGGFGIADTIKKINEGQHMGFDNICA  480

Query  1811  Y  1813
             Y
Sbjct  481   Y  481



>ref|XP_011072363.1| PREDICTED: uncharacterized protein LOC105157640 [Sesamum indicum]
Length=473

 Score =   438 bits (1126),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 280/459 (61%), Positives = 355/459 (77%), Gaps = 8/459 (2%)
 Frame = +2

Query  449   ASAFVSAERSLKNEEVAGTNVSRNSDDDYLST-FVNFLWQPKESGYDHIWPEMELGWEIV  625
             A A V+A+  L+ +      VS N +  Y +T  ++FL Q ++  + H+WP+ME GW I 
Sbjct  17    ACAVVAAQEGLEQDISRRDGVSENLESGYFTTRIISFLQQSRDRVFRHVWPDMEFGWRIG  76

Query  626   IGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLK  805
             +G++IGF GAA GSVGGVGGGGIFVPML+L++GFDPK++TA+SKCMI GAAV++V+YNLK
Sbjct  77    LGTVIGFFGAALGSVGGVGGGGIFVPMLTLIIGFDPKTSTAVSKCMITGAAVATVYYNLK  136

Query  806   LRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLR  985
             LRHP+LD+PIIDYDLA+L QPML+LGISIGV FNVIFA+WMVTVLLI+LFIGTS KAF +
Sbjct  137   LRHPSLDLPIIDYDLALLFQPMLVLGISIGVIFNVIFAEWMVTVLLIILFIGTSMKAFFK  196

Query  986   GVETWKKETIMKKEAAQQLAANGSGGQGE---YKLLPGGPGNGTQDTAKESSEKQVSIIE  1156
             GVETWKKETI+ KEAA++  ++ S    E   YKLLP GP + T+    E+   +VS I+
Sbjct  197   GVETWKKETIIMKEAARRSLSDSSDNGSEEFPYKLLPDGPISETRMRLNENKAPEVSFID  256

Query  1157  NVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGW  1336
             NVYWK+  +L  VW+  L L + K+YT+TCS  YW V LLQIPV++G + ++A  LYKGW
Sbjct  257   NVYWKKLSILVVVWLIILLLHVGKDYTATCSAAYWTVTLLQIPVAVGASGYQAVCLYKGW  316

Query  1337  RKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssat  1516
             R + SKG +G N R  QLI+ C  G++AG+VGGLLGLGGGFI+GPL LELG+PPQVSSAT
Sbjct  317   RVVESKGGAGINWRVHQLILCCCCGILAGIVGGLLGLGGGFIIGPLLLELGIPPQVSSAT  376

Query  1517  atfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIF  1696
             AT  M FSSSMSV++YYLL+RFP  YAL+   VATVAA +GQHVVR+++++L RAS IIF
Sbjct  377   ATLIMTFSSSMSVIQYYLLRRFPPSYALYFVLVATVAALVGQHVVRKMVSILRRASFIIF  436

Query  1697  ILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             ILAFTIFVSAISLG VGISN+I      E + F N+C+Y
Sbjct  437   ILAFTIFVSAISLGWVGISNII----GEENIWFYNICEY  471



>ref|XP_011011435.1| PREDICTED: uncharacterized protein LOC105116005 isoform X2 [Populus 
euphratica]
Length=475

 Score =   437 bits (1125),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 303/482 (63%), Positives = 369/482 (77%), Gaps = 14/482 (3%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVA-LSWSFLLASAFVSAERSLKNE--EVAGTNVSRNSDDDYLSTFV  550
             MA    K  +L+ L A LS S +     V AE SL  E     GT   R          +
Sbjct  1     MARIQAKHLVLKLLGAILSGSLVAVLILVLAEPSLTQEGSRTGGTESHRAMR------ML  54

Query  551   NFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFD  730
             + + +    GY H+WPEM  GW+IV+GSIIGF GAA GSVGGVGGGGIFVPMLSL++GFD
Sbjct  55    SLVREKGRVGYTHVWPEMRFGWKIVMGSIIGFFGAACGSVGGVGGGGIFVPMLSLIIGFD  114

Query  731   PKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNV  910
              KSATA+SKCMI G A ++V+YNLKLRHPTL++P+IDYDLA+L QPML+LGISIGV  NV
Sbjct  115   TKSATAMSKCMITGGAAATVYYNLKLRHPTLELPVIDYDLALLFQPMLVLGISIGVALNV  174

Query  911   IFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQ---GEYKL  1081
             IFA+WM+T+LLIVLFI TSTKAF +GVETWKKET  KKEA + L +N    +   GE   
Sbjct  175   IFANWMITILLIVLFIVTSTKAFFKGVETWKKETKTKKEATRSLESNDDRNEEVDGEPP-  233

Query  1082  LPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYW  1261
              PGGP  G Q   KE   +QVSII+N+YW E  LL  VW+  LALQI KNY++TCS  YW
Sbjct  234   -PGGPTVGAQTETKEYKREQVSIIKNIYWWELALLVAVWLIILALQIGKNYSTTCSVAYW  292

Query  1262  VVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggll  1441
             ++N+LQIPV+ GV+ +EA  LYKG RKI+SKGD+ +N +  QL++YCF G++AG+VGG+L
Sbjct  293   LLNILQIPVAFGVSSYEAFNLYKGRRKIASKGDAVTNWKIRQLVLYCFIGLLAGIVGGML  352

Query  1442  glgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavat  1621
             GLGGGFI+GPLFLE+G+PPQVSSATATF+MMFS+SMSVVEYYLLKRFPVPYAL+  AVAT
Sbjct  353   GLGGGFILGPLFLEMGIPPQVSSATATFSMMFSASMSVVEYYLLKRFPVPYALYFFAVAT  412

Query  1622  vaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFEN  1801
             +AA +GQHV+R+LI++LGRASLIIF LAFTIFVSAI LGGVGI+ M+ +I   EYMGFEN
Sbjct  413   LAALVGQHVIRKLISILGRASLIIFTLAFTIFVSAILLGGVGIARMVRRIERKEYMGFEN  472

Query  1802  LC  1807
             +C
Sbjct  473   IC  474



>gb|AFK35007.1| unknown [Medicago truncatula]
Length=473

 Score =   437 bits (1123),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 278/470 (59%), Positives = 360/470 (77%), Gaps = 29/470 (6%)
 Frame = +2

Query  428   LSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEME  607
             +SWS ++      AER L++E+     + + S          F W   ES Y+ +WPEM+
Sbjct  21    VSWSLIMIYHVSLAERVLEDEKPEIVVMKKTS----------FFWYSGESSYERVWPEMK  70

Query  608   LGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSS  787
              GW IV+GSI+GF GAA GSVGGVGGGGIF+PML+L++GFDPKS+TA+SKCMI GAA S+
Sbjct  71    FGWRIVVGSIVGFFGAALGSVGGVGGGGIFIPMLTLIIGFDPKSSTALSKCMITGAAGST  130

Query  788   VHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTS  967
             V+ NL+LRHPTLDMP+IDYDLA+L QPMLMLGISIGV FNV+FADWMVT+LLI+LFIGTS
Sbjct  131   VYCNLRLRHPTLDMPLIDYDLALLFQPMLMLGISIGVAFNVMFADWMVTILLIILFIGTS  190

Query  968   TKAFLRGVETWKKETIMKKEA---AQQLAANGS----GGQGEYKLLPGGPGNGTQDTAKE  1126
             TKA ++G++TWKKE IMKKEA   A Q+  +GS      + +YK LP            +
Sbjct  191   TKALVKGIDTWKKEAIMKKEAFEEAAQMLESGSTPDYASEEDYKSLPA-----------D  239

Query  1127  SSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVAL  1306
               +++V +++N++WKE  +L +VWV+FL +QI+K Y+ TCS  YW++N LQ+P+++ V L
Sbjct  240   LQDEEVPLLDNIHWKELSVLMYVWVAFLIVQILKTYSKTCSIEYWLLNSLQVPIAISVTL  299

Query  1307  FEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflEL  1486
             FEA  L KG R I+S+G      +  ++ +YCF G+IAG+V GLLGLGGGFI+GPLFLEL
Sbjct  300   FEAICLCKGTRVIASRGKE-ITWKFHKICLYCFCGIIAGMVSGLLGLGGGFILGPLFLEL  358

Query  1487  GVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIA  1666
             G+PPQV+SAT+TFAM+FSSSMSVV+YY L RFP+PYA +L  VAT+AA  GQHVVR++IA
Sbjct  359   GIPPQVASATSTFAMVFSSSMSVVQYYHLDRFPIPYASYLVLVATIAALTGQHVVRKIIA  418

Query  1667  VLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  1816
             + GRAS+I+FILAFTIFVSAISLGGVGI NM+EK+ N EYMGF+NLC +G
Sbjct  419   IFGRASIIVFILAFTIFVSAISLGGVGIGNMVEKMENAEYMGFDNLCHHG  468



>ref|XP_011011433.1| PREDICTED: uncharacterized protein LOC105116005 isoform X1 [Populus 
euphratica]
Length=497

 Score =   437 bits (1125),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 303/482 (63%), Positives = 369/482 (77%), Gaps = 14/482 (3%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVA-LSWSFLLASAFVSAERSLKNE--EVAGTNVSRNSDDDYLSTFV  550
             MA    K  +L+ L A LS S +     V AE SL  E     GT   R          +
Sbjct  23    MARIQAKHLVLKLLGAILSGSLVAVLILVLAEPSLTQEGSRTGGTESHRAMR------ML  76

Query  551   NFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFD  730
             + + +    GY H+WPEM  GW+IV+GSIIGF GAA GSVGGVGGGGIFVPMLSL++GFD
Sbjct  77    SLVREKGRVGYTHVWPEMRFGWKIVMGSIIGFFGAACGSVGGVGGGGIFVPMLSLIIGFD  136

Query  731   PKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNV  910
              KSATA+SKCMI G A ++V+YNLKLRHPTL++P+IDYDLA+L QPML+LGISIGV  NV
Sbjct  137   TKSATAMSKCMITGGAAATVYYNLKLRHPTLELPVIDYDLALLFQPMLVLGISIGVALNV  196

Query  911   IFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQ---GEYKL  1081
             IFA+WM+T+LLIVLFI TSTKAF +GVETWKKET  KKEA + L +N    +   GE   
Sbjct  197   IFANWMITILLIVLFIVTSTKAFFKGVETWKKETKTKKEATRSLESNDDRNEEVDGEPP-  255

Query  1082  LPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYW  1261
              PGGP  G Q   KE   +QVSII+N+YW E  LL  VW+  LALQI KNY++TCS  YW
Sbjct  256   -PGGPTVGAQTETKEYKREQVSIIKNIYWWELALLVAVWLIILALQIGKNYSTTCSVAYW  314

Query  1262  VVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggll  1441
             ++N+LQIPV+ GV+ +EA  LYKG RKI+SKGD+ +N +  QL++YCF G++AG+VGG+L
Sbjct  315   LLNILQIPVAFGVSSYEAFNLYKGRRKIASKGDAVTNWKIRQLVLYCFIGLLAGIVGGML  374

Query  1442  glgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavat  1621
             GLGGGFI+GPLFLE+G+PPQVSSATATF+MMFS+SMSVVEYYLLKRFPVPYAL+  AVAT
Sbjct  375   GLGGGFILGPLFLEMGIPPQVSSATATFSMMFSASMSVVEYYLLKRFPVPYALYFFAVAT  434

Query  1622  vaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFEN  1801
             +AA +GQHV+R+LI++LGRASLIIF LAFTIFVSAI LGGVGI+ M+ +I   EYMGFEN
Sbjct  435   LAALVGQHVIRKLISILGRASLIIFTLAFTIFVSAILLGGVGIARMVRRIERKEYMGFEN  494

Query  1802  LC  1807
             +C
Sbjct  495   IC  496



>ref|XP_003629468.1| hypothetical protein MTR_8g077830 [Medicago truncatula]
Length=480

 Score =   436 bits (1121),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 280/477 (59%), Positives = 362/477 (76%), Gaps = 36/477 (8%)
 Frame = +2

Query  428   LSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEME  607
             +SWS ++      AER L++E+     + + S          F W   ES Y+ +WPEM+
Sbjct  21    VSWSLIMIYHVSLAERVLEDEKPEIVVMKKTS----------FFWYSGESSYERVWPEMK  70

Query  608   LGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSS  787
              GW IV+GSI+GF GAA GSVGGVGGGGIF+PML+L++GFDPKS+TA+SKCMI GAA S+
Sbjct  71    FGWRIVVGSIVGFFGAALGSVGGVGGGGIFIPMLTLIIGFDPKSSTALSKCMITGAAGST  130

Query  788   VHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIG--  961
             V+YNL+LRHPTLDMP+IDYDLA+L QPMLMLGISIGV FNV+FADWMVT+LLI+LFIG  
Sbjct  131   VYYNLRLRHPTLDMPLIDYDLALLFQPMLMLGISIGVAFNVMFADWMVTILLIILFIGNN  190

Query  962   -----TSTKAFLRGVETWKKETIMKKEA---AQQLAANGS----GGQGEYKLLPGGPGNG  1105
                  TSTKA ++G++TWKKETIMKKEA   A Q+  +GS      + +YK LP      
Sbjct  191   HYLFSTSTKALVKGIDTWKKETIMKKEAFEEAAQMLESGSTPDYASEEDYKSLPA-----  245

Query  1106  TQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIP  1285
                   +  +++V +++N++WKE  +L +VWV+FL +QI+K Y+ TCS  YW++N LQ+P
Sbjct  246   ------DLQDEEVPLLDNIHWKELSVLMYVWVAFLIVQILKTYSKTCSIEYWLLNSLQVP  299

Query  1286  VSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfim  1465
             +++ V LFEA  L KG R I+S+G      +  ++ +YCF G+IAG+V GLLGLGGGFI+
Sbjct  300   IAISVTLFEAICLCKGTRVIASRGKE-ITWKFHKICLYCFCGIIAGMVSGLLGLGGGFIL  358

Query  1466  gplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQH  1645
             GPLFLELG+PPQV+SAT+TFAM+FSSSMSVV+YY L RFP+PYA +L  VAT+AA  GQH
Sbjct  359   GPLFLELGIPPQVASATSTFAMVFSSSMSVVQYYHLDRFPIPYASYLVLVATIAALTGQH  418

Query  1646  VVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  1816
             VVR++IA+ GRAS+I+FILAFTIFVSAISLGGVGI NM+EK+ N EYMGF+NLC +G
Sbjct  419   VVRKIIAIFGRASIIVFILAFTIFVSAISLGGVGIGNMVEKMENEEYMGFDNLCHHG  475



>ref|XP_007024174.1| Sulfite exporter TauE/SafE family protein, putative isoform 1 
[Theobroma cacao]
 gb|EOY26796.1| Sulfite exporter TauE/SafE family protein, putative isoform 1 
[Theobroma cacao]
Length=486

 Score =   436 bits (1121),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 290/477 (61%), Positives = 373/477 (78%), Gaps = 4/477 (1%)
 Frame = +2

Query  386   GAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQ  565
             G   +WR++     L     +    V+AE  L ++ V+G N     + +Y+   + FL  
Sbjct  11    GRSNQWRLISTAFVLIGFLAVDLVLVTAEPRL-SQAVSGYN--ETQEKNYVRKALKFLEL  67

Query  566   PKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSAT  745
               +  Y+H WP+M  GW+IV+GSI+GF+GAAFGSVGGVGGGGIFVPML+L++GFDPKS+T
Sbjct  68    NSKPRYEHEWPDMRFGWKIVVGSILGFVGAAFGSVGGVGGGGIFVPMLALIIGFDPKSST  127

Query  746   AISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADW  925
             AISKCMI GAA ++V YN++ RHPTL++P+IDYDLA+L QPML+LGISIGV FNVIFADW
Sbjct  128   AISKCMITGAAAATVCYNIRQRHPTLELPLIDYDLALLFQPMLVLGISIGVGFNVIFADW  187

Query  926   MVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQG-EYKLLPGGPGN  1102
             M+T+LLI+LFIG STK+F +GV TWKKETI KKEAA+QL  NG+     E K       N
Sbjct  188   MITILLIILFIGMSTKSFFKGVGTWKKETIKKKEAARQLELNGNARDAVEIKTEHEATTN  247

Query  1103  GTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQI  1282
              TQ   KE  + +VS+IEN+ WKE GLL  VW+  LALQI KNY++TCS  YWV+N LQI
Sbjct  248   DTQTGDKELGKSKVSLIENIRWKELGLLIVVWILILALQIAKNYSTTCSVEYWVLNFLQI  307

Query  1283  PVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfi  1462
             PV++GV+ +EA  LYKG R+I+SKGD  +N R  +L++YC FG++AG++GG+LGLGGGFI
Sbjct  308   PVAVGVSSYEAVCLYKGRRRIASKGDVVANWRVHKLVIYCAFGLLAGILGGMLGLGGGFI  367

Query  1463  mgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQ  1642
             +GPLFLE+G+PPQVSSAT+TFAM+FS+SMSVVEYYLLKRFPVPYAL+L+ VAT+AAF+GQ
Sbjct  368   LGPLFLEMGIPPQVSSATSTFAMLFSASMSVVEYYLLKRFPVPYALYLSLVATIAAFVGQ  427

Query  1643  HVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             HVV ++I +LGRAS+IIFILA  IF SAISLGG+GI+ MI++I   EYMGF+++C Y
Sbjct  428   HVVGKVIKILGRASIIIFILAGMIFGSAISLGGLGIAKMIKRIERKEYMGFDDICSY  484



>ref|XP_008795085.1| PREDICTED: uncharacterized protein LOC103710932 [Phoenix dactylifera]
Length=411

 Score =   433 bits (1113),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 281/407 (69%), Positives = 330/407 (81%), Gaps = 14/407 (3%)
 Frame = +2

Query  395   GKWRI--LRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSD---DDYLSTFVNFL  559
             GKWR   L P+V +  SFLL +A  SAER  K+E  +G +VS   +    DYL   VNFL
Sbjct  3     GKWRKKWLWPVVVICLSFLLTAAMASAERGPKSE-ASGDDVSVEEEMGASDYLLKAVNFL  61

Query  560   WQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKS  739
             WQP ES Y H+WP M  GW+I++GSIIGF GAAFGSVGGVGGGGIFVPML+L++GFDPKS
Sbjct  62    WQPNESSYHHVWPPMRFGWKIIMGSIIGFFGAAFGSVGGVGGGGIFVPMLTLIIGFDPKS  121

Query  740   ATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFA  919
             +TAISKCMIMGAA S+V+ NLKLRHPTLDMPIIDYDLA+L QPMLMLGISIGV FNV+FA
Sbjct  122   STAISKCMIMGAAGSTVYCNLKLRHPTLDMPIIDYDLALLFQPMLMLGISIGVAFNVVFA  181

Query  920   DWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPG  1099
             DWMVTVLLI+LF+GTS+KAF++GVETWKKET++KKEAA+    NGS  + EYK +P GPG
Sbjct  182   DWMVTVLLILLFLGTSSKAFMKGVETWKKETLLKKEAAKLADTNGS-EKIEYKAVPTGPG  240

Query  1100  NGTQDTAKESSEKQ--VSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNL  1273
             N     AKE   +Q  VS+++NV WKE GLL FVW++FLALQI+K YTS CS  YW++NL
Sbjct  241   N-----AKELKTRQLEVSVLQNVCWKELGLLMFVWMAFLALQIMKEYTSNCSKSYWILNL  295

Query  1274  LQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgg  1453
             LQIPVS+ V  +EA  LY+G R I+SKGD G+N R  QL +YC  G++AG+VGGLLGLGG
Sbjct  296   LQIPVSVVVTSYEAVSLYRGKRVIASKGDEGTNWRVLQLFLYCATGVLAGMVGGLLGLGG  355

Query  1454  gfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPY  1594
             GFI+GPLFLELG+PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPY
Sbjct  356   GFILGPLFLELGIPPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPY  402



>gb|KEH35984.1| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=419

 Score =   432 bits (1111),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 269/382 (70%), Positives = 315/382 (82%), Gaps = 13/382 (3%)
 Frame = +2

Query  461   VSAERSLKNEEVAGTNVS---RNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIG  631
             VS ER L   ++   NV+   +  +  +L+  VNFLW+   SGY H+WPEME GW+IV+G
Sbjct  23    VSGERKLVKIQLPSFNVTTQPQKHEQSFLTKAVNFLWKSDGSGYQHVWPEMEFGWQIVLG  82

Query  632   SIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLR  811
             S IGF GAAFGSVGGVGGGGIFVPMLSL++GFDPKS+TAISKCMIMGAA+S+V+YNL+LR
Sbjct  83    SFIGFCGAAFGSVGGVGGGGIFVPMLSLIIGFDPKSSTAISKCMIMGAALSTVYYNLRLR  142

Query  812   HPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGV  991
             HPTLDMPIIDYDLA+LIQPMLMLGISIGV FNV+F DW+VT+LLIVLF+GTSTKAF +G+
Sbjct  143   HPTLDMPIIDYDLALLIQPMLMLGISIGVVFNVVFPDWLVTILLIVLFLGTSTKAFFKGL  202

Query  992   ETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWK  1171
             ETW KETIMKKEAA++  +NGS   GEYK LP GP    +       E +VSIIENVYWK
Sbjct  203   ETWNKETIMKKEAARRQESNGS---GEYKALPTGPNVAIEK------ENKVSIIENVYWK  253

Query  1172  EFGLLCFVWVSFLALQIVK-NYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKIS  1348
             EFGLL FVW+SFLALQI K NYT+TCS  YW++NLLQIP+++GV  +EAT L+ G R I+
Sbjct  254   EFGLLAFVWISFLALQIAKQNYTTTCSAAYWILNLLQIPIAVGVTAYEATALFTGRRVIA  313

Query  1349  SKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfa  1528
             S GD G     GQL++YC FG++AG+VGGLLGLGGGF+MGPLFLELGVPPQVSSATATFA
Sbjct  314   STGDQGKAFTVGQLVIYCVFGVLAGIVGGLLGLGGGFVMGPLFLELGVPPQVSSATATFA  373

Query  1529  mmfsssmsVVEYYLLKRFPVPY  1594
             M FSSSMSVVEYYLLKRFPVPY
Sbjct  374   MTFSSSMSVVEYYLLKRFPVPY  395



>ref|XP_009784620.1| PREDICTED: uncharacterized protein LOC104233015 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009784621.1| PREDICTED: uncharacterized protein LOC104233015 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009784622.1| PREDICTED: uncharacterized protein LOC104233015 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009784623.1| PREDICTED: uncharacterized protein LOC104233015 isoform X1 [Nicotiana 
sylvestris]
Length=483

 Score =   434 bits (1117),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 278/453 (61%), Positives = 358/453 (79%), Gaps = 1/453 (0%)
 Frame = +2

Query  458   FVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSI  637
             F SAE+      +     + + +  Y     N + Q  +  Y H WPE+E GW +++GS+
Sbjct  29    FASAEQIGIRGSLDKNGTADDFESGYFVKLFNLMLQKGKMHYHHFWPELEFGWRVIVGSV  88

Query  638   IgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHP  817
             IGF  AAFGSVGGVGGGGIFVPML+L++GFDPK++TAISKCMI GAA ++V+YNLKLRHP
Sbjct  89    IGFFAAAFGSVGGVGGGGIFVPMLTLIIGFDPKTSTAISKCMITGAAGATVYYNLKLRHP  148

Query  818   TLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVET  997
             TLD+PIIDYDLA+L+QPML+LGISIGV  N +FADWMVTVLLI+LFI TSTK+F +GVET
Sbjct  149   TLDLPIIDYDLALLLQPMLLLGISIGVVLNTLFADWMVTVLLIILFIATSTKSFFKGVET  208

Query  998   WKKETIMKKEAAQQLAANGSG-GQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKE  1174
             WKKETI+KKE +++LA++ +G G   YKLLPGGP NG +         +VSI+ENVYWK+
Sbjct  209   WKKETIIKKEVSRRLASSNAGAGDATYKLLPGGPTNGVRVRNDGYKTPEVSIVENVYWKD  268

Query  1175  FGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSK  1354
             F ++  VWV  L L + KNYT TCST YW++NLLQ+PV++G + +EA  LYKG R + S 
Sbjct  269   FAVILAVWVILLLLHLFKNYTPTCSTTYWILNLLQVPVAVGASAYEAVCLYKGTRVVMSS  328

Query  1355  GDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfamm  1534
             G++    +  QLI+YC  G++AG+VGGLLGLGGGFI+GPLFLELG+PPQVSSATATF M+
Sbjct  329   GEAVITWKVHQLILYCCCGILAGIVGGLLGLGGGFILGPLFLELGIPPQVSSATATFVMI  388

Query  1535  fsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTI  1714
             FSSSMS ++YYLL+RFPVPYAL+  AVATVAA +GQHVVR++I+++GRAS+IIF+LAFTI
Sbjct  389   FSSSMSAIQYYLLRRFPVPYALYFVAVATVAALVGQHVVRKIISIVGRASVIIFVLAFTI  448

Query  1715  FVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             FVSA++LGG GI++ I +I   +YMGF+N+C Y
Sbjct  449   FVSALTLGGFGIADTIRRIKEGQYMGFDNICAY  481



>ref|XP_009613204.1| PREDICTED: uncharacterized protein LOC104106373 [Nicotiana tomentosiformis]
Length=483

 Score =   433 bits (1114),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 287/481 (60%), Positives = 370/481 (77%), Gaps = 3/481 (1%)
 Frame = +2

Query  380   MAGAGGKWRIL-RPLVALSWSFLLASA-FVSAERSLKNEEVAGTNVSRNSDDDYLSTFVN  553
             MA  G K + L R +V +    +LA A F SAE+      +     + + +  Y     N
Sbjct  1     MAEIGLKLKALTRYVVGVIGFLVLAFALFASAEQIGNRRSLDKNGTAVDFESGYFVKLFN  60

Query  554   FLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDP  733
              + Q  +  Y H WPE E GW +++GS+IGF  AAFGSVGGVGGGGIFVPML+L++GFDP
Sbjct  61    LMLQKGKMHYHHFWPEFEFGWRVIVGSVIGFFAAAFGSVGGVGGGGIFVPMLTLIIGFDP  120

Query  734   KSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVI  913
             K++TAISKCMI GAA ++V+YNLKLRHPTLD+PIIDYDLA+L+QPML+LGISIGV  N +
Sbjct  121   KTSTAISKCMITGAAGATVYYNLKLRHPTLDLPIIDYDLALLLQPMLLLGISIGVVLNTL  180

Query  914   FADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQ-GEYKLLPG  1090
             FADWMVTVLLIVLFI TSTK+F +GVETWKKETI+KKE +++L +  +G +   YKLLPG
Sbjct  181   FADWMVTVLLIVLFIVTSTKSFFKGVETWKKETIIKKEVSRRLTSRNAGAEDATYKLLPG  240

Query  1091  GPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVN  1270
             GP NG +   +     +VSI+ENVYWK+F ++  VWV  L L + KNYT TCST YW++N
Sbjct  241   GPTNGVRVRIEGYKTPEVSIVENVYWKDFTIILTVWVILLLLHLFKNYTPTCSTAYWILN  300

Query  1271  LLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglg  1450
             LLQ+PV++G + +EA  LYKG R + S G++    +  QLI+YC  G++AG+VGGLLGLG
Sbjct  301   LLQVPVAVGASAYEAVCLYKGTRMVMSSGEAVLTWKVHQLILYCCCGILAGIVGGLLGLG  360

Query  1451  ggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaa  1630
             GGFI+GPLFLELG+PPQVSSATATF M+FSSSMS ++YYLLKRFPVPYAL+  AVATVAA
Sbjct  361   GGFILGPLFLELGIPPQVSSATATFVMIFSSSMSAIQYYLLKRFPVPYALYFVAVATVAA  420

Query  1631  fIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  1810
              +GQHVVR++I+++GRAS+IIF+LAFTIF+SA++LGG GI++ I +I   +YMGF+N+C 
Sbjct  421   LVGQHVVRKIISIVGRASVIIFVLAFTIFISALTLGGFGIADTIRRIKEGQYMGFDNICA  480

Query  1811  Y  1813
             Y
Sbjct  481   Y  481



>ref|XP_002299704.2| hypothetical protein POPTR_0001s18300g [Populus trichocarpa]
 gb|EEE84509.2| hypothetical protein POPTR_0001s18300g [Populus trichocarpa]
Length=475

 Score =   432 bits (1112),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 305/480 (64%), Positives = 369/480 (77%), Gaps = 10/480 (2%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVA-LSWSFLLASAFVSAERSLKNE--EVAGTNVSRNSDDDYLSTFV  550
             MA    K  +L+ L A LS S +     V AE SL  E     GT   R          +
Sbjct  1     MARIQAKHWVLKLLGAILSGSLVAVLILVLAEPSLTQEGSRTGGTESHRAMR------ML  54

Query  551   NFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFD  730
             + + +    GY H+WPEM  GW+IV+GSIIGF GAA GSVGGVGGGGIFVPMLSL++GFD
Sbjct  55    SLVREKGRVGYTHVWPEMRFGWKIVLGSIIGFFGAACGSVGGVGGGGIFVPMLSLIIGFD  114

Query  731   PKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNV  910
              KSATA+SKCMI G A ++V+YNLKLRHPTL++PIIDYDLA+L QPML+LGISIGV  NV
Sbjct  115   TKSATAMSKCMITGGAAATVYYNLKLRHPTLELPIIDYDLALLFQPMLVLGISIGVALNV  174

Query  911   IFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQG-EYKLLP  1087
             IFA+WM+T+LLIVLFI TSTKAF +GVETWKKET  KKEA + L +N    +  E +  P
Sbjct  175   IFANWMITILLIVLFIVTSTKAFFKGVETWKKETKTKKEATRSLESNDDRNEEVEGEPPP  234

Query  1088  GGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVV  1267
              GP  G Q   KE  ++QVSII+NVYW E  LL  VW+  LALQI KNY++TCS  YW++
Sbjct  235   VGPTVGAQTETKEYKKEQVSIIKNVYWWELSLLVAVWLIILALQIGKNYSTTCSMAYWLL  294

Query  1268  NLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllgl  1447
             N+LQIPV+ GV+ +EA  LYKG RKI+SKGD+ +N +  QL++YC  G++AGVVGG+LGL
Sbjct  295   NILQIPVAFGVSSYEAFNLYKGRRKIASKGDAVTNWKIRQLVLYCIIGLLAGVVGGMLGL  354

Query  1448  gggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatva  1627
             GGGFI+GPLFLE+G+PPQVSSATATFAMMFS+SMSVVEYYLLKRFPVPYAL+  AVATVA
Sbjct  355   GGGFILGPLFLEMGIPPQVSSATATFAMMFSASMSVVEYYLLKRFPVPYALYFFAVATVA  414

Query  1628  afIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             A +GQHV+R+LI++LGRASLIIF LAFTIFVSAI LGGVGI+ M+++I   EYMGFEN+C
Sbjct  415   ALVGQHVIRKLISILGRASLIIFTLAFTIFVSAILLGGVGIARMVKRIERKEYMGFENIC  474



>ref|XP_009611253.1| PREDICTED: uncharacterized protein LOC104104795 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009611254.1| PREDICTED: uncharacterized protein LOC104104795 isoform X1 [Nicotiana 
tomentosiformis]
Length=482

 Score =   432 bits (1111),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 270/480 (56%), Positives = 357/480 (74%), Gaps = 2/480 (0%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASA--FVSAERSLKNEEVAGTNVSRNSDDDYLSTFVN  553
             MA  G K + L         FL+ S+  F SAE+      ++    + + +  Y+    N
Sbjct  1     MAETGAKLKALTTYAVAVIGFLILSSNVFASAEQISDRITLSNNGTTHDFESGYVFNLFN  60

Query  554   FLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDP  733
              L Q  E  Y H+WPE+++GW +++GSIIGF  AA GSVGGVGGGGIFVPML+L++GFDP
Sbjct  61    ILRQKAEMHYHHVWPELQVGWRVIVGSIIGFFAAALGSVGGVGGGGIFVPMLTLIIGFDP  120

Query  734   KSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVI  913
             K++TAISKCMI GAA ++V+YNLKLRHPT+DMPIIDY+LA+L QPML+LGISIGV  NV+
Sbjct  121   KTSTAISKCMITGAAGATVYYNLKLRHPTMDMPIIDYNLALLFQPMLLLGISIGVVLNVL  180

Query  914   FADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGG  1093
             FA+WMVTVLLI+LFI  STKAF +GVETWK+ETI+KK  A +L +   G +  YKLLP G
Sbjct  181   FAEWMVTVLLIILFIAASTKAFSKGVETWKRETIIKKGVAGRLTSGAGGEEVAYKLLPEG  240

Query  1094  PGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNL  1273
               +G++   +     +V I +NVYWK+   L  VWV  L L I KNY+STCS  YW +NL
Sbjct  241   ANDGSRVEKEVYKAPEVPIDDNVYWKDITALVSVWVVILVLHISKNYSSTCSVTYWSLNL  300

Query  1274  LQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgg  1453
             LQ+PV++G ++++A  LYKG R I S  D+    +  QLI+ C  G++AG+VGGLLGLGG
Sbjct  301   LQVPVAVGASVYQAVCLYKGSRVIMSSRDAVIIWKVHQLILCCCCGILAGIVGGLLGLGG  360

Query  1454  gfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaaf  1633
             GFI+GPL LELG+PPQVSSAT TF M FSSSMS ++YYLL+RFP+PYAL+   V T+AAF
Sbjct  361   GFILGPLLLELGIPPQVSSATTTFVMTFSSSMSAIQYYLLRRFPIPYALYFVTVTTIAAF  420

Query  1634  IGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             +GQ+VVR++I+++GRAS+IIF+LAFTIFVSA+SLGGVGI + I+K+   +++GF+++C Y
Sbjct  421   VGQNVVRKIISIVGRASVIIFVLAFTIFVSALSLGGVGILDTIKKVEKGQHIGFDDICAY  480



>gb|EPS70855.1| hypothetical protein M569_03905 [Genlisea aurea]
Length=444

 Score =   430 bits (1106),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 293/484 (61%), Positives = 346/484 (71%), Gaps = 46/484 (10%)
 Frame = +2

Query  380   MAGAGGKW-RILRPLVALSWSFLLASAFVSAERSLKNEEV----AGTNVSRNSDDDYLST  544
             MA     W +   P  +L  SFL  S  VSAERSL           + VS +  DDY   
Sbjct  1     MAANTESWSKSFAPFFSLLLSFLCTSLCVSAERSLMMRRSFSSRPDSTVSLSPADDY---  57

Query  545   FVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVG  724
                        GY H+WP+    W +V+GSIIGF+GAAFGSVGGVGGGGIFVPML+L++G
Sbjct  58    -----------GYQHVWPDFAFNWRLVVGSIIGFLGAAFGSVGGVGGGGIFVPMLTLIIG  106

Query  725   FDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTF  904
             FD KSATAISKCMIMGAA S+VHYNLKL+HPTLDMPIIDYDLAVLIQPMLMLG       
Sbjct  107   FDAKSATAISKCMIMGAAASTVHYNLKLKHPTLDMPIIDYDLAVLIQPMLMLG-------  159

Query  905   NVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLL  1084
                                TSTK+FL+GVETWKKETI  KEA  +L  +G   + E   L
Sbjct  160   -------------------TSTKSFLKGVETWKKETITIKEAENRLKRSGGDEEAESMHL  200

Query  1085  PGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWV  1264
              G P N   D +    E +VS++ENV W E  LL FVW SFLA+QI+KNYT TCS ++W 
Sbjct  201   TGKPSNSKSDKSDNLDEPEVSVLENVRWNELRLLFFVWFSFLAVQIIKNYTPTCSAIFWF  260

Query  1265  VNLLQIPVSLGVALFEATGLYKGWRKISSK-GDSGSNLRAGQLIVYCFFgmiagvvggll  1441
             VNLLQIPVS+GV+ +EA  LY GW++I SK  D  +  +  QL++YC FG++AGVVGGLL
Sbjct  261   VNLLQIPVSVGVSGYEAVRLYLGWKRIGSKVDDETTTFKPRQLVIYCSFGIVAGVVGGLL  320

Query  1442  glgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavat  1621
             G+GGGFIMGPLFLELGVPPQVSSATATF MMFS+SMSVVEY+LL RFPVPYAL+L  VAT
Sbjct  321   GIGGGFIMGPLFLELGVPPQVSSATATFIMMFSASMSVVEYHLLNRFPVPYALYLFVVAT  380

Query  1622  vaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFEN  1801
             +AA++GQHVVRR+IAV+GRAS+IIF+L+FTIFVSA+SLGG GIS ++ KI  HEYMGF N
Sbjct  381   IAAYVGQHVVRRIIAVMGRASIIIFVLSFTIFVSAVSLGGFGISKIVAKIRWHEYMGFGN  440

Query  1802  LCKY  1813
             LCKY
Sbjct  441   LCKY  444



>gb|ACJ85296.1| unknown [Medicago truncatula]
Length=474

 Score =   428 bits (1101),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 276/471 (59%), Positives = 358/471 (76%), Gaps = 30/471 (6%)
 Frame = +2

Query  428   LSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEME  607
             +SWS ++      AER L++E+     + + S          F W   ES Y+ +WPEM+
Sbjct  21    VSWSLIMIYHVSLAERVLEDEKPEIVVMKKTS----------FFWYSGESSYERVWPEMK  70

Query  608   LGWEIVIGSIIgfmgaafgsvggvgg-ggIFVPMLSLVVGFDPKSATAISKCMIMGAAVS  784
              GW IV+GSI+GF GAA GSVGGVGG  GIF+PML+L++GFDPKS+TA+SKCMI GAA S
Sbjct  71    FGWRIVVGSIVGFFGAALGSVGGVGGWKGIFIPMLTLIIGFDPKSSTALSKCMITGAAGS  130

Query  785   SVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGT  964
             +V+ NL+LRHPTLDMP+IDYDLA+L QPMLMLGISIGV FNV+FADWMVT+LLI+LFIGT
Sbjct  131   TVYCNLRLRHPTLDMPLIDYDLALLFQPMLMLGISIGVAFNVMFADWMVTILLIILFIGT  190

Query  965   STKAFLRGVETWKKETIMKKEA---AQQLAANGS----GGQGEYKLLPGGPGNGTQDTAK  1123
             STKA ++G++TWKKE IMKKEA   A Q+  +GS      + +YK LP            
Sbjct  191   STKALVKGIDTWKKEAIMKKEAFEEAAQMLESGSTPDYASEEDYKSLPA-----------  239

Query  1124  ESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVA  1303
             +  +++V +++N++WKE  +L +VWV+FL +QI+K Y+ TCS  YW++N LQ+P+++ V 
Sbjct  240   DLQDEEVPLLDNIHWKELSVLMYVWVAFLIVQILKTYSKTCSIEYWLLNSLQVPIAISVT  299

Query  1304  LFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflE  1483
             LFEA  L KG R I+S+G      +  ++ +YCF G+IAG+V GLLGLGGGFI+GPLFLE
Sbjct  300   LFEAICLCKGTRVIASRGKE-ITWKFHKICLYCFCGIIAGMVSGLLGLGGGFILGPLFLE  358

Query  1484  LGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLI  1663
             LG+PPQV+SAT+TFAM+FSSSMSVV+YY L RFP+PYA +L  VAT+AA  GQHVVR++I
Sbjct  359   LGIPPQVASATSTFAMVFSSSMSVVQYYHLDRFPIPYASYLVLVATIAALTGQHVVRKII  418

Query  1664  AVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  1816
             A+ GRAS+I+FILAFTIFVSAISLGGVGI NM+EK+ N EYMGF+N C +G
Sbjct  419   AIFGRASIIVFILAFTIFVSAISLGGVGIGNMVEKMENAEYMGFDNFCHHG  469



>ref|XP_006585193.1| PREDICTED: uncharacterized protein LOC100802321 [Glycine max]
Length=473

 Score =   427 bits (1099),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 286/484 (59%), Positives = 357/484 (74%), Gaps = 30/484 (6%)
 Frame = +2

Query  398   KWRILRPLVALSWSFLLASAFVSAERSLKNEEV--AGTNVSRNSDDDYLSTFVNFLWQPK  571
             KW   + LVA    FLL S +V++ +   +++   + +N ++  D               
Sbjct  12    KWVAEKVLVA----FLLVSVYVASSQQNTDQKTISSASNETKGVDTKA---------HHA  58

Query  572   ESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAI  751
             E  Y H WPEM+ GW+I++GSIIGF+G+AFG+VGGVGGGGIFVPML+L++GFD +SATAI
Sbjct  59    EGFYKHTWPEMKFGWKIIVGSIIGFLGSAFGTVGGVGGGGIFVPMLTLIIGFDARSATAI  118

Query  752   SKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMV  931
             SKCMI G A +++ YNLK RHPTLDMP+IDYDLA+L QPMLMLGISIGV FNVIF DWM+
Sbjct  119   SKCMITGGAGATIFYNLKQRHPTLDMPVIDYDLALLFQPMLMLGISIGVAFNVIFPDWML  178

Query  932   TVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQ  1111
             T LLIV+FIG S  AF +GV+TWKKETI+ KEA Q +  N +   G            T+
Sbjct  179   TALLIVVFIGLSFNAFFKGVKTWKKETIVNKEARQNVRLNDTERTGN------AAHPQTE  232

Query  1112  DTAKES------SEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNL  1273
             +TA ES      S K+VS+IEN+YWKE G+L  VW+  LALQI KNYT+ CS LYW +NL
Sbjct  233   ETANESHTNTNQSRKKVSVIENIYWKELGILVSVWILILALQIGKNYTTNCSALYWALNL  292

Query  1274  LQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgg  1453
             LQ+P+++G  ++EA  LYKG RKI+SKGD  +  R  QLI+YC  G+IAG++GGLLGLGG
Sbjct  293   LQVPITVGTTVYEAVLLYKGKRKIASKGDQQTRWRVHQLILYCTCGIIAGIIGGLLGLGG  352

Query  1454  gfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaaf  1633
             GFI+GPLF+ LG+ PQVSSAT+TFAM FS+SMSVVEYYLLKRFP+PYAL+  AVAT AA 
Sbjct  353   GFILGPLFIGLGIHPQVSSATSTFAMTFSASMSVVEYYLLKRFPIPYALYFVAVATAAAL  412

Query  1634  IGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             +GQH+VR++IA+LGR SLIIFILA T+FVS ISLGGVGI+ +IEK      M FENLC Y
Sbjct  413   VGQHLVRKVIAILGRTSLIIFILALTVFVSGISLGGVGIAKLIEK---KVQMKFENLCSY  469

Query  1814  GV*N  1825
              V N
Sbjct  470   RVRN  473



>ref|XP_004504238.1| PREDICTED: uncharacterized protein LOC101507523 [Cicer arietinum]
Length=468

 Score =   427 bits (1097),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 279/472 (59%), Positives = 355/472 (75%), Gaps = 13/472 (3%)
 Frame = +2

Query  413   RPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHI  592
             + ++ + +  +L SA+V++     +++   TN ++  D +Y      F        Y H 
Sbjct  9     KRVLVICFLLILLSAYVTSSHQYTDQK---TNETKGVDGNYNHHAKVF--------YKHT  57

Query  593   WPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMG  772
             WP M+ GW I++G+IIGF+G++FG+VGGVGGGGIFVPML+LV+GFD KSATAISK MI G
Sbjct  58    WPGMKFGWRIIVGTIIGFLGSSFGTVGGVGGGGIFVPMLTLVIGFDAKSATAISKFMITG  117

Query  773   AAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVL  952
              A ++V YNLK RHP+LD+P+IDYDLA+L QPMLMLGIS+GV FNVIF DWM+T LLI+ 
Sbjct  118   GAGATVFYNLKKRHPSLDLPVIDYDLALLFQPMLMLGISLGVAFNVIFPDWMITTLLIIF  177

Query  953   FIGTSTKAFLRGVETWKKETIMKKEAAQQLAAN-GSGGQGEYKLLPGGPGNGTQDTAKES  1129
             F G S  AFL+GV TWKKET+ KKEA + L  N     +G   L  G   N +Q T    
Sbjct  178   FTGISVNAFLKGVNTWKKETLTKKEARENLQLNVRRTEEGALDLQAGESVNESQ-TNTNL  236

Query  1130  SEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALF  1309
               K VS++ENVYWKE GLL  VW+  LALQI KNYT+TCS  YW++NLLQ+P+++GV+ +
Sbjct  237   PRKNVSVMENVYWKELGLLFSVWIMILALQIGKNYTTTCSVAYWILNLLQVPITVGVSSY  296

Query  1310  EATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELG  1489
             EA  LYKG R I+SKGD  +     QLI+YC  G++AG++GGLLGLGGGFI+GPLF+ LG
Sbjct  297   EAVLLYKGKRVIASKGDQQTQWSVQQLILYCACGIVAGIIGGLLGLGGGFILGPLFIGLG  356

Query  1490  VPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAV  1669
             +PPQVSSAT+TFAM FS+SMSVVEYYLLKRFP+ YAL+  AVATVAA IGQH+VR+LIA+
Sbjct  357   IPPQVSSATSTFAMTFSASMSVVEYYLLKRFPISYALYFVAVATVAALIGQHLVRKLIAI  416

Query  1670  LGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV*N  1825
             LGRAS+IIFILA T+FVS ISLGG GI+N+I+++ N EYMGF NLC+Y V N
Sbjct  417   LGRASIIIFILALTVFVSGISLGGTGIANLIKRVENKEYMGFGNLCEYRVRN  468



>dbj|BAG89362.1| unnamed protein product [Oryza sativa Japonica Group]
Length=349

 Score =   422 bits (1085),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 260/353 (74%), Positives = 300/353 (85%), Gaps = 4/353 (1%)
 Frame = +2

Query  761   MIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVL  940
             MIMGAAVS+V+YNLKL+HPTLDMP+IDYDLA+LIQPMLMLGISIGV FNVIF DW++TVL
Sbjct  1     MIMGAAVSTVYYNLKLKHPTLDMPVIDYDLALLIQPMLMLGISIGVLFNVIFPDWLITVL  60

Query  941   LIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTA  1120
             LI+LF+GTSTKAFL+GVETWKKETI+K+EAA++L       + EY  LP GP N T ++ 
Sbjct  61    LIILFLGTSTKAFLKGVETWKKETILKREAAKRLEQIAE--EPEYSPLPTGP-NATAES-  116

Query  1121  KESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGV  1300
             K  S++  S+ +NVYWKEFGLL FVW++FL LQ+ KNY  TCST YWV+N LQIPVS+GV
Sbjct  117   KAPSDEAASLWQNVYWKEFGLLAFVWIAFLVLQVTKNYMPTCSTWYWVLNFLQIPVSVGV  176

Query  1301  ALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplfl  1480
              ++E  GL +G R ISSKGD  +NL+  QL+VYCFFGM+AGVVGGLLGLGGGFIMGPLFL
Sbjct  177   TMYEGLGLMQGRRVISSKGDEQTNLKFHQLLVYCFFGMMAGVVGGLLGLGGGFIMGPLFL  236

Query  1481  ELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRL  1660
             ELG+PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYALF T VA  AA IGQH+VR+L
Sbjct  237   ELGIPPQVSSATATFAMMFSSSMSVVEYYLLDRFPVPYALFFTVVAFFAAIIGQHIVRKL  296

Query  1661  IAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  1819
             I  LGRASLIIFIL+F IF+SAISLGGVGISNMI KI  HEYMGF+N+C Y V
Sbjct  297   INWLGRASLIIFILSFMIFISAISLGGVGISNMIGKIARHEYMGFDNICNYDV  349



>ref|XP_004498484.1| PREDICTED: uncharacterized protein LOC101508758 isoform X2 [Cicer 
arietinum]
Length=457

 Score =   426 bits (1094),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 270/467 (58%), Positives = 357/467 (76%), Gaps = 12/467 (3%)
 Frame = +2

Query  410   LRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDH  589
             +R +V  S+  LL      A R+ K++E +   ++         +F + +     SGY+H
Sbjct  1     MRNVVLFSFILLLVLIIFCANRTPKSKEPSSWIINEAQ------SFYHHVKYNSHSGYEH  54

Query  590   IWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIM  769
             IWP+ME GW I++G++IG  GAAFGSVGGVGGGGIFVPML L++GFDPKSATAISKCM+ 
Sbjct  55    IWPDMEFGWNIIVGTLIGIFGAAFGSVGGVGGGGIFVPMLILIIGFDPKSATAISKCMVT  114

Query  770   GAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIV  949
             GAA+SSV +NLKLRHPTLD+P+IDYDL +L  P+++LGISIGV  +V+FADWM+TVLLI+
Sbjct  115   GAAISSVFFNLKLRHPTLDIPMIDYDLVLLNAPVIILGISIGVVISVVFADWMITVLLII  174

Query  950   LFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANG-SGGQGEYKLLPGGPGNGTQDTAKE  1126
             +FI TS KAFL+G++TWKKETIMKKEA + L +   S G+ EYK LP  P +G Q    +
Sbjct  175   IFIVTSMKAFLKGLDTWKKETIMKKEAIKLLESTATSSGEVEYKFLPSCPNDGPQKEILQ  234

Query  1127  SSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVAL  1306
                   +I+ N+ WK+FGLLCFVW + L LQI KNYT+TCS  YW+++LLQIPV++GV++
Sbjct  235   G-----TILSNIRWKKFGLLCFVWFAVLLLQITKNYTTTCSMTYWILSLLQIPVTVGVSM  289

Query  1307  FEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflEL  1486
             ++A GLY+G +   SK D G++     LI+     ++AG++GGLLG+G GF+MGPLF+EL
Sbjct  290   YQAIGLYQGKKITVSKQDHGTHWPLHLLILSLCCALLAGILGGLLGVGSGFVMGPLFIEL  349

Query  1487  GVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIA  1666
             G+ PQV+SATAT  M F++S+SVV+YYLL RFPVPYAL+LT VATVAA+IGQ ++ +LI 
Sbjct  350   GIAPQVASATATLGMTFTASISVVQYYLLNRFPVPYALYLTLVATVAAYIGQKIIDKLIN  409

Query  1667  VLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             +  RASLIIF+L+FTI VSAI+LGGVGIS+MIEKI  +EYMGFE+LC
Sbjct  410   IFQRASLIIFVLSFTILVSAIALGGVGISHMIEKIQRNEYMGFEDLC  456



>ref|XP_009777896.1| PREDICTED: uncharacterized protein LOC104227363 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777897.1| PREDICTED: uncharacterized protein LOC104227363 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777898.1| PREDICTED: uncharacterized protein LOC104227363 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777899.1| PREDICTED: uncharacterized protein LOC104227363 isoform X1 [Nicotiana 
sylvestris]
Length=483

 Score =   426 bits (1096),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 266/459 (58%), Positives = 354/459 (77%), Gaps = 1/459 (0%)
 Frame = +2

Query  443   LLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEI  622
             L ++ F SAE+      ++    + + +  Y+    N L    E  Y H+WPE+++GW +
Sbjct  24    LSSNVFASAEQISDRITLSNNGTTHDFESGYVFNLFNILRLKAEMHYHHVWPELQVGWRV  83

Query  623   VIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNL  802
             ++GSIIGF  AA GS GGVGGGGIFVPML+L++GFDPK++TAISKCMI GAA ++V+YNL
Sbjct  84    IVGSIIGFFAAALGSAGGVGGGGIFVPMLTLIIGFDPKTSTAISKCMITGAAGATVYYNL  143

Query  803   KLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFL  982
             KLRHPT+DM IIDY+LA+L QPML+LGISIGV  NV+FA+WM+TVLLI+LFI  STKAF 
Sbjct  144   KLRHPTMDMSIIDYNLALLFQPMLLLGISIGVVLNVLFAEWMLTVLLIILFIVASTKAFS  203

Query  983   RGVETWKKETIMKKEAAQQLAANGSGGQGE-YKLLPGGPGNGTQDTAKESSEKQVSIIEN  1159
             +GVETWK+ETI+K+E A +LA+ G+ G+   YKLLP GP N ++   K     ++ II+N
Sbjct  204   KGVETWKRETIIKEEVAGRLASGGADGEEVIYKLLPEGPDNRSRVEKKVYKASEMPIIDN  263

Query  1160  VYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWR  1339
             VYWK+   L  VWV  L L I KNY+STCS  YW++NLLQ+PV++G A+++A  LY G R
Sbjct  264   VYWKDITTLIAVWVVILVLHISKNYSSTCSVAYWILNLLQVPVAVGAAVYQAVCLYNGSR  323

Query  1340  KISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssata  1519
              I S  D+    +  QLI+ C  G++AG+VGGLLGLGGGFI+GPL LE G+PPQVSSATA
Sbjct  324   VIMSSRDAVIIWKVHQLILCCCCGILAGIVGGLLGLGGGFILGPLLLEQGIPPQVSSATA  383

Query  1520  tfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFI  1699
             TF M FSSSMSV++YYLL+RFP+PYAL+  AV+T+AAF+GQ+VVR++I+++GRAS+IIF+
Sbjct  384   TFVMTFSSSMSVIQYYLLRRFPIPYALYFVAVSTIAAFVGQNVVRKIISIVGRASVIIFV  443

Query  1700  LAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  1816
             LAFTIFVSA+SLGGVGI + I+K+   +++GF+N+C Y 
Sbjct  444   LAFTIFVSALSLGGVGILDTIKKVEEGQHIGFDNICAYN  482



>ref|XP_002516036.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46456.1| conserved hypothetical protein [Ricinus communis]
Length=466

 Score =   424 bits (1091),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 268/419 (64%), Positives = 337/419 (80%), Gaps = 10/419 (2%)
 Frame = +2

Query  572   ESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAI  751
              S Y H+WPEM +GW IV+G+IIGF GAAFGS GGVGGGGI+VPML+L++GFD KS+ AI
Sbjct  54    HSDYKHVWPEMRIGWRIVVGAIIGFFGAAFGSAGGVGGGGIYVPMLTLIIGFDAKSSIAI  113

Query  752   SKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMV  931
             SKCMI GAA S+V+YNLK RHPTL+MP+IDYDLA+L QPML+LG+SIGVTFNVIFADWM+
Sbjct  114   SKCMITGAAASTVYYNLKQRHPTLEMPVIDYDLALLFQPMLVLGVSIGVTFNVIFADWMI  173

Query  932   TVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQ  1111
             TVLLI++FI  STKAF +G++TWKKETI KK A   L  N         ++P  P     
Sbjct  174   TVLLIIIFIFMSTKAFSKGIQTWKKETIKKKIAPLLLGDNAE------VVIPTPPPEILS  227

Query  1112  DTA----KESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQ  1279
             D A    K   +++VS+IENVYWK  GLL  +W   LALQI KNYT TC+  YW+++  Q
Sbjct  228   DNAQIETKGPKKEKVSLIENVYWKALGLLLVIWFMILALQIAKNYTKTCTVPYWILDFAQ  287

Query  1280  IPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggf  1459
             IPV+  + +++A  LYKG RKI+S+G++ SN R  +L++YCF G++AG++GGLLGLGGGF
Sbjct  288   IPVAASLTIYQAVRLYKGRRKIASRGEAESNWRVHKLLLYCFSGLLAGIIGGLLGLGGGF  347

Query  1460  imgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIG  1639
             I+GPLFLE+G+PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+L AV T+A F+G
Sbjct  348   ILGPLFLEMGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYLFAVTTLAGFVG  407

Query  1640  QHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  1816
             Q+VV+++I +LGRAS+IIFIL+FTI VSAISLGGVG+++MI+KI   EYMGFE++C Y 
Sbjct  408   QYVVKKVIDMLGRASIIIFILSFTILVSAISLGGVGLADMIKKIERKEYMGFEDICLYS  466



>gb|EMT22888.1| hypothetical protein F775_28607 [Aegilops tauschii]
Length=423

 Score =   423 bits (1087),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 268/435 (62%), Positives = 321/435 (74%), Gaps = 51/435 (12%)
 Frame = +2

Query  509   VSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggg  688
             V+   +   L+   NF+WQ   + Y H+WP ME GW++V+GS+IGF GA+FGSVGGVGGG
Sbjct  38    VAAPEEISLLNKIANFMWQTDGNSYQHVWPPMEFGWKMVLGSLIGFFGASFGSVGGVGGG  97

Query  689   gIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQP  868
             GIFVPML+L++GFDPKS+TAISKCMI GAA+S+V+YNLKL+HPTLDMP+IDYDLA+LIQP
Sbjct  98    GIFVPMLTLIIGFDPKSSTAISKCMITGAAISTVYYNLKLKHPTLDMPVIDYDLALLIQP  157

Query  869   MLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAA  1048
             MLMLGISIGV FNVIF DW+VTVLLI+LF+GTSTKAFL+GVETWKKETI+K+EA ++L  
Sbjct  158   MLMLGISIGVIFNVIFPDWLVTVLLIILFLGTSTKAFLKGVETWKKETIIKREAEKRLEQ  217

Query  1049  NGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVK  1228
                  + EY  L  GPG       K  S++  S+++N+YWKEFGLL FVW++FLA+QI K
Sbjct  218   TSE--EPEYAPLSTGPGAAAD--VKPHSDEAPSLMKNIYWKEFGLLTFVWLAFLAIQITK  273

Query  1229  NYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFF  1408
             NY  TCST YWV+N LQIPVS+GV ++EA GL  G R +SSKG+  + L+  QL +YCFF
Sbjct  274   NYAPTCSTWYWVLNFLQIPVSVGVTMYEALGLMNGKRVLSSKGNEQTTLKFHQLCIYCFF  333

Query  1409  gmiagvvggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPV  1588
             G+ AG+VGGLLGLGGGFIMGPLFLELG+PPQVSSATATFAMMFS+SMSVVEYYLL RFPV
Sbjct  334   GVTAGLVGGLLGLGGGFIMGPLFLELGIPPQVSSATATFAMMFSASMSVVEYYLLNRFPV  393

Query  1589  PYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEK  1768
             PY                                               GGVGISNMI K
Sbjct  394   PY-----------------------------------------------GGVGISNMIHK  406

Query  1769  IHNHEYMGFENLCKY  1813
             +  HEYMGFENLCKY
Sbjct  407   MEQHEYMGFENLCKY  421



>ref|XP_008353719.1| PREDICTED: uncharacterized protein LOC103417306 [Malus domestica]
Length=1022

 Score =   440 bits (1131),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 277/415 (67%), Positives = 344/415 (83%), Gaps = 6/415 (1%)
 Frame = +2

Query  575   SGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAIS  754
             +G  H+  EM +GW+IV+G+IIGF+G+AFG+VGGVGGGGIFVPML+L++GFD KS+TAIS
Sbjct  610   AGDSHLT-EMTIGWKIVVGTIIGFLGSAFGTVGGVGGGGIFVPMLTLIIGFDQKSSTAIS  668

Query  755   KCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVT  934
             KCMI GAA+SSV YNL+LRHPTLD+P+IDYDLA+L QPML+LGISIGV FNVIFA+WM+T
Sbjct  669   KCMITGAAISSVFYNLRLRHPTLDLPLIDYDLALLFQPMLVLGISIGVAFNVIFANWMIT  728

Query  935   VLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAAN--GSGGQGEYKLLPGGPGNGT  1108
             VLLI+ F+ TS++AF +G+ETWKKETI   EAA+++ +N   +  + EYK LPGGP NGT
Sbjct  729   VLLIITFLATSSRAFFKGIETWKKETI---EAARRMQSNCDDASAEVEYKPLPGGPSNGT  785

Query  1109  QDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPV  1288
                  ES   +VSI EN+YWKE  +L  VW+  L LQI KNYT+TCS  YW  NLLQIPV
Sbjct  786   PTETGESKRTEVSIFENLYWKELLILFAVWIIILVLQIAKNYTTTCSAAYWAYNLLQIPV  845

Query  1289  SLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimg  1468
             + GV +FEA  LYKG R I+S+ +S +N    QL++    G+ AG+VGGLLGLGGGFI+G
Sbjct  846   AFGVTIFEAVKLYKGHRVIASRAESNTNWTVNQLVLCSACGITAGIVGGLLGLGGGFILG  905

Query  1469  plflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHV  1648
             P+FLELG+PPQVSSATATFAM FS+SMSVVEYYLLKRFP+PYAL+ TAVAT +A +GQ+V
Sbjct  906   PVFLELGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPIPYALYFTAVATFSALVGQYV  965

Query  1649  VRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             VR+++++ GRAS+IIFILAFTIFVSAISLGGVGI++MIEKI + EYMGFEN+C Y
Sbjct  966   VRKVVSIFGRASIIIFILAFTIFVSAISLGGVGIADMIEKIKHKEYMGFENICTY  1020



>gb|ABC47842.1| membrane protein-like protein [Glycine max]
Length=469

 Score =   422 bits (1085),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 275/464 (59%), Positives = 354/464 (76%), Gaps = 21/464 (5%)
 Frame = +2

Query  431   SWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMEL  610
             SWS ++A     AER LK+++     V        +++ ++F W   E   D +WPEM+ 
Sbjct  21    SWSLIMAYNVCLAERVLKDQKPESFVVKER--QGVMNSIIDFFWNDGEPTNDRVWPEMKF  78

Query  611   GWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSV  790
             GW IV+GSI+GF GAA GSVGGVGGGGIF+PML+LV+GFD KS+TA+SKCMIMGAAVS+V
Sbjct  79    GWRIVVGSIVGFFGAALGSVGGVGGGGIFIPMLTLVIGFDAKSSTALSKCMIMGAAVSTV  138

Query  791   HYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTST  970
             +YNL+ RHPTLD+P+IDYDLA+L QPMLMLGISIGV FNV+FADWMVTVLLI+LFI TST
Sbjct  139   YYNLRFRHPTLDLPVIDYDLALLFQPMLMLGISIGVAFNVMFADWMVTVLLIILFIATST  198

Query  971   KAFLRGVETWKKETIMKKEAAQQLAANGSGG---QGEYKLLPGGPGNGTQDTAKESSEKQ  1141
             KA  +G++TWKKETIMKKEAA+ L ++ S G   + +YK LP G       +A    E+ 
Sbjct  199   KALFKGIDTWKKETIMKKEAAKMLESDSSPGYVSEEDYKSLPAG-------SADPRDEEV  251

Query  1142  VSI-IENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEAT  1318
             + + I+ + +  F  +      FLAL +V  YT TCS LYWV+N LQ+P+++ V L+EA 
Sbjct  252   IPMAIQGIPYSNFIEV------FLALHVV-TYTKTCSILYWVLNSLQVPIAISVTLYEAI  304

Query  1319  GLYKGWRKISSKGDSGSN-LRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVP  1495
              L  G R I+SKG   ++ ++  ++ +YC  G+IAG+V GLLGLGGGFI+GPLFLELG+P
Sbjct  305   CLCNGTRVIASKGKENTDWMKLHKICLYCSCGIIAGIVSGLLGLGGGFILGPLFLELGIP  364

Query  1496  PQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLG  1675
             PQV+SAT+TFAM+FSSSMSVV+YYLL+RFPVPYA +   VAT+AA  GQHVVR++IA+ G
Sbjct  365   PQVASATSTFAMVFSSSMSVVQYYLLERFPVPYASYFILVATIAALTGQHVVRKIIAIFG  424

Query  1676  RASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             RAS+IIF+LAFTIF+SAISLGGVGI NM+EK+ N+EYMGF N+C
Sbjct  425   RASIIIFVLAFTIFLSAISLGGVGIENMVEKMENNEYMGFANIC  468



>ref|XP_009592782.1| PREDICTED: uncharacterized protein LOC104089559 isoform X2 [Nicotiana 
tomentosiformis]
Length=456

 Score =   421 bits (1083),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 269/461 (58%), Positives = 353/461 (77%), Gaps = 20/461 (4%)
 Frame = +2

Query  440   FLLASAFVSAERSLKNEEVAGTNVSRNSDDDY-LSTFVNFLWQPKESGYDHIWPEMELGW  616
              +LA A V +   + +E     N + +S D Y      + LW+  E  Y H+WPE+E GW
Sbjct  12    LVLALAIVVSAEQIPHEATLSNNGTIHSTDSYYFFDLFSLLWKKSEMHYHHVWPELEFGW  71

Query  617   EIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHY  796
              +++GS+IGF GAAFGSVGGVGGGGIFVPML+L++GFDPK++TAISKCMI GAA ++V+Y
Sbjct  72    RVIVGSVIGFFGAAFGSVGGVGGGGIFVPMLTLIIGFDPKTSTAISKCMITGAAGATVYY  131

Query  797   NLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKA  976
             +LKLRHP L++PIIDYDL +L QPML+LGISIGV  NVIFA+WMVT+LLI+LF+  STKA
Sbjct  132   SLKLRHPLLELPIIDYDLVLLFQPMLLLGISIGVVLNVIFAEWMVTMLLIILFLAASTKA  191

Query  977   FLRGVETWKKETIMKKEAAQQLAANGSGGQG-EYKLLPGGPGNGTQDTAKESSE-KQVSI  1150
             F +G+ETWKKETI+KKEA ++L +NG+GG+   YK++PGGP NG+ +   E  +  +VSI
Sbjct  192   FFKGIETWKKETIIKKEAVRRLTSNGAGGEEVAYKIIPGGPNNGSTNYTNEVYKATEVSI  251

Query  1151  IENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYK  1330
             ++N+YWK+  +L  VW+  LAL I K                 +PV++G + +EA  LYK
Sbjct  252   VDNMYWKDITILIAVWIVILALHIFK-----------------LPVAVGASAYEAVCLYK  294

Query  1331  GWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVss  1510
             G R I S G+     +  QLI+YC  G++AG+VGGLLGLGGGFI+GPLFLELG+PPQVSS
Sbjct  295   GSRMIMSSGEIVITWKVHQLILYCCCGILAGIVGGLLGLGGGFILGPLFLELGIPPQVSS  354

Query  1511  atatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLI  1690
             ATA F M+FSSSMSV++YYLL+RFPVPYAL+  AVA++AA +GQHVVRR+I+++GRAS+I
Sbjct  355   ATAAFVMIFSSSMSVIQYYLLRRFPVPYALYFIAVASIAALVGQHVVRRIISIVGRASVI  414

Query  1691  IFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             IFILAFTIFVSAISLGGVGI++ I+KI   ++MGF+N+C Y
Sbjct  415   IFILAFTIFVSAISLGGVGIADTIKKIEEGQHMGFDNICAY  455



>ref|XP_004498483.1| PREDICTED: uncharacterized protein LOC101508758 isoform X1 [Cicer 
arietinum]
Length=458

 Score =   421 bits (1082),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 270/468 (58%), Positives = 357/468 (76%), Gaps = 13/468 (3%)
 Frame = +2

Query  410   LRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDH  589
             +R +V  S+  LL      A R+ K++E +   ++         +F + +     SGY+H
Sbjct  1     MRNVVLFSFILLLVLIIFCANRTPKSKEPSSWIINEAQ------SFYHHVKYNSHSGYEH  54

Query  590   IWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIM  769
             IWP+ME GW I++G++IG  GAAFGSVGGVGGGGIFVPML L++GFDPKSATAISKCM+ 
Sbjct  55    IWPDMEFGWNIIVGTLIGIFGAAFGSVGGVGGGGIFVPMLILIIGFDPKSATAISKCMVT  114

Query  770   GAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIV  949
             GAA+SSV +NLKLRHPTLD+P+IDYDL +L  P+++LGISIGV  +V+FADWM+TVLLI+
Sbjct  115   GAAISSVFFNLKLRHPTLDIPMIDYDLVLLNAPVIILGISIGVVISVVFADWMITVLLII  174

Query  950   LFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANG-SGGQGEYKLLPGGPGNGTQDTAKE  1126
             +FI TS KAFL+G++TWKKETIMKKEA + L +   S G+ EYK LP  P +G Q    +
Sbjct  175   IFIVTSMKAFLKGLDTWKKETIMKKEAIKLLESTATSSGEVEYKFLPSCPNDGPQKEILQ  234

Query  1127  SSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVK-NYTSTCSTLYWVVNLLQIPVSLGVA  1303
                   +I+ N+ WK+FGLLCFVW + L LQI K NYT+TCS  YW+++LLQIPV++GV+
Sbjct  235   G-----TILSNIRWKKFGLLCFVWFAVLLLQITKQNYTTTCSMTYWILSLLQIPVTVGVS  289

Query  1304  LFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflE  1483
             +++A GLY+G +   SK D G++     LI+     ++AG++GGLLG+G GF+MGPLF+E
Sbjct  290   MYQAIGLYQGKKITVSKQDHGTHWPLHLLILSLCCALLAGILGGLLGVGSGFVMGPLFIE  349

Query  1484  LGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLI  1663
             LG+ PQV+SATAT  M F++S+SVV+YYLL RFPVPYAL+LT VATVAA+IGQ ++ +LI
Sbjct  350   LGIAPQVASATATLGMTFTASISVVQYYLLNRFPVPYALYLTLVATVAAYIGQKIIDKLI  409

Query  1664  AVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
              +  RASLIIF+L+FTI VSAI+LGGVGIS+MIEKI  +EYMGFE+LC
Sbjct  410   NIFQRASLIIFVLSFTILVSAIALGGVGISHMIEKIQRNEYMGFEDLC  457



>ref|XP_011011436.1| PREDICTED: uncharacterized protein LOC105116005 isoform X3 [Populus 
euphratica]
Length=422

 Score =   418 bits (1074),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 280/406 (69%), Positives = 338/406 (83%), Gaps = 5/406 (1%)
 Frame = +2

Query  599   EMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAA  778
             EM  GW+IV+GSIIGF GAA GSVGGVGGGGIFVPMLSL++GFD KSATA+SKCMI G A
Sbjct  18    EMRFGWKIVMGSIIGFFGAACGSVGGVGGGGIFVPMLSLIIGFDTKSATAMSKCMITGGA  77

Query  779   VSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFI  958
              ++V+YNLKLRHPTL++P+IDYDLA+L QPML+LGISIGV  NVIFA+WM+T+LLIVLFI
Sbjct  78    AATVYYNLKLRHPTLELPVIDYDLALLFQPMLVLGISIGVALNVIFANWMITILLIVLFI  137

Query  959   GTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQ---GEYKLLPGGPGNGTQDTAKES  1129
              TSTKAF +GVETWKKET  KKEA + L +N    +   GE    PGGP  G Q   KE 
Sbjct  138   VTSTKAFFKGVETWKKETKTKKEATRSLESNDDRNEEVDGEPP--PGGPTVGAQTETKEY  195

Query  1130  SEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALF  1309
               +QVSII+N+YW E  LL  VW+  LALQI KNY++TCS  YW++N+LQIPV+ GV+ +
Sbjct  196   KREQVSIIKNIYWWELALLVAVWLIILALQIGKNYSTTCSVAYWLLNILQIPVAFGVSSY  255

Query  1310  EATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELG  1489
             EA  LYKG RKI+SKGD+ +N +  QL++YCF G++AG+VGG+LGLGGGFI+GPLFLE+G
Sbjct  256   EAFNLYKGRRKIASKGDAVTNWKIRQLVLYCFIGLLAGIVGGMLGLGGGFILGPLFLEMG  315

Query  1490  VPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAV  1669
             +PPQVSSATATF+MMFS+SMSVVEYYLLKRFPVPYAL+  AVAT+AA +GQHV+R+LI++
Sbjct  316   IPPQVSSATATFSMMFSASMSVVEYYLLKRFPVPYALYFFAVATLAALVGQHVIRKLISI  375

Query  1670  LGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             LGRASLIIF LAFTIFVSAI LGGVGI+ M+ +I   EYMGFEN+C
Sbjct  376   LGRASLIIFTLAFTIFVSAILLGGVGIARMVRRIERKEYMGFENIC  421



>ref|XP_010113488.1| hypothetical protein L484_026823 [Morus notabilis]
 gb|EXC35515.1| hypothetical protein L484_026823 [Morus notabilis]
Length=460

 Score =   419 bits (1078),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 279/465 (60%), Positives = 349/465 (75%), Gaps = 27/465 (6%)
 Frame = +2

Query  419   LVALSWSFLLASAFVSAERSLKNEEVAGTNVS-RNSDDDYLSTFVNFLWQPKESGYDHIW  595
             LV + +  L+ +  VS ER LK++      V         L    +FLWQ  +S Y H+W
Sbjct  18    LVWMVFCLLIMNEVVSGERILKDKLNPENFVDVEEKQQGVLMRVAHFLWQSGKSSYQHVW  77

Query  596   PEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGA  775
             PEME GW+IV+GSI+GF GAA GSVGGVGGGGIFVPML+L+VGFDPKS+TAISKCMIMGA
Sbjct  78    PEMEFGWKIVVGSIVGFFGAALGSVGGVGGGGIFVPMLTLIVGFDPKSSTAISKCMIMGA  137

Query  776   AVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLF  955
             A S+V+YNL+LRHPTLDMPIIDYDLA+L QPMLMLGISIGV FNV+FADWMVTVLLI+LF
Sbjct  138   AGSTVYYNLRLRHPTLDMPIIDYDLALLFQPMLMLGISIGVAFNVMFADWMVTVLLIILF  197

Query  956   IGTSTKAFLRGVETWKK-ETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTAKESS  1132
             +GTS KA L+GV  + + +   K++  +  +  G G   +YK LP GP          S 
Sbjct  198   LGTSAKALLKGVSDFAEFQAAQKEQEEESESKPGEGSSADYKPLPSGPA--------ASH  249

Query  1133  EKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFE  1312
             +++V +++N+YWKE  +L +VWV+FL +QIVK                 +P+++ V LFE
Sbjct  250   DEEVPMLQNIYWKELSMLVYVWVAFLFVQIVK-----------------VPIAVSVTLFE  292

Query  1313  ATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGV  1492
             A  LY+G R I+SKG   +N +  Q+ +YC  G++AG+VGGLLGLGGGFI+GPLFLELG+
Sbjct  293   AICLYRGTRVIASKGKEITNWKLHQIFLYCSCGIVAGMVGGLLGLGGGFILGPLFLELGI  352

Query  1493  PPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVL  1672
             PPQV+SAT+TFAM+FSSSMSVV+YYLLKRFPVPYA +   VAT+AAF GQHVVR++IAV+
Sbjct  353   PPQVASATSTFAMVFSSSMSVVQYYLLKRFPVPYASYFVLVATIAAFTGQHVVRKIIAVV  412

Query  1673  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             GRAS+IIFILA TIFVSAISLGGVGI+NM+EK+ N EYMGFEN C
Sbjct  413   GRASIIIFILALTIFVSAISLGGVGIANMVEKMENQEYMGFENFC  457



>gb|AAY63998.1| unknown [Brassica napus]
Length=348

 Score =   415 bits (1067),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 257/350 (73%), Positives = 293/350 (84%), Gaps = 5/350 (1%)
 Frame = +2

Query  767   MGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLI  946
             MGA+VS+V+YNL+LRHPTLDMPIIDYDLA+LIQPMLMLGIS+GV FNV+F DWMVTVLLI
Sbjct  1     MGASVSTVYYNLRLRHPTLDMPIIDYDLALLIQPMLMLGISVGVAFNVMFPDWMVTVLLI  60

Query  947   VLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANG-SGGQGEYKLLPGGPGNGTQDTAK  1123
             +LF+GTSTKAFL+G ETW KETI K EAA++L ++G S  + EY  LP  P     +  K
Sbjct  61    ILFLGTSTKAFLKGRETWNKETIEKMEAAKRLESDGVSATEVEYMPLPAAPNTNPGNNKK  120

Query  1124  ESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVA  1303
                 ++VSIIENVYWKE GLL FVW+ FLALQI K    TCS  YWV+NLLQIPV++GV+
Sbjct  121   ----REVSIIENVYWKELGLLVFVWIVFLALQIAKKNMPTCSVGYWVINLLQIPVAVGVS  176

Query  1304  LFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflE  1483
              +EA  LY+G R I+S G  GSN   GQLI+YC FG++AGVVGGLLGLGGGFIMGPLFLE
Sbjct  177   GYEAVALYQGRRIIASNGQGGSNFTIGQLILYCSFGVLAGVVGGLLGLGGGFIMGPLFLE  236

Query  1484  LGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLI  1663
             LGVPPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+L  VAT+AA +GQHVVRRLI
Sbjct  237   LGVPPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYLVGVATIAALVGQHVVRRLI  296

Query  1664  AVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             AVLGRASLIIFILA TIF+SAISLGGVGI NM+ K+  HEYMGFENLCKY
Sbjct  297   AVLGRASLIIFILASTIFISAISLGGVGIVNMMGKLQRHEYMGFENLCKY  346



>gb|KHN36120.1| hypothetical protein glysoja_003243 [Glycine soja]
Length=441

 Score =   419 bits (1076),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 275/447 (62%), Positives = 340/447 (76%), Gaps = 40/447 (9%)
 Frame = +2

Query  467   AERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgf  646
             A+R LK +E+ G +V +      L   VNFLW+  +S Y+ +WP M+ GW I++GSIIGF
Sbjct  32    ADRILKEKEL-GNDVPKERQG-ILKAIVNFLWEEGKSSYEPVWPNMKFGWRIIVGSIIGF  89

Query  647   mgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLD  826
             +GAA GSVGGVGGGGIFVPML+L++GFDPKS+TAISKCMIMGA++S+V+YNL+LRHPTLD
Sbjct  90    LGAALGSVGGVGGGGIFVPMLALIIGFDPKSSTAISKCMIMGASISTVYYNLRLRHPTLD  149

Query  827   MPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKK  1006
             MP+IDYDLA++ QPMLMLGISIGV  NV+FADWMVTVLLI+LFI TSTKA  +G++TWKK
Sbjct  150   MPLIDYDLALIFQPMLMLGISIGVICNVMFADWMVTVLLIILFIATSTKATYKGIDTWKK  209

Query  1007  ETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLL  1186
             ETI KKEA++ L A    G  +YK LP GP                   E+++ +E    
Sbjct  210   ETIAKKEASKLLEAEPKSGD-DYKSLPSGP------------------TESLFEEE----  246

Query  1187  CFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSG  1366
                            YT  CS  +W++N LQ+PV++ V LFEA GLYKG R I+SKG   
Sbjct  247   ---------------YTKPCSIQFWLLNFLQVPVAVSVTLFEAIGLYKGTRVIASKGKEV  291

Query  1367  SNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfammfsss  1546
             +N +  Q+ +YC  G++AG+VGGLLGLGGGFI+GPLFLELG+PPQV+SAT+TFAM+FSSS
Sbjct  292   TNWKIHQICLYCSTGIMAGMVGGLLGLGGGFILGPLFLELGIPPQVASATSTFAMVFSSS  351

Query  1547  msVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSA  1726
             MSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++I VLGRAS+IIFILA TIF+SA
Sbjct  352   MSVVQYYLLDRFPVPYASYFALVATIAAFTGQHVVRKVIVVLGRASIIIFILALTIFISA  411

Query  1727  ISLGGVGISNMIEKIHNHEYMGFENLC  1807
             ISLGGVGI N+IEKI NHEYMGFE+LC
Sbjct  412   ISLGGVGIENIIEKIENHEYMGFEDLC  438



>ref|XP_006580198.1| PREDICTED: uncharacterized protein LOC100819316 [Glycine max]
Length=475

 Score =   420 bits (1079),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 290/484 (60%), Positives = 357/484 (74%), Gaps = 24/484 (5%)
 Frame = +2

Query  392   GGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPK  571
             G KW   R  V L   FLL S +V++  S +N E     VS  S+D   +  V+      
Sbjct  10    GVKWVAER--VLLVAFFLLVSVYVAS--SHQNTE--QKPVSSPSND---TKGVDTNGHHA  60

Query  572   ESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAI  751
                Y H WPEM+ GW+I++GSIIGF+G+AFG+VGGVGGGGIFVPML+L++GFD +SATAI
Sbjct  61    NGFYKHTWPEMKFGWKIIVGSIIGFLGSAFGTVGGVGGGGIFVPMLTLIIGFDARSATAI  120

Query  752   SKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMV  931
             SKCMI G A ++V YNLK RHPTLDMP+IDYDLA+L QPMLMLGIS+GV FNVIF DWM+
Sbjct  121   SKCMITGGAGATVFYNLKQRHPTLDMPVIDYDLALLFQPMLMLGISVGVAFNVIFPDWML  180

Query  932   TVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQ  1111
             T LLI++FIG S  AF +GV+TWKKETI+KKEA Q +  N +   G            T+
Sbjct  181   TALLIIVFIGLSVNAFFKGVKTWKKETIIKKEARQNVRLNYTERTGN------AAHPQTE  234

Query  1112  DTAKES------SEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNL  1273
             +T  ES      S K+VS+IEN+YWKE G+L  VW+  LALQI KNYT+ CS LYW++NL
Sbjct  235   ETVNESHTNTNQSRKKVSVIENIYWKELGILVSVWILILALQIGKNYTTNCSALYWIMNL  294

Query  1274  LQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgg  1453
             LQ+P+++G   +EA  LYKG R I+SKGD  +  R  QLI+YC  G+IAG++GGLLGLGG
Sbjct  295   LQVPITVGTTFYEAVLLYKGQRVIASKGDQQTRWRVQQLILYCSCGIIAGIIGGLLGLGG  354

Query  1454  gfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaaf  1633
             GFI+GPLF+ LG+ PQVSSAT+TFAM FS+SMSVVEYYLLKRFP+PYAL+  AVAT AA 
Sbjct  355   GFILGPLFIGLGIHPQVSSATSTFAMTFSASMSVVEYYLLKRFPIPYALYFVAVATAAAL  414

Query  1634  IGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             +GQH+VR++IA+LGR SLIIFILA T+FVS ISLGGVGI+ +IEK      M FENLC Y
Sbjct  415   VGQHLVRKVIAILGRTSLIIFILALTVFVSGISLGGVGIAKLIEK---KVQMKFENLCSY  471

Query  1814  GV*N  1825
              V N
Sbjct  472   RVRN  475



>ref|XP_003629897.1| hypothetical protein MTR_8g088080 [Medicago truncatula]
 gb|AET04373.1| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=479

 Score =   420 bits (1079),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 267/415 (64%), Positives = 326/415 (79%), Gaps = 0/415 (0%)
 Frame = +2

Query  581   YDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKC  760
             Y H WP M+ GW I++G+IIGF+G++FG+VGGVGGGGIFVPML+L+VGFD KSATAISK 
Sbjct  65    YKHTWPGMKFGWRIIVGTIIGFLGSSFGTVGGVGGGGIFVPMLTLIVGFDAKSATAISKF  124

Query  761   MIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVL  940
             MI G A ++V YNLK RHPTLD+P+IDYDLA+L QPMLMLGIS+GV FN+IF DWM+T L
Sbjct  125   MITGGAGATVLYNLKKRHPTLDLPVIDYDLALLFQPMLMLGISLGVAFNLIFPDWMLTTL  184

Query  941   LIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTA  1120
             LI+ F G S  AFL+GV TWKKET+ KKEA      N    +     L  G       T 
Sbjct  185   LIIFFTGISVNAFLKGVNTWKKETLTKKEAKDNSQLNDIRTEDATLDLQIGESVNENQTN  244

Query  1121  KESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGV  1300
                  K+VS+IENVYWKE GLL  VW+  LALQI KNYT+TCS +YW++NLLQ+P+++GV
Sbjct  245   TNLPRKKVSVIENVYWKELGLLFSVWIMILALQIGKNYTTTCSLIYWILNLLQVPIAIGV  304

Query  1301  ALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplfl  1480
             + +EA  LYKG R I+S GD G N    QLI+YC  G+IAG++GGLLGLGGGFI+GPLF+
Sbjct  305   SGYEAILLYKGKRVIASNGDQGINWSVKQLILYCSCGIIAGIIGGLLGLGGGFILGPLFI  364

Query  1481  ELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRL  1660
              LG+PPQV+SAT+TFAM FS+SMSVVEYYLLKRFP+PYAL+   VATVAA +GQH+VR+L
Sbjct  365   GLGIPPQVASATSTFAMTFSASMSVVEYYLLKRFPIPYALYFVVVATVAALVGQHLVRKL  424

Query  1661  IAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV*N  1825
             IA+LGRAS+IIFILA T+FVS ISLGG GI+N+I+++ N EYMGF NLC Y V N
Sbjct  425   IALLGRASIIIFILALTVFVSGISLGGTGIANLIKRLENKEYMGFGNLCSYAVRN  479



>gb|ACJ86264.1| unknown [Medicago truncatula]
Length=481

 Score =   420 bits (1079),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 267/415 (64%), Positives = 326/415 (79%), Gaps = 0/415 (0%)
 Frame = +2

Query  581   YDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKC  760
             Y H WP M+ GW I++G+IIGF+G++FG+VGGVGGGGIFVPML+L+VGFD KSATAISK 
Sbjct  67    YKHTWPGMKFGWRIIVGTIIGFLGSSFGTVGGVGGGGIFVPMLTLIVGFDAKSATAISKF  126

Query  761   MIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVL  940
             MI G A ++V YNLK RHPTLD+P+IDYDLA+L QPMLMLGIS+GV FN+IF DWM+T L
Sbjct  127   MITGGAGATVLYNLKKRHPTLDLPVIDYDLALLFQPMLMLGISLGVAFNLIFPDWMLTTL  186

Query  941   LIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTA  1120
             LI+ F G S  AFL+GV TWKKET+ KKEA      N    +     L  G       T 
Sbjct  187   LIIFFTGISVNAFLKGVNTWKKETLTKKEAKDNSQLNDIRTEDATLDLQIGESVNENQTN  246

Query  1121  KESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGV  1300
                  K+VS+IENVYWKE GLL  VW+  LALQI KNYT+TCS +YW++NLLQ+P+++GV
Sbjct  247   TNLPRKKVSVIENVYWKELGLLFSVWIMILALQIGKNYTTTCSLIYWILNLLQVPIAIGV  306

Query  1301  ALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplfl  1480
             + +EA  LYKG R I+S GD G N    QLI+YC  G+IAG++GGLLGLGGGFI+GPLF+
Sbjct  307   SGYEAILLYKGKRVIASNGDQGINWSVKQLILYCSCGIIAGIIGGLLGLGGGFILGPLFI  366

Query  1481  ELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRL  1660
              LG+PPQV+SAT+TFAM FS+SMSVVEYYLLKRFP+PYAL+   VATVAA +GQH+VR+L
Sbjct  367   GLGIPPQVASATSTFAMTFSASMSVVEYYLLKRFPIPYALYFVVVATVAALVGQHLVRKL  426

Query  1661  IAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV*N  1825
             IA+LGRAS+IIFILA T+FVS ISLGG GI+N+I+++ N EYMGF NLC Y V N
Sbjct  427   IALLGRASIIIFILALTVFVSGISLGGTGIANLIKRLENKEYMGFGNLCSYAVRN  481



>ref|XP_002516037.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46457.1| conserved hypothetical protein [Ricinus communis]
Length=481

 Score =   419 bits (1077),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 288/475 (61%), Positives = 362/475 (76%), Gaps = 6/475 (1%)
 Frame = +2

Query  398   KWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDY--LSTFVNFLWQPK  571
             +W ++     LS   ++ S    +E  LK   + G++  R  + ++  ++   NF +Q  
Sbjct  8     RWSLIMLGAILSSFLVVGSLLALSETRLK---LLGSDYKRPKEVEFHHVTRASNFFYQKG  64

Query  572   ESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAI  751
               GY H+WPEM  GW+IV+G +IG  GAA GSVGGVGGGGIFVPML+L+VGFD KS+TA+
Sbjct  65    RLGYKHVWPEMRFGWKIVLGGVIGVFGAACGSVGGVGGGGIFVPMLTLIVGFDAKSSTAL  124

Query  752   SKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMV  931
             SKCMI GAA ++V+YNLKLRHPTL++PIIDYDLA+L QPML+LGIS+GV  NVIFADW +
Sbjct  125   SKCMITGAAAATVYYNLKLRHPTLELPIIDYDLALLFQPMLVLGISLGVALNVIFADWAI  184

Query  932   TVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLA-ANGSGGQGEYKLLPGGPGNGT  1108
             T+LLI+LFI TS+KAF +GVETWK+ET +KKEAA+ L     +  + E K  P G     
Sbjct  185   TILLIILFIVTSSKAFFKGVETWKQETKLKKEAARHLEIDEDTTEEMEEKSPPTGSTIVA  244

Query  1109  QDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPV  1288
             Q    ES  ++VSI ENV WKE GLL  VW   LALQI KNY++TCS  YWV++ LQIPV
Sbjct  245   QAQFSESKREKVSIGENVCWKELGLLVAVWSIILALQIGKNYSTTCSVTYWVLSTLQIPV  304

Query  1289  SLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimg  1468
             ++GV  +EA  LYKG RKI+S+G+  +N +  QL+ Y   G++AGVVGG+LGLGGGFI+G
Sbjct  305   AVGVTGYEAISLYKGQRKIASRGEVSTNWKIHQLVSYSAIGILAGVVGGMLGLGGGFILG  364

Query  1469  plflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHV  1648
             PLFLE+G+PPQVSSATATF M FS+SMSV+EYYLLKRFPVPYAL+L AVA +AAF+GQHV
Sbjct  365   PLFLEMGIPPQVSSATATFIMAFSASMSVIEYYLLKRFPVPYALYLFAVAIIAAFVGQHV  424

Query  1649  VRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             VR+LI++LGRASLIIFILAFTIF SAISLGGVGI+  I+KI   EYMGFE++C Y
Sbjct  425   VRKLISLLGRASLIIFILAFTIFASAISLGGVGIARAIKKIERKEYMGFEDICSY  479



>ref|XP_009396550.1| PREDICTED: uncharacterized protein LOC103981523 [Musa acuminata 
subsp. malaccensis]
Length=474

 Score =   418 bits (1074),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 278/476 (58%), Positives = 351/476 (74%), Gaps = 9/476 (2%)
 Frame = +2

Query  395   GKW--RILRPLVALSWSFLLASAFV-SAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQ  565
             GKW  R++  +V     F LA+A V SA+R LK        ++R      L        Q
Sbjct  3     GKWLSRLVAAVVFAVLCFFLATAQVASADRGLKLMNPNINTIARGEMKRALKRSQ----Q  58

Query  566   PKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSAT  745
                S Y H+WP M+  W I +GS+IGF+GAA GSVGGVGGGGIFVPML+L++GFDPKS+T
Sbjct  59    EDGSSYSHVWPAMKFEWRIAVGSVIGFLGAALGSVGGVGGGGIFVPMLTLIIGFDPKSST  118

Query  746   AISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADW  925
             A+SKCMIMG A S+V+YNL+LRHP+LD P+IDY L +LIQP LMLGISIGV  NVI  +W
Sbjct  119   ALSKCMIMGTACSTVYYNLRLRHPSLDAPLIDYRLVMLIQPTLMLGISIGVILNVIIPEW  178

Query  926   MVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNG  1105
             MVT+LLI+L +GTS KAF++GVETW++ET + KEAA+ L +N    Q  Y+ +P  P N 
Sbjct  179   MVTLLLIILLLGTSVKAFMKGVETWRRETTLMKEAAKGLGSNSRSTQ--YEHIPLSPSNS  236

Query  1106  TQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIP  1285
              Q+  + + E  V +++NV W+EFGLL  VW++FL LQ+ KNYT+TCST YW +NLLQIP
Sbjct  237   DQEDEETAREPVVPVLQNVCWREFGLLVLVWMAFLVLQVTKNYTATCSTWYWFLNLLQIP  296

Query  1286  VSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfim  1465
             ++    L+EA  LY G RKISS  + G+  R  QL +YC  G++AGV GGLLGLGGGFI+
Sbjct  297   IAGSATLYEAVSLYSGRRKISSGREEGTKWRVAQLFIYCSCGVVAGVAGGLLGLGGGFIL  356

Query  1466  gplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQH  1645
             GPLFLELG+PPQVSSAT TFAM FSSS+SVVEYYLL RFP+PYA++ + V+ VAAF GQ 
Sbjct  357   GPLFLELGLPPQVSSATTTFAMAFSSSISVVEYYLLNRFPLPYAVYFSLVSAVAAFNGQV  416

Query  1646  VVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             VV R I  +GR SL+IFILA  IF+SA+SLGGVG+S+M+++I  HEYMGFENLC Y
Sbjct  417   VVGRWIVAMGRVSLVIFILASMIFISALSLGGVGVSDMLKRIEKHEYMGFENLCGY  472



>ref|XP_010667910.1| PREDICTED: uncharacterized protein LOC104884897 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=347

 Score =   413 bits (1061),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 252/352 (72%), Positives = 295/352 (84%), Gaps = 8/352 (2%)
 Frame = +2

Query  761   MIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVL  940
             MIMGAA S+V YN+KL+HPTLDMPIIDYDLA+L QPMLMLGISIGVTFNVIFADWMVTVL
Sbjct  1     MIMGAAASTVFYNMKLKHPTLDMPIIDYDLALLFQPMLMLGISIGVTFNVIFADWMVTVL  60

Query  941   LIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQG-EYKLLPGGPGNGTQDT  1117
             LI+LFIGTS KA  +G+ETW+KET++K E  ++LA+NG+GG+G +YK LPGGP       
Sbjct  61    LIILFIGTSIKALFKGIETWRKETLIKLEETRRLASNGAGGEGIDYKPLPGGPN------  114

Query  1118  AKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLG  1297
               E+ E +VS  E  Y KE GLL FVWV+FL LQIVK  TS+CS  YWV+NLLQ+PV++G
Sbjct  115   -METKETEVSSGEYYYTKELGLLIFVWVTFLVLQIVKEQTSSCSIAYWVLNLLQVPVAIG  173

Query  1298  VALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplf  1477
             V+L+EA GLYKG R ISSKGD  +     QL++YC  G++AG+VGGLLGLGGGFI+ PLF
Sbjct  174   VSLYEAVGLYKGRRIISSKGDVSTTWEVHQLVLYCCCGILAGIVGGLLGLGGGFILIPLF  233

Query  1478  lELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRR  1657
             LELGVPPQVSSATATFAM FS+SMSVVEYYLLKRFP+ YAL+  AVA VAAF+GQH+VR+
Sbjct  234   LELGVPPQVSSATATFAMAFSASMSVVEYYLLKRFPITYALYFMAVAIVAAFVGQHLVRK  293

Query  1658  LIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             LI +LGRASLIIFILAF+IFVSA+SLGGVGISNMI+  H H YMGFENLCKY
Sbjct  294   LIILLGRASLIIFILAFSIFVSAVSLGGVGISNMIKMFHRHHYMGFENLCKY  345



>ref|XP_009777903.1| PREDICTED: uncharacterized protein LOC104227363 isoform X4 [Nicotiana 
sylvestris]
 ref|XP_009777904.1| PREDICTED: uncharacterized protein LOC104227363 isoform X4 [Nicotiana 
sylvestris]
Length=416

 Score =   414 bits (1064),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 257/412 (62%), Positives = 336/412 (82%), Gaps = 1/412 (0%)
 Frame = +2

Query  581   YDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKC  760
             Y H+WPE+++GW +++GSIIGF  AA GS GGVGGGGIFVPML+L++GFDPK++TAISKC
Sbjct  3     YHHVWPELQVGWRVIVGSIIGFFAAALGSAGGVGGGGIFVPMLTLIIGFDPKTSTAISKC  62

Query  761   MIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVL  940
             MI GAA ++V+YNLKLRHPT+DM IIDY+LA+L QPML+LGISIGV  NV+FA+WM+TVL
Sbjct  63    MITGAAGATVYYNLKLRHPTMDMSIIDYNLALLFQPMLLLGISIGVVLNVLFAEWMLTVL  122

Query  941   LIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGE-YKLLPGGPGNGTQDT  1117
             LI+LFI  STKAF +GVETWK+ETI+K+E A +LA+ G+ G+   YKLLP GP N ++  
Sbjct  123   LIILFIVASTKAFSKGVETWKRETIIKEEVAGRLASGGADGEEVIYKLLPEGPDNRSRVE  182

Query  1118  AKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLG  1297
              K     ++ II+NVYWK+   L  VWV  L L I KNY+STCS  YW++NLLQ+PV++G
Sbjct  183   KKVYKASEMPIIDNVYWKDITTLIAVWVVILVLHISKNYSSTCSVAYWILNLLQVPVAVG  242

Query  1298  VALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplf  1477
              A+++A  LY G R I S  D+    +  QLI+ C  G++AG+VGGLLGLGGGFI+GPL 
Sbjct  243   AAVYQAVCLYNGSRVIMSSRDAVIIWKVHQLILCCCCGILAGIVGGLLGLGGGFILGPLL  302

Query  1478  lELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRR  1657
             LE G+PPQVSSATATF M FSSSMSV++YYLL+RFP+PYAL+  AV+T+AAF+GQ+VVR+
Sbjct  303   LEQGIPPQVSSATATFVMTFSSSMSVIQYYLLRRFPIPYALYFVAVSTIAAFVGQNVVRK  362

Query  1658  LIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             +I+++GRAS+IIF+LAFTIFVSA+SLGGVGI + I+K+   +++GF+N+C Y
Sbjct  363   IISIVGRASVIIFVLAFTIFVSALSLGGVGILDTIKKVEEGQHIGFDNICAY  414



>ref|XP_009800426.1| PREDICTED: uncharacterized protein LOC104246320 isoform X2 [Nicotiana 
sylvestris]
Length=456

 Score =   414 bits (1065),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 266/453 (59%), Positives = 343/453 (76%), Gaps = 19/453 (4%)
 Frame = +2

Query  461   VSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSII  640
             VSAE+      ++    + ++D  Y     N L +  E  Y H+WPE+E GW +++GS+I
Sbjct  20    VSAEKIPHEATLSNNGTTHSTDSYYFFDLFNLLQKMSEMHYHHVWPELECGWRVIVGSVI  79

Query  641   gfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPT  820
             GF GAAFGSVGGVGGGGIFVPML+L++GFDPK++TAISKCMI GAA ++V+Y+LKLRHP 
Sbjct  80    GFFGAAFGSVGGVGGGGIFVPMLTLIIGFDPKTSTAISKCMITGAAGATVYYSLKLRHPL  139

Query  821   LDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETW  1000
             L++PIIDYDLA+L QPML+LGISIGV  NVIFA+WMVT LLI+LF   STKAF +GVETW
Sbjct  140   LELPIIDYDLALLFQPMLLLGISIGVVLNVIFAEWMVTTLLIILFSAASTKAFFKGVETW  199

Query  1001  KKETIMKKEAAQQLAANGSGGQG-EYKLLPGGPGNGTQDTAKES-SEKQVSIIENVYWKE  1174
             KKETI+KKEA ++L +N +GG+   YK++PGGP NG+ +   E     +VSI +N+YWK+
Sbjct  200   KKETIIKKEAVRRLTSNVAGGEEVAYKIIPGGPNNGSTNFTNEVYKATEVSIFDNMYWKD  259

Query  1175  FGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSK  1354
                L  VW+  L L I K                 +PV++G + +EA  LYKG R I S 
Sbjct  260   ISRLVAVWIIILVLHISK-----------------VPVAVGASAYEAVCLYKGSRTIMSS  302

Query  1355  GDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfamm  1534
             G++    +  QLI+YC  G++AG+VGGLLGLGGGFI+GPLFLELG+PPQVSSATA F M+
Sbjct  303   GETVITWKVHQLILYCCCGILAGIVGGLLGLGGGFILGPLFLELGIPPQVSSATAAFVMI  362

Query  1535  fsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTI  1714
             FSSSMSV++YYLL+RFPVPYAL+  AVA +AA +GQHVVRR+I+++GRAS+IIFILAFTI
Sbjct  363   FSSSMSVIQYYLLRRFPVPYALYFIAVAGIAALVGQHVVRRIISIVGRASVIIFILAFTI  422

Query  1715  FVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             FVSAISLGGVGI++ I+KI   ++MGF+N+C Y
Sbjct  423   FVSAISLGGVGIADTIKKIEEGQHMGFDNICAY  455



>ref|XP_003532779.1| PREDICTED: uncharacterized protein LOC100801788 [Glycine max]
 gb|KHN48051.1| hypothetical protein glysoja_015521 [Glycine soja]
Length=469

 Score =   414 bits (1063),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 272/476 (57%), Positives = 352/476 (74%), Gaps = 24/476 (5%)
 Frame = +2

Query  398   KWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSD--DDYLSTFVNFLWQPK  571
             KW + + L+A     LL S  VSA  S +N +   T+ S  +   D +   F        
Sbjct  12    KWVVGKALIAF---LLLVS--VSATSSHQNTDNKTTSPSNGTIGVDHHAKAF--------  58

Query  572   ESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAI  751
                Y H WP M+ GW I++G+++GF+G+AFG+VGGVGGGGIFVPML+L+VGFD KSATAI
Sbjct  59    ---YKHHWPSMKFGWRIIVGAVVGFLGSAFGTVGGVGGGGIFVPMLTLIVGFDQKSATAI  115

Query  752   SKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMV  931
             SKCMI G A ++V YNL+ RHPTLD+P+IDYDLA+L QPMLMLGISIGV FNVIF +WM+
Sbjct  116   SKCMITGGATATVFYNLRQRHPTLDLPVIDYDLALLFQPMLMLGISIGVAFNVIFPEWML  175

Query  932   TVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAAN--GSGGQGEYKLLPGGPGNG  1105
             TVLLI+ F+G S K+F +GV+TWKKETIMKKEA +    +  GS     + +  G P   
Sbjct  176   TVLLIIFFVGISVKSFFKGVDTWKKETIMKKEAKKNSRIDDIGSPEDDAHYIQTGDP---  232

Query  1106  TQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIP  1285
             T+D   + S K+VSIIEN+ WKE GLL   W+  LAL+I K +T+TCS LYW+ NLLQ+P
Sbjct  233   TKDDTNQ-SRKKVSIIENIRWKELGLLFAGWIMILALEIGKKHTTTCSRLYWLSNLLQVP  291

Query  1286  VSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfim  1465
             +++G++ +EA  LYKG R I+SKGD  ++    QL+++C  G +AG++ GLLGLGGGFI+
Sbjct  292   IAVGMSSYEAVRLYKGKRIIASKGDKQTHWCVLQLVLFCACGTLAGMIAGLLGLGGGFIL  351

Query  1466  gplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQH  1645
             GPLFL LG+PPQV+SAT+T  M FS+SM+VVEYYLLKRFPVPYAL+  A+AT AA +GQH
Sbjct  352   GPLFLGLGIPPQVASATSTLVMAFSASMAVVEYYLLKRFPVPYALYFVAIATAAALVGQH  411

Query  1646  VVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             +VR+ IA+LGRAS+IIFIL  T+ VSA+ LGGVGI++MI+KI N EYMGF +LC Y
Sbjct  412   LVRKAIAILGRASVIIFILTLTLSVSAVLLGGVGIAHMIQKIENKEYMGFGDLCTY  467



>gb|KHN06458.1| hypothetical protein glysoja_010802 [Glycine soja]
Length=469

 Score =   413 bits (1062),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 273/475 (57%), Positives = 353/475 (74%), Gaps = 22/475 (5%)
 Frame = +2

Query  398   KWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDD-DYLSTFVNFLWQPKE  574
             KW   + L+A     LL S  VSA  S +N +   T+ S  +   DY +          +
Sbjct  12    KWVAGKALIAF---LLLVS--VSATSSHQNTDNKTTSPSNGTIGVDYHA----------K  56

Query  575   SGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAIS  754
             + Y H WP M+ GW I++G+I+GF+G+AFG+VGGVGGGGIFVPML+L+VGFD KSATAIS
Sbjct  57    AFYKHHWPSMKFGWRIIVGAIVGFLGSAFGTVGGVGGGGIFVPMLTLIVGFDQKSATAIS  116

Query  755   KCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVT  934
             KCMI G A ++V YNL+ RHPTLD+P+IDYDLA+L QPMLMLGISIGV FNVIF +WM+T
Sbjct  117   KCMITGGATATVFYNLRQRHPTLDLPVIDYDLALLFQPMLMLGISIGVAFNVIFPEWMLT  176

Query  935   VLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAAN--GSGGQGEYKLLPGGPGNGT  1108
             VLLI+ F+G S K+F +GV+TWKKETIMKKEA +    +  GS     + +  G P    
Sbjct  177   VLLIIFFVGISVKSFFKGVDTWKKETIMKKEAKKNSRIDDIGSPEDDAHYIQTGDPAK--  234

Query  1109  QDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPV  1288
              DT    S K+VSIIEN+ WKE GLL   W+  LAL+I K +T+TCS L+W++NLLQ+P+
Sbjct  235   DDT--NQSRKKVSIIENIRWKELGLLFAGWIMILALEIGKKHTTTCSRLFWLLNLLQVPI  292

Query  1289  SLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimg  1468
             ++G++ +EA  LYKG R I+SKGD  S+    QL+++C  G +AG++ GLLGLGGGFI+G
Sbjct  293   AVGMSSYEAVRLYKGKRIIASKGDQQSHWCVFQLVLFCACGTLAGMIAGLLGLGGGFILG  352

Query  1469  plflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHV  1648
             PLFL LG+PPQV+SAT+T  M FS+SM+VVEYYLLKRFPVPYAL+  A+AT AA +GQH+
Sbjct  353   PLFLGLGIPPQVASATSTLVMAFSASMAVVEYYLLKRFPVPYALYFVAIATAAALVGQHL  412

Query  1649  VRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             VR+ IA+LGRAS+IIFIL+ T+ VSA+ LGGVGI++MI+KI N EYMGF +LC Y
Sbjct  413   VRKAIAILGRASVIIFILSLTLSVSAVLLGGVGIAHMIQKIENKEYMGFGDLCTY  467



>ref|XP_006580197.1| PREDICTED: uncharacterized protein LOC100818778 [Glycine max]
Length=469

 Score =   411 bits (1057),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 272/475 (57%), Positives = 353/475 (74%), Gaps = 22/475 (5%)
 Frame = +2

Query  398   KWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDD-DYLSTFVNFLWQPKE  574
             KW   + L+A     LL S  VSA  S +N +   T+ S  +   DY +          +
Sbjct  12    KWVAGKALIAF---LLLVS--VSATSSHQNTDNKTTSPSNGTIGVDYHA----------K  56

Query  575   SGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAIS  754
             + Y H WP M+ GW I++G+I+GF+G+AFG+VGGVGGGGIFVPML+L+VGFD KSATAIS
Sbjct  57    AFYKHHWPSMKFGWRIIVGAIVGFLGSAFGTVGGVGGGGIFVPMLTLIVGFDQKSATAIS  116

Query  755   KCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVT  934
             KCMI G A ++V YNL+ RHPTLD+P+IDYDLA+L QPMLMLGISIGV FNVIF +WM+T
Sbjct  117   KCMITGGATATVFYNLRQRHPTLDLPVIDYDLALLFQPMLMLGISIGVAFNVIFPEWMLT  176

Query  935   VLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQ--QLAANGSGGQGEYKLLPGGPGNGT  1108
             VLLI+ F+G S K+F +GV+TWKKETIMKKEA +  ++   GS     + +  G P    
Sbjct  177   VLLIIFFVGISVKSFFKGVDTWKKETIMKKEAKKNSRIDDIGSPEDDAHYIQTGDPAK--  234

Query  1109  QDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPV  1288
              DT    S K+VSIIEN+ WKE GLL   W+  LAL+I K +T+TCS L+W++NLLQ+P+
Sbjct  235   DDT--NQSRKKVSIIENIRWKELGLLFAGWIMILALEIGKKHTTTCSRLFWLLNLLQVPI  292

Query  1289  SLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimg  1468
             ++G++ +EA  LYKG R I+SKGD  ++    QL+++C  G +AG++ GLLGLGGGFI+G
Sbjct  293   AVGMSSYEAVRLYKGKRIIASKGDQQTHWCVLQLVLFCACGTLAGMIAGLLGLGGGFILG  352

Query  1469  plflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHV  1648
             PLFL LG+PPQV+SAT+T  M FS+SM+VVEYYLLKRFPVPYAL+  A+AT AA +GQH+
Sbjct  353   PLFLGLGIPPQVASATSTLVMAFSASMAVVEYYLLKRFPVPYALYFVAIATAAALVGQHL  412

Query  1649  VRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             VR+ IA+LGRAS+IIFIL  T+ VSA+ LGGVGI++MI+KI N EYMGF +LC Y
Sbjct  413   VRKAIAILGRASVIIFILTLTLSVSAVLLGGVGIAHMIQKIENKEYMGFGDLCTY  467



>gb|KHN48050.1| hypothetical protein glysoja_015520 [Glycine soja]
Length=465

 Score =   409 bits (1052),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 252/415 (61%), Positives = 329/415 (79%), Gaps = 6/415 (1%)
 Frame = +2

Query  581   YDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKC  760
             Y H WP ME GW+I++G+++GF+G+AFG+VGGVGGGGIFVPML+L++GFD KSA AISKC
Sbjct  53    YKHTWPSMEYGWKIIVGTMVGFLGSAFGNVGGVGGGGIFVPMLTLIIGFDAKSAIAISKC  112

Query  761   MIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVL  940
             MI G A ++V YNL+ RHPTLD+P+IDYDLA+L QPMLMLGISIGV+FNVIF DWM+T L
Sbjct  113   MITGGATATVFYNLRQRHPTLDLPVIDYDLALLFQPMLMLGISIGVSFNVIFPDWMLTTL  172

Query  941   LIVLFIGTSTKAFLRGVETWKKETIMKKEAAQ--QLAANGSGGQGEYKLLPGGPGNGTQD  1114
             LI+ F G S K+F +GV+TWK+ET++ KEA +  Q+   GS     + +  G P    +D
Sbjct  173   LIIFFTGISVKSFFKGVDTWKQETLIVKEARKNSQIDDIGSPEDAAHYIQTGDP---VKD  229

Query  1115  TAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSL  1294
                + S K+VS+IEN++W E GLL  VW+  LAL+I KNYT+TCS +YWV+NLLQ+P+++
Sbjct  230   NTNQ-SRKKVSVIENIHWNELGLLFAVWIMILALEIGKNYTTTCSGVYWVINLLQVPIAV  288

Query  1295  GVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgpl  1474
             G++ ++A  LYKG R I SKGD  +N R  QLI++C  G++AG + GLLGLGGGFI+ PL
Sbjct  289   GMSSYQAMRLYKGQRIIGSKGDQQTNWRVLQLILFCACGILAGTIAGLLGLGGGFILAPL  348

Query  1475  flELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVR  1654
             FL +G+PPQV+SAT+  AM FS+SM+VVEYYLLKRFP+ YAL+  AVAT AA +GQH+VR
Sbjct  349   FLGIGIPPQVASATSILAMAFSASMAVVEYYLLKRFPISYALYFVAVATAAALVGQHLVR  408

Query  1655  RLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  1819
             ++IA+LGRAS+IIFIL  T+ VSA+ LGGVG++NMI++I N EYMGF NLC Y V
Sbjct  409   KVIAILGRASVIIFILTLTLCVSAVLLGGVGVANMIKRIENKEYMGFGNLCTYKV  463



>ref|XP_007159526.1| hypothetical protein PHAVU_002G244900g [Phaseolus vulgaris]
 gb|ESW31520.1| hypothetical protein PHAVU_002G244900g [Phaseolus vulgaris]
Length=464

 Score =   407 bits (1047),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 253/413 (61%), Positives = 325/413 (79%), Gaps = 8/413 (2%)
 Frame = +2

Query  581   YDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKC  760
             Y H WP M+ GW I++GS++ F+G+AFG+VGGVGGGGIFVPML+L+VGFD KSATAISKC
Sbjct  58    YKHHWPSMKFGWRIIVGSLVAFLGSAFGTVGGVGGGGIFVPMLTLIVGFDQKSATAISKC  117

Query  761   MIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVL  940
             MI G A ++V YNL+ RHPTLD+P+IDYDLA+L QPMLMLGISIGV FNVIF +WM+TVL
Sbjct  118   MITGGATATVFYNLRQRHPTLDLPVIDYDLALLFQPMLMLGISIGVAFNVIFPEWMLTVL  177

Query  941   LIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTA  1120
             LI+ F+G S K+F +GVETWKKETIMKKEA +    N       + +    P   T+D  
Sbjct  178   LIIFFVGISIKSFFKGVETWKKETIMKKEAKK----NSRIDDDAHYIQTEEP---TKDDT  230

Query  1121  KESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGV  1300
             KE   K+VSIIEN+ WKE GLL   W+  L L+I K +T+TCS LYW++NLLQ+P+++G+
Sbjct  231   KEPM-KKVSIIENIRWKELGLLFSGWIVILGLEIGKKHTTTCSRLYWLMNLLQVPLAVGM  289

Query  1301  ALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplfl  1480
             + +EA  LYKG R I+SKGD  ++    QL+++C  G +AG++ GLLGLGGGFI+GPLFL
Sbjct  290   SSYEAVRLYKGKRIIASKGDQQTHFCVLQLVLFCACGTLAGMIAGLLGLGGGFILGPLFL  349

Query  1481  ELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRL  1660
              LG+PPQV+SAT+T  M FS+SM+VVEYYLLKRFPVPYA++  ++AT AA +GQH+VR+ 
Sbjct  350   GLGIPPQVASATSTLVMAFSASMAVVEYYLLKRFPVPYAIYFVSIATAAALVGQHLVRKA  409

Query  1661  IAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  1819
             IA+LGRAS+IIFIL FT+ VSA+ LGGVG+ +MI+KI + EYMGF +LC Y V
Sbjct  410   IAILGRASVIIFILTFTLSVSAVLLGGVGVVHMIQKIEHQEYMGFGDLCTYKV  462



>gb|KEH40300.1| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=456

 Score =   405 bits (1042),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 252/467 (54%), Positives = 350/467 (75%), Gaps = 13/467 (3%)
 Frame = +2

Query  410   LRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDH  589
             +R +V  S+  L A     A R++K+EE +       S          F +  K +  +H
Sbjct  1     MRNVVLFSFILLFALLIFCANRTIKSEERSWIVNEAQS----------FYYHVKAN--EH  48

Query  590   IWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIM  769
             +WP++ LGW+I++G++IG  GA+FGSVGGVGGGGIFVPML L++GFD KSATAISKCM+ 
Sbjct  49    VWPDIRLGWQIIVGTLIGIFGASFGSVGGVGGGGIFVPMLILIIGFDAKSATAISKCMVT  108

Query  770   GAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIV  949
             GAA+S+V +NLKLRHPTLD+P+IDYDL +L  P+++LGISIGV  +V+FADWM+TVLLI+
Sbjct  109   GAAISTVFFNLKLRHPTLDIPMIDYDLVLLNAPVIILGISIGVVLSVVFADWMITVLLII  168

Query  950   LFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQG-EYKLLPGGPGNGTQDTAKE  1126
             +FI TS +A+L+G++TW KETI+K+EA + L +N +  +  EYK LP  P +G +   K+
Sbjct  169   VFIVTSVRAYLKGLDTWNKETIIKEEAVKSLESNATTSEDVEYKYLPSCPDDGPEKEIKQ  228

Query  1127  SSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVAL  1306
              +  Q +I+ N+ WKEFGLLCFVW S L LQI KNYT+ CS  +W+   LQIPV++GV+L
Sbjct  229   VTVIQGTILSNIRWKEFGLLCFVWFSVLLLQIAKNYTTRCSITFWIFTFLQIPVTVGVSL  288

Query  1307  FEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflEL  1486
             ++ATGLY+G +   SK D G++     L +     ++AG++GGLLG+G GF+MGPLF+EL
Sbjct  289   YQATGLYQGKKITISKQDHGTHWPLHLLALSLSCSLLAGILGGLLGVGSGFVMGPLFIEL  348

Query  1487  GVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIA  1666
             G+ PQ++SA+A+  M F++S+SV +YYLLKRFPVPYAL+LT V+T+AA+IGQ ++ +L+ 
Sbjct  349   GIAPQLASASASLGMTFTASISVAQYYLLKRFPVPYALYLTLVSTIAAYIGQKIIDKLVN  408

Query  1667  VLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             +  RASLIIF+L+FTI VSAI+LGGVGIS MI++I N+EYMGFE  C
Sbjct  409   IFQRASLIIFVLSFTILVSAIALGGVGISRMIQRIQNNEYMGFEEFC  455



>ref|XP_008228546.1| PREDICTED: uncharacterized protein LOC103327947 isoform X1 [Prunus 
mume]
 ref|XP_008228547.1| PREDICTED: uncharacterized protein LOC103327947 isoform X1 [Prunus 
mume]
Length=478

 Score =   405 bits (1041),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 279/476 (59%), Positives = 368/476 (77%), Gaps = 9/476 (2%)
 Frame = +2

Query  389   AGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQP  568
             +G  W  LR L+ + +  +LA  FVSA+  L+ +  + T       +D +     FL  P
Sbjct  5     SGSNWWSLR-LLGMVY-LVLALVFVSAQEILEQQPSSQTLGEEVESNDLIRA-SKFLSHP  61

Query  569   KESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATA  748
                 Y H+WP M  GW+I IG+IIGF+GAAFGSVGGVGGGG FVPML+L++GFD KS+TA
Sbjct  62    DGVVYKHVWPGMRFGWKIAIGTIIGFLGAAFGSVGGVGGGGFFVPMLTLIIGFDQKSSTA  121

Query  749   ISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWM  928
             ISKCMI   A ++V YNL+LRHPTL++P+IDYDLA+L QPML+LGISIGV+ NV+ ++WM
Sbjct  122   ISKCMITSGAAATVFYNLRLRHPTLELPLIDYDLALLFQPMLVLGISIGVSLNVLLSEWM  181

Query  929   VTVLLIVLFIGTSTKAFLRGVETWKKETIMKK---EAAQQLAANGSGGQGEYKLLPGGPG  1099
             +T+LLI++ +GTSTK+FLRG+ETWKKETI KK   +A++ L + G+G   E   +PGG G
Sbjct  182   ITILLIIVLLGTSTKSFLRGIETWKKETITKKNLLDASKSLQSKGAG--SEDITIPGGVG  239

Query  1100  NGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQ  1279
             N T +T KE+  K+VSI+ NV W++ G++  VW+  LALQI KNY++ CS +YW++NLLQ
Sbjct  240   NDTTET-KETKRKKVSILHNVRWRQLGVIVIVWIIILALQIAKNYSTKCSVVYWILNLLQ  298

Query  1280  IPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggf  1459
             IPV++G+  +EA  LYKG R I SKG+ G+N R  +L+ YC  G++AG++GGLLGLGGGF
Sbjct  299   IPVTVGITSYEAVKLYKGSRIIESKGEGGANWRVHKLVSYCVLGIVAGILGGLLGLGGGF  358

Query  1460  imgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIG  1639
             IMGP+FLE+G+PPQVSSATATF M FSSSMSVVEYYLLKRFP+PYAL+  AVATV+A +G
Sbjct  359   IMGPVFLEMGIPPQVSSATATFIMTFSSSMSVVEYYLLKRFPIPYALYFAAVATVSAIMG  418

Query  1640  QHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             Q++V ++I  LGRASLIIFILA TIFVSA++LGGVGI+NM++KI + E +GFE +C
Sbjct  419   QYLVGKVIKALGRASLIIFILALTIFVSALTLGGVGIANMVKKIEHKESLGFEKMC  474



>gb|EMS50771.1| hypothetical protein TRIUR3_13143 [Triticum urartu]
Length=355

 Score =   397 bits (1021),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 257/404 (64%), Positives = 305/404 (75%), Gaps = 51/404 (13%)
 Frame = +2

Query  602   MELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAV  781
             ME GW++V+G++IGF GA+FGSVGGVGGGGIFVPML+L++GFDPKS+TAISKCMI GAA+
Sbjct  1     MEFGWKMVLGALIGFFGASFGSVGGVGGGGIFVPMLTLIIGFDPKSSTAISKCMITGAAI  60

Query  782   SSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIG  961
             S+V+YNLKL+HPTLDMP+IDYDLA+LIQPMLMLGISIGV FNVIF DW+VTVLLI+LF+G
Sbjct  61    STVYYNLKLKHPTLDMPVIDYDLALLIQPMLMLGISIGVIFNVIFPDWLVTVLLIILFLG  120

Query  962   TSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTAKESSEKQ  1141
             TSTKAFL+GVETWKKETI+K+EA ++L       + EY  L  GPG       K  S++ 
Sbjct  121   TSTKAFLKGVETWKKETIIKREAEKRLEQTSE--EPEYAPLSTGPGAAAD--VKPHSDEA  176

Query  1142  VSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATG  1321
              S+++N+YWKEFGLL FVW++FLA+QI KNY  TCST YWV+N LQIPVS+GV ++EA G
Sbjct  177   PSLMKNIYWKEFGLLTFVWLAFLAIQITKNYAPTCSTWYWVLNFLQIPVSVGVTMYEALG  236

Query  1322  LYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQ  1501
             L  G R +SSKG+  + L+  QL +YCFFG+ AG+VGGLLGLGGGFIMGPLFLELG+PPQ
Sbjct  237   LMNGKRVLSSKGNEQTTLKFHQLCIYCFFGVTAGLVGGLLGLGGGFIMGPLFLELGIPPQ  296

Query  1502  VssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRA  1681
             VSSATATFAMMFS+SMSVVEYYLL RFPVPY                             
Sbjct  297   VSSATATFAMMFSASMSVVEYYLLNRFPVPY-----------------------------  327

Query  1682  SLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
                               GGVGISNMI K+  HEYMGFENLCKY
Sbjct  328   ------------------GGVGISNMIHKMEQHEYMGFENLCKY  353



>ref|XP_007217721.1| hypothetical protein PRUPE_ppa005105mg [Prunus persica]
 gb|EMJ18920.1| hypothetical protein PRUPE_ppa005105mg [Prunus persica]
Length=477

 Score =   402 bits (1033),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 272/459 (59%), Positives = 358/459 (78%), Gaps = 7/459 (2%)
 Frame = +2

Query  440   FLLASAFVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWE  619
              +LA  FVSA+  L+ +  + T       +D +     FL  P    Y H+WPEM  GW+
Sbjct  19    LVLALVFVSAQEILEQQPSSQTLGEEVESNDLIRA-SKFLSHPGGVVYKHVWPEMRFGWK  77

Query  620   IVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYN  799
             I +G+IIGF+GAAFGSVGGVGGGG FVPML+L++GFD KS+TAISKCMI   A ++V YN
Sbjct  78    IAVGTIIGFLGAAFGSVGGVGGGGFFVPMLTLIIGFDQKSSTAISKCMITSGAAATVFYN  137

Query  800   LKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAF  979
             L+LRHPTL++P+IDYDLA+L QPML+LGISIGV+ NV+ ++WM+T+LLI++ +GTST++F
Sbjct  138   LRLRHPTLELPLIDYDLALLFQPMLVLGISIGVSLNVVLSEWMITILLIIVLLGTSTRSF  197

Query  980   LRGVETWKKETIMKK---EAAQQLAANGSGGQGEYKLLPGGPGNGTQDTAKESSEKQVSI  1150
              RGVETWKKETI KK   +A++ L + G+G   E   +PG  GN T +T KE+  K+VSI
Sbjct  198   FRGVETWKKETITKKNLLDASKSLQSKGAG--SEDITIPGEVGNDTTET-KETKRKKVSI  254

Query  1151  IENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYK  1330
             + NV W++ G++  VW+  LALQI KNY + CS +YW++NLLQIPV++G+  +EA  LYK
Sbjct  255   LHNVGWRQLGVIVIVWIIILALQIAKNYAAKCSVVYWILNLLQIPVTVGITSYEAVKLYK  314

Query  1331  GWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVss  1510
             G R I SKG+ G+N R  +L+ YC FG++AG++GGLLGLGGGFIMGP+FLE+G+PPQVSS
Sbjct  315   GSRIIESKGEGGANWRVHKLVSYCAFGIVAGLLGGLLGLGGGFIMGPVFLEMGIPPQVSS  374

Query  1511  atatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLI  1690
             ATATF M FSSSMSVVEYYLLKRFP+PYAL+  AVA V+A +GQ++V ++I  LGRASLI
Sbjct  375   ATATFIMTFSSSMSVVEYYLLKRFPIPYALYFAAVAIVSAIMGQYLVGKVIKALGRASLI  434

Query  1691  IFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  1807
             IFILA TIFVSA++LGGVGI+NM++KI + EY+ FE++C
Sbjct  435   IFILALTIFVSALTLGGVGIANMVKKIEHKEYLWFESMC  473



>tpg|DAA39926.1| TPA: hypothetical protein ZEAMMB73_327447 [Zea mays]
Length=497

 Score =   402 bits (1033),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 269/440 (61%), Positives = 332/440 (75%), Gaps = 32/440 (7%)
 Frame = +2

Query  578   GYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISK  757
              Y H+WP M  GW +V+GS+IGF GAA GSVGGVGGGGIFVPML+L+VGFDPKS+TAISK
Sbjct  60    AYHHVWPPMGFGWRVVVGSLIGFFGAACGSVGGVGGGGIFVPMLALIVGFDPKSSTAISK  119

Query  758   CMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTV  937
             CMIMG +VS+V+YNLK +HP+LDMP+IDYDLA+L+QPMLMLG+SIGV FNVIF DW++T 
Sbjct  120   CMIMGGSVSTVYYNLKRKHPSLDMPLIDYDLALLMQPMLMLGVSIGVIFNVIFPDWLITA  179

Query  938   LLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGN-----  1102
             LLI +F+ TSTKA+L+G ETWKKET+ K+   Q L       + E + +    GN     
Sbjct  180   LLITIFLVTSTKAYLKGFETWKKETVKKR---QMLLRLHRAARQETRQIMKRYGNLACIA  236

Query  1103  -------------------GTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIV  1225
                                   +TA  +  +  S+++N+YWKE GLL FVW++FL LQ+ 
Sbjct  237   VRTIAYIVRIRTCVHIYIDELMETACLALFQTSSVLKNIYWKELGLLAFVWIAFLGLQLT  296

Query  1226  K-NYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISS-KGDSG---SNLRAGQL  1390
             + NY ++CS  YWV+N LQ+PV++GV ++EA GL  G R +SS KG S    S LR  QL
Sbjct  297   RTNYAASCSVWYWVLNSLQVPVAVGVTVYEACGLRTGRRALSSNKGGSQQQQSALRIRQL  356

Query  1391  IVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYL  1570
             +VYC FG++AG+VGGLLG+GGGFIMGPLFLELG+PPQVSSATATF MMFSSSMSVVEYYL
Sbjct  357   LVYCLFGVLAGLVGGLLGMGGGFIMGPLFLELGIPPQVSSATATFTMMFSSSMSVVEYYL  416

Query  1571  LKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGI  1750
             L RFPVPYA + T VA VAA  GQH VR+LIA LGRASLIIFILA  IFVSA++LGGVGI
Sbjct  417   LHRFPVPYAAYFTGVAFVAAITGQHCVRKLIAWLGRASLIIFILASMIFVSALTLGGVGI  476

Query  1751  SNMIEKIHNHEYMGFENLCK  1810
             SN++ ++  H+YMGFE+LCK
Sbjct  477   SNIVHRVERHQYMGFESLCK  496



>ref|XP_006580862.1| PREDICTED: uncharacterized protein LOC100818240 [Glycine max]
Length=422

 Score =   399 bits (1024),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 253/420 (60%), Positives = 330/420 (79%), Gaps = 14/420 (3%)
 Frame = +2

Query  602   MELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAV  781
             M+ GW+I++G+I+GF+G+AFG+VGGVGGGGIFVPML+L++GFD KSA AISKCMI G A 
Sbjct  1     MKYGWKIIVGTIVGFLGSAFGNVGGVGGGGIFVPMLTLIIGFDAKSAIAISKCMITGGAT  60

Query  782   SSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIG  961
             ++V YNL+ RHPTLD+P+IDYDLA+L QPMLMLGISIGV+FNVIF DWM+T LLI+ F G
Sbjct  61    ATVFYNLRQRHPTLDLPVIDYDLALLFQPMLMLGISIGVSFNVIFPDWMLTTLLIISFTG  120

Query  962   TSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQ---GEYKLLPGGPGN--------GT  1108
              S K+F +GV+TWK+ET+M KEA++    +G GG       +L     GN         T
Sbjct  121   ISVKSFFKGVDTWKQETLMMKEASKNSLTDGRGGSTCIATRQLSLQNIGNPEDDAHYIKT  180

Query  1109  QDTAKES---SEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQ  1279
              D  K++   S K+VS+I+NV+WKE GLL  VW+  LAL+I KNYT+TCS +YWV+NLLQ
Sbjct  181   IDPVKDNTNQSRKKVSVIDNVHWKELGLLFAVWIMILALEIGKNYTTTCSGVYWVINLLQ  240

Query  1280  IPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggf  1459
             +P+++G++ ++A  LYKG R I+SKGD  ++ R  QLIV+C  G++AG + GLLGLGGGF
Sbjct  241   VPIAVGMSSYQAMRLYKGQRIIASKGDQQTHWRVLQLIVFCACGILAGTIAGLLGLGGGF  300

Query  1460  imgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIG  1639
             I+ PLFL LG+PPQV+SAT+  AM FS+S++VVEYYLLKRFP+ YAL+  AVAT AA +G
Sbjct  301   ILAPLFLGLGIPPQVASATSILAMAFSASIAVVEYYLLKRFPISYALYFVAVATAAALVG  360

Query  1640  QHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  1819
             QH+VR++IA+LGRAS+IIFIL  T+ VSA+ LGGVG++NMI++I N EYMGF NLC Y V
Sbjct  361   QHLVRKVIAMLGRASVIIFILTLTLCVSAVLLGGVGVANMIKRIENKEYMGFGNLCTYKV  420



>ref|XP_009394307.1| PREDICTED: uncharacterized protein LOC103979817 [Musa acuminata 
subsp. malaccensis]
Length=489

 Score =   400 bits (1029),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 269/492 (55%), Positives = 350/492 (71%), Gaps = 23/492 (5%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASAFVSAERSLKNEEV----AGTNVSRNSDDDYL---  538
             MA +  + R L  ++ L   F+  S    AER L++  V     G+   R+ +DD L   
Sbjct  1     MAPSPERRRWLAVVLLLCSGFVFGSRSALAERPLRSSLVQAASGGSFRGRDVEDDTLPLR  60

Query  539   ----STFVNFLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPM  706
                 S F N           H WP++ELGW +V+GS I F+G+A GS+GGVGGGGIFVPM
Sbjct  61    NLARSLFGN-------GSRAHNWPDLELGWRVVLGSAIAFVGSALGSIGGVGGGGIFVPM  113

Query  707   LSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGI  886
             L L++GFD K++ AISKCMIMGAA S+V+YNL+ RHPTLD+PI+DYDLA+L QPMLMLGI
Sbjct  114   LVLIIGFDLKTSAAISKCMIMGAAGSAVYYNLRFRHPTLDLPIMDYDLALLFQPMLMLGI  173

Query  887   SIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGS---  1057
             SIGV FNVIFA+WM+T +L++LF+GTSTKAFL+G+ETWKKET++ K+AA+ L ++ +   
Sbjct  174   SIGVAFNVIFAEWMITAILVILFLGTSTKAFLKGLETWKKETVLLKDAARHLDSSTNLKD  233

Query  1058  GGQGEYKLLPGGPGNGTQDTAKESSE--KQVSIIENVYWKEFGLLCFVWVSFLALQIVKN  1231
             G + EY  LP GP    Q  +  S      V I EN+Y KE  LL  VWV FL +QI+K 
Sbjct  234   GPELEYAPLPEGPLANEQPKSSASGAVLTIVPIKENIYVKELMLLLIVWVGFLVIQIIKT  293

Query  1232  YTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFg  1411
             +   CS  YW+ N +Q+P++  + L+EA  LY+G R I+S G    N R  QL+ YC  G
Sbjct  294   HAVICSPEYWIFNFMQVPIAAALTLYEAICLYRGKRTIASTGKQEMNWRPHQLVFYCCCG  353

Query  1412  miagvvggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVP  1591
             +IAGVVGGLLGLGGGFI+GPLF+ELGVPPQV+SAT+ F M FSSS+SVV+YYLL RFPVP
Sbjct  354   VIAGVVGGLLGLGGGFILGPLFIELGVPPQVASATSNFVMAFSSSISVVQYYLLDRFPVP  413

Query  1592  YalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKI  1771
             Y+ +L  VAT+AA  GQH+VR++I ++GRASLIIFILA TI VSAI +GG+G+ +++ K+
Sbjct  414   YSAYLLCVATLAAVAGQHMVRKMIILIGRASLIIFILALTILVSAIGIGGLGMEDVVGKL  473

Query  1772  HNHEYMGFENLC  1807
                E+MGFENLC
Sbjct  474   ARKEHMGFENLC  485



>ref|XP_002460083.1| hypothetical protein SORBIDRAFT_02g022500 [Sorghum bicolor]
 gb|EER96604.1| hypothetical protein SORBIDRAFT_02g022500 [Sorghum bicolor]
Length=455

 Score =   398 bits (1023),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 262/413 (63%), Positives = 322/413 (78%), Gaps = 16/413 (4%)
 Frame = +2

Query  578   GYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISK  757
              Y H+WP ME GW +V+GS+IGF GAA GSVGGVGGGGIFVPML+L++GFDPKS+TAISK
Sbjct  56    AYHHVWPPMEFGWRVVVGSLIGFFGAACGSVGGVGGGGIFVPMLALIIGFDPKSSTAISK  115

Query  758   CMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTV  937
                        +YNLKL+HP+LDMP+IDYDLA+L+QPMLMLG+SIGV FNVIF +W++T 
Sbjct  116   ----------FYYNLKLKHPSLDMPLIDYDLALLMQPMLMLGVSIGVIFNVIFPNWLITA  165

Query  938   LLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDT  1117
             LLI +F+ TSTKA+L+G ETWKKETI K+E A++        Q     +P G  +   D 
Sbjct  166   LLITIFLVTSTKAYLKGFETWKKETIKKREDARR---KEQICQEPEHAIPIG-SDAPADK  221

Query  1118  AKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLG  1297
             AK  +++  S+++N+YWKEFGLL FVWV+FL LQ+ KNY ++CS  YWV+N LQIPV++G
Sbjct  222   AKTPTDEATSVLKNIYWKEFGLLAFVWVAFLGLQVTKNYVASCSVWYWVLNSLQIPVAVG  281

Query  1298  VALFEATGLYKGWRKI--SSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgp  1471
             V ++EA GL  G R +         S LR  QL+VYC FG++AG++GGLLG+GGGFIMGP
Sbjct  282   VTVYEAYGLRTGKRVLSSKGSSQQQSTLRIRQLLVYCLFGILAGLIGGLLGMGGGFIMGP  341

Query  1472  lflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVV  1651
             LFLELG+PPQVSSATATF MMFSSSMSVVEYYLL RFPVPYA + T VA VAA  GQH V
Sbjct  342   LFLELGIPPQVSSATATFTMMFSSSMSVVEYYLLHRFPVPYAAYFTGVAFVAAITGQHFV  401

Query  1652  RRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  1810
             R+LIA LGRASLIIFILA  IFVSA++LGGVGISN++ ++  HEYMGFE+LCK
Sbjct  402   RKLIAWLGRASLIIFILASMIFVSALTLGGVGISNIVHRMERHEYMGFESLCK  454



>ref|XP_007159577.1| hypothetical protein PHAVU_002G249100g [Phaseolus vulgaris]
 gb|ESW31571.1| hypothetical protein PHAVU_002G249100g [Phaseolus vulgaris]
Length=463

 Score =   399 bits (1024),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 252/416 (61%), Positives = 322/416 (77%), Gaps = 7/416 (2%)
 Frame = +2

Query  581   YDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKC  760
             Y H WP M+ GW+I++GSI+GF+G+AFG+VGGVGGGGIFVPML+L++GFD KSA AISKC
Sbjct  50    YPHTWPSMKFGWKIIVGSIVGFLGSAFGNVGGVGGGGIFVPMLTLIIGFDTKSAIAISKC  109

Query  761   MIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVL  940
             MI G A ++V YNL+ RHPTLD+P+IDYDLA+L  PMLMLGISIGV FN+IF +WM+TVL
Sbjct  110   MITGGATATVFYNLRQRHPTLDLPVIDYDLALLFTPMLMLGISIGVAFNLIFPEWMLTVL  169

Query  941   LIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTA  1120
             LI+LF+G S K F +GVETWKKETIMKKEA ++ +        E           T+D A
Sbjct  170   LIILFVGLSIKCFFKGVETWKKETIMKKEAKKKNSRISDIATPE----DAAHYIQTEDPA  225

Query  1121  KESSE---KQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVS  1291
             KE ++   K+VSI+EN+ W E G L  VW   L+L+I KNY +TCS +YW VNLLQ+P++
Sbjct  226   KEDTKEPRKKVSIVENIRWTELGHLFTVWFMILSLEIGKNYATTCSKVYWAVNLLQVPIA  285

Query  1292  LGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgp  1471
             +G++ ++A  LYKG R I+SKGD     R  QLI++C  G +AG V GLLGLGGGFI+ P
Sbjct  286   VGMSSYQAMRLYKGQRVIASKGDQQRKWRVWQLILFCGCGTLAGTVAGLLGLGGGFILAP  345

Query  1472  lflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVV  1651
             LFL LG+PPQV+SAT+  AM FS+SM+ +EYYLLKRFPV YAL+L AVAT A+ +GQH+V
Sbjct  346   LFLGLGIPPQVASATSILAMAFSASMAALEYYLLKRFPVRYALYLVAVATAASLVGQHLV  405

Query  1652  RRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  1819
             R+++AVLGRAS+IIFIL FT+ VSA+ LGG G+++MI+KI + EYMGF NLC Y V
Sbjct  406   RKMVAVLGRASVIIFILTFTLCVSAVLLGGSGVAHMIQKIEHKEYMGFGNLCTYKV  461



>ref|XP_006585192.1| PREDICTED: uncharacterized protein LOC100801244 [Glycine max]
Length=406

 Score =   396 bits (1018),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 248/408 (61%), Positives = 325/408 (80%), Gaps = 6/408 (1%)
 Frame = +2

Query  602   MELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAV  781
             ME GW+I++G+++GF+G+AFG+VGGVGGGGIFVPML+L++GFD KSA AISKCMI G A 
Sbjct  1     MEYGWKIIVGTMVGFLGSAFGNVGGVGGGGIFVPMLTLIIGFDAKSAIAISKCMITGGAT  60

Query  782   SSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIG  961
             ++V YNL+ RHPTLD+P+IDYDLA+L QPMLMLGISIGV+FNVIF DWM+T LLI+ F G
Sbjct  61    ATVFYNLRQRHPTLDLPVIDYDLALLFQPMLMLGISIGVSFNVIFPDWMLTTLLIIFFTG  120

Query  962   TSTKAFLRGVETWKKETIMKKEAAQ--QLAANGSGGQGEYKLLPGGPGNGTQDTAKESSE  1135
              S K+F +GV+TWK+ET++ KEA +  Q+   GS     + +  G P    +D   + S 
Sbjct  121   ISVKSFFKGVDTWKQETLIVKEARKNSQIDDIGSPEDAAHYIQTGDP---VKDNTNQ-SR  176

Query  1136  KQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEA  1315
             K+VS+IEN++W E GLL  VW+  LAL+I KNYT+TCS +YWV+NLLQ+P+++G++ ++A
Sbjct  177   KKVSVIENIHWNELGLLFAVWIMILALEIGKNYTTTCSGVYWVINLLQVPIAVGMSSYQA  236

Query  1316  TGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVP  1495
               LYKG R I SKGD  +N R  QLI++C  G++AG + GLLGLGGGFI+ PLFL +G+P
Sbjct  237   MRLYKGQRIIGSKGDQQTNWRVLQLILFCACGILAGTIAGLLGLGGGFILAPLFLGIGIP  296

Query  1496  PQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLG  1675
             PQV+SAT+  AM FS+SM+VVEYYLLKRFP+ YAL+  AVAT AA +GQH+VR++IA+LG
Sbjct  297   PQVASATSILAMAFSASMAVVEYYLLKRFPISYALYFVAVATAAALVGQHLVRKVIAILG  356

Query  1676  RASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  1819
             RAS+IIFIL  T+ VSA+ LGGVG++NMI++I N EYMGF NLC Y V
Sbjct  357   RASVIIFILTLTLCVSAVLLGGVGVANMIKRIENKEYMGFGNLCTYKV  404



>ref|XP_007159524.1| hypothetical protein PHAVU_002G244800g [Phaseolus vulgaris]
 gb|ESW31518.1| hypothetical protein PHAVU_002G244800g [Phaseolus vulgaris]
Length=462

 Score =   398 bits (1023),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 250/418 (60%), Positives = 326/418 (78%), Gaps = 8/418 (2%)
 Frame = +2

Query  581   YDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKC  760
             Y H WP ++ GW+I++GS++GF+G+AFG+VGGVGGGGIFVPML+L++GFD KSA AISKC
Sbjct  50    YPHTWPSIKFGWKIIVGSMVGFLGSAFGNVGGVGGGGIFVPMLTLIIGFDTKSAIAISKC  109

Query  761   MIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVL  940
             MI G A ++V YNL  RHPTLD+P+IDYDLA+L  PMLMLGISIGV FNVIF +WM+TVL
Sbjct  110   MITGGATATVFYNLIQRHPTLDLPVIDYDLALLFTPMLMLGISIGVAFNVIFPEWMLTVL  169

Query  941   LIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGGPGNGTQDTA  1120
             LI+LF+G S K+F +GVETWKKETIMKKEA +    +      +           T++ A
Sbjct  170   LIILFVGISIKSFFKGVETWKKETIMKKEAKKNSRIDDIATPKD-----AAHYIQTEEPA  224

Query  1121  KESSE---KQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVS  1291
             KE ++   K+VSI+EN+ WKE G L  +W+  LAL+I KNY +TCS  YW +NL+Q+P++
Sbjct  225   KEDTKEPRKKVSIVENIRWKELGYLFAIWIMILALEIGKNYATTCSEAYWALNLIQVPIA  284

Query  1292  LGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgp  1471
             +G++ ++A  LYKG R I+SKGD  ++ R  QLI++C  G +AG + GLLGLGGGFI+ P
Sbjct  285   VGMSSYQAVRLYKGQRVIASKGDQQTHWRVWQLILFCGCGTLAGTIAGLLGLGGGFILAP  344

Query  1472  lflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVV  1651
             LFL +G+PPQV+SAT+  AM FS+SM+ VEYYLLKRFPV YAL+L AVAT A+ +GQH+V
Sbjct  345   LFLGIGIPPQVASATSILAMAFSASMAAVEYYLLKRFPVRYALYLVAVATAASLVGQHLV  404

Query  1652  RRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV*N  1825
             R+++AVLGRAS+IIFIL FT+ VSA+ LGGVG+S+MI+KI + EYMGF NLC Y V N
Sbjct  405   RKMVAVLGRASVIIFILTFTLSVSAVLLGGVGVSHMIQKIEHKEYMGFGNLCMYKVKN  462



>ref|XP_010314281.1| PREDICTED: uncharacterized protein LOC101268364 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314282.1| PREDICTED: uncharacterized protein LOC101268364 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314283.1| PREDICTED: uncharacterized protein LOC101268364 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314284.1| PREDICTED: uncharacterized protein LOC101268364 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314285.1| PREDICTED: uncharacterized protein LOC101268364 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314286.1| PREDICTED: uncharacterized protein LOC101268364 isoform X1 [Solanum 
lycopersicum]
Length=468

 Score =   398 bits (1023),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 279/453 (62%), Positives = 359/453 (79%), Gaps = 10/453 (2%)
 Frame = +2

Query  458   FVSAERSLKNEEVAGTNVSRNSDDDYLSTFVNFLWQPKESGYDHIWPEMELGWEIVIGSI  637
             FV AE  + N    GTN   + +  Y       L    +  Y H WPE+E GW +++GS+
Sbjct  23    FVCAEEIVAN---GGTN--DDFESSYFFKIFKILLHKAKLHYQHFWPELEFGWRVIVGSV  77

Query  638   IgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHP  817
             IGF  AAFGSVGGVGGGGIFVPML+L++GFDPK++TAISKCMI GAA ++V+YNLKLRHP
Sbjct  78    IGFFAAAFGSVGGVGGGGIFVPMLTLIIGFDPKTSTAISKCMITGAAGATVYYNLKLRHP  137

Query  818   TLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVET  997
              LD+PIIDYDLA+L+QPML+LGISIGV  N++FA+WMVTVLLI+LFI TST++F +GVET
Sbjct  138   ILDLPIIDYDLALLLQPMLLLGISIGVVLNILFAEWMVTVLLIILFIVTSTRSFFKGVET  197

Query  998   WKKETIMKKEAAQQLAANGSGGQ-GEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKE  1174
             WKKETI+KKE +++L +N +G +   YKLLPGGP    ++   ++ E  VSI++NVYWK+
Sbjct  198   WKKETIIKKEVSRRLTSNNAGAEVAAYKLLPGGP--RVRNEGYKTPE--VSIVDNVYWKD  253

Query  1175  FGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSK  1354
             F +L  VW+  L L I K YTSTCST YW++N+LQ+PV++G + +EA  LYKG R + S 
Sbjct  254   FTVLIAVWIILLVLHIFKTYTSTCSTTYWILNVLQVPVAVGASAYEAVFLYKGTRVVMSS  313

Query  1355  GDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplflELGVPPQVssatatfamm  1534
             G++    +  QLI+YC  G++AG+VGGLLGLGGGFI+GPLFLELG+PPQVSSATATF M+
Sbjct  314   GEAVITWKVHQLILYCCCGILAGIVGGLLGLGGGFILGPLFLELGIPPQVSSATATFVMI  373

Query  1535  fsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTI  1714
             FSSSMSV++YYL+ RFPVPYAL+  AVATVAA +GQHVVR++I+++GRAS+IIFILAFTI
Sbjct  374   FSSSMSVIQYYLIGRFPVPYALYFVAVATVAALVGQHVVRKIISIVGRASVIIFILAFTI  433

Query  1715  FVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             FVSA+SLGGVGI++ I KI   +YMGF+N+C Y
Sbjct  434   FVSALSLGGVGIADTIRKIKEGQYMGFDNICAY  466



>ref|XP_009611256.1| PREDICTED: uncharacterized protein LOC104104795 isoform X2 [Nicotiana 
tomentosiformis]
Length=453

 Score =   397 bits (1021),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 255/449 (57%), Positives = 332/449 (74%), Gaps = 2/449 (0%)
 Frame = +2

Query  380   MAGAGGKWRILRPLVALSWSFLLASA--FVSAERSLKNEEVAGTNVSRNSDDDYLSTFVN  553
             MA  G K + L         FL+ S+  F SAE+      ++    + + +  Y+    N
Sbjct  1     MAETGAKLKALTTYAVAVIGFLILSSNVFASAEQISDRITLSNNGTTHDFESGYVFNLFN  60

Query  554   FLWQPKESGYDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDP  733
              L Q  E  Y H+WPE+++GW +++GSIIGF  AA GSVGGVGGGGIFVPML+L++GFDP
Sbjct  61    ILRQKAEMHYHHVWPELQVGWRVIVGSIIGFFAAALGSVGGVGGGGIFVPMLTLIIGFDP  120

Query  734   KSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVI  913
             K++TAISKCMI GAA ++V+YNLKLRHPT+DMPIIDY+LA+L QPML+LGISIGV  NV+
Sbjct  121   KTSTAISKCMITGAAGATVYYNLKLRHPTMDMPIIDYNLALLFQPMLLLGISIGVVLNVL  180

Query  914   FADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKLLPGG  1093
             FA+WMVTVLLI+LFI  STKAF +GVETWK+ETI+KK  A +L +   G +  YKLLP G
Sbjct  181   FAEWMVTVLLIILFIAASTKAFSKGVETWKRETIIKKGVAGRLTSGAGGEEVAYKLLPEG  240

Query  1094  PGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNL  1273
               +G++   +     +V I +NVYWK+   L  VWV  L L I KNY+STCS  YW +NL
Sbjct  241   ANDGSRVEKEVYKAPEVPIDDNVYWKDITALVSVWVVILVLHISKNYSSTCSVTYWSLNL  300

Query  1274  LQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgg  1453
             LQ+PV++G ++++A  LYKG R I S  D+    +  QLI+ C  G++AG+VGGLLGLGG
Sbjct  301   LQVPVAVGASVYQAVCLYKGSRVIMSSRDAVIIWKVHQLILCCCCGILAGIVGGLLGLGG  360

Query  1454  gfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaaf  1633
             GFI+GPL LELG+PPQVSSAT TF M FSSSMS ++YYLL+RFP+PYAL+   V T+AAF
Sbjct  361   GFILGPLLLELGIPPQVSSATTTFVMTFSSSMSAIQYYLLRRFPIPYALYFVTVTTIAAF  420

Query  1634  IGQHVVRRLIAVLGRASLIIFILAFTIFV  1720
             +GQ+VVR++I+++GRAS+IIF+LAFTIFV
Sbjct  421   VGQNVVRKIISIVGRASVIIFVLAFTIFV  449



>gb|AET04372.2| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=474

 Score =   397 bits (1021),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 260/416 (63%), Positives = 323/416 (78%), Gaps = 2/416 (0%)
 Frame = +2

Query  581   YDHIWPEMELGWEIVIGSIIgfmgaafgsvggvggggIFVPMLSLVVGFDPKSATAISKC  760
             Y H WP M+ GW I++G+I+ F+G++FG+VGGVGGGGI VPML+L++GFD KSATAISKC
Sbjct  60    YKHTWPGMKFGWRIIVGTILAFLGSSFGTVGGVGGGGI-VPMLTLIIGFDAKSATAISKC  118

Query  761   MIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVL  940
             MI G A ++V YNL+ RHPTLD+P+IDYDLA+L QPMLMLGIS+GV FNVIF DWM+T L
Sbjct  119   MITGGAGATVLYNLRQRHPTLDLPVIDYDLALLFQPMLMLGISLGVAFNVIFPDWMITSL  178

Query  941   LIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQGEYKL-LPGGPGNGTQDT  1117
             +++ F G S KAFL+GV TWK ET+ KKEA      N      + +L L  G       T
Sbjct  179   ILIFFTGISVKAFLKGVNTWKNETLAKKEARDNSQLNDIRRIEDVELDLQAGESVNDNHT  238

Query  1118  AKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLG  1297
                   K+VS+IENV WKE GLL FVW+  LALQI K+YT TCS  YW++NLLQ+P+++G
Sbjct  239   NTNIQRKKVSVIENVSWKEVGLLFFVWIMILALQIGKSYTITCSVAYWILNLLQVPIAVG  298

Query  1298  VALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplf  1477
             V+ +EA  LYKG + I+SKGD G N    QLI+YC  G+IAG++GGLLGLGGGFI+ PLF
Sbjct  299   VSSYEAVLLYKGKKVIASKGDQGINWSVKQLILYCSCGIIAGLIGGLLGLGGGFILAPLF  358

Query  1478  lELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRR  1657
             L LG+PPQVSSAT+TFAM FS+SMSVVEYYLLKRFP+PYAL+   VATVAA +GQH+VR+
Sbjct  359   LGLGIPPQVSSATSTFAMTFSASMSVVEYYLLKRFPIPYALYFVVVATVAALVGQHLVRK  418

Query  1658  LIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV*N  1825
             LI +LGRAS+IIFILA T+FVS ISLGG GI+++I++  N EYMGF +LC Y V N
Sbjct  419   LIVLLGRASIIIFILALTVFVSGISLGGTGIASLIKRTENKEYMGFGSLCAYRVRN  474



>ref|XP_009784625.1| PREDICTED: uncharacterized protein LOC104233015 isoform X2 [Nicotiana 
sylvestris]
Length=373

 Score =   394 bits (1011),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 241/371 (65%), Positives = 309/371 (83%), Gaps = 1/371 (0%)
 Frame = +2

Query  704   MLSLVVGFDPKSATAISKCMIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLG  883
             ML+L++GFDPK++TAISKCMI GAA ++V+YNLKLRHPTLD+PIIDYDLA+L+QPML+LG
Sbjct  1     MLTLIIGFDPKTSTAISKCMITGAAGATVYYNLKLRHPTLDLPIIDYDLALLLQPMLLLG  60

Query  884   ISIGVTFNVIFADWMVTVLLIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSG-  1060
             ISIGV  N +FADWMVTVLLI+LFI TSTK+F +GVETWKKETI+KKE +++LA++ +G 
Sbjct  61    ISIGVVLNTLFADWMVTVLLIILFIATSTKSFFKGVETWKKETIIKKEVSRRLASSNAGA  120

Query  1061  GQGEYKLLPGGPGNGTQDTAKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTS  1240
             G   YKLLPGGP NG +         +VSI+ENVYWK+F ++  VWV  L L + KNYT 
Sbjct  121   GDATYKLLPGGPTNGVRVRNDGYKTPEVSIVENVYWKDFAVILAVWVILLLLHLFKNYTP  180

Query  1241  TCSTLYWVVNLLQIPVSLGVALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmia  1420
             TCST YW++NLLQ+PV++G + +EA  LYKG R + S G++    +  QLI+YC  G++A
Sbjct  181   TCSTTYWILNLLQVPVAVGASAYEAVCLYKGTRVVMSSGEAVITWKVHQLILYCCCGILA  240

Query  1421  gvvggllglgggfimgplflELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYal  1600
             G+VGGLLGLGGGFI+GPLFLELG+PPQVSSATATF M+FSSSMS ++YYLL+RFPVPYAL
Sbjct  241   GIVGGLLGLGGGFILGPLFLELGIPPQVSSATATFVMIFSSSMSAIQYYLLRRFPVPYAL  300

Query  1601  fltavatvaafIGQHVVRRLIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNH  1780
             +  AVATVAA +GQHVVR++I+++GRAS+IIF+LAFTIFVSA++LGG GI++ I +I   
Sbjct  301   YFVAVATVAALVGQHVVRKIISIVGRASVIIFVLAFTIFVSALTLGGFGIADTIRRIKEG  360

Query  1781  EYMGFENLCKY  1813
             +YMGF+N+C Y
Sbjct  361   QYMGFDNICAY  371



>gb|AEI72271.1| hypothetical protein [Citrus trifoliata]
Length=353

 Score =   391 bits (1004),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 238/352 (68%), Positives = 286/352 (81%), Gaps = 1/352 (0%)
 Frame = +2

Query  761   MIMGAAVSSVHYNLKLRHPTLDMPIIDYDLAVLIQPMLMLGISIGVTFNVIFADWMVTVL  940
             MI G AV++V YNL+ RHPTLDMP+IDYDLA+L QPML+LGISIGV FNVIFADWM+TVL
Sbjct  1     MITGTAVATVVYNLRQRHPTLDMPVIDYDLALLFQPMLVLGISIGVAFNVIFADWMITVL  60

Query  941   LIVLFIGTSTKAFLRGVETWKKETIMKKEAAQQLAANGSGGQG-EYKLLPGGPGNGTQDT  1117
             LI+LFIG S KAFL+GVETWKKETI K EAA++L  + +G Q  E+K  P    N T   
Sbjct  61    LIILFIGMSAKAFLKGVETWKKETITKVEAAKRLELDRNGDQAEEFKCEPENLSNTTPKE  120

Query  1118  AKESSEKQVSIIENVYWKEFGLLCFVWVSFLALQIVKNYTSTCSTLYWVVNLLQIPVSLG  1297
              KE  + + SI++N+YWKE GLL  VWV  LALQI KNYT+TCS LYWV+N LQIPV+ G
Sbjct  121   TKEPVKSEGSILKNIYWKELGLLVAVWVIVLALQIAKNYTATCSVLYWVLNFLQIPVAGG  180

Query  1298  VALFEATGLYKGWRKISSKGDSGSNLRAGQLIVYCFFgmiagvvggllglgggfimgplf  1477
             V+ +EA  LYKG R I+SKGD G+N R  QL+ YC  G+ AGVVGGLLGLGGGFI+GPLF
Sbjct  181   VSAYEAVALYKGRRTIASKGDVGTNWRPHQLVFYCACGITAGVVGGLLGLGGGFILGPLF  240

Query  1478  lELGVPPQVssatatfammfsssmsVVEYYLLKRFPVPYalfltavatvaafIGQHVVRR  1657
             LELG+PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+  AV+T+AAF+GQHVVR+
Sbjct  241   LELGIPPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYFFAVSTIAAFVGQHVVRK  300

Query  1658  LIAVLGRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  1813
             LI +LGRAS+IIF L+ TIFVSA+SL G+G++ M+ +I   EYMGF+++C Y
Sbjct  301   LINILGRASIIIFTLSLTIFVSALSLSGIGLAKMVPRIDRKEYMGFDSICSY  352



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7297527788884