BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19023_g1_i3 len=1922 path=[2092:0-811 97:812-852 @2943@!:853-1290
3381:1291-1921]

Length=1922
                                                                      Score     E

ref|XP_009619333.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    748   0.0      
ref|XP_004249093.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    742   0.0      
ref|XP_006364750.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    716   0.0      
ref|XP_009763181.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    662   0.0      
ref|XP_011079138.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    637   0.0      
ref|XP_011041313.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    631   0.0      
ref|XP_007028169.1|  Zinc induced facilitator-like 1 isoform 1          629   0.0      
ref|XP_002322579.2|  hypothetical protein POPTR_0016s02500g             623   0.0      Populus trichocarpa [western balsam poplar]
emb|CDP11656.1|  unnamed protein product                                623   0.0      
gb|EYU20856.1|  hypothetical protein MIMGU_mgv1a005872mg                621   0.0      
ref|XP_002307932.2|  hypothetical protein POPTR_0006s02710g             619   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011079140.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    618   0.0      
ref|XP_003632620.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    616   0.0      
ref|XP_011079141.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    615   0.0      
ref|XP_010653665.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    614   0.0      
ref|XP_009608804.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    611   0.0      
ref|XP_009776344.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    607   0.0      
ref|XP_007028170.1|  Zinc induced facilitator-like 1 isoform 2          600   0.0      
ref|XP_010067061.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    598   0.0      
ref|XP_002277598.2|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    598   0.0      Vitis vinifera
emb|CBI29172.3|  unnamed protein product                                589   0.0      
ref|XP_011032990.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    588   0.0      
gb|KCW65127.1|  hypothetical protein EUGRSUZ_G02630                     586   0.0      
ref|XP_010036423.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    587   0.0      
ref|XP_010067054.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    586   0.0      
ref|XP_002310957.2|  hypothetical protein POPTR_0008s01110g             586   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009355075.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    583   0.0      
ref|XP_007010371.1|  Zinc induced facilitator-like 1 isoform 1          583   0.0      
ref|XP_006347686.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    583   0.0      
ref|XP_008346199.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    583   0.0      
ref|XP_008346187.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    582   0.0      
ref|XP_008354840.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    582   0.0      
ref|XP_006347684.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    582   0.0      
ref|XP_006347687.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    581   0.0      
ref|XP_004230051.2|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    580   0.0      
ref|XP_010659034.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    580   0.0      
ref|XP_009355074.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    579   0.0      
emb|CBI29168.3|  unnamed protein product                                580   0.0      
gb|KCW47973.1|  hypothetical protein EUGRSUZ_K01705                     579   0.0      
ref|XP_002277751.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    578   0.0      Vitis vinifera
ref|XP_010251709.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    577   0.0      
ref|XP_009608807.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    576   0.0      
ref|XP_006347685.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    576   0.0      
ref|XP_009776345.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    573   0.0      
gb|KHG08311.1|  protein zinc induced facilitator-like 1                 575   0.0      
ref|XP_010557810.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    573   0.0      
ref|XP_009355073.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    572   0.0      
ref|XP_009776342.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    572   0.0      
ref|XP_008231756.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    572   0.0      
ref|XP_010067056.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    571   0.0      
ref|XP_011041314.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    567   0.0      
gb|KDP27074.1|  hypothetical protein JCGZ_22071                         570   0.0      
ref|XP_007010372.1|  Zinc induced facilitator-like 1 isoform 2          569   0.0      
ref|XP_010673231.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    569   0.0      
ref|XP_007217932.1|  hypothetical protein PRUPE_ppa004919mg             568   0.0      
ref|XP_010673232.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    568   0.0      
ref|XP_010067060.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    568   0.0      
ref|XP_006471269.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    567   0.0      
ref|XP_010041137.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    567   0.0      
gb|KDO47752.1|  hypothetical protein CISIN_1g011424mg                   566   0.0      
ref|XP_010067057.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    563   0.0      
ref|XP_010251716.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    578   0.0      
ref|XP_002527379.1|  carbohydrate transporter, putative                 563   0.0      Ricinus communis
ref|XP_007028171.1|  Zinc induced facilitator-like 1 isoform 3          560   0.0      
ref|XP_010067055.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    560   0.0      
ref|XP_010453472.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    558   0.0      
emb|CDX78536.1|  BnaA03g04480D                                          557   0.0      
ref|XP_004516554.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    557   0.0      
ref|XP_009131358.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    556   0.0      
ref|XP_006286669.1|  hypothetical protein CARUB_v10002619mg             556   0.0      
ref|XP_006399873.1|  hypothetical protein EUTSA_v10013417mg             555   0.0      
emb|CDX70518.1|  BnaC03g06020D                                          555   0.0      
ref|XP_010492149.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    554   0.0      
gb|KDO47758.1|  hypothetical protein CISIN_1g011424mg                   553   0.0      
ref|XP_011086111.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    554   0.0      
ref|XP_006347688.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    551   0.0      
ref|XP_002871583.1|  hypothetical protein ARALYDRAFT_488196             552   0.0      
gb|KFK25600.1|  hypothetical protein AALP_AA8G135600                    552   0.0      
emb|CDY65960.1|  BnaA10g29800D                                          551   0.0      
gb|KEH19210.1|  zinc induced facilitator-like protein                   551   0.0      
ref|XP_004230052.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    551   0.0      
ref|XP_010419980.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    551   0.0      
ref|XP_009121731.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    551   0.0      
ref|XP_008777370.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    551   0.0      
ref|XP_010453471.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    550   0.0      
ref|XP_009776346.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    548   0.0      
ref|XP_008445955.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    550   0.0      
ref|XP_010036424.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    549   0.0      
ref|XP_010036425.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    548   0.0      
ref|XP_008777369.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    548   0.0      
ref|XP_003542783.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    548   0.0      
emb|CDP18958.1|  unnamed protein product                                548   0.0      
ref|XP_009121733.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    548   0.0      
gb|KDO47751.1|  hypothetical protein CISIN_1g011424mg                   546   0.0      
gb|KEH19209.1|  zinc induced facilitator-like protein                   546   0.0      
ref|XP_010547293.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    546   0.0      
ref|XP_010557818.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    546   0.0      
ref|XP_010251712.1|  PREDICTED: probable peptide/nitrate transpor...    545   0.0      
ref|XP_010922099.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    545   0.0      
ref|XP_010045119.1|  PREDICTED: probable peptide/nitrate transpor...    545   0.0      
ref|XP_009763182.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    541   0.0      
ref|XP_003542784.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    543   0.0      
ref|NP_851036.1|  zinc induced facilitator-like 1 protein               543   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009776343.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    541   0.0      
ref|XP_004515444.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    542   0.0      
ref|XP_008364744.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    541   0.0      
ref|XP_010557819.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    541   0.0      
ref|XP_010557815.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    541   0.0      
gb|KHN10321.1|  Protein ZINC INDUCED FACILITATOR-LIKE 1                 541   0.0      
ref|XP_007133567.1|  hypothetical protein PHAVU_011G189900g             541   0.0      
emb|CDX70517.1|  BnaC03g06010D                                          541   0.0      
ref|XP_010492148.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    541   0.0      
ref|XP_010419976.1|  PREDICTED: protein ZINC INDUCED FACILITATOR 1      541   0.0      
ref|XP_010492150.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    540   0.0      
ref|XP_010453469.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    539   0.0      
ref|XP_010557807.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    538   0.0      
ref|XP_010453500.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    536   0.0      
gb|KDO47759.1|  hypothetical protein CISIN_1g011424mg                   534   0.0      
ref|XP_007016707.1|  Zinc induced facilitator-like 2                    551   0.0      
ref|XP_004516549.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    534   0.0      
ref|XP_003542780.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    535   0.0      
ref|XP_004516552.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    535   0.0      
ref|XP_010492151.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    535   0.0      
ref|XP_011042021.1|  PREDICTED: probable peptide/nitrate transpor...    535   0.0      
ref|XP_004135359.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    535   0.0      
emb|CDX78535.1|  BnaA03g04470D                                          535   0.0      
dbj|BAE71198.1|  putative transporter-like protein                      535   0.0      Trifolium pratense [peavine clover]
ref|XP_009410441.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    534   0.0      
ref|XP_010909581.1|  PREDICTED: probable peptide/nitrate transpor...    534   0.0      
ref|XP_010492179.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    534   0.0      
gb|KHN10320.1|  Protein ZINC INDUCED FACILITATOR-LIKE 1                 534   0.0      
ref|XP_009131357.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    533   1e-180   
ref|XP_010420011.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    533   2e-180   
gb|AES68618.2|  zinc induced facilitator-like protein                   533   2e-180   
ref|XP_010419977.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    532   3e-180   
ref|XP_003542782.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    532   3e-180   
gb|KCW65124.1|  hypothetical protein EUGRSUZ_G02629                     531   3e-180   
ref|XP_009108316.1|  PREDICTED: probable peptide/nitrate transpor...    532   5e-180   
gb|KHN10156.1|  Protein ZINC INDUCED FACILITATOR-LIKE 1                 532   6e-180   
ref|XP_010492152.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    531   1e-179   
ref|XP_010068811.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    531   2e-179   
ref|XP_007133563.1|  hypothetical protein PHAVU_011G189500g             530   2e-179   
ref|XP_006399872.1|  hypothetical protein EUTSA_v10013388mg             530   2e-179   
ref|XP_008775046.1|  PREDICTED: probable peptide/nitrate transpor...    530   3e-179   
ref|XP_009125940.1|  PREDICTED: protein ZINC INDUCED FACILITATOR 1      530   4e-179   
ref|XP_002871582.1|  hypothetical protein ARALYDRAFT_488195             530   4e-179   
ref|XP_006347689.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    526   6e-179   
ref|XP_004230048.2|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    526   6e-179   
ref|XP_004502380.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    529   9e-179   
emb|CDX85629.1|  BnaA02g01840D                                          528   1e-178   
gb|AET03120.2|  zinc induced facilitator-like protein                   528   2e-178   
emb|CDY65961.1|  BnaA10g29810D                                          527   2e-178   
ref|XP_004516551.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    527   6e-178   
ref|XP_004516553.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    525   6e-178   
ref|NP_196878.2|  zinc induced facilitator 1 proetin                    526   2e-177   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189965.2|  probable peptide/nitrate transporter                  525   2e-177   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006598055.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    525   2e-177   
emb|CDX91099.1|  BnaC02g04980D                                          529   3e-177   
gb|ACG25327.1|  carbohydrate transporter/ sugar porter/ transporter     525   6e-177   Zea mays [maize]
ref|XP_002313476.2|  transporter-related family protein                 524   8e-177   Populus trichocarpa [western balsam poplar]
ref|XP_006594343.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    524   9e-177   
ref|XP_006832870.1|  hypothetical protein AMTR_s00095p00084980          524   9e-177   
gb|EEC67611.1|  hypothetical protein OsI_34993                          522   2e-176   Oryza sativa Indica Group [Indian rice]
ref|XP_006663792.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    522   3e-176   
ref|XP_006662712.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    522   3e-176   
ref|XP_007133564.1|  hypothetical protein PHAVU_011G189600g             522   4e-176   
gb|KHN10319.1|  Protein ZINC INDUCED FACILITATOR-LIKE 1                 522   6e-176   
emb|CDY59529.1|  BnaCnng35110D                                          521   6e-176   
ref|NP_001065681.1|  Os11g0134900                                       521   8e-176   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007010373.1|  Zinc induced facilitator-like 1 isoform 3          518   1e-175   
ref|XP_010237967.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    521   1e-175   
ref|XP_007133565.1|  hypothetical protein PHAVU_011G189700g             521   1e-175   
gb|KEH19211.1|  zinc induced facilitator-like protein                   519   1e-175   
gb|ABG21873.1|  transporter, putative, expressed                        521   2e-175   
gb|ABR17390.1|  unknown                                                 521   2e-175   Picea sitchensis
ref|NP_001130680.1|  uncharacterized protein LOC100191783               521   2e-175   Zea mays [maize]
tpd|FAA00732.1|  TPA: DMA efflux transporter                            519   4e-175   
ref|XP_002875624.1|  hypothetical protein ARALYDRAFT_484816             518   6e-175   
ref|XP_010514733.1|  PREDICTED: probable peptide/nitrate transpor...    518   7e-175   
ref|NP_974382.1|  probable peptide/nitrate transporter                  518   1e-174   Arabidopsis thaliana [mouse-ear cress]
gb|KEH19214.1|  zinc induced facilitator-like protein                   518   1e-174   
ref|XP_010425830.1|  PREDICTED: probable peptide/nitrate transpor...    518   2e-174   
gb|EMS51903.1|  Protein ZINC INDUCED FACILITATOR-LIKE 1                 518   2e-174   
dbj|BAB10596.1|  transporter-like protein                               515   4e-174   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003577879.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    517   6e-174   
ref|XP_009403835.1|  PREDICTED: probable peptide/nitrate transpor...    516   8e-174   
ref|XP_010909584.1|  PREDICTED: probable peptide/nitrate transpor...    515   1e-173   
ref|XP_010251713.1|  PREDICTED: probable peptide/nitrate transpor...    513   2e-173   
ref|XP_008775051.1|  PREDICTED: probable peptide/nitrate transpor...    514   2e-173   
ref|XP_004977467.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    514   8e-173   
ref|XP_007133369.1|  hypothetical protein PHAVU_011G173400g             513   9e-173   
gb|ABG22349.1|  transporter, putative, expressed                        514   1e-172   
ref|XP_003577876.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    513   1e-172   
dbj|BAK02262.1|  predicted protein                                      513   1e-172   
ref|XP_010673233.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    510   1e-172   
ref|XP_007133566.1|  hypothetical protein PHAVU_011G189800g             513   1e-172   
ref|XP_010237968.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    511   5e-172   
dbj|BAJ94369.1|  predicted protein                                      511   7e-172   
ref|NP_001130901.1|  carbohydrate transporter/ sugar porter/ tran...    511   1e-171   Zea mays [maize]
ref|XP_003578972.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    510   1e-171   
ref|XP_003526355.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    510   2e-171   
gb|KDO47755.1|  hypothetical protein CISIN_1g011424mg                   507   4e-171   
gb|ABG21874.1|  transporter, putative, expressed                        509   6e-171   
ref|XP_006662713.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    508   6e-171   
ref|XP_004978595.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    508   7e-171   
ref|XP_010922100.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    507   8e-171   
ref|XP_006832881.1|  hypothetical protein AMTR_s00095p00099600          507   8e-171   
ref|XP_010237969.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    507   2e-170   
gb|AAM12978.1|  transporter-like protein                                506   2e-170   Arabidopsis thaliana [mouse-ear cress]
gb|EEC67612.1|  hypothetical protein OsI_34994                          506   6e-170   Oryza sativa Indica Group [Indian rice]
ref|XP_009121734.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    505   6e-170   
gb|KCW87280.1|  hypothetical protein EUGRSUZ_B03776                     505   6e-170   
ref|XP_006663796.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    506   7e-170   
gb|AAN33182.1|  major facilitator superfamily antiporter                505   9e-170   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001066084.1|  Os12g0132800                                       505   9e-170   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663795.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    505   1e-169   
ref|NP_001065685.1|  Os11g0135900                                       505   1e-169   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009403837.1|  PREDICTED: probable peptide/nitrate transpor...    505   1e-169   
ref|NP_001065682.1|  Os11g0135000                                       504   2e-169   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006662714.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    505   2e-169   
ref|XP_009383252.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    505   2e-169   
gb|EEC68819.1|  hypothetical protein OsI_37385                          505   2e-169   Oryza sativa Indica Group [Indian rice]
ref|XP_004977469.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    504   2e-169   
gb|AFK38823.1|  unknown                                                 504   3e-169   
gb|KCW65123.1|  hypothetical protein EUGRSUZ_G02629                     502   1e-168   
ref|XP_008674224.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    502   2e-168   
gb|KDO47761.1|  hypothetical protein CISIN_1g011424mg                   500   2e-168   
gb|AFO67942.1|  YS3                                                     501   3e-168   
ref|XP_004960719.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    501   4e-168   
tpg|DAA39260.1|  TPA: carbohydrate transporter/ sugar porter/ tra...    502   4e-168   
ref|XP_006293241.1|  hypothetical protein CARUB_v10019572mg             499   1e-167   
ref|XP_008676450.1|  PREDICTED: uncharacterized protein LOC100191...    501   2e-167   
ref|XP_004308184.1|  PREDICTED: LOW QUALITY PROTEIN: protein ZINC...    498   2e-167   
ref|XP_003598370.1|  Membrane protein, putative                         499   2e-167   
tpd|FAA01135.1|  TPA: efflux transporter of phytosiderophore (mug...    499   3e-167   
ref|XP_010251715.1|  PREDICTED: probable peptide/nitrate transpor...    496   6e-167   
ref|XP_004977466.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    493   1e-164   
gb|ACN28887.1|  unknown                                                 493   1e-164   Zea mays [maize]
gb|EMT05811.1|  Putative membrane protein                               491   4e-164   
ref|XP_004515445.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    489   5e-164   
ref|XP_008677778.1|  PREDICTED: LOC541978 isoform X1                    502   1e-163   
gb|KCW87278.1|  hypothetical protein EUGRSUZ_B03776                     488   2e-163   
ref|XP_006582392.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    488   6e-163   
ref|XP_010045121.1|  PREDICTED: probable peptide/nitrate transpor...    487   7e-163   
ref|XP_003576348.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    487   2e-162   
emb|CAB83151.1|  transporter-like protein                               486   5e-162   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003578976.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    485   9e-162   
ref|XP_008672742.1|  PREDICTED: uncharacterized protein LOC100280...    485   1e-161   
gb|ACG42557.1|  major facilitator superfamily antiporter                484   1e-161   Zea mays [maize]
gb|KCW65125.1|  hypothetical protein EUGRSUZ_G02629                     482   1e-161   
ref|NP_001148164.1|  carbohydrate transporter/ sugar porter/ tran...    485   1e-161   Zea mays [maize]
ref|XP_004977468.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    484   2e-161   
ref|XP_006432311.1|  hypothetical protein CICLE_v10001373mg             481   3e-161   
gb|KDO47762.1|  hypothetical protein CISIN_1g011424mg                   480   4e-161   
ref|XP_006582390.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    482   7e-161   
gb|KDO47760.1|  hypothetical protein CISIN_1g011424mg                   478   3e-160   
ref|XP_002457625.1|  hypothetical protein SORBIDRAFT_03g010620          481   5e-160   Sorghum bicolor [broomcorn]
ref|XP_008672743.1|  PREDICTED: uncharacterized protein LOC100280...    480   6e-160   
ref|XP_009608808.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    477   6e-160   
ref|NP_001042690.1|  Os01g0268100                                       480   8e-160   Oryza sativa Japonica Group [Japonica rice]
gb|AES72135.2|  zinc induced facilitator-like protein                   479   9e-160   
ref|XP_006594344.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    480   1e-159   
ref|XP_006645747.1|  PREDICTED: probable peptide/nitrate transpor...    481   1e-159   
ref|XP_010067052.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    476   3e-159   
ref|XP_010419978.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    476   7e-159   
ref|XP_004977465.1|  PREDICTED: probable peptide/nitrate transpor...    477   8e-159   
ref|NP_001042748.1|  Os01g0279400                                       478   9e-159   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006290345.1|  hypothetical protein CARUB_v10017130mg             477   9e-159   
ref|XP_004967683.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    478   1e-158   
ref|XP_004967684.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    478   1e-158   
ref|XP_006664311.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    477   2e-158   
ref|XP_010909586.1|  PREDICTED: probable peptide/nitrate transpor...    474   2e-158   
tpg|DAA54146.1|  TPA: carbohydrate transporter/ sugar porter/ tra...    476   3e-158   
ref|XP_009383764.1|  PREDICTED: probable peptide/nitrate transpor...    476   5e-158   
ref|NP_001150835.1|  carbohydrate transporter/ sugar porter/ tran...    476   5e-158   Zea mays [maize]
emb|CDY09820.1|  BnaC09g43410D                                          474   6e-158   
emb|CDY09868.1|  BnaC09g42930D                                          475   6e-158   
ref|XP_006578391.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    474   1e-157   
gb|KEH32901.1|  zinc induced facilitator-like protein                   474   1e-157   
ref|XP_004978597.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    473   2e-157   
ref|XP_008667079.1|  PREDICTED: carbohydrate transporter/ sugar p...    473   3e-157   
ref|NP_001141824.1|  major facilitator superfamily defense1             474   3e-157   
ref|XP_006663793.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    471   5e-157   
ref|XP_006582394.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    473   1e-156   
ref|XP_010453473.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    468   1e-156   
ref|XP_003577878.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    472   1e-156   
gb|EAZ11441.1|  hypothetical protein OsJ_01308                          472   2e-156   
ref|XP_003567304.1|  PREDICTED: probable peptide/nitrate transpor...    471   3e-156   
ref|NP_001031877.1|  zinc induced facilitator-like 1 protein            468   4e-156   
dbj|BAJ87168.1|  predicted protein                                      471   6e-156   
ref|XP_002455465.1|  hypothetical protein SORBIDRAFT_03g011240          470   6e-156   
ref|XP_002457667.1|  hypothetical protein SORBIDRAFT_03g011360          470   7e-156   
ref|XP_003601884.1|  Membrane protein, putative                         471   1e-155   
ref|XP_008775052.1|  PREDICTED: probable peptide/nitrate transpor...    469   1e-155   
ref|XP_003628644.1|  hypothetical protein MTR_8g062990                  472   3e-155   
ref|XP_004978596.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    468   3e-155   
ref|XP_008346195.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    464   4e-155   
dbj|BAJ99531.1|  predicted protein                                      469   5e-155   
ref|XP_010909590.1|  PREDICTED: probable peptide/nitrate transpor...    466   6e-155   
ref|XP_006832888.1|  hypothetical protein AMTR_s00095p00107410          465   7e-155   
ref|XP_008354839.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    464   7e-155   
emb|CDM82928.1|  unnamed protein product                                467   2e-154   
ref|XP_006287795.1|  hypothetical protein CARUB_v10001006mg             464   2e-154   
emb|CBX24389.1|  hypothetical_protein                                   465   2e-154   
gb|ACN27407.1|  unknown                                                 467   3e-154   
ref|XP_006471270.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    462   3e-154   
ref|XP_009355076.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    462   5e-154   
gb|ABG21872.1|  transporter, putative, expressed                        462   2e-153   
ref|XP_004516556.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    461   2e-153   
ref|XP_009121732.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    461   2e-153   
dbj|BAB10595.1|  transporter-like protein                               464   3e-153   
ref|XP_010425832.1|  PREDICTED: probable peptide/nitrate transpor...    462   3e-153   
gb|EMT28258.1|  Putative membrane protein                               461   4e-153   
ref|XP_006645771.1|  PREDICTED: probable peptide/nitrate transpor...    461   7e-153   
ref|XP_004977470.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    462   1e-152   
ref|XP_009776347.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    458   3e-152   
ref|XP_008667080.1|  PREDICTED: carbohydrate transporter/ sugar p...    458   3e-152   
ref|XP_009776348.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    457   5e-152   
ref|XP_008657261.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    459   8e-152   
ref|XP_009108317.1|  PREDICTED: probable peptide/nitrate transpor...    457   1e-151   
ref|XP_007148766.1|  hypothetical protein PHAVU_005G012400g             459   1e-151   
ref|XP_003565633.2|  PREDICTED: uncharacterized protein LOC100824896    475   2e-151   
ref|XP_004967681.1|  PREDICTED: probable peptide/nitrate transpor...    458   4e-151   
gb|EEE52720.1|  hypothetical protein OsJ_35131                          455   6e-151   
ref|XP_010909585.1|  PREDICTED: probable peptide/nitrate transpor...    455   2e-150   
gb|EMT23181.1|  Putative membrane protein                               454   3e-150   
ref|XP_002972599.1|  hypothetical protein SELMODRAFT_97863              454   4e-150   
gb|EMT23954.1|  Metacaspase-9                                           458   4e-150   
gb|EMS63644.1|  Protein ZINC INDUCED FACILITATOR-LIKE 1                 458   6e-150   
gb|EMS64099.1|  Protein ZINC INDUCED FACILITATOR-LIKE 1                 455   3e-149   
ref|XP_002972052.1|  hypothetical protein SELMODRAFT_96275              452   3e-149   
ref|NP_568290.3|  zinc induced facilitator-like 1 protein               449   7e-149   
ref|XP_006662716.1|  PREDICTED: probable peptide/nitrate transpor...    452   9e-149   
ref|XP_009608805.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    447   1e-148   
emb|CDM82722.1|  unnamed protein product                                451   1e-148   
ref|XP_008775053.1|  PREDICTED: probable peptide/nitrate transpor...    450   1e-148   
gb|EMT29587.1|  Putative membrane protein                               451   3e-148   
ref|XP_008775054.1|  PREDICTED: probable peptide/nitrate transpor...    449   3e-148   
ref|XP_006582395.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    450   4e-148   
gb|ABA95719.2|  major facilitator superfamily antiporter, putative      447   4e-148   
dbj|BAH56812.1|  AT5G13750                                              446   5e-148   
ref|XP_010111301.1|  Protein ZINC INDUCED FACILITATOR-LIKE 1            449   6e-148   
gb|AAM63809.1|  transporter-like protein                                446   9e-148   
ref|XP_010238772.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    446   2e-147   
ref|XP_010045120.1|  PREDICTED: probable peptide/nitrate transpor...    447   2e-147   
ref|XP_002449350.1|  hypothetical protein SORBIDRAFT_05g008475          447   3e-147   
ref|XP_009414365.1|  PREDICTED: probable peptide/nitrate transpor...    445   3e-147   
ref|XP_009608806.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    442   5e-147   
ref|XP_004515446.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    444   9e-147   
ref|XP_004978937.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    447   1e-146   
ref|XP_002971506.1|  hypothetical protein SELMODRAFT_147893             447   2e-146   
gb|KCW65117.1|  hypothetical protein EUGRSUZ_G02625                     440   9e-146   
ref|XP_001766859.1|  predicted protein                                  444   2e-145   
ref|XP_010045122.1|  PREDICTED: probable peptide/nitrate transpor...    440   2e-145   
ref|XP_002991627.1|  hypothetical protein SELMODRAFT_186199             444   3e-145   
ref|XP_009383253.1|  PREDICTED: probable peptide/nitrate transpor...    440   7e-145   
ref|XP_002960420.1|  hypothetical protein SELMODRAFT_164091             441   2e-144   
tpg|DAA54200.1|  TPA: hypothetical protein ZEAMMB73_141781              439   3e-144   
ref|XP_008673934.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    440   3e-144   
emb|CBX25239.1|  hypothetical_protein                                   441   1e-143   
ref|XP_008664521.1|  PREDICTED: probable peptide/nitrate transpor...    437   2e-143   
ref|XP_011079142.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    436   3e-143   
ref|XP_011079143.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    435   6e-143   
gb|ABA91322.2|  major facilitator superfamily antiporter, putativ...    434   1e-142   
gb|EMS63645.1|  Protein ZINC INDUCED FACILITATOR-LIKE 1                 435   1e-142   
gb|EEE54296.1|  hypothetical protein OsJ_01228                          434   1e-142   
ref|XP_002988668.1|  hypothetical protein SELMODRAFT_184037             436   2e-142   
ref|XP_011079139.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    436   2e-142   
ref|XP_002986402.1|  hypothetical protein SELMODRAFT_157948             435   2e-142   
ref|XP_006432309.1|  hypothetical protein CICLE_v10001373mg             431   4e-142   
gb|KDO47763.1|  hypothetical protein CISIN_1g011424mg                   430   6e-142   
emb|CBX25425.1|  hypothetical_protein                                   432   9e-142   
gb|EAY82181.1|  hypothetical protein OsI_37383                          433   1e-141   
ref|NP_001066085.1|  Os12g0133000                                       431   5e-141   
dbj|BAL15698.1|  DMA efflux transporter                                 431   8e-141   
gb|KHG29235.1|  putative peptide/nitrate transporter -like protein      428   1e-140   
ref|XP_006578392.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    429   1e-140   
ref|XP_002457661.1|  hypothetical protein SORBIDRAFT_03g011330          433   2e-140   
ref|XP_006290344.1|  hypothetical protein CARUB_v10017130mg             430   2e-140   
gb|KHN06906.1|  Protein ZINC INDUCED FACILITATOR-LIKE 1                 427   4e-140   
gb|EMS67726.1|  Protein ZINC INDUCED FACILITATOR-LIKE 1                 427   6e-140   
ref|XP_002967299.1|  hypothetical protein SELMODRAFT_408219             427   4e-139   
ref|XP_010238777.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    426   5e-139   
gb|ABA91327.1|  major facilitator superfamily antiporter, putative      423   2e-138   
ref|XP_006663797.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    422   3e-138   
ref|XP_006662715.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    420   1e-137   
ref|XP_002967298.1|  hypothetical protein SELMODRAFT_408218             422   5e-137   
emb|CBX25238.1|  hypothetical_protein                                   419   1e-136   
gb|ABG21869.1|  major facilitator superfamily antiporter, putativ...    416   4e-136   
ref|XP_006582391.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    416   5e-136   
ref|XP_010237965.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    417   8e-136   
ref|XP_007028172.1|  Zinc induced facilitator-like 1 isoform 4          412   1e-135   
ref|XP_006662717.1|  PREDICTED: probable peptide/nitrate transpor...    417   2e-135   
emb|CBX25237.1|  hypothetical_protein                                   417   2e-135   
ref|XP_002972376.1|  hypothetical protein SELMODRAFT_441865             416   6e-135   
ref|NP_001105101.1|  LOC541978                                          411   4e-134   
gb|EEE53418.1|  hypothetical protein OsJ_36493                          410   2e-133   
ref|XP_008672744.1|  PREDICTED: uncharacterized protein LOC100280...    407   7e-132   
gb|EEC68817.1|  hypothetical protein OsI_37381                          402   5e-131   
ref|XP_002974343.1|  hypothetical protein SELMODRAFT_101350             404   2e-130   
tpg|DAA59174.1|  TPA: hypothetical protein ZEAMMB73_263626              402   4e-130   
ref|XP_001754748.1|  predicted protein                                  402   5e-130   
ref|XP_007133367.1|  hypothetical protein PHAVU_011G173300g             403   9e-130   
ref|XP_002457677.1|  hypothetical protein SORBIDRAFT_03g011490          402   9e-130   
gb|KDO47764.1|  hypothetical protein CISIN_1g011424mg                   398   9e-130   
emb|CBX25429.1|  hypothetical_protein                                   397   6e-128   
emb|CDY65709.1|  BnaC09g54760D                                          392   1e-126   
gb|EEC68818.1|  hypothetical protein OsI_37382                          390   4e-126   
ref|XP_002524976.1|  Multidrug resistance protein mdtG, putative        385   5e-124   
gb|EMT23026.1|  Putative membrane protein                               390   6e-124   
emb|CDX91098.1|  BnaC02g04990D                                          385   2e-123   
ref|XP_006471308.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    380   3e-123   
gb|EEE52722.1|  hypothetical protein OsJ_35135                          383   8e-123   
emb|CBX25426.1|  hypothetical_protein                                   379   2e-121   
ref|XP_002442059.1|  hypothetical protein SORBIDRAFT_08g008410          378   4e-121   
tpg|DAA48434.1|  TPA: hypothetical protein ZEAMMB73_437680              376   3e-119   
ref|XP_008672745.1|  PREDICTED: uncharacterized protein LOC100280...    371   1e-118   
gb|EMT00511.1|  Putative membrane protein                               371   6e-118   
gb|ABA91323.2|  major facilitator superfamily antiporter, putativ...    367   9e-118   
gb|ABG21870.1|  major facilitator superfamily antiporter, putativ...    366   2e-117   
ref|XP_002971851.1|  hypothetical protein SELMODRAFT_412524             369   7e-117   
gb|EEC78872.1|  hypothetical protein OsI_19229                          363   3e-115   
ref|XP_008344548.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    357   1e-114   
gb|EMS47831.1|  Protein ZINC INDUCED FACILITATOR-LIKE 1                 363   1e-114   
ref|XP_006663794.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    360   4e-114   
ref|XP_009608809.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    347   2e-110   
ref|XP_007133368.1|  hypothetical protein PHAVU_011G173400g             350   2e-110   
dbj|BAJ97721.1|  predicted protein                                      345   6e-109   
tpg|DAA54224.1|  TPA: hypothetical protein ZEAMMB73_986961              353   1e-108   
gb|ACF88450.1|  unknown                                                 333   7e-105   
ref|NP_001066082.1|  Os12g0132500                                       334   2e-104   
gb|KEH19212.1|  MFS transporter                                         331   2e-104   
ref|XP_002455741.1|  hypothetical protein SORBIDRAFT_03g023750          336   3e-104   
dbj|BAJ34036.1|  unnamed protein product                                328   2e-103   
ref|XP_002441728.1|  hypothetical protein SORBIDRAFT_08g001410          329   3e-102   
gb|EMT15394.1|  Putative membrane protein                               329   5e-102   
gb|EMS68168.1|  Protein ZINC INDUCED FACILITATOR-LIKE 1                 324   1e-101   
gb|ABA91341.1|  major facilitator superfamily antiporter, putativ...    325   5e-101   
ref|NP_001065689.1|  Os11g0136400                                       325   2e-100   
emb|CBX24391.1|  hypothetical_protein                                   324   8e-100   
gb|EEC67617.1|  hypothetical protein OsI_35001                          319   6e-99    
gb|EYU26916.1|  hypothetical protein MIMGU_mgv1a008860mg                317   2e-98    
ref|XP_002992883.1|  hypothetical protein SELMODRAFT_431014             320   5e-97    
gb|ABG21871.1|  major facilitator superfamily antiporter, putativ...    310   2e-96    
gb|EAZ02981.1|  hypothetical protein OsI_25122                          311   5e-96    
gb|AFW64725.1|  hypothetical protein ZEAMMB73_249414                    313   7e-96    
ref|XP_010091305.1|  hypothetical protein L484_012198                   308   1e-94    
ref|XP_010667675.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    302   6e-93    
emb|CBX25336.1|  hypothetical_protein                                   304   8e-93    
emb|CBI29171.3|  unnamed protein product                                299   1e-92    
ref|XP_002990848.1|  hypothetical protein SELMODRAFT_429199             320   3e-92    
emb|CBX25335.1|  hypothetical_protein                                   293   6e-89    
ref|XP_009383254.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    293   3e-88    
ref|XP_002968783.1|  hypothetical protein SELMODRAFT_409890             303   2e-87    
gb|EMT27514.1|  Putative membrane protein                               297   3e-87    
emb|CDY72192.1|  BnaAnng40280D                                          280   4e-86    
gb|AAV32178.1|  hypothetical protein                                    285   1e-85    
emb|CDY09863.1|  BnaC09g42980D                                          280   2e-85    
gb|ABA91324.2|  major facilitator superfamily antiporter, putativ...    280   3e-85    
ref|XP_004517218.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    278   2e-84    
ref|XP_003598366.1|  Carbohydrate transporter/ sugar porter/ tran...    275   2e-83    
ref|XP_002457663.1|  hypothetical protein SORBIDRAFT_03g011340          280   3e-83    
emb|CBX25240.1|  hypothetical_protein                                   276   2e-82    
ref|XP_010237966.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    277   3e-82    
emb|CDP20757.1|  unnamed protein product                                270   3e-82    
ref|XP_008796954.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...    267   1e-80    
gb|EPS59156.1|  hypothetical protein M569_15654                         267   1e-80    
gb|EEE66677.1|  hypothetical protein OsJ_23324                          269   9e-80    
emb|CDP06827.1|  unnamed protein product                                261   4e-79    
ref|XP_004516783.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    261   5e-79    
dbj|BAG89474.1|  unnamed protein product                                263   1e-78    
ref|XP_003598367.1|  hypothetical protein MTR_3g010820                  257   8e-77    
emb|CBX24393.1|  hypothetical_protein                                   256   9e-76    
tpg|DAA39263.1|  TPA: hypothetical protein ZEAMMB73_384773              253   1e-75    
gb|EMT31005.1|  hypothetical protein F775_20914                         252   6e-73    
gb|AFK35273.1|  unknown                                                 243   2e-72    
ref|XP_006832882.1|  hypothetical protein AMTR_s00095p00101800          244   1e-71    
gb|ACU17941.1|  unknown                                                 240   4e-71    
emb|CBX25334.1|  hypothetical_protein                                   243   5e-71    
gb|ACJ84488.1|  unknown                                                 238   1e-70    
emb|CDY27960.1|  BnaCnng05450D                                          239   3e-70    
gb|EMT23180.1|  Putative membrane protein                               248   7e-70    
emb|CDY69241.1|  BnaAnng29740D                                          238   2e-69    
ref|XP_006432492.1|  hypothetical protein CICLE_v10003550mg             234   8e-69    
gb|EPS69109.1|  hypothetical protein M569_05658                         234   1e-68    
emb|CBX25337.1|  hypothetical_protein                                   236   1e-67    
gb|EEE51608.1|  hypothetical protein OsJ_32873                          234   5e-67    
ref|NP_001146500.1|  uncharacterized protein LOC100280090               230   5e-67    
tpg|DAA59178.1|  TPA: hypothetical protein ZEAMMB73_263626              230   5e-67    
ref|XP_004289280.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    230   1e-66    
gb|KDO40632.1|  hypothetical protein CISIN_1g0412731mg                  226   1e-65    
ref|XP_011016745.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    226   1e-65    
ref|NP_001131594.1|  uncharacterized protein LOC100192941               228   1e-64    
gb|AFK41220.1|  unknown                                                 223   2e-64    
ref|XP_008356830.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...    219   3e-63    
emb|CBI29173.3|  unnamed protein product                                218   3e-63    
ref|XP_002450217.1|  hypothetical protein SORBIDRAFT_05g002070          223   1e-62    
ref|XP_010909591.1|  PREDICTED: probable peptide/nitrate transpor...    223   1e-62    
tpg|DAA54979.1|  TPA: hypothetical protein ZEAMMB73_058478              214   1e-61    
gb|ACU24358.1|  unknown                                                 211   2e-60    



>ref|XP_009619333.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Nicotiana 
tomentosiformis]
Length=517

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/522 (75%), Positives = 453/522 (87%), Gaps = 19/522 (4%)
 Frame = +2

Query  215   GNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAAL  394
              N EPLL++ E+      ++       C GC+V+LLKR+D  VP+K +F+IS+VTLCAAL
Sbjct  3     NNREPLLQKREEEENEYFED-------CPGCKVDLLKRSDRSVPVKAIFYISIVTLCAAL  55

Query  395   PISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvv  574
             PISSLFPFLYFM+RDFHIA+REEDISYYAGYVGSSFMLGRALTS+LWG+IADRYGRKPVV
Sbjct  56    PISSLFPFLYFMVRDFHIADREEDISYYAGYVGSSFMLGRALTSILWGMIADRYGRKPVV  115

Query  575   iigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAV  754
             IIGT+TVVIFNA+FGLS N+WMAI  RFL+G+LCGIIGTMRAYASEICR+EYHALGISAV
Sbjct  116   IIGTITVVIFNALFGLSTNFWMAIFLRFLMGSLCGIIGTMRAYASEICRKEYHALGISAV  175

Query  755   STAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFW  934
             ST+WGIGLVIGPA+GGY AQPAEKYP +FS +S FG+FPY LPCL+IS+FALVATV+SFW
Sbjct  176   STSWGIGLVIGPAIGGYLAQPAEKYPGVFSKDSLFGRFPYLLPCLMISLFALVATVVSFW  235

Query  935   LPETMHThkkehkeehD-----------VSQNSKQPEHEVPTSQKSLLKNWPLISSILVY  1081
             LPET+H H K +K++ D           +S++ K  E  +P SQKSLLKNWPL+S+I VY
Sbjct  236   LPETLHKHNKTNKDQSDLHDVAEGTTNGLSESMKHSERRIPNSQKSLLKNWPLVSAIFVY  295

Query  1082  CVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVL  1261
             CVFQLHDIAYLEIFSLWAVSPR LGGLS+TTADVGQVLAITG+GLLLFQLFAYPL E+++
Sbjct  296   CVFQLHDIAYLEIFSLWAVSPRNLGGLSFTTADVGQVLAITGVGLLLFQLFAYPLAERIV  355

Query  1262  GPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRA  1441
             GPVMISR+GA LSIPLL++YPYIA+LSG CLS+ LNCASMLKNVLSVSITTGLLI+QNRA
Sbjct  356   GPVMISRVGAVLSIPLLASYPYIAMLSGFCLSIALNCASMLKNVLSVSITTGLLIMQNRA  415

Query  1442  VSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfell  1621
             V+QEQRGAANGISMS+MS FKTIGPAAGGSLLSW+Q RQDA  +PGDQLVFFVLNV ELL
Sbjct  416   VAQEQRGAANGISMSSMSFFKTIGPAAGGSLLSWAQRRQDADILPGDQLVFFVLNVIELL  475

Query  1622  glIMTFKPFLQLPEDDILKSKQDGAAE-ENCMQHRIALPELP  1744
             GL++TF+PFLQ PED+I KSK+D A + EN +Q  ++L ELP
Sbjct  476   GLLLTFRPFLQEPEDNIPKSKKDSADQSENGIQETLSLTELP  517



>ref|XP_004249093.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Solanum lycopersicum]
Length=512

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/512 (76%), Positives = 441/512 (86%), Gaps = 18/512 (4%)
 Frame = +2

Query  263   LEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDF  442
             +E+      E C GC+VE LKR++ G+P+K V FIS+VTLCA+LPISSLFPFLYFM+RDF
Sbjct  1     MEEGLLNNYEDCPGCKVEQLKRSNNGIPVKPVLFISVVTLCASLPISSLFPFLYFMVRDF  60

Query  443   HIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGL  622
             HIAEREEDISYYAGY+GSSFMLGRALTS+LWGIIADRYGRKPVV+IGT+TV+IFNA+FGL
Sbjct  61    HIAEREEDISYYAGYLGSSFMLGRALTSILWGIIADRYGRKPVVVIGTITVLIFNALFGL  120

Query  623   SVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGG  802
             S NYWMAI+TRFL+G+LCGIIGTMRAYASEICR+EYHALGISAVST+WGIGLVIGPA+GG
Sbjct  121   STNYWMAIVTRFLIGSLCGIIGTMRAYASEICRKEYHALGISAVSTSWGIGLVIGPAIGG  180

Query  803   YFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeeh  982
             Y AQPAEKYP+IFS ESFFG+FPYFLPCL+IS+FAL ATVMSFWLPET+H H K  ++++
Sbjct  181   YLAQPAEKYPSIFSKESFFGRFPYFLPCLLISVFALAATVMSFWLPETLHKHNKIKQDKN  240

Query  983   ----------------DVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYL  1114
                             +VSQN    E   P+SQKSLL NWPL+SSI+VYCVFQLHDIAYL
Sbjct  241   NFQEAVEGSPDESNGLNVSQNINPSERRAPSSQKSLLMNWPLMSSIIVYCVFQLHDIAYL  300

Query  1115  EIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAA  1294
             EIFSLWAVSPR LGGLS+TT+DVGQVLAITGIGLLLFQL  YPLVE++ GPVMISRIGA 
Sbjct  301   EIFSLWAVSPRTLGGLSFTTSDVGQVLAITGIGLLLFQLLVYPLVERITGPVMISRIGAV  360

Query  1295  LSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANG  1474
             LSIPLL++YPYIALL+G  LS+ LNCASMLKN+LSVSITTGLLI+QNRAVSQEQRGAANG
Sbjct  361   LSIPLLASYPYIALLTGFGLSIALNCASMLKNILSVSITTGLLIMQNRAVSQEQRGAANG  420

Query  1475  ISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQ  1654
             ISMS+MSLFKTIGPAAGGSLLSWSQ R DA  +PGDQLVFFVLN  ELLGL++T +PFLQ
Sbjct  421   ISMSSMSLFKTIGPAAGGSLLSWSQRRLDADILPGDQLVFFVLNAIELLGLLLTLRPFLQ  480

Query  1655  LPE--DDILKSKQDGAAEENCMQHRIALPELP  1744
              PE  D++ KSK D   +EN MQ R+ L ELP
Sbjct  481   EPEDSDNVPKSKHDSLDQENGMQERLVLTELP  512



>ref|XP_006364750.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Solanum tuberosum]
Length=514

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/504 (76%), Positives = 437/504 (87%), Gaps = 18/504 (4%)
 Frame = +2

Query  287   DESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREED  466
             +E C GC+VE LKR++ G+P+K V FIS+VTLCA+LPISSLFPFLYFM+RDFHIAEREED
Sbjct  11    EEDCPGCKVEQLKRSNTGIPVKPVLFISVVTLCASLPISSLFPFLYFMVRDFHIAEREED  70

Query  467   ISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMAI  646
             ISYYAGY+GSSFMLGRALTS+LWGIIADRYGRKPVV+IGT+TV+IFN +FGLS NYWMAI
Sbjct  71    ISYYAGYLGSSFMLGRALTSILWGIIADRYGRKPVVVIGTITVLIFNTLFGLSTNYWMAI  130

Query  647   ITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAEK  826
             +TRFL+G+LCGIIGTMRAYASEICR+EYHALGISAVST+WGIGLVIGPA+GGY AQPAEK
Sbjct  131   VTRFLIGSLCGIIGTMRAYASEICRKEYHALGISAVSTSWGIGLVIGPAIGGYLAQPAEK  190

Query  827   YPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeeh--------  982
             YP+IFS ES FG+FPYFLPCL+IS+FAL ATVMS WLPET+H H K  K+++        
Sbjct  191   YPSIFSKESLFGRFPYFLPCLLISVFALAATVMSCWLPETLHKHNKIKKDKNNFQDAVEG  250

Query  983   --------DVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAV  1138
                     +VSQN+   E   P+SQKSLLKNWPL+SSI+VYCVFQLHDIAYLEIFSLWAV
Sbjct  251   TSDESNGLNVSQNTNHSERIAPSSQKSLLKNWPLVSSIIVYCVFQLHDIAYLEIFSLWAV  310

Query  1139  SPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLST  1318
             SPR LGGLS+TT+DVGQVLAITG+GLLLFQL  YPLVE++ GPVMISRIGA LSIPLL++
Sbjct  311   SPRTLGGLSFTTSDVGQVLAITGLGLLLFQLLVYPLVERITGPVMISRIGAVLSIPLLAS  370

Query  1319  YPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSL  1498
             YPYIALL+G  LS+ L+CASMLKN+LSVSITTGLLI+QNRAVSQ+QRGAANGISMS+MSL
Sbjct  371   YPYIALLTGFGLSIALSCASMLKNILSVSITTGLLIMQNRAVSQDQRGAANGISMSSMSL  430

Query  1499  FKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPE--DDI  1672
             FKTIGPAAGGSLLSWSQ RQDA  +PGDQLVFF LN  ELLGL++T +PFLQ PE  D+I
Sbjct  431   FKTIGPAAGGSLLSWSQRRQDADILPGDQLVFFALNAIELLGLLLTLRPFLQEPEDSDNI  490

Query  1673  LKSKQDGAAEENCMQHRIALPELP  1744
              KSK +   +EN MQ R+   ELP
Sbjct  491   PKSKHNSLDQENGMQERLVNTELP  514



>ref|XP_009763181.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like isoform X1 
[Nicotiana sylvestris]
Length=453

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/453 (76%), Positives = 397/453 (88%), Gaps = 14/453 (3%)
 Frame = +2

Query  428   MIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFN  607
             M+RDFHIA+REEDISYYAG+VGSS MLGRALTS+LWG+IADRYGRKPVVIIGT+TVVIFN
Sbjct  1     MVRDFHIADREEDISYYAGFVGSSLMLGRALTSILWGVIADRYGRKPVVIIGTITVVIFN  60

Query  608   AVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIG  787
             A+FGLS N+WMAII RFL+G+LCGIIGTMRAYASEICR+EYHALGISAVST+WGIGLVIG
Sbjct  61    ALFGLSTNFWMAIILRFLMGSLCGIIGTMRAYASEICRKEYHALGISAVSTSWGIGLVIG  120

Query  788   PAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkke  967
             P +GGY AQPAEKYP +FS +S FG+FPY LPCL+IS+ ALVATV+SFWLPET+H H K 
Sbjct  121   PVIGGYLAQPAEKYPGVFSKDSLFGRFPYLLPCLMISLLALVATVVSFWLPETLHKHNKT  180

Query  968   hkeehDV-------------SQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIA  1108
             +K++ D+             S++ K  E  +P S KSLLKNWPL+S+I+VYCVFQLHDIA
Sbjct  181   NKDQSDLYDVAEGTTNGLNLSESMKHSERRIPNSHKSLLKNWPLVSAIIVYCVFQLHDIA  240

Query  1109  YLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIG  1288
             YLEIFSLWAVSPR LGGLS+TT DVGQVLAITG+GLLLFQLFAYPLVE+++GPVMISR+G
Sbjct  241   YLEIFSLWAVSPRTLGGLSFTTTDVGQVLAITGVGLLLFQLFAYPLVERIVGPVMISRVG  300

Query  1289  AALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAA  1468
             A LSIPLL++YP IALLSG CLS+ LNCASMLKNVLSVSITTGLLI+QNRAV+QEQRGAA
Sbjct  301   AVLSIPLLASYPCIALLSGFCLSIALNCASMLKNVLSVSITTGLLIMQNRAVAQEQRGAA  360

Query  1469  NGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPF  1648
             NG+SM +MS FKTIGPAAGGSLLSW+Q RQDA  +PGDQLVFFVLNV ELLGL++TF+PF
Sbjct  361   NGLSMCSMSFFKTIGPAAGGSLLSWAQRRQDADILPGDQLVFFVLNVIELLGLLLTFRPF  420

Query  1649  LQLPEDDILKSKQDGAAE-ENCMQHRIALPELP  1744
             LQ PED+I KSK D A + EN +Q  ++L ELP
Sbjct  421   LQEPEDNIPKSKNDSADQSENGIQETLSLTELP  453



>ref|XP_011079138.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Sesamum indicum]
Length=503

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/513 (64%), Positives = 412/513 (80%), Gaps = 37/513 (7%)
 Frame = +2

Query  212   EGNT--EPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             E N+  EPL+K+              Y ++C  C++E  K ++ G+P K +FF+ +VTL 
Sbjct  2     EDNSAAEPLIKKQ------------GYHDNCEACKIERFKESNTGIPFKLLFFVWVVTLA  49

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
             AALPISSLFPFLYFM RDFHIA+REEDISYYAGYVGSSFM GRALTS+LWG++AD+YGRK
Sbjct  50    AALPISSLFPFLYFMTRDFHIAKREEDISYYAGYVGSSFMFGRALTSLLWGMVADKYGRK  109

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             P+++IGT+ VV+FN +FGLSVNYWMAI TRFLLG+LCGI+G MRAYASEICR+E+ ALG+
Sbjct  110   PIIMIGTIIVVVFNTLFGLSVNYWMAISTRFLLGSLCGILGPMRAYASEICRKEHQALGM  169

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S + T+WGIGLVIGPAVGG+ AQPAEKYP IFS ES FG+FPYFLPCL+IS+FALVA ++
Sbjct  170   SVIGTSWGIGLVIGPAVGGFLAQPAEKYPQIFSRESLFGRFPYFLPCLVISVFALVAFII  229

Query  926   SFWLPETMHThkkehkeehDVSQNSKQPEHEVPT------------------SQKSLLKN  1051
             S WLPET+H        E ++++NS++   E  T                  SQ+SL +N
Sbjct  230   SCWLPETLHI-----HCEENIARNSREAPPEDNTYESIQSQEMEVSKLQSTVSQRSLFRN  284

Query  1052  WPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQL  1231
             WPL+S+I+VYC+FQLHD+AY EIFSLWAVS RKLGGLS++T+DVG+VL++TG G+LLFQL
Sbjct  285   WPLVSAIIVYCIFQLHDMAYSEIFSLWAVSSRKLGGLSFSTSDVGEVLSVTGFGMLLFQL  344

Query  1232  FAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSIT  1411
             F Y  +E++LG +++SRIGA ++IPLLS+YP+IA LSG  L +VLN AS+LKNVLS+SIT
Sbjct  345   FLYTWIERMLGAILVSRIGAVITIPLLSSYPFIAKLSGPVLLLVLNSASLLKNVLSISIT  404

Query  1412  TGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlv  1591
             TGLL++QNRAV+QEQRGAANGISMSAMSLFK IGPAAGGSLLSW+Q RQ A+F+PG  +V
Sbjct  405   TGLLVIQNRAVAQEQRGAANGISMSAMSLFKAIGPAAGGSLLSWAQGRQHAEFLPGVHMV  464

Query  1592  ffvlnvfellglIMTFKPFLQLPEDDILKSKQD  1690
             FF+LNV E++GLIMTFKPFL  PED+I   + D
Sbjct  465   FFILNVVEIVGLIMTFKPFLAHPEDEISDPEPD  497



>ref|XP_011041313.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Populus euphratica]
Length=478

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/490 (67%), Positives = 403/490 (82%), Gaps = 14/490 (3%)
 Frame = +2

Query  206   MAE-GNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTL  382
             MAE G  E LL++++            Y E C GC++EL K  + GVP K++ ++ +V L
Sbjct  1     MAENGIGESLLRKNK------------YYEDCPGCKIELSKETNTGVPFKYLLYVWIVVL  48

Query  383   CAALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGR  562
             CAALPISSLFPFLYFMIRDFHIA+REEDI YYAGYVGS+FM GRALTSVLWG+IADRYGR
Sbjct  49    CAALPISSLFPFLYFMIRDFHIAKREEDIGYYAGYVGSAFMFGRALTSVLWGMIADRYGR  108

Query  563   KPvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALG  742
             KPV+I GTV+VVIFN +FGLS ++WMAI  RFLLG+LCGI+G MRAYASE+CR+EY ALG
Sbjct  109   KPVIIFGTVSVVIFNTLFGLSTSFWMAISMRFLLGSLCGILGPMRAYASEVCRKEYQALG  168

Query  743   ISAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATV  922
             +S +ST+WGIGLVIGPA+GG+ AQPAEK+P IFS++  FG+FPY LPCL+IS+F++   V
Sbjct  169   MSIISTSWGIGLVIGPALGGFLAQPAEKFPNIFSSDCLFGRFPYLLPCLLISIFSVGVLV  228

Query  923   MSFWLPETMHThkkehkeehDVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHD  1102
             +  +LPET+H HK   +E +D S        E  +SQKSLLKNWPLISSI+ YCVFQLHD
Sbjct  229   VCCFLPETIHNHKGNDEECND-SDALVATTFESTSSQKSLLKNWPLISSIIAYCVFQLHD  287

Query  1103  IAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISR  1282
             +AY EIFSLWAVSPRK GGLS++TA+VG+VLA +G GLLLFQLF YP+ E+  GPVM+SR
Sbjct  288   MAYAEIFSLWAVSPRKNGGLSFSTAEVGEVLAFSGFGLLLFQLFIYPVAERNFGPVMVSR  347

Query  1283  IGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRG  1462
             +GA L+IPLLS+YP+IA L GL L +++NCAS+LKNVLSVSITTGL +LQNR+V+Q+QRG
Sbjct  348   LGAVLTIPLLSSYPFIAFLKGLMLMLLINCASILKNVLSVSITTGLFLLQNRSVTQQQRG  407

Query  1463  AANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFK  1642
             AANGISMSAMSLFK IGPAAGGSL SW+Q RQ A F+PGDQ+VFF+LN+ E++GL +TFK
Sbjct  408   AANGISMSAMSLFKAIGPAAGGSLFSWAQKRQSAFFLPGDQMVFFLLNMIEVIGLFLTFK  467

Query  1643  PFLQLPEDDI  1672
             PFL LP+D I
Sbjct  468   PFLALPDDSI  477



>ref|XP_007028169.1| Zinc induced facilitator-like 1 isoform 1 [Theobroma cacao]
 gb|EOY08671.1| Zinc induced facilitator-like 1 isoform 1 [Theobroma cacao]
Length=490

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/482 (67%), Positives = 403/482 (84%), Gaps = 15/482 (3%)
 Frame = +2

Query  266   EDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFH  445
             E++YF   E+C GC+VELLK  + G+P KH+ ++ +V L AALPISSLFPFLYFMIRDF+
Sbjct  12    ENKYF---ENCPGCKVELLKETNPGIPFKHLLYVWVVVLAAALPISSLFPFLYFMIRDFN  68

Query  446   IAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLS  625
             IA++EEDI YYAGYVGS+FM GRALTSV WG+IADRYGRKPV++ GT +VVIFN +FGLS
Sbjct  69    IAKKEEDIGYYAGYVGSAFMFGRALTSVFWGMIADRYGRKPVIMFGTFSVVIFNTLFGLS  128

Query  626   VNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGY  805
              N+W+A+ TRFLLG+LCGI+G MRAYASE+CR+EY ALG+S +ST+WGIGLVIGPA+GG+
Sbjct  129   TNFWVAVSTRFLLGSLCGILGPMRAYASEVCRKEYQALGMSIISTSWGIGLVIGPALGGF  188

Query  806   FAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehD  985
              AQPAEK+P IF+ ES FG+FPYFLPC++IS+FA    ++S  LPET+H H++  KE   
Sbjct  189   LAQPAEKFPYIFANESLFGRFPYFLPCILISLFAFGVFLISCSLPETLHIHERTDKECDK  248

Query  986   VSQ---------NSKQPEHEV---PTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSL  1129
             ++          N+ +    V   PTSQ++L KNWPL+SSI+VYCVFQLHD+AY EIFSL
Sbjct  249   LNDALVTSTGEPNANEKVRIVGRHPTSQQNLWKNWPLMSSIIVYCVFQLHDMAYAEIFSL  308

Query  1130  WAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPL  1309
             WAVSPRK GGLSY+TADVG+VLAI+G GLLLFQLF YPL+E+ LGPVMISR+GA L+IPL
Sbjct  309   WAVSPRKNGGLSYSTADVGEVLAISGCGLLLFQLFLYPLIERTLGPVMISRLGAVLTIPL  368

Query  1310  LSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSA  1489
             L TYP+IA+L GL L  +++ AS+LKNVLSVSITTGL +LQNRAV+Q+QRGAANGISMSA
Sbjct  369   LFTYPFIAMLKGLSLMFLISSASVLKNVLSVSITTGLFLLQNRAVTQKQRGAANGISMSA  428

Query  1490  MSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPEDD  1669
             MS+FK +GPAAGGSL SW+Q RQ+A F+PGDQ+VFF LN+ E++GL+MTFKPFL  P+D+
Sbjct  429   MSIFKAVGPAAGGSLFSWAQNRQNAFFLPGDQMVFFALNMIEVIGLLMTFKPFLIPPDDN  488

Query  1670  IL  1675
             +L
Sbjct  489   VL  490



>ref|XP_002322579.2| hypothetical protein POPTR_0016s02500g [Populus trichocarpa]
 gb|EEF04340.2| hypothetical protein POPTR_0016s02500g [Populus trichocarpa]
Length=479

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/464 (70%), Positives = 395/464 (85%), Gaps = 2/464 (0%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y E C GC++EL K  + GVP K++ ++ +V LCAALPISSLFPFLYFMIRDFHIA+REE
Sbjct  16    YYEDCPGCKIELSKETNTGVPFKYLLYVWIVVLCAALPISSLFPFLYFMIRDFHIAKREE  75

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI YYAGYVGS+FM GRALTSVLWG+IADRYGRKPV+I GTV+VVIFN +FGLS ++WMA
Sbjct  76    DIGYYAGYVGSAFMFGRALTSVLWGMIADRYGRKPVIIFGTVSVVIFNTLFGLSTSFWMA  135

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TRFLLG+LCGI+G MRAYASE+CR+EY ALG+S +ST+WGIGLVIGPA+GG+ AQPAE
Sbjct  136   ISTRFLLGSLCGILGPMRAYASEVCRKEYQALGMSIISTSWGIGLVIGPALGGFLAQPAE  195

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             K+P IFS++S FG+FPY LPCL+IS+F++   V+   LPET+H HK   +E +D S    
Sbjct  196   KFPNIFSSDSLFGRFPYLLPCLLISIFSVGVLVVCCLLPETIHNHKGNDEECND-SDALG  254

Query  1004  QPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADV  1183
                 E  +SQKSLLKNWPLISSI+VYCVFQLHD+AY EIFSLWAVSPRK GGLS++TADV
Sbjct  255   ATTFESNSSQKSLLKNWPLISSIIVYCVFQLHDMAYAEIFSLWAVSPRKNGGLSFSTADV  314

Query  1184  GQVLAITG-IGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSV  1360
             G+VLA +G  GLLLFQLF YP+ E+  GPVM+SR+GA L+IPLLS+YP+IALL GL L +
Sbjct  315   GEVLAFSGSFGLLLFQLFIYPVAERNFGPVMVSRLGAVLTIPLLSSYPFIALLKGLTLML  374

Query  1361  VLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLS  1540
             ++NCAS+LKNVLSVSITTGL +LQNR+V+Q+QRGAANGISMSAMSLFK IGPAAGGSL S
Sbjct  375   LINCASILKNVLSVSITTGLFLLQNRSVAQQQRGAANGISMSAMSLFKAIGPAAGGSLFS  434

Query  1541  WSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPEDDI  1672
             W+Q RQ A F+PGDQ+VFF LN+ E++GL +TFKPFL LP+D+I
Sbjct  435   WAQKRQSAFFLPGDQIVFFFLNMIEVIGLFLTFKPFLALPDDNI  478



>emb|CDP11656.1| unnamed protein product [Coffea canephora]
Length=504

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/510 (65%), Positives = 407/510 (80%), Gaps = 19/510 (4%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE N++ LL   E+  G   + Y    E+C GC +E LK ++ G+P+KH+FFI  VTL 
Sbjct  1     MAE-NSQLLL---EKGAGKQSNYY----ENCPGCAIERLKCSNVGIPLKHLFFIGTVTLS  52

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
             AALPI+SLFPFLYFMI DFHIA+ EEDI YYAGYVGSSFM GRALTS+LWG++ADRYGRK
Sbjct  53    AALPITSLFPFLYFMIGDFHIAKTEEDIGYYAGYVGSSFMFGRALTSLLWGLVADRYGRK  112

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV++IGTV VVIFN +FGLS N+WMA+  RFLLG+L G++G MRAYASEICR+EY ALG+
Sbjct  113   PVILIGTVAVVIFNTLFGLSSNFWMAVSMRFLLGSLSGVLGPMRAYASEICRKEYQALGM  172

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S +ST+WG+GLVIGPA+GGY AQPA KYP IFS +S FG+FPY LPCL+IS+FA+V +V+
Sbjct  173   SVISTSWGVGLVIGPAIGGYLAQPANKYPEIFSKQSVFGRFPYLLPCLLISLFAVVVSVV  232

Query  926   SFWLPETMH-----------ThkkehkeehDVSQNSKQPEHEVPTSQKSLLKNWPLISSI  1072
               WLPET+H              +    +  + +        +PTSQ SLLKNWPL+SSI
Sbjct  233   CCWLPETLHIHCQNKEYAAYNGVEAAAYDSTLQERDGNSGDSLPTSQSSLLKNWPLMSSI  292

Query  1073  LVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVE  1252
             + YCVFQLHD+AY EIFSLWA+SPR  GGLSYTT++VG+ L+ITG+GLLLFQLF YP+VE
Sbjct  293   ITYCVFQLHDMAYSEIFSLWAISPRNSGGLSYTTSEVGETLSITGLGLLLFQLFLYPVVE  352

Query  1253  KVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQ  1432
             ++LG +M+SRIGA LS+PLLSTYPYIA+LSG  LSVVL+ AS+LKNV SVSITTGL +LQ
Sbjct  353   RILGTIMVSRIGAVLSVPLLSTYPYIAMLSGFWLSVVLDSASVLKNVFSVSITTGLFLLQ  412

Query  1433  NRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvf  1612
             NRAVSQEQRGAANGISMSAMSL K IGPAAGGSL SW+Q RQ A  +PGDQ+VFF+LNV 
Sbjct  413   NRAVSQEQRGAANGISMSAMSLSKAIGPAAGGSLFSWAQKRQGASVLPGDQMVFFILNVI  472

Query  1613  ellglIMTFKPFLQLPEDDILKSKQDGAAE  1702
             E++GL+MTFKPFL LPED++   K + + E
Sbjct  473   EVIGLLMTFKPFLVLPEDNVSNRKHETSEE  502



>gb|EYU20856.1| hypothetical protein MIMGU_mgv1a005872mg [Erythranthe guttata]
Length=466

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/469 (67%), Positives = 382/469 (81%), Gaps = 24/469 (5%)
 Frame = +2

Query  212   EGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAA  391
             E  +EPL+K+    GG        Y ESC  C +E  K +  G+P K   F+ ++TL AA
Sbjct  2     EDKSEPLIKK---RGG--------YHESCEACTIEKFKESSNGIPFKLFSFVWIITLAAA  50

Query  392   LPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPv  571
             LPISSLFPFLYFMI+DFHIA+REEDIS+YAGYVGS+FMLGRALTS+LWG +AD+YGR+P+
Sbjct  51    LPISSLFPFLYFMIKDFHIAKREEDISFYAGYVGSAFMLGRALTSLLWGKVADKYGRRPI  110

Query  572   viigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISA  751
             ++IGT TVVIFN +FGLSVN+WMAI TRFLLG+LCGI+G MRAYASEICR E+ ALG+S 
Sbjct  111   IMIGTFTVVIFNTLFGLSVNFWMAISTRFLLGSLCGILGPMRAYASEICREEHQALGMSV  170

Query  752   VSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSF  931
             V T+WGIGLVIGPAVGG+ AQPAEKYP IFSAES FG+FPYFLPCL+IS+FALVA ++S+
Sbjct  171   VGTSWGIGLVIGPAVGGFLAQPAEKYPHIFSAESLFGRFPYFLPCLVISLFALVAFIISY  230

Query  932   WLPETMHThkkeh----keehDVSQNSKQP---------EHEVPTSQKSLLKNWPLISSI  1072
             WLPET+H H +E+      +  +  NS +P         E +  T  +SLL+NWPL+S+I
Sbjct  231   WLPETLHIHTEENIGRDSTQASLEDNSYEPTRTHKTEVSELKFSTPHRSLLRNWPLMSAI  290

Query  1073  LVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVE  1252
             +VYC+FQLHD+AY EIFSLWA+SPRKLGGLS+TTADVG+VL+ITG G+L FQLF Y  VE
Sbjct  291   MVYCIFQLHDMAYSEIFSLWALSPRKLGGLSFTTADVGEVLSITGFGMLFFQLFLYTWVE  350

Query  1253  KVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQ  1432
             ++LG V +SRIGA +SIPLL++YP+IA LSG  L +VLNCASM+KN+LS++ITTGLL++Q
Sbjct  351   RILGSVTVSRIGAVISIPLLTSYPFIAKLSGSILFLVLNCASMVKNILSIAITTGLLVIQ  410

Query  1433  NRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPG  1579
             NRAV QEQRGAANGISMSAMSLFK IGPAAGGSLLSW+Q RQ+  F+PG
Sbjct  411   NRAVPQEQRGAANGISMSAMSLFKAIGPAAGGSLLSWAQSRQENDFLPG  459



>ref|XP_002307932.2| hypothetical protein POPTR_0006s02710g [Populus trichocarpa]
 gb|EEE91455.2| hypothetical protein POPTR_0006s02710g [Populus trichocarpa]
Length=478

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/488 (67%), Positives = 403/488 (83%), Gaps = 15/488 (3%)
 Frame = +2

Query  212   EGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAA  391
              G  E LLK+++            Y E C GC++E  K  + GVP KH+ ++ +V LCAA
Sbjct  4     NGIGESLLKKNK------------YHEDCPGCKIEHFKETNTGVPFKHLLYVGIVVLCAA  51

Query  392   LPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPv  571
             LPISSLFPFLYFMIRD HIA+REEDI YYAGYVGS+FM GRALTSVLWG+IADRYGRKPV
Sbjct  52    LPISSLFPFLYFMIRDLHIAKREEDIGYYAGYVGSAFMFGRALTSVLWGMIADRYGRKPV  111

Query  572   viigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISA  751
             ++ GT++VVIFN +FG S N+WMA+ TRFLLG+LCGI+G MRAYASE+CR+EY ALG+S 
Sbjct  112   IMFGTISVVIFNTLFGFSTNFWMAVSTRFLLGSLCGILGPMRAYASEVCRKEYQALGMSI  171

Query  752   VSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSF  931
             +ST+WGIGLVIGPA+GG+ AQPA+KYP IFS +S FG+FPY LPCL+IS+F++    +  
Sbjct  172   ISTSWGIGLVIGPALGGFLAQPAQKYPNIFSTDSLFGRFPYLLPCLLISIFSVGVIAVCC  231

Query  932   WLPETMHThkkehkeehD-VSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIA  1108
              LPET+H+H    +E +D V+  +   E   P  +KSLLKNWPLISSI+VYCVFQLHD+A
Sbjct  232   LLPETLHSHVGNGEECNDSVALGAAAFESNSP--RKSLLKNWPLISSIIVYCVFQLHDMA  289

Query  1109  YLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIG  1288
             Y EIFSLWAVSPRK GGLS++TADVG+VLA +G+GLLLFQLF YPLVE+  GPVM+SRIG
Sbjct  290   YAEIFSLWAVSPRKNGGLSFSTADVGEVLAFSGLGLLLFQLFIYPLVERNFGPVMVSRIG  349

Query  1289  AALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAA  1468
             A L+IPLLS+YP++A+L GL L +++NCAS+LKNVL+VSITTGL +LQNR+V+Q+QRGAA
Sbjct  350   AVLTIPLLSSYPFLAMLKGLALMLLINCASILKNVLAVSITTGLFLLQNRSVTQQQRGAA  409

Query  1469  NGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPF  1648
             NGISMSAMSLFK IGPAAGGSL SW+Q RQDA F PGDQ++FF+LN+ E++GL++TFKPF
Sbjct  410   NGISMSAMSLFKAIGPAAGGSLFSWAQKRQDAFFFPGDQMIFFLLNMIEVIGLLLTFKPF  469

Query  1649  LQLPEDDI  1672
             L LP+D+I
Sbjct  470   LALPDDNI  477



>ref|XP_011079140.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X3 [Sesamum indicum]
Length=473

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/478 (64%), Positives = 385/478 (81%), Gaps = 37/478 (8%)
 Frame = +2

Query  212   EGNT--EPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             E N+  EPL+K+              Y ++C  C++E  K ++ G+P K +FF+ +VTL 
Sbjct  2     EDNSAAEPLIKKQG------------YHDNCEACKIERFKESNTGIPFKLLFFVWVVTLA  49

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
             AALPISSLFPFLYFM RDFHIA+REEDISYYAGYVGSSFM GRALTS+LWG++AD+YGRK
Sbjct  50    AALPISSLFPFLYFMTRDFHIAKREEDISYYAGYVGSSFMFGRALTSLLWGMVADKYGRK  109

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             P+++IGT+ VV+FN +FGLSVNYWMAI TRFLLG+LCGI+G MRAYASEICR+E+ ALG+
Sbjct  110   PIIMIGTIIVVVFNTLFGLSVNYWMAISTRFLLGSLCGILGPMRAYASEICRKEHQALGM  169

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S + T+WGIGLVIGPAVGG+ AQPAEKYP IFS ES FG+FPYFLPCL+IS+FALVA ++
Sbjct  170   SVIGTSWGIGLVIGPAVGGFLAQPAEKYPQIFSRESLFGRFPYFLPCLVISVFALVAFII  229

Query  926   SFWLPETMHThkkehkeehDVSQNSKQPEHEVPT------------------SQKSLLKN  1051
             S WLPET+H        E ++++NS++   E  T                  SQ+SL +N
Sbjct  230   SCWLPETLHI-----HCEENIARNSREAPPEDNTYESIQSQEMEVSKLQSTVSQRSLFRN  284

Query  1052  WPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQL  1231
             WPL+S+I+VYC+FQLHD+AY EIFSLWAVS RKLGGLS++T+DVG+VL++TG G+LLFQL
Sbjct  285   WPLVSAIIVYCIFQLHDMAYSEIFSLWAVSSRKLGGLSFSTSDVGEVLSVTGFGMLLFQL  344

Query  1232  FAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSIT  1411
             F Y  +E++LG +++SRIGA ++IPLLS+YP+IA LSG  L +VLN AS+LKNVLS+SIT
Sbjct  345   FLYTWIERMLGAILVSRIGAVITIPLLSSYPFIAKLSGPVLLLVLNSASLLKNVLSISIT  404

Query  1412  TGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQ  1585
             TGLL++QNRAV+QEQRGAANGISMSAMSLFK IGPAAGGSLLSW+Q RQ A+F+PG +
Sbjct  405   TGLLVIQNRAVAQEQRGAANGISMSAMSLFKAIGPAAGGSLLSWAQGRQHAEFLPGTR  462



>ref|XP_003632620.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1 isoform X1 [Vitis 
vinifera]
 emb|CBI32850.3| unnamed protein product [Vitis vinifera]
Length=490

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/480 (66%), Positives = 401/480 (84%), Gaps = 11/480 (2%)
 Frame = +2

Query  263   LEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDF  442
             L+ E + YDESC GC+++ LK ++ G+P K +F++ +V LCAALPISSLFPFLYFMIRDF
Sbjct  9     LKKEVWEYDESCPGCKIDHLKESNPGIPFKLLFYVWIVVLCAALPISSLFPFLYFMIRDF  68

Query  443   HIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGL  622
             HIA+REEDI +YAGYVGSSFM GRALTSV+WG++ADRYGRKPV+  G + ++IFN +FGL
Sbjct  69    HIAKREEDIGFYAGYVGSSFMFGRALTSVIWGMVADRYGRKPVITAGLIALIIFNTLFGL  128

Query  623   SVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGG  802
             S N WMA+ TRFLLG+ CGI+G MRAYASE+CR+EY ALG+S +STAWGIGLVIGPA+GG
Sbjct  129   STNVWMALSTRFLLGSFCGILGPMRAYASEVCRKEYQALGMSIISTAWGIGLVIGPALGG  188

Query  803   YFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeeh  982
             + AQPAEK+P IFS ES FG+FPYFLPCL+IS FAL  +V+ +WLPET+H HK+  +++ 
Sbjct  189   FLAQPAEKFPHIFSKESLFGRFPYFLPCLLISTFALGVSVLCYWLPETLHIHKENKEQDE  248

Query  983   -----------DVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSL  1129
                        DV +  K+ E + P  Q+SLLKNWPL+SSI+VYCVFQLHD+AY EIFSL
Sbjct  249   LYAWEVAAYGCDVKEKLKKFEGKGPNQQQSLLKNWPLMSSIIVYCVFQLHDMAYAEIFSL  308

Query  1130  WAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPL  1309
             WA+SP + GGLSY+TADVG+VLA++G+GLLLFQLF YP +E++LGPVM+SRIGA L++PL
Sbjct  309   WAISPSEYGGLSYSTADVGEVLAMSGLGLLLFQLFLYPPLERILGPVMVSRIGAVLTVPL  368

Query  1310  LSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSA  1489
             LS+YP IA+LSG+ LS+++NCAS+LKNVL VSITTGL +LQNRAV+Q+QRGAANGISMSA
Sbjct  369   LSSYPLIAMLSGVGLSLLINCASLLKNVLCVSITTGLFLLQNRAVTQQQRGAANGISMSA  428

Query  1490  MSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPEDD  1669
             MS FK +GPA GGSL SW+  RQ+  F+PG ++VFF+LN+ E+LGL MTFKPFL +P ++
Sbjct  429   MSFFKAVGPAGGGSLFSWALKRQNDSFLPGSRMVFFILNIIEVLGLFMTFKPFLTVPGEN  488



>ref|XP_011079141.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X4 [Sesamum indicum]
Length=464

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/476 (64%), Positives = 383/476 (80%), Gaps = 37/476 (8%)
 Frame = +2

Query  212   EGNT--EPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             E N+  EPL+K+              Y ++C  C++E  K ++ G+P K +FF+ +VTL 
Sbjct  2     EDNSAAEPLIKKQG------------YHDNCEACKIERFKESNTGIPFKLLFFVWVVTLA  49

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
             AALPISSLFPFLYFM RDFHIA+REEDISYYAGYVGSSFM GRALTS+LWG++AD+YGRK
Sbjct  50    AALPISSLFPFLYFMTRDFHIAKREEDISYYAGYVGSSFMFGRALTSLLWGMVADKYGRK  109

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             P+++IGT+ VV+FN +FGLSVNYWMAI TRFLLG+LCGI+G MRAYASEICR+E+ ALG+
Sbjct  110   PIIMIGTIIVVVFNTLFGLSVNYWMAISTRFLLGSLCGILGPMRAYASEICRKEHQALGM  169

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S + T+WGIGLVIGPAVGG+ AQPAEKYP IFS ES FG+FPYFLPCL+IS+FALVA ++
Sbjct  170   SVIGTSWGIGLVIGPAVGGFLAQPAEKYPQIFSRESLFGRFPYFLPCLVISVFALVAFII  229

Query  926   SFWLPETMHThkkehkeehDVSQNSKQPEHEVPT------------------SQKSLLKN  1051
             S WLPET+H        E ++++NS++   E  T                  SQ+SL +N
Sbjct  230   SCWLPETLHI-----HCEENIARNSREAPPEDNTYESIQSQEMEVSKLQSTVSQRSLFRN  284

Query  1052  WPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQL  1231
             WPL+S+I+VYC+FQLHD+AY EIFSLWAVS RKLGGLS++T+DVG+VL++TG G+LLFQL
Sbjct  285   WPLVSAIIVYCIFQLHDMAYSEIFSLWAVSSRKLGGLSFSTSDVGEVLSVTGFGMLLFQL  344

Query  1232  FAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSIT  1411
             F Y  +E++LG +++SRIGA ++IPLLS+YP+IA LSG  L +VLN AS+LKNVLS+SIT
Sbjct  345   FLYTWIERMLGAILVSRIGAVITIPLLSSYPFIAKLSGPVLLLVLNSASLLKNVLSISIT  404

Query  1412  TGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPG  1579
             TGLL++QNRAV+QEQRGAANGISMSAMSLFK IGPAAGGSLLSW+Q RQ A+F+P 
Sbjct  405   TGLLVIQNRAVAQEQRGAANGISMSAMSLFKAIGPAAGGSLLSWAQGRQHAEFLPA  460



>ref|XP_010653665.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1 isoform X2 [Vitis 
vinifera]
Length=488

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/472 (67%), Positives = 397/472 (84%), Gaps = 11/472 (2%)
 Frame = +2

Query  287   DESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREED  466
              E+C GC+++ LK+AD GVP+KH+F++ +V L AALPISSLFPFLYFMIRDFHIA+REED
Sbjct  15    HENCPGCKIDRLKQADTGVPVKHLFYVWIVVLAAALPISSLFPFLYFMIRDFHIAKREED  74

Query  467   ISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMAI  646
             I +YAGYVGSSFM GRALTSV+WG++ADRYGRKPV+  G + ++IFN +FGLS N WMA+
Sbjct  75    IGFYAGYVGSSFMFGRALTSVIWGMVADRYGRKPVITAGLIALIIFNTLFGLSTNVWMAL  134

Query  647   ITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAEK  826
              TRFLLG+ CGI+G MRAYASE+CR+EY ALG+S +STAWGIGLVIGPA+GG+ AQPAEK
Sbjct  135   STRFLLGSFCGILGPMRAYASEVCRKEYQALGMSIISTAWGIGLVIGPALGGFLAQPAEK  194

Query  827   YPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeeh--------  982
             +P IFS ES FG+FPYFLPCL+IS FAL  +V+ +WLPET+H HK+  +++         
Sbjct  195   FPHIFSKESLFGRFPYFLPCLLISTFALGVSVLCYWLPETLHIHKENKEQDELYAWEVAA  254

Query  983   ---DVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKL  1153
                DV +  K+ E + P  Q+SLLKNWPL+SSI+VYCVFQLHD+AY EIFSLWA+SP + 
Sbjct  255   YGCDVKEKLKKFEGKGPNQQQSLLKNWPLMSSIIVYCVFQLHDMAYAEIFSLWAISPSEY  314

Query  1154  GGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIA  1333
             GGLSY+TADVG+VLA++G+GLLLFQLF YP +E++LGPVM+SRIGA L++PLLS+YP IA
Sbjct  315   GGLSYSTADVGEVLAMSGLGLLLFQLFLYPPLERILGPVMVSRIGAVLTVPLLSSYPLIA  374

Query  1334  LLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIG  1513
             +LSG+ LS+++NCAS+LKNVL VSITTGL +LQNRAV+Q+QRGAANGISMSAMS FK +G
Sbjct  375   MLSGVGLSLLINCASLLKNVLCVSITTGLFLLQNRAVTQQQRGAANGISMSAMSFFKAVG  434

Query  1514  PAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPEDD  1669
             PA GGSL SW+  RQ+  F+PG ++VFF+LN+ E+LGL MTFKPFL +P ++
Sbjct  435   PAGGGSLFSWALKRQNDSFLPGSRMVFFILNIIEVLGLFMTFKPFLTVPGEN  486



>ref|XP_009608804.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Nicotiana tomentosiformis]
Length=482

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/485 (65%), Positives = 389/485 (80%), Gaps = 19/485 (4%)
 Frame = +2

Query  212   EGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAA  391
             EG  E L+ + E            Y E+C GC+V+L K    G+PIK +F I +V L  A
Sbjct  6     EGVKEKLVNKKE------------YYENCPGCKVDLHKAGQRGLPIKELFTIWIVILGTA  53

Query  392   LPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPv  571
             LPISSLFPFLYFMIRDFHIA+REEDISYYAGYVGSS+MLGRALTSV WG++ADRYGRKPV
Sbjct  54    LPISSLFPFLYFMIRDFHIAKREEDISYYAGYVGSSYMLGRALTSVFWGLVADRYGRKPV  113

Query  572   viigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISA  751
             +I GT  VVIFN +FGLSVN+WMAIITRFLLG+L G+IG ++AYA+EI R EY ALG+S 
Sbjct  114   IIFGTFVVVIFNTLFGLSVNFWMAIITRFLLGSLNGLIGPIKAYAAEIFREEYQALGMST  173

Query  752   VSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSF  931
             +STAWGIGL+IGPA+GG+ AQPAEKYP+IFS +S FG+FPYFLPCLIIS+F+LV  + SF
Sbjct  174   ISTAWGIGLIIGPALGGFLAQPAEKYPSIFSKDSIFGRFPYFLPCLIISLFSLVVAIASF  233

Query  932   WLPETMHThkkeh-----keehDVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQL  1096
             WLPET+H H+         E  + + ++K+     P  +++L KNWPL+SSI++YCVF L
Sbjct  234   WLPETLHIHESSMPVHDSYEALEAASDTKEGNESTP--KENLFKNWPLMSSIILYCVFSL  291

Query  1097  HDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMI  1276
             HD+AY EIFSLWAVSPRK GGLSY+TADVG+VL+I+G GLL+FQL  YPLVE+ +GPV+ 
Sbjct  292   HDMAYTEIFSLWAVSPRKFGGLSYSTADVGEVLSISGFGLLVFQLTLYPLVERYVGPVVT  351

Query  1277  SRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQ  1456
             +R+   LSIPLL++YPYIA+LSG+ LSV +N AS++KN LS+SI TGL ILQN+AV+Q Q
Sbjct  352   ARVAGVLSIPLLTSYPYIAMLSGIALSVAINFASVMKNALSISIITGLFILQNKAVNQRQ  411

Query  1457  RGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMT  1636
             RGAANGI+M+AMS+FK +GPA GG+L SW+Q R DA  +PGDQ+VFFVLNV E +G++MT
Sbjct  412   RGAANGIAMTAMSIFKALGPAGGGALFSWAQKRLDASILPGDQVVFFVLNVIEAIGVLMT  471

Query  1637  FKPFL  1651
             FKPFL
Sbjct  472   FKPFL  476



>ref|XP_009776344.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Nicotiana sylvestris]
Length=500

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/485 (64%), Positives = 389/485 (80%), Gaps = 19/485 (4%)
 Frame = +2

Query  212   EGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAA  391
             EG  E LL + E            Y E+C GC+V+L K    G+PIK +F I +V L  A
Sbjct  24    EGVKETLLNKKE------------YYENCPGCKVDLHKAGQRGLPIKELFTIWIVILGTA  71

Query  392   LPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPv  571
             LPISSLFPFLYFMIRDFHIA+REEDISYYAGYVGSS+MLGRALTSV WG++ADRYGRKPV
Sbjct  72    LPISSLFPFLYFMIRDFHIAKREEDISYYAGYVGSSYMLGRALTSVFWGLVADRYGRKPV  131

Query  572   viigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISA  751
             +I GT  VVIFN +FGLSVN+WMAIITRFLLG+L G+IG ++AYA+EI R EY ALG+S 
Sbjct  132   IIFGTFVVVIFNTLFGLSVNFWMAIITRFLLGSLNGLIGPIKAYAAEIFREEYQALGMST  191

Query  752   VSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSF  931
             +STAWGIGL+IGPA+GG+ AQPAEKYP+IF+ +S FG+FPYFLPCLIIS+F+LV  + SF
Sbjct  192   ISTAWGIGLIIGPALGGFLAQPAEKYPSIFAKDSIFGRFPYFLPCLIISLFSLVVAIASF  251

Query  932   WLPETMHThkke-----hkeehDVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQL  1096
             WLPET+H H+         E  + + ++K+     P  +++L KNWPL+SSI++YCVF L
Sbjct  252   WLPETLHIHESSVPPQDSYEALEAAPDTKEGNESAP--KENLFKNWPLMSSIILYCVFSL  309

Query  1097  HDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMI  1276
             HD+AY EIFSLWAVSPRK GGLSY+TADVG+VL+I+G GLL+FQL  YPLVE+ +GP++ 
Sbjct  310   HDMAYNEIFSLWAVSPRKFGGLSYSTADVGEVLSISGFGLLVFQLTLYPLVERYVGPIIA  369

Query  1277  SRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQ  1456
             +R+   LSIPLL++YPYIA+LSG+ LS+ +N AS++KN LS+SI TGL ILQN+AV+Q Q
Sbjct  370   ARVAGVLSIPLLTSYPYIAMLSGIALSLAINFASVMKNALSISIITGLFILQNKAVNQRQ  429

Query  1457  RGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMT  1636
             RGAANGI+M+AMS+FK +GPA GG+L SW+Q R DA  +PGDQ+VFFVLNV E +G++MT
Sbjct  430   RGAANGIAMTAMSIFKALGPAGGGALFSWAQKRLDASILPGDQVVFFVLNVIEAIGVLMT  489

Query  1637  FKPFL  1651
             FKPFL
Sbjct  490   FKPFL  494



>ref|XP_007028170.1| Zinc induced facilitator-like 1 isoform 2 [Theobroma cacao]
 gb|EOY08672.1| Zinc induced facilitator-like 1 isoform 2 [Theobroma cacao]
Length=458

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/447 (67%), Positives = 372/447 (83%), Gaps = 15/447 (3%)
 Frame = +2

Query  266   EDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFH  445
             E++YF   E+C GC+VELLK  + G+P KH+ ++ +V L AALPISSLFPFLYFMIRDF+
Sbjct  12    ENKYF---ENCPGCKVELLKETNPGIPFKHLLYVWVVVLAAALPISSLFPFLYFMIRDFN  68

Query  446   IAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLS  625
             IA++EEDI YYAGYVGS+FM GRALTSV WG+IADRYGRKPV++ GT +VVIFN +FGLS
Sbjct  69    IAKKEEDIGYYAGYVGSAFMFGRALTSVFWGMIADRYGRKPVIMFGTFSVVIFNTLFGLS  128

Query  626   VNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGY  805
              N+W+A+ TRFLLG+LCGI+G MRAYASE+CR+EY ALG+S +ST+WGIGLVIGPA+GG+
Sbjct  129   TNFWVAVSTRFLLGSLCGILGPMRAYASEVCRKEYQALGMSIISTSWGIGLVIGPALGGF  188

Query  806   FAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehD  985
              AQPAEK+P IF+ ES FG+FPYFLPC++IS+FA    ++S  LPET+H H++  KE   
Sbjct  189   LAQPAEKFPYIFANESLFGRFPYFLPCILISLFAFGVFLISCSLPETLHIHERTDKECDK  248

Query  986   VSQ---------NSKQPEHEV---PTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSL  1129
             ++          N+ +    V   PTSQ++L KNWPL+SSI+VYCVFQLHD+AY EIFSL
Sbjct  249   LNDALVTSTGEPNANEKVRIVGRHPTSQQNLWKNWPLMSSIIVYCVFQLHDMAYAEIFSL  308

Query  1130  WAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPL  1309
             WAVSPRK GGLSY+TADVG+VLAI+G GLLLFQLF YPL+E+ LGPVMISR+GA L+IPL
Sbjct  309   WAVSPRKNGGLSYSTADVGEVLAISGCGLLLFQLFLYPLIERTLGPVMISRLGAVLTIPL  368

Query  1310  LSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSA  1489
             L TYP+IA+L GL L  +++ AS+LKNVLSVSITTGL +LQNRAV+Q+QRGAANGISMSA
Sbjct  369   LFTYPFIAMLKGLSLMFLISSASVLKNVLSVSITTGLFLLQNRAVTQKQRGAANGISMSA  428

Query  1490  MSLFKTIGPAAGGSLLSWSQLRQDAKF  1570
             MS+FK +GPAAGGSL SW+Q RQ+A F
Sbjct  429   MSIFKAVGPAAGGSLFSWAQNRQNAFF  455



>ref|XP_010067061.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X3 [Eucalyptus grandis]
 gb|KCW65126.1| hypothetical protein EUGRSUZ_G02630 [Eucalyptus grandis]
Length=485

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/488 (63%), Positives = 382/488 (78%), Gaps = 29/488 (6%)
 Frame = +2

Query  242   SEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFL  421
              EQ    L+  Y+   E+C GC+VE LK +  G+PI+ +F I +V LC ALPISSLFPFL
Sbjct  4     EEQKEALLKRHYY---ENCPGCKVEKLKESQGGLPIRELFSIWIVVLCNALPISSLFPFL  60

Query  422   YFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvvi  601
             YFMIRDFH+AEREEDI YYAGYVG S MLGRALTSVLWG++ADRYGRKPV+I GT+ VVI
Sbjct  61    YFMIRDFHVAEREEDIGYYAGYVGCSLMLGRALTSVLWGVVADRYGRKPVIITGTIAVVI  120

Query  602   FNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLV  781
             FN +FGLSVN+WMA   RFLLG+L G+ G ++AYA+E+ R EY ALG+S VSTAWGIGL+
Sbjct  121   FNTLFGLSVNFWMAFAMRFLLGSLNGLYGPIKAYATELFREEYQALGVSTVSTAWGIGLI  180

Query  782   IGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThk  961
             IGPA+GGY AQPAEK+P+IFS ES FG+FPYFLPCL IS FALV  V+S WLPET+H   
Sbjct  181   IGPALGGYLAQPAEKFPSIFSKESVFGRFPYFLPCLTISFFALVVCVVSCWLPETLH---  237

Query  962   kehkeehDVSQNSKQPEHEVPTS------------------QKSLLKNWPLISSILVYCV  1087
                   H  +    +P  +V T+                  +KSLL+NWPL+S+I+ YCV
Sbjct  238   -----MHHANSELDEPREDVETASLEAGVKCKMQNVKGKAPKKSLLRNWPLMSAIIAYCV  292

Query  1088  FQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGP  1267
             F LHD+AY EIFSLWAVSPR+ GGLSYTT DVG VL+I+G GLL+FQ   YP ++++LGP
Sbjct  293   FSLHDMAYSEIFSLWAVSPRQYGGLSYTTEDVGTVLSISGAGLLIFQTCLYPYMDRLLGP  352

Query  1268  VMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVS  1447
             ++++RI  ALS+PLLS+YP+IA+L+GL LS+VLNCAS++KNVLS+S+ TGL +LQN+AV 
Sbjct  353   ILVARICGALSLPLLSSYPFIAMLTGLSLSIVLNCASVVKNVLSLSVFTGLFLLQNKAVD  412

Query  1448  QEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellgl  1627
             Q+QRGAANGI+M+AMSLFK  GPA GG+L SW+Q RQDA F+PG+Q++FF+LNV   +G+
Sbjct  413   QDQRGAANGIAMTAMSLFKAAGPAGGGTLFSWAQKRQDAAFLPGNQMIFFILNVVAAIGV  472

Query  1628  IMTFKPFL  1651
             +MTFKPFL
Sbjct  473   LMTFKPFL  480



>ref|XP_002277598.2| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1 [Vitis vinifera]
Length=548

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/559 (61%), Positives = 411/559 (74%), Gaps = 35/559 (6%)
 Frame = +2

Query  14    EACIFSLGNEIHKSLIMTPSPSHPPAIYTHDSCSSSVHKLVPPLRASTS*QWCAYRASER  193
             + C F L ++IH SL+ TPS  HP  ++   S      +  P    +T+  + A R    
Sbjct  7     QDCPFKL-HQIH-SLLQTPSLHHPLTLFASLSVCILFPR-APNGAGATAALFWAVR----  59

Query  194   ASESMAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISM  373
               E MAE    PLLK+              Y ++C+GCRVE LK    G+PI+ +  I  
Sbjct  60    --EQMAEEQQVPLLKK-------------VYYQNCSGCRVEQLKETRRGLPIRELVSIWS  104

Query  374   VTLCAALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADR  553
             V LC ALPISSLFPFLYFMIRDFHIA+REEDI YYAGYVGS+FMLGRALTSV WG++ADR
Sbjct  105   VVLCTALPISSLFPFLYFMIRDFHIAKREEDIGYYAGYVGSAFMLGRALTSVAWGMVADR  164

Query  554   YGRKPvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYH  733
             YGRKPV++IGT+TVVIFN +FGLSVN+WMA+ TRFLLG+L G++G ++AYA+EI R EY 
Sbjct  165   YGRKPVIMIGTITVVIFNTLFGLSVNFWMALSTRFLLGSLNGVLGPIKAYAAEIFRDEYQ  224

Query  734   ALGISAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALV  913
             ALG+S VSTA GIGL+IGPA+GG+ AQPAEKYP IFS +S FG+FPYFLPCL IS++A++
Sbjct  225   ALGLSTVSTARGIGLIIGPALGGFLAQPAEKYPDIFSEDSLFGRFPYFLPCLFISVYAMI  284

Query  914   ATVMSFWLPETMHThkkehkeehDV---------SQNSKQPEHEV----PTSQKSLLKNW  1054
              TV   WLPET+HTH +  K   D            N+K+ E E+    PTS +SL  NW
Sbjct  285   ITVACCWLPETLHTHNENKKSREDSYDALEGANGGSNAKEKEQEIEGSEPTSNESLFMNW  344

Query  1055  PLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLF  1234
             PL+SSI++YCVF LHDIAY+EIFSLWAVSPR  GGLSY+T DVG VLAI+G GL + Q+ 
Sbjct  345   PLMSSIIIYCVFSLHDIAYIEIFSLWAVSPRIHGGLSYSTDDVGVVLAISGFGLFVSQVT  404

Query  1235  AYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITT  1414
              YPLVE+ LGPVMI RI   LSIPLL++YP IA+LSG  LSVVLNCAS+LKNVLSVSI T
Sbjct  405   LYPLVERFLGPVMICRIAGVLSIPLLASYPLIAMLSGSTLSVVLNCASVLKNVLSVSIIT  464

Query  1415  GLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvf  1594
             G+ +LQN AV Q QRG ANGISM+AMSLFK  GPA GG+L SW+Q RQD+ F PGDQ+VF
Sbjct  465   GMFLLQNSAVDQHQRGTANGISMTAMSLFKAAGPAGGGALFSWAQKRQDSAFFPGDQMVF  524

Query  1595  fvlnvfellglIMTFKPFL  1651
              +LNV E +GL+MTFKPFL
Sbjct  525   LILNVVEAIGLLMTFKPFL  543



>emb|CBI29172.3| unnamed protein product [Vitis vinifera]
Length=487

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/495 (65%), Positives = 383/495 (77%), Gaps = 26/495 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE    PLLK+              Y ++C+GCRVE LK    G+PI+ +  I  V LC
Sbjct  1     MAEEQQVPLLKK-------------VYYQNCSGCRVEQLKETRRGLPIRELVSIWSVVLC  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              ALPISSLFPFLYFMIRDFHIA+REEDI YYAGYVGS+FMLGRALTSV WG++ADRYGRK
Sbjct  48    TALPISSLFPFLYFMIRDFHIAKREEDIGYYAGYVGSAFMLGRALTSVAWGMVADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV++IGT+TVVIFN +FGLSVN+WMA+ TRFLLG+L G++G ++AYA+EI R EY ALG+
Sbjct  108   PVIMIGTITVVIFNTLFGLSVNFWMALSTRFLLGSLNGVLGPIKAYAAEIFRDEYQALGL  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S VSTA GIGL+IGPA+GG+ AQPAEKYP IFS +S FG+FPYFLPCL IS++A++ TV 
Sbjct  168   STVSTARGIGLIIGPALGGFLAQPAEKYPDIFSEDSLFGRFPYFLPCLFISVYAMIITVA  227

Query  926   SFWLPETMHThkkehkeehDV---------SQNSKQPEHEV----PTSQKSLLKNWPLIS  1066
               WLPET+HTH +  K   D            N+K+ E E+    PTS +SL  NWPL+S
Sbjct  228   CCWLPETLHTHNENKKSREDSYDALEGANGGSNAKEKEQEIEGSEPTSNESLFMNWPLMS  287

Query  1067  SILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPL  1246
             SI++YCVF LHDIAY+EIFSLWAVSPR  GGLSY+T DVG VLAI+G GL + Q+  YPL
Sbjct  288   SIIIYCVFSLHDIAYIEIFSLWAVSPRIHGGLSYSTDDVGVVLAISGFGLFVSQVTLYPL  347

Query  1247  VEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLI  1426
             VE+ LGPVMI RI   LSIPLL++YP IA+LSG  LSVVLNCAS+LKNVLSVSI TG+ +
Sbjct  348   VERFLGPVMICRIAGVLSIPLLASYPLIAMLSGSTLSVVLNCASVLKNVLSVSIITGMFL  407

Query  1427  LQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvln  1606
             LQN AV Q QRG ANGISM+AMSLFK  GPA GG+L SW+Q RQD+ F PGDQ+VF +LN
Sbjct  408   LQNSAVDQHQRGTANGISMTAMSLFKAAGPAGGGALFSWAQKRQDSAFFPGDQMVFLILN  467

Query  1607  vfellglIMTFKPFL  1651
             V E +GL+MTFKPFL
Sbjct  468   VVEAIGLLMTFKPFL  482



>ref|XP_011032990.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Populus 
euphratica]
 ref|XP_011032991.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Populus 
euphratica]
Length=495

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/500 (63%), Positives = 387/500 (77%), Gaps = 25/500 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE   E LLK+ +            Y E+C GC+V+ LK    G P + +  I +V LC
Sbjct  1     MAEEYREALLKKDD------------YHENCPGCQVDQLKELKKGFPFRDLVSIWIVVLC  48

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              ALPIS+LFPFLYFMIRDF IAEREEDI YYAGYVGSSFM+GRALTSV WGI+ADRYGRK
Sbjct  49    TALPISTLFPFLYFMIRDFGIAEREEDIGYYAGYVGSSFMIGRALTSVFWGIVADRYGRK  108

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV+++GT+ VVIFN +FGLSVN+WMAI+TRFLLG L G++G ++AYA EI R EY ALG+
Sbjct  109   PVILLGTIAVVIFNTLFGLSVNFWMAIVTRFLLGCLNGLLGPIKAYAVEIFRAEYQALGL  168

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S VSTAWGIGL+IGPA+GG+ AQPAEKYP +FS ES FG+FPYFLPC  IS+FALV T++
Sbjct  169   STVSTAWGIGLIIGPALGGFLAQPAEKYPNLFSKESLFGRFPYFLPCFCISLFALVVTIV  228

Query  926   SFWLPETMHThkkehkeehD-------VSQNSKQPEHEV------PTSQKSLLKNWPLIS  1066
             S WLPET+H H ++    +D        +  SK  E         P+S +SLLKNWPL+S
Sbjct  229   SCWLPETLHVHNEKKTSSNDSYNALEAATGASKGDEARTDDKGRKPSSNESLLKNWPLMS  288

Query  1067  SILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPL  1246
             SI+VYC+F LHD+AY EIFSLWA S RKLGGL YTT DVG+VLA++G GLL+FQL  YP 
Sbjct  289   SIIVYCIFSLHDMAYTEIFSLWAESSRKLGGLGYTTEDVGEVLAVSGFGLLVFQLSLYPY  348

Query  1247  VEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLI  1426
             VE++LGP+ ++RI AALSI LLS+YP+IA+LSGL LS+++NCAS++KNV SVSI TG+ I
Sbjct  349   VERILGPIPVARIAAALSILLLSSYPFIAMLSGLGLSILINCASIMKNVFSVSIITGMFI  408

Query  1427  LQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvln  1606
             LQN AV Q QRGAANGISM+ MS FK +GPA GG++LSW+Q RQ+A F+PG QLVFF+LN
Sbjct  409   LQNNAVDQNQRGAANGISMTGMSFFKAVGPAGGGAILSWAQRRQNAAFLPGVQLVFFILN  468

Query  1607  vfellglIMTFKPFLQLPED  1666
               EL+G++MTFKPFL   +D
Sbjct  469   AVELIGVLMTFKPFLAQTQD  488



>gb|KCW65127.1| hypothetical protein EUGRSUZ_G02630 [Eucalyptus grandis]
Length=461

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/466 (62%), Positives = 362/466 (78%), Gaps = 29/466 (6%)
 Frame = +2

Query  242   SEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFL  421
              EQ    L+  Y+   E+C GC+VE LK +  G+PI+ +F I +V LC ALPISSLFPFL
Sbjct  4     EEQKEALLKRHYY---ENCPGCKVEKLKESQGGLPIRELFSIWIVVLCNALPISSLFPFL  60

Query  422   YFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvvi  601
             YFMIRDFH+AEREEDI YYAGYVG S MLGRALTSVLWG++ADRYGRKPV+I GT+ VVI
Sbjct  61    YFMIRDFHVAEREEDIGYYAGYVGCSLMLGRALTSVLWGVVADRYGRKPVIITGTIAVVI  120

Query  602   FNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLV  781
             FN +FGLSVN+WMA   RFLLG+L G+ G ++AYA+E+ R EY ALG+S VSTAWGIGL+
Sbjct  121   FNTLFGLSVNFWMAFAMRFLLGSLNGLYGPIKAYATELFREEYQALGVSTVSTAWGIGLI  180

Query  782   IGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThk  961
             IGPA+GGY AQPAEK+P+IFS ES FG+FPYFLPCL IS FALV  V+S WLPET+H   
Sbjct  181   IGPALGGYLAQPAEKFPSIFSKESVFGRFPYFLPCLTISFFALVVCVVSCWLPETLH---  237

Query  962   kehkeehDVSQNSKQPEHEVPTS------------------QKSLLKNWPLISSILVYCV  1087
                   H  +    +P  +V T+                  +KSLL+NWPL+S+I+ YCV
Sbjct  238   -----MHHANSELDEPREDVETASLEAGVKCKMQNVKGKAPKKSLLRNWPLMSAIIAYCV  292

Query  1088  FQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGP  1267
             F LHD+AY EIFSLWAVSPR+ GGLSYTT DVG VL+I+G GLL+FQ   YP ++++LGP
Sbjct  293   FSLHDMAYSEIFSLWAVSPRQYGGLSYTTEDVGTVLSISGAGLLIFQTCLYPYMDRLLGP  352

Query  1268  VMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVS  1447
             ++++RI  ALS+PLLS+YP+IA+L+GL LS+VLNCAS++KNVLS+S+ TGL +LQN+AV 
Sbjct  353   ILVARICGALSLPLLSSYPFIAMLTGLSLSIVLNCASVVKNVLSLSVFTGLFLLQNKAVD  412

Query  1448  QEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQ  1585
             Q+QRGAANGI+M+AMSLFK  GPA GG+L SW+Q RQDA F+PG +
Sbjct  413   QDQRGAANGIAMTAMSLFKAAGPAGGGTLFSWAQKRQDAAFLPGKK  458



>ref|XP_010036423.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW47974.1| hypothetical protein EUGRSUZ_K01705 [Eucalyptus grandis]
Length=501

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/469 (66%), Positives = 388/469 (83%), Gaps = 13/469 (3%)
 Frame = +2

Query  296   CAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREEDISY  475
             C GC +E LK  + GVP K  F++ ++ LCAALPISSLFPFLYFMIRDF IA+REEDI +
Sbjct  34    CPGCEIERLKETNRGVPYKLFFYVWIIVLCAALPISSLFPFLYFMIRDFKIAKREEDIGF  93

Query  476   YAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMAIITR  655
             YAGYVGS+FM GRALTSVLWG++ADRYGRKPV++ GTVTVV+FN +FGLS N+WMA+ TR
Sbjct  94    YAGYVGSAFMFGRALTSVLWGMLADRYGRKPVILFGTVTVVVFNTLFGLSTNFWMAVSTR  153

Query  656   FLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAEKYPT  835
             FLLG+LCGI+G MRAYASE+CR+EY AL +S +ST+WGIGLVIGPA+GGY AQPAEK+P 
Sbjct  154   FLLGSLCGILGPMRAYASEVCRKEYQALAMSIISTSWGIGLVIGPAIGGYLAQPAEKFPN  213

Query  836   IFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHT------------hkkehkee  979
             +FS +S FG+FPYFLPCL+IS+F+L   V++ WLPE++H                E +E 
Sbjct  214   VFSEKSIFGRFPYFLPCLLISVFSLGVMVVACWLPESLHRHGESSEECDIPYEALEAEEN  273

Query  980   hDVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGG  1159
               +   S++ E    TS  SLL+NWPL+SSI+VYCVFQLHD+AY EIFSLWA+SP K GG
Sbjct  274   KTLKDESQRNEKSCQTSW-SLLRNWPLMSSIIVYCVFQLHDMAYTEIFSLWAISPWKFGG  332

Query  1160  LSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALL  1339
             LSY+TADVG+VLA++G GLLLFQLF YP VE++ GP+++SR+GAALSI LLS+YP+IA L
Sbjct  333   LSYSTADVGEVLALSGFGLLLFQLFLYPRVERICGPIVVSRVGAALSIILLSSYPFIAKL  392

Query  1340  SGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPA  1519
             +G+ L+++++ AS+LKNVL+VSITTGL +LQNRAV+QEQRGAANG+S+SAMSLFK +GPA
Sbjct  393   TGIILTILVDSASILKNVLAVSITTGLFLLQNRAVTQEQRGAANGLSLSAMSLFKAMGPA  452

Query  1520  AGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPED  1666
             AGGS+ SW+Q RQ+A F+PG+ +VFF+LNV E LGL+MTFKPFL  P+D
Sbjct  453   AGGSIFSWAQKRQNASFLPGNHMVFFILNVIEALGLLMTFKPFLTQPKD  501



>ref|XP_010067054.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Eucalyptus grandis]
Length=497

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/496 (60%), Positives = 386/496 (78%), Gaps = 15/496 (3%)
 Frame = +2

Query  233   LKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLF  412
             + + EQ    L+  Y+   E+C GC+V+ +K +  G+PI+ + +IS V +CA LPISSLF
Sbjct  1     MAEEEQQEALLKKHYY---ENCPGCKVKKIKESQTGLPIRELTWISTVVICATLPISSLF  57

Query  413   PFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvt  592
             PFLYFMIRDFHIAERE+DI YYAGY+G SFM GRALTSV WGI+ADRYGRKPV+I+GT++
Sbjct  58    PFLYFMIRDFHIAEREDDIGYYAGYLGCSFMFGRALTSVFWGIVADRYGRKPVIIMGTIS  117

Query  593   vviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGI  772
             VVIFN +FGLSVN+WMAI  RFLLG+L GI+G ++AYA E+ R EY ALGIS V TAWGI
Sbjct  118   VVIFNTLFGLSVNFWMAIAMRFLLGSLNGILGPIKAYACEMFREEYQALGISTVVTAWGI  177

Query  773   GLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM-SFWLPETM  949
             GL+IGPA+GGY AQPAEK+P+IFS ES FG+FPYFLPCL IS+FALV +V+ SFWLPET+
Sbjct  178   GLIIGPALGGYLAQPAEKFPSIFSKESVFGRFPYFLPCLAISLFALVVSVVASFWLPETL  237

Query  950   HThkkehkeehDVSQNSKQP-EHEV---------PTSQKSLLKNWPLISSILVYCVFQLH  1099
             H H    + +         P E  V           S+KSL+ NWPL+SSI+ YCVF LH
Sbjct  238   HMHHVSSELDESCEDAETAPLESGVKCKTQKVGGKASKKSLVCNWPLMSSIIPYCVFSLH  297

Query  1100  DIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMIS  1279
             ++AY+EIFSLWAVSPR+ GGLS+TT DVG VL+I+G GLL+FQ++ YP ++ +LGPV+++
Sbjct  298   EVAYVEIFSLWAVSPRQYGGLSFTTEDVGTVLSISGAGLLVFQMWLYPYLDGLLGPVVVA  357

Query  1280  RIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQR  1459
             R+G  L+IP+LS+YP+IA+L+GL LS+VLNCAS   NVLS+   T L++LQN+AV Q+QR
Sbjct  358   RVGGVLTIPILSSYPFIAMLTGLSLSIVLNCASAALNVLSICALTSLMLLQNKAVDQDQR  417

Query  1460  GAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTF  1639
             GAANGI+M+AMSLFK  GP  GGS+ SW+Q RQDA  +PGDQ++FFV+N+   +G++MTF
Sbjct  418   GAANGIAMTAMSLFKAAGPVGGGSIFSWTQKRQDAALLPGDQMIFFVMNLVMAIGVLMTF  477

Query  1640  KPFL-QLPEDDILKSK  1684
             KPFL + PE    +S 
Sbjct  478   KPFLVERPESKKTESN  493



>ref|XP_002310957.2| hypothetical protein POPTR_0008s01110g [Populus trichocarpa]
 gb|EEE88324.2| hypothetical protein POPTR_0008s01110g [Populus trichocarpa]
Length=495

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/500 (63%), Positives = 390/500 (78%), Gaps = 25/500 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE   E LLK+         D+Y+   E+C GC+V+ LK    G P + +  I +V LC
Sbjct  1     MAEEYREALLKK---------DDYY---ENCPGCKVDQLKELKKGFPFRDLISIWIVVLC  48

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              ALPIS+LFPFLYFMIRDF IAEREEDI YYAGYVGSSFM+GRALTSV WGI+ADRYGRK
Sbjct  49    TALPISTLFPFLYFMIRDFGIAEREEDIGYYAGYVGSSFMIGRALTSVFWGIVADRYGRK  108

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV+++GT+ VVIFN +FGLSVN+WMAIITRFLLG+L G++G ++AYA EI R EY ALG+
Sbjct  109   PVILLGTIAVVIFNTLFGLSVNFWMAIITRFLLGSLNGLLGPIKAYAVEIFRAEYQALGL  168

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S VSTAWG+GL+IGPA+GG+ AQPAEKYP +FS ES FG+FPYFLPC  IS+FALV T++
Sbjct  169   STVSTAWGLGLIIGPALGGFLAQPAEKYPNLFSKESLFGRFPYFLPCFCISLFALVVTIV  228

Query  926   SFWLPETMHThkkehkeehD-------VSQNSKQPEHEV------PTSQKSLLKNWPLIS  1066
             S WLPET+H H ++    +D        +  SK  E         P+S +SLLKNWPL+S
Sbjct  229   SCWLPETLHVHNEKKTSSNDSYDALEAATGASKGDETRTDDKGRKPSSNESLLKNWPLMS  288

Query  1067  SILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPL  1246
             SI+VYC+F LHD+AY EIFSLWA S RKLGGL YTT DVG+VLAI+G  LL+FQL  YP 
Sbjct  289   SIVVYCIFSLHDMAYTEIFSLWAESSRKLGGLGYTTEDVGEVLAISGFSLLVFQLSLYPF  348

Query  1247  VEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLI  1426
             VE++LGP+ +++I AALSI LLS+YP+IA+LSGL LS+++NCAS++KNV SVSI TG+ I
Sbjct  349   VERILGPIPVAQIAAALSILLLSSYPFIAMLSGLGLSILINCASIMKNVFSVSIVTGMFI  408

Query  1427  LQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvln  1606
             LQN AV Q QRGAANGISM+ MSLFK +GPA GG++LSW+Q RQ+A F+PG Q+VFF+LN
Sbjct  409   LQNNAVDQNQRGAANGISMTGMSLFKAVGPAGGGAILSWAQRRQNAAFLPGVQMVFFILN  468

Query  1607  vfellglIMTFKPFLQLPED  1666
               EL+GL+MTFKPFL   +D
Sbjct  469   AVELIGLLMTFKPFLAQRQD  488



>ref|XP_009355075.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Pyrus x bretschneideri]
Length=483

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/497 (63%), Positives = 386/497 (78%), Gaps = 25/497 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE   E LLK+              Y + C GC VE  K    G+PIK +  + ++ L 
Sbjct  1     MAEECRETLLKK-------------VYYDECPGCVVEQRKELQRGLPIKMLVSVWLIVLS  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
             AALPISSLFPFLYFMIRDFHIA+REEDI YYAGYVGSS+MLGR LTS+LWG++ADRYGRK
Sbjct  48    AALPISSLFPFLYFMIRDFHIAKREEDIGYYAGYVGSSYMLGRVLTSILWGMVADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV+IIGTV VVIFN +FGLSVN+WMAI TRFLLG+L G++G ++AYASE  R E+ ALG+
Sbjct  108   PVIIIGTVAVVIFNTLFGLSVNFWMAISTRFLLGSLNGLLGPIKAYASEAFREEHQALGM  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S VS AWGIGL+IGPA+GG+ AQPA+KYP+IFS  S FG+FPYFLPCL IS  A   T+ 
Sbjct  168   STVSVAWGIGLIIGPALGGFLAQPADKYPSIFSKSSIFGRFPYFLPCLCISALAFGVTIT  227

Query  926   SFWLPETMHThkkehkeehDVSQ-----------NSKQPEHEVPTSQKSLLKNWPLISSI  1072
             SFWLPET+H H  + + + D  +           N KQ   E  T +++L KNWPL+SSI
Sbjct  228   SFWLPETLHKHNGKARLDDDSYEALEAANGGSDANEKQKTEE-QTPKENLFKNWPLMSSI  286

Query  1073  LVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVE  1252
             +VYCVF LHD+AY EIFSLWAVSPRK GGLSYTT DVG+VLAI+G GL +FQ+  YP +E
Sbjct  287   IVYCVFSLHDMAYTEIFSLWAVSPRKFGGLSYTTEDVGEVLAISGFGLFVFQITLYPYIE  346

Query  1253  KVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQ  1432
             ++LGPV+I+R+G  +SIPLLS+YP+IA+L+GL LSV+LNCAS++KNVLS++I TGL ILQ
Sbjct  347   RLLGPVIIARVGGIISIPLLSSYPFIAMLTGLSLSVLLNCASVVKNVLSITIVTGLFILQ  406

Query  1433  NRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvf  1612
             NRAV Q+QRGAANG++M+AMSLFK IGPAAGG+L SW+Q R+DA  +PG Q++FF+LNV 
Sbjct  407   NRAVDQKQRGAANGLAMTAMSLFKAIGPAAGGALFSWAQKRRDAAILPGSQMIFFILNVV  466

Query  1613  ellglIMTFKPFLQLPE  1663
             E + ++MTFKPFL L E
Sbjct  467   EAIAVLMTFKPFLTLRE  483



>ref|XP_007010371.1| Zinc induced facilitator-like 1 isoform 1 [Theobroma cacao]
 gb|EOY19181.1| Zinc induced facilitator-like 1 isoform 1 [Theobroma cacao]
Length=487

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/495 (64%), Positives = 389/495 (79%), Gaps = 26/495 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MA+   EPLLK+              Y E+C GC+V+ +K    G+P++ +  I +V LC
Sbjct  1     MAQEYREPLLKKK-------------YHENCPGCKVDQMKELQRGLPLRQLVSIWIVVLC  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
             AALPISSLFPFLYFMIRDFHI++REEDI YYAGYVGS+FMLGRA TSVLWGIIADRYGRK
Sbjct  48    AALPISSLFPFLYFMIRDFHISKREEDIGYYAGYVGSAFMLGRASTSVLWGIIADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV+I+GT+TVV+FN +FGLSVN++MA+ TRFLLG+L G++G ++AYA EI R E+ ALG+
Sbjct  108   PVIIMGTITVVVFNTLFGLSVNFYMAVTTRFLLGSLNGLLGPIKAYAVEIFREEHQALGL  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S VST+WGIGL+IGPA+GG+ AQPAEKYP IFS +S FG+FPYFLPCL IS+FAL  T+ 
Sbjct  168   STVSTSWGIGLIIGPALGGFLAQPAEKYPNIFSKDSLFGRFPYFLPCLAISLFALGVTIA  227

Query  926   SFWLPETMHThkkehkeehD-------------VSQNSKQPEHEVPTSQKSLLKNWPLIS  1066
             +FWLPET+H H    +   D               + +++ E    TS++SLLKNWPL+S
Sbjct  228   TFWLPETLHKHNDNDRSSDDSYDALEAAPHESSSKEITEEDEGRESTSKQSLLKNWPLMS  287

Query  1067  SILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPL  1246
             SI+VYCVF LHD+AY EIFSLWAVSPRK GGLSY+T DVG+VLAI+G  LL+FQL  YP 
Sbjct  288   SIIVYCVFSLHDMAYTEIFSLWAVSPRKFGGLSYSTKDVGEVLAISGFSLLVFQLSVYPT  347

Query  1247  VEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLI  1426
             VE++LGPVM+SRI + L+IPLL +Y YIALLSG  LS+VLNCAS+LKNVLSVSI TGL I
Sbjct  348   VERILGPVMVSRIASVLTIPLLQSYSYIALLSGFTLSLVLNCASILKNVLSVSIITGLFI  407

Query  1427  LQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvln  1606
             LQNRAV Q QRGAANGI+M+ MSLFK  GPA GG+L SW++ RQDA F+PG Q+VFF+LN
Sbjct  408   LQNRAVDQHQRGAANGIAMTGMSLFKAAGPAGGGALFSWAEKRQDAAFLPGTQMVFFILN  467

Query  1607  vfellglIMTFKPFL  1651
             + E +G++MTFKPFL
Sbjct  468   IVEAVGVLMTFKPFL  482



>ref|XP_006347686.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X3 [Solanum tuberosum]
Length=480

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/487 (61%), Positives = 375/487 (77%), Gaps = 19/487 (4%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE    PL+ + +            Y E+C GC+V+L K    G+PIK +F + +V L 
Sbjct  1     MAEELETPLINKKD------------YYENCPGCKVDLHKAGQTGLPIKELFTVWVVILS  48

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
             AALPISSLFPF+YFMI+DFHIA+REEDIS YAGYVGS+FMLGRALTSV WG +ADRYGRK
Sbjct  49    AALPISSLFPFVYFMIKDFHIAKREEDISTYAGYVGSAFMLGRALTSVFWGTVADRYGRK  108

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV++ GT  VVIFN +FGLSVN+WMA+ITRFLLG L G++G +RAYA+EI R EY A+G+
Sbjct  109   PVIVFGTFVVVIFNTLFGLSVNFWMAVITRFLLGFLNGLMGPIRAYAAEIFREEYQAMGM  168

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S +S+AWGIGL+IGPA+GG+FAQPAEKYP +FS +S FG+FPYFLPCL IS+F+LV  + 
Sbjct  169   STISSAWGIGLIIGPAIGGFFAQPAEKYPAVFSKDSIFGRFPYFLPCLCISLFSLVVGIA  228

Query  926   SFWLPETMHThkk-----ehkeehDVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVF  1090
             SFWLPET+H H          +  + + ++K+     P   KSL KNWPLIS+I++YCVF
Sbjct  229   SFWLPETLHNHDSRMPPQSSYKALEAASDTKEGNKSTPA--KSLFKNWPLISAIILYCVF  286

Query  1091  QLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPV  1270
              LHD+AY EIFSLWAV+PRK GGL+Y+T DVG+VL+I+G GLL+FQL  YPLVE+  GP+
Sbjct  287   ALHDMAYSEIFSLWAVTPRKFGGLNYSTVDVGEVLSISGCGLLVFQLTLYPLVERYFGPI  346

Query  1271  MISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQ  1450
             +I+RI   LSIPLL+ YPYIA+LSG  LSV +N AS+LKN LS+ I TGL ILQN++V Q
Sbjct  347   VIARIAGVLSIPLLACYPYIAMLSGTALSVAINVASLLKNALSICIITGLFILQNKSVDQ  406

Query  1451  EQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglI  1630
              QRGAANG++M++ S FK IGPA  G L SW+Q R DA  +PG Q+VFFVLNV E +G++
Sbjct  407   RQRGAANGLAMTSQSFFKAIGPAGAGVLFSWAQKRLDAPILPGAQVVFFVLNVIEAIGVL  466

Query  1631  MTFKPFL  1651
             +TFKPFL
Sbjct  467   LTFKPFL  473



>ref|XP_008346199.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Malus domestica]
Length=483

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/497 (62%), Positives = 378/497 (76%), Gaps = 25/497 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE   E LLK+              Y + C GC VE  K    G+PIK +  I ++ L 
Sbjct  1     MAEECRETLLKK-------------VYYDECPGCVVEQRKELQRGLPIKMLVSIWLIALS  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
             +ALP+SSLFPFLYFMIRD HIA+REEDI YYAGYVG+SFMLGR LTS+LWG++ADRYGRK
Sbjct  48    SALPVSSLFPFLYFMIRDLHIAKREEDIGYYAGYVGASFMLGRVLTSILWGMVADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV+IIGTV VVIFN +FGLSVNYWMAI TRFLLG+L G +G ++AYA E  R E+ AL +
Sbjct  108   PVIIIGTVAVVIFNTLFGLSVNYWMAICTRFLLGSLNGSLGPIKAYACEAFREEHQALSM  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S VS A GIGL+IGPA+GG+ AQPA+KYP+IFS  S FG+FPYFLPCL IS  A   T++
Sbjct  168   STVSVARGIGLIIGPALGGFLAQPADKYPSIFSQNSIFGRFPYFLPCLCISALAFGVTII  227

Query  926   SFWLPETMHThkkehkeehDVSQ-----------NSKQPEHEVPTSQKSLLKNWPLISSI  1072
             SFWLPET+H H  + +   D  +           N KQ   E  T +++L KNWPL+SSI
Sbjct  228   SFWLPETLHXHNGKARLHDDSYEALETASGGSDANEKQKTEE-QTPKENLFKNWPLMSSI  286

Query  1073  LVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVE  1252
             +VYCVF LHD+AY EIFSLWAVSPRK GGLS+TT DVG+VLAI+G  L +FQ+  YP VE
Sbjct  287   IVYCVFSLHDMAYAEIFSLWAVSPRKFGGLSFTTEDVGEVLAISGFSLFVFQITLYPYVE  346

Query  1253  KVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQ  1432
             ++LGPVMI+R+G  +SIPLLS+YP+IA+LSGL L V+LNCAS+LKNV+S++I TG+ ILQ
Sbjct  347   RLLGPVMIARVGGIISIPLLSSYPFIAMLSGLSLFVLLNCASVLKNVISITIITGMFILQ  406

Query  1433  NRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvf  1612
             NRAV Q+QRGAANG+SM+AMSLFK I PAAGG+L SW+Q R+DA  +PG Q++FF+LNV 
Sbjct  407   NRAVDQKQRGAANGLSMTAMSLFKAIAPAAGGALFSWAQKRRDAALLPGSQMIFFILNVV  466

Query  1613  ellglIMTFKPFLQLPE  1663
             E + ++MTFKPFL L E
Sbjct  467   EAIAVLMTFKPFLTLRE  483



>ref|XP_008346187.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Malus 
domestica]
Length=483

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/497 (63%), Positives = 385/497 (77%), Gaps = 25/497 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE   E LLK+              Y + C GC +E  K    G+P K +  + ++ L 
Sbjct  1     MAEECRETLLKK-------------VYYDECPGCVMEQRKELQRGLPXKMLVSVWLIVLS  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
             AALPISSLFPFLYFMIRDFHIA+REEDI YYAGYVGSS+MLGR LTS+LWG++ADRYGRK
Sbjct  48    AALPISSLFPFLYFMIRDFHIAKREEDIGYYAGYVGSSYMLGRVLTSILWGMVADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV+IIGTV VVIFN +FGLSVN+WMAI TRFLLG+L G++G ++AYASE  R E+ ALG+
Sbjct  108   PVIIIGTVAVVIFNTLFGLSVNFWMAISTRFLLGSLNGLLGPIKAYASEAFREEHQALGM  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S VS AWGIGL+IGPA+GG+ AQPA+KYP+IFS  S FG+FPYFLPCL IS+FA   T+ 
Sbjct  168   STVSVAWGIGLIIGPALGGFLAQPADKYPSIFSQSSIFGRFPYFLPCLCISVFAFGVTIA  227

Query  926   SFWLPETMHThkkehkeehDVSQ-----------NSKQPEHEVPTSQKSLLKNWPLISSI  1072
             SFWLPET+H H  + + + D  +           N KQ   E  T +++L KNWPL+SSI
Sbjct  228   SFWLPETLHKHNGKARLDDDSYEALEAANGGSDANEKQKTEE-QTPKENLFKNWPLMSSI  286

Query  1073  LVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVE  1252
             +VYCVF LHD+AY EIFSLWAVSPRKLGGLS TT DVG+VLAI+G GL +FQ+  YP  E
Sbjct  287   IVYCVFSLHDMAYTEIFSLWAVSPRKLGGLSXTTEDVGEVLAISGFGLFVFQITLYPYFE  346

Query  1253  KVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQ  1432
             ++LGPVMI+R+G  +SIPLLS+YP+IA+LSGL LSV+LNCAS++KNVLS+ I TGL ILQ
Sbjct  347   RLLGPVMIARVGGIISIPLLSSYPFIAMLSGLALSVLLNCASVVKNVLSIXIVTGLFILQ  406

Query  1433  NRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvf  1612
             NRAV Q+QRGAANGI+M+AMSLFK IGPAAGG+L SW+Q R+DA  +PG Q++FF+LNV 
Sbjct  407   NRAVDQKQRGAANGIAMTAMSLFKAIGPAAGGALFSWAQKRRDAAILPGSQMIFFILNVV  466

Query  1613  ellglIMTFKPFLQLPE  1663
             E + ++MTFKPFL L E
Sbjct  467   EAIAVLMTFKPFLTLHE  483



>ref|XP_008354840.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Malus domestica]
Length=483

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/497 (62%), Positives = 378/497 (76%), Gaps = 25/497 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE   E LLK+              Y + C GC VE  K    G+PIK +  I ++ L 
Sbjct  1     MAEECRETLLKK-------------VYYDECPGCVVEQRKELQRGLPIKMLVSIWLIALS  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
             +ALP+SSLFPFLYFMIRD HIA+REEDI YYAGYVG+SFMLGR LTS+LWG++ADRYGRK
Sbjct  48    SALPVSSLFPFLYFMIRDLHIAKREEDIGYYAGYVGASFMLGRVLTSILWGMVADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV+IIGTV VVIFN +FGLSVNYWMAI TRFLLG+L G +G ++AYA E  R E+ AL +
Sbjct  108   PVIIIGTVAVVIFNTLFGLSVNYWMAICTRFLLGSLNGSLGPIKAYACEAFRXEHQALSM  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S VS A GIGL+IGPA+GG+ AQPA+KYP+IFS  S FG+FPYFLPCL IS  A   T++
Sbjct  168   STVSVARGIGLIIGPALGGFLAQPADKYPSIFSQNSIFGRFPYFLPCLCISALAFGVTII  227

Query  926   SFWLPETMHThkkehkeehDVSQ-----------NSKQPEHEVPTSQKSLLKNWPLISSI  1072
             SFWLPET+H H  + +   D  +           N KQ   E  T +++L KNWPL+SSI
Sbjct  228   SFWLPETLHXHNGKARLHDDSYEALETASGGSDANEKQKTEE-QTPKENLFKNWPLMSSI  286

Query  1073  LVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVE  1252
             +VYCVF LHD+AY EIFSLWAVSPRK GGLS+TT DVG+VLAI+G  L +FQ+  YP VE
Sbjct  287   IVYCVFSLHDMAYAEIFSLWAVSPRKFGGLSFTTEDVGEVLAISGFSLFVFQITLYPYVE  346

Query  1253  KVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQ  1432
             ++LGPVMI+R+G  +SIPLLS+YP+IA+LSGL L V+LNCAS+LKNV+S++I TG+ ILQ
Sbjct  347   RLLGPVMIARVGGIISIPLLSSYPFIAMLSGLSLFVLLNCASVLKNVISITIITGMFILQ  406

Query  1433  NRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvf  1612
             NRAV Q+QRGAANG+SM+AMSLFK I PAAGG+L SW+Q R+DA  +PG Q++FF+LNV 
Sbjct  407   NRAVDQKQRGAANGLSMTAMSLFKAIAPAAGGALFSWAQKRRDAALLPGSQMIFFILNVV  466

Query  1613  ellglIMTFKPFLQLPE  1663
             E + ++MTFKPFL L E
Sbjct  467   EAIAVLMTFKPFLTLRE  483



>ref|XP_006347684.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Solanum tuberosum]
Length=481

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/482 (62%), Positives = 374/482 (78%), Gaps = 15/482 (3%)
 Frame = +2

Query  221   TEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPI  400
             +EPLL    +     E  Y+   E+C GC+++L K    G+PIK +F I +V L  ALPI
Sbjct  3     SEPLLINKRE-----EKHYY---ENCPGCKMDLHKAGQTGLPIKELFTIWVVVLGTALPI  54

Query  401   SSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvvii  580
             SSLFPFLYFMI+DFHIA+REEDIS YAGYVGS+FMLGRALTSV WG +ADRYGRKPV++ 
Sbjct  55    SSLFPFLYFMIKDFHIAKREEDISTYAGYVGSAFMLGRALTSVFWGTVADRYGRKPVIVF  114

Query  581   gtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVST  760
             GT  VVIFN +FGLSVN+WMA+ITRFLLG L G++G +RAYA+EI R EY A+G+S +S+
Sbjct  115   GTFVVVIFNTLFGLSVNFWMAVITRFLLGFLNGLMGPIRAYAAEIFREEYQAMGMSTISS  174

Query  761   AWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLP  940
             AWGIGL+IGPA+GG+FAQPAEKYP +FS +S FG+FPYFLPCL IS+F+LV  + SFWLP
Sbjct  175   AWGIGLIIGPAIGGFFAQPAEKYPAVFSKDSIFGRFPYFLPCLCISLFSLVVGIASFWLP  234

Query  941   ETMHThkk-----ehkeehDVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDI  1105
             ET+H H          +  + + ++K+     P   KSL KNWPLIS+I++YCVF LHD+
Sbjct  235   ETLHNHDSRMPPQSSYKALEAASDTKEGNKSTPA--KSLFKNWPLISAIILYCVFALHDM  292

Query  1106  AYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRI  1285
             AY EIFSLWAV+PRK GGL+Y+T DVG+VL+I+G GLL+FQL  YPLVE+  GP++I+RI
Sbjct  293   AYSEIFSLWAVTPRKFGGLNYSTVDVGEVLSISGCGLLVFQLTLYPLVERYFGPIVIARI  352

Query  1286  GAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGA  1465
                LSIPLL+ YPYIA+LSG  LSV +N AS+LKN LS+ I TGL ILQN++V Q QRGA
Sbjct  353   AGVLSIPLLACYPYIAMLSGTALSVAINVASLLKNALSICIITGLFILQNKSVDQRQRGA  412

Query  1466  ANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKP  1645
             ANG++M++ S FK IGPA  G L SW+Q R DA  +PG Q+VFFVLNV E +G+++TFKP
Sbjct  413   ANGLAMTSQSFFKAIGPAGAGVLFSWAQKRLDAPILPGAQVVFFVLNVIEAIGVLLTFKP  472

Query  1646  FL  1651
             FL
Sbjct  473   FL  474



>ref|XP_006347687.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Solanum tuberosum]
Length=480

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/462 (64%), Positives = 370/462 (80%), Gaps = 8/462 (2%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y E+C GC+V+  K    G+PIK +F I +V L  ALPISSLFPFLYFMI+DFHIA+REE
Sbjct  15    YYENCPGCKVDQHKSGQTGLPIKELFTIWVVILGTALPISSLFPFLYFMIKDFHIAKREE  74

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DIS YAGYVGS+FMLGRA TSV WG +ADRYGRKPV++ GT  VV+FN +FGLSVN+WMA
Sbjct  75    DISTYAGYVGSAFMLGRASTSVFWGAVADRYGRKPVIVFGTFVVVVFNTLFGLSVNFWMA  134

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TRFLLG L G+IG ++AYA+EI R EY ALG+S +STAWGIGL+IGPA+GG+ AQPAE
Sbjct  135   ITTRFLLGFLNGLIGPIKAYAAEIFREEYQALGMSTISTAWGIGLIIGPALGGFLAQPAE  194

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHTh------kkehkeehD  985
             KYP +FS +S FG+FPYFLPCL IS+F+L   + SFWLPET+H H      +  ++   +
Sbjct  195   KYPDVFSKDSIFGRFPYFLPCLCISLFSLAVGIASFWLPETLHNHDSRMPPQSSYEALEE  254

Query  986   VSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLS  1165
              + ++K     VP  +++L KNWPL+SSI++YCVF LHD+AY EIFSLW VSPRK GGLS
Sbjct  255   AASDTKDRNESVP--KENLFKNWPLMSSIILYCVFSLHDMAYTEIFSLWTVSPRKFGGLS  312

Query  1166  YTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSG  1345
             Y+T DVG+VL+I+G GLL+FQL  YPLVEK +GP++I+R+   LSIP+L++YPYIA+LSG
Sbjct  313   YSTVDVGEVLSISGFGLLVFQLSLYPLVEKYVGPIVIARVAGVLSIPVLTSYPYIAMLSG  372

Query  1346  LCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAG  1525
             + LSV +N AS++KN LS+SI TGL ILQN+AV Q QRGAANGI+M+AMS+FK IGPA  
Sbjct  373   IALSVAINFASVIKNALSISIITGLFILQNKAVDQRQRGAANGIAMTAMSIFKAIGPAGA  432

Query  1526  GSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             G L SW+Q R DA  +PGDQ+VFFVLNV E +G+++TFKPFL
Sbjct  433   GVLFSWAQKRLDASILPGDQVVFFVLNVIEAIGVLLTFKPFL  474



>ref|XP_004230051.2| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1 [Solanum lycopersicum]
Length=506

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/461 (64%), Positives = 367/461 (80%), Gaps = 7/461 (2%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y E+C GC+V+L K    G+PIK +F + +V L AALPISSLFPF+YFMIRDFHIA+REE
Sbjct  41    YYENCPGCKVDLHKAGQTGLPIKELFTVWVVILSAALPISSLFPFVYFMIRDFHIAKREE  100

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DIS YAGYVGS+FMLGRALTSVLWG +ADRYGRKPV++ GT  VVIFN +FGLSVN+WMA
Sbjct  101   DISTYAGYVGSAFMLGRALTSVLWGTVADRYGRKPVIVFGTFVVVIFNTLFGLSVNFWMA  160

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             +ITRFLLG L G++G +RAYA+EI R EY A+G+S +S+AWGIGL+IGPA+GG+FAQPAE
Sbjct  161   VITRFLLGFLNGLMGPIRAYAAEIFREEYQAMGMSTISSAWGIGLIIGPAIGGFFAQPAE  220

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMH-----ThkkehkeehDV  988
             KYP  FS +S FG+FPYFLPCL IS+F+LV  + S WLPET+H     T  +   +  + 
Sbjct  221   KYPAAFSKDSIFGRFPYFLPCLCISLFSLVVGIASIWLPETLHNHDTRTPPQRSYKALEA  280

Query  989   SQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSY  1168
             + ++K+     PT  KSL KNWPL+S+I++YCVF LHD+AY EIFSLWAV+PRK GGL+Y
Sbjct  281   ASDTKEGNESTPT--KSLFKNWPLMSAIILYCVFALHDMAYSEIFSLWAVTPRKFGGLNY  338

Query  1169  TTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGL  1348
             +T DVG+VL+I+G GLL+FQL  YPLVE+  GP++I+RI   LSIPLL+ YPYIA+LSG 
Sbjct  339   STVDVGEVLSISGCGLLVFQLTLYPLVERYFGPIVIARIAGVLSIPLLACYPYIAMLSGT  398

Query  1349  CLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGG  1528
              LSV +N AS+LKN LS+ I TGL ILQN++V Q QRGAANG++M++ S FK IGPA  G
Sbjct  399   ALSVAINFASLLKNALSICIITGLFILQNKSVDQRQRGAANGLAMTSQSFFKAIGPAGAG  458

Query  1529  SLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
              L SW+Q R D   +PG Q+VFFVLNV E +G+++TFKPFL
Sbjct  459   VLFSWAQKRLDTPILPGSQVVFFVLNVIEAIGVLLTFKPFL  499



>ref|XP_010659034.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Vitis 
vinifera]
Length=486

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/494 (61%), Positives = 378/494 (77%), Gaps = 25/494 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             M E   E LLK+              Y E C GCRVE LK    G+P++ +FF+ +V LC
Sbjct  1     MEEEQREVLLKK-------------VYHEGCPGCRVEHLKDTQRGLPVRQLFFVWIVVLC  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              ALPISSLFP+LYFMIRDF+IA+ E+DI YYAGY G+S+M GRALTS+LWG++ADRYGRK
Sbjct  48    NALPISSLFPYLYFMIRDFNIAKTEKDIGYYAGYAGASYMFGRALTSILWGMVADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV+++GT +VVIFN +FGLS+NYWMAI +RFLLG++  ++G + AYA+EI R EY ALG+
Sbjct  108   PVILVGTASVVIFNTLFGLSLNYWMAISSRFLLGSMSTLLGPIMAYATEIFREEYQALGL  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S ++TAWG+GL+IGPA+GG+ AQPAEKYP IFS ES FG+FPYFLPCL  S++A   T+ 
Sbjct  168   STINTAWGVGLIIGPALGGFLAQPAEKYPNIFSKESIFGRFPYFLPCLCTSVYAFGITIA  227

Query  926   SFWLPETMHThkkehkeehDVSQ--------NSKQPEHEV----PTSQKSLLKNWPLISS  1069
               WL ET+HTH + +K   +           N+++  +E+    PTS++SL+KNWPL+SS
Sbjct  228   CCWLQETLHTHNENNKLSKNSYNALEAPCGFNAEEAVNEIEANKPTSKESLIKNWPLMSS  287

Query  1070  ILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLV  1249
             I+V+CVF LHD+AY EIFSLWAVSPRK GGLSY+T DVG VLAI+G G+L+FQLF YP +
Sbjct  288   IIVFCVFSLHDMAYSEIFSLWAVSPRKYGGLSYSTDDVGVVLAISGFGVLVFQLFLYPYL  347

Query  1250  EKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLIL  1429
             EK+LGP++I RI   LSIPLL+ YP IA+LSG  LS+ LNCAS +KNVLSVSI T L+IL
Sbjct  348   EKLLGPIIICRIAGVLSIPLLAIYPLIAMLSGFNLSLALNCASAMKNVLSVSIGTSLIIL  407

Query  1430  QNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnv  1609
             QNRAV Q QRGAANGI+M+ MSLFK  GPA GG + SW+Q RQ A F PGDQ++FF+LNV
Sbjct  408   QNRAVEQHQRGAANGITMTTMSLFKAAGPAGGGVIFSWAQGRQRAAFFPGDQMIFFILNV  467

Query  1610  fellglIMTFKPFL  1651
              E + ++MTFKPFL
Sbjct  468   VEAIAVLMTFKPFL  481



>ref|XP_009355074.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Pyrus x bretschneideri]
Length=483

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/497 (61%), Positives = 375/497 (75%), Gaps = 25/497 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE   E LLK+              Y + C GC VE  K+   G+PIK +  I ++ L 
Sbjct  1     MAEECRETLLKK-------------VYYDDCPGCVVEQRKQLQRGLPIKMLVSIWLIALS  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
             +ALPISSLFPFLYFMIRD HIA REEDI YYAGYVG+SFMLGR LTS+LWG++ADRYGRK
Sbjct  48    SALPISSLFPFLYFMIRDLHIANREEDIGYYAGYVGASFMLGRVLTSILWGMVADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV+I+G V VVIFN +FGLSVNYWMAI TRFLLG+L G +G ++AY+ E  R E+ AL +
Sbjct  108   PVIILGIVAVVIFNTLFGLSVNYWMAISTRFLLGSLNGSLGPIKAYSCEAFREEHQALSM  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S VS A GIGL+IGPA+GG+ AQPA+KYP+IFS  S FG+FPYFLPCL IS  A   T++
Sbjct  168   STVSVARGIGLIIGPALGGFLAQPADKYPSIFSQNSIFGRFPYFLPCLCISALAFGVTII  227

Query  926   SFWLPETMHThkkehkeehDVSQ-----------NSKQPEHEVPTSQKSLLKNWPLISSI  1072
             SFWLPET+H H  + +   D  +           N KQ   E  T +++L KNWPLISSI
Sbjct  228   SFWLPETLHKHNGKARLHDDSYEALETASGGSDANEKQKTEE-QTPKENLFKNWPLISSI  286

Query  1073  LVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVE  1252
             +VYCVF LHD+AY EIFSLWAVSPRK GGLS+TT DVG+VLAI+G  L +FQ+  YP VE
Sbjct  287   VVYCVFSLHDMAYGEIFSLWAVSPRKFGGLSFTTEDVGEVLAISGFSLFVFQITLYPYVE  346

Query  1253  KVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQ  1432
             ++LGPVMI+R+G  +SIPLLS+YP IA+LSG  L V+LNCAS+LKNV+S++I TG+ ILQ
Sbjct  347   RLLGPVMIARVGGIISIPLLSSYPLIAMLSGFSLFVLLNCASVLKNVISITIITGMFILQ  406

Query  1433  NRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvf  1612
             NRAV Q+QRGAANG+SM+AMSLFK I PAAGG+L SW+Q R+DA  +PG Q++FF+LNV 
Sbjct  407   NRAVDQKQRGAANGLSMTAMSLFKAIAPAAGGALFSWAQKRRDAAILPGSQMIFFILNVV  466

Query  1613  ellglIMTFKPFLQLPE  1663
             E + ++MTFKPFL L E
Sbjct  467   EAIAVLMTFKPFLTLRE  483



>emb|CBI29168.3| unnamed protein product [Vitis vinifera]
Length=518

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/496 (60%), Positives = 378/496 (76%), Gaps = 25/496 (5%)
 Frame = +2

Query  200   ESMAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVT  379
               M E   E LLK+              Y E C GCRVE LK    G+P++ +FF+ +V 
Sbjct  31    REMEEEQREVLLKK-------------VYHEGCPGCRVEHLKDTQRGLPVRQLFFVWIVV  77

Query  380   LCAALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYG  559
             LC ALPISSLFP+LYFMIRDF+IA+ E+DI YYAGY G+S+M GRALTS+LWG++ADRYG
Sbjct  78    LCNALPISSLFPYLYFMIRDFNIAKTEKDIGYYAGYAGASYMFGRALTSILWGMVADRYG  137

Query  560   RKPvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHAL  739
             RKPV+++GT +VVIFN +FGLS+NYWMAI +RFLLG++  ++G + AYA+EI R EY AL
Sbjct  138   RKPVILVGTASVVIFNTLFGLSLNYWMAISSRFLLGSMSTLLGPIMAYATEIFREEYQAL  197

Query  740   GISAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVAT  919
             G+S ++TAWG+GL+IGPA+GG+ AQPAEKYP IFS ES FG+FPYFLPCL  S++A   T
Sbjct  198   GLSTINTAWGVGLIIGPALGGFLAQPAEKYPNIFSKESIFGRFPYFLPCLCTSVYAFGIT  257

Query  920   VMSFWLPETMHThkkehkeehDVSQ--------NSKQPEHEV----PTSQKSLLKNWPLI  1063
             +   WL ET+HTH + +K   +           N+++  +E+    PTS++SL+KNWPL+
Sbjct  258   IACCWLQETLHTHNENNKLSKNSYNALEAPCGFNAEEAVNEIEANKPTSKESLIKNWPLM  317

Query  1064  SSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYP  1243
             SSI+V+CVF LHD+AY EIFSLWAVSPRK GGLSY+T DVG VLAI+G G+L+FQLF YP
Sbjct  318   SSIIVFCVFSLHDMAYSEIFSLWAVSPRKYGGLSYSTDDVGVVLAISGFGVLVFQLFLYP  377

Query  1244  LVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLL  1423
              +EK+LGP++I RI   LSIPLL+ YP IA+LSG  LS+ LNCAS +KNVLSVSI T L+
Sbjct  378   YLEKLLGPIIICRIAGVLSIPLLAIYPLIAMLSGFNLSLALNCASAMKNVLSVSIGTSLI  437

Query  1424  ILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvl  1603
             ILQNRAV Q QRGAANGI+M+ MSLFK  GPA GG + SW+Q RQ A F PGDQ++FF+L
Sbjct  438   ILQNRAVEQHQRGAANGITMTTMSLFKAAGPAGGGVIFSWAQGRQRAAFFPGDQMIFFIL  497

Query  1604  nvfellglIMTFKPFL  1651
             NV E + ++MTFKPFL
Sbjct  498   NVVEAIAVLMTFKPFL  513



>gb|KCW47973.1| hypothetical protein EUGRSUZ_K01705 [Eucalyptus grandis]
Length=499

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/469 (65%), Positives = 386/469 (82%), Gaps = 15/469 (3%)
 Frame = +2

Query  296   CAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREEDISY  475
             C GC +E LK  + GVP K  F++ ++ LCAALPISSLFPFLYFMIRDF IA+REEDI +
Sbjct  34    CPGCEIERLKETNRGVPYKLFFYVWIIVLCAALPISSLFPFLYFMIRDFKIAKREEDIGF  93

Query  476   YAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMAIITR  655
             YAGYVGS+FM GRALTSVLWG++ADRYGRKPV++ GTVTVV+FN +FGLS N+WMA+ TR
Sbjct  94    YAGYVGSAFMFGRALTSVLWGMLADRYGRKPVILFGTVTVVVFNTLFGLSTNFWMAVSTR  153

Query  656   FLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAEKYPT  835
             FLLG+LCGI+G MRAYASE+CR+EY AL +S +ST+WGIGLVIGPA+GGY AQPAEK+P 
Sbjct  154   FLLGSLCGILGPMRAYASEVCRKEYQALAMSIISTSWGIGLVIGPAIGGYLAQPAEKFPN  213

Query  836   IFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHT------------hkkehkee  979
             +FS +S FG+FPYFLPCL+IS+F+L   V++ WLPE++H                E +E 
Sbjct  214   VFSEKSIFGRFPYFLPCLLISVFSLGVMVVACWLPESLHRHGESSEECDIPYEALEAEEN  273

Query  980   hDVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGG  1159
               +   S++ E    TS  SLL+NWPL+SSI+VYCVFQLHD+AY EIFSLWA+SP K GG
Sbjct  274   KTLKDESQRNEKSCQTSW-SLLRNWPLMSSIIVYCVFQLHDMAYTEIFSLWAISPWKFGG  332

Query  1160  LSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALL  1339
             LSY+TADVG+VLA++G GLLLFQLF YP VE++ GP+++SR+GAALSI LLS+YP+IA L
Sbjct  333   LSYSTADVGEVLALSGFGLLLFQLFLYPRVERICGPIVVSRVGAALSIILLSSYPFIAKL  392

Query  1340  SGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPA  1519
             +G+ L+++++ AS+LKNVL+VSITTGL +LQNRAV  EQRGAANG+S+SAMSLFK +GPA
Sbjct  393   TGIILTILVDSASILKNVLAVSITTGLFLLQNRAV--EQRGAANGLSLSAMSLFKAMGPA  450

Query  1520  AGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPED  1666
             AGGS+ SW+Q RQ+A F+PG+ +VFF+LNV E LGL+MTFKPFL  P+D
Sbjct  451   AGGSIFSWAQKRQNASFLPGNHMVFFILNVIEALGLLMTFKPFLTQPKD  499



>ref|XP_002277751.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1 [Vitis vinifera]
 emb|CBI29174.3| unnamed protein product [Vitis vinifera]
Length=487

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/495 (65%), Positives = 382/495 (77%), Gaps = 26/495 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MA     PLLK+              Y ++C+GCRVE LK    G+PI+ +  I  V LC
Sbjct  1     MAAEQQVPLLKK-------------VYYQNCSGCRVEQLKETRRGLPIRELLSIWTVVLC  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              ALPISSLFPFLYFMIRDFHIA+REEDI YYAGYVGS+FMLGRALTSV WG++ADRYGRK
Sbjct  48    TALPISSLFPFLYFMIRDFHIAKREEDIGYYAGYVGSAFMLGRALTSVAWGMVADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV++IGT+ VVIFN +FGLSVN+WMA+ TRFLLG+L G++G ++AYA+EI R EY ALG+
Sbjct  108   PVIMIGTIAVVIFNTLFGLSVNFWMALSTRFLLGSLNGLLGPIKAYAAEIFRDEYQALGL  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S VSTAWGIGL+IGPA+GG+ AQPAEKYP IFS +S FG+FPYFLPCL IS++A++ TV 
Sbjct  168   STVSTAWGIGLIIGPALGGFLAQPAEKYPDIFSEDSLFGRFPYFLPCLFISVYAMIVTVA  227

Query  926   SFWLPETMHThkkehkeehDV---------SQNSKQPEHEV----PTSQKSLLKNWPLIS  1066
               WLPET+HTH +  K   D            N+K+ E E+    PTS +SL  NWPL+S
Sbjct  228   CCWLPETLHTHNENKKSREDSYDALEAANGGSNAKEKEQEIEGSEPTSNESLFMNWPLMS  287

Query  1067  SILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPL  1246
             SI+VYCVF LHD+AY EIFSLWAVSPR  GGLSY+T DVG VLAI+G GLL+ QL  YPL
Sbjct  288   SIIVYCVFSLHDMAYTEIFSLWAVSPRIHGGLSYSTDDVGVVLAISGFGLLVSQLTLYPL  347

Query  1247  VEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLI  1426
             VE+ LGPVMI RI   LSIPLL++YP IA+LSG  LSVVLNCAS+LKNVLSVSI TGL +
Sbjct  348   VERFLGPVMICRIAGVLSIPLLASYPLIAMLSGSSLSVVLNCASVLKNVLSVSIITGLFL  407

Query  1427  LQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvln  1606
             LQN AV Q QRG ANGISM+AMSLFK  GPA GG+L SW+Q RQD+ F PGDQ+VF +LN
Sbjct  408   LQNSAVDQHQRGTANGISMTAMSLFKAAGPAGGGALFSWAQKRQDSAFFPGDQMVFLILN  467

Query  1607  vfellglIMTFKPFL  1651
             V E +G++MTFKPFL
Sbjct  468   VVEAIGVLMTFKPFL  482



>ref|XP_010251709.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010251711.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Nelumbo nucifera]
Length=503

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/497 (62%), Positives = 385/497 (77%), Gaps = 26/497 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE N EP LK+              Y +SC GC+++ L     G+P +  F++ +V LC
Sbjct  1     MAE-NREPFLKR-------------FYHQSCPGCKIDQLNDTRRGIPYRGFFYVWIVVLC  46

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              ALPISSLFP+LYFMIRDFHI +REEDI  YAGYVGSSFM GRALTSV WG++ADRYGRK
Sbjct  47    TALPISSLFPYLYFMIRDFHITKREEDIGSYAGYVGSSFMFGRALTSVFWGVVADRYGRK  106

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV++IG +TVVIFN +FGLS N+WMAI  RFLLG+L G++G ++AY++E+CR EY ALG+
Sbjct  107   PVIMIGIITVVIFNTLFGLSTNFWMAISMRFLLGSLNGLLGPIKAYSTEVCREEYQALGV  166

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S VSTAWG GL+IGPA+GG+ AQPAEK+P IFS ES FG+FPY LPCL +S+FAL   + 
Sbjct  167   SLVSTAWGTGLIIGPALGGFLAQPAEKFPNIFSRESLFGRFPYLLPCLPVSIFALFVAIS  226

Query  926   SFWLPETMHThkkehkeehDV------------SQNSKQPEHEVPTSQKSLLKNWPLISS  1069
              FWLPET+H HK+ +K+  +              +  ++ E  +P S++SLL+NWPL+SS
Sbjct  227   CFWLPETLHKHKEHNKDGCESYDALEAAPYTSDEKEKQETEQRIPPSKESLLRNWPLMSS  286

Query  1070  ILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLV  1249
             I+VYCVF LHD+AY EIFSLWAVSPRK GGL+Y++ +VG+VL+ITG  LL FQL  YP V
Sbjct  287   IIVYCVFSLHDMAYTEIFSLWAVSPRKFGGLNYSSDNVGEVLSITGASLLFFQLTLYPCV  346

Query  1250  EKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLIL  1429
             EK+LGPV +SRI A LSIPLLS+YP+IA LSG  LS+++NCAS+LKNVLSVSI TGL IL
Sbjct  347   EKILGPVKVSRIAAVLSIPLLSSYPFIARLSGFRLSLLINCASVLKNVLSVSIITGLFIL  406

Query  1430  QNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnv  1609
             QN AV+Q QRGAANGISM+AMSLFK  GPA GG+L SW+Q RQ+  F+PGDQ+VFF+LN+
Sbjct  407   QNNAVAQNQRGAANGISMTAMSLFKAFGPAGGGALFSWAQKRQNVSFLPGDQMVFFILNI  466

Query  1610  fellglIMTFKPFLQLP  1660
              EL+G+++TF+PFL  P
Sbjct  467   VELIGVLLTFEPFLVQP  483



>ref|XP_009608807.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Nicotiana tomentosiformis]
Length=481

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/461 (65%), Positives = 375/461 (81%), Gaps = 7/461 (2%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y E+C GC+V+L K    G+PIK +F +  V L  ALPISSLFPFLYFMIRDFHIA+REE
Sbjct  17    YYENCPGCKVDLHKAGQRGLPIKELFTVWAVVLGTALPISSLFPFLYFMIRDFHIAKREE  76

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI  YAGYVGS++MLGRALTSV WGI+ADRYGRKPV+I+GT TVV+FN +FGLS+N+WMA
Sbjct  77    DIGSYAGYVGSAYMLGRALTSVFWGIVADRYGRKPVIIVGTFTVVVFNTLFGLSINFWMA  136

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             +ITRFLLG+L G++G ++AYA+EI R EY ALG+S +STAWGIGL+IGPA+GG+ AQPAE
Sbjct  137   VITRFLLGSLNGLLGPIKAYAAEIFREEYQALGMSTISTAWGIGLIIGPALGGFLAQPAE  196

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkeh-----keehDV  988
             KYP IFS +S FG+FPYFLPCL IS+F+LV  + SFWLPET+H H  E       +  + 
Sbjct  197   KYPAIFSKDSIFGRFPYFLPCLCISLFSLVVAIGSFWLPETLHIHDSEMPPQDSYKTLEA  256

Query  989   SQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSY  1168
             + ++K+     P  +++L KNWPL+SSI++YC+F LHD+AY EIFSLWAVSPRK GGLSY
Sbjct  257   ASDAKEESESNP--KENLFKNWPLMSSIIIYCIFALHDMAYSEIFSLWAVSPRKFGGLSY  314

Query  1169  TTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGL  1348
             +TADVG+VL+ +G GLL+FQLF YPLV K  GP++ +R+   LSIPLL++YPYIA+LSG+
Sbjct  315   STADVGEVLSFSGFGLLVFQLFLYPLVAKYFGPIITARVAGVLSIPLLASYPYIAMLSGI  374

Query  1349  CLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGG  1528
              LSVV+N ASM+KN LS+SI TGL ILQN AV Q QRGAANG++M+ MS FK +GPA GG
Sbjct  375   TLSVVINFASMMKNALSISIITGLFILQNNAVDQRQRGAANGLAMTGMSFFKALGPAGGG  434

Query  1529  SLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             +L SW+Q R DA F+PG+Q+VFFVLNV E +GL++TFKPFL
Sbjct  435   ALFSWAQKRLDASFLPGNQVVFFVLNVIEAIGLLLTFKPFL  475



>ref|XP_006347685.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Solanum tuberosum]
Length=481

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/482 (61%), Positives = 373/482 (77%), Gaps = 15/482 (3%)
 Frame = +2

Query  221   TEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPI  400
             +EPLL    +     E  Y+   E+C GC+++L K    G+PIK +F I +V L  ALPI
Sbjct  3     SEPLLINKRE-----EKHYY---ENCPGCKMDLHKAGQTGLPIKELFTIWVVVLGTALPI  54

Query  401   SSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvvii  580
             SSLFPFLYFM+RDFHIA+REEDI  YAGYVGS++M GR LTS  WG++ADRYGRKPV+I 
Sbjct  55    SSLFPFLYFMVRDFHIAKREEDIGSYAGYVGSAYMFGRTLTSAFWGVVADRYGRKPVIIF  114

Query  581   gtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVST  760
             GT  VV+FN +FGLS N+WMA+ITRFLLG+L G++  ++AYA+EI R EY ALG+S +ST
Sbjct  115   GTSIVVVFNTLFGLSTNFWMAVITRFLLGSLNGLLAPIKAYAAEIFREEYQALGMSTIST  174

Query  761   AWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLP  940
             AWGIGL+IGPA+GG+ AQPAEKYP +FS +S FG+FPYFLPCL IS+FALV  V SFW+P
Sbjct  175   AWGIGLIIGPALGGFLAQPAEKYPDLFSKDSLFGRFPYFLPCLCISVFALVVAVGSFWIP  234

Query  941   ETMHThkke-----hkeehDVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDI  1105
             ET+H H  E       +  + + ++K      P  +++L KNWPL+SSI++YCVF LHD+
Sbjct  235   ETLHNHDSERPCQDSSKALEAASDTKDGNESAP--KENLFKNWPLMSSIILYCVFSLHDM  292

Query  1106  AYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRI  1285
             AY EIFSLWAVSPRK GGLSY+TA+VG+VL+I+G GLL+FQL  Y  V K +GPVM +R 
Sbjct  293   AYSEIFSLWAVSPRKFGGLSYSTANVGEVLSISGFGLLVFQLTLYSSVAKYVGPVMTARA  352

Query  1286  GAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGA  1465
             G  LSI LL+TYPYIA+LSG  LSVV+N  SM+KN+LS+SI TGL ILQN+AV Q QRGA
Sbjct  353   GGVLSIFLLTTYPYIAMLSGTTLSVVMNVVSMMKNILSISIMTGLFILQNKAVDQRQRGA  412

Query  1466  ANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKP  1645
             ANG++M+ MS FK +GPA GG+L SW+Q R DA  +PG+Q+VFFVLNV E +G+++TFKP
Sbjct  413   ANGLAMTGMSFFKALGPAGGGALFSWAQKRLDATILPGNQVVFFVLNVIEAIGVLLTFKP  472

Query  1646  FL  1651
             FL
Sbjct  473   FL  474



>ref|XP_009776345.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Nicotiana sylvestris]
Length=432

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/426 (68%), Positives = 360/426 (85%), Gaps = 7/426 (2%)
 Frame = +2

Query  389   ALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKP  568
             ALPISSLFPFLYFMIRDFHIA+REEDISYYAGYVGSS+MLGRALTSV WG++ADRYGRKP
Sbjct  3     ALPISSLFPFLYFMIRDFHIAKREEDISYYAGYVGSSYMLGRALTSVFWGLVADRYGRKP  62

Query  569   vviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGIS  748
             V+I GT  VVIFN +FGLSVN+WMAIITRFLLG+L G+IG ++AYA+EI R EY ALG+S
Sbjct  63    VIIFGTFVVVIFNTLFGLSVNFWMAIITRFLLGSLNGLIGPIKAYAAEIFREEYQALGMS  122

Query  749   AVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMS  928
              +STAWGIGL+IGPA+GG+ AQPAEKYP+IF+ +S FG+FPYFLPCLIIS+F+LV  + S
Sbjct  123   TISTAWGIGLIIGPALGGFLAQPAEKYPSIFAKDSIFGRFPYFLPCLIISLFSLVVAIAS  182

Query  929   FWLPETMHThkkeh-----keehDVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQ  1093
             FWLPET+H H+         E  + + ++K+     P  +++L KNWPL+SSI++YCVF 
Sbjct  183   FWLPETLHIHESSVPPQDSYEALEAAPDTKEGNESAP--KENLFKNWPLMSSIILYCVFS  240

Query  1094  LHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVM  1273
             LHD+AY EIFSLWAVSPRK GGLSY+TADVG+VL+I+G GLL+FQL  YPLVE+ +GP++
Sbjct  241   LHDMAYNEIFSLWAVSPRKFGGLSYSTADVGEVLSISGFGLLVFQLTLYPLVERYVGPII  300

Query  1274  ISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQE  1453
              +R+   LSIPLL++YPYIA+LSG+ LS+ +N AS++KN LS+SI TGL ILQN+AV+Q 
Sbjct  301   AARVAGVLSIPLLTSYPYIAMLSGIALSLAINFASVMKNALSISIITGLFILQNKAVNQR  360

Query  1454  QRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIM  1633
             QRGAANGI+M+AMS+FK +GPA GG+L SW+Q R DA  +PGDQ+VFFVLNV E +G++M
Sbjct  361   QRGAANGIAMTAMSIFKALGPAGGGALFSWAQKRLDASILPGDQVVFFVLNVIEAIGVLM  420

Query  1634  TFKPFL  1651
             TFKPFL
Sbjct  421   TFKPFL  426



>gb|KHG08311.1| protein zinc induced facilitator-like 1 [Gossypium arboreum]
Length=511

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/471 (63%), Positives = 364/471 (77%), Gaps = 26/471 (6%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MA    EPLLK+              Y ++C GC+V+ +K  + G+PI+ +  I ++ LC
Sbjct  1     MAAEYREPLLKKK-------------YYKNCPGCKVDEMKELEQGLPIRPLLSIWIIVLC  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              ALPISSLFPFLYFMIRDFHIAEREEDI  YAGYVGS+FMLGRALTSV WGI ADRYGRK
Sbjct  48    TALPISSLFPFLYFMIRDFHIAEREEDIGSYAGYVGSAFMLGRALTSVSWGIFADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV+I+GT +VVIFN +FGLSVN+WMA+ITRFLLG+L G++G ++AYA EI R EY ALG+
Sbjct  108   PVIIMGTTSVVIFNTLFGLSVNFWMAVITRFLLGSLNGLLGPIKAYAVEIFRDEYQALGL  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S VSTAWGIGL+IGPA+GG+ AQPAEKYP +FS +S FG+FPYFLPCL IS+FAL  T+ 
Sbjct  168   STVSTAWGIGLIIGPALGGFLAQPAEKYPNLFSKDSLFGRFPYFLPCLAISIFALAVTIA  227

Query  926   SFWLPETMHThkkehkeehDV---------SQNSK----QPEHEVPTSQKSLLKNWPLIS  1066
             + WLPET+H H    +   D            N+K    + E    TS++SLLKNWPL+S
Sbjct  228   TCWLPETLHKHNDNDQSSDDSYDALEAASNESNTKDITEKEEGRESTSKQSLLKNWPLMS  287

Query  1067  SILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPL  1246
             SI+VYCVF LHD+AY EIFSLWAVSPRK GGLSY+T  VG+VLA++G  LL+FQ+  YP 
Sbjct  288   SIIVYCVFSLHDMAYTEIFSLWAVSPRKYGGLSYSTEQVGEVLAVSGFSLLVFQMSLYPY  347

Query  1247  VEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLI  1426
             VE++LGPVM+SRIG+ L+IPLL +YP IA+LSG  L++V+NCAS+LKNVLSVSI TGL I
Sbjct  348   VERLLGPVMVSRIGSVLAIPLLQSYPLIAMLSGFTLTLVINCASVLKNVLSVSIITGLFI  407

Query  1427  LQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPG  1579
             LQNRAV Q QRGAANGI+M+ MSLFK +GPA GG+L SWS+ R DA F+PG
Sbjct  408   LQNRAVDQHQRGAANGIAMTGMSLFKAVGPAGGGALFSWSEKRLDASFLPG  458



>ref|XP_010557810.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Tarenaya 
hassleriana]
 ref|XP_010557811.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Tarenaya 
hassleriana]
 ref|XP_010557812.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Tarenaya 
hassleriana]
 ref|XP_010557813.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Tarenaya 
hassleriana]
 ref|XP_010557814.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Tarenaya 
hassleriana]
Length=480

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/489 (61%), Positives = 373/489 (76%), Gaps = 20/489 (4%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE + E LLK++             Y E+C GC+VE +K+   G P+  +  + +V LC
Sbjct  1     MAEEHMETLLKKN-------------YHENCPGCKVEQMKQLRRGFPLWELCTVWIVVLC  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              ALPISSLFPFLYFMI DF IA++EEDI +YAG+VG SFMLGRA TSV WG++ADRYGRK
Sbjct  48    TALPISSLFPFLYFMIGDFKIAQKEEDIGFYAGFVGCSFMLGRAFTSVAWGMVADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV+++GT +VVIFN +FGLS+N+WMAIITRF LG+  G++G ++AYA EI R EY AL +
Sbjct  108   PVILLGTGSVVIFNTLFGLSLNFWMAIITRFCLGSFNGLLGPIKAYAMEIFRDEYQALAL  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             SAVSTAWGIGL+IGPA+GG+ AQPAEKYP IFS ES FGKFPYFLPC +IS+FAL  T++
Sbjct  168   SAVSTAWGIGLIIGPAMGGFLAQPAEKYPNIFSKESIFGKFPYFLPCFVISLFALGVTII  227

Query  926   SFWLPETMHThkkehkeehDVSQNSKQPEHEVPTSQK-------SLLKNWPLISSILVYC  1084
             S W+PET+H HK +     D  +  +   H+     K       SLLKNWPLISSI+VYC
Sbjct  228   SLWIPETLHNHKFDDASHDDSYEALEAASHDPDFDGKAGRDEGSSLLKNWPLISSIIVYC  287

Query  1085  VFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLG  1264
             +F LHD+AY EIFSLWA SP++ GGL YTT++VG VLAI+G GLL+FQL  Y  +E++LG
Sbjct  288   IFSLHDMAYTEIFSLWANSPKRYGGLGYTTSEVGSVLAISGFGLLVFQLSLYSYLERLLG  347

Query  1265  PVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAV  1444
             P+ ++R  AAL+IPLLS+YP IA LSG  LS+VLNCAS+ KNVLSVS+ TGL ILQN+AV
Sbjct  348   PIKVTRFAAALAIPLLSSYPLIAKLSGFTLSLVLNCASVAKNVLSVSVITGLFILQNQAV  407

Query  1445  SQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellg  1624
              Q QRGAANGI+M+AMS+FK IGPAA G L SWS+ RQDA F+PG Q++FF+LNV   +G
Sbjct  408   KQHQRGAANGIAMTAMSIFKAIGPAAAGVLFSWSEKRQDAAFLPGTQMIFFILNVILAIG  467

Query  1625  lIMTFKPFL  1651
             +  TFKPFL
Sbjct  468   VASTFKPFL  476



>ref|XP_009355073.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Pyrus x bretschneideri]
Length=487

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/501 (61%), Positives = 375/501 (75%), Gaps = 29/501 (6%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE   E LLK+              Y + C GC VE  K+   G+PIK +  I ++ L 
Sbjct  1     MAEECRETLLKK-------------VYYDDCPGCVVEQRKQLQRGLPIKMLVSIWLIALS  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
             +ALPISSLFPFLYFMIRD HIA REEDI YYAGYVG+SFMLGR LTS+LWG++ADRYGRK
Sbjct  48    SALPISSLFPFLYFMIRDLHIANREEDIGYYAGYVGASFMLGRVLTSILWGMVADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV+I+G V VVIFN +FGLSVNYWMAI TRFLLG+L G +G ++AY+ E  R E+ AL +
Sbjct  108   PVIILGIVAVVIFNTLFGLSVNYWMAISTRFLLGSLNGSLGPIKAYSCEAFREEHQALSM  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S VS A GIGL+IGPA+GG+ AQPA+KYP+IFS  S FG+FPYFLPCL IS  A   T++
Sbjct  168   STVSVARGIGLIIGPALGGFLAQPADKYPSIFSQNSIFGRFPYFLPCLCISALAFGVTII  227

Query  926   SFWLP----ETMHThkkehkeehDVSQ-----------NSKQPEHEVPTSQKSLLKNWPL  1060
             SFWLP    ET+H H  + +   D  +           N KQ   E  T +++L KNWPL
Sbjct  228   SFWLPVHILETLHKHNGKARLHDDSYEALETASGGSDANEKQKTEE-QTPKENLFKNWPL  286

Query  1061  ISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAY  1240
             ISSI+VYCVF LHD+AY EIFSLWAVSPRK GGLS+TT DVG+VLAI+G  L +FQ+  Y
Sbjct  287   ISSIVVYCVFSLHDMAYGEIFSLWAVSPRKFGGLSFTTEDVGEVLAISGFSLFVFQITLY  346

Query  1241  PLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGL  1420
             P VE++LGPVMI+R+G  +SIPLLS+YP IA+LSG  L V+LNCAS+LKNV+S++I TG+
Sbjct  347   PYVERLLGPVMIARVGGIISIPLLSSYPLIAMLSGFSLFVLLNCASVLKNVISITIITGM  406

Query  1421  LILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffv  1600
              ILQNRAV Q+QRGAANG+SM+AMSLFK I PAAGG+L SW+Q R+DA  +PG Q++FF+
Sbjct  407   FILQNRAVDQKQRGAANGLSMTAMSLFKAIAPAAGGALFSWAQKRRDAAILPGSQMIFFI  466

Query  1601  lnvfellglIMTFKPFLQLPE  1663
             LNV E + ++MTFKPFL L E
Sbjct  467   LNVVEAIAVLMTFKPFLTLRE  487



>ref|XP_009776342.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Nicotiana sylvestris]
Length=481

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/466 (64%), Positives = 378/466 (81%), Gaps = 7/466 (2%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y E+C GC+V+L K    G+PIK +F + +V L  ALPISSLFPFLYFMIRDFHIA+REE
Sbjct  17    YYENCPGCKVDLHKAGQRGLPIKELFTVWVVVLGTALPISSLFPFLYFMIRDFHIAKREE  76

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI  YAGYVGS++MLGRALTSV WGI+ADRYGRKPV+IIGT TVV+FN +FGLS+N+WMA
Sbjct  77    DIGSYAGYVGSAYMLGRALTSVFWGIVADRYGRKPVIIIGTFTVVVFNTLFGLSINFWMA  136

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             +ITRFLLG+L G++G ++AYA+EI R EY ALG+S +STAWGIGL+IGPA+GG+ AQPAE
Sbjct  137   VITRFLLGSLNGLLGPIKAYAAEIFREEYQALGMSTISTAWGIGLIIGPALGGFLAQPAE  196

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkeh-----keehDV  988
             KYP  FS +S FG+FPYFLPCL IS+F+LV  + SFWLPET+H H  E       +  + 
Sbjct  197   KYPATFSKDSVFGRFPYFLPCLCISLFSLVVAIGSFWLPETLHIHDSEMPPQDSYKALEA  256

Query  989   SQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSY  1168
             + ++K+    +P  +++L KNW L+SSI++YC+F LHD+AY EIFSLWAVSPRK GGL+Y
Sbjct  257   ASDTKEGNESIP--KENLFKNWALMSSIILYCIFALHDMAYSEIFSLWAVSPRKFGGLNY  314

Query  1169  TTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGL  1348
             +TADVG+VL+ +G GLL+FQLF YPLV K  GP++ +R+   LSIPLL++YPYIA+LSG+
Sbjct  315   STADVGEVLSFSGFGLLVFQLFLYPLVAKYFGPIITARVAGVLSIPLLASYPYIAMLSGI  374

Query  1349  CLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGG  1528
              LSVV+N ASM+KN LS+SI TGL ILQN AV Q QRGAANG++M+ MS FK +GPA GG
Sbjct  375   TLSVVINFASMMKNALSISIITGLFILQNNAVDQRQRGAANGLAMTGMSFFKALGPAGGG  434

Query  1529  SLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPED  1666
             +L SW+Q R DA F+PG+Q+VFFVLNV E +GL++TFKPFL + ++
Sbjct  435   ALFSWAQKRLDASFLPGNQVVFFVLNVIEAIGLLLTFKPFLVVRQN  480



>ref|XP_008231756.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Prunus 
mume]
Length=485

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/500 (60%), Positives = 380/500 (76%), Gaps = 28/500 (6%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE + E LLK+              Y E+C GC+VE  K    G+PIK +  + +V L 
Sbjct  1     MAEESREALLKK-------------VYYENCPGCKVEQRKELQRGLPIKMLVAVWLVVLS  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
             AALPISSLFPFLYFMIRD HIA+REEDI YYAGYVG+SFM+GR LTS+ WG++ADRYGRK
Sbjct  48    AALPISSLFPFLYFMIRDLHIAKREEDIGYYAGYVGASFMIGRVLTSIFWGVVADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV+IIG   VVIFN +FGLSVN+WMAI TRFLLG L G++G ++AYASE  R E+ ALG+
Sbjct  108   PVIIIGIAAVVIFNTLFGLSVNFWMAISTRFLLGCLNGLLGPIKAYASEAFREEHQALGM  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S VS AWGIGL+IGPA+GG+ AQPA+KYP IFS  S FG+FPYFLPCL IS+FA    + 
Sbjct  168   STVSVAWGIGLIIGPALGGFLAQPADKYPNIFSQNSIFGRFPYFLPCLCISLFAFGVCIA  227

Query  926   SFWLPETMHThkkehkeehD-------------VSQNSKQPEHEVPTSQKSLLKNWPLIS  1066
             SFWLPET+H H    + + D              ++  ++ E ++P  +++L KNWPL+S
Sbjct  228   SFWLPETLHKHNGNTRLQDDSYEALETASYGSFANEGKQKTEEQIP--KENLFKNWPLMS  285

Query  1067  SILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPL  1246
             SI+VYCV+ LHD+AY EIFSLWAVSPRKLGGLS++T +VG++LAI+G GL +FQ+  YP 
Sbjct  286   SIIVYCVYSLHDMAYTEIFSLWAVSPRKLGGLSFSTENVGEILAISGFGLFVFQITLYPF  345

Query  1247  VEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLI  1426
             VE++LGPVMI+RIG  ++IPLLS+YP+IA+LSG  L + LN AS+LKN+LS++I TG+ I
Sbjct  346   VERLLGPVMIARIGGIITIPLLSSYPFIAMLSGFSLYLTLNIASVLKNILSITIVTGMFI  405

Query  1427  LQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvln  1606
             LQN+AV Q QRGAANGISM+AMSLFK IGPAAGG+L SW+Q R DA  +PG Q++FF+LN
Sbjct  406   LQNKAVDQRQRGAANGISMTAMSLFKAIGPAAGGALFSWAQTRLDAAILPGSQMIFFILN  465

Query  1607  vfellglIMTFKPFLQLPED  1666
             V E + ++MTFKPFL L  +
Sbjct  466   VVEAIAVLMTFKPFLTLRHE  485



>ref|XP_010067056.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW65119.1| hypothetical protein EUGRSUZ_G02628 [Eucalyptus grandis]
Length=485

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/467 (64%), Positives = 373/467 (80%), Gaps = 12/467 (3%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y E+C GC+V+ LK +  G+PI+ +  I +V L  ALPISSLFPFLYFMIRDFHIA+REE
Sbjct  15    YYENCPGCKVDKLKESQRGLPIRELVSIWIVVLSTALPISSLFPFLYFMIRDFHIAKREE  74

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI YYAGYVGSS M GR LTS+ WG++ADRYGRKPV++IG +TVVIFN +FGLSVN+WMA
Sbjct  75    DIGYYAGYVGSSLMFGRVLTSLFWGVVADRYGRKPVIVIGIITVVIFNTLFGLSVNFWMA  134

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TRFLLG+L G++G +RAYA+E+ R EY ALGI+ VSTAWGIGL+IGPA+GGY AQPAE
Sbjct  135   IATRFLLGSLNGLLGPIRAYATELFREEYQALGITTVSTAWGIGLIIGPALGGYLAQPAE  194

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             K+P+IFS ES FG+FPYFLPCL IS+FALV ++ SFWLPET+H       E  +  ++ +
Sbjct  195   KFPSIFSKESVFGRFPYFLPCLAISIFALVVSIASFWLPETLH-MHHGSSELDESCKDME  253

Query  1004  QPEHEVPTS-----------QKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRK  1150
              P  E PT            +K L++NWPL+SSI++YCVF  HD+AY EIFSLWAVSPR+
Sbjct  254   TPSLESPTKNKRHKFEGKAPKKCLIRNWPLMSSIILYCVFSFHDMAYTEIFSLWAVSPRR  313

Query  1151  LGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYI  1330
             LGGLSYTT DVG VL+I+G GL++FQ   +P + ++LGPV+++RIG  LSIPLLS+YP+I
Sbjct  314   LGGLSYTTEDVGTVLSISGAGLIVFQTCLFPHLTRLLGPVVVARIGGVLSIPLLSSYPFI  373

Query  1331  ALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTI  1510
             A+L+GL LS  LNCAS+ KNV+ VSI T L ILQN+AV Q+QRGAANGI+M+AMSLFK  
Sbjct  374   AMLTGLSLSTALNCASIAKNVMYVSIVTSLFILQNKAVDQDQRGAANGIAMTAMSLFKAF  433

Query  1511  GPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             GPA GG++ SW+Q RQDA F+PG+ +VFF+LNV   +G++MTFKPFL
Sbjct  434   GPAGGGTIFSWAQKRQDAAFLPGNHMVFFILNVVGAIGVLMTFKPFL  480



>ref|XP_011041314.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like isoform X2 
[Populus euphratica]
Length=415

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/415 (71%), Positives = 355/415 (86%), Gaps = 1/415 (0%)
 Frame = +2

Query  428   MIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFN  607
             MIRDFHIA+REEDI YYAGYVGS+FM GRALTSVLWG+IADRYGRKPV+I GTV+VVIFN
Sbjct  1     MIRDFHIAKREEDIGYYAGYVGSAFMFGRALTSVLWGMIADRYGRKPVIIFGTVSVVIFN  60

Query  608   AVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIG  787
              +FGLS ++WMAI  RFLLG+LCGI+G MRAYASE+CR+EY ALG+S +ST+WGIGLVIG
Sbjct  61    TLFGLSTSFWMAISMRFLLGSLCGILGPMRAYASEVCRKEYQALGMSIISTSWGIGLVIG  120

Query  788   PAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkke  967
             PA+GG+ AQPAEK+P IFS++  FG+FPY LPCL+IS+F++   V+  +LPET+H HK  
Sbjct  121   PALGGFLAQPAEKFPNIFSSDCLFGRFPYLLPCLLISIFSVGVLVVCCFLPETIHNHKGN  180

Query  968   hkeehDVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPR  1147
              +E +D S        E  +SQKSLLKNWPLISSI+ YCVFQLHD+AY EIFSLWAVSPR
Sbjct  181   DEECND-SDALVATTFESTSSQKSLLKNWPLISSIIAYCVFQLHDMAYAEIFSLWAVSPR  239

Query  1148  KLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPY  1327
             K GGLS++TA+VG+VLA +G GLLLFQLF YP+ E+  GPVM+SR+GA L+IPLLS+YP+
Sbjct  240   KNGGLSFSTAEVGEVLAFSGFGLLLFQLFIYPVAERNFGPVMVSRLGAVLTIPLLSSYPF  299

Query  1328  IALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKT  1507
             IA L GL L +++NCAS+LKNVLSVSITTGL +LQNR+V+Q+QRGAANGISMSAMSLFK 
Sbjct  300   IAFLKGLMLMLLINCASILKNVLSVSITTGLFLLQNRSVTQQQRGAANGISMSAMSLFKA  359

Query  1508  IGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPEDDI  1672
             IGPAAGGSL SW+Q RQ A F+PGDQ+VFF+LN+ E++GL +TFKPFL LP+D I
Sbjct  360   IGPAAGGSLFSWAQKRQSAFFLPGDQMVFFLLNMIEVIGLFLTFKPFLALPDDSI  414



>gb|KDP27074.1| hypothetical protein JCGZ_22071 [Jatropha curcas]
Length=485

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/495 (62%), Positives = 381/495 (77%), Gaps = 26/495 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE  +E LLK++             Y E+C GC+V+  K    G+PI+ +F I +V L 
Sbjct  1     MAEDYSEALLKKN-------------YYENCPGCKVDRYKELKKGLPIRELFSIWIVVLG  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              ALPISSLFPFLYFM+RDFHIA+REEDI YYAGYVGS++MLGRALTS  WGI+ADRYGRK
Sbjct  48    TALPISSLFPFLYFMVRDFHIAKREEDIGYYAGYVGSTYMLGRALTSAFWGIVADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV+IIG +TVVIFN +FGLS N+WMAI TRF LG+  G++G ++AYA EI R EY ALG+
Sbjct  108   PVIIIGNLTVVIFNTLFGLSTNFWMAIATRFFLGSFNGLLGPIKAYACEIFREEYSALGL  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S VSTAWGIGL+IGPA+GG+ AQPAEKYP IFS ES FG+FPYFLPC  +S+FAL  T+ 
Sbjct  168   STVSTAWGIGLIIGPALGGFLAQPAEKYPNIFSKESLFGRFPYFLPCFCMSVFALGVTIA  227

Query  926   SFWLPETMHThkkehkeehDV-----------SQNSKQPEHE--VPTSQKSLLKNWPLIS  1066
             S WLPET+HTH K      D             +N  +P++E   PTS++SLL+NWPL+S
Sbjct  228   SCWLPETLHTHDKHSSSVDDTVDDKEIGFTGSKRNEGKPDNEGNKPTSEESLLRNWPLMS  287

Query  1067  SILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPL  1246
             SI+VYCVF LHD+AY EIFSLWAVSPRK GGLSY+T DVG+VL+I+G  LL+FQL  YP 
Sbjct  288   SIIVYCVFALHDMAYGEIFSLWAVSPRKFGGLSYSTEDVGEVLSISGFSLLVFQLSLYPC  347

Query  1247  VEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLI  1426
             +E++ GP+ ISRIG  +SIPLL++YP+IA LSG  L+++LNCAS++KNVLSVSI TGL +
Sbjct  348   LERIFGPITISRIGGIISIPLLASYPFIAKLSGFNLTLLLNCASVVKNVLSVSIITGLFL  407

Query  1427  LQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvln  1606
             LQNRAVSQ QRGAANG++M+ MSLFK  GP   G+L SW+Q  ++  F+PG+ LVFF+LN
Sbjct  408   LQNRAVSQHQRGAANGLAMTGMSLFKAAGPLGAGALFSWAQKHRNLAFLPGNHLVFFILN  467

Query  1607  vfellglIMTFKPFL  1651
             V E +G++MTFKPFL
Sbjct  468   VIEAIGVLMTFKPFL  482



>ref|XP_007010372.1| Zinc induced facilitator-like 1 isoform 2, partial [Theobroma 
cacao]
 gb|EOY19182.1| Zinc induced facilitator-like 1 isoform 2, partial [Theobroma 
cacao]
Length=466

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/470 (64%), Positives = 367/470 (78%), Gaps = 26/470 (6%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MA+   EPLLK+              Y E+C GC+V+ +K    G+P++ +  I +V LC
Sbjct  1     MAQEYREPLLKKK-------------YHENCPGCKVDQMKELQRGLPLRQLVSIWIVVLC  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
             AALPISSLFPFLYFMIRDFHI++REEDI YYAGYVGS+FMLGRA TSVLWGIIADRYGRK
Sbjct  48    AALPISSLFPFLYFMIRDFHISKREEDIGYYAGYVGSAFMLGRASTSVLWGIIADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV+I+GT+TVV+FN +FGLSVN++MA+ TRFLLG+L G++G ++AYA EI R E+ ALG+
Sbjct  108   PVIIMGTITVVVFNTLFGLSVNFYMAVTTRFLLGSLNGLLGPIKAYAVEIFREEHQALGL  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S VST+WGIGL+IGPA+GG+ AQPAEKYP IFS +S FG+FPYFLPCL IS+FAL  T+ 
Sbjct  168   STVSTSWGIGLIIGPALGGFLAQPAEKYPNIFSKDSLFGRFPYFLPCLAISLFALGVTIA  227

Query  926   SFWLPETMHThkkehkeehD-------------VSQNSKQPEHEVPTSQKSLLKNWPLIS  1066
             +FWLPET+H H    +   D               + +++ E    TS++SLLKNWPL+S
Sbjct  228   TFWLPETLHKHNDNDRSSDDSYDALEAAPHESSSKEITEEDEGRESTSKQSLLKNWPLMS  287

Query  1067  SILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPL  1246
             SI+VYCVF LHD+AY EIFSLWAVSPRK GGLSY+T DVG+VLAI+G  LL+FQL  YP 
Sbjct  288   SIIVYCVFSLHDMAYTEIFSLWAVSPRKFGGLSYSTKDVGEVLAISGFSLLVFQLSVYPT  347

Query  1247  VEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLI  1426
             VE++LGPVM+SRI + L+IPLL +Y YIALLSG  LS+VLNCAS+LKNVLSVSI TGL I
Sbjct  348   VERILGPVMVSRIASVLTIPLLQSYSYIALLSGFTLSLVLNCASILKNVLSVSIITGLFI  407

Query  1427  LQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMP  1576
             LQNRAV Q QRGAANGI+M+ MSLFK  GPA GG+L SW++ RQDA F+P
Sbjct  408   LQNRAVDQHQRGAANGIAMTGMSLFKAAGPAGGGALFSWAEKRQDAAFLP  457



>ref|XP_010673231.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=484

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/507 (59%), Positives = 380/507 (75%), Gaps = 28/507 (6%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE N EPLL ++          Y+  DE+C GC+++  K  +  +P    FFI ++TLC
Sbjct  1     MAE-NKEPLLNKN----------YYYDDENCPGCKIDKRKAENPNLPWIPFFFIWIITLC  49

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
             A+LPISS+FPFLY+M+RDF+IA+REED+S+YAG+ GS+FM+GR LT+VLWGI+ADRYGRK
Sbjct  50    ASLPISSIFPFLYYMVRDFNIAKREEDVSFYAGFEGSAFMVGRTLTAVLWGIVADRYGRK  109

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV+I  T++VVIFN +FGLS NYWMA+ +RFLLGA CG +G MRAYA+E+ RRE+ ALG+
Sbjct  110   PVMIFSTLSVVIFNTMFGLSTNYWMALTSRFLLGAFCGTLGPMRAYATEVSRREHQALGV  169

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             + +S+AWGIGLVIGPA+GGY AQPA+K+P++FS ES FG+FPYFL  L+IS+FAL  +++
Sbjct  170   AMLSSAWGIGLVIGPALGGYLAQPADKFPSVFSQESIFGRFPYFLVSLVISIFALGVSIL  229

Query  926   SFWLPETMHThk-----kehkeehDVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVF  1090
              FWLPET+HT K     K     HD+     +   +   S  SLL+NWPL+S++++YCVF
Sbjct  230   CFWLPETLHTCKPITDGKVQDHPHDIEDADSEKLQDTENSWLSLLQNWPLMSTVILYCVF  289

Query  1091  QLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPV  1270
             QLHD+AY+EIFSLW VSPR +GGLS  T DVGQ LA+ G GLL  QL  YP +E+ LGP+
Sbjct  290   QLHDMAYIEIFSLWTVSPRSVGGLSLATEDVGQALAVAGFGLLFCQLLFYPFLERKLGPI  349

Query  1271  MISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQ  1450
              +SR+GA LSI LLS YP+ A L G  LS+V++ AS LKNVLS+SITTGL +LQNRAV Q
Sbjct  350   TVSRVGAVLSIALLSGYPFFANLRGTTLSIVVDLASALKNVLSISITTGLFLLQNRAVRQ  409

Query  1451  EQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglI  1630
              QRGAANG+S+S MSL K +GPA  GSLLSW+Q RQ A F+PG  +VFF+LNV E LGL+
Sbjct  410   HQRGAANGLSLSMMSLCKALGPAGAGSLLSWAQTRQTASFLPGTHMVFFILNVVEFLGLV  469

Query  1631  MTFKPFLQLPEDDILKSKQDGAAEENC  1711
             MTFKPFL              AAEE C
Sbjct  470   MTFKPFLA------------RAAEEYC  484



>ref|XP_007217932.1| hypothetical protein PRUPE_ppa004919mg [Prunus persica]
 gb|EMJ19131.1| hypothetical protein PRUPE_ppa004919mg [Prunus persica]
Length=485

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/500 (60%), Positives = 380/500 (76%), Gaps = 28/500 (6%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE + E LLK+              Y E+C GC+VE  K    G+PIK +  + +V L 
Sbjct  1     MAEESREALLKK-------------VYYENCPGCKVEQRKELQRGLPIKMLVAVWLVVLS  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
             AALPISSLFPFLYFMIRD  IA+REEDI YYAGYVG+SFM+GR LTS+ WG++ADRYGRK
Sbjct  48    AALPISSLFPFLYFMIRDLQIAKREEDIGYYAGYVGASFMIGRVLTSIFWGVVADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV+IIG   VVIFN +FGLSVN+WMAI TRFLLG L G++G ++AYASE  R E+ ALG+
Sbjct  108   PVIIIGIAAVVIFNTLFGLSVNFWMAISTRFLLGCLNGLLGPIKAYASEAFREEHQALGM  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S VS AWGIGL+IGPA+GG+ AQPA+KYP IFS  S FG+FPYFLPCL IS+FA    + 
Sbjct  168   STVSVAWGIGLIIGPALGGFLAQPADKYPNIFSQNSIFGRFPYFLPCLCISVFAFGVCIA  227

Query  926   SFWLPETMHThkkehkeehD-------------VSQNSKQPEHEVPTSQKSLLKNWPLIS  1066
             SFWLPET+H H    + + D              ++  ++ E ++P  +++L KNWPL+S
Sbjct  228   SFWLPETLHKHNGNIRLQDDSFEALETASYGSFANEGKQKTEEQIP--KENLFKNWPLMS  285

Query  1067  SILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPL  1246
             +I+VYCV+ LHD+AY EIFSLWAVSPRKLGGLS++T +VG+VLAI+G GL +FQ+  YP 
Sbjct  286   AIIVYCVYSLHDMAYTEIFSLWAVSPRKLGGLSFSTENVGEVLAISGFGLFVFQITLYPF  345

Query  1247  VEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLI  1426
             VE++LGPVMI+RIG  ++IPLLS+YP+IA+LSG  L ++LN AS+LKNVLS++I TG+ I
Sbjct  346   VERLLGPVMIARIGGIITIPLLSSYPFIAMLSGFSLYLMLNIASVLKNVLSITIVTGMFI  405

Query  1427  LQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvln  1606
             LQN+AV Q QRGAANGISM+AMSLFK IGPAAGG+L SW+Q R DA  +PG Q++FF+LN
Sbjct  406   LQNKAVDQRQRGAANGISMTAMSLFKAIGPAAGGALFSWAQTRLDAAILPGSQMIFFILN  465

Query  1607  vfellglIMTFKPFLQLPED  1666
             V E + ++MTFKPFL L  +
Sbjct  466   VVEAIAVLMTFKPFLTLRHE  485



>ref|XP_010673232.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=481

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/503 (59%), Positives = 374/503 (74%), Gaps = 30/503 (6%)
 Frame = +2

Query  218   NTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALP  397
             N +PLL +              Y E+C GC++E  K  D  +P  H FFI ++TL AALP
Sbjct  4     NKKPLLNKE-------------YIENCKGCQIERRKAQDPHIPWHHFFFIWVITLTAALP  50

Query  398   ISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvvi  577
             ISS+FPFLY+M+RDF+IA+REED+S+YAG+ GS+FM+GR LT+VLWGI+ADRYGRKPV+I
Sbjct  51    ISSIFPFLYYMVRDFNIAKREEDVSFYAGFEGSAFMVGRTLTAVLWGIVADRYGRKPVMI  110

Query  578   igtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVS  757
               T++VVIFN +FGLS NYWMA+ +RFLLGA CG +G MRAYA+E+ RRE+ ALG++ +S
Sbjct  111   FSTLSVVIFNTMFGLSTNYWMALTSRFLLGAFCGTLGPMRAYATEVSRREHQALGVAMLS  170

Query  758   TAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWL  937
             +AWGIGLVIGPA+GGY AQPA+K+P++FS ES FG+FPYFL  L+IS+FAL  +++ FWL
Sbjct  171   SAWGIGLVIGPALGGYLAQPADKFPSVFSQESIFGRFPYFLVSLVISIFALGVSILCFWL  230

Query  938   PETMHThk-----kehkeehDVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHD  1102
             PET+HT K     K     HD+     +   +   S  SLL+NWPL+S++++YCVFQLHD
Sbjct  231   PETLHTCKPITDGKVQDHPHDIEDADSEKLQDTENSWLSLLQNWPLMSTVILYCVFQLHD  290

Query  1103  IAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISR  1282
             +AY+EIFSLW VSPR +GGLS  T DVGQ LA+ G GLL  QL  YP +E+ LGP+ +SR
Sbjct  291   MAYIEIFSLWTVSPRSVGGLSLATEDVGQALAVAGFGLLFCQLLFYPFLERKLGPITVSR  350

Query  1283  IGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRG  1462
             +GA LSI LLS YP+ A L G  LS+V++ AS LKNVLS+SITTGL +LQNRAV Q QRG
Sbjct  351   VGAVLSIALLSGYPFFANLRGTTLSIVVDLASALKNVLSISITTGLFLLQNRAVRQHQRG  410

Query  1463  AANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFK  1642
             AANG+S+S MSL K +GPA  GSLLSW+Q RQ A F+PG  +VFF+LNV E LGL+MTFK
Sbjct  411   AANGLSLSMMSLCKALGPAGAGSLLSWAQTRQTASFLPGTHMVFFILNVVEFLGLVMTFK  470

Query  1643  PFLQLPEDDILKSKQDGAAEENC  1711
             PFL              AAEE C
Sbjct  471   PFLA------------RAAEEYC  481



>ref|XP_010067060.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Eucalyptus grandis]
Length=484

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/480 (64%), Positives = 377/480 (79%), Gaps = 13/480 (3%)
 Frame = +2

Query  242   SEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFL  421
              EQ    L+  Y+   E+C GC+VE LK +  G+PI+ +F I +V LC ALPISSLFPFL
Sbjct  4     EEQKEALLKRHYY---ENCPGCKVEKLKESQGGLPIRELFSIWIVVLCNALPISSLFPFL  60

Query  422   YFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvvi  601
             YFMIRDFH+AEREEDI YYAGYVGSSFM GRALTSV WGI+ADRYGRKPV+I+GT+ VVI
Sbjct  61    YFMIRDFHVAEREEDIGYYAGYVGSSFMFGRALTSVFWGIVADRYGRKPVIIMGTIAVVI  120

Query  602   FNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLV  781
             FN +FGLSVN+WMAI  RFLLG+L G++G ++AYA+EI R EY ALG+S VSTAWGIGL+
Sbjct  121   FNTLFGLSVNFWMAIAMRFLLGSLNGLLGPIKAYATEIFREEYQALGVSTVSTAWGIGLI  180

Query  782   IGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThk  961
             IGPA+GGY AQPAEK+P+IF  ES FG+FPYFLPCL IS+FALV T+ + WLPET+H H 
Sbjct  181   IGPALGGYLAQPAEKFPSIFPKESVFGRFPYFLPCLAISVFALVVTIATCWLPETLHKHH  240

Query  962   keh---keehDVS-------QNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAY  1111
             K         DV           K  + E    +KSL +NWPL+SSI+VYCVF LHD+AY
Sbjct  241   KSSKFDAACEDVETAPLMSGTKYKTQKAEGKAPKKSLFRNWPLMSSIIVYCVFSLHDMAY  300

Query  1112  LEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGA  1291
              EIFSLWAVSPR+ GGLSYTT DVG VLAI+G GLL+FQ   YP   ++LGPV+++R+  
Sbjct  301   TEIFSLWAVSPRRYGGLSYTTEDVGNVLAISGAGLLIFQTCLYPYFNRLLGPVVVARLNG  360

Query  1292  ALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAAN  1471
              L+IPLLS+YP+IA+L+GL LS+VLNC S+ KNVLS SI T L +LQN+AV Q+QRGAAN
Sbjct  361   VLAIPLLSSYPFIAMLTGLSLSIVLNCTSVAKNVLSTSIITSLFLLQNKAVDQDQRGAAN  420

Query  1472  GISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             GI+M+AMSLFK  GPA GG++ SW+Q RQDA F+PG+ +VFF+LNV E +G++MTFKPFL
Sbjct  421   GIAMTAMSLFKAAGPAGGGAIFSWAQKRQDAAFLPGNHMVFFILNVVEAIGVLMTFKPFL  480



>ref|XP_006471269.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Citrus sinensis]
Length=486

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/493 (63%), Positives = 385/493 (78%), Gaps = 20/493 (4%)
 Frame = +2

Query  212   EGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAA  391
             E   EP LK  ++           Y E+C GC+V+ LK   +G+PI  +F I ++ LC A
Sbjct  6     EKLREPFLKNEKR-----------YYENCPGCKVDQLKETKSGLPITELFSIWIIVLCTA  54

Query  392   LPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPv  571
             LPISSLFPFLYFMIRDF IA+REEDI  YAGYVGSSFM GRALTSV WG++ADRYGRKPV
Sbjct  55    LPISSLFPFLYFMIRDFQIAKREEDIGSYAGYVGSSFMFGRALTSVFWGLVADRYGRKPV  114

Query  572   viigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISA  751
             +I+GT +VVIFN +FGLSVN+WMA++TRFLLG+L G++G ++AYA EI R E+ ALG+S 
Sbjct  115   IIMGTASVVIFNTLFGLSVNFWMAVLTRFLLGSLNGLLGPIKAYACEIFREEHQALGLST  174

Query  752   VSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSF  931
             VSTAWGIGL+IGPA+GG+ AQPAEK+P +FS+ES FGKFPYFLPCL IS+FA   T+ +F
Sbjct  175   VSTAWGIGLIIGPALGGFLAQPAEKFPNLFSSESLFGKFPYFLPCLCISLFAFGVTIAAF  234

Query  932   WLPETMHThkkehkeehDVSQNS--------KQPEHEVPTSQKSLLKNWPLISSILVYCV  1087
             WLPET+H    +  +  DVS ++        K+ E    T +KSLLKNWPL+SSI+VYCV
Sbjct  235   WLPETLHR-HNDDDDSCDVSYDALESASAEVKEEEGREATPKKSLLKNWPLMSSIIVYCV  293

Query  1088  FQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGP  1267
             F LHD+AY EIFSLWA SP+KLGGL+Y+T  VG+VLAITG  LL+FQL  YP +E++LGP
Sbjct  294   FSLHDMAYSEIFSLWANSPKKLGGLNYSTQMVGEVLAITGFSLLVFQLSLYPFLERILGP  353

Query  1268  VMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVS  1447
             +M++RI   L+IPLL++YPYIA+LSG  L+ +LNCAS++KN+LSVSI TGL ILQNRAV 
Sbjct  354   IMVARIAGVLTIPLLTSYPYIAMLSGFGLAFLLNCASVVKNLLSVSIITGLFILQNRAVD  413

Query  1448  QEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellgl  1627
             Q+QRGAANGI+M+ MSLFK  GPA GG+L SW+Q R DA F+PG Q+VFFVLNV E +G+
Sbjct  414   QDQRGAANGIAMTGMSLFKAAGPAGGGALFSWAQKRLDASFLPGSQMVFFVLNVVEAIGV  473

Query  1628  IMTFKPFLQLPED  1666
             +MTFKPFL    D
Sbjct  474   LMTFKPFLAQRHD  486



>ref|XP_010041137.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Eucalyptus 
grandis]
 ref|XP_010041138.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Eucalyptus 
grandis]
 ref|XP_010041139.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Eucalyptus 
grandis]
 gb|KCW44609.1| hypothetical protein EUGRSUZ_L01874 [Eucalyptus grandis]
Length=485

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/483 (63%), Positives = 383/483 (79%), Gaps = 13/483 (3%)
 Frame = +2

Query  233   LKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLF  412
             + + EQ    L+  Y+   E+C GC+VE LK    G+PI+ +  I +V LC ALPISSLF
Sbjct  1     MAEEEQKEALLQKHYY---ENCPGCKVEKLKELQRGLPIRELVSIWIVVLCNALPISSLF  57

Query  413   PFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvt  592
             PFLYFMIRDFHIA REEDI YYAGYVG SF+ GRALTS+ WG++ADRYGRKPV+I+GT+ 
Sbjct  58    PFLYFMIRDFHIATREEDIGYYAGYVGCSFLFGRALTSIFWGVVADRYGRKPVIIMGTIA  117

Query  593   vviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGI  772
             VVIFN +FGLSVN+WMA+  RFLLG+L G++G ++AYA+E+ R EY ALG+S VSTAWGI
Sbjct  118   VVIFNTLFGLSVNFWMAVAMRFLLGSLNGLLGPIKAYATELFREEYQALGVSTVSTAWGI  177

Query  773   GLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMH  952
             GL+IGPA+GGY AQPAEK+P+IFS ES FG+FPYFLPCL IS+FA+V ++ S WLPET+H
Sbjct  178   GLIIGPALGGYLAQPAEKFPSIFSEESVFGRFPYFLPCLTISLFAVVVSIASCWLPETLH  237

Query  953   Thkkehk---eehDVSQNS-------KQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHD  1102
              H +  K      DV   S       K    E   S+KSLL+NWPL+S+I+ YC+F LHD
Sbjct  238   KHHENSKLDESCKDVETASLESGVKCKTQNIEGKASKKSLLRNWPLMSAIMAYCIFSLHD  297

Query  1103  IAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISR  1282
             +AY EIFSLWAVSPR+LGGLSYTT DVG VL+I+G GLL+FQ   YP V+K+LGPV+++R
Sbjct  298   MAYSEIFSLWAVSPRRLGGLSYTTEDVGTVLSISGAGLLVFQTCLYPYVDKLLGPVLVAR  357

Query  1283  IGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRG  1462
             I   LSIPLLS+YPYIA+L+GL LS+VLNCAS+ KNVLS+S+ T L +LQN+AV Q+QRG
Sbjct  358   ICGILSIPLLSSYPYIAMLTGLSLSIVLNCASVTKNVLSISVFTSLFLLQNKAVDQDQRG  417

Query  1463  AANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFK  1642
             AANGI+M+AMS+FK  GPA GG++ SWSQ RQDA  +PG+Q++FF+LNV  ++G++MTFK
Sbjct  418   AANGIAMTAMSIFKAAGPAGGGAIFSWSQKRQDAAILPGNQMIFFILNVVLVIGVLMTFK  477

Query  1643  PFL  1651
             PFL
Sbjct  478   PFL  480



>gb|KDO47752.1| hypothetical protein CISIN_1g011424mg [Citrus sinensis]
 gb|KDO47753.1| hypothetical protein CISIN_1g011424mg [Citrus sinensis]
 gb|KDO47754.1| hypothetical protein CISIN_1g011424mg [Citrus sinensis]
Length=486

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/493 (63%), Positives = 385/493 (78%), Gaps = 20/493 (4%)
 Frame = +2

Query  212   EGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAA  391
             E   EP LK  ++           Y E+C GC+V+ LK   +G+PI  +F I ++ LC A
Sbjct  6     EKLREPFLKNEKR-----------YYENCPGCKVDQLKDTKSGLPITELFSIWIIVLCTA  54

Query  392   LPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPv  571
             LPISSLFPFLYFMI+DF IA+REEDI  YAGYVGSSFM GRALTSV WG++ADRYGRKPV
Sbjct  55    LPISSLFPFLYFMIKDFQIAKREEDIGSYAGYVGSSFMFGRALTSVFWGLVADRYGRKPV  114

Query  572   viigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISA  751
             +I+GT +VVIFN +FGLSVN+WMA++TRFLLG+L G++G ++AYA EI R E+ ALG+S 
Sbjct  115   IIMGTASVVIFNTLFGLSVNFWMAVLTRFLLGSLNGLLGPIKAYACEIFREEHQALGLST  174

Query  752   VSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSF  931
             VSTAWGIGL+IGPA+GG+ AQPAEKYP +FS+ES FGKFPYFLPCL IS+FA   T+ +F
Sbjct  175   VSTAWGIGLIIGPALGGFLAQPAEKYPNLFSSESLFGKFPYFLPCLCISLFAFGVTIAAF  234

Query  932   WLPETMHThkkehkeehDVSQNS--------KQPEHEVPTSQKSLLKNWPLISSILVYCV  1087
             WLPET+H    +  +  DVS ++        K+ E    T +KSLLKNWPL+SSI+VYCV
Sbjct  235   WLPETLHR-HNDDDDSCDVSYDALESASAEVKEEEGREATPKKSLLKNWPLMSSIIVYCV  293

Query  1088  FQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGP  1267
             F LHD+AY EIFSLWA SP+KLGGL+Y+T  VG+VLAITG  LL+FQL  YP +E++LGP
Sbjct  294   FSLHDMAYSEIFSLWANSPKKLGGLNYSTQMVGEVLAITGFSLLVFQLSLYPFLERILGP  353

Query  1268  VMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVS  1447
             +M++RI   L+IPLL++YPYIA+LSG  L+ +LNCAS++KN+LSVSI TGL ILQNRAV 
Sbjct  354   IMVARIAGVLTIPLLTSYPYIAMLSGFGLAFLLNCASVVKNLLSVSIITGLFILQNRAVD  413

Query  1448  QEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellgl  1627
             Q+QRGAANGI+M+ MSLFK  GPA GG+L SW+Q R DA F+PG Q+VFFVLNV E +G+
Sbjct  414   QDQRGAANGIAMTGMSLFKAAGPAGGGALFSWAQKRLDASFLPGSQMVFFVLNVVEAIGV  473

Query  1628  IMTFKPFLQLPED  1666
             +MTFKPFL    D
Sbjct  474   LMTFKPFLAQRHD  486



>ref|XP_010067057.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Eucalyptus grandis]
 ref|XP_010067058.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Eucalyptus grandis]
 ref|XP_010067059.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW65121.1| hypothetical protein EUGRSUZ_G02629 [Eucalyptus grandis]
 gb|KCW65122.1| hypothetical protein EUGRSUZ_G02629 [Eucalyptus grandis]
Length=484

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/480 (64%), Positives = 376/480 (78%), Gaps = 12/480 (3%)
 Frame = +2

Query  242   SEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFL  421
             +E+    L ++YF   E+C GC+VE  K +  G PI+ +  I +V LC ALPISSLFPFL
Sbjct  3     AEEQEKALLEKYF--HENCPGCKVEKYKESQKGFPIRELLSIWIVVLCTALPISSLFPFL  60

Query  422   YFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvvi  601
             YFMIRDFHIA+REEDI YYAGYVGSSFM GRALTSV WGI+ADRYGRKPV+I+GT+ VVI
Sbjct  61    YFMIRDFHIAKREEDIGYYAGYVGSSFMFGRALTSVFWGIVADRYGRKPVIIMGTIAVVI  120

Query  602   FNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLV  781
             FN +FGLSVN+WMAI  RFLLG+L G++G ++AYA+EI R EY ALG+S VSTAWGIGL+
Sbjct  121   FNTLFGLSVNFWMAIAMRFLLGSLNGLLGPIKAYATEIFREEYQALGVSTVSTAWGIGLI  180

Query  782   IGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThk  961
             IGPA+GGY AQPAEK+P+IF  ES FG+FPYFLPCL IS+FALV T+ + WLPET+H H 
Sbjct  181   IGPALGGYLAQPAEKFPSIFPKESVFGRFPYFLPCLAISVFALVVTIATCWLPETLHKHH  240

Query  962   keh---keehDVS-------QNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAY  1111
             K         DV           K  + E    +KSL +NWPL+SSI+VYCVF LHD+AY
Sbjct  241   KSSKFDAACEDVETAPLMSGTKYKTQKAEGKAPKKSLFRNWPLMSSIIVYCVFSLHDMAY  300

Query  1112  LEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGA  1291
              EIFSLWAVSPR+ GGLSYTT DVG VLAI+G GLL+FQ   YP   ++LGPV+++R+  
Sbjct  301   TEIFSLWAVSPRRYGGLSYTTEDVGNVLAISGAGLLIFQTCLYPYFNRLLGPVVVARLNG  360

Query  1292  ALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAAN  1471
              L+IPLLS+YP+IA+L+GL LS+VLNC S+ KNVLS SI T L +LQN+AV Q+QRGAAN
Sbjct  361   VLAIPLLSSYPFIAMLTGLSLSIVLNCTSVAKNVLSTSIITSLFLLQNKAVDQDQRGAAN  420

Query  1472  GISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             GI+M+AMSLFK  GPA GG++ SW+Q RQDA F+PG+ +VFF+LNV E +G++MTFKPFL
Sbjct  421   GIAMTAMSLFKAAGPAGGGAIFSWAQKRQDAAFLPGNHMVFFILNVVEAIGVLMTFKPFL  480



>ref|XP_010251716.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X5 [Nelumbo nucifera]
Length=918

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/497 (62%), Positives = 385/497 (77%), Gaps = 26/497 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE N EP LK+              Y +SC GC+++ L     G+P +  F++ +V LC
Sbjct  1     MAE-NREPFLKR-------------FYHQSCPGCKIDQLNDTRRGIPYRGFFYVWIVVLC  46

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              ALPISSLFP+LYFMIRDFHI +REEDI  YAGYVGSSFM GRALTSV WG++ADRYGRK
Sbjct  47    TALPISSLFPYLYFMIRDFHITKREEDIGSYAGYVGSSFMFGRALTSVFWGVVADRYGRK  106

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV++IG +TVVIFN +FGLS N+WMAI  RFLLG+L G++G ++AY++E+CR EY ALG+
Sbjct  107   PVIMIGIITVVIFNTLFGLSTNFWMAISMRFLLGSLNGLLGPIKAYSTEVCREEYQALGV  166

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S VSTAWG GL+IGPA+GG+ AQPAEK+P IFS ES FG+FPY LPCL +S+FAL   + 
Sbjct  167   SLVSTAWGTGLIIGPALGGFLAQPAEKFPNIFSRESLFGRFPYLLPCLPVSIFALFVAIS  226

Query  926   SFWLPETMHThkkehkeehDV------------SQNSKQPEHEVPTSQKSLLKNWPLISS  1069
              FWLPET+H HK+ +K+  +              +  ++ E  +P S++SLL+NWPL+SS
Sbjct  227   CFWLPETLHKHKEHNKDGCESYDALEAAPYTSDEKEKQETEQRIPPSKESLLRNWPLMSS  286

Query  1070  ILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLV  1249
             I+VYCVF LHD+AY EIFSLWAVSPRK GGL+Y++ +VG+VL+ITG  LL FQL  YP V
Sbjct  287   IIVYCVFSLHDMAYTEIFSLWAVSPRKFGGLNYSSDNVGEVLSITGASLLFFQLTLYPCV  346

Query  1250  EKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLIL  1429
             EK+LGPV +SRI A LSIPLLS+YP+IA LSG  LS+++NCAS+LKNVLSVSI TGL IL
Sbjct  347   EKILGPVKVSRIAAVLSIPLLSSYPFIARLSGFRLSLLINCASVLKNVLSVSIITGLFIL  406

Query  1430  QNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnv  1609
             QN AV+Q QRGAANGISM+AMSLFK  GPA GG+L SW+Q RQ+  F+PGDQ+VFF+LN+
Sbjct  407   QNNAVAQNQRGAANGISMTAMSLFKAFGPAGGGALFSWAQKRQNVSFLPGDQMVFFILNI  466

Query  1610  fellglIMTFKPFLQLP  1660
              EL+G+++TF+PFL  P
Sbjct  467   VELIGVLLTFEPFLVQP  483


 Score =   510 bits (1314),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 272/434 (63%), Positives = 335/434 (77%), Gaps = 11/434 (3%)
 Frame = +2

Query  392   LPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPv  571
             LPISSLFP++YFMIRDFHIA+REEDI +YAG+VGSSFM+GRALTSV WG++ADRYGRKPV
Sbjct  485   LPISSLFPYMYFMIRDFHIAKREEDIGFYAGFVGSSFMIGRALTSVFWGVVADRYGRKPV  544

Query  572   viigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISA  751
             ++IGT++VVIFN +FGLS + WMA+  RFLLG    ++G +RAYASE+C  +YHALG S 
Sbjct  545   ILIGTISVVIFNTLFGLSTSLWMAVSMRFLLGCFNCMLGPIRAYASEVCHEKYHALGQSI  604

Query  752   VSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSF  931
              ST+ GIG +IGPA+GG+F QPAEKYP IFS  S F +FPYFLPCLIIS+FAL A +  F
Sbjct  605   ASTSRGIGFIIGPAIGGFFVQPAEKYPNIFSDNSLFARFPYFLPCLIISIFALGAFISCF  664

Query  932   WLPETMH-----------ThkkehkeehDVSQNSKQPEHEVPTSQKSLLKNWPLISSILV  1078
             W+PET+H              +      D  +  K+ E   P S+ SLL+NWPL+S+I+V
Sbjct  665   WIPETLHMHNRNNKEESYDALEASSHRSDEKEEMKETEQTGPPSRLSLLRNWPLMSTIIV  724

Query  1079  YCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKV  1258
             YC+F LH+IAY E+FSLWAVS RK GGL +++  VG+VLAI+G GLLLFQLF YP +EK 
Sbjct  725   YCIFSLHEIAYAEVFSLWAVSDRKYGGLGFSSQSVGEVLAISGFGLLLFQLFLYPSIEKF  784

Query  1259  LGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNR  1438
             LGP+M+SR+ A LSIPLLS+YP+IA LSG  L +V+NCAS+LKNVLSV   TGL IL N 
Sbjct  785   LGPIMVSRLAAVLSIPLLSSYPFIARLSGFTLQLVINCASILKNVLSVVTLTGLFILLNS  844

Query  1439  AVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfel  1618
             AV Q QRGAANGISM+ MS FK IGPA GGSL S +Q RQ A F+PGDQ+VFF+LNV   
Sbjct  845   AVPQHQRGAANGISMTLMSTFKAIGPAGGGSLFSLAQKRQHAAFLPGDQIVFFILNVITA  904

Query  1619  lglIMTFKPFLQLP  1660
             + +++TFKPFL  P
Sbjct  905   VEVVLTFKPFLTRP  918



>ref|XP_002527379.1| carbohydrate transporter, putative [Ricinus communis]
 gb|EEF35004.1| carbohydrate transporter, putative [Ricinus communis]
Length=500

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/427 (67%), Positives = 356/427 (83%), Gaps = 13/427 (3%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y E+C GC+++L K+ +  +P+KH+F++ +V LCAALPISSLFPFLYFMIRDFHIA+REE
Sbjct  27    YYENCPGCQLDLFKQTNPAIPVKHLFYVWIVVLCAALPISSLFPFLYFMIRDFHIAKREE  86

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI YYAGYVGS+FMLGRALTSVLWG+IADRYGRKPV++ G + V++FN +FGLS ++WMA
Sbjct  87    DIGYYAGYVGSAFMLGRALTSVLWGVIADRYGRKPVIVFGMIAVIVFNTLFGLSTSFWMA  146

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I  RFLLG+LCGI+G MRAYASE+CR+EY ALG+S +ST+WGIGLVIGPA+GG+ AQP E
Sbjct  147   ISLRFLLGSLCGILGPMRAYASEVCRKEYQALGMSIISTSWGIGLVIGPALGGFLAQPVE  206

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehk----------  973
             KYP IFS  S FG+FPYFLPCL+IS+F L   V+   LPET+H HK + K          
Sbjct  207   KYPNIFSKVSIFGRFPYFLPCLLISIFTLAVLVVCCSLPETLHNHKGKEKECDYLCDDQE  266

Query  974   eehDVSQNSKQPEH---EVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSP  1144
                D S ++K+ +    +  T ++SLLKNWPL+SSI+VYC+FQLHD+AY EIFSLWAVSP
Sbjct  267   SNVDESNSNKRAQMNKGKSSTPEESLLKNWPLMSSIIVYCIFQLHDMAYTEIFSLWAVSP  326

Query  1145  RKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYP  1324
             RK GGLSY+TADVG+VLAI+G GLLLFQL  YPLVE+ LGPV +SRIGA +++PLLS+YP
Sbjct  327   RKNGGLSYSTADVGEVLAISGFGLLLFQLLLYPLVERNLGPVTVSRIGAVMTVPLLSSYP  386

Query  1325  YIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFK  1504
             +IALL+G+ L++++ C S+LKNVLSV+ITTGL +LQNRAV+Q+QRGAANGISMSAMSLFK
Sbjct  387   FIALLTGVSLTLLVGCVSVLKNVLSVTITTGLFLLQNRAVTQKQRGAANGISMSAMSLFK  446

Query  1505  TIGPAAG  1525
              IGPAAG
Sbjct  447   AIGPAAG  453



>ref|XP_007028171.1| Zinc induced facilitator-like 1 isoform 3 [Theobroma cacao]
 gb|EOY08673.1| Zinc induced facilitator-like 1 isoform 3 [Theobroma cacao]
Length=436

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/427 (68%), Positives = 360/427 (84%), Gaps = 12/427 (3%)
 Frame = +2

Query  431   IRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNA  610
             IRDF+IA++EEDI YYAGYVGS+FM GRALTSV WG+IADRYGRKPV++ GT +VVIFN 
Sbjct  10    IRDFNIAKKEEDIGYYAGYVGSAFMFGRALTSVFWGMIADRYGRKPVIMFGTFSVVIFNT  69

Query  611   VFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGP  790
             +FGLS N+W+A+ TRFLLG+LCGI+G MRAYASE+CR+EY ALG+S +ST+WGIGLVIGP
Sbjct  70    LFGLSTNFWVAVSTRFLLGSLCGILGPMRAYASEVCRKEYQALGMSIISTSWGIGLVIGP  129

Query  791   AVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkeh  970
             A+GG+ AQPAEK+P IF+ ES FG+FPYFLPC++IS+FA    ++S  LPET+H H++  
Sbjct  130   ALGGFLAQPAEKFPYIFANESLFGRFPYFLPCILISLFAFGVFLISCSLPETLHIHERTD  189

Query  971   keehDVSQ---------NSKQPEHEV---PTSQKSLLKNWPLISSILVYCVFQLHDIAYL  1114
             KE   ++          N+ +    V   PTSQ++L KNWPL+SSI+VYCVFQLHD+AY 
Sbjct  190   KECDKLNDALVTSTGEPNANEKVRIVGRHPTSQQNLWKNWPLMSSIIVYCVFQLHDMAYA  249

Query  1115  EIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAA  1294
             EIFSLWAVSPRK GGLSY+TADVG+VLAI+G GLLLFQLF YPL+E+ LGPVMISR+GA 
Sbjct  250   EIFSLWAVSPRKNGGLSYSTADVGEVLAISGCGLLLFQLFLYPLIERTLGPVMISRLGAV  309

Query  1295  LSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANG  1474
             L+IPLL TYP+IA+L GL L  +++ AS+LKNVLSVSITTGL +LQNRAV+Q+QRGAANG
Sbjct  310   LTIPLLFTYPFIAMLKGLSLMFLISSASVLKNVLSVSITTGLFLLQNRAVTQKQRGAANG  369

Query  1475  ISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQ  1654
             ISMSAMS+FK +GPAAGGSL SW+Q RQ+A F+PGDQ+VFF LN+ E++GL+MTFKPFL 
Sbjct  370   ISMSAMSIFKAVGPAAGGSLFSWAQNRQNAFFLPGDQMVFFALNMIEVIGLLMTFKPFLI  429

Query  1655  LPEDDIL  1675
              P+D++L
Sbjct  430   PPDDNVL  436



>ref|XP_010067055.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW65120.1| hypothetical protein EUGRSUZ_G02628 [Eucalyptus grandis]
Length=492

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/444 (64%), Positives = 353/444 (80%), Gaps = 12/444 (3%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y E+C GC+V+ LK +  G+PI+ +  I +V L  ALPISSLFPFLYFMIRDFHIA+REE
Sbjct  15    YYENCPGCKVDKLKESQRGLPIRELVSIWIVVLSTALPISSLFPFLYFMIRDFHIAKREE  74

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI YYAGYVGSS M GR LTS+ WG++ADRYGRKPV++IG +TVVIFN +FGLSVN+WMA
Sbjct  75    DIGYYAGYVGSSLMFGRVLTSLFWGVVADRYGRKPVIVIGIITVVIFNTLFGLSVNFWMA  134

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TRFLLG+L G++G +RAYA+E+ R EY ALGI+ VSTAWGIGL+IGPA+GGY AQPAE
Sbjct  135   IATRFLLGSLNGLLGPIRAYATELFREEYQALGITTVSTAWGIGLIIGPALGGYLAQPAE  194

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             K+P+IFS ES FG+FPYFLPCL IS+FALV ++ SFWLPET+H       E  +  ++ +
Sbjct  195   KFPSIFSKESVFGRFPYFLPCLAISIFALVVSIASFWLPETLH-MHHGSSELDESCKDME  253

Query  1004  QPEHEVPTS-----------QKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRK  1150
              P  E PT            +K L++NWPL+SSI++YCVF  HD+AY EIFSLWAVSPR+
Sbjct  254   TPSLESPTKNKRHKFEGKAPKKCLIRNWPLMSSIILYCVFSFHDMAYTEIFSLWAVSPRR  313

Query  1151  LGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYI  1330
             LGGLSYTT DVG VL+I+G GL++FQ   +P + ++LGPV+++RIG  LSIPLLS+YP+I
Sbjct  314   LGGLSYTTEDVGTVLSISGAGLIVFQTCLFPHLTRLLGPVVVARIGGVLSIPLLSSYPFI  373

Query  1331  ALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTI  1510
             A+L+GL LS  LNCAS+ KNV+ VSI T L ILQN+AV Q+QRGAANGI+M+AMSLFK  
Sbjct  374   AMLTGLSLSTALNCASIAKNVMYVSIVTSLFILQNKAVDQDQRGAANGIAMTAMSLFKAF  433

Query  1511  GPAAGGSLLSWSQLRQDAKFMPGD  1582
             GPA GG++ SW+Q RQDA F+PG 
Sbjct  434   GPAGGGTIFSWAQKRQDAAFLPGK  457



>ref|XP_010453472.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Camelina sativa]
Length=475

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/483 (59%), Positives = 367/483 (76%), Gaps = 14/483 (3%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE  TE LL                Y E C GC+V+ +KR   G P   +F + ++ LC
Sbjct  1     MAEEYTECLLGNK-------------YHEGCPGCKVDQMKRLRRGFPFWELFSVWIIVLC  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              ALPISSLFPFLYF+I DF IA++EEDI +YAG+VG SFMLGRALTSV+WG++ADRYGRK
Sbjct  48    TALPISSLFPFLYFLIDDFGIAKKEEDIGFYAGFVGCSFMLGRALTSVIWGLVADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV++IGT +VV+FN +FGLS+N+WMAIITRF LG+  G++G ++AYA EI R EY  L +
Sbjct  108   PVILIGTASVVVFNTLFGLSLNFWMAIITRFCLGSFNGLLGPIKAYAMEIFRDEYQGLAL  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             SAVSTAWGIGL+IGPA+GG+ AQPA++YP++FS +S FGKFPYFLPC  IS+FA + T++
Sbjct  168   SAVSTAWGIGLIIGPAIGGFLAQPAKQYPSLFSQDSIFGKFPYFLPCFAISIFAFLVTII  227

Query  926   SFWLPETMHThkkehkeehDVSQNSKQPEHEVPTSQK-SLLKNWPLISSILVYCVFQLHD  1102
             S W+PET+H HK +  +  D  ++  +       ++K SLL NWPL+SSI+VYC+F LHD
Sbjct  228   SLWIPETLHNHKFDDVQSFDAVKDDTESNKVAEKNEKSSLLNNWPLVSSIIVYCIFSLHD  287

Query  1103  IAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISR  1282
             +AY EIFSLWA SPRK GGL YTTADVG VLAI+G GLL+FQL  Y   E+ LGP++++R
Sbjct  288   MAYSEIFSLWANSPRKYGGLGYTTADVGSVLAISGFGLLIFQLSLYSYAERNLGPIIVTR  347

Query  1283  IGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRG  1462
             I  +L++ +LSTYP IA LSG+ L++ +N AS+ KNVLS S  TGL ILQN+AV Q+QRG
Sbjct  348   ISGSLALVVLSTYPLIAKLSGVALTLTVNSASVAKNVLSTSAITGLFILQNKAVRQDQRG  407

Query  1463  AANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFK  1642
             AANGI+M+AMS FK IGPAA G + SWS+ RQ+A F+PG Q+VF +LNV   LG++MTFK
Sbjct  408   AANGIAMTAMSFFKAIGPAAAGIIFSWSEKRQNAYFLPGTQMVFIILNVVLALGVLMTFK  467

Query  1643  PFL  1651
             PFL
Sbjct  468   PFL  470



>emb|CDX78536.1| BnaA03g04480D [Brassica napus]
Length=481

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/488 (60%), Positives = 371/488 (76%), Gaps = 18/488 (4%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE  TE LL+ ++            Y E C GC+V+ +K++  G P   +  + ++ LC
Sbjct  1     MAEEYTECLLENNK------------YHEHCPGCKVDQMKKSRRGFPFSELLSVWIIVLC  48

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              ALPISSLFPFLYFMI DF IA++EEDI +YAG+VG SFMLGR LTSV+WGI+ADRYGRK
Sbjct  49    TALPISSLFPFLYFMISDFDIAKKEEDIGFYAGFVGCSFMLGRTLTSVIWGIMADRYGRK  108

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV++IGT +VVIFN +FGLSVN+WMAIITRF LG+  G++G ++AYA EI R EY  L +
Sbjct  109   PVILIGTASVVIFNTLFGLSVNFWMAIITRFCLGSFNGLLGPIKAYAIEIFRDEYQGLAL  168

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             SAVSTAWGIGL+IGPA+GG+ AQPA++YP++FS ES FGKFPYFLPCL+IS FAL+ T++
Sbjct  169   SAVSTAWGIGLIIGPAMGGFLAQPAKQYPSLFSEESVFGKFPYFLPCLVISCFALLVTIV  228

Query  926   SFWLPETMHThkke-hkeehDVSQN--SKQPE-HEVP--TSQKSLLKNWPLISSILVYCV  1087
             S  +PET+H HK       HD S    S  PE H+V     + SLLKNWPLISSI+VYC+
Sbjct  229   SLRIPETLHNHKIADDASSHDESMKFLSHDPESHKVTERNEKNSLLKNWPLISSIIVYCI  288

Query  1088  FQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGP  1267
               LHD+AY E+FSLWA SPRK GGL YT+ADVG VLA +G GLL+FQL  Y   E++LGP
Sbjct  289   LSLHDMAYTEVFSLWANSPRKYGGLGYTSADVGSVLAFSGFGLLVFQLSLYSYAERLLGP  348

Query  1268  VMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVS  1447
             ++++RI  +L + LLS+YP IA LSGL L++ LNCAS+ KNVLSVS  TGL ILQN AV 
Sbjct  349   IVVTRISGSLGLVLLSSYPLIAKLSGLALTLTLNCASVAKNVLSVSAITGLFILQNNAVG  408

Query  1448  QEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellgl  1627
             Q+QRGAANG++M+ MSLFK IGPAA G + SWS+ RQ+A F+PG Q+VFF+LN    LG+
Sbjct  409   QDQRGAANGLAMTGMSLFKAIGPAAAGIIYSWSEKRQNATFLPGTQMVFFILNTVLALGV  468

Query  1628  IMTFKPFL  1651
             ++TFKPFL
Sbjct  469   VLTFKPFL  476



>ref|XP_004516554.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004516555.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Cicer arietinum]
Length=486

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/467 (60%), Positives = 362/467 (78%), Gaps = 7/467 (1%)
 Frame = +2

Query  263   LEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDF  442
             LE +YF   + C GC+VE  K  + GV I ++  I MV L A LP SSLFPFLYFM+RDF
Sbjct  11    LEKQYF---KDCPGCKVEQAKELNQGVSITNLLIIWMVVLSATLPASSLFPFLYFMVRDF  67

Query  443   HIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGL  622
             ++A+ E DISYYAGYVGSSFMLGR+LTS+ WG+I+DRYGRKPV+IIG + VVI N +FGL
Sbjct  68    NVAKEEADISYYAGYVGSSFMLGRSLTSIFWGMISDRYGRKPVIIIGIIAVVILNTLFGL  127

Query  623   SVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGG  802
             S ++WMA+ITRFLLG+L G++G ++AYA+E+ R E+ A+G+S VS AWGIGL+IGPA+GG
Sbjct  128   STSFWMAVITRFLLGSLNGVLGPVKAYATELFREEHQAIGLSTVSAAWGIGLIIGPALGG  187

Query  803   YFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeeh  982
             Y AQP EKYP IF  +SFF KFPYFLPC IIS  AL A ++  W+PET+H H   ++ + 
Sbjct  188   YLAQPVEKYPKIFMKDSFFDKFPYFLPCFIISGLALTAAIICIWIPETLHNHSGRNESKD  247

Query  983   DVS--QNSKQPEHEVPTSQK--SLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRK  1150
             D    +N    + +  T QK  +L  NWPL+SSI+ YC+F LHDIAY E+FSLWAVSP K
Sbjct  248   DAEALENGSNEDDKQRTVQKNENLFMNWPLMSSIIAYCIFALHDIAYQEVFSLWAVSPSK  307

Query  1151  LGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYI  1330
             LGGL++TT DVG VL+I+G+ L ++Q+  YP VEKV GP+ I+RI    SIPLL +YP+I
Sbjct  308   LGGLNFTTDDVGDVLSISGLALFIYQIAVYPFVEKVCGPIAIARIAGISSIPLLQSYPFI  367

Query  1331  ALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTI  1510
             A+LSG+ L  +++ ASMLKNV++V+ITTGL ++QNR V Q QRGAANGISM+AMS FK I
Sbjct  368   AMLSGITLYTIISIASMLKNVMAVTITTGLFLIQNRVVEQHQRGAANGISMTAMSFFKAI  427

Query  1511  GPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             GPAAGG++L+WSQ R+DA F+PG Q+VFF LN+ E LG+++ FKPFL
Sbjct  428   GPAAGGTILTWSQKRRDASFLPGSQMVFFFLNLVEGLGILLLFKPFL  474



>ref|XP_009131358.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Brassica 
rapa]
Length=481

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/488 (60%), Positives = 370/488 (76%), Gaps = 18/488 (4%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE  TE LL+ +             Y E C GC+V+ +K++  G P   +  + ++ LC
Sbjct  1     MAEEYTECLLENN------------MYHEHCPGCKVDQMKKSRRGFPFSELLSVWIIVLC  48

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              ALPISSLFPFLYFMI DF IA++EEDI +YAG+VG SFMLGR LTSV+WGI+ADRYGRK
Sbjct  49    TALPISSLFPFLYFMISDFDIAKKEEDIGFYAGFVGCSFMLGRTLTSVIWGIMADRYGRK  108

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV++IGT +VVIFN +FGLSVN+WMAIITRF LG+  G++G ++AYA EI R EY  L +
Sbjct  109   PVILIGTASVVIFNTLFGLSVNFWMAIITRFCLGSFNGLLGPIKAYAIEIFRDEYQGLAL  168

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             SAVSTAWGIGL+IGPA+GG+ AQPA++YP++FS ES FGKFPYFLPCL+IS FAL+ T++
Sbjct  169   SAVSTAWGIGLIIGPAMGGFLAQPAKQYPSLFSEESVFGKFPYFLPCLVISCFALLVTIV  228

Query  926   SFWLPETMHThkke-hkeehDVSQN--SKQPE-HEVP--TSQKSLLKNWPLISSILVYCV  1087
             S  +PET+H HK       HD S    S  PE H+V     + SLLKNWPLISSI+VYC+
Sbjct  229   SLRIPETLHNHKIADDASSHDESMKFLSHDPESHKVTERNEKNSLLKNWPLISSIIVYCI  288

Query  1088  FQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGP  1267
               LHD+AY E+FSLWA SPRK GGL YT+ADVG VLA +G GLL+FQL  Y   E++LGP
Sbjct  289   LSLHDMAYTEVFSLWANSPRKYGGLGYTSADVGSVLAFSGFGLLVFQLSLYSYAERLLGP  348

Query  1268  VMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVS  1447
             ++++RI  +L + LLS+YP IA LSGL L++ LNCAS+ KNVLSVS  TGL ILQN AV 
Sbjct  349   IVVTRISGSLGLVLLSSYPLIAKLSGLALTLTLNCASVAKNVLSVSAITGLFILQNNAVG  408

Query  1448  QEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellgl  1627
             Q+QRGAANG++M+ MSLFK IGPAA G + SWS+ RQ+A F+PG Q+VFF+LN    LG+
Sbjct  409   QDQRGAANGLAMTGMSLFKAIGPAAAGIIYSWSEKRQNATFLPGTQMVFFILNTVLALGV  468

Query  1628  IMTFKPFL  1651
             ++TFKPFL
Sbjct  469   VLTFKPFL  476



>ref|XP_006286669.1| hypothetical protein CARUB_v10002619mg [Capsella rubella]
 gb|EOA19567.1| hypothetical protein CARUB_v10002619mg [Capsella rubella]
Length=479

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/486 (60%), Positives = 369/486 (76%), Gaps = 16/486 (3%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE   E LL+ ++            Y E C GC+V+ +K    G P   +F + ++ LC
Sbjct  1     MAEEYRECLLENNK------------YHEDCPGCKVDRMKSLRRGFPFWELFTVWIIVLC  48

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              ALPISSLFPFLYFMI DF IA++EEDI +YAG+VG SFMLGRALTSV+WGI+ADRYGRK
Sbjct  49    TALPISSLFPFLYFMIDDFDIAKKEEDIGFYAGFVGCSFMLGRALTSVIWGIVADRYGRK  108

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV++IGT +VV+FN +FGLS+N+WMAIITRF LG+  G++G ++AYA E  R EY  L +
Sbjct  109   PVILIGTASVVVFNTLFGLSLNFWMAIITRFCLGSFNGLLGPIKAYAVETFRDEYQGLAL  168

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             SAVSTAWGIGL+IGPA+GG+ AQPA++YP++FS +S FG+FPYFLPC  IS+FA + T++
Sbjct  169   SAVSTAWGIGLIIGPAIGGFLAQPAKQYPSLFSHDSIFGRFPYFLPCFAISIFAFLVTLI  228

Query  926   SFWLPETMHThk-kehkeehDVSQNSKQPE-HEVP--TSQKSLLKNWPLISSILVYCVFQ  1093
             + W+PET+H HK  + +   DV   S  PE +EV     + SLL NWPLISSI+VYC+F 
Sbjct  229   TLWIPETLHNHKFDDEQSYDDVKVLSHDPESNEVAERNEKSSLLNNWPLISSIIVYCIFS  288

Query  1094  LHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVM  1273
             LHD+AY EIFSLWA SPRK GGL YTTADVG VLAI+G GLL+FQL  Y   E++LGP++
Sbjct  289   LHDMAYSEIFSLWANSPRKYGGLGYTTADVGSVLAISGFGLLIFQLSLYSYAERLLGPII  348

Query  1274  ISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQE  1453
             ++RI  +L++ LLSTYP IA LSG+ L++ LN AS+ K VLS S  TGL ILQNRAV Q+
Sbjct  349   VTRISGSLALVLLSTYPLIAKLSGVALTLTLNSASVAKTVLSTSAITGLFILQNRAVRQD  408

Query  1454  QRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIM  1633
             QRGAANGI+M+ MS FK IGPAA G + SWS+ RQDA F+PG Q+VFF+LNV   LG++M
Sbjct  409   QRGAANGIAMTGMSFFKAIGPAAAGIIFSWSEKRQDASFLPGTQMVFFILNVVLALGVLM  468

Query  1634  TFKPFL  1651
             TFKPFL
Sbjct  469   TFKPFL  474



>ref|XP_006399873.1| hypothetical protein EUTSA_v10013417mg [Eutrema salsugineum]
 gb|ESQ41326.1| hypothetical protein EUTSA_v10013417mg [Eutrema salsugineum]
Length=479

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/492 (59%), Positives = 370/492 (75%), Gaps = 28/492 (6%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE  TE LL+++             + E+C GC+V+ +KR   G P   +  + ++ LC
Sbjct  1     MAEEYTECLLEKN-------------FHENCPGCKVDQMKRLRRGFPFSELCSVWIIVLC  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              ALPISSLFPFLYFMI DF+IA++EEDI +YAG+VG SFMLGR LTSV WGI+ADRYGRK
Sbjct  48    TALPISSLFPFLYFMIDDFNIAKKEEDIGFYAGFVGCSFMLGRTLTSVFWGIVADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV++IGT +VV+FN +FGLSVN+WMAIITRF LG+  G++G ++A+A E  R EY  L +
Sbjct  108   PVILIGTASVVVFNTLFGLSVNFWMAIITRFCLGSFNGLLGPIKAFAMETFRDEYQGLAL  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             SAVSTAWGIGL+IGPA+GG+ AQPA++YP++FS ES FGKFPYFLPCL IS FA + T++
Sbjct  168   SAVSTAWGIGLIIGPALGGFLAQPAKQYPSLFSEESVFGKFPYFLPCLAISCFAFLVTII  227

Query  926   SFWLPETMHThkkehkeehDVSQN-------SKQPE-HEVP--TSQKSLLKNWPLISSIL  1075
             S  +PET+H       +  D S++       S  PE H+V     + SLLKNWPL+SSI+
Sbjct  228   SLRIPETLHN-----HKIDDDSKSFDALKVLSHDPESHKVTERNEKSSLLKNWPLLSSII  282

Query  1076  VYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEK  1255
             VYC+F LHD+AY EIFSLWA SPRK GGL Y++ADVG VLAI+G GLL+FQL  Y   E+
Sbjct  283   VYCIFSLHDMAYTEIFSLWANSPRKYGGLGYSSADVGTVLAISGFGLLIFQLSLYSYAER  342

Query  1256  VLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQN  1435
             +LGP++++RI  +L+I LL++YP IA LSG  L++ LNCAS+ KNVL VS  TGL ILQN
Sbjct  343   LLGPIIVTRISGSLAIVLLASYPLIAKLSGFSLTLALNCASVAKNVLGVSAITGLFILQN  402

Query  1436  RAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfe  1615
             RAV Q+QRGAANGI+M+ MSLFK IGPAA G + SWS+ RQDA F+PG Q+VFF+LN   
Sbjct  403   RAVRQDQRGAANGIAMTGMSLFKAIGPAAAGIIFSWSEKRQDAAFLPGTQIVFFILNAVL  462

Query  1616  llglIMTFKPFL  1651
              LG++MTFKPFL
Sbjct  463   ALGVVMTFKPFL  474



>emb|CDX70518.1| BnaC03g06020D [Brassica napus]
Length=481

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/488 (60%), Positives = 368/488 (75%), Gaps = 18/488 (4%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE  TE LL+ ++            Y E C GC+V+ +K++  G P   +  + ++ LC
Sbjct  1     MAEEYTECLLENNK------------YHEHCPGCKVDQMKKSRRGFPFSELLSVWIIVLC  48

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              ALPISSLFPFLYFMI DF IA++EEDI +YAG+VG SFMLGR LTSV+WGI+ADRYGRK
Sbjct  49    TALPISSLFPFLYFMISDFDIAKKEEDIGFYAGFVGCSFMLGRTLTSVIWGIMADRYGRK  108

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV++IGT +VVIFN +FGLSVN+WMAIITRF LG+  G++G ++AYA EI R EY  L +
Sbjct  109   PVILIGTASVVIFNTLFGLSVNFWMAIITRFCLGSFNGLLGPIKAYAIEIFRDEYQGLAL  168

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             SAVSTAWGIGL+IGPA+GG+ AQPA++YP++FS ES FGKFPYFLPCL+IS FAL+ T+ 
Sbjct  169   SAVSTAWGIGLIIGPAMGGFLAQPAKQYPSLFSEESVFGKFPYFLPCLVISCFALLVTIA  228

Query  926   SFWLPETMHThkk---ehkeehDVSQNSKQPE-HEVP--TSQKSLLKNWPLISSILVYCV  1087
             S  +PET+H HK        +  +   S  PE H+V     + SLLKNWPLISSI+VYC+
Sbjct  229   SLRIPETLHNHKIGDDASSHDESIKFLSHDPESHKVTERNEKNSLLKNWPLISSIIVYCI  288

Query  1088  FQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGP  1267
               LHD+AY E+FSLWA SPRK GGL YT+ADVG VLA +G GLL+FQL  Y   E++LGP
Sbjct  289   LSLHDMAYTEVFSLWANSPRKYGGLGYTSADVGSVLAFSGFGLLVFQLSLYSYAERLLGP  348

Query  1268  VMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVS  1447
             ++++RI  +L + LLS+YP IA LSGL L++ LNCAS+ KNVLSVS  TGL ILQN AV 
Sbjct  349   IVVTRISGSLGLVLLSSYPLIAKLSGLVLTLTLNCASVAKNVLSVSAITGLFILQNNAVG  408

Query  1448  QEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellgl  1627
             Q+QRGAANG++M+ MSLFK IGPAA G + SWS+  QDA F+PG Q+VFF+LN    LG+
Sbjct  409   QDQRGAANGLAMTGMSLFKAIGPAAAGIIYSWSEKHQDAAFLPGTQMVFFILNTVLALGV  468

Query  1628  IMTFKPFL  1651
             ++TFKPFL
Sbjct  469   VLTFKPFL  476



>ref|XP_010492149.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1 [Camelina 
sativa]
Length=478

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/460 (62%), Positives = 359/460 (78%), Gaps = 4/460 (1%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y E C GC+V+ +KR   G P   +F + ++ LC ALPISSLFPFLYF+I DF IA++EE
Sbjct  14    YHEGCPGCKVDQMKRLRRGFPFWELFSVWIIVLCTALPISSLFPFLYFLIDDFGIAKKEE  73

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG+VG SFMLGRALTSV+WG++ADRYGRKPV++IGT +VV+FN +FGLS+N+WMA
Sbjct  74    DIGFYAGFVGCSFMLGRALTSVIWGLVADRYGRKPVILIGTASVVVFNTLFGLSLNFWMA  133

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             IITRF LG+  G++G ++AYA EI R EY  L +SAVSTAWGIGL+IGPA+GG+ AQPA+
Sbjct  134   IITRFCLGSFNGLLGPIKAYAMEIFRDEYQGLALSAVSTAWGIGLIIGPAIGGFLAQPAK  193

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehD-VSQNS  1000
             +YP++FS +S FGKFPYFLPC  IS+FA + T++S W+PET+H HK +  E  D V   S
Sbjct  194   QYPSLFSQDSIFGKFPYFLPCFAISIFAFLVTIISLWIPETLHKHKSDEDESFDAVKVLS  253

Query  1001  KQPEHEV---PTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYT  1171
               PE         + SLL NWPL+SSI+VYC+F LHD+AY EIFSLWA SPRK GGL YT
Sbjct  254   HDPESNKVAEKNEKSSLLNNWPLVSSIIVYCIFSLHDMAYSEIFSLWANSPRKYGGLGYT  313

Query  1172  TADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLC  1351
             TADVG VLAI+G GLL+FQL  Y   E+ LGP++++RI   L++ +LSTYP IA LSG+ 
Sbjct  314   TADVGSVLAISGFGLLIFQLSLYSYAERNLGPIIVTRISGCLALVVLSTYPLIAKLSGVA  373

Query  1352  LSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGS  1531
             L++ +N AS+ KNVLS S  TGL ILQN+AV Q+QRGAANGI+M+AMS FK IGPAA G 
Sbjct  374   LTLTVNSASVAKNVLSTSAITGLFILQNKAVRQDQRGAANGIAMTAMSFFKAIGPAAAGI  433

Query  1532  LLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             + SWS+ RQ+A F+PG Q+VFF+LNV   LG++MTFKPFL
Sbjct  434   IFSWSEKRQNASFLPGTQMVFFILNVVLALGVLMTFKPFL  473



>gb|KDO47758.1| hypothetical protein CISIN_1g011424mg [Citrus sinensis]
Length=473

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/464 (63%), Positives = 363/464 (78%), Gaps = 20/464 (4%)
 Frame = +2

Query  212   EGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAA  391
             E   EP LK  ++           Y E+C GC+V+ LK   +G+PI  +F I ++ LC A
Sbjct  6     EKLREPFLKNEKR-----------YYENCPGCKVDQLKDTKSGLPITELFSIWIIVLCTA  54

Query  392   LPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPv  571
             LPISSLFPFLYFMI+DF IA+REEDI  YAGYVGSSFM GRALTSV WG++ADRYGRKPV
Sbjct  55    LPISSLFPFLYFMIKDFQIAKREEDIGSYAGYVGSSFMFGRALTSVFWGLVADRYGRKPV  114

Query  572   viigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISA  751
             +I+GT +VVIFN +FGLSVN+WMA++TRFLLG+L G++G ++AYA EI R E+ ALG+S 
Sbjct  115   IIMGTASVVIFNTLFGLSVNFWMAVLTRFLLGSLNGLLGPIKAYACEIFREEHQALGLST  174

Query  752   VSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSF  931
             VSTAWGIGL+IGPA+GG+ AQPAEKYP +FS+ES FGKFPYFLPCL IS+FA   T+ +F
Sbjct  175   VSTAWGIGLIIGPALGGFLAQPAEKYPNLFSSESLFGKFPYFLPCLCISLFAFGVTIAAF  234

Query  932   WLPETMHThkkehkeehDVSQNS--------KQPEHEVPTSQKSLLKNWPLISSILVYCV  1087
             WLPET+H    +  +  DVS ++        K+ E    T +KSLLKNWPL+SSI+VYCV
Sbjct  235   WLPETLHR-HNDDDDSCDVSYDALESASAEVKEEEGREATPKKSLLKNWPLMSSIIVYCV  293

Query  1088  FQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGP  1267
             F LHD+AY EIFSLWA SP+KLGGL+Y+T  VG+VLAITG  LL+FQL  YP +E++LGP
Sbjct  294   FSLHDMAYSEIFSLWANSPKKLGGLNYSTQMVGEVLAITGFSLLVFQLSLYPFLERILGP  353

Query  1268  VMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVS  1447
             +M++RI   L+IPLL++YPYIA+LSG  L+ +LNCAS++KN+LSVSI TGL ILQNRAV 
Sbjct  354   IMVARIAGVLTIPLLTSYPYIAMLSGFGLAFLLNCASVVKNLLSVSIITGLFILQNRAVD  413

Query  1448  QEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPG  1579
             Q+QRGAANGI+M+ MSLFK  GPA GG+L SW+Q R DA F+PG
Sbjct  414   QDQRGAANGIAMTGMSLFKAAGPAGGGALFSWAQKRLDASFLPG  457



>ref|XP_011086111.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Sesamum indicum]
Length=489

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/494 (62%), Positives = 379/494 (77%), Gaps = 23/494 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAEG         E     L  +Y  Y E C GC V+ LK+   G+PIK V  + ++ L 
Sbjct  1     MAEGQ--------EHVESLLRKDY--YVEGCPGCEVDQLKQTQRGMPIKQVLVVWVIVLS  50

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              AL ISSLFPFLYFMIRDF IA+REEDI YYAG++GSS+MLGRALTS+LWG+IADRYGRK
Sbjct  51    TALTISSLFPFLYFMIRDFGIAKREEDIGYYAGFIGSSYMLGRALTSMLWGVIADRYGRK  110

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV+IIG  TVV+FN +FGLS+N+WMAI TRFLLG+L G++G ++AYA E  R EY +L +
Sbjct  111   PVIIIGCATVVVFNTLFGLSINFWMAITTRFLLGSLNGLLGPIKAYACETVRDEYQSLAL  170

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             SAVSTAWG GL+IGPA+GG+ AQPAEK+P IF+++SF  +FPYFLPCLIIS+FA V TV 
Sbjct  171   SAVSTAWGAGLIIGPALGGFLAQPAEKFPGIFASDSFLARFPYFLPCLIISLFAAVVTVA  230

Query  926   SFWLPETMHThkkehkeehDVSQNSKQPEHE------------VPTSQKSLLKNWPLISS  1069
              FW+PET+HTH  E     D S ++ +  ++              TS++SL KNWPL+SS
Sbjct  231   CFWIPETLHTHNSEKIASQD-SYDALESANQGSSEKEEIEERRETTSKQSLFKNWPLMSS  289

Query  1070  ILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLV  1249
             I+VYCVF LHD+AY EIFSLWA SPR+LGGLSYTT DVG VL I+G+GLL+FQ   YPLV
Sbjct  290   IIVYCVFSLHDMAYTEIFSLWAESPRRLGGLSYTTEDVGTVLVISGVGLLIFQSSLYPLV  349

Query  1250  EKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLIL  1429
             EK++GP+ +SRI   +SIPLL++Y YIA+LSG+ LS++LNCAS+LKNV S+SI TGL IL
Sbjct  350   EKIMGPIRLSRILGIISIPLLTSYHYIAMLSGITLSIMLNCASLLKNVFSISIVTGLFIL  409

Query  1430  QNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnv  1609
             QNRAV Q QRGAANGI+M  MSLFK  GPA GG+L SW+Q RQ A F+PGDQ+VFF+LNV
Sbjct  410   QNRAVDQHQRGAANGIAMLFMSLFKAAGPAGGGALFSWAQKRQHADFLPGDQMVFFILNV  469

Query  1610  fellglIMTFKPFL  1651
              E +G++MTFKPFL
Sbjct  470   IEAIGVLMTFKPFL  483



>ref|XP_006347688.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Solanum tuberosum]
Length=432

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/427 (65%), Positives = 349/427 (82%), Gaps = 8/427 (2%)
 Frame = +2

Query  389   ALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKP  568
             +LPISSLFPFLYFMI+DFHIA+REEDIS YAGYVGS+FMLGRA TSV WG +ADRYGRKP
Sbjct  2     SLPISSLFPFLYFMIKDFHIAKREEDISTYAGYVGSAFMLGRASTSVFWGAVADRYGRKP  61

Query  569   vviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGIS  748
             V++ GT  VV+FN +FGLSVN+WMAI TRFLLG L G+IG ++AYA+EI R EY ALG+S
Sbjct  62    VIVFGTFVVVVFNTLFGLSVNFWMAITTRFLLGFLNGLIGPIKAYAAEIFREEYQALGMS  121

Query  749   AVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMS  928
              +STAWGIGL+IGPA+GG+ AQPAEKYP +FS +S FG+FPYFLPCL IS+F+L   + S
Sbjct  122   TISTAWGIGLIIGPALGGFLAQPAEKYPDVFSKDSIFGRFPYFLPCLCISLFSLAVGIAS  181

Query  929   FWLPETMHTh------kkehkeehDVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVF  1090
             FWLPET+H H      +  ++   + + ++K     VP  +++L KNWPL+SSI++YCVF
Sbjct  182   FWLPETLHNHDSRMPPQSSYEALEEAASDTKDRNESVP--KENLFKNWPLMSSIILYCVF  239

Query  1091  QLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPV  1270
              LHD+AY EIFSLW VSPRK GGLSY+T DVG+VL+I+G GLL+FQL  YPLVEK +GP+
Sbjct  240   SLHDMAYTEIFSLWTVSPRKFGGLSYSTVDVGEVLSISGFGLLVFQLSLYPLVEKYVGPI  299

Query  1271  MISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQ  1450
             +I+R+   LSIP+L++YPYIA+LSG+ LSV +N AS++KN LS+SI TGL ILQN+AV Q
Sbjct  300   VIARVAGVLSIPVLTSYPYIAMLSGIALSVAINFASVIKNALSISIITGLFILQNKAVDQ  359

Query  1451  EQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglI  1630
              QRGAANGI+M+AMS+FK IGPA  G L SW+Q R DA  +PGDQ+VFFVLNV E +G++
Sbjct  360   RQRGAANGIAMTAMSIFKAIGPAGAGVLFSWAQKRLDASILPGDQVVFFVLNVIEAIGVL  419

Query  1631  MTFKPFL  1651
             +TFKPFL
Sbjct  420   LTFKPFL  426



>ref|XP_002871583.1| hypothetical protein ARALYDRAFT_488196 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47842.1| hypothetical protein ARALYDRAFT_488196 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/490 (59%), Positives = 365/490 (74%), Gaps = 24/490 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE  TE LL+               + E C GC+V+ +KR   G P+  +F + ++ LC
Sbjct  1     MAEEYTECLLENK-------------FHEDCPGCKVDQMKRLRRGFPLWELFTVWIIVLC  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              ALPISSLFPFLYFMI DF+IA++EEDI +YAG+VG SFMLGRA TSV+WG++ADRYGRK
Sbjct  48    TALPISSLFPFLYFMIDDFNIAKKEEDIGFYAGFVGCSFMLGRAFTSVIWGLVADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV++IGT +VV+FN +FGLS+N+WMAIITRF LG+  G++G ++AYA EI R EY  L +
Sbjct  108   PVILIGTASVVVFNTLFGLSLNFWMAIITRFCLGSFNGLLGPIKAYAMEIFRDEYQGLAL  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             SAVSTAWGIGL+IGPA+GG+ AQPA +YP++FS +S FGKFP+FLPC  IS+FA + T++
Sbjct  168   SAVSTAWGIGLIIGPAIGGFLAQPATQYPSLFSQDSIFGKFPFFLPCFAISVFAFLVTII  227

Query  926   SFWLPETMHThkkehkeehDVSQNSKQPEHEVPTSQK--------SLLKNWPLISSILVY  1081
             S W+PET+H        + D S ++ +     P S K        SLL NWPLISSI+VY
Sbjct  228   SLWIPETLHN---HKYVDDDDSFDALKYLSHDPESNKVVERNEKSSLLNNWPLISSIIVY  284

Query  1082  CVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVL  1261
             CVF LHD+AY EIFSLWA SPRK GGL Y+TADVG VLAI+G GLL+FQL  Y   E++L
Sbjct  285   CVFSLHDMAYTEIFSLWANSPRKYGGLGYSTADVGSVLAISGFGLLIFQLSLYSYAERLL  344

Query  1262  GPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRA  1441
             GP++++RI   L++ +LS YP IA LSGL L++ +N AS+ KNVLS S  TGL ILQN A
Sbjct  345   GPIIVTRISGILAMVILSCYPLIAKLSGLALTLAVNSASVAKNVLSTSAITGLFILQNNA  404

Query  1442  VSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfell  1621
             V Q+QRGAANGI+M+AMSLFK IGPAA G + SWS+ RQDA F PG Q+VFF+LNV   L
Sbjct  405   VRQDQRGAANGIAMTAMSLFKAIGPAAAGIIFSWSEKRQDAAFFPGTQMVFFILNVVLAL  464

Query  1622  glIMTFKPFL  1651
             G++MTFKPFL
Sbjct  465   GVLMTFKPFL  474



>gb|KFK25600.1| hypothetical protein AALP_AA8G135600 [Arabis alpina]
Length=479

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/460 (62%), Positives = 362/460 (79%), Gaps = 4/460 (1%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y E C GC+V+  KR   G PI  +  + ++ LC ALPISSLFPFLYFMI DF IA++EE
Sbjct  14    YHEGCPGCKVDQTKRLRRGFPIWELCTVWIIVLCTALPISSLFPFLYFMIGDFDIAKKEE  73

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG+VG SFMLGRALTSV+WGI+ADRYGRKPV++IGT +VVIFN +FGLS+N+WMA
Sbjct  74    DIGFYAGFVGCSFMLGRALTSVIWGIVADRYGRKPVILIGTASVVIFNTLFGLSLNFWMA  133

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             IITRF LG+  G++G ++AYA EI R EY  L +SAVSTAWGIGL+IGPA+GG+ AQPA+
Sbjct  134   IITRFCLGSFNGLLGPIKAYAMEIFRDEYQGLALSAVSTAWGIGLIIGPALGGFLAQPAK  193

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQN-S  1000
             +YP +FS +S FG+FPYFLPC  IS+FA + T++S  +PET+H HK +  E  D  +  S
Sbjct  194   QYPNLFSEDSIFGRFPYFLPCFAISVFAFLVTLISLRIPETLHNHKFDDDESLDALKALS  253

Query  1001  KQPEHEVPT---SQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYT  1171
               PE    T    + SLLKNWPLISSI+VYC+F LHD+AY EIFSLWA SPRK GGL Y+
Sbjct  254   HDPESHKATERNEESSLLKNWPLISSIIVYCIFSLHDMAYTEIFSLWANSPRKYGGLGYS  313

Query  1172  TADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLC  1351
             ++DVG VLAI+G+GLL+FQL  Y  VE++LGPV+++RI  +L++ +L+ YP IA L+G  
Sbjct  314   SSDVGSVLAISGVGLLIFQLSLYSYVERLLGPVIVTRISGSLALVILACYPLIAKLTGFA  373

Query  1352  LSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGS  1531
             L++ LN AS+ KNVLSVS  TGL ILQN+AV Q+QRGAANGI+M+AMS+FK IGPAA G 
Sbjct  374   LTLTLNSASVAKNVLSVSAITGLFILQNKAVRQDQRGAANGIAMTAMSMFKAIGPAAAGI  433

Query  1532  LLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             + SWS+ RQDA F+PG Q+VFF+LNV   LG++MTFKPFL
Sbjct  434   IFSWSEKRQDASFLPGTQMVFFILNVVLALGVVMTFKPFL  473



>emb|CDY65960.1| BnaA10g29800D [Brassica napus]
Length=471

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/461 (61%), Positives = 354/461 (77%), Gaps = 13/461 (3%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             + E+C GC+V+ +KR   G P   +  + ++ LC ALPISSLFPFLYFMI DF+IA++EE
Sbjct  14    FHENCPGCKVDQMKRLRRGFPFSELLTVWLIVLCTALPISSLFPFLYFMIGDFNIAKKEE  73

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG+VG SFMLGR LTSV+ GI+ADRYGRKPV++IGT +VVIFN +FGLSVN+WMA
Sbjct  74    DIGFYAGFVGCSFMLGRTLTSVICGIVADRYGRKPVILIGTASVVIFNTLFGLSVNFWMA  133

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             IITRF LG+  G++G ++AYA E  R EY  L +SAVSTAWGIGL+IGPA+GG+ AQPA+
Sbjct  134   IITRFCLGSFNGLLGPIKAYAMETFRDEYQGLALSAVSTAWGIGLIIGPAMGGFLAQPAK  193

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             +YP++FS ES FGKFPY LPCL IS FAL+ T++S  +PET+H         H +  ++ 
Sbjct  194   QYPSLFSEESVFGKFPYLLPCLAISCFALLVTIISLRIPETLHN--------HKIDDDAP  245

Query  1004  QPEHEVPTS-----QKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSY  1168
              P+     S     + SLLKNWPLISSI+VYC+F LHD+AY EIFSLWA SPRK GGL Y
Sbjct  246   SPDESFDASKLLNEKTSLLKNWPLISSIIVYCIFSLHDMAYTEIFSLWANSPRKYGGLGY  305

Query  1169  TTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGL  1348
             ++ADVG VLA +G GLL+FQL  Y   E++LGP M++RI  +L++ LLSTYP IA LSGL
Sbjct  306   SSADVGSVLAFSGFGLLIFQLSLYSYAERLLGPTMVTRISGSLALVLLSTYPLIAKLSGL  365

Query  1349  CLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGG  1528
              L++ LNCAS+ KNVL+ S  TGL ILQNRAV Q+QRGAANGI+M+ MSLFK IGPAA G
Sbjct  366   ALTLALNCASVAKNVLATSAITGLFILQNRAVRQDQRGAANGIAMTGMSLFKAIGPAAAG  425

Query  1529  SLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
              + SWS+ RQDA F+PG Q+VFF+L     LG++MTFKPFL
Sbjct  426   IIYSWSEKRQDAAFLPGTQMVFFILGTVLALGVVMTFKPFL  466



>gb|KEH19210.1| zinc induced facilitator-like protein [Medicago truncatula]
Length=480

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/478 (59%), Positives = 358/478 (75%), Gaps = 15/478 (3%)
 Frame = +2

Query  224   EPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPIS  403
             EPLL++ +            Y E C GC+VE  K  + G+ + ++  I M+ L A LP S
Sbjct  4     EPLLEKKQ------------YYEDCPGCKVEQTKELNQGLSMINLVIIWMIVLSATLPAS  51

Query  404   SLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviig  583
             SLFPFLYFM+RDF++A+ E DISYYAGYVGSSFMLGR LTSVLWG+++DRYGRKPV+I+G
Sbjct  52    SLFPFLYFMVRDFNVAKEEADISYYAGYVGSSFMLGRCLTSVLWGMVSDRYGRKPVIIMG  111

Query  584   tvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTA  763
              + VVIFN +FGLS  YWMAIITRFLLG+L G++G ++AYASE+ R E+ A+G+S VS A
Sbjct  112   IIAVVIFNTLFGLSTGYWMAIITRFLLGSLNGVLGPVKAYASELFREEHQAIGLSTVSAA  171

Query  764   WGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPE  943
             WG+GL+IGPA+GGY AQP EKYP IF  +SF+ KFPYFLPC IIS+ A    +   W+PE
Sbjct  172   WGVGLIIGPAIGGYLAQPVEKYPQIFPKDSFWDKFPYFLPCFIISVLAFTVVIACIWIPE  231

Query  944   TMHThkkehkeehDVS--QNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLE  1117
             T+H H    +   D    +N    E  V    ++L  NWPL+SSI+VYCVF LHDIAY E
Sbjct  232   TLHNHNGNKESTDDAEALENGSNKEKTV-RKNENLFMNWPLMSSIIVYCVFSLHDIAYHE  290

Query  1118  IFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAAL  1297
             +FSLWA SP KLGGL++TT DVG VL+I+G+ L ++QLF YP VEK  GP+ + RI    
Sbjct  291   VFSLWATSPPKLGGLNFTTDDVGNVLSISGVALCIYQLFIYPSVEKACGPIGLGRITGIF  350

Query  1298  SIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGI  1477
             SIPLL +YP+IA+LSG+ L +V++ AS+LKN++SV+ITTGL ++QNR V Q QRGAANG+
Sbjct  351   SIPLLQSYPFIAMLSGITLYIVISIASVLKNIMSVTITTGLFLIQNRVVEQHQRGAANGL  410

Query  1478  SMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             SM+ MSLFK IGPAAGG++L+WSQ R DA F+PG Q+VFF LN+ E LG+I+ FKPFL
Sbjct  411   SMTGMSLFKAIGPAAGGTILTWSQKRMDASFLPGTQMVFFFLNLVEGLGIILLFKPFL  468



>ref|XP_004230052.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1 [Solanum lycopersicum]
Length=484

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/486 (60%), Positives = 369/486 (76%), Gaps = 16/486 (3%)
 Frame = +2

Query  209   AEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCA  388
             +E   E LL + E+           Y E+C GC+++L K    G+P+K +F I +V L  
Sbjct  3     SEERRETLLNKREEK---------HYYENCPGCKMDLHKAGQTGLPVKELFTIWVVVLGT  53

Query  389   ALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKP  568
             ALPISSLFPFLYFM+RDFHIA+REEDI  YAGY+GS+FM GR LTS  WG++AD+YGRKP
Sbjct  54    ALPISSLFPFLYFMVRDFHIAKREEDIGSYAGYIGSAFMFGRTLTSAFWGVVADQYGRKP  113

Query  569   vviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGIS  748
             V+I GT  V+IFN  FGLS N+WMA++TRFLLG+L G++G ++AYA+EI R EY ALG+S
Sbjct  114   VIIFGTSIVIIFNTFFGLSANFWMAVVTRFLLGSLNGLLGPIKAYAAEIFREEYQALGMS  173

Query  749   AVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMS  928
              +S+AWGIGL+IGPA+GG+ AQPAEKYP +FS  S FG+FPYFLPCL IS+FALV  V S
Sbjct  174   TISSAWGIGLIIGPALGGFLAQPAEKYPDLFSKGSLFGRFPYFLPCLCISVFALVVAVGS  233

Query  929   FWLPETMHThkke-----hkeehDVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQ  1093
             FW+PET+H H  E       +  + + ++K      P  +++L KNWPL+SSI+ YCVF 
Sbjct  234   FWIPETLHNHDSERPRPDSYKALEAASDTKDGNESAP--KENLFKNWPLMSSIISYCVFA  291

Query  1094  LHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVM  1273
             LHD+AY EIFSLWAVSPRK GGLSY+TADVG+VL+I+G GLL+FQL  Y  V K +GPVM
Sbjct  292   LHDMAYSEIFSLWAVSPRKFGGLSYSTADVGEVLSISGFGLLVFQLTLYSSVAKYIGPVM  351

Query  1274  ISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQE  1453
              +R G  LSI LL+TYPYIA+LSG  LSVV+N  SM+KN+LS+SI TGL ILQN+AV Q 
Sbjct  352   TARAGGVLSIVLLTTYPYIAMLSGTTLSVVMNVVSMMKNILSISIITGLFILQNKAVDQR  411

Query  1454  QRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIM  1633
             QRGAANG++M+ MS FK +GPA GG+L SW+Q R  A  +PG+ +VFFVLN+ E +G+++
Sbjct  412   QRGAANGLAMTGMSFFKALGPAGGGALFSWAQKRLHASILPGNHVVFFVLNMIEAIGVLL  471

Query  1634  TFKPFL  1651
             TFKPFL
Sbjct  472   TFKPFL  477



>ref|XP_010419980.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Camelina 
sativa]
Length=476

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/457 (61%), Positives = 359/457 (79%), Gaps = 1/457 (0%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y + C GC+V+ +KR   G P   +F + ++ LC ALPISSLFPFLYF+I DF IA +EE
Sbjct  15    YHDGCPGCKVDQMKRLRRGFPFWELFSVWIIVLCTALPISSLFPFLYFLIDDFGIANKEE  74

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG+VG SFMLGRALTSV+WG++ADRYGRKPV++IGT +VV+FN +FGLS+N+WMA
Sbjct  75    DIGFYAGFVGCSFMLGRALTSVIWGLVADRYGRKPVILIGTASVVVFNTLFGLSLNFWMA  134

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             IITRF LG+  G++G ++AYA EI R EY  L +SAVSTAWGIGL+IGPA+GG+ AQPA+
Sbjct  135   IITRFCLGSFNGLLGPIKAYAMEIFRDEYQGLALSAVSTAWGIGLIIGPAIGGFLAQPAK  194

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             +YP++FS +S FGKFPYFLPC  IS+FA + T++S W+PET+H HK +  +  D  ++  
Sbjct  195   QYPSLFSQDSIFGKFPYFLPCFAISIFAFLVTIISLWIPETLHNHKFDDDQPFDAVKDDP  254

Query  1004  QPEHEVPTSQK-SLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTAD  1180
             +       ++K SLL NWPL+SSI+VYC+  LHD+AY EIFSLWA SPRK GGL YTTAD
Sbjct  255   ESNKVAEKNEKSSLLNNWPLVSSIIVYCILSLHDMAYSEIFSLWANSPRKYGGLGYTTAD  314

Query  1181  VGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSV  1360
             VG VLAI+G GLL+FQL  Y   E+ LGP++++RI  +L++ +LSTYP IA LSG+ L++
Sbjct  315   VGSVLAISGFGLLIFQLSLYSYAERNLGPIIVTRISGSLALVVLSTYPLIAKLSGVALTL  374

Query  1361  VLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLS  1540
              +N AS+ KNVLS S  TGL ILQN+AV Q+QRGAANGI+M+AMS FK +GPAA G + S
Sbjct  375   TVNSASVAKNVLSTSAITGLFILQNKAVRQDQRGAANGIAMTAMSFFKAVGPAAAGIIFS  434

Query  1541  WSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             WS+ RQ+A F+PG Q+VFF+LNV   LG++MTFKPFL
Sbjct  435   WSEKRQNAYFLPGTQMVFFILNVVLALGVLMTFKPFL  471



>ref|XP_009121731.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1 isoform X1 
[Brassica rapa]
Length=483

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/465 (62%), Positives = 356/465 (77%), Gaps = 9/465 (2%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             + E+C GC+V+ +KR   G P   +  + ++ LC ALPISSLFPFLYFMI DF+IA +EE
Sbjct  14    FHENCPGCKVDQMKRLRRGFPFSELLTVWLIVLCTALPISSLFPFLYFMIGDFNIATKEE  73

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG+VG SFMLGR LTSV+WGI+ADRYGRKPV++IGT +VVIFN +FGLSVN+WMA
Sbjct  74    DIGFYAGFVGCSFMLGRTLTSVIWGIVADRYGRKPVILIGTASVVIFNTLFGLSVNFWMA  133

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             IITRF LG+  G++G ++AYA E  R EY  L +SAVSTAWGIGL+IGPA+GG+ AQPA+
Sbjct  134   IITRFCLGSFNGLLGPIKAYAMETFRDEYQGLALSAVSTAWGIGLIIGPAMGGFLAQPAK  193

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehke-ehDVSQNS  1000
             +YP++FS ES FGKFPY LPCL IS FAL+ T++S  +PET+H HK +      D S ++
Sbjct  194   QYPSLFSEESVFGKFPYLLPCLAISCFALLVTIISLRIPETLHNHKIDDDAPSPDESFDA  253

Query  1001  KQPEHEVPTSQK--------SLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLG  1156
              +     P S K        SLLKNWPLISSI+VYC+F LHD+AY EIFSLWA SP K G
Sbjct  254   SKLLSHDPESHKAIERNEKTSLLKNWPLISSIIVYCIFSLHDMAYTEIFSLWANSPTKYG  313

Query  1157  GLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIAL  1336
             GL Y++ADVG VLA +G GLL+FQL  Y   E++LGP M++RI  +L++ LLSTYP IA 
Sbjct  314   GLGYSSADVGSVLAFSGFGLLIFQLSLYSYAERLLGPTMVTRISGSLALVLLSTYPLIAK  373

Query  1337  LSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGP  1516
             LSGL L++ LNCAS+ KNVL+ S  TGL ILQNRAV Q+QRGAANGI+M+ MSLFK IGP
Sbjct  374   LSGLALTLALNCASVAKNVLATSAITGLFILQNRAVRQDQRGAANGIAMTGMSLFKAIGP  433

Query  1517  AAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             AA G + SWS+ RQDA F+PG Q+VFF+L     LG++MTFKPFL
Sbjct  434   AAAGIIYSWSEKRQDAAFLPGTQMVFFILGTVLALGVVMTFKPFL  478



>ref|XP_008777370.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Phoenix dactylifera]
Length=483

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/480 (60%), Positives = 365/480 (76%), Gaps = 17/480 (4%)
 Frame = +2

Query  263   LEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDF  442
             LE  YF   E+C GC+ E  K A+ G+P K   F+ MVTLC ALPIS LFPFLYFMIRD 
Sbjct  9     LEKVYF---ENCPGCKQEKKKDANPGIPYKEFAFVWMVTLCTALPISILFPFLYFMIRDL  65

Query  443   HIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGL  622
             HIA+REEDI +YAG+VG+SFM GRALTSV WG++ADRYGRKPV+ IG   VVIFN +FGL
Sbjct  66    HIAKREEDIGFYAGFVGASFMFGRALTSVFWGLVADRYGRKPVIAIGICAVVIFNTLFGL  125

Query  623   SVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGG  802
             S  YWMAI TR LLG+L G++G ++AY+ E+CR E+ ALG+S VSTAWGIGL+IGPA+GG
Sbjct  126   STTYWMAITTRLLLGSLNGLLGPIKAYSIEVCRAEHQALGLSLVSTAWGIGLIIGPAIGG  185

Query  803   YFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeeh  982
             +FAQPAEKYP IFS +SFFG+FPYFLPC  IS+FA+   ++  WLPET+H H     ++ 
Sbjct  186   FFAQPAEKYPDIFSQDSFFGRFPYFLPCFCISLFAVGVLILCIWLPETLHMHIVNKMQDG  245

Query  983   DV------------SQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFS  1126
              +             +N+ + E   PT  ++L KNWPL+SSI+VYCVF LHD+AY EIFS
Sbjct  246   TIEFLEAPSRGSGLKENANESEERAPT--ENLFKNWPLMSSIIVYCVFSLHDMAYTEIFS  303

Query  1127  LWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIP  1306
             LWAVS +  GGLS+++ DVG+VLAI+G  LL++QLF YP + K+LGP++ SR+ + LSIP
Sbjct  304   LWAVSDKSYGGLSFSSQDVGEVLAISGFSLLVYQLFLYPSLVKLLGPIISSRVASVLSIP  363

Query  1307  LLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMS  1486
             LL+ +P++  LSGL LS++ NCAS+LKN+L V+I TGL ILQN AV Q QRGAANGI+M+
Sbjct  364   LLAAFPFMTKLSGLRLSLIANCASLLKNILCVTIITGLFILQNNAVPQHQRGAANGIAMT  423

Query  1487  AMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPED  1666
              MSLFK   PA GG L SW+Q RQ A F+PGDQ+VFF+LNV E +GL+MTFKPFL +P  
Sbjct  424   GMSLFKAAAPAGGGILFSWAQKRQSASFLPGDQMVFFILNVVEFIGLLMTFKPFLAVPNK  483



>ref|XP_010453471.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Camelina 
sativa]
Length=476

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/469 (60%), Positives = 360/469 (77%), Gaps = 7/469 (1%)
 Frame = +2

Query  266   EDEY------FCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYF  427
             E EY      F Y E C GC V+ +KR   G P   +F + ++ LC+ LPISSLFPF+YF
Sbjct  3     EQEYTECLLGFKYHEGCPGCEVDQMKRLRRGYPFWELFSVWIIVLCSTLPISSLFPFVYF  62

Query  428   MIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFN  607
             MI DF IA++EEDI +YAG+VG SFM+GRALTSV+WG++ADRYGRKPV++IGT +VV+FN
Sbjct  63    MIDDFDIAKKEEDIGFYAGFVGCSFMVGRALTSVIWGLVADRYGRKPVILIGTASVVVFN  122

Query  608   AVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIG  787
              +FGLS+N+WMA+ITRF LG+  G++G ++AYA E  R EY  L +SAVSTAWGIGL+IG
Sbjct  123   TLFGLSLNFWMAVITRFCLGSFNGLVGPIKAYAVETFRDEYQGLALSAVSTAWGIGLIIG  182

Query  788   PAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkke  967
             PA+GG+ AQPA +YP++FS +S FGKFPYFLPC +IS FA + T+ S W+PET+H HK +
Sbjct  183   PAIGGFLAQPATQYPSLFSQDSIFGKFPYFLPCFVISFFAFLVTIFSLWIPETLHNHKFD  242

Query  968   hkeehDVSQNSKQPEHEVPTSQK-SLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSP  1144
               +  D  ++  +       ++K SLLKNWPL+SSI+VYC+F LH++AY EIFSLWA SP
Sbjct  243   DDQSFDAVKDDPESNKVAEKNEKSSLLKNWPLMSSIIVYCIFSLHNMAYSEIFSLWANSP  302

Query  1145  RKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYP  1324
             RK GGL+YTTADVG VLAI+G GLL+FQL  Y   E+ LGP++++RI   L++ +LSTYP
Sbjct  303   RKFGGLAYTTADVGSVLAISGFGLLVFQLALYSYAERNLGPIIVTRICGILALVVLSTYP  362

Query  1325  YIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFK  1504
              IA LSG+ L+V +N AS+ KNV S S  TG  ILQNRAV Q+QRGAANGI+M+AMS+ K
Sbjct  363   LIAKLSGVALTVAVNSASVAKNVFSSSTITGTFILQNRAVRQDQRGAANGIAMTAMSICK  422

Query  1505  TIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
              IGPAA G + SWS+ RQDA F+PG Q+VFF+LNV   LG++MTFKPFL
Sbjct  423   AIGPAAAGIIFSWSEKRQDASFLPGTQMVFFILNVVLALGVLMTFKPFL  471



>ref|XP_009776346.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X3 [Nicotiana sylvestris]
Length=417

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/413 (67%), Positives = 347/413 (84%), Gaps = 7/413 (2%)
 Frame = +2

Query  428   MIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFN  607
             MIRDFHIA+REEDISYYAGYVGSS+MLGRALTSV WG++ADRYGRKPV+I GT  VVIFN
Sbjct  1     MIRDFHIAKREEDISYYAGYVGSSYMLGRALTSVFWGLVADRYGRKPVIIFGTFVVVIFN  60

Query  608   AVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIG  787
              +FGLSVN+WMAIITRFLLG+L G+IG ++AYA+EI R EY ALG+S +STAWGIGL+IG
Sbjct  61    TLFGLSVNFWMAIITRFLLGSLNGLIGPIKAYAAEIFREEYQALGMSTISTAWGIGLIIG  120

Query  788   PAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkke  967
             PA+GG+ AQPAEKYP+IF+ +S FG+FPYFLPCLIIS+F+LV  + SFWLPET+H H+  
Sbjct  121   PALGGFLAQPAEKYPSIFAKDSIFGRFPYFLPCLIISLFSLVVAIASFWLPETLHIHESS  180

Query  968   h-----keehDVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLW  1132
                    E  + + ++K+     P  +++L KNWPL+SSI++YCVF LHD+AY EIFSLW
Sbjct  181   VPPQDSYEALEAAPDTKEGNESAP--KENLFKNWPLMSSIILYCVFSLHDMAYNEIFSLW  238

Query  1133  AVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLL  1312
             AVSPRK GGLSY+TADVG+VL+I+G GLL+FQL  YPLVE+ +GP++ +R+   LSIPLL
Sbjct  239   AVSPRKFGGLSYSTADVGEVLSISGFGLLVFQLTLYPLVERYVGPIIAARVAGVLSIPLL  298

Query  1313  STYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAM  1492
             ++YPYIA+LSG+ LS+ +N AS++KN LS+SI TGL ILQN+AV+Q QRGAANGI+M+AM
Sbjct  299   TSYPYIAMLSGIALSLAINFASVMKNALSISIITGLFILQNKAVNQRQRGAANGIAMTAM  358

Query  1493  SLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             S+FK +GPA GG+L SW+Q R DA  +PGDQ+VFFVLNV E +G++MTFKPFL
Sbjct  359   SIFKALGPAGGGALFSWAQKRLDASILPGDQVVFFVLNVIEAIGVLMTFKPFL  411



>ref|XP_008445955.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Cucumis 
melo]
Length=490

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/496 (56%), Positives = 365/496 (74%), Gaps = 25/496 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MA+ N E LLK         E++Y+ Y E+C GC++E   +   G P + +  IS + L 
Sbjct  1     MADENRERLLK---------EEDYYYY-ENCPGCKMEQYNQLHRGFPFRQLLMISFIVLI  50

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              ALPISS FPFLYFM+RDF+IAE  EDI +YAG++G+SFM+GRALTSV WGI+ADRYGRK
Sbjct  51    TALPISSFFPFLYFMVRDFNIAENVEDIGFYAGFIGASFMVGRALTSVFWGIVADRYGRK  110

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV++ G   V  FN +FGLS+NYWMAIITRFLLG+L GI+G ++AYASE    EY A+ +
Sbjct  111   PVILFGIFIVFTFNTLFGLSLNYWMAIITRFLLGSLNGILGPIKAYASESVNEEYQAIAM  170

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S++ST WGI L++GPA+GG+ AQP EK+P IFS+E  FG+FPYFLPCL  S+ AL+  ++
Sbjct  171   SSISTTWGIALIVGPAIGGFLAQPVEKFPGIFSSEGLFGRFPYFLPCLFTSLLALITGII  230

Query  926   SFWLPETMHThkkehkeehDVSQ---------NSKQP-----EHEVPTSQKSLLKNWPLI  1063
             S WLPE++H H K         +         N  +P       E+P S+ SL +NW L+
Sbjct  231   SLWLPESLHMHDKNVPSHSISYEALEDQPGDCNGNEPTLTTESKELP-SKPSLFRNWELM  289

Query  1064  SSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYP  1243
             S+I+VYCVF LHD+AY+EIFSLW VS R LGGLS+T+ DVG+VLAITG  LL+FQ   YP
Sbjct  290   SAIIVYCVFSLHDMAYVEIFSLWTVSSRTLGGLSFTSGDVGEVLAITGFSLLVFQSALYP  349

Query  1244  LVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLL  1423
              VE++ GP+M+SR+   LSIPLL+ YP++++ SG  L +V+  AS+LKN+LSVSI TGL 
Sbjct  350   YVERIFGPIMVSRVCGILSIPLLAMYPFLSVFSGAVLHIVVTLASVLKNLLSVSIITGLF  409

Query  1424  ILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvl  1603
             I+QNRAV Q QRGAANGI+M+ MS+FK IGPAAGG+LLSWSQ R DA F+PG  ++FF+L
Sbjct  410   IIQNRAVDQHQRGAANGIAMTGMSIFKAIGPAAGGALLSWSQKRLDAAFLPGPHMLFFIL  469

Query  1604  nvfellglIMTFKPFL  1651
             NV E++ ++MTFKPFL
Sbjct  470   NVIEVIAVVMTFKPFL  485



>ref|XP_010036424.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Eucalyptus grandis]
Length=483

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/469 (63%), Positives = 373/469 (80%), Gaps = 31/469 (7%)
 Frame = +2

Query  296   CAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREEDISY  475
             C GC +E LK  + GVP K  F++ ++ LCAALPISSLFPFLYFMIRDF IA+REEDI +
Sbjct  34    CPGCEIERLKETNRGVPYKLFFYVWIIVLCAALPISSLFPFLYFMIRDFKIAKREEDIGF  93

Query  476   YAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMAIITR  655
             YAGYVGS+FM GRALTSVLWG++ADRYGRKPV++ GTVTVV+FN +FGLS N+WMA+ TR
Sbjct  94    YAGYVGSAFMFGRALTSVLWGMLADRYGRKPVILFGTVTVVVFNTLFGLSTNFWMAVSTR  153

Query  656   FLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAEKYPT  835
             FLLG+LCGI+G MR                  +ST+WGIGLVIGPA+GGY AQPAEK+P 
Sbjct  154   FLLGSLCGILGPMR------------------ISTSWGIGLVIGPAIGGYLAQPAEKFPN  195

Query  836   IFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHT------------hkkehkee  979
             +FS +S FG+FPYFLPCL+IS+F+L   V++ WLPE++H                E +E 
Sbjct  196   VFSEKSIFGRFPYFLPCLLISVFSLGVMVVACWLPESLHRHGESSEECDIPYEALEAEEN  255

Query  980   hDVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGG  1159
               +   S++ E    TS  SLL+NWPL+SSI+VYCVFQLHD+AY EIFSLWA+SP K GG
Sbjct  256   KTLKDESQRNEKSCQTSW-SLLRNWPLMSSIIVYCVFQLHDMAYTEIFSLWAISPWKFGG  314

Query  1160  LSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALL  1339
             LSY+TADVG+VLA++G GLLLFQLF YP VE++ GP+++SR+GAALSI LLS+YP+IA L
Sbjct  315   LSYSTADVGEVLALSGFGLLLFQLFLYPRVERICGPIVVSRVGAALSIILLSSYPFIAKL  374

Query  1340  SGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPA  1519
             +G+ L+++++ AS+LKNVL+VSITTGL +LQNRAV+QEQRGAANG+S+SAMSLFK +GPA
Sbjct  375   TGIILTILVDSASILKNVLAVSITTGLFLLQNRAVTQEQRGAANGLSLSAMSLFKAMGPA  434

Query  1520  AGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPED  1666
             AGGS+ SW+Q RQ+A F+PG+ +VFF+LNV E LGL+MTFKPFL  P+D
Sbjct  435   AGGSIFSWAQKRQNASFLPGNHMVFFILNVIEALGLLMTFKPFLTQPKD  483



>ref|XP_010036425.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X3 [Eucalyptus grandis]
Length=457

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/425 (66%), Positives = 352/425 (83%), Gaps = 13/425 (3%)
 Frame = +2

Query  296   CAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREEDISY  475
             C GC +E LK  + GVP K  F++ ++ LCAALPISSLFPFLYFMIRDF IA+REEDI +
Sbjct  34    CPGCEIERLKETNRGVPYKLFFYVWIIVLCAALPISSLFPFLYFMIRDFKIAKREEDIGF  93

Query  476   YAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMAIITR  655
             YAGYVGS+FM GRALTSVLWG++ADRYGRKPV++ GTVTVV+FN +FGLS N+WMA+ TR
Sbjct  94    YAGYVGSAFMFGRALTSVLWGMLADRYGRKPVILFGTVTVVVFNTLFGLSTNFWMAVSTR  153

Query  656   FLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAEKYPT  835
             FLLG+LCGI+G MRAYASE+CR+EY AL +S +ST+WGIGLVIGPA+GGY AQPAEK+P 
Sbjct  154   FLLGSLCGILGPMRAYASEVCRKEYQALAMSIISTSWGIGLVIGPAIGGYLAQPAEKFPN  213

Query  836   IFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHT------------hkkehkee  979
             +FS +S FG+FPYFLPCL+IS+F+L   V++ WLPE++H                E +E 
Sbjct  214   VFSEKSIFGRFPYFLPCLLISVFSLGVMVVACWLPESLHRHGESSEECDIPYEALEAEEN  273

Query  980   hDVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGG  1159
               +   S++ E    TS  SLL+NWPL+SSI+VYCVFQLHD+AY EIFSLWA+SP K GG
Sbjct  274   KTLKDESQRNEKSCQTSW-SLLRNWPLMSSIIVYCVFQLHDMAYTEIFSLWAISPWKFGG  332

Query  1160  LSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALL  1339
             LSY+TADVG+VLA++G GLLLFQLF YP VE++ GP+++SR+GAALSI LLS+YP+IA L
Sbjct  333   LSYSTADVGEVLALSGFGLLLFQLFLYPRVERICGPIVVSRVGAALSIILLSSYPFIAKL  392

Query  1340  SGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPA  1519
             +G+ L+++++ AS+LKNVL+VSITTGL +LQNRAV+QEQRGAANG+S+SAMSLFK +GPA
Sbjct  393   TGIILTILVDSASILKNVLAVSITTGLFLLQNRAVTQEQRGAANGLSLSAMSLFKAMGPA  452

Query  1520  AGGSL  1534
             AGGS+
Sbjct  453   AGGSM  457



>ref|XP_008777369.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Phoenix dactylifera]
Length=484

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/499 (59%), Positives = 369/499 (74%), Gaps = 27/499 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE N  PLL            E   Y ESC GC++E  K    G+P K   ++ +VTLC
Sbjct  1     MAE-NRAPLL------------ERMMYYESCPGCKLERRKEERRGIPYKEFLYVWIVTLC  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              ALPIS LFPFLYFMIRD HIA+REEDI +YAG+VG+SFM GRALTSV WG++ADRYGRK
Sbjct  48    TALPISILFPFLYFMIRDLHIAKREEDIGFYAGFVGASFMFGRALTSVFWGLVADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV+ IG   VVIFN +FGLS  YWMAI TR LLG+L G++G ++AY+ E+CR E+ ALG+
Sbjct  108   PVIAIGICAVVIFNTLFGLSTTYWMAITTRLLLGSLNGLLGPIKAYSIEVCRAEHQALGL  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S VSTAWGIGL+IGPA+GG+FAQPAEKYP IFS +SFFG+FPYFLPC  IS+FA+   ++
Sbjct  168   SLVSTAWGIGLIIGPAIGGFFAQPAEKYPDIFSQDSFFGRFPYFLPCFCISLFAVGVLIL  227

Query  926   SFWLPETMHThkkehkeehDV------------SQNSKQPEHEVPTSQKSLLKNWPLISS  1069
               WLPET+H H     ++  +             +N+ + E   PT  ++L KNWPL+SS
Sbjct  228   CIWLPETLHMHIVNKMQDGTIEFLEAPSRGSGLKENANESEERAPT--ENLFKNWPLMSS  285

Query  1070  ILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLV  1249
             I+VYCVF LHD+AY EIFSLWAVS +  GGLS+++ DVG+VLAI+G  LL++QLF YP +
Sbjct  286   IIVYCVFSLHDMAYTEIFSLWAVSDKSYGGLSFSSQDVGEVLAISGFSLLVYQLFLYPSL  345

Query  1250  EKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLIL  1429
              K+LGP++ SR+ + LSIPLL+ +P++  LSGL LS++ NCAS+LKN+L V+I TGL IL
Sbjct  346   VKLLGPIISSRVASVLSIPLLAAFPFMTKLSGLRLSLIANCASLLKNILCVTIITGLFIL  405

Query  1430  QNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnv  1609
             QN AV Q QRGAANGI+M+ MSLFK   PA GG L SW+Q RQ A F+PGDQ+VFF+LNV
Sbjct  406   QNNAVPQHQRGAANGIAMTGMSLFKAAAPAGGGILFSWAQKRQSASFLPGDQMVFFILNV  465

Query  1610  fellglIMTFKPFLQLPED  1666
              E +GL+MTFKPFL +P  
Sbjct  466   VEFIGLLMTFKPFLAVPNK  484



>ref|XP_003542783.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Glycine max]
 ref|XP_006594341.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Glycine max]
 gb|KHN10322.1| Protein ZINC INDUCED FACILITATOR-LIKE 1 [Glycine soja]
Length=488

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/489 (60%), Positives = 366/489 (75%), Gaps = 20/489 (4%)
 Frame = +2

Query  206   MAEGN-TEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKR--ADAGVPIKHVFFISMV  376
             MAE N  +PLL++              Y E C GC+V+  K      GV I+++  I MV
Sbjct  1     MAEENIRQPLLEKK-------------YYEDCPGCKVDQAKELSKGQGVSIRNLLIIWMV  47

Query  377   TLCAALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRY  556
              LC+ALPISSLFPFLYFM+RDF+IA+ E DIS YAGYVGSS+MLGR LTSVLWGI+ADRY
Sbjct  48    VLCSALPISSLFPFLYFMVRDFNIAKTEADISSYAGYVGSSYMLGRCLTSVLWGIVADRY  107

Query  557   GRKPvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHA  736
             GRKPV++IG ++VV+FN +FGLS ++WMA I RFLLG+  G++GT++AYA+E+ R E+ A
Sbjct  108   GRKPVIVIGIISVVLFNTLFGLSTSFWMAFIMRFLLGSFHGLLGTVKAYATELFREEHQA  167

Query  737   LGISAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVA  916
             LG+S VS  WGIGL+IGPA+GGY AQPAEKYP IF  +SF+ KFPYFLPC IIS  A V 
Sbjct  168   LGLSTVSAVWGIGLIIGPALGGYLAQPAEKYPDIFPKDSFWDKFPYFLPCFIISAAAFVV  227

Query  917   TVMSFWLPETMHThkkehkeehDVS--QNSKQPEHEVPTSQK--SLLKNWPLISSILVYC  1084
              +   W+PET+H H   ++   +    +N         T QK  +LL+NWPL+SSIL YC
Sbjct  228   AIGCIWIPETLHNHNSNNESIDNSEALENGSSGASNEKTIQKNENLLRNWPLMSSILSYC  287

Query  1085  VFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLG  1264
             VF LHDIAY E+FSLW+VSP++LGGL++TT DVG VL+I+G+ L+ +QL  Y  VEK  G
Sbjct  288   VFSLHDIAYQEVFSLWSVSPQRLGGLNFTTNDVGNVLSISGLALITYQLTIYQSVEKASG  347

Query  1265  PVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAV  1444
             P+ I+RI A LSIPLL +YP+IALLSGL L +VL+ AS+LKN+LS++I TGL ILQNRAV
Sbjct  348   PISIARISAMLSIPLLQSYPFIALLSGLALYIVLSIASILKNILSITIVTGLFILQNRAV  407

Query  1445  SQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellg  1624
              Q QRGAANGI+M+ MSLFK IGPAAGG+LL+WS+ R DA F+PG  +VFF LN+ E  G
Sbjct  408   EQHQRGAANGIAMTGMSLFKAIGPAAGGALLTWSEKRMDASFLPGTHMVFFALNIVEGFG  467

Query  1625  lIMTFKPFL  1651
             L+M FKPFL
Sbjct  468   LLMLFKPFL  476



>emb|CDP18958.1| unnamed protein product [Coffea canephora]
Length=490

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/466 (61%), Positives = 356/466 (76%), Gaps = 10/466 (2%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y E+C GC V+ +K    GVPIK +  +  + L AALPI+SL+PFLYFMIRDFHIA+REE
Sbjct  15    YHENCPGCVVDEMKERQEGVPIKKLLTMGTIVLSAALPIASLYPFLYFMIRDFHIAKREE  74

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI++YAGYVG+S+MLGR LTS+ WG++ADRYGRKPV+  G + V +FN +FGLS+N+WMA
Sbjct  75    DINFYAGYVGASYMLGRTLTSIFWGVVADRYGRKPVIFTGVIAVFVFNTLFGLSLNFWMA  134

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TRFLLGAL G++G M+AYASEI   +Y A+ +S++S +W IGL+ GPA+GG+ AQPAE
Sbjct  135   IGTRFLLGALNGLLGPMKAYASEIFHHKYQAVALSSISASWAIGLITGPALGGFLAQPAE  194

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMH----------Thkkehk  973
             KYP  FS  S FG+FPYFLPCL IS+FAL+  +  FWLPET+H          ++     
Sbjct  195   KYPATFSPNSIFGRFPYFLPCLCISLFALIGAICCFWLPETLHMHPCNSSPSESYDALEA  254

Query  974   eehDVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKL  1153
                  +  ++  +     S KSLLKNWPL+SSI+ YC+F LHD+AY EI SLWA SPRK 
Sbjct  255   ALPKFNGKTETKDGREAASAKSLLKNWPLMSSIIAYCIFSLHDMAYSEICSLWAESPRKF  314

Query  1154  GGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIA  1333
             GGLSY+T  VG++L ITG GLL+FQLF YP VEK+LGP+ I+RI   LSIPLL++YPYIA
Sbjct  315   GGLSYSTQSVGEILTITGCGLLVFQLFLYPFVEKMLGPINIARISGILSIPLLTSYPYIA  374

Query  1334  LLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIG  1513
             +L G+ L+VVLNCA +LK+VLS SI TGL ILQN AV Q QRGAANGI+M+AMSLFK +G
Sbjct  375   MLPGIALAVVLNCAILLKSVLSTSIITGLFILQNNAVEQHQRGAANGIAMTAMSLFKAVG  434

Query  1514  PAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             PA GG++LSW+Q RQ A F PG  LVFF+LNV E +G++MTFKPFL
Sbjct  435   PAGGGAILSWAQKRQHAAFFPGVHLVFFILNVIEAIGVLMTFKPFL  480



>ref|XP_009121733.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Brassica rapa]
Length=483

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/465 (62%), Positives = 358/465 (77%), Gaps = 9/465 (2%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             + E+C GC+V+ +KR   G P   +  + ++ L  ALP+SSLFPFLYFMI DF+IA++EE
Sbjct  14    FHENCPGCKVDQMKRLRRGFPFSELVTVWLIVLSTALPVSSLFPFLYFMIGDFNIAKKEE  73

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG+VG S MLGR LTSV+WGI+ADRYGRK V++IGT +VVIFN +FGLSVNYWMA
Sbjct  74    DIGFYAGFVGCSLMLGRTLTSVVWGIVADRYGRKRVILIGTASVVIFNTLFGLSVNYWMA  133

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             IITRF LG   G++G ++AYA E  R EY  L +SAVSTAWGIGL+IGPA+GG+ AQPA+
Sbjct  134   IITRFCLGCFNGLLGPIKAYAVETFRDEYQGLALSAVSTAWGIGLIIGPAMGGFLAQPAK  193

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehke-----ehDV  988
             +YP++FS ES FGKFPYFLPCL IS FAL+ T++S  +PET+H HK +          D 
Sbjct  194   QYPSLFSEESVFGKFPYFLPCLAISCFALLVTIISLRIPETLHNHKIDDDAPSPDESCDA  253

Query  989   SQ-NSKQPEHEVPTSQK---SLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLG  1156
             S+  S  PE    T +    SLLKNWPLISSI+VYC+F LHD+AY EIFSLWA SPRK G
Sbjct  254   SKLLSHDPESHKATERNERPSLLKNWPLISSIIVYCIFSLHDMAYTEIFSLWANSPRKYG  313

Query  1157  GLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIAL  1336
             GL Y++ADVG VLAI+G GLL+FQL  Y   E++LGP M++RI  +L++ LLSTYP IA 
Sbjct  314   GLGYSSADVGSVLAISGFGLLIFQLSLYSYAERLLGPTMVTRISGSLALVLLSTYPLIAK  373

Query  1337  LSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGP  1516
             LSGL L++ LNCAS+ KNVL+ S  TGL ILQNRAV Q+QRGAANGI+M+AMSLFK IGP
Sbjct  374   LSGLALTLALNCASVAKNVLATSAITGLFILQNRAVRQDQRGAANGIAMTAMSLFKAIGP  433

Query  1517  AAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             AA G + SWS+ R DA F+PG Q+VFF+LNV   LG++MTFKPFL
Sbjct  434   AAAGIIYSWSEKRLDAAFLPGTQMVFFILNVVLALGVVMTFKPFL  478



>gb|KDO47751.1| hypothetical protein CISIN_1g011424mg [Citrus sinensis]
Length=477

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/485 (62%), Positives = 373/485 (77%), Gaps = 13/485 (3%)
 Frame = +2

Query  212   EGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAA  391
             E   EP LK  ++           Y E+C GC+V+ LK   +G+PI  +F I ++ LC A
Sbjct  6     EKLREPFLKNEKR-----------YYENCPGCKVDQLKDTKSGLPITELFSIWIIVLCTA  54

Query  392   LPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPv  571
             LPISSLFPFLYFMI+DF IA+REEDI  YAGYVGSSFM GRALTSV WG++ADRYGRKPV
Sbjct  55    LPISSLFPFLYFMIKDFQIAKREEDIGSYAGYVGSSFMFGRALTSVFWGLVADRYGRKPV  114

Query  572   viigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISA  751
             +I+GT +VVIFN +FGLSVN+WMA++TRFLLG+L G++G ++AYA EI R E+ ALG+S 
Sbjct  115   IIMGTASVVIFNTLFGLSVNFWMAVLTRFLLGSLNGLLGPIKAYACEIFREEHQALGLST  174

Query  752   VSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSF  931
             VSTAWGIGL+IGPA+GG+ AQPAEKYP +FS+ES FGKFPYFLPCL IS+FA   T+   
Sbjct  175   VSTAWGIGLIIGPALGGFLAQPAEKYPNLFSSESLFGKFPYFLPCLCISLFAFGETLHRH  234

Query  932   WLPETMHThkkehkeehDVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAY  1111
                +   +    +      S   K+ E    T +KSLLKNWPL+SSI+VYCVF LHD+AY
Sbjct  235   --NDDDDSCDVSYDALESASAEVKEEEGREATPKKSLLKNWPLMSSIIVYCVFSLHDMAY  292

Query  1112  LEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGA  1291
              EIFSLWA SP+KLGGL+Y+T  VG+VLAITG  LL+FQL  YP +E++LGP+M++RI  
Sbjct  293   SEIFSLWANSPKKLGGLNYSTQMVGEVLAITGFSLLVFQLSLYPFLERILGPIMVARIAG  352

Query  1292  ALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAAN  1471
              L+IPLL++YPYIA+LSG  L+ +LNCAS++KN+LSVSI TGL ILQNRAV Q+QRGAAN
Sbjct  353   VLTIPLLTSYPYIAMLSGFGLAFLLNCASVVKNLLSVSIITGLFILQNRAVDQDQRGAAN  412

Query  1472  GISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             GI+M+ MSLFK  GPA GG+L SW+Q R DA F+PG Q+VFFVLNV E +G++MTFKPFL
Sbjct  413   GIAMTGMSLFKAAGPAGGGALFSWAQKRLDASFLPGSQMVFFVLNVVEAIGVLMTFKPFL  472

Query  1652  QLPED  1666
                 D
Sbjct  473   AQRHD  477



>gb|KEH19209.1| zinc induced facilitator-like protein [Medicago truncatula]
Length=487

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/484 (58%), Positives = 358/484 (74%), Gaps = 16/484 (3%)
 Frame = +2

Query  212   EGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAA  391
             E   EPLL++ +            Y + C GC+VE  K  + GV I ++  I MV LC+ 
Sbjct  4     ENMREPLLEKKQ------------YYKDCPGCKVEQAKELNKGVSITNLLVIWMVVLCST  51

Query  392   LPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPv  571
             LP SSLFPFLYFM+RDF IA+ E DISYYAGYVGSSFMLGR LTSVLWG+++DRYGRKPV
Sbjct  52    LPASSLFPFLYFMVRDFKIAKSEADISYYAGYVGSSFMLGRTLTSVLWGMVSDRYGRKPV  111

Query  572   viigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISA  751
             ++ G  TVV+ N +FGLS ++WMA+ITRFLLG L G IG ++AYA+E+ R E+ ALG+S 
Sbjct  112   IVFGVFTVVVLNTLFGLSTSFWMAVITRFLLGTLNGAIGPVKAYATELFREEHQALGLST  171

Query  752   VSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSF  931
             VS AWG GL+IGPA+GGY AQPAEKYP IF   SF+ KFPYFLPC IIS  + V  +   
Sbjct  172   VSAAWGTGLIIGPALGGYLAQPAEKYPNIFPKGSFWDKFPYFLPCFIISGVSFVVVIACL  231

Query  932   WLPETMHThkkehkeehD---VSQNSKQPEHE-VPTSQKSLLKNWPLISSILVYCVFQLH  1099
             W+PET+H H    +   D   +   SK+ + E +    ++LL NWP +SSI+ YCVF LH
Sbjct  232   WIPETLHKHNGSSESIDDAEAIENGSKKVDKEKIVQKNENLLMNWPFMSSIIAYCVFSLH  291

Query  1100  DIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMIS  1279
             DIAY E+FSLW+VSP  LGGL++TT DVG VLAITG+ L+++QL  Y  +EK  GPV IS
Sbjct  292   DIAYQEVFSLWSVSPLNLGGLNFTTDDVGNVLAITGLALVIYQLTIYQYMEKACGPVNIS  351

Query  1280  RIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQR  1459
             RI    SIP+L +YP+IA+LSG+ L +++  AS+LKN++SV+ITTGL ++QNRAV Q QR
Sbjct  352   RITGIFSIPVLQSYPFIAMLSGITLYIIICLASILKNIVSVTITTGLFLIQNRAVEQHQR  411

Query  1460  GAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTF  1639
             GAANGISM+AMSLFK IGPAAGG++L+WSQ R DA F+PG  +VFF LN+FE LG++M F
Sbjct  412   GAANGISMTAMSLFKAIGPAAGGTILTWSQKRMDASFLPGTHMVFFFLNLFEGLGILMMF  471

Query  1640  KPFL  1651
             KPFL
Sbjct  472   KPFL  475



>ref|XP_010547293.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Tarenaya 
hassleriana]
 ref|XP_010547294.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Tarenaya 
hassleriana]
Length=473

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/456 (61%), Positives = 357/456 (78%), Gaps = 0/456 (0%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y E C GC+VE +K    G P + +FF+ ++ L   LPISSL+PFLY+MI DF IA+ E+
Sbjct  14    YHEECPGCKVEQMKELRRGFPFRELFFVWIIVLSTCLPISSLYPFLYYMIEDFDIAKTEK  73

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG+VG +FMLGR +TSV WGI+ADRYGRKP++++GT+++ I NA+FGLS+N+WMA
Sbjct  74    DIGFYAGFVGCAFMLGRGMTSVFWGIVADRYGRKPIILLGTISIAILNALFGLSLNFWMA  133

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             + TRFLLGA   ++GTM+AYA+EI R EY A  +SAVSTAWGIGL+IGPA+GG+ AQPA+
Sbjct  134   VATRFLLGAFNCLLGTMKAYATEIFRDEYQATAMSAVSTAWGIGLIIGPALGGFLAQPAD  193

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             KYP+IFS ES FG+FPY LPC  IS+FAL+ T++  ++PET+H HK++   E   +  +K
Sbjct  194   KYPSIFSKESIFGRFPYALPCFTISVFALLVTIVCCFIPETLHNHKQDSTYETLEATGNK  253

Query  1004  QPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADV  1183
             +       S  SLLKNWPL+SSI+VYCV  LHD AY EIF+LWA SPRK GGLS++T DV
Sbjct  254   ENNKGNKDSNGSLLKNWPLMSSIMVYCVLCLHDTAYSEIFALWANSPRKYGGLSFSTNDV  313

Query  1184  GQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVV  1363
             G VLAI+GIGL +FQ+  YPL E++LGP++++R   AL IPL ++YP+IA L+GL LS+V
Sbjct  314   GTVLAISGIGLFVFQVLVYPLAERLLGPILVTRFSGALMIPLQTSYPFIANLTGLSLSLV  373

Query  1364  LNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSW  1543
             LN AS+L NVLSVS  TGLLILQN+AV Q QRGAANGI+M+AMSLFK +GPA  G L SW
Sbjct  374   LNSASILLNVLSVSAITGLLILQNKAVDQRQRGAANGIAMTAMSLFKAMGPAGAGVLFSW  433

Query  1544  SQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             S+ R DA F+PG  +VFFVLNV  L+G+ +TFKPFL
Sbjct  434   SERRLDAAFLPGAHMVFFVLNVIVLIGVALTFKPFL  469



>ref|XP_010557818.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Tarenaya hassleriana]
Length=481

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/490 (58%), Positives = 363/490 (74%), Gaps = 21/490 (4%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE + E LLK++             Y E+C GC+V+ +K+   G P++ +  I ++ LC
Sbjct  1     MAEEHMETLLKKN-------------YHENCPGCKVDQMKQLRRGFPLRELCTIWIIVLC  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              ALPISSLFPFLYFMIRD  IAE+EEDI YY+G+VG SFMLGRALTSV WG++ADRYGRK
Sbjct  48    TALPISSLFPFLYFMIRDLKIAEKEEDIGYYSGFVGCSFMLGRALTSVAWGMVADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV+++ T +VVI N++FGLS+N+WMAIITRF LG+  G++G ++AYA EI   EY AL +
Sbjct  108   PVILLATGSVVILNSLFGLSLNFWMAIITRFCLGSFSGLLGPIKAYAMEIFPDEYQALAL  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             SAVST+WGIGL+IGPA+GG+ AQPAEKYP IF  ES FGKFPYFLPC +IS+FAL  T++
Sbjct  168   SAVSTSWGIGLIIGPALGGFLAQPAEKYPGIFPKESIFGKFPYFLPCFVISLFALGVTII  227

Query  926   SFWLPETMHThkkehkeehDVSQNSKQPEHEVPTSQ--------KSLLKNWPLISSILVY  1081
              F +PET+H HK +     + ++  +   H+   S          SLLKNWPLISSI+VY
Sbjct  228   FFRIPETLHNHKFDDASHDESNETLEAATHDPAGSDGKAEGDEGSSLLKNWPLISSIIVY  287

Query  1082  CVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVL  1261
             C+F LHD+ Y E+FSLWA SPR  GGL Y+T  VG VL+I+G GLL+FQ+  Y  VE+ L
Sbjct  288   CIFSLHDMGYTEVFSLWANSPRSYGGLGYSTTQVGSVLSISGFGLLVFQISLYSYVERCL  347

Query  1262  GPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRA  1441
             G + ++R+  AL+IPLLS YP IA LSG  LS+VLNCAS+ KNVLSV   TGLLILQN+A
Sbjct  348   GTIKVTRLAGALAIPLLSCYPLIAKLSGFTLSLVLNCASVAKNVLSVCAITGLLILQNQA  407

Query  1442  VSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfell  1621
             V Q QRG ANGI+M+AMSLF+ +GP+A G L SWS+ R+DA F+PG Q++FF+LNV   +
Sbjct  408   VKQRQRGVANGIAMTAMSLFQAVGPSAAGVLFSWSEKRRDAAFLPGTQMIFFMLNVVLAI  467

Query  1622  glIMTFKPFL  1651
             G+  TFKPFL
Sbjct  468   GVASTFKPFL  477



>ref|XP_010251712.1| PREDICTED: probable peptide/nitrate transporter At3g43790 isoform 
X2 [Nelumbo nucifera]
Length=482

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/496 (59%), Positives = 365/496 (74%), Gaps = 25/496 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE N E LLK+   NG             C GC V+ LK +   +P K   +I +V+LC
Sbjct  1     MAE-NRETLLKKVYYNG-------------CPGCEVDRLKESQQQIPYKKFLYIWVVSLC  46

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              ALPISSLFP++YFMIRDFHIA+REEDI +YAG+VGSSFM+GRALTSV WG++ADRYGRK
Sbjct  47    TALPISSLFPYMYFMIRDFHIAKREEDIGFYAGFVGSSFMIGRALTSVFWGVVADRYGRK  106

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV++IGT++VVIFN +FGLS + WMA+  RFLLG    ++G +RAYASE+C  +YHALG 
Sbjct  107   PVILIGTISVVIFNTLFGLSTSLWMAVSMRFLLGCFNCMLGPIRAYASEVCHEKYHALGQ  166

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S  ST+ GIG +IGPA+GG+F QPAEKYP IFS  S F +FPYFLPCLIIS+FAL A + 
Sbjct  167   SIASTSRGIGFIIGPAIGGFFVQPAEKYPNIFSDNSLFARFPYFLPCLIISIFALGAFIS  226

Query  926   SFWLPETMH-----------ThkkehkeehDVSQNSKQPEHEVPTSQKSLLKNWPLISSI  1072
              FW+PET+H              +      D  +  K+ E   P S+ SLL+NWPL+S+I
Sbjct  227   CFWIPETLHMHNRNNKEESYDALEASSHRSDEKEEMKETEQTGPPSRLSLLRNWPLMSTI  286

Query  1073  LVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVE  1252
             +VYC+F LH+IAY E+FSLWAVS RK GGL +++  VG+VLAI+G GLLLFQLF YP +E
Sbjct  287   IVYCIFSLHEIAYAEVFSLWAVSDRKYGGLGFSSQSVGEVLAISGFGLLLFQLFLYPSIE  346

Query  1253  KVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQ  1432
             K LGP+M+SR+ A LSIPLLS+YP+IA LSG  L +V+NCAS+LKNVLSV   TGL IL 
Sbjct  347   KFLGPIMVSRLAAVLSIPLLSSYPFIARLSGFTLQLVINCASILKNVLSVVTLTGLFILL  406

Query  1433  NRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvf  1612
             N AV Q QRGAANGISM+ MS FK IGPA GGSL S +Q RQ A F+PGDQ+VFF+LNV 
Sbjct  407   NSAVPQHQRGAANGISMTLMSTFKAIGPAGGGSLFSLAQKRQHAAFLPGDQIVFFILNVI  466

Query  1613  ellglIMTFKPFLQLP  1660
               + +++TFKPFL  P
Sbjct  467   TAVEVVLTFKPFLTRP  482



>ref|XP_010922099.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Elaeis guineensis]
Length=483

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/480 (59%), Positives = 365/480 (76%), Gaps = 17/480 (4%)
 Frame = +2

Query  263   LEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDF  442
             LE  YF   E+C GC+ E  K  + G+P K   F+ MVTLC ALPIS LFPFLYFMIRD 
Sbjct  9     LEKVYF---ENCPGCKQEKKKDTNPGIPYKEFAFVWMVTLCTALPISILFPFLYFMIRDL  65

Query  443   HIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGL  622
             H+A+REEDI +YAG+VG+SFM GRALTS  WG++ADR GRKPV++IG   V+IFN +FGL
Sbjct  66    HVAKREEDIGFYAGFVGASFMFGRALTSAFWGLVADRCGRKPVIVIGICAVIIFNTLFGL  125

Query  623   SVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGG  802
             S  YWMAI TR LLG+L G++G ++AY+ E+CR E+ ALG+S VSTAWGIGL+IGPA+GG
Sbjct  126   STTYWMAITTRLLLGSLNGLLGPIKAYSIEVCRPEHQALGLSLVSTAWGIGLIIGPAIGG  185

Query  803   YFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeeh  982
             +FAQPAEKYP IFS +SFFG+FPYFLPC  +S+FA+   ++ FWLPET+H H     ++ 
Sbjct  186   FFAQPAEKYPNIFSQDSFFGRFPYFLPCFCVSLFAVGVFILCFWLPETLHRHNANKMQDG  245

Query  983   DV------------SQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFS  1126
              +             +N+ + E   PT  ++L KNWPL+SSI+VYCVF LHD+AY EIFS
Sbjct  246   TIEVLEAPSHGSGLKENTNECEERAPT--ENLFKNWPLMSSIIVYCVFSLHDMAYTEIFS  303

Query  1127  LWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIP  1306
             LWAVS +  GGLS+++ DVG+VLAI+G  LL++QLF YP +EK+LGP+  SR+ + LSIP
Sbjct  304   LWAVSDKIYGGLSFSSQDVGEVLAISGFSLLVYQLFLYPSLEKILGPITSSRVASVLSIP  363

Query  1307  LLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMS  1486
             LL+ +P++  LSGL LS+++NCAS+LKN+LSV+I TG  ILQN AV Q QRGAANGI+M+
Sbjct  364   LLAAFPFMTKLSGLGLSLIVNCASLLKNILSVTIITGTFILQNNAVPQHQRGAANGIAMT  423

Query  1487  AMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPED  1666
              MSLFKT  PA  G + SW+Q RQ A F+PGDQ+VFF+LNV E +GL++TFKPFL LP  
Sbjct  424   GMSLFKTAAPACAGIIFSWAQKRQYASFLPGDQVVFFILNVVEFIGLLLTFKPFLALPNK  483



>ref|XP_010045119.1| PREDICTED: probable peptide/nitrate transporter At3g43790 isoform 
X1 [Eucalyptus grandis]
 gb|KCW87277.1| hypothetical protein EUGRSUZ_B03776 [Eucalyptus grandis]
Length=495

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/501 (58%), Positives = 383/501 (76%), Gaps = 27/501 (5%)
 Frame = +2

Query  206   MAEG----NTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISM  373
             MAEG    +  PLL+++             Y ++C GC+V+ LKR   G+P + + +I +
Sbjct  1     MAEGPESRDAAPLLEKA-------------YHDNCPGCKVDRLKRERRGIPYRDLSYIWI  47

Query  374   VTLCAALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADR  553
             V+LC ALPI+SLFPF+YFMIRDFHIA+REEDI +YAG+VGSSFM+GRALTSV WG++ADR
Sbjct  48    VSLCTALPITSLFPFVYFMIRDFHIAKREEDIGFYAGFVGSSFMVGRALTSVFWGVVADR  107

Query  554   YGRKPvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYH  733
             YGRKP+++IGT +VV+ NA+FGLS ++WMA+ TRFLLG    ++GT+RAYA EIC  E+ 
Sbjct  108   YGRKPIILIGTFSVVVLNALFGLSTSFWMALCTRFLLGCFNSVLGTIRAYAVEICTEEHR  167

Query  734   ALGISAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALV  913
              L +S VST+ GIGL+IGPA+GG+FAQPAEKYP +FS  S FG++PYFLPCL+IS++A  
Sbjct  168   GLTLSVVSTSRGIGLIIGPAIGGFFAQPAEKYPGLFSQSSIFGRYPYFLPCLLISIYAAG  227

Query  914   ATVMSFWLPETMH----ThkkehkeehDVSQNSKQPE------HEVPTSQKSLLKNWPLI  1063
               +  +WLPET+H    T  +   +E +VS +S           E  T +++LLKNWPL+
Sbjct  228   VFISCWWLPETLHMHERTDGRSSCDEVEVSCDSSDATKHDTEVEEQKTYEENLLKNWPLM  287

Query  1064  SSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYP  1243
             S+I+VYCVF L +IAY EIFSLWAVS RK GGL++++ DVG+VLAI+G GLLLFQL  YP
Sbjct  288   STIIVYCVFSLQEIAYSEIFSLWAVSERKFGGLNFSSQDVGEVLAISGFGLLLFQLLLYP  347

Query  1244  LVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLL  1423
              VEK+LGP+MI+R+ A +SIPLLS+YPYIA+LSGL L + +N ASML+N LSVS+ TG+ 
Sbjct  348   RVEKILGPIMITRLSAGISIPLLSSYPYIAMLSGLTLHIAINFASMLRNALSVSVVTGIF  407

Query  1424  ILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvl  1603
             IL N AV Q QRGAANGISM+AMS+ K  GPA GG+L SW+Q RQ A F+PGDQ+VFFVL
Sbjct  408   ILLNNAVPQHQRGAANGISMTAMSISKAFGPACGGALFSWAQKRQVATFLPGDQMVFFVL  467

Query  1604  nvfellglIMTFKPFLQLPED  1666
             N+ +++GLI+TFKPFL  P +
Sbjct  468   NLLQMIGLILTFKPFLAQPHE  488



>ref|XP_009763182.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like isoform X2 
[Nicotiana sylvestris]
Length=394

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/352 (77%), Positives = 312/352 (89%), Gaps = 13/352 (4%)
 Frame = +2

Query  428   MIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFN  607
             M+RDFHIA+REEDISYYAG+VGSS MLGRALTS+LWG+IADRYGRKPVVIIGT+TVVIFN
Sbjct  1     MVRDFHIADREEDISYYAGFVGSSLMLGRALTSILWGVIADRYGRKPVVIIGTITVVIFN  60

Query  608   AVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIG  787
             A+FGLS N+WMAII RFL+G+LCGIIGTMRAYASEICR+EYHALGISAVST+WGIGLVIG
Sbjct  61    ALFGLSTNFWMAIILRFLMGSLCGIIGTMRAYASEICRKEYHALGISAVSTSWGIGLVIG  120

Query  788   PAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkke  967
             P +GGY AQPAEKYP +FS +S FG+FPY LPCL+IS+ ALVATV+SFWLPET+H H K 
Sbjct  121   PVIGGYLAQPAEKYPGVFSKDSLFGRFPYLLPCLMISLLALVATVVSFWLPETLHKHNKT  180

Query  968   hkeehD-------------VSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIA  1108
             +K++ D             +S++ K  E  +P S KSLLKNWPL+S+I+VYCVFQLHDIA
Sbjct  181   NKDQSDLYDVAEGTTNGLNLSESMKHSERRIPNSHKSLLKNWPLVSAIIVYCVFQLHDIA  240

Query  1109  YLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIG  1288
             YLEIFSLWAVSPR LGGLS+TT DVGQVLAITG+GLLLFQLFAYPLVE+++GPVMISR+G
Sbjct  241   YLEIFSLWAVSPRTLGGLSFTTTDVGQVLAITGVGLLLFQLFAYPLVERIVGPVMISRVG  300

Query  1289  AALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAV  1444
             A LSIPLL++YP IALLSG CLS+ LNCASMLKNVLSVSITTGLLI+QNRAV
Sbjct  301   AVLSIPLLASYPCIALLSGFCLSIALNCASMLKNVLSVSITTGLLIMQNRAV  352


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  1447  PGAERSCQWHFHVCNVSF*DNWPSSRGFIIIMVTTASRC  1563
             PGA+RSC+W F+V NV F DN PSS GFII++ TTASRC
Sbjct  356   PGAKRSCKWPFYVFNVFFQDNRPSSWGFIIVLGTTASRC  394



>ref|XP_003542784.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Glycine 
max]
Length=488

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/469 (61%), Positives = 366/469 (78%), Gaps = 9/469 (2%)
 Frame = +2

Query  263   LEDEYFCYDESCAGCRVELLKR--ADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIR  436
             LE +Y+   + C GC+V+  K      GVP+K++F + MV LCAALPISSLFPFLYFM+R
Sbjct  11    LERKYY---KDCPGCKVDQAKELSEGKGVPVKNLFIMWMVVLCAALPISSLFPFLYFMVR  67

Query  437   DFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVF  616
             DF+IA+ E DIS YAGYVGSSFMLGR LTSVLWGI+ADRYGRKPV+++G + VVIFN +F
Sbjct  68    DFNIAKTEADISSYAGYVGSSFMLGRCLTSVLWGIVADRYGRKPVIVMGIIAVVIFNTLF  127

Query  617   GLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAV  796
             GLS N+WMA+I RFLLG+L G++G ++AYASE+ R E+ A+G+S VS AWGIGL+IGPA+
Sbjct  128   GLSTNFWMAVIMRFLLGSLNGLLGPVKAYASELFREEHQAIGLSTVSAAWGIGLIIGPAL  187

Query  797   GGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehke  976
             GGY AQP EKYP IF+ +SF+ KFPYFLP LIIS FA V  +   W+PET+H H   ++ 
Sbjct  188   GGYLAQPVEKYPHIFTKDSFWDKFPYFLPNLIISAFAFVVAIGCIWIPETLHNHNCSNES  247

Query  977   ehDV----SQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSP  1144
               D     S NS     ++     +LL NWPL+SSI+VYCVF LHDIAY E+FSLWAVSP
Sbjct  248   TDDAKALESGNSGAGNEKIIQKNDNLLLNWPLMSSIIVYCVFSLHDIAYQEVFSLWAVSP  307

Query  1145  RKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYP  1324
             ++LGGL++TT +VG VL+I+G+ L+++QL  YP VEK  GP++I+R    L+IPLL +YP
Sbjct  308   QRLGGLNFTTDNVGDVLSISGLALIIYQLTLYPFVEKASGPIVIARFSGMLTIPLLQSYP  367

Query  1325  YIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFK  1504
             +IALLSGL L +V++ AS+LKN++S++I T L +LQNRAV Q QRGAANGISM+AMSLFK
Sbjct  368   FIALLSGLALYIVISIASILKNIMSITIITSLFLLQNRAVEQHQRGAANGISMTAMSLFK  427

Query  1505  TIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
              IGPA GG++L+WSQ R DA F+PG  +VFFVLN+ E LG++M FKPFL
Sbjct  428   AIGPATGGAVLTWSQKRMDASFLPGTHMVFFVLNIVEALGILMMFKPFL  476



>ref|NP_851036.1| zinc induced facilitator-like 1 protein [Arabidopsis thaliana]
 sp|Q94BZ1.1|ZIFL1_ARATH RecName: Full=Protein ZINC INDUCED FACILITATOR-LIKE 1; AltName: 
Full=Protein ZIF-LIKE 1 [Arabidopsis thaliana]
 gb|AAK62597.1| AT5g13750/MXE10_2 [Arabidopsis thaliana]
 gb|AAL32945.1| transporter-like protein [Arabidopsis thaliana]
 gb|AAM26717.1| AT5g13750/MXE10_2 [Arabidopsis thaliana]
 gb|AED91935.1| zinc induced facilitator-like 1 protein [Arabidopsis thaliana]
Length=478

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/486 (59%), Positives = 367/486 (76%), Gaps = 17/486 (3%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE   E LL+++             + E C+GC+V+ +KR   G P   +F + ++ LC
Sbjct  1     MAEEYAECLLEKN-------------FHEDCSGCKVDQMKRLRRGFPFWELFTVWIIVLC  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              ALPISSLFPFLYFMI DF+IA++EEDI +YAG+VG SFMLGRA TSV WG++ADRYGRK
Sbjct  48    TALPISSLFPFLYFMIDDFNIAKKEEDIGFYAGFVGCSFMLGRAFTSVAWGLVADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV++IGT +VV+FN +FGLS+N+WMAIITRF LG+  G++G ++AYA EI R EY  L +
Sbjct  108   PVILIGTASVVVFNTLFGLSLNFWMAIITRFCLGSFNGLLGPIKAYAMEIFRDEYQGLAL  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             SAVSTAWGIGL+IGPA+GG+ AQPA++YP++FS +S FGKFP+FLPCL IS+FA + T++
Sbjct  168   SAVSTAWGIGLIIGPAIGGFLAQPAKQYPSLFSQDSIFGKFPFFLPCLAISVFAFLVTIV  227

Query  926   SFWLPETMHThkkehkeehDVSQN-SKQPEHEV---PTSQKSLLKNWPLISSILVYCVFQ  1093
             S  +PET+H HK    E +D  ++ S  PE         + SLL NWPLISSI+VYCVF 
Sbjct  228   SSRIPETLHNHKFNDDESYDALKDLSDDPESNKVAERNGKSSLLNNWPLISSIIVYCVFS  287

Query  1094  LHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVM  1273
             LHD+AY EIFSLWA SPRK GGL Y+TADVG VLA +G GLL+FQL  Y   E++LGP++
Sbjct  288   LHDMAYTEIFSLWANSPRKYGGLGYSTADVGSVLAFSGFGLLIFQLSLYSYAERLLGPII  347

Query  1274  ISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQE  1453
             ++RI  +L++ +LS YP IA LSGL L+V +  AS+ K+VL  S  TGL ILQN+AV Q+
Sbjct  348   VTRISGSLAMVVLSCYPLIAKLSGLALTVTVTSASVAKSVLGTSAITGLFILQNKAVRQD  407

Query  1454  QRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIM  1633
             QRGAANGI+M+AMSLFK IGPAA G + SWS+ RQ A F+PG Q+VFF+LNV   LG+++
Sbjct  408   QRGAANGIAMTAMSLFKAIGPAAAGIIFSWSEKRQGAAFLPGTQMVFFILNVVLALGVVL  467

Query  1634  TFKPFL  1651
             TFKPFL
Sbjct  468   TFKPFL  473



>ref|XP_009776343.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Nicotiana sylvestris]
Length=450

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/431 (65%), Positives = 356/431 (83%), Gaps = 7/431 (2%)
 Frame = +2

Query  389   ALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKP  568
             +LPISSLFPFLYFMIRDFHIA+REEDI  YAGYVGS++MLGRALTSV WGI+ADRYGRKP
Sbjct  21    SLPISSLFPFLYFMIRDFHIAKREEDIGSYAGYVGSAYMLGRALTSVFWGIVADRYGRKP  80

Query  569   vviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGIS  748
             V+IIGT TVV+FN +FGLS+N+WMA+ITRFLLG+L G++G ++AYA+EI R EY ALG+S
Sbjct  81    VIIIGTFTVVVFNTLFGLSINFWMAVITRFLLGSLNGLLGPIKAYAAEIFREEYQALGMS  140

Query  749   AVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMS  928
              +STAWGIGL+IGPA+GG+ AQPAEKYP  FS +S FG+FPYFLPCL IS+F+LV  + S
Sbjct  141   TISTAWGIGLIIGPALGGFLAQPAEKYPATFSKDSVFGRFPYFLPCLCISLFSLVVAIGS  200

Query  929   FWLPETMHThkkeh-----keehDVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQ  1093
             FWLPET+H H  E       +  + + ++K+    +P  +++L KNW L+SSI++YC+F 
Sbjct  201   FWLPETLHIHDSEMPPQDSYKALEAASDTKEGNESIP--KENLFKNWALMSSIILYCIFA  258

Query  1094  LHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVM  1273
             LHD+AY EIFSLWAVSPRK GGL+Y+TADVG+VL+ +G GLL+FQLF YPLV K  GP++
Sbjct  259   LHDMAYSEIFSLWAVSPRKFGGLNYSTADVGEVLSFSGFGLLVFQLFLYPLVAKYFGPII  318

Query  1274  ISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQE  1453
              +R+   LSIPLL++YPYIA+LSG+ LSVV+N ASM+KN LS+SI TGL ILQN AV Q 
Sbjct  319   TARVAGVLSIPLLASYPYIAMLSGITLSVVINFASMMKNALSISIITGLFILQNNAVDQR  378

Query  1454  QRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIM  1633
             QRGAANG++M+ MS FK +GPA GG+L SW+Q R DA F+PG+Q+VFFVLNV E +GL++
Sbjct  379   QRGAANGLAMTGMSFFKALGPAGGGALFSWAQKRLDASFLPGNQVVFFVLNVIEAIGLLL  438

Query  1634  TFKPFLQLPED  1666
             TFKPFL + ++
Sbjct  439   TFKPFLVVRQN  449



>ref|XP_004515444.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Cicer arietinum]
Length=487

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/492 (56%), Positives = 369/492 (75%), Gaps = 17/492 (3%)
 Frame = +2

Query  206   MAEGN-TEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTL  382
             M E N  EPLL         L+ +Y+   E+C GC+V+  K     V  +++F I MV L
Sbjct  1     MEENNFGEPLL---------LKKQYY---ENCPGCKVDKAKELKTDVTFRNLFNIWMVVL  48

Query  383   CAALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGR  562
             C++LPISSLFP+LYFM+RDF+IA+REEDIS YAGY+GSSFMLGR+LTS+LWG+IADRYGR
Sbjct  49    CSSLPISSLFPYLYFMVRDFNIAKREEDISAYAGYIGSSFMLGRSLTSILWGLIADRYGR  108

Query  563   KPvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALG  742
             KPV  +G ++V+IFN +FGLS ++WMA+ITRF LG L G++G M+AY SEI R E  ALG
Sbjct  109   KPVAFLGIISVIIFNTLFGLSTSFWMAVITRFFLGCLNGLLGPMKAYCSEIFREEKQALG  168

Query  743   ISAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATV  922
             +S  S AWG+GL+IGP++GGY AQP  KYP +F  +SF+ K+PYFLP + IS+FA VA +
Sbjct  169   LSTFSAAWGMGLIIGPSLGGYLAQPTLKYPNLFPKDSFWDKYPYFLPSISISIFAFVAVI  228

Query  923   MSFWLPETMHThkkehkeehD---VSQNSKQPEHE-VPTSQKSLLKNWPLISSILVYCVF  1090
             +  WLPET+H H   ++  +D   +   SK+   E +    ++L  NWPL+SSI+VYC+F
Sbjct  229   VCIWLPETLHNHPLSNESSNDAEALENGSKEKVREKIIQKDENLFLNWPLMSSIIVYCIF  288

Query  1091  QLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPV  1270
              L+DIAY E+FSLWAVSPR+LGGL+++T DVG VLAI+GIGL++FQL  YP +E+  GP+
Sbjct  289   SLYDIAYQEVFSLWAVSPRRLGGLNFSTDDVGNVLAISGIGLIVFQLSVYPSLERTFGPI  348

Query  1271  MISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQ  1450
               +RI   LSIPLL +YP+IA+LSG+ L +V+N AS+LKN+LSV++ TGL ++QNRAV Q
Sbjct  349   RFARISGVLSIPLLQSYPFIAMLSGITLYLVINIASLLKNLLSVTVITGLFLMQNRAVEQ  408

Query  1451  EQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglI  1630
              QRGAANGISM+ MS+FK IGPA GG++L+WSQ R  A F+PG  +VFFVLNV   L ++
Sbjct  409   HQRGAANGISMTGMSIFKAIGPAGGGAILAWSQKRMHASFLPGTHMVFFVLNVAGGLTVL  468

Query  1631  MTFKPFLQLPED  1666
             + F PFL + + 
Sbjct  469   LMFTPFLSVKKK  480



>ref|XP_008364744.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Malus domestica]
Length=483

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/497 (61%), Positives = 377/497 (76%), Gaps = 25/497 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE   E LLK+              Y + C GC +E  K    G+PIK +  I ++ L 
Sbjct  1     MAEECRETLLKKD-------------YYDDCPGCVMEQRKELQRGLPIKMLVSIWIIVLS  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
             A+LPISSLFPFLYFMIRD HIA+REEDI YYAGYVG+S+M+GR LTS+ WG++ADRYGRK
Sbjct  48    ASLPISSLFPFLYFMIRDLHIAKREEDIGYYAGYVGASYMIGRGLTSIFWGMVADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV+IIGTV VVIFN +FGLSVN+WMAI TRFLLG+L G++G ++AYASE  R E+ ALG+
Sbjct  108   PVIIIGTVAVVIFNTLFGLSVNFWMAISTRFLLGSLNGLLGPIKAYASEAFREEHQALGM  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S VS AWGIGL+IGPA+GG+ AQPA+K+P+IFS  S FG+FPYFLPCL IS+FA    V 
Sbjct  168   STVSVAWGIGLIIGPALGGFLAQPADKFPSIFSQNSIFGRFPYFLPCLCISVFAFGVAVA  227

Query  926   SFWLPETMHTh-----------kkehkeehDVSQNSKQPEHEVPTSQKSLLKNWPLISSI  1072
              FWLPET+H H           +           N KQ   E  T +++L KNWPL+SSI
Sbjct  228   CFWLPETLHKHDGKARLHDGPYEALETASGGSDANEKQNTEE-QTPKENLFKNWPLMSSI  286

Query  1073  LVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVE  1252
             +VY +F L+D+AY EIFSLWAVSPRK GGLS++T DVG+VL+I+G GL  FQ+  YP VE
Sbjct  287   IVYSIFALYDMAYTEIFSLWAVSPRKFGGLSFSTEDVGEVLSISGFGLFFFQITLYPYVE  346

Query  1253  KVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQ  1432
             ++LGPVMI+RIG  +SIPLLS+YP+IA+LSGL LSV+LNCAS+LKNVLSV+I TGL ILQ
Sbjct  347   RLLGPVMIARIGGIISIPLLSSYPFIAMLSGLSLSVLLNCASVLKNVLSVTIVTGLSILQ  406

Query  1433  NRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvf  1612
             N+AV Q+QRGAANG++M+AMS+FK IGPA GG+L SW+Q R+DA  +PG Q++FF+LNV 
Sbjct  407   NKAVDQKQRGAANGLAMTAMSMFKAIGPAGGGALFSWAQKRRDAAILPGSQMIFFILNVI  466

Query  1613  ellglIMTFKPFLQLPE  1663
             E + ++MTFKPFL L E
Sbjct  467   EAIAVLMTFKPFLTLHE  483



>ref|XP_010557819.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Tarenaya 
hassleriana]
 ref|XP_010557820.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Tarenaya 
hassleriana]
 ref|XP_010557821.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Tarenaya 
hassleriana]
Length=476

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/494 (56%), Positives = 364/494 (74%), Gaps = 26/494 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE   E LL+++             Y E+C GC+VE +K +  G P+  +F I ++ L 
Sbjct  1     MAETYMETLLEKN-------------YHENCPGCKVEQMKHSRRGFPLWELFIIWIIVLS  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
               LP+SSLFPFLYFMI DF I ++EEDI +YAG+VG +FM+GR LTSV+WG++ADRYGRK
Sbjct  48    TVLPVSSLFPFLYFMIEDFKITDKEEDIGFYAGFVGCTFMVGRILTSVVWGVMADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             P++++GT +VVIFN +FGLS N+WMAIITRF LG+  G++G ++A+A EI R EYH L +
Sbjct  108   PIILLGTGSVVIFNTLFGLSPNFWMAIITRFFLGSFNGVLGPIKAFAMEIFRDEYHVLAL  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S V+ +WG+ L+IGPA+GG+ AQPAEKYP++FS ES FGKFPYFLPCL IS+FALVAT++
Sbjct  168   SNVTASWGVALIIGPAIGGFLAQPAEKYPSLFSKESIFGKFPYFLPCLAISLFALVATLI  227

Query  926   SFWLPETMHThkkehkeehDVSQNSKQPEHEVPT--------SQKSLLKNWPLISSILVY  1081
             SFW+PET+H       +  DVS +      E  T         + SLLKNWPLIS+I + 
Sbjct  228   SFWIPETLHN-----HKFDDVSHDESTEALEAATHDGKAEGDEESSLLKNWPLISAITIS  282

Query  1082  CVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVL  1261
             C+F LHD++Y EIFSLWA SPR+ GGL Y+TADVG VL I+G GLL+FQL  Y  + ++L
Sbjct  283   CIFALHDMSYTEIFSLWANSPREYGGLGYSTADVGSVLTISGFGLLVFQLSLYSYMGRLL  342

Query  1262  GPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRA  1441
             GP  + R  AAL+IP+L+TYP IA LSG  LS+VLNCAS++K+ L VS TTGL IL N+A
Sbjct  343   GPTKVIRFSAALAIPILATYPLIAKLSGFTLSLVLNCASIIKSALGVSATTGLYILHNQA  402

Query  1442  VSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfell  1621
             V Q QRGAANG++M+A+S+ K IGPAA G+L SW++ RQDA F+PG Q++FF+LN    +
Sbjct  403   VKQHQRGAANGLAMTAVSVSKAIGPAAAGALFSWAEKRQDAAFLPGMQMIFFILNAILAI  462

Query  1622  glIMTFKPFLQLPE  1663
             G+ +TFKPFL + +
Sbjct  463   GVALTFKPFLTVAK  476



>ref|XP_010557815.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010557817.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Tarenaya hassleriana]
Length=482

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/491 (58%), Positives = 363/491 (74%), Gaps = 22/491 (4%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE + E LLK++             Y E+C GC+V+ +K+   G P++ +  I ++ LC
Sbjct  1     MAEEHMETLLKKN-------------YHENCPGCKVDQMKQLRRGFPLRELCTIWIIVLC  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              ALPISSLFPFLYFMIRD  IAE+EEDI YY+G+VG SFMLGRALTSV WG++ADRYGRK
Sbjct  48    TALPISSLFPFLYFMIRDLKIAEKEEDIGYYSGFVGCSFMLGRALTSVAWGMVADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV+++ T +VVI N++FGLS+N+WMAIITRF LG+  G++G ++AYA EI   EY AL +
Sbjct  108   PVILLATGSVVILNSLFGLSLNFWMAIITRFCLGSFSGLLGPIKAYAMEIFPDEYQALAL  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             SAVST+WGIGL+IGPA+GG+ AQPAEKYP IF  ES FGKFPYFLPC +IS+FAL  T++
Sbjct  168   SAVSTSWGIGLIIGPALGGFLAQPAEKYPGIFPKESIFGKFPYFLPCFVISLFALGVTII  227

Query  926   SFWLPETMHThkkehkeehDVSQNSKQPEHEVPTSQ--------KSLLKNWPLISSILVY  1081
              F +PET+H HK +     + ++  +   H+   S          SLLKNWPLISSI+VY
Sbjct  228   FFRIPETLHNHKFDDASHDESNETLEAATHDPAGSDGKAEGDEGSSLLKNWPLISSIIVY  287

Query  1082  CVFQLHDIAYLE-IFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKV  1258
             C+F LHD+ Y E +FSLWA SPR  GGL Y+T  VG VL+I+G GLL+FQ+  Y  VE+ 
Sbjct  288   CIFSLHDMGYTEQVFSLWANSPRSYGGLGYSTTQVGSVLSISGFGLLVFQISLYSYVERC  347

Query  1259  LGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNR  1438
             LG + ++R+  AL+IPLLS YP IA LSG  LS+VLNCAS+ KNVLSV   TGLLILQN+
Sbjct  348   LGTIKVTRLAGALAIPLLSCYPLIAKLSGFTLSLVLNCASVAKNVLSVCAITGLLILQNQ  407

Query  1439  AVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfel  1618
             AV Q QRG ANGI+M+AMSLF+ +GP+A G L SWS+ R+DA F+PG Q++FF+LNV   
Sbjct  408   AVKQRQRGVANGIAMTAMSLFQAVGPSAAGVLFSWSEKRRDAAFLPGTQMIFFMLNVVLA  467

Query  1619  lglIMTFKPFL  1651
             +G+  TFKPFL
Sbjct  468   IGVASTFKPFL  478



>gb|KHN10321.1| Protein ZINC INDUCED FACILITATOR-LIKE 1 [Glycine soja]
Length=488

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/469 (61%), Positives = 365/469 (78%), Gaps = 9/469 (2%)
 Frame = +2

Query  263   LEDEYFCYDESCAGCRVELLKR--ADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIR  436
             LE +Y+   + C GC+V+  K      GVP+ ++F + MV LCAALPISSLFPFLYFM+R
Sbjct  11    LERKYY---KDCPGCKVDQAKELSEGKGVPVTNLFIMWMVVLCAALPISSLFPFLYFMVR  67

Query  437   DFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVF  616
             DF+IA+ E DIS YAGYVGSSFMLGR LTSVLWGI+ADRYGRKPV+++G + VVIFN +F
Sbjct  68    DFNIAKTEADISSYAGYVGSSFMLGRCLTSVLWGIVADRYGRKPVIVMGIIAVVIFNTLF  127

Query  617   GLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAV  796
             GLS N+WMA+I RFLLG+L G++G ++AYASE+ R E+ A+G+S VS AWGIGL+IGPA+
Sbjct  128   GLSTNFWMAVIMRFLLGSLNGLLGPVKAYASELFREEHQAIGLSTVSAAWGIGLIIGPAL  187

Query  797   GGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehke  976
             GGY AQP EKYP IF+ +SF+ KFPYFLP LIIS FA V  +   W+PET+H H   ++ 
Sbjct  188   GGYLAQPVEKYPHIFTKDSFWDKFPYFLPNLIISAFAFVVAIGCIWIPETLHNHNCSNES  247

Query  977   ehDV----SQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSP  1144
               D     S NS     ++     +LL NWPL+SSI+VYCVF LHDIAY E+FSLWAVSP
Sbjct  248   TDDAKALESGNSGAGNEKIIQKNDNLLLNWPLMSSIIVYCVFSLHDIAYQEVFSLWAVSP  307

Query  1145  RKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYP  1324
             ++LGGL++TT +VG VL+I+G+ L+++QL  YP VEK  GP++I+R    L+IPLL +YP
Sbjct  308   QRLGGLNFTTDNVGDVLSISGLALIIYQLTLYPFVEKASGPIVIARFSGMLTIPLLQSYP  367

Query  1325  YIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFK  1504
             +IALLSGL L +V++ AS+LKN++S++I T L +LQNRAV Q QRGAANGISM+AMSLFK
Sbjct  368   FIALLSGLALYIVISIASILKNIMSITIITSLFLLQNRAVEQHQRGAANGISMTAMSLFK  427

Query  1505  TIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
              IGPA GG++L+WSQ R DA F+PG  +VFFVLN+ E LG++M FKPFL
Sbjct  428   AIGPATGGAVLTWSQKRMDASFLPGTHMVFFVLNIVEALGILMMFKPFL  476



>ref|XP_007133567.1| hypothetical protein PHAVU_011G189900g [Phaseolus vulgaris]
 gb|ESW05561.1| hypothetical protein PHAVU_011G189900g [Phaseolus vulgaris]
Length=489

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/489 (58%), Positives = 365/489 (75%), Gaps = 19/489 (4%)
 Frame = +2

Query  206   MAEGNT-EPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKR--ADAGVPIKHVFFISMV  376
             M E N  +PLL++ +            Y E+C GC+V+  K      GVP+K++  I ++
Sbjct  1     MGEENVKQPLLRRKK------------YYENCPGCKVDEAKELSEGQGVPVKNLVIIWIL  48

Query  377   TLCAALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRY  556
              +  ALPISSLFPFLYFM+RDF+IA+ E DISYYAGY+GSSFMLGR LTSVLWG++ADRY
Sbjct  49    VVSNALPISSLFPFLYFMVRDFNIAKTEADISYYAGYIGSSFMLGRCLTSVLWGVVADRY  108

Query  557   GRKPvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHA  736
             GRKPV++IG V VVIFN +FGLS ++WMA++TRFLLG+L G++G ++AYA+EI R E+H+
Sbjct  109   GRKPVIVIGVVVVVIFNTLFGLSTSFWMAVVTRFLLGSLNGMLGPVKAYATEIFREEHHS  168

Query  737   LGISAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVA  916
             LG+S VS AWG GL+IGPA+GGY AQP EKYP IF   SF+ KFPYFLP L+IS+ A + 
Sbjct  169   LGLSTVSAAWGTGLIIGPALGGYLAQPVEKYPHIFPKGSFWDKFPYFLPNLVISVLAFIV  228

Query  917   TVMSFWLPETMHThkkehkeehDV----SQNSKQPEHEVPTSQKSLLKNWPLISSILVYC  1084
              +  FW+PET+H H    +   D     + NS           ++LL NWPL+SS+++YC
Sbjct  229   IICCFWIPETLHNHSSSDESIDDAEALENGNSGAGTDMTIQKNENLLLNWPLMSSVIIYC  288

Query  1085  VFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLG  1264
             VF LHDIAY E+FSLWAVSPRKLGGL+++T +VG VL+ITG  L+++QL  YP +E+  G
Sbjct  289   VFSLHDIAYQEVFSLWAVSPRKLGGLNFSTNNVGNVLSITGATLIIYQLSVYPSIERACG  348

Query  1265  PVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAV  1444
              V I+RI   LSIPLL +YP IALLSG+ L++V+  AS+LKN+LS +I TGL +LQNRAV
Sbjct  349   AVGIARITGMLSIPLLQSYPLIALLSGVALTIVIVIASILKNILSTTIITGLFLLQNRAV  408

Query  1445  SQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellg  1624
              Q QRGAANGISM+ MSLFK IGPA GG++L+WSQ R DA F+PG  +VFFVLN+ E +G
Sbjct  409   EQHQRGAANGISMTCMSLFKAIGPATGGAVLTWSQKRMDASFLPGTNMVFFVLNIIEAVG  468

Query  1625  lIMTFKPFL  1651
             +IM FKPFL
Sbjct  469   IIMMFKPFL  477



>emb|CDX70517.1| BnaC03g06010D [Brassica napus]
Length=487

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/469 (60%), Positives = 359/469 (77%), Gaps = 13/469 (3%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y E C GC+VE +K+   G P   + F+ +V L  +LPISSL+PFLY+MI DF +A+ E+
Sbjct  16    YHEGCPGCKVEKMKQLRKGYPYLELSFVWIVVLSTSLPISSLYPFLYYMIEDFGVAKTEK  75

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG++  SFM GRALTSV WGI+ADRYGRKP++++GT+++ +FNA+FGLS+N+WMA
Sbjct  76    DIGFYAGFIACSFMFGRALTSVFWGIVADRYGRKPIILLGTISIAVFNALFGLSLNFWMA  135

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TRFLLG+   ++GTM+AYASEI R EY A  +SAVSTAWGIGL+IGPA+GG+ AQPA+
Sbjct  136   IGTRFLLGSFNCLLGTMKAYASEIFRDEYQATAMSAVSTAWGIGLIIGPALGGFLAQPAD  195

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehD------  985
             KYP +FS ES FG+FPY LPC  IS FALV TV+  ++PET+H HK+++  + D      
Sbjct  196   KYPNVFSKESIFGRFPYALPCFTISAFALVVTVLCCFIPETLHNHKQDNTLDDDSYEIIE  255

Query  986   ------VSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPR  1147
                    +   K  +HE   SQ  LLKNWPL+SSI+VYCV  LHD AY EIF+LWA SPR
Sbjct  256   AAARDSTASTGKTEKHE-KASQGPLLKNWPLMSSIIVYCVLCLHDTAYSEIFALWANSPR  314

Query  1148  KLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPY  1327
             K GGLSY+T DVG VLAI+G+GL  FQ+F YPLVE++LGPV+++R   AL IP+  +YP+
Sbjct  315   KYGGLSYSTNDVGTVLAISGLGLFCFQVFVYPLVERLLGPVLVTRFAGALMIPIQMSYPF  374

Query  1328  IALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKT  1507
             IA LSGL  S++LNCAS+L NVLSVS  TGLLILQN+AV Q QRGAANGI+M+AMSLFKT
Sbjct  375   IANLSGLSQSLMLNCASILVNVLSVSAITGLLILQNKAVDQRQRGAANGIAMTAMSLFKT  434

Query  1508  IGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQ  1654
             +GPA  G L S S+ R +A F+PG  +VFFVLNV  L+G+ +TFKPFL+
Sbjct  435   VGPAGAGILFSLSERRLNASFLPGSHMVFFVLNVIVLVGVALTFKPFLK  483



>ref|XP_010492148.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Camelina 
sativa]
Length=487

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/493 (58%), Positives = 364/493 (74%), Gaps = 23/493 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE   E LL+  +            Y + C GC+VE +K+   G P   + F+ ++ L 
Sbjct  1     MAEEYKEALLENHK------------YHDGCPGCKVEQMKQLRRGYPYLELSFVWIIVLS  48

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              +LPISSL+PFLY+MI DF +A+ E+DI +YAG+VG SFMLGRALTSV WGI+ADRYGRK
Sbjct  49    TSLPISSLYPFLYYMIDDFGVAKTEKDIGFYAGFVGCSFMLGRALTSVFWGIVADRYGRK  108

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             P++++GT+++ IFNA+FGLSVN+WMAI TRFLLG+   ++GTM+AYASEI R EY A  +
Sbjct  109   PIILLGTISIAIFNALFGLSVNFWMAIGTRFLLGSFNCLLGTMKAYASEIFRDEYQATAM  168

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             SAVSTAWGIGL+IGPA+GG+ AQPA+KYP +FS ES FG+F Y LPC  IS FAL+ TV+
Sbjct  169   SAVSTAWGIGLIIGPALGGFLAQPADKYPNVFSQESIFGRFRYALPCFTISAFALLVTVL  228

Query  926   SFWLPETMHThkkehkeehDVSQNSKQPEHEVPTS-----------QKSLLKNWPLISSI  1072
               ++PET+H HK++     +  +  +   HE   S            +SLLKNWPL+SSI
Sbjct  229   CCFIPETLHNHKQDSTSHDESYEILEDGSHESTASTGKAGKNDRKASQSLLKNWPLMSSI  288

Query  1073  LVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVE  1252
              VYCV  LHD AY EIF+LWA SPRK GGLSY+T DVG VLAI+G+GL  FQ+F YP  E
Sbjct  289   FVYCVLCLHDTAYSEIFALWANSPRKYGGLSYSTNDVGTVLAISGLGLFFFQVFVYPFAE  348

Query  1253  KVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQ  1432
             K+LGPV+++R   AL IP+  +YP+IA +SGL LS++LNCAS+L NVLSVS  TGLLILQ
Sbjct  349   KLLGPVLVTRFAGALMIPIQMSYPFIADMSGLSLSLMLNCASILINVLSVSAITGLLILQ  408

Query  1433  NRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvf  1612
             NRAV Q QRGAANGI+M+AMSLFKT+GPA  G L SWS+ R +A F+PG  +VFFVLNV 
Sbjct  409   NRAVDQSQRGAANGIAMTAMSLFKTVGPAGAGILFSWSERRLNAAFLPGSHMVFFVLNVI  468

Query  1613  ellglIMTFKPFL  1651
              ++G+ +TFKPFL
Sbjct  469   VVVGVALTFKPFL  481



>ref|XP_010419976.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1 [Camelina sativa]
Length=487

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/493 (58%), Positives = 364/493 (74%), Gaps = 23/493 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE   E LL+  +            Y + C GC+VE +K+   G P   + F+ ++ L 
Sbjct  1     MAEEYKEALLENHK------------YHDGCPGCKVEQMKQLRRGYPYLELSFVWIIVLS  48

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              +LPISSL+PFLY+MI DF +A+ E+DI +YAG+VG SFMLGRALTSV WGI+ADRYGRK
Sbjct  49    TSLPISSLYPFLYYMIDDFGVAKTEKDIGFYAGFVGCSFMLGRALTSVFWGIVADRYGRK  108

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             P++++GT+++ IFNA+FGLSVN+WMAI TRFLLG+   ++GTM+AYASEI R EY A  +
Sbjct  109   PIILLGTISIAIFNALFGLSVNFWMAIGTRFLLGSFNCLLGTMKAYASEIFRDEYQATAM  168

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             SAVSTAWGIGL+IGPA+GG+ AQPA+KYP +FS ES FG+F Y LPC  IS FAL+ TV+
Sbjct  169   SAVSTAWGIGLIIGPALGGFLAQPADKYPNVFSQESIFGRFRYALPCFTISAFALLVTVL  228

Query  926   SFWLPETMHThkkehkeehDVSQNSKQPEHEVPTS-----------QKSLLKNWPLISSI  1072
               ++PET+H HK++     +  +  +   HE   S            +SLLKNWPL+SSI
Sbjct  229   CCFIPETLHNHKQDSTSHDESYEILEAGSHESTASTGKAGKNDRKASQSLLKNWPLMSSI  288

Query  1073  LVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVE  1252
              VYCV  LHD AY EIF+LWA SPRK GGLSY+T DVG VLAI+G+GL  FQ+F YP  E
Sbjct  289   FVYCVLCLHDTAYSEIFALWANSPRKYGGLSYSTNDVGTVLAISGLGLFFFQVFVYPFAE  348

Query  1253  KVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQ  1432
             K+LGPV+++R   AL IP+  +YP+IA +SGL LS++LNCAS+L NVLSVS  TGLLILQ
Sbjct  349   KLLGPVLVTRFAGALMIPIQMSYPFIADMSGLSLSLMLNCASILINVLSVSAITGLLILQ  408

Query  1433  NRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvf  1612
             NRAV Q QRGAANGI+M+AMSLFKT+GPA  G L SWS+ R +A F+PG  +VFFVLNV 
Sbjct  409   NRAVDQSQRGAANGIAMTAMSLFKTVGPAGAGILFSWSERRLNAAFLPGSHMVFFVLNVI  468

Query  1613  ellglIMTFKPFL  1651
              ++G+ +TFKPFL
Sbjct  469   VVVGVALTFKPFL  481



>ref|XP_010492150.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Camelina 
sativa]
Length=476

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/457 (59%), Positives = 351/457 (77%), Gaps = 1/457 (0%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y E C GC V+ +KR   G P   +F + ++ LC+ LPISSLFPF+YFMI DF IA++EE
Sbjct  15    YHEGCPGCEVDQMKRLRRGYPFWELFSVWIIVLCSTLPISSLFPFIYFMIDDFDIAKKEE  74

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG+VG SFM+GRALTSV+WG++ADRYGRKPV++IGT +VV+FN +FGLS+N+WMA
Sbjct  75    DIGFYAGFVGCSFMVGRALTSVIWGLVADRYGRKPVILIGTASVVVFNTLFGLSLNFWMA  134

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             +ITRF LG+  G++G ++AYA E  R EY  L +SAVSTAWGIGL+IGPA+GG+ AQPA 
Sbjct  135   VITRFCLGSFNGLVGPIKAYAVETFRDEYQGLALSAVSTAWGIGLIIGPAIGGFLAQPAT  194

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             +YP++FS +S FGKFPYFLPC +IS FA + T+ S W+PET+H HK +  +  D  ++  
Sbjct  195   QYPSLFSQDSIFGKFPYFLPCFVISFFAFLVTIFSLWIPETLHNHKFDDVQSFDAVKDDP  254

Query  1004  QPEHEVPTSQK-SLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTAD  1180
             +        +K SLLKNWPL+SSI+VYC+F LH++AY EIFSLWA SPRK GGL Y+TAD
Sbjct  255   ESNKVAEKKEKSSLLKNWPLMSSIIVYCIFSLHNMAYSEIFSLWANSPRKFGGLGYSTAD  314

Query  1181  VGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSV  1360
             VG VLAI+G GLL+FQL  Y   E+ LGP++++RI   L++ +LSTYP IA LSG+ L++
Sbjct  315   VGSVLAISGFGLLVFQLSLYSYAERNLGPIIVTRICGILALVVLSTYPLIAKLSGVALTL  374

Query  1361  VLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLS  1540
              +N AS+ KNV   S  TG  ILQNRAV Q+QRGAANGI+M+AMS+ K IGP A G + S
Sbjct  375   AVNSASVAKNVFGSSTITGTFILQNRAVGQDQRGAANGIAMTAMSICKAIGPGAAGVIFS  434

Query  1541  WSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             WS+ RQDA F+PG Q+VFF+LNV   LG++ TFKPFL
Sbjct  435   WSEKRQDASFLPGTQMVFFILNVVLALGVLWTFKPFL  471



>ref|XP_010453469.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Camelina 
sativa]
 ref|XP_010453470.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Camelina 
sativa]
Length=487

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/493 (58%), Positives = 363/493 (74%), Gaps = 23/493 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE   E LL++ +            Y E C GC+VE +K+   G P   + F+ ++ L 
Sbjct  1     MAEEYKEALLEKHK------------YHEGCPGCKVEQMKQLRRGYPYLELSFVWIIVLS  48

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              +LPISSL+PFLY+MI DF +A+ E+DI +YAG+VG SFM GRALTSV WGI+ADRYGRK
Sbjct  49    TSLPISSLYPFLYYMIDDFGVAKTEKDIGFYAGFVGCSFMFGRALTSVFWGIVADRYGRK  108

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             P++++GT+++ IFNA+FGLSVN+WMAI TRFLLG+   ++GTM+AYASEI R EY A  +
Sbjct  109   PIILLGTISIAIFNALFGLSVNFWMAIGTRFLLGSFNCLLGTMKAYASEIFRDEYQATAM  168

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             SAVSTAWGIGL+IGPA+GG+ AQPA+KYP +FS ES FG+F Y LPC  IS FAL+ TV+
Sbjct  169   SAVSTAWGIGLIIGPALGGFLAQPADKYPNVFSQESIFGRFRYALPCFTISAFALLVTVL  228

Query  926   SFWLPETMHThkkehkeehDVSQNSKQPEHEVPTS-----------QKSLLKNWPLISSI  1072
               ++PET+H HK++     +  +  +   HE   S            +SLLKNWPL+SSI
Sbjct  229   CCFIPETLHNHKQDSTSHDESYEILEAGSHESTASTGKAGKNDRKASQSLLKNWPLMSSI  288

Query  1073  LVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVE  1252
              VYCV  LHD AY EIF+LWA SPRK GGLSY+T DVG VLAI+G+GL  FQ+F YP  E
Sbjct  289   FVYCVLCLHDTAYSEIFALWANSPRKYGGLSYSTNDVGTVLAISGLGLFFFQVFVYPFAE  348

Query  1253  KVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQ  1432
             K+LGPV+++R   AL IP+  +YP+IA +SGL LS++LNCAS+L NVLSVS  TGLLILQ
Sbjct  349   KLLGPVLVTRFAGALMIPIQMSYPFIADMSGLSLSLMLNCASILLNVLSVSAITGLLILQ  408

Query  1433  NRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvf  1612
             NRAV Q QRGAANGI+M+AMSLFKT+GPA  G L SWS+ R +  F+PG  +VFFVLNV 
Sbjct  409   NRAVDQSQRGAANGIAMTAMSLFKTVGPAGAGILFSWSERRLNTAFLPGSHMVFFVLNVI  468

Query  1613  ellglIMTFKPFL  1651
              ++G+ +TFKPFL
Sbjct  469   VVVGVALTFKPFL  481



>ref|XP_010557807.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Tarenaya 
hassleriana]
 ref|XP_010557808.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Tarenaya 
hassleriana]
 ref|XP_010557809.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Tarenaya 
hassleriana]
Length=477

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/461 (59%), Positives = 352/461 (76%), Gaps = 6/461 (1%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y + C GC+VE +K    G P + + F+ ++ L  +LPISSL+PFLY+MI DF IA+ E+
Sbjct  14    YHDECPGCKVEQMKERRRGFPFRELVFVWIIVLSTSLPISSLYPFLYYMIDDFGIAKTEK  73

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG+VGS+FMLGR +TSV WGI+ADRYGRKP++++GT+++ I N +FGLS+N+WMA
Sbjct  74    DIGFYAGFVGSAFMLGRGMTSVFWGIVADRYGRKPIILLGTISIAILNTLFGLSLNFWMA  133

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             + TRF LGA   ++GTM+AYA+EI R EY A+ +SAVSTAWGIGL+IGPA+GG+ AQPA+
Sbjct  134   VATRFFLGAFNCLLGTMKAYATEIFRDEYQAMAMSAVSTAWGIGLIIGPALGGFLAQPAD  193

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMH-----ThkkehkeehDV  988
             KYP IFS ES FG+FPY LPC  IS FAL+ TV   ++PET+H     T      E  + 
Sbjct  194   KYPNIFSKESIFGRFPYALPCFTISAFALLVTVWCCFIPETLHNHKQDTAYDYSYEALEA  253

Query  989   SQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSY  1168
             S+N+ + E     S  SLLKNWPL+SSI+VYCV  LHD AY EIF+LWA SPRK GGLS+
Sbjct  254   SENTVKDEGN-KDSNVSLLKNWPLMSSIIVYCVLCLHDTAYSEIFALWANSPRKYGGLSF  312

Query  1169  TTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGL  1348
             +T DVG VLAI+GIGL  FQ+  YP  E++LGP++++R    L IPL + YP+IA L+GL
Sbjct  313   STNDVGAVLAISGIGLFFFQVTIYPFAERLLGPILVTRFSGVLMIPLQTCYPFIATLTGL  372

Query  1349  CLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGG  1528
              LS+VLNCAS+L NVLSVS  TGLLILQN+AV Q QRGAANGI+M+AMSLFK +GPAA G
Sbjct  373   SLSLVLNCASILLNVLSVSAITGLLILQNKAVDQRQRGAANGIAMTAMSLFKAMGPAAAG  432

Query  1529  SLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             +L SWS+ R DA F+PG   VFFVLNV  ++G+ +TF+PFL
Sbjct  433   ALFSWSERRLDAAFLPGAHTVFFVLNVIVVVGVALTFRPFL  473



>ref|XP_010453500.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Camelina 
sativa]
Length=483

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/477 (58%), Positives = 358/477 (75%), Gaps = 10/477 (2%)
 Frame = +2

Query  245   EQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLY  424
             E N   LE +   Y   C+GC+VE +K+   G P   + F+ ++ L  +LPISSL+PFLY
Sbjct  4     EYNAALLEKQ--IYHAGCSGCKVEQMKQLRRGYPYLELAFVWIIVLSTSLPISSLYPFLY  61

Query  425   FMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviF  604
              MI DF +AE E+DI +YAG+VG SFM GRALTS+ WG+++DRYGRKP++++GT+++ I 
Sbjct  62    SMIEDFGVAESEKDIGFYAGFVGCSFMFGRALTSLSWGMVSDRYGRKPIILVGTISIAIL  121

Query  605   NAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVI  784
             NA+FGLSVN+WMAI TRFLLG+   ++GTM+AYASEI R EY A  +SAVSTAWGIGL++
Sbjct  122   NALFGLSVNFWMAIGTRFLLGSFNCLLGTMKAYASEIFREEYQATAMSAVSTAWGIGLIV  181

Query  785   GPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkk  964
             GPA+GG+ AQPA+KYP +FS +S FG+F Y LPC  IS FALV TV+  ++PET+H HK 
Sbjct  182   GPALGGFLAQPADKYPNVFSKDSIFGRFRYALPCFTISAFALVVTVLCCFIPETLHNHKL  241

Query  965   ehkeehD--------VSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEI  1120
             + K   D         +  +    +E   SQ SLLKNWPL+SSI+VYC+  LHD AY EI
Sbjct  242   DSKAYDDSLETLEESSASTTNAGRNERKASQVSLLKNWPLMSSIIVYCILCLHDTAYSEI  301

Query  1121  FSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALS  1300
             F+LWA SPRK GGL+Y+T DVG VLAI+G+GL  FQ+F YP  E++LGPV+++R   AL 
Sbjct  302   FALWANSPRKYGGLNYSTNDVGTVLAISGVGLFSFQVFVYPFAERLLGPVLVTRFAGALM  361

Query  1301  IPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGIS  1480
             IP+  +YP+IA LSGL  S++LNCAS+L NVLSVS  TGLLILQN+AV Q QRGAANGI+
Sbjct  362   IPMQISYPFIANLSGLSQSIMLNCASILLNVLSVSAITGLLILQNKAVEQSQRGAANGIA  421

Query  1481  MSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             M+AMSLFKT+GPA  G L SWS+ R DA F+PG  +VFFVLNV  ++G+ +TFKPFL
Sbjct  422   MTAMSLFKTVGPAGAGILFSWSERRLDAAFLPGSHMVFFVLNVIVMVGVALTFKPFL  478



>gb|KDO47759.1| hypothetical protein CISIN_1g011424mg [Citrus sinensis]
Length=442

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/444 (63%), Positives = 347/444 (78%), Gaps = 23/444 (5%)
 Frame = +2

Query  206   MAEGNT---EPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMV  376
             MA G     EP LK  ++           Y E+C GC+V+ LK   +G+PI  +F I ++
Sbjct  1     MAAGEEKLREPFLKNEKR-----------YYENCPGCKVDQLKDTKSGLPITELFSIWII  49

Query  377   TLCAALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRY  556
              LC ALPISSLFPFLYFMI+DF IA+REEDI  YAGYVGSSFM GRALTSV WG++ADRY
Sbjct  50    VLCTALPISSLFPFLYFMIKDFQIAKREEDIGSYAGYVGSSFMFGRALTSVFWGLVADRY  109

Query  557   GRKPvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHA  736
             GRKPV+I+GT +VVIFN +FGLSVN+WMA++TRFLLG+L G++G ++AYA EI R E+ A
Sbjct  110   GRKPVIIMGTASVVIFNTLFGLSVNFWMAVLTRFLLGSLNGLLGPIKAYACEIFREEHQA  169

Query  737   LGISAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVA  916
             LG+S VSTAWGIGL+IGPA+GG+ AQPAEKYP +FS+ES FGKFPYFLPCL IS+FA   
Sbjct  170   LGLSTVSTAWGIGLIIGPALGGFLAQPAEKYPNLFSSESLFGKFPYFLPCLCISLFAFGV  229

Query  917   TVMSFWLPETMHThkkehkeehDVSQNS--------KQPEHEVPTSQKSLLKNWPLISSI  1072
             T+ +FWLPET+H    +  +  DVS ++        K+ E    T +KSLLKNWPL+SSI
Sbjct  230   TIAAFWLPETLHR-HNDDDDSCDVSYDALESASAEVKEEEGREATPKKSLLKNWPLMSSI  288

Query  1073  LVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVE  1252
             +VYCVF LHD+AY EIFSLWA SP+KLGGL+Y+T  VG+VLAITG  LL+FQL  YP +E
Sbjct  289   IVYCVFSLHDMAYSEIFSLWANSPKKLGGLNYSTQMVGEVLAITGFSLLVFQLSLYPFLE  348

Query  1253  KVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQ  1432
             ++LGP+M++RI   L+IPLL++YPYIA+LSG  L+ +LNCAS++KN+LSVSI TGL ILQ
Sbjct  349   RILGPIMVARIAGVLTIPLLTSYPYIAMLSGFGLAFLLNCASVVKNLLSVSIITGLFILQ  408

Query  1433  NRAVSQEQRGAANGISMSAMSLFK  1504
             NRAV Q+QRGAANGI+M+ MSLFK
Sbjct  409   NRAVDQDQRGAANGIAMTGMSLFK  432



>ref|XP_007016707.1| Zinc induced facilitator-like 2 [Theobroma cacao]
 gb|EOY34326.1| Zinc induced facilitator-like 2 [Theobroma cacao]
Length=923

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/484 (59%), Positives = 380/484 (79%), Gaps = 12/484 (2%)
 Frame = +2

Query  245   EQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLY  424
             E++   L +    Y E+C GC+ + LK+   GVP KH+ FI +V+LC ALPISSLFPF+Y
Sbjct  2     EESTTSLLEREVEYYENCPGCKTDRLKQEQTGVPYKHLSFIWIVSLCTALPISSLFPFVY  61

Query  425   FMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviF  604
             FMIRDFHIA+REEDI +YAG+VGSSFM+GRALTS+ WG++ADRYGRKP++++G  +VV+F
Sbjct  62    FMIRDFHIAKREEDIGFYAGFVGSSFMVGRALTSLFWGVVADRYGRKPIILMGIFSVVVF  121

Query  605   NAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVI  784
             N +FGLS+++WMA+  RFLLG    ++GT+RAYASE+CR EY AL +S VST+ GIGL+I
Sbjct  122   NTLFGLSMSFWMALSMRFLLGCFNSLLGTIRAYASEVCREEYRALALSIVSTSRGIGLII  181

Query  785   GPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkk  964
             GPA+GG+FAQPAEKYP +F+  S FG+FPYFLPCLIIS++++   +   WLPET+H H  
Sbjct  182   GPAIGGFFAQPAEKYPNVFTESSIFGRFPYFLPCLIISVYSVGVLIACRWLPETLHRHGG  241

Query  965   ehkeehDV------------SQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIA  1108
             +  ++HD              +N+     +  T + +LLKNWPL+S+I+VYCVF L ++A
Sbjct  242   KGNQKHDPYDMSEPCLNESGRKNNIVELEDRQTHKLNLLKNWPLMSTIIVYCVFSLQEMA  301

Query  1109  YLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIG  1288
             Y EIFSLWAVS +K GGLS+++ +VG+VLAI+G GLLLFQL  YP VEK+LGP+M++R+ 
Sbjct  302   YSEIFSLWAVSDKKYGGLSFSSQEVGEVLAISGFGLLLFQLLLYPPVEKILGPLMVTRLS  361

Query  1289  AALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAA  1468
             AA+SIPLLS YPYIA+LSG+ L +V+NCAS+L+N LSVS+ TGL ILQN AV Q QRGAA
Sbjct  362   AAISIPLLSCYPYIAMLSGVVLHLVINCASILRNTLSVSLVTGLFILQNNAVPQSQRGAA  421

Query  1469  NGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPF  1648
             NGIS++AMS+FK  GPA GG+L SW+Q RQ   F+PGDQ+VFFVLN+ +++GL++TFKPF
Sbjct  422   NGISITAMSVFKAFGPAGGGALFSWAQKRQVTNFLPGDQMVFFVLNLVQVVGLMLTFKPF  481

Query  1649  LQLP  1660
             L  P
Sbjct  482   LTEP  485


 Score =   515 bits (1327),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 269/437 (62%), Positives = 349/437 (80%), Gaps = 12/437 (3%)
 Frame = +2

Query  392   LPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPv  571
             LPISSLFPF+YFMIRDFHIA+REEDI +YAG++GSSFM+GRALTS+ WG++AD+YGRKP+
Sbjct  487   LPISSLFPFVYFMIRDFHIAKREEDIGFYAGFIGSSFMVGRALTSLFWGVVADQYGRKPI  546

Query  572   viigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISA  751
             +++G  +VV+FN +FGLS ++WMA+  RFLLG    +IGT RAYASE+CR EY AL +S 
Sbjct  547   ILMGIFSVVVFNTLFGLSTSFWMALSMRFLLGCFNSLIGTARAYASEVCREEYQALALSV  606

Query  752   VSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSF  931
             VST+WGIGL+IGPA+GG+FAQPAEKYP IF+  S FG+FPYFLPCLIIS++++   +   
Sbjct  607   VSTSWGIGLIIGPAIGGFFAQPAEKYPNIFAESSIFGRFPYFLPCLIISVYSIGVLIACR  666

Query  932   WLPETMHThkkehkeehDV------------SQNSKQPEHEVPTSQKSLLKNWPLISSIL  1075
             WLPET+H H  +  ++HD              +N+     E  T + +LL+NWPL+S+I+
Sbjct  667   WLPETLHRHGGKGNQKHDPYDMSEPSLNESGQKNNIVELEERQTHKPNLLRNWPLMSTII  726

Query  1076  VYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEK  1255
             VYCVF L ++AY EIFSLWAVS +K GGLS+++ DVG+VLAI+G GLLLFQL  YP VEK
Sbjct  727   VYCVFSLQEMAYSEIFSLWAVSDKKYGGLSFSSQDVGEVLAISGFGLLLFQLLLYPPVEK  786

Query  1256  VLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQN  1435
             +LGP+M++R+ AA+SIPLLS YPYIA+LS + L +V+NCAS+L+N LSVS+ TGL ILQN
Sbjct  787   ILGPLMVTRLSAAISIPLLSCYPYIAMLSAVVLHLVINCASILRNALSVSLVTGLFILQN  846

Query  1436  RAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfe  1615
              AV Q QRGAANGIS++AMS+FK  GPA GG+L SW+Q RQ A F+PGDQ+VFFVLN+ +
Sbjct  847   NAVPQSQRGAANGISITAMSVFKAFGPAGGGALFSWAQKRQVATFLPGDQMVFFVLNLVQ  906

Query  1616  llglIMTFKPFLQLPED  1666
             ++GL++TFKPFL  P  
Sbjct  907   VVGLMLTFKPFLAEPRS  923



>ref|XP_004516549.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Cicer 
arietinum]
Length=461

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/444 (60%), Positives = 341/444 (77%), Gaps = 7/444 (2%)
 Frame = +2

Query  263   LEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDF  442
             LE +YF   + C GC+VE  K  + GV I ++  I MV LC+ LP +SLFPFLYFM++DF
Sbjct  11    LEKQYF---KDCPGCKVEQAKELNQGVSITNLLVIWMVVLCSTLPAASLFPFLYFMVKDF  67

Query  443   HIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGL  622
             +IA+ E DISYYAGYVGSSFMLGR LTSVLWGI++DRYGRKPV+IIGT+TVVIFN +FGL
Sbjct  68    NIAKSEADISYYAGYVGSSFMLGRTLTSVLWGIVSDRYGRKPVMIIGTITVVIFNTLFGL  127

Query  623   SVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGG  802
             S ++WMA+ITRFLLG L G IG ++AYA+E+ R E+ ALG+S VS AWG GL+IGPA+GG
Sbjct  128   STSFWMAVITRFLLGCLNGAIGPVKAYATELFREEHQALGLSTVSAAWGTGLIIGPALGG  187

Query  803   YFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeeh  982
             Y AQP EKYP IF  +SF+ KFPYFLPC IIS  A +  +   W+PET+H H   ++ + 
Sbjct  188   YLAQPVEKYPNIFPKDSFWDKFPYFLPCFIISGLAFLVVIGCIWIPETLHNHNGSNESKD  247

Query  983   DVS--QNSKQPEHEVPTSQK--SLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRK  1150
             D    +N      +  T QK  +L  NWP +SSI+VYCVF LHDIAY E+FSLWAVSP +
Sbjct  248   DAETLENGSNMVDKEKTVQKNENLFMNWPFMSSIIVYCVFSLHDIAYQEVFSLWAVSPSR  307

Query  1151  LGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYI  1330
             LGGLS+TT DVG VL+I+G+ L+++QL  Y  +EKV GPV I+RI    SIPLL +YP+I
Sbjct  308   LGGLSFTTDDVGNVLSISGLALVIYQLTLYQYIEKVFGPVGIARITGFFSIPLLQSYPFI  367

Query  1331  ALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTI  1510
             A+LSG+ L +V++ AS+++N+++V+ITT L ++QN+AV Q QRGAANGI M+AMS FK I
Sbjct  368   AMLSGITLYIVISIASIMRNIIAVTITTSLFLIQNQAVEQRQRGAANGICMTAMSFFKAI  427

Query  1511  GPAAGGSLLSWSQLRQDAKFMPGD  1582
             GPAAGG++L+WSQ R DA F+PG+
Sbjct  428   GPAAGGTILTWSQKRMDASFLPGN  451



>ref|XP_003542780.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoformX1 
[Glycine max]
 ref|XP_006594342.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Glycine max]
Length=485

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/476 (59%), Positives = 360/476 (76%), Gaps = 10/476 (2%)
 Frame = +2

Query  242   SEQNGGH--LEDEYFCYDESCAGCRVELLKR--ADAGVPIKHVFFISMVTLCAALPISSL  409
             +E+NG    LE +Y+   E C GC+V+  K      GV   ++F I +V LCAALPISSL
Sbjct  2     TEKNGKQPLLERKYY---EDCPGCKVDQAKELSKGQGVSFTNLFIIWVVVLCAALPISSL  58

Query  410   FPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtv  589
             +PFLYFM+RDF+IA+ E DIS YAGYVGS+FMLGR LTS+LWG IADR+GRKPV +IG +
Sbjct  59    YPFLYFMVRDFNIAKTEADISSYAGYVGSAFMLGRCLTSLLWGTIADRFGRKPVFVIGII  118

Query  590   tvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWG  769
              VVIFN +FGLS ++WMA+I RFL+G+L G++GT +AYA+EI R E+ ALG+S VS AWG
Sbjct  119   AVVIFNTLFGLSTSFWMAVIMRFLMGSLNGLLGTAKAYATEIFREEHQALGLSTVSAAWG  178

Query  770   IGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETM  949
             IGL+IGPA+GGY AQP EKYP IF  +SF+ KFPYFLP  ++S  A V  +   W+PET+
Sbjct  179   IGLIIGPALGGYLAQPVEKYPHIFPKDSFWDKFPYFLPNFVVSALAFVVAIGCIWIPETL  238

Query  950   HThkkehkeehDVSQNSKQPEHEVPTSQK--SLLKNWPLISSILVYCVFQLHDIAYLEIF  1123
             H H   ++   D    S    +E  T QK  +LL NWPL+SSI+ YCVF LHDI Y E+F
Sbjct  239   HNHNCSNESIDDAENGSSGAGNE-KTIQKNENLLLNWPLMSSIIAYCVFSLHDITYTEVF  297

Query  1124  SLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSI  1303
             SLW+VSP+++GGL++T+ DVG +L+I+G+ L+++QL  YP VEK  GP+ I+RI A LSI
Sbjct  298   SLWSVSPQRMGGLNFTSDDVGNILSISGVALIIYQLTLYPSVEKASGPIGIARISAMLSI  357

Query  1304  PLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISM  1483
             PLL +Y +IALLSGL L +VL+ AS+LKN+LS++I TGL +LQNRAV Q QRG ANGI++
Sbjct  358   PLLQSYSFIALLSGLALYIVLSIASILKNILSITIVTGLFLLQNRAVEQHQRGVANGIAV  417

Query  1484  SAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             + MSLF  IGPAAGG++L+WSQ R DA F+PG  +VFF LN+ E LGL+M FKPFL
Sbjct  418   TGMSLFNAIGPAAGGAVLTWSQKRMDASFLPGTHMVFFALNIVEALGLLMLFKPFL  473



>ref|XP_004516552.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Cicer arietinum]
Length=486

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/467 (59%), Positives = 355/467 (76%), Gaps = 7/467 (1%)
 Frame = +2

Query  263   LEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDF  442
             LE +YF   + C GC+VE  K  + GV I ++  I MV LCA LP  SLFPFLYFM+RDF
Sbjct  11    LEKQYF---KDCPGCKVEQAKELNQGVSITNLLIIWMVVLCATLPAISLFPFLYFMVRDF  67

Query  443   HIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGL  622
             ++A+ E DISYYA YVGSSFMLGR+LT+VLWG+I+DRYGRKPV+IIG V VVIFN +FGL
Sbjct  68    NVAKEEADISYYADYVGSSFMLGRSLTAVLWGMISDRYGRKPVIIIGIVAVVIFNTLFGL  127

Query  623   SVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGG  802
             S ++WMAI TRFLLG+L G++G ++AYA+E+ R E+ A+G+S VS AWGIGL+IGPA+GG
Sbjct  128   STSFWMAITTRFLLGSLNGVLGPVKAYATELFREEHQAIGLSTVSVAWGIGLIIGPALGG  187

Query  803   YFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeeh  982
             Y +QPA+KYP IF   SF  KFPYFLPC IIS FAL   +   W+PET+H H   +K + 
Sbjct  188   YLSQPAQKYPKIFPKYSFCDKFPYFLPCFIISGFALTVAIACIWIPETLHNHNDSNKSKD  247

Query  983   DV----SQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRK  1150
             DV    ++  K  +       ++L  NWPL+SSI+ Y +F LHDIAY E+FSLW+VSP  
Sbjct  248   DVEALENETDKVEKQRTVQHNENLFMNWPLMSSIIAYSIFALHDIAYQEVFSLWSVSPLG  307

Query  1151  LGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYI  1330
             LGGL++TT DVG VL+I+G+ L+++ L  YP VEK  GP+ I+RI    SIPLL +YP+I
Sbjct  308   LGGLNFTTDDVGNVLSISGVVLVIYNLAVYPYVEKTCGPIGIARITGICSIPLLQSYPFI  367

Query  1331  ALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTI  1510
             A+LSG+ L +V++ AS+LKN+++V+ITTGL ++QNR V Q QRGAANGISM+ MSLFK I
Sbjct  368   AMLSGITLYIVISIASILKNIIAVTITTGLFLIQNRVVEQHQRGAANGISMTVMSLFKAI  427

Query  1511  GPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             GPA GG++L+WSQ R DA F+PG Q+VFF LN+ E LG+++ FKPFL
Sbjct  428   GPATGGTILTWSQKRMDASFLPGTQMVFFFLNLVEGLGILLMFKPFL  474



>ref|XP_010492151.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Camelina 
sativa]
Length=477

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/458 (61%), Positives = 355/458 (78%), Gaps = 2/458 (0%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y E C GC+V+ +KR   G P   +F + ++ LC  LPISSLFPFLYFMI DF IA++EE
Sbjct  15    YHEGCPGCKVDQMKRLRRGFPFSELFSVWIIVLCTTLPISSLFPFLYFMIDDFDIAKKEE  74

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG+VG SFMLGRALTSV+ GI++DRYGRKPV++IGT +VVIFN +FGLS+N+WMA
Sbjct  75    DIGFYAGFVGCSFMLGRALTSVICGILSDRYGRKPVILIGTSSVVIFNTLFGLSLNFWMA  134

Query  644   IITRFLLGALCGIIG-TMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPA  820
             IITRF LG   G++G  ++AYA E  R EY +L +SAVSTAWGIGL+IGPA+GG+ AQPA
Sbjct  135   IITRFCLGCFNGLLGGPIKAYAVETFRDEYQSLALSAVSTAWGIGLIIGPAIGGFLAQPA  194

Query  821   EKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNS  1000
             ++YP++FS +S FGKFPY LPC  IS+FA + TV+S W+PET+H HK +  E  D  ++ 
Sbjct  195   KQYPSLFSQDSIFGKFPYCLPCFAISIFAFLVTVISLWMPETLHNHKSDEDESFDAVKDD  254

Query  1001  KQPEHEVPTSQK-SLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTA  1177
              + +     ++K SL KNWPL+SSI+VYC+F LH++AY EIFSLWA SPRK GGL+Y+TA
Sbjct  255   PESKKVAERNEKKSLWKNWPLMSSIIVYCIFSLHNMAYTEIFSLWANSPRKFGGLAYSTA  314

Query  1178  DVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLS  1357
             +VG VLA++G+GLL+FQL  Y   E+ LGPV+++RI   LS+ +LSTYP IA LSG+ L+
Sbjct  315   EVGSVLAVSGVGLLIFQLSLYSYAERNLGPVVVTRICGILSVVVLSTYPLIAKLSGVALT  374

Query  1358  VVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLL  1537
             V L  AS+ KNVLS S  TG  ILQNRAV Q+QRGAANGISM+AMS+ K IGP A G + 
Sbjct  375   VALYSASVAKNVLSTSTITGTFILQNRAVGQDQRGAANGISMTAMSICKAIGPGAAGVIF  434

Query  1538  SWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             SWS+ RQDA F+PG Q+VFF+LNV   LG++ TFKPFL
Sbjct  435   SWSEKRQDASFLPGTQMVFFILNVVLALGVLWTFKPFL  472



>ref|XP_011042021.1| PREDICTED: probable peptide/nitrate transporter At3g43790 [Populus 
euphratica]
Length=490

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/493 (58%), Positives = 380/493 (77%), Gaps = 18/493 (4%)
 Frame = +2

Query  233   LKQSEQNGGHLED--EYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISS  406
             + ++E     LE   EY+   E+C GC+++ L     GVP +++ +I +V+LC ALPISS
Sbjct  1     MARTESRNALLETTREYY---ENCPGCKIDRLNEEQRGVPYRNLSYIWIVSLCTALPISS  57

Query  407   LFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigt  586
             LFPF+YFMIRDFHIAEREEDI +YAG+VGSSFM+GRALTS  WG++ADRYGRKP+++IGT
Sbjct  58    LFPFIYFMIRDFHIAEREEDIGFYAGFVGSSFMIGRALTSFFWGLLADRYGRKPIILIGT  117

Query  587   vtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAW  766
              +VV+ NA+FGLS ++WMA+  RFLLG    ++GT+RAYASE+CR EY ++ +S VST+ 
Sbjct  118   SSVVVLNALFGLSTSFWMALSMRFLLGCFNSLLGTIRAYASEVCREEYRSVALSVVSTSR  177

Query  767   GIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPET  946
             GIG++IGPA+GG+ AQPAE +P +F+  S FG+FPYFLPCL+IS++A+   V  +WLPET
Sbjct  178   GIGMIIGPAIGGFLAQPAENFPNLFAESSIFGRFPYFLPCLVISVYAVGVLVACWWLPET  237

Query  947   MHThkkehkeehD-------VSQNSKQPEH-----EVPTSQK-SLLKNWPLISSILVYCV  1087
             +H H K+  +  D        ++ S + ++     E   SQK +LL+NWPL+S I+VYCV
Sbjct  238   LHMHDKKISKRCDSCDVLEASAEESDEKDYVTEVKERKISQKANLLRNWPLMSVIVVYCV  297

Query  1088  FQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGP  1267
             F L +IAY EIFSLWAVS +K GGLS+++ DVG+VLAI+G GLLLFQL  YP +EKV GP
Sbjct  298   FSLQEIAYAEIFSLWAVSDKKYGGLSFSSQDVGEVLAISGFGLLLFQLLLYPPIEKVFGP  357

Query  1268  VMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVS  1447
             + ++R+ AA+SIPLL++YPYIA+LSG+ L +V+N AS+L+N LSV++ TGL ILQN AV 
Sbjct  358   LTVTRLSAAVSIPLLASYPYIAMLSGITLHLVINIASVLRNTLSVTLVTGLFILQNNAVP  417

Query  1448  QEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellgl  1627
             Q QR AANGISM+AMS+FK  GPA GG+L SW+Q RQ A F+PGDQLVFFVLN+ + +GL
Sbjct  418   QSQRAAANGISMTAMSVFKAFGPAGGGALFSWAQKRQVAAFLPGDQLVFFVLNLVQFIGL  477

Query  1628  IMTFKPFLQLPED  1666
             ++TFKPFL  P +
Sbjct  478   VLTFKPFLAQPHE  490



>ref|XP_004135359.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Cucumis 
sativus]
 ref|XP_004169125.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Cucumis 
sativus]
 gb|KGN51612.1| hypothetical protein Csa_5G585390 [Cucumis sativus]
Length=489

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/496 (54%), Positives = 361/496 (73%), Gaps = 26/496 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             M + N E LLK+        ED Y+   E+C GC++E   +   G P + +  +S++ L 
Sbjct  1     MGDENRERLLKE--------EDYYY---ENCPGCKMEQYNQLHRGFPFRQLLMVSLIVLI  49

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
               LPISS FPFLYFM+RDF+IAE  EDI +YAG++G+SFM+GRALTSV WGI+ADRYGRK
Sbjct  50    TGLPISSFFPFLYFMVRDFNIAENVEDIGFYAGFIGASFMVGRALTSVFWGIVADRYGRK  109

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV++ GT  V  FN +FGLS+NYWMAIITRFLLG+L GI+G ++AYASE    EY ++ +
Sbjct  110   PVILFGTFIVFTFNILFGLSLNYWMAIITRFLLGSLNGILGPIKAYASESVNEEYQSIAM  169

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S +ST+WGI L++GPA+GG+ AQP EK+P IFS+E  FG+FPYFLPCL  S+ AL+  ++
Sbjct  170   STISTSWGIALIVGPAIGGFLAQPVEKFPGIFSSEGLFGRFPYFLPCLCTSLLALITGII  229

Query  926   SFWLPETMH-----------ThkkehkeehDVSQNSK---QPEHEVPTSQKSLLKNWPLI  1063
             S WLPE++H           +++       D + N         E+P S+ SL +NW L+
Sbjct  230   SLWLPESLHMHDKNVPSHSVSYEALEDRPGDCNGNESTLTNESKELP-SKPSLFRNWELM  288

Query  1064  SSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYP  1243
             SSI+VYC+F LHD+AY+EIFSLW VS R LGGLS+T+ DVG+VLAITG  LL+FQ   YP
Sbjct  289   SSIIVYCMFSLHDMAYVEIFSLWTVSSRTLGGLSFTSGDVGEVLAITGFSLLVFQSALYP  348

Query  1244  LVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLL  1423
              VE++ GP+M+SR+   LSIPLL+ YP ++L SG  L +++  AS+LKN+LSVSI TG+ 
Sbjct  349   YVERIFGPIMVSRVSGILSIPLLAMYPLLSLFSGAVLHIIVTLASILKNLLSVSIITGMF  408

Query  1424  ILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvl  1603
             I+QNRAV Q QRGAANGI+++ MS+ K IGPAAGG+LLSWSQ R +A F+PG  ++FF+L
Sbjct  409   IIQNRAVDQHQRGAANGIALTGMSICKAIGPAAGGALLSWSQKRLNAAFLPGPHMLFFIL  468

Query  1604  nvfellglIMTFKPFL  1651
             NV E + ++MTF+PFL
Sbjct  469   NVIEAIAVVMTFRPFL  484



>emb|CDX78535.1| BnaA03g04470D [Brassica napus]
Length=487

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/469 (59%), Positives = 357/469 (76%), Gaps = 13/469 (3%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y E C GC+VE +K+   G P   + F+ +V L  +LPISSL+PFLY+MI DF +A+ E+
Sbjct  16    YHEGCPGCKVENMKQLRTGYPYLELSFVWIVVLSTSLPISSLYPFLYYMIEDFGVAKTEK  75

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG++  SFM GRALTS+ WGI+ADRYGRKP++++GT+++ +FNA+FGLS+N+WMA
Sbjct  76    DIGFYAGFIACSFMFGRALTSIFWGIVADRYGRKPIILLGTISIAVFNALFGLSLNFWMA  135

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I  RFLLG+   ++GTM+AYASEI R EY A  +SAVSTAWGIGL+IGPA+GG+ AQPA+
Sbjct  136   IGMRFLLGSFNCLLGTMKAYASEIFRDEYQATAMSAVSTAWGIGLIIGPALGGFLAQPAD  195

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehD------  985
             KYP +FS ES FG+FPY LPC  IS FALV TV+  ++PET+H HK+++  + D      
Sbjct  196   KYPNVFSKESIFGRFPYALPCFTISAFALVVTVLCCFIPETLHNHKQDNTLDDDSYEIIE  255

Query  986   ------VSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPR  1147
                    +   K  +HE   SQ  LLKNWPL+SSI+VYCV  LHD AY EIF+LWA SPR
Sbjct  256   AAARDSTASTGKTEKHE-KASQGPLLKNWPLMSSIIVYCVLCLHDTAYSEIFALWANSPR  314

Query  1148  KLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPY  1327
             K GGL+Y+T DVG VLAI+G+GL  FQ+F YPL E++LGPV+++R   AL IP+  +YP+
Sbjct  315   KYGGLNYSTNDVGTVLAISGLGLFCFQVFVYPLAERLLGPVLVTRFAGALMIPIQMSYPF  374

Query  1328  IALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKT  1507
             IA LSGL  S++LNCAS+L NVLSVS  TGLLILQN+AV Q QRGAANGI+M+AMSLFKT
Sbjct  375   IANLSGLSQSLMLNCASILINVLSVSAITGLLILQNKAVEQRQRGAANGIAMTAMSLFKT  434

Query  1508  IGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQ  1654
             +GPA  G L S S+ R +A F+PG  +VFFVLNV  L+G+ +TFKPFL+
Sbjct  435   VGPAGAGILFSLSERRLNASFLPGSHMVFFVLNVIVLVGVALTFKPFLK  483



>dbj|BAE71198.1| putative transporter-like protein [Trifolium pratense]
Length=493

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/485 (58%), Positives = 361/485 (74%), Gaps = 21/485 (4%)
 Frame = +2

Query  224   EPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPIS  403
             EPLL++ +            Y + C GC+VE  K  + GV I  +  I MV L A LP +
Sbjct  9     EPLLEKKQ------------YYKDCPGCKVEQEKELNQGVSIIKLVIIWMVVLSATLPAA  56

Query  404   SLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviig  583
             SLFPFLYFM+RDF++A+ E DISYYAGYVGSSFMLGR+LTSV+WG+++DRYGRKPV+IIG
Sbjct  57    SLFPFLYFMVRDFNVAKEEADISYYAGYVGSSFMLGRSLTSVIWGMVSDRYGRKPVIIIG  116

Query  584   tvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVST-  760
              + VVIFN +FGLS ++WMAIITRFLLG+L G++G ++AYA+E+ R E+ A+G+S     
Sbjct  117   IIAVVIFNTLFGLSTSFWMAIITRFLLGSLNGVLGPVKAYATELFREEHQAIGLSTCDMI  176

Query  761   ----AWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMS  928
                 + GIGL+IGPA+GGY AQPAEKYP IF+ +SF+ KFPYFLPC IIS  AL   +  
Sbjct  177   SGMCSLGIGLIIGPAIGGYLAQPAEKYPQIFAKDSFWDKFPYFLPCFIISGLALTVAIAC  236

Query  929   FWLPETMHThkkehkeehDVS--QNSKQPEHEVPTSQKS--LLKNWPLISSILVYCVFQL  1096
              W+PET+H H   ++   D    +N      +  T QK+  L  NWPL+SSI+ Y VF L
Sbjct  237   IWIPETLHNHSGSNESTDDAEALENGSNRVEKQKTVQKNENLFMNWPLMSSIIAYSVFSL  296

Query  1097  HDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMI  1276
             HD+AY E+FSLWAVSP +LGGLS+TT DVG VL+I+G+ L+++QLF YP VEK  GP+  
Sbjct  297   HDVAYQEVFSLWAVSPPRLGGLSFTTDDVGNVLSISGLALVIYQLFIYPSVEKACGPIAF  356

Query  1277  SRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQ  1456
             +RI    SIPLL +YP+IA+LSG+ L +V++ ASMLKNV+SV+ITTGL ++QNR V Q Q
Sbjct  357   ARITGIFSIPLLQSYPFIAMLSGVSLYIVISIASMLKNVMSVTITTGLFLIQNRVVEQHQ  416

Query  1457  RGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMT  1636
             RGAANGISM+AMSLFK IGPAAGG++L+WSQ R DA  +PG Q+VFF LN+ E+LG++M 
Sbjct  417   RGAANGISMTAMSLFKAIGPAAGGTILTWSQKRMDASILPGTQMVFFFLNLVEILGILML  476

Query  1637  FKPFL  1651
             FKPFL
Sbjct  477   FKPFL  481



>ref|XP_009410441.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Musa 
acuminata subsp. malaccensis]
Length=485

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/496 (58%), Positives = 379/496 (76%), Gaps = 24/496 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE NTEPLLK+              Y + C GC+ +  K A +G+P K  F++ ++TLC
Sbjct  1     MAE-NTEPLLKRK------------VYFDGCPGCKQDRRKEASSGIPYKEFFYVWIITLC  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              ALPISSLFPF+YFMIRD H+A+REEDI +YAG+VG+SFM GRALTS+ WG++ADRYGRK
Sbjct  48    TALPISSLFPFIYFMIRDLHVAKREEDIGFYAGFVGASFMFGRALTSLFWGVVADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV+++G  +V IFN +FGLS +YWMAI TR LLG+L G++G ++AY+ E+CR+E+ ALG+
Sbjct  108   PVILLGIFSVTIFNTLFGLSTSYWMAITTRLLLGSLNGLLGPIKAYSIEVCRQEHQALGL  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S V+TAWGIGL++GPA+GG+FAQPAEKYP IFS +S FG+FPYFLPCL IS+FA+   + 
Sbjct  168   SLVTTAWGIGLIVGPALGGFFAQPAEKYPEIFSQDSLFGRFPYFLPCLCISLFAVCVLIG  227

Query  926   SFWLPETMH---ThkkehkeehDV-------SQNSKQPEHEVPTSQK-SLLKNWPLISSI  1072
             S WLPET+H   + KK      DV       S+     + E  T  K +L KNWPL+SS+
Sbjct  228   SLWLPETLHKHDSKKKGETTIEDVETPYSSDSKGHTDKDEESDTQPKANLFKNWPLMSSV  287

Query  1073  LVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVE  1252
             +VYC+F LHD+AY EIFSLWAVS +  GGLS+++ DVG+VL+I+G GLL+FQ+  YP +E
Sbjct  288   IVYCIFSLHDMAYTEIFSLWAVSDKSYGGLSFSSQDVGEVLSISGFGLLVFQILLYPRIE  347

Query  1253  KVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQ  1432
             K+LGPV   R+ + L++PLL+ YP+++ LSGL L++++NCAS+LKNVLSV I  GL ILQ
Sbjct  348   KLLGPVSSLRVASVLAVPLLAAYPFMSKLSGLQLTLIVNCASLLKNVLSVMIVIGLFILQ  407

Query  1433  NRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvf  1612
             N AVSQEQRGAANGI+M+AMS FK I PAAGG++ SW+Q RQ A F PGDQ+VFF+LNV 
Sbjct  408   NNAVSQEQRGAANGIAMTAMSFFKAIAPAAGGAIFSWAQKRQHASFFPGDQMVFFILNVV  467

Query  1613  ellglIMTFKPFLQLP  1660
             EL+GL+ +FKPFL  P
Sbjct  468   ELIGLLFSFKPFLIEP  483



>ref|XP_010909581.1| PREDICTED: probable peptide/nitrate transporter At3g43790 isoform 
X1 [Elaeis guineensis]
 ref|XP_010909583.1| PREDICTED: probable peptide/nitrate transporter At3g43790 isoform 
X1 [Elaeis guineensis]
Length=489

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/493 (58%), Positives = 367/493 (74%), Gaps = 25/493 (5%)
 Frame = +2

Query  218   NTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALP  397
             N  PLLK+              Y E+C GC+ +    A  G+P K  F+I  VTLC+ALP
Sbjct  4     NANPLLKK-------------VYHENCPGCKQDRRNEAHPGIPYKEFFYIWAVTLCSALP  50

Query  398   ISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvvi  577
             ISSLFPFLYFMIRD HI++REEDI +YAG+VGS+FM GRALTSV WG++ADRYGRKPV++
Sbjct  51    ISSLFPFLYFMIRDLHISKREEDIGFYAGFVGSAFMFGRALTSVFWGMVADRYGRKPVIV  110

Query  578   igtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVS  757
             I  V+V++FN +FGLS +Y MAI TR LLG LCG++G ++AYASE+CRRE+ ALG+S V+
Sbjct  111   ISIVSVIVFNTLFGLSTSYVMAITTRSLLGFLCGLLGPIKAYASEVCRREHQALGLSLVT  170

Query  758   TAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWL  937
             T+ GIGL++GPA+GG+ AQPAEKYP IFS +S FG+FPYFLPCL IS+FA+ A +  FWL
Sbjct  171   TSRGIGLIVGPAIGGFLAQPAEKYPNIFSEDSLFGRFPYFLPCLCISLFAVGAFIACFWL  230

Query  938   PETMH------------ThkkehkeehDVSQNSKQPEHEVPTSQKSLLKNWPLISSILVY  1081
             PET+H               +      D+ +N ++ E     S KSL+KNWPLISSI+VY
Sbjct  231   PETLHMHKENSLGDGTVESLEASLIGSDLKRNDEETEGRELASSKSLIKNWPLISSIIVY  290

Query  1082  CVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVL  1261
             CVF L D+AY EIFSLWAVS +  GGLS+++ DVG+VLAI+G  LL++QL  YP   K L
Sbjct  291   CVFSLQDMAYSEIFSLWAVSNKSYGGLSFSSQDVGEVLAISGFSLLVYQLLLYPHFAKCL  350

Query  1262  GPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRA  1441
             GP+  SR+ A LSIPLL++YP++A LSG  LS+++NCAS+LKN  SV+I TG  ILQN A
Sbjct  351   GPITSSRVAAVLSIPLLASYPFMAKLSGFTLSLIVNCASLLKNAFSVTIITGFNILQNNA  410

Query  1442  VSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfell  1621
             VSQ QRGAANGIS++AMSLFK   PA GG+L SW+Q RQ+A F+PGD++VFFVLN+   +
Sbjct  411   VSQHQRGAANGISITAMSLFKAAAPAGGGALFSWAQRRQNASFLPGDRMVFFVLNIIGFV  470

Query  1622  glIMTFKPFLQLP  1660
             GL++TFKPFL  P
Sbjct  471   GLLLTFKPFLNQP  483



>ref|XP_010492179.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Camelina 
sativa]
Length=483

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/477 (58%), Positives = 355/477 (74%), Gaps = 10/477 (2%)
 Frame = +2

Query  245   EQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLY  424
             E N   LE + F   E C GCRVE +K+   G P   + F+ +V L  +LPISSL+PFLY
Sbjct  4     EYNAALLEKKNF--HEGCPGCRVEKMKQIRRGYPYLELSFVWVVVLATSLPISSLYPFLY  61

Query  425   FMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviF  604
              MI DF +A+ E+DI +YAG+VG SFM GRALTS+ WG++ADRYGRKP++++GT+++ I 
Sbjct  62    SMIEDFGVADTEKDIGFYAGFVGCSFMFGRALTSLSWGMLADRYGRKPIILVGTISIAIL  121

Query  605   NAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVI  784
             NA+FGLSVN+WMAI  RFLLG+   ++GTM+AYASEI R EY A  +SAVSTAWGIGL++
Sbjct  122   NALFGLSVNFWMAIGMRFLLGSFNCLLGTMKAYASEIFREEYQATAMSAVSTAWGIGLIV  181

Query  785   GPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkk  964
             GPA+GG+ AQPA+KYP +FS +S FG+F Y LPC  IS FALV T++  ++PET+H H  
Sbjct  182   GPALGGFLAQPADKYPNVFSKDSIFGRFRYALPCFTISAFALVVTLLCCFIPETLHNHNL  241

Query  965   ehkeehD--------VSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEI  1120
             +     D         +  +    +E   SQ SLLKNWPL+SSI+VYCV  LHD AY EI
Sbjct  242   DSTAHDDSLETLEESSASTTNTGRNERKVSQVSLLKNWPLMSSIIVYCVLCLHDTAYSEI  301

Query  1121  FSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALS  1300
             F+LWA SPRK GGL+Y+T DVG VLAI+G+GL  FQ+F YP  E++LGPV+++R   AL 
Sbjct  302   FALWANSPRKYGGLNYSTNDVGTVLAISGVGLFSFQVFVYPFAERLLGPVLVTRFAGALM  361

Query  1301  IPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGIS  1480
             IP+  +YP+IA LSGL  S++LNCAS+L NVLSVS  TGLLILQN+AV Q QRGAANGI+
Sbjct  362   IPMQISYPFIANLSGLSQSIMLNCASILLNVLSVSAITGLLILQNKAVDQSQRGAANGIA  421

Query  1481  MSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             M+AMSLFKT+GPA  G L SWS+ R DA F+PG  +VFFVLNV  ++G+ +TFKPFL
Sbjct  422   MTAMSLFKTVGPAGAGILFSWSERRLDAAFLPGSHMVFFVLNVIVVVGVALTFKPFL  478



>gb|KHN10320.1| Protein ZINC INDUCED FACILITATOR-LIKE 1 [Glycine soja]
Length=485

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/476 (58%), Positives = 359/476 (75%), Gaps = 10/476 (2%)
 Frame = +2

Query  242   SEQNGGH--LEDEYFCYDESCAGCRVELLKR--ADAGVPIKHVFFISMVTLCAALPISSL  409
             +E+NG    LE +Y+   E C GC+V+  K      GV   ++F I +V LCAALPISSL
Sbjct  2     TEKNGKQPLLERKYY---EDCPGCKVDQAKELSKGQGVSFTNLFIIWVVVLCAALPISSL  58

Query  410   FPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtv  589
             +PFLYFM+RDF+IA+ E DIS YAGYVGS+FMLGR LTS+LWG IADR+GRKPV +IG +
Sbjct  59    YPFLYFMVRDFNIAKTEADISSYAGYVGSAFMLGRCLTSLLWGTIADRFGRKPVFVIGII  118

Query  590   tvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWG  769
              VVIFN +FGLS ++WMA+I RFL+G+L G++GT +AYA+EI R E+ ALG+S VS AWG
Sbjct  119   AVVIFNTLFGLSTSFWMAVIMRFLMGSLNGLLGTAKAYATEIFREEHQALGLSTVSAAWG  178

Query  770   IGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETM  949
             IGL+IGPA+GGY AQP EKYP IF  +SF+ KFPYFLP  ++S  A V  +   W+PET+
Sbjct  179   IGLIIGPALGGYLAQPVEKYPHIFPKDSFWDKFPYFLPNFVVSALAFVVAIGCIWIPETL  238

Query  950   HThkkehkeehDVSQNSKQPEHEVPTSQK--SLLKNWPLISSILVYCVFQLHDIAYLEIF  1123
             H H   ++   D    S    +E  T QK  +LL NWPL+SSI+ YCVF LHDI Y E+F
Sbjct  239   HNHNCSNESIDDAENGSSGAGNE-KTIQKNENLLLNWPLMSSIIAYCVFSLHDITYTEVF  297

Query  1124  SLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSI  1303
             SLW+VSP+++GGL++T+ DVG +L+I+G+ L+++QL  YP VEK  GP+ I+RI A LSI
Sbjct  298   SLWSVSPQRMGGLNFTSDDVGNILSISGVALIIYQLTLYPSVEKASGPIGIARISAMLSI  357

Query  1304  PLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISM  1483
             PLL +Y +IALLSGL L +VL+ AS+LKN+LS++I TGL +LQNRAV Q QRG ANGI++
Sbjct  358   PLLQSYSFIALLSGLALYIVLSIASILKNILSITIVTGLFLLQNRAVEQHQRGVANGIAV  417

Query  1484  SAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             + MSLF  IGPA GG++L+WSQ R DA F+PG  +VFF LN+ E LGL+M FKPFL
Sbjct  418   TGMSLFNAIGPATGGAVLTWSQKRMDASFLPGTHMVFFALNIVEALGLLMLFKPFL  473



>ref|XP_009131357.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Brassica 
rapa]
Length=484

 Score =   533 bits (1374),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 275/465 (59%), Positives = 356/465 (77%), Gaps = 8/465 (2%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y E C GC+VE +K+   G P   + F+ +V L  +LPISSL+PFLY+MI DF +A+ E+
Sbjct  16    YHEGCPGCKVEKMKQLRTGYPYLELSFVWIVVLSTSLPISSLYPFLYYMIEDFGVAKTEK  75

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG++  SFM GRALTS+ WGI+ADRYGRKP++++GT+++ +FNA+FGLS+N+WMA
Sbjct  76    DIGFYAGFIACSFMFGRALTSIFWGIVADRYGRKPIILLGTISIAVFNALFGLSLNFWMA  135

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TRFLLG+   ++GTM+AYASEI R EY A  +SAVSTAWGIGL+IGPA+GG+ AQPA+
Sbjct  136   IGTRFLLGSFNCLLGTMKAYASEIFRDEYQATAMSAVSTAWGIGLIIGPALGGFLAQPAD  195

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehD------  985
             KYP +FS ES FG+FPY LPC  IS FALV T++  ++PET+H HK++H  + D      
Sbjct  196   KYPNVFSKESIFGRFPYALPCFTISAFALVVTLLCCFIPETLHNHKQDHTLDDDSYEIIE  255

Query  986   --VSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGG  1159
                  ++ + E     SQ  LLKNWPL+SSI+VYCV  LHD AY EIF+LWA SPRK GG
Sbjct  256   AAAHDSTGKTEKHEKASQGPLLKNWPLMSSIIVYCVLCLHDTAYSEIFALWANSPRKYGG  315

Query  1160  LSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALL  1339
             L+Y+T DVG VLAI+G+GL  FQ+F YPL E +LGPV+++R   AL IP+  +YP+IA L
Sbjct  316   LNYSTNDVGTVLAISGLGLFCFQVFVYPLAEGLLGPVLVTRFAGALMIPIQMSYPFIANL  375

Query  1340  SGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPA  1519
             SGL  S++LNCAS+L NVLSVS  TGLLILQN+AV Q QRGAANGI+M+AMSLFKT+GPA
Sbjct  376   SGLSQSLMLNCASILINVLSVSAITGLLILQNKAVDQRQRGAANGIAMTAMSLFKTVGPA  435

Query  1520  AGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQ  1654
               G L S S+ R +A F+PG  +VFFVLNV  ++G+ +TFKPFL+
Sbjct  436   GAGILFSLSERRLNASFLPGSHMVFFVLNVIVVVGVALTFKPFLK  480



>ref|XP_010420011.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Camelina 
sativa]
 ref|XP_010420012.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Camelina 
sativa]
Length=483

 Score =   533 bits (1373),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 278/477 (58%), Positives = 354/477 (74%), Gaps = 10/477 (2%)
 Frame = +2

Query  245   EQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLY  424
             E N   LE   F   E C GCRVE +K+   G P   + F+ ++ L  +LPISSL+PFLY
Sbjct  4     EYNAALLEKRNF--HEGCPGCRVEQMKQLRRGYPYLELSFVWIIVLATSLPISSLYPFLY  61

Query  425   FMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviF  604
              MI DF +AE E+DI +YAG+VG SFM GRALTS+ WG++ADRYGRKP++++GT+++ I 
Sbjct  62    SMIEDFDVAESEKDIGFYAGFVGCSFMFGRALTSLSWGMLADRYGRKPIILVGTISIAIL  121

Query  605   NAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVI  784
             NA+FGLSVN+WMAI TRFLLG+   ++GTM+AYASEI R EY A  +SAVST+WGIGL++
Sbjct  122   NALFGLSVNFWMAIGTRFLLGSFNCLLGTMKAYASEIFREEYQATAMSAVSTSWGIGLIV  181

Query  785   GPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkk  964
             GPA+GG+ AQPA+KYP +FS  S FG+F Y LPC  IS FALV TV   ++PET+H HK 
Sbjct  182   GPALGGFLAQPADKYPNVFSKNSIFGRFRYALPCFTISAFALVVTVRCCFIPETLHNHKL  241

Query  965   ehkeehD--------VSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEI  1120
             +     D         +  +    +E   SQ SLLKNWPL+SSI+VYC+  LHD AY EI
Sbjct  242   DSTAHDDSLETLEESSASTTNAGRNERKASQVSLLKNWPLMSSIIVYCILCLHDTAYSEI  301

Query  1121  FSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALS  1300
             F+LWA SPRK GGL+Y+T DVG VLAI+GIGL  FQ+F YP  E++LGPV+++R   A+ 
Sbjct  302   FALWANSPRKYGGLNYSTNDVGTVLAISGIGLFSFQVFVYPFAERLLGPVLVTRFAGAVM  361

Query  1301  IPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGIS  1480
             IP+  +YP+IA LSGL  S++LNCAS+L N+LSVS  TGLLILQN+AV Q QRGAANGI+
Sbjct  362   IPMQISYPFIANLSGLSQSIMLNCASILLNLLSVSAITGLLILQNKAVDQSQRGAANGIA  421

Query  1481  MSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             M+AMSLFKT+GPA  G L SWS+ R DA F+PG  +VFFVLNV  ++G+ +TFKPFL
Sbjct  422   MTAMSLFKTVGPAGAGILFSWSERRLDAAFLPGSHMVFFVLNVIVVVGVALTFKPFL  478



>gb|AES68618.2| zinc induced facilitator-like protein [Medicago truncatula]
Length=487

 Score =   533 bits (1373),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 273/488 (56%), Positives = 361/488 (74%), Gaps = 19/488 (4%)
 Frame = +2

Query  206   MAEGNT-EPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTL  382
             M +GN  E LLK+              Y E+C GC+V+  K     V  +++  I MV L
Sbjct  1     MEDGNVGETLLKKK-------------YYENCPGCKVDKAKELKTDVSFRNLLNIWMVVL  47

Query  383   CAALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGR  562
             C++LPISSLFP+LYFMIRDF+IA+REEDIS YAGYVGS+FMLGR+LTS+ WGI+ADRYGR
Sbjct  48    CSSLPISSLFPYLYFMIRDFNIAKREEDISAYAGYVGSAFMLGRSLTSISWGIVADRYGR  107

Query  563   KPvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALG  742
             KPV I+G ++V+IFN +FGLS ++WMA+ TRF LG L G++G M+AY SEI R E  ALG
Sbjct  108   KPVAILGIISVIIFNTLFGLSTSFWMAVTTRFFLGCLNGLLGPMKAYCSEIFREEKQALG  167

Query  743   ISAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATV  922
             +S  S AWGIGL+IGPA+GGY AQP  KYP +F  +SF+ KFPYFLP + IS FA V  +
Sbjct  168   LSTFSAAWGIGLIIGPALGGYLAQPTVKYPNLFPKDSFWDKFPYFLPSISISAFAFVVAI  227

Query  923   MSFWLPETMHThkkehkeehD-----VSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCV  1087
                WLPET+H H   ++   D       +N +  ++++    ++L  NWPL+SSI+VYC+
Sbjct  228   ACIWLPETLHNHPLSNESIDDAEALETGRNGRAGKNKIIQKDENLFLNWPLMSSIVVYCI  287

Query  1088  FQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGP  1267
             F L+DI+Y E+FSLWAVSPR+LGGL++TT +VG VLAI+GIGL+++QL  YP +EK  GP
Sbjct  288   FSLYDISYQEVFSLWAVSPRRLGGLNFTTENVGDVLAISGIGLIVYQLSLYPSLEKSFGP  347

Query  1268  VMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVS  1447
                +RI   L+IP+L +YP+IA+LSG+ L +V+N AS+LKN+LSV+I TGL ++QNRAV 
Sbjct  348   ARFARISGVLAIPILQSYPFIAMLSGITLYLVINIASLLKNILSVTIITGLFLMQNRAVE  407

Query  1448  QEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellgl  1627
             Q QRGAANGI+M+ MS+FKTIGPA GG++L+WSQ R  A F+PG  +VFFVLN+   LG+
Sbjct  408   QRQRGAANGIAMTGMSIFKTIGPAGGGAVLAWSQKRMHASFLPGTHMVFFVLNIAGGLGV  467

Query  1628  IMTFKPFL  1651
             ++ F PFL
Sbjct  468   LLMFTPFL  475



>ref|XP_010419977.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Camelina sativa]
Length=478

 Score =   532 bits (1371),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 274/459 (60%), Positives = 355/459 (77%), Gaps = 3/459 (1%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y E C GC+V+ +KR   G P   +F + ++ LC  LPISSLFPFLYFMI DF IA++EE
Sbjct  15    YHEGCPGCKVDQMKRLRHGFPFSELFSVWIIVLCTTLPISSLFPFLYFMIDDFDIAKKEE  74

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG+VG SFMLGRALTSV+ GI+ADRYGRKPV++IGT +VV+FN +FGLS+N+WMA
Sbjct  75    DIGFYAGFVGCSFMLGRALTSVICGILADRYGRKPVILIGTTSVVVFNTLFGLSLNFWMA  134

Query  644   IITRFLLGALCGIIG-TMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPA  820
             IITRF LG   G++G  ++AYA E  R EY +L +SAVSTAWGIGL+IGPA+GG+ AQPA
Sbjct  135   IITRFCLGCFNGLLGGPIKAYAVETFRDEYQSLALSAVSTAWGIGLIIGPAIGGFLAQPA  194

Query  821   EKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeeh--DVSQ  994
             ++YP++FS +S FGKFPY LPC  IS+FA + T++S W+PET+H HK +  ++    V  
Sbjct  195   KQYPSLFSQDSIFGKFPYCLPCFAISIFAFLVTIISLWIPETLHNHKFDDHDQSFDAVKD  254

Query  995   NSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTT  1174
             + +  +      +KSLLKNWPL+SS++VYC+F LH++AY EIFSLWA SPRK GGL+YTT
Sbjct  255   DPESNKVAKKNEKKSLLKNWPLMSSMIVYCIFSLHNMAYTEIFSLWANSPRKFGGLAYTT  314

Query  1175  ADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCL  1354
             A+VG VLA++G+GLL+FQL  Y   E+ LGP++++RI   LS+ +LSTYP IA LSG+ L
Sbjct  315   AEVGSVLAVSGVGLLIFQLSLYSYAERNLGPIIVTRICGILSVVVLSTYPLIAKLSGVAL  374

Query  1355  SVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSL  1534
             ++ L  AS+ KNVLS S  TG  ILQNRAV Q+QRGAANGISM+AMS+ K IGP A G +
Sbjct  375   TMALYSASVAKNVLSTSTITGTFILQNRAVGQDQRGAANGISMTAMSICKAIGPGAAGVI  434

Query  1535  LSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
              SWS+ RQDA F+PG Q+VFF+LNV   +G++ TFKPFL
Sbjct  435   FSWSEKRQDASFLPGTQMVFFILNVVLAVGVLWTFKPFL  473



>ref|XP_003542782.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Glycine max]
Length=487

 Score =   532 bits (1371),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 284/488 (58%), Positives = 367/488 (75%), Gaps = 19/488 (4%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKR--ADAGVPIKHVFFISMVT  379
             M E   +PLL++              Y E C GC+V+  K      GVP++++F I MV 
Sbjct  1     MEENVKQPLLERK-------------YYEDCPGCKVDQAKELSEGQGVPVRNLFIIWMVV  47

Query  380   LCAALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYG  559
             LCAALPISSLFPFLYFM+RDF+IA+ E DIS YAGYVGS+FM GR LTSV+WGI+ADRYG
Sbjct  48    LCAALPISSLFPFLYFMVRDFNIAKTEADISSYAGYVGSAFMFGRCLTSVMWGIVADRYG  107

Query  560   RKPvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHAL  739
             RKPV++IG + VVIFN +FGLS ++WMA+I RFLLG+L G++G ++AYA+E+ R E+ AL
Sbjct  108   RKPVIVIGIIVVVIFNTLFGLSTSFWMAVIMRFLLGSLNGLLGPVKAYATELFREEHQAL  167

Query  740   GISAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVAT  919
             G+S VS AWG+GL+IGPA+GGY AQP EKYP IFS +SF+ KFPYFLP  IIS  A V  
Sbjct  168   GLSTVSAAWGVGLIIGPALGGYLAQPVEKYPHIFSKDSFWDKFPYFLPNFIISAVAFVVV  227

Query  920   VMSFWLPETMHThkkehkeehDV----SQNSKQPEHEVPTSQKSLLKNWPLISSILVYCV  1087
             +   W+PET+H H   ++   +     +  S   + ++   +++LL NWPL+SS++VYCV
Sbjct  228   IGCIWIPETLHNHNCRNESIDNAEALENGGSVASKDKIIQKKENLLLNWPLMSSVIVYCV  287

Query  1088  FQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGP  1267
             F LHDIAY E+FSLWAVSP++LGGL++TT DVG VL+I+G+ L+++QL  YP VEK  GP
Sbjct  288   FALHDIAYQEVFSLWAVSPQRLGGLNFTTDDVGNVLSISGLALIIYQLTIYPSVEKASGP  347

Query  1268  VMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVS  1447
             ++I RI   +SIPLL +YP+IALLSGL + +VL+ AS+LKN+LS +I TGL +LQNRAV 
Sbjct  348   IVIGRISGMISIPLLQSYPFIALLSGLAIYIVLSIASVLKNILSATINTGLFLLQNRAVE  407

Query  1448  QEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellgl  1627
             Q QRGAANGISM+ MSLFK IGPA GG++L+WSQ R DA F+PG  +VFF LN+ E LGL
Sbjct  408   QHQRGAANGISMTGMSLFKAIGPATGGAILTWSQKRMDASFLPGTHMVFFALNIVEALGL  467

Query  1628  IMTFKPFL  1651
             +M FKPFL
Sbjct  468   LMLFKPFL  475



>gb|KCW65124.1| hypothetical protein EUGRSUZ_G02629 [Eucalyptus grandis]
Length=441

 Score =   531 bits (1367),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 276/431 (64%), Positives = 336/431 (78%), Gaps = 12/431 (3%)
 Frame = +2

Query  242   SEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFL  421
             +E+    L ++YF   E+C GC+VE  K +  G PI+ +  I +V LC ALPISSLFPFL
Sbjct  3     AEEQEKALLEKYF--HENCPGCKVEKYKESQKGFPIRELLSIWIVVLCTALPISSLFPFL  60

Query  422   YFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvvi  601
             YFMIRDFHIA+REEDI YYAGYVGSSFM GRALTSV WGI+ADRYGRKPV+I+GT+ VVI
Sbjct  61    YFMIRDFHIAKREEDIGYYAGYVGSSFMFGRALTSVFWGIVADRYGRKPVIIMGTIAVVI  120

Query  602   FNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLV  781
             FN +FGLSVN+WMAI  RFLLG+L G++G ++AYA+EI R EY ALG+S VSTAWGIGL+
Sbjct  121   FNTLFGLSVNFWMAIAMRFLLGSLNGLLGPIKAYATEIFREEYQALGVSTVSTAWGIGLI  180

Query  782   IGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThk  961
             IGPA+GGY AQPAEK+P+IF  ES FG+FPYFLPCL IS+FALV T+ + WLPET+H H 
Sbjct  181   IGPALGGYLAQPAEKFPSIFPKESVFGRFPYFLPCLAISVFALVVTIATCWLPETLHKHH  240

Query  962   keh---keehDVS-------QNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAY  1111
             K         DV           K  + E    +KSL +NWPL+SSI+VYCVF LHD+AY
Sbjct  241   KSSKFDAACEDVETAPLMSGTKYKTQKAEGKAPKKSLFRNWPLMSSIIVYCVFSLHDMAY  300

Query  1112  LEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGA  1291
              EIFSLWAVSPR+ GGLSYTT DVG VLAI+G GLL+FQ   YP   ++LGPV+++R+  
Sbjct  301   TEIFSLWAVSPRRYGGLSYTTEDVGNVLAISGAGLLIFQTCLYPYFNRLLGPVVVARLNG  360

Query  1292  ALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAAN  1471
              L+IPLLS+YP+IA+L+GL LS+VLNC S+ KNVLS SI T L +LQN+AV Q+QRGAAN
Sbjct  361   VLAIPLLSSYPFIAMLTGLSLSIVLNCTSVAKNVLSTSIITSLFLLQNKAVDQDQRGAAN  420

Query  1472  GISMSAMSLFK  1504
             GI+M+AMSLFK
Sbjct  421   GIAMTAMSLFK  431



>ref|XP_009108316.1| PREDICTED: probable peptide/nitrate transporter At3g43790 isoform 
X1 [Brassica rapa]
Length=486

 Score =   532 bits (1370),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 279/495 (56%), Positives = 367/495 (74%), Gaps = 26/495 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MA+   E LL++ E             D +C GC ++ LK+   G+P  H+ FI +V+LC
Sbjct  1     MADEARETLLEEKE-------------DNNCPGCNIDRLKQEQRGIPYIHLSFIWLVSLC  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              ALPISSLFP+LYFMIRDFH+AE+EEDI +YAG+V SSFM+GRALTS+LWG +ADRYGRK
Sbjct  48    TALPISSLFPYLYFMIRDFHVAEKEEDIGFYAGFVASSFMIGRALTSILWGKLADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             P++++ T +V+IFN +FGLS ++W AI  RFLLG +  ++G +RAYASE+   EYHAL +
Sbjct  108   PIILMATFSVIIFNTLFGLSTSFWFAISVRFLLGCVNCLLGVIRAYASEVVSEEYHALSL  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S VST+ GIGL+IGPA+GGY AQPAEKYP IFS +S FG FPYFLP L+IS++A+ A + 
Sbjct  168   SVVSTSRGIGLIIGPAIGGYLAQPAEKYPNIFSLDSVFGSFPYFLPSLVISVYAIGALIA  227

Query  926   SFWLPETMHThkkehkeehDVSQNSKQP-------------EHEVPTSQKSLLKNWPLIS  1066
              +WLPET+HTH +  +   + ++    P             E     S+ SLL+N PL++
Sbjct  228   CWWLPETLHTHCRISRGRLNPNEPEYSPNELNNDGSTGRGLEDHNTQSKPSLLRNRPLMA  287

Query  1067  SILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPL  1246
              I+VYCVF L +IAY EIFSLWAVS +  GGLS+++ DVGQVLAI+G+GLLLFQL  YP 
Sbjct  288   IIIVYCVFSLQEIAYSEIFSLWAVSDKSYGGLSFSSQDVGQVLAISGLGLLLFQLMVYPP  347

Query  1247  VEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLI  1426
             +EK LG +++ R+ A + IPLLS YP IA LSGL L +V+NCAS+LKN LS+S+ TGL I
Sbjct  348   MEKSLGLLVVIRLSAVMLIPLLSCYPSIASLSGLTLHLVINCASILKNALSISLVTGLFI  407

Query  1427  LQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvln  1606
             L N+AV Q QRGAANG+SM+AMS+FK+ GPA GG L SW+Q RQ A F+PGD++VFFVLN
Sbjct  408   LLNKAVPQSQRGAANGLSMTAMSIFKSFGPAGGGILFSWAQKRQTATFLPGDEMVFFVLN  467

Query  1607  vfellglIMTFKPFL  1651
             + +L+GLI+TF P++
Sbjct  468   LVQLIGLILTFIPYI  482



>gb|KHN10156.1| Protein ZINC INDUCED FACILITATOR-LIKE 1 [Glycine soja]
Length=488

 Score =   532 bits (1370),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 284/463 (61%), Positives = 361/463 (78%), Gaps = 8/463 (2%)
 Frame = +2

Query  284   YDESCAGCRVELLKR--ADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAER  457
             Y E+C GC+V+  K      GVP+ ++F I MV LCAALPISSLFPFLYFM+RDF+IA+ 
Sbjct  15    YHENCPGCKVDQAKELSEGKGVPVTNLFIIWMVVLCAALPISSLFPFLYFMVRDFNIAKT  74

Query  458   EEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYW  637
             E DIS YAGYVGS+FM GR LTSVLWGIIADRYGRKPV++IG + VVIFN +FGLS ++W
Sbjct  75    EADISSYAGYVGSAFMFGRCLTSVLWGIIADRYGRKPVIVIGIIVVVIFNTLFGLSTSFW  134

Query  638   MAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQP  817
             MA+I RFLLG+L G++G ++AYA+E+ R E+ ALG+S VS AWGIGL+IGPA+GGY AQP
Sbjct  135   MAVIMRFLLGSLNGLLGPVKAYATELFREEHQALGLSTVSAAWGIGLIIGPALGGYLAQP  194

Query  818   AEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQN  997
              EKYP IF  +SF+ KFPYFLP  IIS  A V  +   W+PET+H   K   E  D ++ 
Sbjct  195   VEKYPHIFPKDSFWDKFPYFLPNFIISAVAFVVVIGCIWIPETLHN-HKCRNESIDNAET  253

Query  998   SKQ-----PEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGL  1162
              K       + ++   +++LL NWPL+SS++VYCVF LHDIAY E+FS+WAVSP++LGGL
Sbjct  254   LKNGGNVAGKDKIIQKKENLLLNWPLMSSVIVYCVFALHDIAYQEVFSIWAVSPQRLGGL  313

Query  1163  SYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLS  1342
             ++TT DVG VL+I+G+ L+++QL  YP VEK  GP++I RI   +SIPLL +YP+IALLS
Sbjct  314   NFTTDDVGNVLSISGLALIIYQLIIYPYVEKASGPIVIGRISGMISIPLLQSYPFIALLS  373

Query  1343  GLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAA  1522
             GL L +VL+ AS+LKN+LSV+I TGL +LQNRAV Q QRGAANGISM+ MSLFK+IGPA 
Sbjct  374   GLALYIVLSVASILKNLLSVTINTGLFLLQNRAVEQHQRGAANGISMTGMSLFKSIGPAT  433

Query  1523  GGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             GG++L+WSQ R DA F+PG  +VFFVLN+ E LG++M FKPFL
Sbjct  434   GGAILTWSQKRMDASFLPGTHMVFFVLNIVEGLGILMLFKPFL  476



>ref|XP_010492152.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Camelina 
sativa]
Length=471

 Score =   531 bits (1367),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 277/457 (61%), Positives = 355/457 (78%), Gaps = 6/457 (1%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y E C GC+V+ +KR   G P   +F I ++ LC  LPISSLFPFLYFMI DF IA++EE
Sbjct  15    YHEGCPGCKVDQMKRLRRGFPFSALFSIWIIVLCTTLPISSLFPFLYFMIDDFDIAKKEE  74

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG+VG SFMLGRALTSV+ GI+ADRYGRKPV++IGT +VV+FN +FGLS+N+WMA
Sbjct  75    DIGFYAGFVGCSFMLGRALTSVICGILADRYGRKPVILIGTTSVVVFNTLFGLSLNFWMA  134

Query  644   IITRFLLGALCGIIG-TMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPA  820
             I+TRF LG   G++G  ++AYA E  R EY +L +SAVS AWGIGL+IGPA+GG+ AQPA
Sbjct  135   IVTRFCLGCFNGLLGGPIKAYAVETFRDEYLSLALSAVSAAWGIGLIIGPAIGGFLAQPA  194

Query  821   EKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNS  1000
             ++YP++FS +SFFGKFPY LPC  IS+FA + T++S W+PET+H HK +  +  D  +++
Sbjct  195   KQYPSLFSQDSFFGKFPYCLPCFAISIFAFLVTIISLWIPETLHNHKFDAVK--DDPESN  252

Query  1001  KQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTAD  1180
             K  E      +KSLLKNWPL+SSI+VYC+F LH++AY EIFSLWA SPRK GGL YTTA+
Sbjct  253   KVAEKN---EKKSLLKNWPLMSSIIVYCIFSLHNMAYTEIFSLWANSPRKYGGLGYTTAE  309

Query  1181  VGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSV  1360
             VG VLA++G+GLL+FQL  Y   E+ LGP++++RI   LS+ +LSTYP IA LSG+ L++
Sbjct  310   VGSVLAVSGVGLLIFQLSLYSYAERNLGPIIVTRICGILSLVVLSTYPLIAKLSGVALTM  369

Query  1361  VLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLS  1540
              L  AS+ KNVLS S  TG  ILQNRAV Q+QRGAANGIS++AMS+ K IGP A G + S
Sbjct  370   ALYSASVAKNVLSTSTITGTFILQNRAVGQDQRGAANGISITAMSICKAIGPGAAGVIFS  429

Query  1541  WSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             WS+ RQDA F+PG Q+VFF+LNV   LG++ TFKPFL
Sbjct  430   WSEKRQDASFLPGTQMVFFILNVVLALGVLWTFKPFL  466



>ref|XP_010068811.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Eucalyptus 
grandis]
 gb|KCW65128.1| hypothetical protein EUGRSUZ_G02631 [Eucalyptus grandis]
Length=493

 Score =   531 bits (1367),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 293/487 (60%), Positives = 374/487 (77%), Gaps = 13/487 (3%)
 Frame = +2

Query  233   LKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLF  412
             +   EQ    L+  YF   E+C GC+VE LK +  G+PI+ +  I +V L ++LPISSL+
Sbjct  1     MAMEEQREALLQKHYF---ENCPGCKVEKLKESQRGLPIRELLSIWIVVLSSSLPISSLY  57

Query  413   PFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvt  592
             PFLYFMIRDFHIA REEDI YYAG+VG SF+ GRALTS+ WGI+ADRYGRKPV+IIG   
Sbjct  58    PFLYFMIRDFHIATREEDIGYYAGWVGCSFLFGRALTSIFWGIVADRYGRKPVIIIGIAV  117

Query  593   vviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGI  772
             VVIFN +FGLSVN+WMAI+ RFLLG+L G++G ++AYASEI R EY ALG+S VS AWGI
Sbjct  118   VVIFNTLFGLSVNFWMAIVVRFLLGSLNGLLGPIKAYASEIFREEYQALGVSTVSAAWGI  177

Query  773   GLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMH  952
             GLVIGPA+GGY AQPAEK+P+IFS ES FGKFPYFLPCL +S+FALV ++ SFWLPET+H
Sbjct  178   GLVIGPALGGYLAQPAEKFPSIFSKESVFGKFPYFLPCLTMSLFALVVSIGSFWLPETLH  237

Query  953   ----------ThkkehkeehDVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHD  1102
                       + K       +     K  + +    +KSL++NWPL+S+I+ YCVF L+D
Sbjct  238   MHHGIGELDESRKDAETASLESGVKCKTEKVKGKAPKKSLIRNWPLMSTIIAYCVFALYD  297

Query  1103  IAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISR  1282
              AY EIFSLWA SPR+LGGLSYTT DVG VL+I+G GLL+ Q F YP ++++LGPV ++R
Sbjct  298   TAYSEIFSLWAESPRRLGGLSYTTEDVGTVLSISGAGLLVIQTFIYPYLDRLLGPVWVAR  357

Query  1283  IGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRG  1462
             I   LSIPLLS+YP+IA+L+GL LS+VLNCAS+ +N LS++I T L +LQN+AV Q+QRG
Sbjct  358   ICGILSIPLLSSYPFIAMLTGLSLSIVLNCASVAENSLSLTILTSLFLLQNKAVDQDQRG  417

Query  1463  AANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFK  1642
             AANGISM+A+SLFK  GP  GG++ SW+Q RQDA F+PG+Q++FF+LNV   +G++M FK
Sbjct  418   AANGISMTAISLFKAAGPGGGGAIFSWTQKRQDAAFLPGNQMIFFILNVIGAIGVLMMFK  477

Query  1643  PFLQLPE  1663
             PF   P+
Sbjct  478   PFRPAPQ  484



>ref|XP_007133563.1| hypothetical protein PHAVU_011G189500g [Phaseolus vulgaris]
 gb|ESW05557.1| hypothetical protein PHAVU_011G189500g [Phaseolus vulgaris]
Length=489

 Score =   530 bits (1366),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 282/501 (56%), Positives = 367/501 (73%), Gaps = 22/501 (4%)
 Frame = +2

Query  206   MAEGNTE-PLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKR--ADAGVPIKHVFFISMV  376
             M E N E PLL++ +            Y E+C GC+V+  K      GVP+  +F + M+
Sbjct  1     MEEENVEQPLLERKK------------YYENCPGCKVDKAKELSEGQGVPVTKLFIMWML  48

Query  377   TLCAALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRY  556
              LCAALPISSLFPF+YFM+RDF+IA+ E DIS YAGYVGS FMLGR LTS+LWG +ADR 
Sbjct  49    ALCAALPISSLFPFIYFMVRDFNIAKTEADISSYAGYVGSVFMLGRCLTSLLWGALADRI  108

Query  557   GRKPvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHA  736
             GRKP+++ G + VVIFN +FGLS ++WMAI+TRFLLG+  G +G +RAYA+E+ R E+ A
Sbjct  109   GRKPIILAGIIAVVIFNTLFGLSTSFWMAIVTRFLLGSFNGFLGPLRAYAAELFREEHQA  168

Query  737   LGISAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVA  916
             LG+S +S+AWGIGL+IGP++GGY AQP EKYP IF  +SF+ KFPYFLP LIIS+FA V 
Sbjct  169   LGLSTLSSAWGIGLIIGPSLGGYLAQPVEKYPNIFPKDSFWDKFPYFLPNLIISVFAFVV  228

Query  917   TVMSFWLPETMHTh--kkehkeehDVSQNSKQ--PEHEVPTSQKSLLKNWPLISSILVYC  1084
              +   W+PET+H H    E  E  +  +N        ++    ++LL NWPL+SSI+ YC
Sbjct  229   AIGCIWIPETLHNHNCSNESIEYAEALENGSGGVGNKKIIKRNENLLMNWPLMSSIIAYC  288

Query  1085  VFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLG  1264
             VF LHDIAY EIFSLWAVSP KLGGL++TT DVG +L+I+G+ L+++QL  +P VEK  G
Sbjct  289   VFSLHDIAYQEIFSLWAVSPPKLGGLNFTTNDVGNILSISGLALIIYQLTLFPCVEKASG  348

Query  1265  PVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAV  1444
              + I+RI + LSIPLL +YP+IALLSGL L +VL+ AS+LKN+LS++I TGL + QNR V
Sbjct  349   AIGIARISSMLSIPLLQSYPFIALLSGLALHIVLSTASILKNILSITIVTGLFLQQNRVV  408

Query  1445  SQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellg  1624
              Q QRGAANGI+M+ MSLFK IGPAAGGS+L+W Q R D+ F+PG  +VF VLN+ E++G
Sbjct  409   EQHQRGAANGIAMTGMSLFKAIGPAAGGSVLAWCQKRMDSSFLPGTHMVFLVLNIVEVVG  468

Query  1625  lIMTFKPFL---QLPEDDILK  1678
             L+M FKPF    + P  D L+
Sbjct  469   LLMMFKPFFVEKKKPHTDQLQ  489



>ref|XP_006399872.1| hypothetical protein EUTSA_v10013388mg [Eutrema salsugineum]
 gb|ESQ41325.1| hypothetical protein EUTSA_v10013388mg [Eutrema salsugineum]
Length=487

 Score =   530 bits (1366),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 284/468 (61%), Positives = 358/468 (76%), Gaps = 12/468 (3%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y E C GC+VE +K+   G P   + F+ ++ L  +LPISSL+PFLY+MI DF +A+ E+
Sbjct  15    YHEGCPGCKVEQMKQQRRGYPYLELSFVWIIVLSTSLPISSLYPFLYYMIEDFGVAKTEK  74

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG+VG SFMLGRALTSV WGI+ADRYGRKP++++GT+++ IFNA+FGLS+N+WMA
Sbjct  75    DIGFYAGFVGCSFMLGRALTSVFWGIVADRYGRKPIILLGTISIAIFNALFGLSLNFWMA  134

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TRFLLG+   ++GTM+AYASEI R EY A  +SAVSTAWGIGL+IGPA+GG+ AQPA+
Sbjct  135   IGTRFLLGSFNCLLGTMKAYASEIFRDEYQATAMSAVSTAWGIGLIIGPALGGFLAQPAD  194

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQ---  994
             KYP +FS ES FG+F Y LPC  IS FALV TV+  ++PET+H HK++     D  +   
Sbjct  195   KYPNVFSQESIFGRFRYALPCFTISAFALVVTVLCCFIPETLHNHKQDRTSHDDSYEILE  254

Query  995   ---------NSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPR  1147
                        K  + E   SQ SLLKNWPL+SSI+VYCV  LHD AY EIF+LWA SPR
Sbjct  255   AASRDSAASAGKAEKDERKGSQGSLLKNWPLMSSIIVYCVLCLHDTAYSEIFALWANSPR  314

Query  1148  KLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPY  1327
             K GGLSY+T DVG VLAI+G+GL  FQ+F YPL E++LGPV+++R   AL IP+  +YP+
Sbjct  315   KYGGLSYSTNDVGTVLAISGLGLFSFQVFVYPLAERLLGPVLVTRFAGALMIPIQMSYPF  374

Query  1328  IALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKT  1507
             IA LSGL LS++LNCAS+L NVLSVS  TGLLILQN+AV Q QRGAANGI+M+AMSLFKT
Sbjct  375   IASLSGLSLSLMLNCASILINVLSVSAITGLLILQNKAVDQSQRGAANGIAMTAMSLFKT  434

Query  1508  IGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             +GPA  G L SWS+ R DA F+PG  +VFFVLNV  ++G+ +TFKPFL
Sbjct  435   VGPAGAGILFSWSERRVDAAFLPGSHMVFFVLNVIVVVGVALTFKPFL  482



>ref|XP_008775046.1| PREDICTED: probable peptide/nitrate transporter At3g43790 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008775047.1| PREDICTED: probable peptide/nitrate transporter At3g43790 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008775048.1| PREDICTED: probable peptide/nitrate transporter At3g43790 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008775050.1| PREDICTED: probable peptide/nitrate transporter At3g43790 isoform 
X1 [Phoenix dactylifera]
Length=489

 Score =   530 bits (1365),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 288/495 (58%), Positives = 368/495 (74%), Gaps = 25/495 (5%)
 Frame = +2

Query  215   GNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAAL  394
              NT PLLK+              Y E+C GC+ +       G+P K  F+I +VTLC+AL
Sbjct  3     ANTNPLLKK-------------VYYENCPGCKQDRRNEVHLGIPYKEFFYIWVVTLCSAL  49

Query  395   PISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvv  574
             PISSLFPFLYFMIRD HIA+REEDI +YAG+VGS+FM GRALTSV WG++ADRYGRKPV+
Sbjct  50    PISSLFPFLYFMIRDLHIAKREEDIGFYAGFVGSAFMFGRALTSVFWGMVADRYGRKPVI  109

Query  575   iigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAV  754
             +I  V+V++FN +FGLS +Y MAI TR LLG LCG++G ++AYASE+CR+E+ ALG+S V
Sbjct  110   VISIVSVIVFNTLFGLSTSYVMAITTRSLLGFLCGLLGPVKAYASEVCRKEHQALGLSLV  169

Query  755   STAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFW  934
             ST+ GIGL++GPA+GG+ AQPAEKYP IFS +S FG+FPYFLPCL IS+FA+ A +  FW
Sbjct  170   STSRGIGLIVGPAIGGFLAQPAEKYPNIFSEDSLFGRFPYFLPCLCISLFAVGAFIACFW  229

Query  935   LPETMH------------ThkkehkeehDVSQNSKQPEHEVPTSQKSLLKNWPLISSILV  1078
             LPET+H               +      D+ +NS++ E     S K+LLKNWPLISSI+V
Sbjct  230   LPETLHMHKGNSLGDGTVESLEASLIGSDLKRNSEETEGIELASNKNLLKNWPLISSIIV  289

Query  1079  YCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKV  1258
             YCVF L D+AY EIFSLWAVS ++ GGLS+++ DVG+VLAITG  LL++QL  YP   K 
Sbjct  290   YCVFSLQDMAYSEIFSLWAVSSKRYGGLSFSSQDVGEVLAITGFSLLVYQLLLYPRFVKC  349

Query  1259  LGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNR  1438
             LG +  +R+ A LSIPLL++YP++A LSG   S+++NCAS+LKNV SV+I TG  ILQN 
Sbjct  350   LGHITSTRVAAVLSIPLLASYPFMAKLSGFTRSLIVNCASLLKNVFSVTIITGFNILQNN  409

Query  1439  AVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfel  1618
             AVSQ+QRGAANG+S++AMSLFK   PA GG+L SW+Q RQ A F+PGD +VFFVLN+   
Sbjct  410   AVSQQQRGAANGMSVTAMSLFKAAAPAGGGALFSWAQSRQKASFLPGDHMVFFVLNIVGF  469

Query  1619  lglIMTFKPFLQLPE  1663
             +GL++TFKPFL  P 
Sbjct  470   VGLLLTFKPFLTQPS  484



>ref|XP_009125940.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1 [Brassica rapa]
 ref|XP_009125941.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1 [Brassica rapa]
 ref|XP_009125942.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1 [Brassica rapa]
Length=483

 Score =   530 bits (1364),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 289/491 (59%), Positives = 370/491 (75%), Gaps = 22/491 (4%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE   E LL++ +            Y E C GC+VE +K+   G P   + F+ ++ L 
Sbjct  1     MAEEYKEALLEKHK------------YHEGCPGCKVEQMKQLRKGYPYLELSFVWIIVLS  48

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              +LPISSL+PFLY+MI DF +A+ E+DI +YAG++G SFMLGRALTSV WGI+ADRYGRK
Sbjct  49    TSLPISSLYPFLYYMIEDFGVAKTEKDIGFYAGFIGCSFMLGRALTSVFWGIVADRYGRK  108

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             P++++GT+++ IFNA+FGLS+N+WMAI TRFLLG+   ++GTM+AYASEI R EY A  +
Sbjct  109   PIILLGTISIAIFNALFGLSLNFWMAIGTRFLLGSFNCLLGTMKAYASEIFRDEYQATAM  168

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             SAVSTAWGIGL+IGPA+GG+ AQPA+KYP +FS +S FG+F Y LPC  IS FALV TV+
Sbjct  169   SAVSTAWGIGLIIGPALGGFLAQPADKYPNVFSKDSIFGRFRYALPCFTISAFALVVTVL  228

Query  926   SFWLPETMHThkkehkeehD---------VSQNSKQPEHEVPTSQKSLLKNWPLISSILV  1078
               ++PET+H HK++   + D         +    K  ++E  TSQ SLLKNWPL+SSI+V
Sbjct  229   CCFIPETLHNHKQDITSDDDSYEVLEAASLESTGKTGKNE-KTSQGSLLKNWPLMSSIIV  287

Query  1079  YCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKV  1258
             YCV  LHD AY EIF+LWA SPRK GGLSY+T DVG VLAI+G+GL  FQ+F YPL E++
Sbjct  288   YCVLCLHDTAYSEIFALWANSPRKYGGLSYSTNDVGTVLAISGLGLFSFQVFVYPLAERL  347

Query  1259  LGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNR  1438
             LGPV+++R   AL IP+  +YP+IA LSGL LS++LNCAS+L NVLSVS  TGLLILQN+
Sbjct  348   LGPVLVTRYAGALMIPIQMSYPFIANLSGLSLSLLLNCASILINVLSVSAITGLLILQNK  407

Query  1439  AVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfel  1618
             AV Q QRGAANGI+M+AMSLFKT+GPA  G L SWS+ R +A F+PG  LVFFVLNV  +
Sbjct  408   AVDQSQRGAANGIAMTAMSLFKTVGPAGAGILFSWSERRLNAAFLPGSHLVFFVLNVIVV  467

Query  1619  lglIMTFKPFL  1651
             +G+ +TFKPFL
Sbjct  468   VGVALTFKPFL  478



>ref|XP_002871582.1| hypothetical protein ARALYDRAFT_488195 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47841.1| hypothetical protein ARALYDRAFT_488195 [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score =   530 bits (1364),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 292/493 (59%), Positives = 364/493 (74%), Gaps = 24/493 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE   E LL + +            Y + C GC+VE +K+   G P   + F+ ++ L 
Sbjct  1     MAEEYKEALLDKQK------------YHDGCPGCKVEQMKQLRRGYPYLELTFVWIIVLS  48

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              +LPISSL+PFLY+MI DF +A+ E+DI +YAG+VG SFMLGRALTSV WGI+ADRYGRK
Sbjct  49    TSLPISSLYPFLYYMIEDFGVAKTEKDIGFYAGFVGCSFMLGRALTSVFWGIVADRYGRK  108

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             P++++GT+++ IFNA+FGLSVN+WMAI TRFLLG+   ++GTM+AYASEI R EY A  +
Sbjct  109   PIILLGTISIAIFNALFGLSVNFWMAIGTRFLLGSFNCLLGTMKAYASEIFRDEYQATAM  168

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             SAVSTAWGIGL+IGPA+GG+ AQPA+KYP +FS ES FG+F Y LPC  IS FALV TV+
Sbjct  169   SAVSTAWGIGLIIGPALGGFLAQPADKYPNVFSQESIFGRFRYALPCFTISAFALVVTVL  228

Query  926   SFWLPETMHThkkehkeehD-----------VSQNSKQPEHEVPTSQKSLLKNWPLISSI  1072
               ++PET+H HK       D            S   K  ++E   SQ SLLKNWPL+SSI
Sbjct  229   CCFIPETLHNHKLGSTSHDDSYEILEAASLESSAIEKAGKNERKASQ-SLLKNWPLMSSI  287

Query  1073  LVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVE  1252
             +VYCV  LHD AY EIF+LWA SPRK GGLSY+T DVG VLAI+G+GL  FQ+F YP  E
Sbjct  288   IVYCVLCLHDTAYSEIFALWANSPRKYGGLSYSTNDVGTVLAISGLGLFSFQVFVYPFAE  347

Query  1253  KVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQ  1432
             K+LGPV+++R   AL IP+  +YP+IA LSGL LS++LNCAS+L NVLSVS  TGLLILQ
Sbjct  348   KLLGPVLVTRYAGALMIPIQMSYPFIASLSGLSLSLMLNCASILINVLSVSAITGLLILQ  407

Query  1433  NRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvf  1612
             NRAV Q QRGAANGI+M+AMSLFKT+GPA  G L SWS+ R DA F+PG  +VFFVLNV 
Sbjct  408   NRAVDQSQRGAANGIAMTAMSLFKTVGPAGAGILFSWSERRLDAAFLPGSHMVFFVLNVI  467

Query  1613  ellglIMTFKPFL  1651
              ++G+ +TFKPFL
Sbjct  468   VVVGVALTFKPFL  480



>ref|XP_006347689.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X3 [Solanum tuberosum]
Length=418

 Score =   526 bits (1356),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 267/414 (64%), Positives = 336/414 (81%), Gaps = 8/414 (2%)
 Frame = +2

Query  428   MIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFN  607
             MI+DFHIA+REEDIS YAGYVGS+FMLGRA TSV WG +ADRYGRKPV++ GT  VV+FN
Sbjct  1     MIKDFHIAKREEDISTYAGYVGSAFMLGRASTSVFWGAVADRYGRKPVIVFGTFVVVVFN  60

Query  608   AVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIG  787
              +FGLSVN+WMAI TRFLLG L G+IG ++AYA+EI R EY ALG+S +STAWGIGL+IG
Sbjct  61    TLFGLSVNFWMAITTRFLLGFLNGLIGPIKAYAAEIFREEYQALGMSTISTAWGIGLIIG  120

Query  788   PAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHTh---  958
             PA+GG+ AQPAEKYP +FS +S FG+FPYFLPCL IS+F+L   + SFWLPET+H H   
Sbjct  121   PALGGFLAQPAEKYPDVFSKDSIFGRFPYFLPCLCISLFSLAVGIASFWLPETLHNHDSR  180

Query  959   ---kkehkeehDVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSL  1129
                +  ++   + + ++K     VP  +++L KNWPL+SSI++YCVF LHD+AY EIFSL
Sbjct  181   MPPQSSYEALEEAASDTKDRNESVP--KENLFKNWPLMSSIILYCVFSLHDMAYTEIFSL  238

Query  1130  WAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPL  1309
             W VSPRK GGLSY+T DVG+VL+I+G GLL+FQL  YPLVEK +GP++I+R+   LSIP+
Sbjct  239   WTVSPRKFGGLSYSTVDVGEVLSISGFGLLVFQLSLYPLVEKYVGPIVIARVAGVLSIPV  298

Query  1310  LSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSA  1489
             L++YPYIA+LSG+ LSV +N AS++KN LS+SI TGL ILQN+AV Q QRGAANGI+M+A
Sbjct  299   LTSYPYIAMLSGIALSVAINFASVIKNALSISIITGLFILQNKAVDQRQRGAANGIAMTA  358

Query  1490  MSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             MS+FK IGPA  G L SW+Q R DA  +PGDQ+VFFVLNV E +G+++TFKPFL
Sbjct  359   MSIFKAIGPAGAGVLFSWAQKRLDASILPGDQVVFFVLNVIEAIGVLLTFKPFL  412



>ref|XP_004230048.2| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Solanum 
lycopersicum]
Length=416

 Score =   526 bits (1356),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 264/414 (64%), Positives = 335/414 (81%), Gaps = 8/414 (2%)
 Frame = +2

Query  428   MIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFN  607
             MI+DFHIA+REEDIS YAG+VGSSFM+GRALTSV WG +ADRYGRKPV++ GT  VV+FN
Sbjct  1     MIKDFHIAKREEDISTYAGFVGSSFMVGRALTSVFWGAVADRYGRKPVIVFGTFAVVVFN  60

Query  608   AVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIG  787
              +FGLSVN+WMAI TRFLLG L G+IG ++AYA+EI R EY ALG+S +STAWGIGL+IG
Sbjct  61    TLFGLSVNFWMAIATRFLLGFLNGLIGPIKAYAAEIFREEYQALGMSTISTAWGIGLIIG  120

Query  788   PAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHTh---  958
             P++GG+ AQPAEKYPT+FS +S FG+FPYFLPCL IS+F+L   + SFWLPET+H H   
Sbjct  121   PSLGGFLAQPAEKYPTVFSKDSIFGRFPYFLPCLCISLFSLAVGIASFWLPETLHNHDSR  180

Query  959   ---kkehkeehDVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSL  1129
                +  ++   + + ++K      P  +++L  NWPL+SSI++YCVF LHD+AY EIFSL
Sbjct  181   MPPQSSYEALEEAASDTKDGNESAP--KENLFNNWPLMSSIILYCVFSLHDMAYTEIFSL  238

Query  1130  WAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPL  1309
             W VSPRK GGLSY+T DVG+VL+I+G GLL+FQL  YPLVEK +GP++I+R+   LSI +
Sbjct  239   WTVSPRKFGGLSYSTVDVGEVLSISGFGLLVFQLSLYPLVEKCVGPIVITRVAGVLSIAV  298

Query  1310  LSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSA  1489
             L++YPYIALLSG+ LSV +N AS++KN LS+SI TGL ILQN+AV Q QRGAANGI+M+A
Sbjct  299   LTSYPYIALLSGIALSVTINIASVIKNALSISIITGLFILQNKAVDQRQRGAANGIAMTA  358

Query  1490  MSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             MS+FK IGPA  G + SW+Q R DA  +PGDQ+VFFVLNV E +G+++TFKPFL
Sbjct  359   MSIFKAIGPAGAGVVFSWAQKRLDASILPGDQVVFFVLNVIEAIGVLLTFKPFL  412



>ref|XP_004502380.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Cicer arietinum]
Length=486

 Score =   529 bits (1362),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 279/487 (57%), Positives = 365/487 (75%), Gaps = 9/487 (2%)
 Frame = +2

Query  245   EQNGGH--LEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPF  418
             E+N G   L+ +Y+   ++C GC+VE  K     V I+++ +I +  LC  LP++SLFPF
Sbjct  3     EENFGQPLLKKQYY---DNCPGCKVEQAKELGTDVSIRNLSYIWITILCGTLPVASLFPF  59

Query  419   LYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvv  598
             +YFM++DF+IAE EEDIS YAGYVGSSFMLGR+LTS+LWGII+DRYGRKPV+IIG +TVV
Sbjct  60    VYFMVKDFNIAESEEDISAYAGYVGSSFMLGRSLTSILWGIISDRYGRKPVIIIGVITVV  119

Query  599   iFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGL  778
             +FN +FGLS N WMAI  RFLLG+L G+IG ++AYA+EI   E  ALG+S V  AWG+GL
Sbjct  120   VFNTLFGLSTNLWMAISVRFLLGSLNGLIGPVKAYATEIFSEEKQALGLSTVVAAWGVGL  179

Query  779   VIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHTh  958
             VIGPA+GGY AQPA KYP +F  +SF+ KFPYFLPC +IS FA V  +   WLPET+H H
Sbjct  180   VIGPALGGYLAQPALKYPHLFPKDSFWDKFPYFLPCFVISAFAFVVAIACIWLPETLHYH  239

Query  959   kkehkeehDVSQ----NSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFS  1126
                 +    V      +S+  + ++    +S+  NWPL+SSI+VY VF LHDIAY E+FS
Sbjct  240   NGSKESTDIVEAAEVGSSETAKDKMIQKDESIFLNWPLMSSIIVYSVFSLHDIAYQEVFS  299

Query  1127  LWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIP  1306
             LWAVSPR LGGL++TT DVG VLAI+GIG++++QL  YP V+K  GPV ++RI  ALSIP
Sbjct  300   LWAVSPRSLGGLNFTTNDVGNVLAISGIGIIVYQLALYPSVQKACGPVNLARITGALSIP  359

Query  1307  LLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMS  1486
             LL +YP++ LLSG  L +V+N AS+LK ++S +I TGL +LQNRAV Q QRGAANG +M+
Sbjct  360   LLQSYPFMTLLSGSTLYLVINIASILKFLMSETIATGLFLLQNRAVEQHQRGAANGFAMT  419

Query  1487  AMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPED  1666
             AMS FKTIGPA GG+LL+WSQ R +A F+PG  +VFFV+NV E LG+++ FKPFL + ++
Sbjct  420   AMSAFKTIGPAGGGALLAWSQKRLNASFLPGTHMVFFVMNVVEGLGVLLMFKPFLGVKKE  479

Query  1667  DILKSKQ  1687
               ++  Q
Sbjct  480   KPMEQLQ  486



>emb|CDX85629.1| BnaA02g01840D [Brassica napus]
Length=483

 Score =   528 bits (1361),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 287/490 (59%), Positives = 369/490 (75%), Gaps = 20/490 (4%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE   E LL++ +            Y E C GC+VE +K+   G P   + F+ ++ L 
Sbjct  1     MAEEYKEALLEKHK------------YHEGCPGCKVEQMKQLRKGYPYLELSFVWIIVLS  48

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              +LPISSL+PFLY+MI DF +A+ E+DI +YAG++G SFMLGRALTSV WGI+ADRYGRK
Sbjct  49    TSLPISSLYPFLYYMIEDFGVAKTEKDIGFYAGFIGCSFMLGRALTSVFWGIVADRYGRK  108

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             P++++GT+++ IFNA+FGLS+N+WMAI TRFLLG+   ++GTM+AYASEI R EY A  +
Sbjct  109   PIILLGTISIAIFNALFGLSLNFWMAIGTRFLLGSFNCLLGTMKAYASEIFRDEYQATAM  168

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             SAVSTAWGIGL+IGPA+GG+ AQPA+KYP +FS +S FG+F Y LPC  IS FALV TV+
Sbjct  169   SAVSTAWGIGLIIGPALGGFLAQPADKYPNVFSKDSIFGRFRYALPCFTISAFALVVTVL  228

Query  926   SFWLPETMHThkkehkeehD--------VSQNSKQPEHEVPTSQKSLLKNWPLISSILVY  1081
               ++PET+H HK++   + D          +++ +      TSQ SLLKNWPL+SSI+VY
Sbjct  229   CCFIPETLHNHKQDITSDDDSYEVLEAASRESTGKTGKNEKTSQGSLLKNWPLMSSIIVY  288

Query  1082  CVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVL  1261
             CV  LHD AY EIF+LWA SPRK GGLSY+T DVG VLAI+G+GL  FQ+F YPL E++L
Sbjct  289   CVLCLHDTAYSEIFALWANSPRKYGGLSYSTNDVGTVLAISGLGLFSFQVFVYPLAERLL  348

Query  1262  GPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRA  1441
             GPV+++R   AL IP+  +YP+IA LSGL LS++LNCAS+L NVLSVS  TGLLILQN+A
Sbjct  349   GPVLVTRYAGALMIPIQMSYPFIANLSGLSLSLLLNCASILINVLSVSAITGLLILQNKA  408

Query  1442  VSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfell  1621
             V Q QRGAANGI+M+AMSLFKT+GPA  G L SWS+ R +A F+PG  LVFFVLNV  ++
Sbjct  409   VDQSQRGAANGIAMTAMSLFKTVGPAGAGILFSWSERRLNAAFLPGSHLVFFVLNVIVVV  468

Query  1622  glIMTFKPFL  1651
             G+ +TFKPFL
Sbjct  469   GVALTFKPFL  478



>gb|AET03120.2| zinc induced facilitator-like protein [Medicago truncatula]
Length=487

 Score =   528 bits (1360),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 269/488 (55%), Positives = 358/488 (73%), Gaps = 19/488 (4%)
 Frame = +2

Query  206   MAEGNT-EPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTL  382
             M +GN  E LLK+              Y E+C GC+V+  K     V  +++  I MV L
Sbjct  1     MKDGNIGETLLKKQ-------------YYENCPGCKVDKAKELKTDVSFRNLLNIWMVVL  47

Query  383   CAALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGR  562
             C++LPISSLFP+ YFMIRDF+IAEREEDIS YAGY+GS++MLGR+LTS+LWG+IADRYGR
Sbjct  48    CSSLPISSLFPYQYFMIRDFNIAEREEDISAYAGYMGSAYMLGRSLTSILWGVIADRYGR  107

Query  563   KPvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALG  742
             KPV I+G ++V+IFN +FGLS ++WMA+ TRF LG+L G++G M+AY SEI R E  A G
Sbjct  108   KPVAILGVISVIIFNTLFGLSTSFWMAVTTRFFLGSLNGLLGPMKAYCSEIFREEKQAFG  167

Query  743   ISAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATV  922
             +S +S AWGIGL+IGPA+GGY AQP  KYP +F  +SF+ KFPYFLP + IS FA    +
Sbjct  168   LSTLSAAWGIGLIIGPALGGYLAQPTIKYPNLFPKDSFWDKFPYFLPSISISAFAFAVAI  227

Query  923   MSFWLPETMH-----ThkkehkeehDVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCV  1087
                WLPET+H         +  E  +  +N K  + ++    ++L  NWPL+SSI+VYC+
Sbjct  228   ACIWLPETLHNHPLSNESIDGAEALETGRNGKAGKDKIIQKDENLFLNWPLMSSIVVYCI  287

Query  1088  FQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGP  1267
             F L++I+Y E+FSLWAVS R+LGGL++TT +VG VLAI+GIGL+++QL  YP +EK  GP
Sbjct  288   FSLYNISYQEVFSLWAVSSRRLGGLNFTTGNVGDVLAISGIGLIVYQLSLYPSLEKTFGP  347

Query  1268  VMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVS  1447
             V  +RI   LSIPLL +YP+IA+LSG+ L +V+N AS+LKN+LS +I TGL ++QNRAV 
Sbjct  348   VRFARISGVLSIPLLQSYPFIAMLSGITLYLVINIASLLKNLLSATIITGLFLMQNRAVE  407

Query  1448  QEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellgl  1627
             Q QRGAANGI+M+ MS+FKTIGPA GG++L+WSQ R +A F+PG  +VF VLN+   LG+
Sbjct  408   QHQRGAANGIAMTGMSIFKTIGPAGGGAVLAWSQKRMNASFLPGTHMVFLVLNIAGGLGV  467

Query  1628  IMTFKPFL  1651
             ++ F PFL
Sbjct  468   LLMFTPFL  475



>emb|CDY65961.1| BnaA10g29810D [Brassica napus]
Length=477

 Score =   527 bits (1358),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 284/465 (61%), Positives = 351/465 (75%), Gaps = 15/465 (3%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             + E+C GC+V+ +KR   G P   +  + ++ L  ALP+SSLFPFLYFMI DF+IA++EE
Sbjct  14    FHENCPGCKVDQMKRLRRGFPFSELVTVWLIVLSTALPVSSLFPFLYFMIGDFNIAKKEE  73

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG+VG S MLGR LTSV+WGI+ADRYGRK V++IGT +VVIFN +FGLSVNYWMA
Sbjct  74    DIGFYAGFVGCSLMLGRTLTSVVWGIVADRYGRKRVILIGTASVVIFNTLFGLSVNYWMA  133

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             IITRF LG   G++G ++AYA E    EY  L +SAVSTAWGIGL+IGPA+GG+ AQPA+
Sbjct  134   IITRFCLGCFNGLLGPIKAYAVETFSDEYQGLALSAVSTAWGIGLIIGPAMGGFLAQPAK  193

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehke-----ehDV  988
             +Y      +S FGKFPYFLPCL IS FAL+ T++S  +PET+H HK +          D 
Sbjct  194   QY------QSVFGKFPYFLPCLAISCFALLVTIISLRIPETLHNHKIDDDAPSPDESCDA  247

Query  989   SQN-SKQPEHEVPTSQK---SLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLG  1156
             S+  S  PE    T +    SLLKNWPLISSI+VYC+F LHD+AY EIFSLWA SPRK G
Sbjct  248   SKLLSHDPESHKATERNERTSLLKNWPLISSIIVYCIFSLHDMAYTEIFSLWANSPRKYG  307

Query  1157  GLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIAL  1336
             GL Y++ADVG VLAI+G GLL+FQL  Y   E +LGP M++RI  +L++ LLSTYP IA 
Sbjct  308   GLGYSSADVGSVLAISGFGLLIFQLSLYSYAEWLLGPTMVTRISGSLALVLLSTYPLIAK  367

Query  1337  LSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGP  1516
             LSGL L++ LNCAS+ KNVL+ S  TGL ILQNRAV Q+QRGAANGI+M+AMSLFK IGP
Sbjct  368   LSGLALTLALNCASVAKNVLATSAITGLFILQNRAVRQDQRGAANGIAMTAMSLFKAIGP  427

Query  1517  AAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             AA G + SWS+ R DA F+PG Q+VFF+LNV   LG++MTFKPFL
Sbjct  428   AAAGIIYSWSEKRLDAAFLPGTQMVFFILNVVLALGVVMTFKPFL  472



>ref|XP_004516551.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Cicer arietinum]
Length=501

 Score =   527 bits (1358),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 260/443 (59%), Positives = 336/443 (76%), Gaps = 7/443 (2%)
 Frame = +2

Query  263   LEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDF  442
             LE +YF   + C GC+VE  K  + GV I ++  I MV LCA LP  SLFPFLYFM+RDF
Sbjct  11    LEKQYF---KDCPGCKVEQAKELNQGVSITNLLIIWMVVLCATLPAISLFPFLYFMVRDF  67

Query  443   HIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGL  622
             ++A+ E DISYYA YVGSSFMLGR+LT+VLWG+I+DRYGRKPV+IIG V VVIFN +FGL
Sbjct  68    NVAKEEADISYYADYVGSSFMLGRSLTAVLWGMISDRYGRKPVIIIGIVAVVIFNTLFGL  127

Query  623   SVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGG  802
             S ++WMAI TRFLLG+L G++G ++AYA+E+ R E+ A+G+S VS AWGIGL+IGPA+GG
Sbjct  128   STSFWMAITTRFLLGSLNGVLGPVKAYATELFREEHQAIGLSTVSVAWGIGLIIGPALGG  187

Query  803   YFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeeh  982
             Y +QPA+KYP IF   SF  KFPYFLPC IIS FAL   +   W+PET+H H   +K + 
Sbjct  188   YLSQPAQKYPKIFPKYSFCDKFPYFLPCFIISGFALTVAIACIWIPETLHNHNDSNKSKD  247

Query  983   DV----SQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRK  1150
             DV    ++  K  +       ++L  NWPL+SSI+ Y +F LHDIAY E+FSLW+VSP  
Sbjct  248   DVEALENETDKVEKQRTVQHNENLFMNWPLMSSIIAYSIFALHDIAYQEVFSLWSVSPLG  307

Query  1151  LGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYI  1330
             LGGL++TT DVG VL+I+G+ L+++ L  YP VEK  GP+ I+RI    SIPLL +YP+I
Sbjct  308   LGGLNFTTDDVGNVLSISGVVLVIYNLAVYPYVEKTCGPIGIARITGICSIPLLQSYPFI  367

Query  1331  ALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTI  1510
             A+LSG+ L +V++ AS+LKN+++V+ITTGL ++QNR V Q QRGAANGISM+ MSLFK I
Sbjct  368   AMLSGITLYIVISIASILKNIIAVTITTGLFLIQNRVVEQHQRGAANGISMTVMSLFKAI  427

Query  1511  GPAAGGSLLSWSQLRQDAKFMPG  1579
             GPA GG++L+WSQ R DA F+PG
Sbjct  428   GPATGGTILTWSQKRMDASFLPG  450



>ref|XP_004516553.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X3 [Cicer arietinum]
Length=450

 Score =   525 bits (1353),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 259/442 (59%), Positives = 335/442 (76%), Gaps = 7/442 (2%)
 Frame = +2

Query  263   LEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDF  442
             LE +YF   + C GC+VE  K  + GV I ++  I MV LCA LP  SLFPFLYFM+RDF
Sbjct  11    LEKQYF---KDCPGCKVEQAKELNQGVSITNLLIIWMVVLCATLPAISLFPFLYFMVRDF  67

Query  443   HIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGL  622
             ++A+ E DISYYA YVGSSFMLGR+LT+VLWG+I+DRYGRKPV+IIG V VVIFN +FGL
Sbjct  68    NVAKEEADISYYADYVGSSFMLGRSLTAVLWGMISDRYGRKPVIIIGIVAVVIFNTLFGL  127

Query  623   SVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGG  802
             S ++WMAI TRFLLG+L G++G ++AYA+E+ R E+ A+G+S VS AWGIGL+IGPA+GG
Sbjct  128   STSFWMAITTRFLLGSLNGVLGPVKAYATELFREEHQAIGLSTVSVAWGIGLIIGPALGG  187

Query  803   YFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeeh  982
             Y +QPA+KYP IF   SF  KFPYFLPC IIS FAL   +   W+PET+H H   +K + 
Sbjct  188   YLSQPAQKYPKIFPKYSFCDKFPYFLPCFIISGFALTVAIACIWIPETLHNHNDSNKSKD  247

Query  983   DV----SQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRK  1150
             DV    ++  K  +       ++L  NWPL+SSI+ Y +F LHDIAY E+FSLW+VSP  
Sbjct  248   DVEALENETDKVEKQRTVQHNENLFMNWPLMSSIIAYSIFALHDIAYQEVFSLWSVSPLG  307

Query  1151  LGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYI  1330
             LGGL++TT DVG VL+I+G+ L+++ L  YP VEK  GP+ I+RI    SIPLL +YP+I
Sbjct  308   LGGLNFTTDDVGNVLSISGVVLVIYNLAVYPYVEKTCGPIGIARITGICSIPLLQSYPFI  367

Query  1331  ALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTI  1510
             A+LSG+ L +V++ AS+LKN+++V+ITTGL ++QNR V Q QRGAANGISM+ MSLFK I
Sbjct  368   AMLSGITLYIVISIASILKNIIAVTITTGLFLIQNRVVEQHQRGAANGISMTVMSLFKAI  427

Query  1511  GPAAGGSLLSWSQLRQDAKFMP  1576
             GPA GG++L+WSQ R DA F+P
Sbjct  428   GPATGGTILTWSQKRMDASFLP  449



>ref|NP_196878.2| zinc induced facilitator 1 proetin [Arabidopsis thaliana]
 sp|Q8RWN2.2|ZIF1_ARATH RecName: Full=Protein ZINC INDUCED FACILITATOR 1 [Arabidopsis 
thaliana]
 gb|AED91934.1| zinc induced facilitator 1 proetin [Arabidopsis thaliana]
Length=486

 Score =   526 bits (1354),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 289/493 (59%), Positives = 365/493 (74%), Gaps = 23/493 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE   E LL++  QN          Y + C GC+VE +K+   G P   + F+ ++ L 
Sbjct  1     MAEEYKEALLEK--QN----------YHDGCPGCKVEQMKQLRRGYPYLELSFVWIIVLS  48

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              +LPISSL+PFLY+MI DF +A+ E+DI +YAG+VG SFMLGRALTSV WGI+ADRYGRK
Sbjct  49    TSLPISSLYPFLYYMIEDFGVAKTEKDIGFYAGFVGCSFMLGRALTSVFWGIVADRYGRK  108

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             P++++GT+++ IFNA+FGLS N+WMAI TRFLLG+   ++GTM+AYASEI R EY A  +
Sbjct  109   PIILLGTISIAIFNALFGLSSNFWMAIGTRFLLGSFNCLLGTMKAYASEIFRDEYQATAM  168

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             SAVSTAWGIGL+IGPA+GG+ AQPA+KYP +FS ES FG+F Y LPC  IS FAL+ TV+
Sbjct  169   SAVSTAWGIGLIIGPALGGFLAQPADKYPNVFSQESLFGRFRYALPCFTISAFALLVTVL  228

Query  926   SFWLPETMHThkkehkeehDVSQNSKQPEHEVPTS-----------QKSLLKNWPLISSI  1072
               ++PET+H HK +     D     +   HE   S            +SLLKNWPL+SSI
Sbjct  229   CCFIPETLHNHKLDSLSHDDSYDILEAASHESSPSTGKAGKNERKASQSLLKNWPLMSSI  288

Query  1073  LVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVE  1252
             +VYCV  LHD AY EIF+LWA SPRK GGLSY+T +VG VLAI+G+GL  FQ+F YPL E
Sbjct  289   IVYCVLCLHDTAYSEIFALWANSPRKYGGLSYSTNEVGTVLAISGLGLFSFQVFVYPLAE  348

Query  1253  KVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQ  1432
             K+LGPV+++R   AL IP+  +YP+IA LSGL LS++LNCAS+L NVLSVS  TGLLILQ
Sbjct  349   KLLGPVLVTRYAGALMIPIQMSYPFIAGLSGLSLSLMLNCASILINVLSVSAITGLLILQ  408

Query  1433  NRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvf  1612
             NRAV Q QRGAANGI+M+AMSLFKT+GPA  G L SWS+ R +A F+PG  +VFFVLNV 
Sbjct  409   NRAVDQSQRGAANGIAMTAMSLFKTVGPAGAGILFSWSERRLNAAFLPGSHMVFFVLNVI  468

Query  1613  ellglIMTFKPFL  1651
              ++G+ +TFKPFL
Sbjct  469   VVVGVALTFKPFL  481



>ref|NP_189965.2| probable peptide/nitrate transporter  [Arabidopsis thaliana]
 gb|ABO38791.1| At3g43790 [Arabidopsis thaliana]
 gb|AEE77828.1| probable peptide/nitrate transporter [Arabidopsis thaliana]
Length=478

 Score =   525 bits (1352),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 269/462 (58%), Positives = 357/462 (77%), Gaps = 8/462 (2%)
 Frame = +2

Query  287   DESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREED  466
             +E C GC ++  K+   GVP  H+ FI +V+LC ALPISSLFP++YFMIRDFHIA++EED
Sbjct  14    NEDCPGCIIDRTKQQQRGVPYLHLSFIWLVSLCTALPISSLFPYIYFMIRDFHIAKQEED  73

Query  467   ISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMAI  646
             I +YAG+VGSSFM+GRALTS+ WG +ADRYGRKP+++IGT +V+IFN +FGLS ++W+AI
Sbjct  74    IGFYAGFVGSSFMIGRALTSIFWGKLADRYGRKPIILIGTFSVIIFNTLFGLSTSFWLAI  133

Query  647   ITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAEK  826
               RFLLG    ++G +RAYASE+   EY+AL +S VST+ GIGL++GPA+GGY AQPAEK
Sbjct  134   SVRFLLGCFNCLLGVIRAYASEVVSEEYNALSLSVVSTSRGIGLILGPAIGGYLAQPAEK  193

Query  827   YPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehk-------eehD  985
             YP IFS  S FG+FPYFLP L+IS++A    +  +WLPET+HT  +  +          D
Sbjct  194   YPNIFSQSSVFGRFPYFLPSLVISVYATAVLIACWWLPETLHTRCRIAQGRLNPTELNDD  253

Query  986   VSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLS  1165
              S+     E ++  ++ SLL+N PL++ I+VYCVF L +IAY EIFSLWAVS R  GGLS
Sbjct  254   ESRGGGLDEQKI-INKPSLLRNRPLMAIIIVYCVFSLQEIAYNEIFSLWAVSDRSYGGLS  312

Query  1166  YTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSG  1345
             +++ DVG+VLAI+G+GLL+FQL  YP +EK +G + + R+ A L IPLLS YPYIALLSG
Sbjct  313   FSSQDVGEVLAISGLGLLVFQLLVYPPLEKSVGLLAVIRLSAVLLIPLLSCYPYIALLSG  372

Query  1346  LCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAG  1525
             + L +V+NCAS++KN LS+S+ TGL I+ N+AV Q QRGAANGISM+AMS+FK+ GPA G
Sbjct  373   VTLHLVINCASIIKNALSISLVTGLFIMLNKAVPQNQRGAANGISMTAMSVFKSFGPAGG  432

Query  1526  GSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             G L SW+Q RQDA F+PGD++VF VLN+ +L+GLI+TF P++
Sbjct  433   GVLFSWAQKRQDATFLPGDEMVFLVLNLVQLVGLILTFIPYI  474



>ref|XP_006598055.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Glycine 
max]
Length=487

 Score =   525 bits (1352),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 283/463 (61%), Positives = 362/463 (78%), Gaps = 9/463 (2%)
 Frame = +2

Query  284   YDESCAGCRVELLKR--ADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAER  457
             Y E+C GC+V+  K      GVP+ ++F I MV LCAALPISSLFPFLYFM+RDF+IA+ 
Sbjct  15    YHENCPGCKVDQAKELSEGKGVPVTNLFIIWMVVLCAALPISSLFPFLYFMVRDFNIAKT  74

Query  458   EEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYW  637
             E DIS YAGYVGS+FM GR LTSVLWGIIADRYGRKPV++IG + VVIFN +FGLS ++W
Sbjct  75    EADISSYAGYVGSAFMFGRCLTSVLWGIIADRYGRKPVIVIGIIVVVIFNTLFGLSTSFW  134

Query  638   MAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQP  817
             MA+I RFLLG+L G++G ++AYA+E+ R E+ ALG+S VS AWGIGL+IGPA+GGY AQP
Sbjct  135   MAVIMRFLLGSLNGLLGPVKAYATELFREEHQALGLSTVSAAWGIGLIIGPALGGYLAQP  194

Query  818   AEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQN  997
              EKYP IF  +SF+ KFPY LP  IIS  A V  +   W+PET+H HK  ++   D ++ 
Sbjct  195   VEKYPHIFPKDSFWDKFPY-LPNFIISAVAFVVVIGCIWIPETLHNHKCRNESI-DNAET  252

Query  998   SKQP-----EHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGL  1162
              K       + ++   +++LL NWPL+SS++VYCVF LHDIAY E+FS+WAVSP++LGGL
Sbjct  253   LKNGGNVAGKDKIIQKKENLLLNWPLMSSVIVYCVFALHDIAYQEVFSIWAVSPQRLGGL  312

Query  1163  SYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLS  1342
             ++TT DVG VL+I+G+ L+++QL  YP VEK  GP++I RI   +SIPLL +YP+IALLS
Sbjct  313   NFTTDDVGNVLSISGLALIIYQLIIYPYVEKASGPIVIGRISGMISIPLLQSYPFIALLS  372

Query  1343  GLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAA  1522
             GL L +VL+ AS+LKN+LSV+I TGL +LQNRAV Q QRGAANGISM+ MSLFK+IGPA 
Sbjct  373   GLALYIVLSVASILKNLLSVTINTGLFLLQNRAVEQHQRGAANGISMTGMSLFKSIGPAT  432

Query  1523  GGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             GG++L+WSQ R DA F+PG  +VFFVLN+ E LG++M FKPFL
Sbjct  433   GGAILTWSQKRMDASFLPGTHMVFFVLNIVEGLGILMLFKPFL  475



>emb|CDX91099.1| BnaC02g04980D [Brassica napus]
Length=583

 Score =   529 bits (1362),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 290/500 (58%), Positives = 370/500 (74%), Gaps = 25/500 (5%)
 Frame = +2

Query  188   ERASESMAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFI  367
             E     MAE   E LL++ +            Y E C GC+VE +K+   G P   + F+
Sbjct  92    ELRRREMAEEYKEALLEKHK------------YHEGCPGCKVEQMKQLRKGYPYLELSFV  139

Query  368   SMVTLCAALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIA  547
              ++ L  +LPISSL+PFLY+MI DF +A+ E+DI +YAG++G SFMLGRALTSV WGI+A
Sbjct  140   WIIVLSTSLPISSLYPFLYYMIEDFGVAKTEKDIGFYAGFIGCSFMLGRALTSVFWGIVA  199

Query  548   DRYGRKPvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRRE  727
             DRYGRKP++++GT+++ IFNA+FGLS+N+WMAI TRFLLG+   ++GTM+AYASEI R E
Sbjct  200   DRYGRKPIILLGTISIAIFNALFGLSLNFWMAIGTRFLLGSFNCLLGTMKAYASEIFRDE  259

Query  728   YHALGISAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFA  907
             Y A  +SAVSTAWGIGL+IGPA+GG+ AQPA+KYP +FS +S FG+F Y LPC  IS FA
Sbjct  260   YQATAMSAVSTAWGIGLIIGPALGGFLAQPADKYPNVFSKDSIFGRFRYALPCFTISAFA  319

Query  908   LVATVMSFWLPETMHThkkehkeehD------------VSQNSKQPEHEVPTSQKSLLKN  1051
             LV TV+  ++PET+H HK +   + D             +   K  ++E  TSQ SLLKN
Sbjct  320   LVVTVLCCFIPETLHNHKLDITSDDDSYEVLEAASRESTASAGKTGKNE-KTSQGSLLKN  378

Query  1052  WPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQL  1231
             WPL+SSI+VYCV  LHD AY EIF+LWA SPRK GGLSY+T DVG VLAI+G+GL  FQ+
Sbjct  379   WPLMSSIIVYCVLCLHDTAYSEIFALWANSPRKYGGLSYSTNDVGTVLAISGLGLFSFQV  438

Query  1232  FAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSIT  1411
             F YPL E++LGPV+++R   AL IP+  +YP+IA LSGL LS++LNCAS+L NVLSVS  
Sbjct  439   FVYPLAERLLGPVLVTRYAGALMIPIQMSYPFIANLSGLSLSLLLNCASILINVLSVSAI  498

Query  1412  TGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlv  1591
             TGLLILQN+AV Q QRGAANGI+M+AMSLFKT+GPA  G L SWS+ R +A F+PG  LV
Sbjct  499   TGLLILQNKAVDQSQRGAANGIAMTAMSLFKTVGPAGAGILFSWSERRLNAAFLPGSHLV  558

Query  1592  ffvlnvfellglIMTFKPFL  1651
             FFVLNV  ++G+ +TFKPFL
Sbjct  559   FFVLNVIMVVGVALTFKPFL  578



>gb|ACG25327.1| carbohydrate transporter/ sugar porter/ transporter [Zea mays]
Length=499

 Score =   525 bits (1351),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 271/458 (59%), Positives = 341/458 (74%), Gaps = 4/458 (1%)
 Frame = +2

Query  290   ESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREEDI  469
             + C GC V+  K A  G+P  +  ++ +VTLC ALPISSLFPFLYFMIRD ++AER EDI
Sbjct  41    DGCPGCAVDRRKAASPGIPYANFIYVWIVTLCTALPISSLFPFLYFMIRDLNVAERTEDI  100

Query  470   SYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMAII  649
              +YAG+VG+SFM GR LTS  WGI ADR GRKPVV+ G  +VV+FN +FGLSVNYWMAI 
Sbjct  101   GFYAGFVGASFMFGRCLTSTAWGIAADRIGRKPVVVFGISSVVVFNTLFGLSVNYWMAIA  160

Query  650   TRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAEKY  829
             TRFL GAL G++G ++AYA E+CR E+ AL +S VSTAWGIGL+IGPA+GGY A PAE +
Sbjct  161   TRFLFGALNGLLGPIKAYAIEVCRPEHEALALSLVSTAWGIGLIIGPALGGYLALPAENF  220

Query  830   PTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSKQP  1009
             P IFS +S FG+FPYFLPCL  S+FA    V   W+PET+H     HK     SQ+ ++ 
Sbjct  221   PAIFSPDSVFGRFPYFLPCLCTSVFAAAVLVSCIWMPETLHR----HKVHESTSQDVEKV  276

Query  1010  EHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQ  1189
             +      +KSL +NWPL+SSI+VYC+F  HD+AY E+FSLWA S +K GGLS ++ DVGQ
Sbjct  277   QESGIRKKKSLFRNWPLMSSIIVYCIFSFHDMAYTEVFSLWAESDKKYGGLSLSSEDVGQ  336

Query  1190  VLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLN  1369
             VLA+TG  LL++QLF YP + KVLGP+  SRI A L I +L  YPY+  +S   LS++LN
Sbjct  337   VLAVTGASLLVYQLFLYPRINKVLGPIKSSRIAAILCISILFAYPYMTYISEPGLSIILN  396

Query  1370  CASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQ  1549
              AS++KN L+V+I TG  ILQN AV Q+QRGAANG+SM+ MS FK + PA  G + SW+Q
Sbjct  397   IASVIKNNLAVTIITGTFILQNNAVPQDQRGAANGLSMTGMSFFKALAPAGAGIVFSWAQ  456

Query  1550  LRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPE  1663
              RQ A F PGDQ+VFF+LNV EL+GLI+TFKPFL +PE
Sbjct  457   KRQHAFFFPGDQMVFFLLNVVELVGLILTFKPFLAVPE  494



>ref|XP_002313476.2| transporter-related family protein [Populus trichocarpa]
 gb|EEE87431.2| transporter-related family protein [Populus trichocarpa]
Length=498

 Score =   524 bits (1350),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 285/501 (57%), Positives = 380/501 (76%), Gaps = 26/501 (5%)
 Frame = +2

Query  233   LKQSEQNGGHLE--DEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISS  406
             + ++E     LE   EY+   E+C GC+++ L     GVP +++ +I +V+LC ALPI S
Sbjct  1     MARTENRNALLETTKEYY---ENCPGCKIDRLNEEQRGVPYRNLSYIWIVSLCTALPICS  57

Query  407   LFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigt  586
             LFPF+YFMIRDFHIAEREEDI +YAG+VGSSFM+GRALTS  WG +ADRYGRKP+++IGT
Sbjct  58    LFPFIYFMIRDFHIAEREEDIGFYAGFVGSSFMIGRALTSFFWGWLADRYGRKPIILIGT  117

Query  587   vtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAW  766
              +VV+ NA+FGLS ++WMA+ TRFLLG    ++GT+RAYASE+CR EY ++ +S VST+ 
Sbjct  118   SSVVVLNALFGLSTSFWMALSTRFLLGCFNSLLGTIRAYASEVCREEYRSVALSVVSTSR  177

Query  767   GIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPET  946
             GIG++IGPA+GG+ AQPAE +P +FS  S FG+FPYFLPCL+IS++A+   V  +WLPET
Sbjct  178   GIGMIIGPAIGGFLAQPAENFPNLFSESSIFGRFPYFLPCLVISVYAVGVLVACWWLPET  237

Query  947   MHThkkehkeehD-------VSQNSKQPEH-----EVPTSQK-SLLKNWPLISSILVYCV  1087
             +H H K+  +  D        ++ S + ++     E   SQK ++L+NWPL+S I+VYCV
Sbjct  238   LHMHDKKVNKRCDSCDVLEASAEESDEKDYVIEVEERKISQKANMLRNWPLMSVIIVYCV  297

Query  1088  FQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGP  1267
             F L +IAY EIFSLWAVS +K GGLS+++ DVG+VLAI+G GLLLFQL  YP +EKVLGP
Sbjct  298   FSLQEIAYAEIFSLWAVSDKKYGGLSFSSQDVGEVLAISGFGLLLFQLLLYPPIEKVLGP  357

Query  1268  VMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAV-  1444
             + ++R+ AA+SIPLL++YPYIA+LSG+ L +V+N AS+L+N LSV++ TGL ILQN AV 
Sbjct  358   ITVTRLSAAVSIPLLASYPYIAILSGITLHLVINIASVLRNTLSVTLVTGLFILQNNAVA  417

Query  1445  SQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPG-------DQlvffvl  1603
             S  QR AANGISM+AMS+FK  GPA GG+L SW+Q RQ A F+PG       DQLVFFVL
Sbjct  418   SSNQRAAANGISMTAMSVFKAFGPAGGGALFSWAQKRQVAAFLPGAYISLCCDQLVFFVL  477

Query  1604  nvfellglIMTFKPFLQLPED  1666
             N+ + +GL++TFKPFL  P +
Sbjct  478   NLVQFIGLLLTFKPFLAQPHE  498



>ref|XP_006594343.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Glycine max]
Length=498

 Score =   524 bits (1350),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 284/499 (57%), Positives = 367/499 (74%), Gaps = 30/499 (6%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKR--ADAGVPIKHVFFISMVT  379
             M E   +PLL++              Y E C GC+V+  K      GVP++++F I MV 
Sbjct  1     MEENVKQPLLERK-------------YYEDCPGCKVDQAKELSEGQGVPVRNLFIIWMVV  47

Query  380   LCA-----------ALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTS  526
             LCA           ALPISSLFPFLYFM+RDF+IA+ E DIS YAGYVGS+FM GR LTS
Sbjct  48    LCADKHSCYKVAKLALPISSLFPFLYFMVRDFNIAKTEADISSYAGYVGSAFMFGRCLTS  107

Query  527   VLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYA  706
             V+WGI+ADRYGRKPV++IG + VVIFN +FGLS ++WMA+I RFLLG+L G++G ++AYA
Sbjct  108   VMWGIVADRYGRKPVIVIGIIVVVIFNTLFGLSTSFWMAVIMRFLLGSLNGLLGPVKAYA  167

Query  707   SEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPC  886
             +E+ R E+ ALG+S VS AWG+GL+IGPA+GGY AQP EKYP IFS +SF+ KFPYFLP 
Sbjct  168   TELFREEHQALGLSTVSAAWGVGLIIGPALGGYLAQPVEKYPHIFSKDSFWDKFPYFLPN  227

Query  887   LIISMFALVATVMSFWLPETMHThkkehkeehDV----SQNSKQPEHEVPTSQKSLLKNW  1054
              IIS  A V  +   W+PET+H H   ++   +     +  S   + ++   +++LL NW
Sbjct  228   FIISAVAFVVVIGCIWIPETLHNHNCRNESIDNAEALENGGSVASKDKIIQKKENLLLNW  287

Query  1055  PLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLF  1234
             PL+SS++VYCVF LHDIAY E+FSLWAVSP++LGGL++TT DVG VL+I+G+ L+++QL 
Sbjct  288   PLMSSVIVYCVFALHDIAYQEVFSLWAVSPQRLGGLNFTTDDVGNVLSISGLALIIYQLT  347

Query  1235  AYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITT  1414
              YP VEK  GP++I RI   +SIPLL +YP+IALLSGL + +VL+ AS+LKN+LS +I T
Sbjct  348   IYPSVEKASGPIVIGRISGMISIPLLQSYPFIALLSGLAIYIVLSIASVLKNILSATINT  407

Query  1415  GLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvf  1594
             GL +LQNRAV Q QRGAANGISM+ MSLFK IGPA GG++L+WSQ R DA F+PG  +VF
Sbjct  408   GLFLLQNRAVEQHQRGAANGISMTGMSLFKAIGPATGGAILTWSQKRMDASFLPGTHMVF  467

Query  1595  fvlnvfellglIMTFKPFL  1651
             F LN+ E LGL+M FKPFL
Sbjct  468   FALNIVEALGLLMLFKPFL  486



>ref|XP_006832870.1| hypothetical protein AMTR_s00095p00084980 [Amborella trichopoda]
 gb|ERM98148.1| hypothetical protein AMTR_s00095p00084980 [Amborella trichopoda]
Length=495

 Score =   524 bits (1349),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 267/477 (56%), Positives = 359/477 (75%), Gaps = 10/477 (2%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             + E+C GCRV  +K A+ G P  +VF I  V LC++LPIS LFPFLYFM+RDFHI E+ E
Sbjct  14    HHENCPGCRVNRIKEAERGTPFLNVFSIWAVILCSSLPISLLFPFLYFMVRDFHITEQVE  73

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG+VGSSFM+GR LTS LWG+ ADRYGRKPV++ G  ++V+FN +FGLS ++WMA
Sbjct  74    DIGFYAGFVGSSFMVGRFLTSYLWGMAADRYGRKPVILCGVGSIVLFNGLFGLSNSFWMA  133

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             +ITRF+LG   G++GT++AYASE+ R ++ AL +S V T+WGIGL+IGPA+GGY AQPAE
Sbjct  134   VITRFILGCFNGLLGTIKAYASELFREDHQALAMSVVGTSWGIGLIIGPAIGGYLAQPAE  193

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHTh-kkehkeehDVSQ--  994
             KYP  FS +S FG+FPYFLPCL IS+FA V  + SFWLPET+H H  +E ++  D S   
Sbjct  194   KYPNTFSKDSLFGRFPYFLPCLCISVFAFVVFIASFWLPETIHKHPLEEIEKGFDTSDDL  253

Query  995   ---NSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLS  1165
                +++  +  + TS+ SL KNW L+S++++Y  + LH+I+Y EIFSLWA SPR LGGL 
Sbjct  254   EASDTETKKKRISTSRMSLFKNWSLMSTVIIYGFYSLHEISYTEIFSLWANSPRSLGGLG  313

Query  1166  YTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSG  1345
             +++ DVGQVLAI+G  LL  QL  +P +EK+ GP+ ++R+ +AL+IPLL  YP IA+L+G
Sbjct  314   FSSEDVGQVLAISGFILLFSQLCIFPKLEKLFGPIHVARLASALTIPLLMCYPLIAMLTG  373

Query  1346  LCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAG  1525
               L  V+N AS+LKN LS++I TG+ ILQN +V + QRGAANGIS++AMSLFK IGPAAG
Sbjct  374   FTLKFVINVASLLKNALSLTIVTGIAILQNNSVPRCQRGAANGISLTAMSLFKAIGPAAG  433

Query  1526  GSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL----QLPEDDILKSK  1684
             G++ SW+Q RQ A F+PGD +VFF L +  LL +I+T++PFL      P D+I +  
Sbjct  434   GAIFSWAQKRQHASFLPGDSMVFFFLCLLVLLLVILTYEPFLPKSCAKPYDEIEREN  490



>gb|EEC67611.1| hypothetical protein OsI_34993 [Oryza sativa Indica Group]
Length=463

 Score =   522 bits (1345),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 262/460 (57%), Positives = 345/460 (75%), Gaps = 1/460 (0%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             + + C GC +E    +  G+P K  FF+ + T+ ++LPISSLFPFLYFMI D H+A++E+
Sbjct  5     FYDGCPGCAMERKLESSQGIPYKEFFFVGITTIASSLPISSLFPFLYFMIEDLHVAKKEQ  64

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI  YAG++G+S+M+GR   S+ WG++ADR GRKP++    ++VVIFN +FGLSV YWMA
Sbjct  65    DIGLYAGFLGASYMIGRCFASLFWGVVADRIGRKPIIKFSILSVVIFNTLFGLSVKYWMA  124

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TRFLLGAL G++  ++AY+ E+CR E+ ALG+S VST WGIGLV+GPA+GGYFAQPA+
Sbjct  125   IATRFLLGALNGMLAPIKAYSIEVCRPEHQALGLSIVSTGWGIGLVVGPAIGGYFAQPAK  184

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             +YP +FS +S FG+FPYFLPCL IS+ ALV  +   WLPET+H   K+ + E ++  NS+
Sbjct  185   QYPNVFSEKSIFGRFPYFLPCLCISLIALVVLISCIWLPETLHK-HKDTEGEIEMIDNSR  243

Query  1004  QPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADV  1183
                 E    QKSL KNWPLISSI+ YCVF LHD AY EIFSLWAVS ++ GGLS+++ +V
Sbjct  244   STLEEDSHKQKSLYKNWPLISSIIAYCVFTLHDTAYTEIFSLWAVSEKRYGGLSFSSKEV  303

Query  1184  GQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVV  1363
             GQVLA+ G GLL++QLF Y  V K LG +  SRI +ALS+P+L+TYP++  LSG  L + 
Sbjct  304   GQVLAVAGAGLLVYQLFIYRSVHKFLGSINSSRIASALSVPILATYPFMTHLSGFRLGIA  363

Query  1364  LNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSW  1543
             L   ++LK VLS++I TG  +LQN AVSQ QRGAANGIS +AMS FK I PA  G+L SW
Sbjct  364   LYLGTILKGVLSITIITGTSLLQNNAVSQSQRGAANGISTTAMSFFKAIAPAGAGALFSW  423

Query  1544  SQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPE  1663
             +Q RQ+  F PGDQ++FF+LNV EL+GL +TFKPFL +P 
Sbjct  424   AQERQNEAFFPGDQMIFFILNVIELIGLALTFKPFLAIPN  463



>ref|XP_006663792.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like isoform X1 
[Oryza brachyantha]
Length=476

 Score =   522 bits (1344),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 261/460 (57%), Positives = 344/460 (75%), Gaps = 1/460 (0%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             + + C GC +E    +  G+P K   F+ + T+ ++LPISSLFPFLYFMI D H+A++E+
Sbjct  18    FYDGCPGCAMERKLESSKGIPYKEFIFVGITTIASSLPISSLFPFLYFMIEDLHVAKKEQ  77

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI  YAG++G+S+M+GR   S+ WG++ADR GRKP++    ++VVIFN +FGLSV YWMA
Sbjct  78    DIGLYAGFLGASYMVGRCFASLFWGVVADRIGRKPIIKFSILSVVIFNTLFGLSVRYWMA  137

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TRFLLGAL G++  ++AY+ E+CR E+ ALG+S VST WGIGLV+GPA+GGYFAQPA+
Sbjct  138   IATRFLLGALNGMLAPIKAYSIEVCRPEHQALGLSIVSTGWGIGLVVGPAIGGYFAQPAK  197

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             +YP IFS +S FG+FPYFLPCL IS+ ALV  +   WLPET+H   K  +   ++  NS+
Sbjct  198   QYPNIFSEKSIFGRFPYFLPCLCISLIALVVLISCIWLPETLHK-HKNVEGGIEMIDNSR  256

Query  1004  QPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADV  1183
                 E    QK+L KNWPLISSI+ YCVF LHD AY EIFSLWAVS +K GGLS+++ +V
Sbjct  257   STLEEDSHKQKNLYKNWPLISSIIAYCVFTLHDTAYSEIFSLWAVSDKKYGGLSFSSKEV  316

Query  1184  GQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVV  1363
             GQVLA+ G GLL++QLF Y  V + LG V  SR+ +ALSIP+L+ YP++  LSG  L + 
Sbjct  317   GQVLAVAGAGLLVYQLFIYRSVHRFLGSVNSSRVASALSIPILAAYPFMTHLSGFRLGIA  376

Query  1364  LNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSW  1543
             L  A++LK VLS++I TG  +LQN AVSQ QRGAANGIS +AMS FK I PA  G+L SW
Sbjct  377   LYLATILKGVLSITIITGTSLLQNNAVSQSQRGAANGISTTAMSFFKAIAPAGAGALFSW  436

Query  1544  SQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPE  1663
             +Q RQ+A F PGDQ++FF+LN+ EL+GL++TFKPFL +P 
Sbjct  437   TQKRQNAAFFPGDQMIFFILNLIELVGLVLTFKPFLAIPN  476



>ref|XP_006662712.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Oryza brachyantha]
Length=476

 Score =   522 bits (1344),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 261/460 (57%), Positives = 344/460 (75%), Gaps = 1/460 (0%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             + + C GC +E    +  G+P K   F+ + T+ ++LPISSLFPFLYFMI D H+A++E+
Sbjct  18    FYDGCPGCAMERKLESSKGIPYKEFIFVGITTIASSLPISSLFPFLYFMIEDLHVAKKEQ  77

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI  YAG++G+S+M+GR   S+ WG++ADR GRKP++    ++VVIFN +FGLSV YWMA
Sbjct  78    DIGLYAGFLGASYMVGRCFASLFWGVVADRIGRKPIIKFSILSVVIFNTLFGLSVRYWMA  137

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TRFLLGAL G++  ++AY+ E+CR E+ ALG+S VST WGIGLV+GPA+GGYFAQPA+
Sbjct  138   IATRFLLGALNGMLAPVKAYSIEVCRPEHQALGLSIVSTGWGIGLVVGPAIGGYFAQPAK  197

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             +YP IFS +S FG+FPYFLPCL IS+ ALV  +   WLPET+H   K  +   ++  NS+
Sbjct  198   QYPNIFSEKSIFGRFPYFLPCLCISLIALVVLISCIWLPETLHK-HKNVEGGIEMIDNSR  256

Query  1004  QPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADV  1183
                 E    QK+L KNWPLISSI+ YCVF LHD AY EIFSLWAVS +K GGLS+++ +V
Sbjct  257   STLEEDSHKQKNLYKNWPLISSIIAYCVFTLHDTAYSEIFSLWAVSDKKYGGLSFSSKEV  316

Query  1184  GQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVV  1363
             GQVLA+ G GLL++QLF Y  V + LG V  SR+ +ALSIP+L+ YP++  LSG  L + 
Sbjct  317   GQVLAVAGAGLLVYQLFIYRSVHRFLGSVNSSRVASALSIPILAAYPFMTHLSGFRLGIA  376

Query  1364  LNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSW  1543
             L  A++LK VLS++I TG  +LQN AVSQ QRGAANGIS +AMS FK I PA  G+L SW
Sbjct  377   LYLATILKGVLSITIITGTSLLQNNAVSQSQRGAANGISTTAMSFFKAIAPAGAGALFSW  436

Query  1544  SQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPE  1663
             +Q RQ+A F PGDQ++FF+LN+ EL+GL++TFKPFL +P 
Sbjct  437   TQKRQNAAFFPGDQMIFFILNLIELVGLVLTFKPFLAIPN  476



>ref|XP_007133564.1| hypothetical protein PHAVU_011G189600g [Phaseolus vulgaris]
 gb|ESW05558.1| hypothetical protein PHAVU_011G189600g [Phaseolus vulgaris]
Length=490

 Score =   522 bits (1345),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 268/458 (59%), Positives = 349/458 (76%), Gaps = 5/458 (1%)
 Frame = +2

Query  293   SCAGCRVELLKRADAG--VPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREED  466
             +C GC+V+  K    G  VP   +F + M+ LCAALPISSLFPFLYFM+RDF+IA+ E D
Sbjct  21    NCPGCKVDKEKELSEGQGVPFTKLFIVWMLVLCAALPISSLFPFLYFMVRDFNIAKTEAD  80

Query  467   ISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMAI  646
             IS Y+GYVGS+FMLGR LTS+LWG IADR GRKPV+IIG ++V+IFN +FGLS ++WMA+
Sbjct  81    ISSYSGYVGSAFMLGRCLTSLLWGTIADRIGRKPVIIIGIISVIIFNTLFGLSTSFWMAV  140

Query  647   ITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAEK  826
             I RFLLG+L  + G ++AY +E+ R E+ ALG+S VS AWGIGL+IGPA+GGY +QP EK
Sbjct  141   IMRFLLGSLNCLFGPVKAYTTELFREEHQALGLSTVSAAWGIGLIIGPALGGYLSQPVEK  200

Query  827   YPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehD---VSQN  997
             YP IF  +SF+ KFPYFLP ++IS FA V  +   W+PET+H H    +   D   +   
Sbjct  201   YPHIFPKDSFWDKFPYFLPNIVISTFAFVVAIGCIWIPETLHNHNCSDEYTEDAKALENG  260

Query  998   SKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTA  1177
             +     E     ++L  NWPL+SSI+ YC+F LHDIAYLE+FSLWAVSP++LGGL++TT 
Sbjct  261   NSGAGIENIQKNENLFLNWPLMSSIISYCIFSLHDIAYLEVFSLWAVSPQRLGGLNFTTD  320

Query  1178  DVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLS  1357
             DVG VL+I+G+ L+++QL  YP VEK  GP+ ++RI + LSIPLL +YP+IALLSGL L 
Sbjct  321   DVGNVLSISGLALIIYQLTIYPSVEKTSGPISLARISSILSIPLLQSYPFIALLSGLALY  380

Query  1358  VVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLL  1537
             +VL+  S+LKN+LS++I TGLL+LQNRAV Q QRGAANG++++ MSLF  IGPA GG+LL
Sbjct  381   IVLSIFSILKNILSITIITGLLLLQNRAVEQHQRGAANGVALTCMSLFSAIGPATGGTLL  440

Query  1538  SWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             +WSQ R DA F+PG  +VFFVLN+ +  GL+M FKPFL
Sbjct  441   TWSQKRMDASFLPGTHMVFFVLNIIQAFGLLMMFKPFL  478



>gb|KHN10319.1| Protein ZINC INDUCED FACILITATOR-LIKE 1 [Glycine soja]
Length=498

 Score =   522 bits (1344),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 283/499 (57%), Positives = 367/499 (74%), Gaps = 30/499 (6%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKR--ADAGVPIKHVFFISMVT  379
             M E   +PLL++              Y E C GC+V+  K      GVP++++F I MV 
Sbjct  1     MEENVKQPLLERK-------------YYEDCPGCKVDQAKELSEGQGVPVRNLFIIWMVV  47

Query  380   LCA-----------ALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTS  526
             LCA           ALPISSLFPFLYFM+RDF+IA+ E DIS YAGYVGS+FM GR LTS
Sbjct  48    LCADKHSCYKVAKLALPISSLFPFLYFMVRDFNIAKTEADISSYAGYVGSAFMFGRCLTS  107

Query  527   VLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYA  706
             V+WGI+ADRYGRKPV++IG + VVIFN +FGLS ++WMA+I RFLLG+L G++G ++AYA
Sbjct  108   VMWGIVADRYGRKPVIVIGIIVVVIFNTLFGLSTSFWMAVIMRFLLGSLNGLLGPVKAYA  167

Query  707   SEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPC  886
             +E+ R E+ ALG+S VS AWG+GL+IGPA+GGY A+P EKYP IFS +SF+ KFPYFLP 
Sbjct  168   TELFREEHQALGLSTVSAAWGVGLIIGPALGGYLARPVEKYPHIFSKDSFWDKFPYFLPN  227

Query  887   LIISMFALVATVMSFWLPETMHThkkehkeehDV----SQNSKQPEHEVPTSQKSLLKNW  1054
              IIS  A V  +   W+PET+H H   ++   +     +  S   + ++   +++LL NW
Sbjct  228   FIISAVAFVVVIGCIWIPETLHNHNCRNESIDNAEALENGGSVASKDKIIQKKENLLLNW  287

Query  1055  PLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLF  1234
             PL+SS++VYCVF LHDIAY E+FSLWAVSP++LGGL++TT DVG VL+I+G+ L+++QL 
Sbjct  288   PLMSSVIVYCVFALHDIAYQEVFSLWAVSPQRLGGLNFTTDDVGNVLSISGLALIIYQLT  347

Query  1235  AYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITT  1414
              YP VEK  GP++I RI   +SIPLL +YP+IALLSGL + +VL+ AS+LKN+LS +I T
Sbjct  348   IYPSVEKASGPIVIGRISGMISIPLLQSYPFIALLSGLAIYIVLSIASVLKNILSATINT  407

Query  1415  GLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvf  1594
             GL +LQNRAV Q QRGAANGISM+ MSLFK IGPA GG++L+WSQ R DA F+PG  +VF
Sbjct  408   GLFLLQNRAVEQHQRGAANGISMTGMSLFKAIGPATGGAILTWSQKRMDASFLPGTHMVF  467

Query  1595  fvlnvfellglIMTFKPFL  1651
             F LN+ E LGL+M FKPFL
Sbjct  468   FALNIVEALGLLMLFKPFL  486



>emb|CDY59529.1| BnaCnng35110D [Brassica napus]
Length=486

 Score =   521 bits (1343),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 269/468 (57%), Positives = 355/468 (76%), Gaps = 13/468 (3%)
 Frame = +2

Query  287   DESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREED  466
             + +C GC ++  K+   G+P  H+ FI +V+LC ALPISSLFP+LYFMIRDFH+AE+EED
Sbjct  15    ERNCPGCNIDRFKQEQRGIPYIHLSFIWLVSLCTALPISSLFPYLYFMIRDFHVAEKEED  74

Query  467   ISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMAI  646
             I +YAG+V SSFM+GRALTS+LWG +ADRYGRKP++++ T +V+IFN +FGLS ++W AI
Sbjct  75    IGFYAGFVASSFMIGRALTSILWGKLADRYGRKPIILMATFSVIIFNTLFGLSTSFWFAI  134

Query  647   ITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAEK  826
               RFLLG +  ++G +RAYASE+   EYHAL +S VST+ GIGL+IGPA+GGY AQPA+K
Sbjct  135   SVRFLLGCVNCLLGVIRAYASEVVSEEYHALSLSVVSTSRGIGLIIGPAIGGYLAQPAKK  194

Query  827   YPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSKQ  1006
             YP +FS +S FG FPYFLP L+IS +A  A +  +WLPET+HTH +  +   + ++    
Sbjct  195   YPNLFSQDSVFGSFPYFLPSLVISAYATGAFIACWWLPETLHTHCRISRGRLNPNEPEYS  254

Query  1007  P-------------EHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPR  1147
             P             E     S+ SLL+N PL++ I+VYCVF L +IAY EIFSLWAVS +
Sbjct  255   PNELNNDGSTGRGLEDHNTQSKPSLLRNRPLMAIIIVYCVFSLQEIAYSEIFSLWAVSDK  314

Query  1148  KLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPY  1327
               GGLS+++ DVGQVLAI+G+GLLLFQL  YP +EK LG +++ R+ A + IPLLS YP 
Sbjct  315   SYGGLSFSSQDVGQVLAISGLGLLLFQLMVYPPMEKSLGLLVVIRLSAVMLIPLLSCYPS  374

Query  1328  IALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKT  1507
             IA LSGL L +V+NCAS+LKN LS+S+ TGL IL N+AV Q QRGAANG+SM+AMS+FK+
Sbjct  375   IASLSGLTLHLVINCASILKNALSISLVTGLFILLNKAVPQSQRGAANGLSMTAMSIFKS  434

Query  1508  IGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
              GPA GG L SW+Q RQ A F+PGD++VFFVLN+ +L+GLI+TF P++
Sbjct  435   FGPAGGGILFSWAQKRQTATFLPGDEMVFFVLNLVQLIGLILTFIPYI  482



>ref|NP_001065681.1| Os11g0134900 [Oryza sativa Japonica Group]
 gb|ABA91320.1| major facilitator superfamily antiporter, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF27526.1| Os11g0134900 [Oryza sativa Japonica Group]
 gb|EEE51602.1| hypothetical protein OsJ_32857 [Oryza sativa Japonica Group]
Length=473

 Score =   521 bits (1341),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 261/460 (57%), Positives = 345/460 (75%), Gaps = 1/460 (0%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             + + C GC +E    +  G+P K  FF+ + T+ ++LPISSLFPFLYFMI D H+A++E+
Sbjct  15    FYDGCPGCAMERKLESSQGIPYKEFFFVGITTIASSLPISSLFPFLYFMIEDLHVAKKEQ  74

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI  YAG++G+S+M+GR   S+ WG++ADR GRKP++    ++VVIFN +FGLSV YWMA
Sbjct  75    DIGLYAGFLGASYMIGRCFASLFWGVVADRIGRKPIIKFSILSVVIFNTLFGLSVKYWMA  134

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TRFLLGAL G++  ++AY+ E+CR E+ ALG+S VST WG+GLV+GPA+GGYFAQPA+
Sbjct  135   IATRFLLGALNGMLAPIKAYSIEVCRPEHQALGLSIVSTGWGVGLVVGPAIGGYFAQPAK  194

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             +YP +FS +S FG+FPYFLPCL IS+ ALV  +   WLPET+H   K+ + E ++  NS+
Sbjct  195   QYPNVFSEKSIFGRFPYFLPCLCISLIALVVLISCIWLPETLHK-HKDTEGEIEMIDNSR  253

Query  1004  QPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADV  1183
                 E    QKSL KNWPLISSI+ YCVF LHD AY EIFSLWAVS ++ GGLS+++ +V
Sbjct  254   STLEEDSHKQKSLYKNWPLISSIIAYCVFTLHDTAYSEIFSLWAVSEKRYGGLSFSSKEV  313

Query  1184  GQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVV  1363
             GQVLA+ G GLL++QLF Y  V K LG +  SRI +ALS+P+L+TYP++  LSG  L + 
Sbjct  314   GQVLAVAGAGLLVYQLFIYRSVHKFLGSINSSRIASALSVPILATYPFMTHLSGFRLGIA  373

Query  1364  LNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSW  1543
             L   ++LK VLS++I TG  +LQN AVSQ QRGAANGIS +AMS FK I PA  G+L SW
Sbjct  374   LYLGTILKGVLSITIITGTSLLQNNAVSQSQRGAANGISTTAMSFFKAIAPAGAGALFSW  433

Query  1544  SQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPE  1663
             +Q RQ+  F PGDQ++FF+LNV EL+GL +TFKPFL +P 
Sbjct  434   AQERQNEAFFPGDQMIFFILNVIELIGLALTFKPFLAIPN  473



>ref|XP_007010373.1| Zinc induced facilitator-like 1 isoform 3 [Theobroma cacao]
 gb|EOY19183.1| Zinc induced facilitator-like 1 isoform 3 [Theobroma cacao]
Length=418

 Score =   518 bits (1335),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 271/426 (64%), Positives = 332/426 (78%), Gaps = 26/426 (6%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MA+   EPLLK+              Y E+C GC+V+ +K    G+P++ +  I +V LC
Sbjct  1     MAQEYREPLLKKK-------------YHENCPGCKVDQMKELQRGLPLRQLVSIWIVVLC  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
             AALPISSLFPFLYFMIRDFHI++REEDI YYAGYVGS+FMLGRA TSVLWGIIADRYGRK
Sbjct  48    AALPISSLFPFLYFMIRDFHISKREEDIGYYAGYVGSAFMLGRASTSVLWGIIADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV+I+GT+TVV+FN +FGLSVN++MA+ TRFLLG+L G++G ++AYA EI R E+ ALG+
Sbjct  108   PVIIMGTITVVVFNTLFGLSVNFYMAVTTRFLLGSLNGLLGPIKAYAVEIFREEHQALGL  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S VST+WGIGL+IGPA+GG+ AQPAEKYP IFS +S FG+FPYFLPCL IS+FAL  T+ 
Sbjct  168   STVSTSWGIGLIIGPALGGFLAQPAEKYPNIFSKDSLFGRFPYFLPCLAISLFALGVTIA  227

Query  926   SFWLPETMHThkkehkeehD-------------VSQNSKQPEHEVPTSQKSLLKNWPLIS  1066
             +FWLPET+H H    +   D               + +++ E    TS++SLLKNWPL+S
Sbjct  228   TFWLPETLHKHNDNDRSSDDSYDALEAAPHESSSKEITEEDEGRESTSKQSLLKNWPLMS  287

Query  1067  SILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPL  1246
             SI+VYCVF LHD+AY EIFSLWAVSPRK GGLSY+T DVG+VLAI+G  LL+FQL  YP 
Sbjct  288   SIIVYCVFSLHDMAYTEIFSLWAVSPRKFGGLSYSTKDVGEVLAISGFSLLVFQLSVYPT  347

Query  1247  VEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLI  1426
             VE++LGPVM+SRI + L+IPLL +Y YIALLSG  LS+VLNCAS+LKNVLSVSI TGL I
Sbjct  348   VERILGPVMVSRIASVLTIPLLQSYSYIALLSGFTLSLVLNCASILKNVLSVSIITGLFI  407

Query  1427  LQNRAV  1444
             LQNRAV
Sbjct  408   LQNRAV  413



>ref|XP_010237967.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Brachypodium distachyon]
Length=498

 Score =   521 bits (1343),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 294/511 (58%), Positives = 360/511 (70%), Gaps = 34/511 (7%)
 Frame = +2

Query  182   ASERASESMAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVF  361
             A ER++    E  T PLL   E+ G +       Y E C GC VE  K ADAG+P   + 
Sbjct  2     AEERSAGGGGETRTAPLL---EKKGAY-------YVEGCPGCGVERRKAADAGIPYGSLV  51

Query  362   FISMVTLCAALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGI  541
             +I +V LC ALPISSLFPFLYFMIRD ++A+R EDI +YAG+VG+SFM GR LTS  WGI
Sbjct  52    YIWVVILCTALPISSLFPFLYFMIRDLNVAKRTEDIGFYAGFVGASFMFGRCLTSTAWGI  111

Query  542   IADRYGRKPvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICR  721
              ADR GRKPV++ G  +VVIFN +FGLSV YWMAI TRFLLGAL G++G ++AYA E+CR
Sbjct  112   AADRIGRKPVIVFGIFSVVIFNTLFGLSVTYWMAIATRFLLGALNGLLGPIKAYAIEVCR  171

Query  722   REYHALGISAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISM  901
              E+ AL +S VSTAWGIGL+IGPA+GGY A PAEKYP+IFS +SFFG+FPYFLPCL  SM
Sbjct  172   PEHEALALSLVSTAWGIGLIIGPALGGYLALPAEKYPSIFSPDSFFGRFPYFLPCLCTSM  231

Query  902   FALVATVMSFWLPETMHThkkehkeehDVSQNSKQ--PEHEVP--------------TSQ  1033
             FA V  V   W+PET+H         H V++N  Q     E P               ++
Sbjct  232   FAAVVLVSCIWMPETLHK--------HKVNENGNQCVEALEAPLIDPKGNAVQSGNVDTK  283

Query  1034  KSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIG  1213
             KSL KNWPL+SSI++YCVF  HD+AY E+FSLWA S RK GGLS ++ DVGQ LAITG  
Sbjct  284   KSLFKNWPLMSSIIIYCVFSFHDMAYTEVFSLWAESDRKYGGLSLSSEDVGQTLAITGAS  343

Query  1214  LLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNV  1393
             LL++QLF YP + KVLG V  S+I A L IP+L  YPY+  LS   LS+VLN AS++KN 
Sbjct  344   LLVYQLFMYPRINKVLGHVRSSQIAAVLCIPILFAYPYMTYLSEPGLSIVLNIASVIKNN  403

Query  1394  LSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFM  1573
             L V+I TG  ILQN AV Q+QRGAANG++M+ MS FK + PA  G + SW+Q RQ A F 
Sbjct  404   LGVTIITGTFILQNNAVPQDQRGAANGLAMTGMSFFKAVAPAGAGIVFSWAQKRQHAFFF  463

Query  1574  PGDQlvffvlnvfellglIMTFKPFLQLPED  1666
             PGDQ+VFF+LN+ ELLGL++TFKPFL +PE 
Sbjct  464   PGDQMVFFLLNIVELLGLVLTFKPFLAVPEQ  494



>ref|XP_007133565.1| hypothetical protein PHAVU_011G189700g [Phaseolus vulgaris]
 gb|ESW05559.1| hypothetical protein PHAVU_011G189700g [Phaseolus vulgaris]
Length=488

 Score =   521 bits (1341),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 270/488 (55%), Positives = 353/488 (72%), Gaps = 17/488 (3%)
 Frame = +2

Query  206   MAEGN-TEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAG--VPIKHVFFISMV  376
             M E N  +PLL++ ++           Y E+C GC+V+     + G  VP   +  + M+
Sbjct  1     MKEENVNQPLLEKKKK-----------YYENCPGCKVDKANELNEGQGVPFTKLLIVWML  49

Query  377   TLCAALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRY  556
              LCAALPISSLFPFLYFM+RDF+IA+ E DIS YAGYVGS+FMLGR LTS+ WG +ADR 
Sbjct  50    VLCAALPISSLFPFLYFMVRDFNIAKTEADISSYAGYVGSAFMLGRCLTSLFWGTVADRI  109

Query  557   GRKPvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHA  736
             GRKPV+ IG ++VVIFN +FGLS ++WMA+I RFLLG+L  ++G +RAYASE+ R E+  
Sbjct  110   GRKPVITIGIMSVVIFNTLFGLSTSFWMAVIVRFLLGSLNCLLGPVRAYASELFREEHQT  169

Query  737   LGISAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVA  916
             LG+S VS AWGIGL++GPA+GGY +QP EKYP IF  +SF+ KFPYFLP  +IS  A V 
Sbjct  170   LGLSTVSAAWGIGLIVGPALGGYLSQPVEKYPHIFPKDSFWDKFPYFLPNFVISALAFVV  229

Query  917   TVMSFWLPETMHThkkehkeehD---VSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCV  1087
              +   W+PET+H H    +   D   +   +   + E     ++L  NWPL+SSI+ YC+
Sbjct  230   AIGCIWIPETLHNHNYSDESMEDAKALENGNNGADKENIQKNENLFLNWPLMSSIIAYCI  289

Query  1088  FQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGP  1267
             F LHDI YLE+FSLWAVSP++ GGL++TT +VG VL+I+G+ L+++QL  YP VEK  GP
Sbjct  290   FSLHDITYLEVFSLWAVSPQRFGGLNFTTDNVGNVLSISGLALIIYQLTIYPSVEKASGP  349

Query  1268  VMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVS  1447
             + ++RI + LSIPLL +YP+I L SGL L VVL+  S+LKN+ S++I TGLL+LQNRAV 
Sbjct  350   ISLARISSILSIPLLQSYPFITLFSGLALYVVLSILSILKNIFSITIITGLLLLQNRAVE  409

Query  1448  QEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellgl  1627
             Q QRGAANGI M+ MSLF  IGP  GG++L+WSQ R DA F+PG  +VFFVLN+ E LGL
Sbjct  410   QHQRGAANGIVMTGMSLFNAIGPVTGGAVLTWSQKRMDASFLPGTHMVFFVLNIVEALGL  469

Query  1628  IMTFKPFL  1651
             +M FKPFL
Sbjct  470   LMMFKPFL  477



>gb|KEH19211.1| zinc induced facilitator-like protein [Medicago truncatula]
Length=434

 Score =   519 bits (1336),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 255/440 (58%), Positives = 328/440 (75%), Gaps = 15/440 (3%)
 Frame = +2

Query  224   EPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPIS  403
             EPLL++ +            Y E C GC+VE  K  + G+ + ++  I M+ L A LP S
Sbjct  4     EPLLEKKQ------------YYEDCPGCKVEQTKELNQGLSMINLVIIWMIVLSATLPAS  51

Query  404   SLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviig  583
             SLFPFLYFM+RDF++A+ E DISYYAGYVGSSFMLGR LTSVLWG+++DRYGRKPV+I+G
Sbjct  52    SLFPFLYFMVRDFNVAKEEADISYYAGYVGSSFMLGRCLTSVLWGMVSDRYGRKPVIIMG  111

Query  584   tvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTA  763
              + VVIFN +FGLS  YWMAIITRFLLG+L G++G ++AYASE+ R E+ A+G+S VS A
Sbjct  112   IIAVVIFNTLFGLSTGYWMAIITRFLLGSLNGVLGPVKAYASELFREEHQAIGLSTVSAA  171

Query  764   WGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPE  943
             WG+GL+IGPA+GGY AQP EKYP IF  +SF+ KFPYFLPC IIS+ A    +   W+PE
Sbjct  172   WGVGLIIGPAIGGYLAQPVEKYPQIFPKDSFWDKFPYFLPCFIISVLAFTVVIACIWIPE  231

Query  944   TMHThkkehkeehDVS--QNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLE  1117
             T+H H    +   D    +N    E  V    ++L  NWPL+SSI+VYCVF LHDIAY E
Sbjct  232   TLHNHNGNKESTDDAEALENGSNKEKTV-RKNENLFMNWPLMSSIIVYCVFSLHDIAYHE  290

Query  1118  IFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAAL  1297
             +FSLWA SP KLGGL++TT DVG VL+I+G+ L ++QLF YP VEK  GP+ + RI    
Sbjct  291   VFSLWATSPPKLGGLNFTTDDVGNVLSISGVALCIYQLFIYPSVEKACGPIGLGRITGIF  350

Query  1298  SIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGI  1477
             SIPLL +YP+IA+LSG+ L +V++ AS+LKN++SV+ITTGL ++QNR V Q QRGAANG+
Sbjct  351   SIPLLQSYPFIAMLSGITLYIVISIASVLKNIMSVTITTGLFLIQNRVVEQHQRGAANGL  410

Query  1478  SMSAMSLFKTIGPAAGGSLL  1537
             SM+ MSLFK IGPAAGG+++
Sbjct  411   SMTGMSLFKAIGPAAGGTII  430



>gb|ABG21873.1| transporter, putative, expressed [Oryza sativa Japonica Group]
Length=502

 Score =   521 bits (1342),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 284/488 (58%), Positives = 356/488 (73%), Gaps = 10/488 (2%)
 Frame = +2

Query  227   PLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISS  406
             PLL++    G  ++D Y C  E C GC V+  K A  G+P     F+ +VTLC ALPISS
Sbjct  13    PLLEKKGSTGTGVDDGY-CI-EGCPGCVVDRRKAASYGIPYGSFLFVWIVTLCTALPISS  70

Query  407   LFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigt  586
             LFPFLYFMIRD H+A+R EDI +YAG+VG+SFM GR LTS +WGI ADR GRKPVV+ G 
Sbjct  71    LFPFLYFMIRDLHVAKRTEDIGFYAGFVGASFMFGRCLTSTVWGIAADRIGRKPVVVFGI  130

Query  587   vtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAW  766
               VVIFN +FGLS  YWMAI TRFLLGAL G++G ++AYA E+CR E+ AL +S VSTAW
Sbjct  131   FAVVIFNTLFGLSFTYWMAIATRFLLGALNGLLGPIKAYAIEVCRPEHEALALSLVSTAW  190

Query  767   GIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPET  946
             GIGL+IGPA+GGY +QPAEK+P +FS +S F +FPYFLPCL IS+FA V  +   W+PET
Sbjct  191   GIGLIIGPAIGGYLSQPAEKFPNVFSPDSLFARFPYFLPCLCISVFAAVVLIGCIWMPET  250

Query  947   MHThkkehkeehDVSQ--------NSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHD  1102
             +H HK +      V            K  ++     +KSLL+NWPL+SSI++YCVF  HD
Sbjct  251   LHKHKADASRSQTVEALESHLIDPKEKADQNGSLDCKKSLLRNWPLMSSIILYCVFSFHD  310

Query  1103  IAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISR  1282
             +AY EIFSLWA S RK GGLS ++ DVGQVLAITG+ LL++QLF YP + KV+G +  SR
Sbjct  311   MAYTEIFSLWAESDRKYGGLSLSSEDVGQVLAITGVSLLVYQLFIYPRINKVIGHIKASR  370

Query  1283  IGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRG  1462
             I A L IP+L  YPY+  LSG  L+++LN AS++KN L V+I TG  ILQN AV Q+QRG
Sbjct  371   IAAILCIPILFAYPYMTYLSGPGLTIILNIASVIKNNLGVTIITGCFILQNNAVPQDQRG  430

Query  1463  AANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFK  1642
             AANG++M+ MS FK + PA  G + SW+Q RQ A F+PGDQ+VFF+LN+FELLGLI+TFK
Sbjct  431   AANGLAMTGMSFFKAVAPAGAGIVFSWAQKRQHASFLPGDQMVFFLLNLFELLGLILTFK  490

Query  1643  PFLQLPED  1666
             PFL +PE 
Sbjct  491   PFLAVPEQ  498



>gb|ABR17390.1| unknown [Picea sitchensis]
Length=512

 Score =   521 bits (1343),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 267/509 (52%), Positives = 367/509 (72%), Gaps = 22/509 (4%)
 Frame = +2

Query  212   EGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAA  391
             +  +EPLL +  +           Y E+C GC+VE  K      P+K +  ++++ LC A
Sbjct  5     DEQSEPLLTKDVK-----------YYENCPGCKVEERKEKQKARPLKELMLLALLVLCNA  53

Query  392   LPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPv  571
             LPISSLFPF+YFM+RDFH+  + EDI YYAGY+GSSFM GR LTS LWG+ AD+YGRKP+
Sbjct  54    LPISSLFPFVYFMVRDFHMG-KTEDIGYYAGYIGSSFMFGRFLTSALWGMAADKYGRKPI  112

Query  572   viigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISA  751
             +IIG  +V++FN +FG+S ++WMA+  RFLLG+  G++G ++AYASEICR E+ ALG+S 
Sbjct  113   MIIGVSSVIVFNTLFGMSTSFWMAVSMRFLLGSFNGMLGPVKAYASEICRDEHQALGLSV  172

Query  752   VSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSF  931
             V T WGIGL+IGPA+GG+FAQPA+KYP IF   S FG+FPY LPCL IS+ ALV  V +F
Sbjct  173   VGTMWGIGLIIGPALGGFFAQPADKYPKIFPKNSLFGRFPYLLPCLCISVIALVVLVTTF  232

Query  932   WLPETMHThkkehkeehD----------VSQNSKQPEHEVPTSQKSLLKNWPLISSILVY  1081
             WLPET+H H  E +E+ D          + +   Q   +   ++KSL +NWP++SSI+VY
Sbjct  233   WLPETLHRHPLECEEKGDDDLEFSGPNSIKEKDGQIMEKQKVNRKSLFRNWPVMSSIIVY  292

Query  1082  CVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVL  1261
             CVF LH++AY EIFSLWA SP+  GGL +TT +VG VL+ITG+G+L+FQL  +P +    
Sbjct  293   CVFSLHEVAYSEIFSLWAESPKAYGGLGFTTTNVGTVLSITGVGVLIFQLLIFPSIANFT  352

Query  1262  GPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRA  1441
             G ++I+RI A LSIP+L+ YP+I++LSG  L +V+NCAS+LKNVL+V++ TG  +L N +
Sbjct  353   GAILITRIAAVLSIPVLACYPFISMLSGGFLWLVINCASLLKNVLTVTVYTGTFLLLNNS  412

Query  1442  VSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfell  1621
              SQ+QRGAANG++M+ MSLFKT GPA GGS+ +W+Q RQDA F+PG+Q+VFF LN   L+
Sbjct  413   ASQDQRGAANGLAMTGMSLFKTFGPAGGGSIFAWAQRRQDASFLPGNQIVFFFLNAILLI  472

Query  1622  glIMTFKPFLQLPEDDILKSKQDGAAEEN  1708
              + MTF+PFL    + + +SK     ++ 
Sbjct  473   VIAMTFEPFLPRSTNRLNQSKDSKVDKQE  501



>ref|NP_001130680.1| uncharacterized protein LOC100191783 [Zea mays]
 gb|ACF78992.1| unknown [Zea mays]
 gb|ACG43528.1| carbohydrate transporter/ sugar porter/ transporter [Zea mays]
 gb|ACL54562.1| unknown [Zea mays]
 gb|AFW64733.1| carbohydrate transporter/ sugar porter/ transporter [Zea mays]
Length=501

 Score =   521 bits (1341),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 282/492 (57%), Positives = 356/492 (72%), Gaps = 18/492 (4%)
 Frame = +2

Query  227   PLLKQS----EQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAAL  394
             PLL+++    E  GG       CY + C GC V+  K A+ G+P  +  ++ +VTLC AL
Sbjct  12    PLLEKTAAAAESGGGC------CYVDGCPGCAVDRHKAANPGIPYGNFIYVWIVTLCTAL  65

Query  395   PISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvv  574
             PISSLFPFLYFMIRD ++A+R EDI +YAG+VG+SFM GR LTS +WGI ADR GRKPVV
Sbjct  66    PISSLFPFLYFMIRDLNVAKRTEDIGFYAGFVGASFMFGRCLTSTVWGIAADRVGRKPVV  125

Query  575   iigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAV  754
             + G  +VV+FN +FGLSVNYWMAI TRFLLGAL G++G ++AYA E+CR E+ AL +S V
Sbjct  126   VFGISSVVVFNTLFGLSVNYWMAIATRFLLGALNGLLGPIKAYAIEVCRPEHEALALSLV  185

Query  755   STAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFW  934
             STAWGIGL+IGPA+GGY A PAE +PT+FS +S FG+FPYFLPCL  S+FA V  +   W
Sbjct  186   STAWGIGLIIGPALGGYLALPAENFPTVFSPDSIFGRFPYFLPCLCTSIFAAVVLISCIW  245

Query  935   LPETMHThkkehkeehD--------VSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVF  1090
             +PET+H HK       +        +  N K  E     S+KSL +NWPL+SSI+VYCVF
Sbjct  246   MPETLHKHKVHENRSRNIEALEARLIDSNEKVEESGSLDSKKSLFRNWPLMSSIIVYCVF  305

Query  1091  QLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPV  1270
               HD+AY E+FSLWA S +K GGLS ++ DVGQVLA+TG  LL++QLF YP + KVLGP+
Sbjct  306   SFHDMAYTEVFSLWAESDKKYGGLSLSSEDVGQVLAVTGASLLVYQLFLYPSINKVLGPI  365

Query  1271  MISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQ  1450
               SR+ A L IP+L  YPY+  LS   LS+VLN AS++KN L V+I TG  ILQN AV Q
Sbjct  366   KSSRVAAILCIPILFAYPYMTYLSEPGLSIVLNIASVIKNNLGVTIITGTFILQNNAVPQ  425

Query  1451  EQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglI  1630
             +QRGAANG+SM+ MS FK + PA  G + SW+Q RQ A F PGDQ+VFF+LN  EL+GL+
Sbjct  426   DQRGAANGLSMTGMSFFKALAPAGAGIVFSWAQKRQHAFFFPGDQMVFFLLNAVELVGLL  485

Query  1631  MTFKPFLQLPED  1666
             +TFKPFL +PE 
Sbjct  486   LTFKPFLAVPEQ  497



>tpd|FAA00732.1| TPA: DMA efflux transporter [Oryza sativa Japonica Group]
Length=473

 Score =   519 bits (1336),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 260/460 (57%), Positives = 345/460 (75%), Gaps = 1/460 (0%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             + + C GC +E    +  G+P K  FF+ + T+ ++LPISSLFPFLYFMI D H+A++E+
Sbjct  15    FYDGCPGCAMERKLESSQGIPYKEFFFVGITTIASSLPISSLFPFLYFMIEDLHVAKKEQ  74

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI  YAG++G+S+M+GR   S+ WG++ADR GRKP++    ++VVIFN +FGLSV YWMA
Sbjct  75    DIGLYAGFLGASYMIGRCFASLFWGVVADRIGRKPIIKFSILSVVIFNTLFGLSVKYWMA  134

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TRFLLGAL G++  ++AY+ E+CR E+ ALG+S VST WG+GLV+GPA+GGYFAQPA+
Sbjct  135   IATRFLLGALNGMLAPIKAYSIEVCRPEHQALGLSIVSTGWGVGLVVGPAIGGYFAQPAK  194

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             +YP +FS +S FG+FPYFLPCL IS+ ALV  +   WLPET+H   K+ + E ++  +S+
Sbjct  195   QYPNVFSEKSIFGRFPYFLPCLCISLIALVVLISCIWLPETLHK-HKDTEGEIEMIDDSR  253

Query  1004  QPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADV  1183
                 E    QKSL KNWPLISSI+ YCVF LHD AY EIFSLWAVS ++ GGLS+++ +V
Sbjct  254   STLEEDSHKQKSLYKNWPLISSIIAYCVFTLHDTAYSEIFSLWAVSEKRYGGLSFSSKEV  313

Query  1184  GQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVV  1363
             GQVLA+ G GLL++QLF Y  V K LG +  SRI +ALS+P+L+TYP++  LSG  L + 
Sbjct  314   GQVLAVAGAGLLVYQLFIYRSVHKFLGSINSSRIASALSVPILATYPFMTHLSGFRLGIA  373

Query  1364  LNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSW  1543
             L   ++LK VLS++I TG  +LQN AVSQ QRGAANGIS +AMS FK I PA  G+L SW
Sbjct  374   LYLGTILKGVLSITIITGTSLLQNNAVSQSQRGAANGISTTAMSFFKAIAPAGAGALFSW  433

Query  1544  SQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPE  1663
             +Q RQ+  F PGDQ++FF+LNV EL+GL +TFKPFL +P 
Sbjct  434   AQERQNEAFFPGDQMIFFILNVIELIGLALTFKPFLAIPN  473



>ref|XP_002875624.1| hypothetical protein ARALYDRAFT_484816 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51883.1| hypothetical protein ARALYDRAFT_484816 [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   518 bits (1335),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 268/461 (58%), Positives = 357/461 (77%), Gaps = 6/461 (1%)
 Frame = +2

Query  287   DESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREED  466
             +E C GC ++  K+   GVP  H+ FI +V+LC ALPISSLFP+LYFMIRDFHIA++EED
Sbjct  14    NEDCPGCIIDRTKQDQRGVPYFHLSFIWLVSLCTALPISSLFPYLYFMIRDFHIAKQEED  73

Query  467   ISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMAI  646
             I +YAG+V SSFM+GRALTS+ WG +ADRYGRKP+++IGT +V+IFN +FGLS ++W+AI
Sbjct  74    IGFYAGFVASSFMIGRALTSIFWGKLADRYGRKPIILIGTFSVIIFNTLFGLSTSFWLAI  133

Query  647   ITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAEK  826
               RFLLG    ++G +RAYASE+   EY+AL +S VST+ GIGL++GPA+GGY AQPAEK
Sbjct  134   SVRFLLGCFNCLLGVIRAYASEVVSEEYNALSLSVVSTSRGIGLILGPAIGGYLAQPAEK  193

Query  827   YPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQ-NSK  1003
             YP IFS  S FG+FPYFLP L+IS++A    +  +WLPET+HT  +  +   + ++ N  
Sbjct  194   YPNIFSQSSVFGRFPYFLPSLVISVYATGVLIACWWLPETLHTRCRIAQGRLNPTELNDD  253

Query  1004  QP-----EHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSY  1168
             +      + +   S+ SLL+N PL++ I+VYCVF L +IAY +IFSLWAVS R+ GGLS+
Sbjct  254   ESRGGGLDDQKIISKPSLLRNRPLMAIIIVYCVFSLQEIAYNKIFSLWAVSDRRYGGLSF  313

Query  1169  TTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGL  1348
             ++ DVG+VLAI+G+GLL+FQL  YP +EK +G + I R+ A L IPLLS YPYIALLSG+
Sbjct  314   SSQDVGEVLAISGLGLLVFQLLVYPPLEKSVGLLAIIRLSAVLLIPLLSCYPYIALLSGV  373

Query  1349  CLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGG  1528
              L +V+N AS+LKN LS+S+ TGL I+ N+AV Q QRGAANGISM+AMS+FK+ GPA GG
Sbjct  374   TLHLVINFASILKNALSISLVTGLFIMLNKAVPQNQRGAANGISMTAMSVFKSFGPAGGG  433

Query  1529  SLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
              L SW+Q RQDA F+PGD++VF VLN+ +L+GLI+TF P++
Sbjct  434   VLFSWAQKRQDATFLPGDEMVFLVLNLVQLVGLILTFVPYI  474



>ref|XP_010514733.1| PREDICTED: probable peptide/nitrate transporter At3g43790 [Camelina 
sativa]
Length=479

 Score =   518 bits (1335),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 269/462 (58%), Positives = 356/462 (77%), Gaps = 7/462 (2%)
 Frame = +2

Query  287   DESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREED  466
             +E C GC ++  K+   GVP  H+ FI +V+LC ALPISSLFP+LYFMI+DF IA++EED
Sbjct  14    NEDCPGCIIDRTKQHQQGVPYLHLSFIWLVSLCTALPISSLFPYLYFMIKDFGIAKQEED  73

Query  467   ISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMAI  646
             I +YAG+VGSSFM+GRALTS++WG +ADRYGRKP+++IGT +V+IFN +FGLS ++W+AI
Sbjct  74    IGFYAGFVGSSFMIGRALTSIVWGKLADRYGRKPIILIGTFSVIIFNTLFGLSTSFWLAI  133

Query  647   ITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAEK  826
               RFLLG    ++G +RAYASE+   EY+AL +S VST+ GIGL++GPA+GGY AQPAEK
Sbjct  134   SFRFLLGCFNCLLGVIRAYASEVVSEEYNALSLSVVSTSRGIGLILGPAIGGYLAQPAEK  193

Query  827   YPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehk-------eehD  985
             YPTIFS  S FG+ PYFLP L+IS++A    +  +WLPET+HT  +  +          D
Sbjct  194   YPTIFSQSSVFGRLPYFLPSLVISVYATGVFIACWWLPETLHTRCRIAQGRLNPTELNDD  253

Query  986   VSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLS  1165
              S+     + +   S+ SLL+N PL++ I+VYCVF L +IAY EIFSLWAVS R  GGLS
Sbjct  254   ESRGGGGLDDQNIISKPSLLRNLPLMAIIIVYCVFSLQEIAYSEIFSLWAVSDRSYGGLS  313

Query  1166  YTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSG  1345
             +++ DVGQVLAI+G+GLL+FQL  YP + K L  ++I R+ A L IPLLS YPYIALLSG
Sbjct  314   FSSQDVGQVLAISGLGLLVFQLLVYPPLAKALRLLVIIRLSAVLLIPLLSCYPYIALLSG  373

Query  1346  LCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAG  1525
             + L +V+NCAS++KN LS+S+ TGL I+ N+AV Q QRGAANGISM+AMS+FK+ GPA G
Sbjct  374   VTLHMVINCASIIKNALSISLVTGLFIMLNKAVPQNQRGAANGISMTAMSVFKSFGPAGG  433

Query  1526  GSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             G+L SW+Q RQDA F+PGD++VF VLN+ +L+GLI+TF P++
Sbjct  434   GALFSWAQKRQDATFLPGDEMVFLVLNLVQLVGLILTFIPYI  475



>ref|NP_974382.1| probable peptide/nitrate transporter  [Arabidopsis thaliana]
 ref|NP_974383.1| probable peptide/nitrate transporter  [Arabidopsis thaliana]
 sp|Q3EAQ5.2|PTR36_ARATH RecName: Full=Probable peptide/nitrate transporter At3g43790; 
AltName: Full=Protein ZINC INDUCED FACILITATOR-LIKE 2 [Arabidopsis 
thaliana]
 gb|AEE77827.1| probable peptide/nitrate transporter [Arabidopsis thaliana]
 gb|AEE77829.1| probable peptide/nitrate transporter [Arabidopsis thaliana]
Length=484

 Score =   518 bits (1335),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 269/468 (57%), Positives = 357/468 (76%), Gaps = 14/468 (3%)
 Frame = +2

Query  287   DESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREED  466
             +E C GC ++  K+   GVP  H+ FI +V+LC ALPISSLFP++YFMIRDFHIA++EED
Sbjct  14    NEDCPGCIIDRTKQQQRGVPYLHLSFIWLVSLCTALPISSLFPYIYFMIRDFHIAKQEED  73

Query  467   ISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMAI  646
             I +YAG+VGSSFM+GRALTS+ WG +ADRYGRKP+++IGT +V+IFN +FGLS ++W+AI
Sbjct  74    IGFYAGFVGSSFMIGRALTSIFWGKLADRYGRKPIILIGTFSVIIFNTLFGLSTSFWLAI  133

Query  647   ITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAEK  826
               RFLLG    ++G +RAYASE+   EY+AL +S VST+ GIGL++GPA+GGY AQPAEK
Sbjct  134   SVRFLLGCFNCLLGVIRAYASEVVSEEYNALSLSVVSTSRGIGLILGPAIGGYLAQPAEK  193

Query  827   YPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehk-------eehD  985
             YP IFS  S FG+FPYFLP L+IS++A    +  +WLPET+HT  +  +          D
Sbjct  194   YPNIFSQSSVFGRFPYFLPSLVISVYATAVLIACWWLPETLHTRCRIAQGRLNPTELNDD  253

Query  986   VSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLS  1165
              S+     E ++  ++ SLL+N PL++ I+VYCVF L +IAY EIFSLWAVS R  GGLS
Sbjct  254   ESRGGGLDEQKI-INKPSLLRNRPLMAIIIVYCVFSLQEIAYNEIFSLWAVSDRSYGGLS  312

Query  1166  YTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSG  1345
             +++ DVG+VLAI+G+GLL+FQL  YP +EK +G + + R+ A L IPLLS YPYIALLSG
Sbjct  313   FSSQDVGEVLAISGLGLLVFQLLVYPPLEKSVGLLAVIRLSAVLLIPLLSCYPYIALLSG  372

Query  1346  LCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAG  1525
             + L +V+NCAS++KN LS+S+ TGL I+ N+AV Q QRGAANGISM+AMS+FK+ GPA G
Sbjct  373   VTLHLVINCASIIKNALSISLVTGLFIMLNKAVPQNQRGAANGISMTAMSVFKSFGPAGG  432

Query  1526  GSLLSWSQLRQDAKFMPG------DQlvffvlnvfellglIMTFKPFL  1651
             G L SW+Q RQDA F+PG      D++VF VLN+ +L+GLI+TF P++
Sbjct  433   GVLFSWAQKRQDATFLPGQIFAPCDEMVFLVLNLVQLVGLILTFIPYI  480



>gb|KEH19214.1| zinc induced facilitator-like protein [Medicago truncatula]
Length=484

 Score =   518 bits (1335),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 271/482 (56%), Positives = 357/482 (74%), Gaps = 15/482 (3%)
 Frame = +2

Query  212   EGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAA  391
             E   EPLL++ +            Y E C GC+VE     + GV I  +  I MV L A 
Sbjct  4     EHMREPLLEKKQ------------YYEDCPGCKVEQENELNEGVSIIKLLIIWMVVLSAT  51

Query  392   LPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPv  571
             LP SSLFPFLYFM+RDF++A+ E DISYYAGY+GSS+MLGR  T+VLWG+++DRYGRKPV
Sbjct  52    LPTSSLFPFLYFMVRDFNVAKEEADISYYAGYIGSSYMLGRCFTAVLWGMVSDRYGRKPV  111

Query  572   viigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISA  751
             +I+G + VVIFN +FGLS  +WMAI TRFLLG L G++G ++AYA+E+ R E+ A+G+S 
Sbjct  112   LIMGIIAVVIFNTLFGLSTGFWMAIATRFLLGGLNGVLGPVKAYATELFREEHQAIGLST  171

Query  752   VSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSF  931
             VS AWGIGL++GPA+GGY AQP +KYP IF  +SF+ KFPYFLPC  IS  AL   ++  
Sbjct  172   VSAAWGIGLIVGPAIGGYLAQPVDKYPQIFPKDSFWDKFPYFLPCFTISALALTVAIVCI  231

Query  932   WLPETMHThkkehkeehDVS--QNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDI  1105
             W+PET+H H    + + +    +N    E  V  ++ +L  NWPL+SSI+ YCV  LHDI
Sbjct  232   WIPETLHNHNGNEESKGNAEALENGSSKEKTVQKNE-NLFLNWPLMSSIIAYCVVSLHDI  290

Query  1106  AYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRI  1285
             AY E+FSLWAVSP +LGGL +TT DVG VL+I+G+ L ++QLF YP VEK  GP++++RI
Sbjct  291   AYQEVFSLWAVSPLRLGGLKFTTDDVGDVLSISGVALCIYQLFIYPYVEKACGPIVLARI  350

Query  1286  GAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGA  1465
                +SIPLL +YP+IA+LSG+ L +V++ AS+LKN+++V+ITTGL ++QNR V Q QRGA
Sbjct  351   TGIISIPLLQSYPFIAMLSGITLYIVISIASILKNIIAVTITTGLFLVQNRVVEQHQRGA  410

Query  1466  ANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKP  1645
             ANGISM+AMSLFK IGPAAGG++L+WSQ R DA F+PG Q+VFF LN+ E LG+++  KP
Sbjct  411   ANGISMTAMSLFKAIGPAAGGTILTWSQKRMDASFLPGTQMVFFFLNLVEGLGILLMCKP  470

Query  1646  FL  1651
             FL
Sbjct  471   FL  472



>ref|XP_010425830.1| PREDICTED: probable peptide/nitrate transporter At3g43790 isoform 
X1 [Camelina sativa]
Length=480

 Score =   518 bits (1333),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 269/463 (58%), Positives = 356/463 (77%), Gaps = 8/463 (2%)
 Frame = +2

Query  287   DESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREED  466
             +E C GC ++  K+   GVP  H+ FI +V+LC ALPISSLFP+LYFMI+DF IA++EED
Sbjct  14    NEDCPGCIIDRTKQHQQGVPYLHLSFIWLVSLCTALPISSLFPYLYFMIKDFGIAKQEED  73

Query  467   ISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMAI  646
             I +YAG+VGSSFM+GRALTS++WG +ADRYGRKP+++IGT +V+IFN +FGLS ++W+AI
Sbjct  74    IGFYAGFVGSSFMIGRALTSIVWGKLADRYGRKPIILIGTFSVIIFNTLFGLSTSFWLAI  133

Query  647   ITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAEK  826
               RFLLG    ++G +RAYASE+   EY+AL +S VST+ GIGL++GPA+GGY AQPAEK
Sbjct  134   SFRFLLGCFNCLLGVIRAYASEVVSEEYNALSLSVVSTSRGIGLILGPAIGGYLAQPAEK  193

Query  827   YPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkke--------hkeeh  982
             YPTIFS  S FG+ PYFLP L+IS++A    +  +WLPET+HT  +          +   
Sbjct  194   YPTIFSQSSVFGRLPYFLPSLVISVYATGVFIACWWLPETLHTRCRIAHRRLNKPTELND  253

Query  983   DVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGL  1162
             D S+     + +   S+ SLL+N PL++ I+VYCVF L +IAY EIFSLWAVS R  GGL
Sbjct  254   DESRGGGGLDDQNIISKPSLLRNLPLMAIIIVYCVFSLQEIAYSEIFSLWAVSDRSYGGL  313

Query  1163  SYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLS  1342
             S+++ DVGQVLAI+G+GLL+FQL  YP + K L  ++I R+ A L IPLLS YPYIALLS
Sbjct  314   SFSSQDVGQVLAISGLGLLVFQLLVYPPLVKALRLLVIIRLSAVLLIPLLSCYPYIALLS  373

Query  1343  GLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAA  1522
             G+ L +V+NCAS++KN LS+S+ TGL I+ N+AV Q QRGAANGISM+AMS+FK+ GPA 
Sbjct  374   GVTLHMVINCASIIKNALSISLVTGLFIMLNKAVPQNQRGAANGISMTAMSVFKSFGPAG  433

Query  1523  GGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             GG+L SW+Q RQDA F+PGD++VF VLN+ +L+GLI+TF P++
Sbjct  434   GGALFSWAQKRQDATFLPGDEMVFLVLNLVQLVGLILTFIPYI  476



>gb|EMS51903.1| Protein ZINC INDUCED FACILITATOR-LIKE 1 [Triticum urartu]
Length=492

 Score =   518 bits (1334),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 263/466 (56%), Positives = 336/466 (72%), Gaps = 1/466 (0%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y E C GC +E  K    G P K  F++ + TL +ALPIS+LFPFLYFMI+D H+A+ EE
Sbjct  27    YYEGCPGCAMERKKENSTGTPYKEFFYVGVTTLASALPISALFPFLYFMIQDMHVAKNEE  86

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI  YAG +G+S+M+GR   S+ WG++ADR GRKP++     +VVIFN +FGLS  YWMA
Sbjct  87    DIGVYAGLLGASYMIGRCFASLFWGVVADRIGRKPIIAFSMFSVVIFNTLFGLSEKYWMA  146

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TR LLG+L G++  ++AY+ E+CR E+HALG+S VST WGIGLV+GPA+GGY AQPA+
Sbjct  147   IATRMLLGSLNGMLAPIKAYSVEVCRPEHHALGLSVVSTGWGIGLVVGPAIGGYLAQPAK  206

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             +YP +FS +S FG+FPY LPCL IS+ A    V   WLPET+H HK   +E         
Sbjct  207   QYPNLFSEKSVFGRFPYLLPCLFISLIAFAVLVSCIWLPETLHMHKNLEREIEMSGDLGV  266

Query  1004  QPEHEVPTSQ-KSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTAD  1180
                 EVP S+ KSL KNWPL+SSI+ YCVF LHD AY EIFSLWAVS +K GGLS+++ D
Sbjct  267   ATHREVPHSEKKSLYKNWPLMSSIIAYCVFTLHDTAYSEIFSLWAVSNKKYGGLSFSSKD  326

Query  1181  VGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSV  1360
             VGQVLA +G GLLL+Q+F Y  V K LG ++ SRI A LSIPLL+TYP++  LSG  L +
Sbjct  327   VGQVLAASGAGLLLYQIFVYRHVHKYLGSIISSRIAAVLSIPLLATYPFMTHLSGTRLGL  386

Query  1361  VLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLS  1540
              + CA+++K   + +I TG  ILQN AVSQ QRGAANGIS +AMSLFK I PA  G L S
Sbjct  387   AIYCAAVMKGAFATTILTGTCILQNSAVSQNQRGAANGISTTAMSLFKAIAPAGAGVLFS  446

Query  1541  WSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPEDDILK  1678
             W+Q RQ A F PGDQ++F +LN+ E++GL++TFKPFL +P+    K
Sbjct  447   WAQKRQHAAFFPGDQMIFLILNIVEVIGLVLTFKPFLAIPKQYDFK  492



>dbj|BAB10596.1| transporter-like protein [Arabidopsis thaliana]
Length=441

 Score =   515 bits (1326),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 259/425 (61%), Positives = 330/425 (78%), Gaps = 4/425 (1%)
 Frame = +2

Query  320   LKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSS  499
             +KR   G P   +F + ++ LC ALPISSLFPFLYFMI DF+IA++EEDI +YAG+VG S
Sbjct  1     MKRLRRGFPFWELFTVWIIVLCTALPISSLFPFLYFMIDDFNIAKKEEDIGFYAGFVGCS  60

Query  500   FMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCG  679
             FMLGRA TSV WG++ADRYGRKPV++IGT +VV+FN +FGLS+N+WMAIITRF LG+  G
Sbjct  61    FMLGRAFTSVAWGLVADRYGRKPVILIGTASVVVFNTLFGLSLNFWMAIITRFCLGSFNG  120

Query  680   IIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFF  859
             ++G ++AYA EI R EY  L +SAVSTAWGIGL+IGPA+GG+ AQPA++YP++FS +S F
Sbjct  121   LLGPIKAYAMEIFRDEYQGLALSAVSTAWGIGLIIGPAIGGFLAQPAKQYPSLFSQDSIF  180

Query  860   GKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQN-SKQPEHEV---PT  1027
             GKFP+FLPCL IS+FA + T++S  +PET+H HK    E +D  ++ S  PE        
Sbjct  181   GKFPFFLPCLAISVFAFLVTIVSSRIPETLHNHKFNDDESYDALKDLSDDPESNKVAERN  240

Query  1028  SQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITG  1207
              + SLL NWPLISSI+VYCVF LHD+AY EIFSLWA SPRK GGL Y+TADVG VLA +G
Sbjct  241   GKSSLLNNWPLISSIIVYCVFSLHDMAYTEIFSLWANSPRKYGGLGYSTADVGSVLAFSG  300

Query  1208  IGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLK  1387
              GLL+FQL  Y   E++LGP++++RI  +L++ +LS YP IA LSGL L+V +  AS+ K
Sbjct  301   FGLLIFQLSLYSYAERLLGPIIVTRISGSLAMVVLSCYPLIAKLSGLALTVTVTSASVAK  360

Query  1388  NVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAK  1567
             +VL  S  TGL ILQN+AV Q+QRGAANGI+M+AMSLFK IGPAA G + SWS+ RQ A 
Sbjct  361   SVLGTSAITGLFILQNKAVRQDQRGAANGIAMTAMSLFKAIGPAAAGIIFSWSEKRQGAA  420

Query  1568  FMPGD  1582
             F+PG+
Sbjct  421   FLPGN  425



>ref|XP_003577879.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Brachypodium 
distachyon]
Length=497

 Score =   517 bits (1331),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 260/491 (53%), Positives = 344/491 (70%), Gaps = 2/491 (0%)
 Frame = +2

Query  200   ESMAEGNTEPLLKQSEQNGGH--LEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISM  373
             ++     T P   + +  G      +E   Y E C GC ++  K    G P    F++ +
Sbjct  3     DTTTRNRTYPACSEDDDAGERSPASEEQVLYYEGCPGCVMDRKKERSTGTPYMEFFYVGV  62

Query  374   VTLCAALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADR  553
              T  +ALPISSL+PFLYFMI D  +A+ E+DI +YAG++G+S+M+GR   S+ WG++ADR
Sbjct  63    TTFASALPISSLYPFLYFMIEDMRVAKNEQDIGFYAGFLGASYMIGRCFASLFWGVVADR  122

Query  554   YGRKPvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYH  733
              GRKP++     TVVIFN +FGLSV YWMAI TR LLG+L G++  ++AY+ E+CR E+H
Sbjct  123   IGRKPIIAFSMFTVVIFNTLFGLSVKYWMAITTRLLLGSLNGMLAPIKAYSVEVCRPEHH  182

Query  734   ALGISAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALV  913
             ALG+S VST WGIGLV GPA+GGY AQPA++YP +FS +S FG+FPYFLPCLIIS+ AL 
Sbjct  183   ALGLSVVSTGWGIGLVAGPAIGGYLAQPAKQYPNLFSEKSIFGRFPYFLPCLIISLVALA  242

Query  914   ATVMSFWLPETMHThkkehkeehDVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQ  1093
               +   WLPET+H HK   +E   V  ++  P  E P  +KS+ KNWPL+S+IL YCVF 
Sbjct  243   VLISCIWLPETLHMHKNLEREVEMVDGSTAAPHREAPHKEKSIYKNWPLMSAILAYCVFT  302

Query  1094  LHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVM  1273
             L+D AY EI SLWAVS RK GGLS  + DVGQ+LA++G GLL++QLF Y  V + LG ++
Sbjct  303   LNDTAYSEILSLWAVSDRKYGGLSLPSKDVGQILAVSGAGLLMYQLFMYRHVHRYLGSII  362

Query  1274  ISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQE  1453
              SRI AALSIPL++ +P++  LSG  L + +  A+ +K  L+ +I TG  ILQN AVSQ 
Sbjct  363   SSRIAAALSIPLIAAFPFMTHLSGTRLGLAIYFAAAIKGALATTILTGTCILQNSAVSQS  422

Query  1454  QRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIM  1633
             QRGAANGIS +AMSLFK I PA  G L SW+Q RQ A F PGDQ++F +LN+ E++GL+M
Sbjct  423   QRGAANGISTTAMSLFKAIAPAGAGVLFSWAQKRQHAAFFPGDQMIFLILNIVEVIGLVM  482

Query  1634  TFKPFLQLPED  1666
             TFKPFL +P+ 
Sbjct  483   TFKPFLTVPKQ  493



>ref|XP_009403835.1| PREDICTED: probable peptide/nitrate transporter At3g43790 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=496

 Score =   516 bits (1330),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 270/497 (54%), Positives = 359/497 (72%), Gaps = 22/497 (4%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE    PLL  SE+   H         E+C GCR +   R   G+P +  F++ +V LC
Sbjct  1     MAE-RAAPLLAPSEEATHH---------ENCPGCRQDRRNRLHLGIPYREFFYVWIVALC  50

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
             +ALPISSL+PFLYFMIRD  IA+REEDI +YAG+VGS+FMLGRA TS+LWG++ADRYGR+
Sbjct  51    SALPISSLYPFLYFMIRDLDIAKREEDIGFYAGFVGSAFMLGRASTSILWGMVADRYGRR  110

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV++I  + V++FN +FGLS  YWMAI+TR  LG L G++G ++AYASE+CR+EY ALG+
Sbjct  111   PVIMISLLAVIVFNTLFGLSTRYWMAIMTRSFLGFLSGLLGPIQAYASEVCRKEYQALGL  170

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S V T+W +GLV GPA+GG+ AQPAEKYP IFSAE  FG+FPYFLPCL IS+F++ A + 
Sbjct  171   SVVDTSWAMGLVFGPAIGGFLAQPAEKYPNIFSAECLFGRFPYFLPCLCISLFSVGALIA  230

Query  926   SFWLPETMHThkkehkeehDV------SQNSKQPEHEVPTSQK------SLLKNWPLISS  1069
              FWLPET+H H +   E+  +      S  S    +   T Q+      SLLKNW L+SS
Sbjct  231   CFWLPETLHMHGESKVEDEHINVLEALSNGSNLKGYRGETKQRRLFSDQSLLKNWLLMSS  290

Query  1070  ILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLV  1249
             I+VYC+F L   AY EIFSLW+VS +K GGLS+++ +VG VLAI+GI LL++QL  +P +
Sbjct  291   IIVYCIFGLQSTAYSEIFSLWSVSNKKYGGLSFSSQEVGMVLAISGISLLVYQLVLFPHI  350

Query  1250  EKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLIL  1429
             EK LGP+ ++R  AAL IPLL++YP++  LSG  L++ +NCAS L+++ S +IT GL IL
Sbjct  351   EKHLGPINLTRAVAALLIPLLASYPFMTKLSGFILNLSVNCASSLRSIFSSTITVGLNIL  410

Query  1430  QNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnv  1609
             QN AVSQ QRGAANG++++A+SLFK   PA  G L SW+Q  Q    +PGD +VFFVL++
Sbjct  411   QNNAVSQHQRGAANGMAVTALSLFKAFAPAGAGILFSWAQNHQGVSILPGDYIVFFVLDM  470

Query  1610  fellglIMTFKPFLQLP  1660
               ++GL++TFKPFL  P
Sbjct  471   VGVVGLLLTFKPFLTQP  487



>ref|XP_010909584.1| PREDICTED: probable peptide/nitrate transporter At3g43790 isoform 
X2 [Elaeis guineensis]
Length=479

 Score =   515 bits (1327),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 282/493 (57%), Positives = 358/493 (73%), Gaps = 35/493 (7%)
 Frame = +2

Query  218   NTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALP  397
             N  PLLK+              Y E+C GC+ +    A  G+P K  F+I  VTLC+ALP
Sbjct  4     NANPLLKK-------------VYHENCPGCKQDRRNEAHPGIPYKEFFYIWAVTLCSALP  50

Query  398   ISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvvi  577
             ISSLFPFLYFMIRD HI++REEDI +YAG+VGS+FM GRALTSV WG++ADRYGRKPV++
Sbjct  51    ISSLFPFLYFMIRDLHISKREEDIGFYAGFVGSAFMFGRALTSVFWGMVADRYGRKPVIV  110

Query  578   igtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVS  757
             I  V+V           +Y MAI TR LLG LCG++G ++AYASE+CRRE+ ALG+S V+
Sbjct  111   ISIVSV----------TSYVMAITTRSLLGFLCGLLGPIKAYASEVCRREHQALGLSLVT  160

Query  758   TAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWL  937
             T+ GIGL++GPA+GG+ AQPAEKYP IFS +S FG+FPYFLPCL IS+FA+ A +  FWL
Sbjct  161   TSRGIGLIVGPAIGGFLAQPAEKYPNIFSEDSLFGRFPYFLPCLCISLFAVGAFIACFWL  220

Query  938   PETMH------------ThkkehkeehDVSQNSKQPEHEVPTSQKSLLKNWPLISSILVY  1081
             PET+H               +      D+ +N ++ E     S KSL+KNWPLISSI+VY
Sbjct  221   PETLHMHKENSLGDGTVESLEASLIGSDLKRNDEETEGRELASSKSLIKNWPLISSIIVY  280

Query  1082  CVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVL  1261
             CVF L D+AY EIFSLWAVS +  GGLS+++ DVG+VLAI+G  LL++QL  YP   K L
Sbjct  281   CVFSLQDMAYSEIFSLWAVSNKSYGGLSFSSQDVGEVLAISGFSLLVYQLLLYPHFAKCL  340

Query  1262  GPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRA  1441
             GP+  SR+ A LSIPLL++YP++A LSG  LS+++NCAS+LKN  SV+I TG  ILQN A
Sbjct  341   GPITSSRVAAVLSIPLLASYPFMAKLSGFTLSLIVNCASLLKNAFSVTIITGFNILQNNA  400

Query  1442  VSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfell  1621
             VSQ QRGAANGIS++AMSLFK   PA GG+L SW+Q RQ+A F+PGD++VFFVLN+   +
Sbjct  401   VSQHQRGAANGISITAMSLFKAAAPAGGGALFSWAQRRQNASFLPGDRMVFFVLNIIGFV  460

Query  1622  glIMTFKPFLQLP  1660
             GL++TFKPFL  P
Sbjct  461   GLLLTFKPFLNQP  473



>ref|XP_010251713.1| PREDICTED: probable peptide/nitrate transporter At3g43790 isoform 
X3 [Nelumbo nucifera]
 ref|XP_010251714.1| PREDICTED: probable peptide/nitrate transporter At3g43790 isoform 
X3 [Nelumbo nucifera]
Length=444

 Score =   513 bits (1322),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 273/439 (62%), Positives = 337/439 (77%), Gaps = 11/439 (3%)
 Frame = +2

Query  377   TLCAALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRY  556
              +  ALPISSLFP++YFMIRDFHIA+REEDI +YAG+VGSSFM+GRALTSV WG++ADRY
Sbjct  6     NMIIALPISSLFPYMYFMIRDFHIAKREEDIGFYAGFVGSSFMIGRALTSVFWGVVADRY  65

Query  557   GRKPvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHA  736
             GRKPV++IGT++VVIFN +FGLS + WMA+  RFLLG    ++G +RAYASE+C  +YHA
Sbjct  66    GRKPVILIGTISVVIFNTLFGLSTSLWMAVSMRFLLGCFNCMLGPIRAYASEVCHEKYHA  125

Query  737   LGISAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVA  916
             LG S  ST+ GIG +IGPA+GG+F QPAEKYP IFS  S F +FPYFLPCLIIS+FAL A
Sbjct  126   LGQSIASTSRGIGFIIGPAIGGFFVQPAEKYPNIFSDNSLFARFPYFLPCLIISIFALGA  185

Query  917   TVMSFWLPETMH-----------ThkkehkeehDVSQNSKQPEHEVPTSQKSLLKNWPLI  1063
              +  FW+PET+H              +      D  +  K+ E   P S+ SLL+NWPL+
Sbjct  186   FISCFWIPETLHMHNRNNKEESYDALEASSHRSDEKEEMKETEQTGPPSRLSLLRNWPLM  245

Query  1064  SSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYP  1243
             S+I+VYC+F LH+IAY E+FSLWAVS RK GGL +++  VG+VLAI+G GLLLFQLF YP
Sbjct  246   STIIVYCIFSLHEIAYAEVFSLWAVSDRKYGGLGFSSQSVGEVLAISGFGLLLFQLFLYP  305

Query  1244  LVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLL  1423
              +EK LGP+M+SR+ A LSIPLLS+YP+IA LSG  L +V+NCAS+LKNVLSV   TGL 
Sbjct  306   SIEKFLGPIMVSRLAAVLSIPLLSSYPFIARLSGFTLQLVINCASILKNVLSVVTLTGLF  365

Query  1424  ILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvl  1603
             IL N AV Q QRGAANGISM+ MS FK IGPA GGSL S +Q RQ A F+PGDQ+VFF+L
Sbjct  366   ILLNSAVPQHQRGAANGISMTLMSTFKAIGPAGGGSLFSLAQKRQHAAFLPGDQIVFFIL  425

Query  1604  nvfellglIMTFKPFLQLP  1660
             NV   + +++TFKPFL  P
Sbjct  426   NVITAVEVVLTFKPFLTRP  444



>ref|XP_008775051.1| PREDICTED: probable peptide/nitrate transporter At3g43790 isoform 
X2 [Phoenix dactylifera]
Length=469

 Score =   514 bits (1324),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 271/466 (58%), Positives = 346/466 (74%), Gaps = 25/466 (5%)
 Frame = +2

Query  215   GNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAAL  394
              NT PLLK+              Y E+C GC+ +       G+P K  F+I +VTLC+AL
Sbjct  3     ANTNPLLKK-------------VYYENCPGCKQDRRNEVHLGIPYKEFFYIWVVTLCSAL  49

Query  395   PISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvv  574
             PISSLFPFLYFMIRD HIA+REEDI +YAG+VGS+FM GRALTSV WG++ADRYGRKPV+
Sbjct  50    PISSLFPFLYFMIRDLHIAKREEDIGFYAGFVGSAFMFGRALTSVFWGMVADRYGRKPVI  109

Query  575   iigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAV  754
             +I  V+V++FN +FGLS +Y MAI TR LLG LCG++G ++AYASE+CR+E+ ALG+S V
Sbjct  110   VISIVSVIVFNTLFGLSTSYVMAITTRSLLGFLCGLLGPVKAYASEVCRKEHQALGLSLV  169

Query  755   STAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFW  934
             ST+ GIGL++GPA+GG+ AQPAEKYP IFS +S FG+FPYFLPCL IS+FA+ A +  FW
Sbjct  170   STSRGIGLIVGPAIGGFLAQPAEKYPNIFSEDSLFGRFPYFLPCLCISLFAVGAFIACFW  229

Query  935   LPETMH------------ThkkehkeehDVSQNSKQPEHEVPTSQKSLLKNWPLISSILV  1078
             LPET+H               +      D+ +NS++ E     S K+LLKNWPLISSI+V
Sbjct  230   LPETLHMHKGNSLGDGTVESLEASLIGSDLKRNSEETEGIELASNKNLLKNWPLISSIIV  289

Query  1079  YCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKV  1258
             YCVF L D+AY EIFSLWAVS ++ GGLS+++ DVG+VLAITG  LL++QL  YP   K 
Sbjct  290   YCVFSLQDMAYSEIFSLWAVSSKRYGGLSFSSQDVGEVLAITGFSLLVYQLLLYPRFVKC  349

Query  1259  LGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNR  1438
             LG +  +R+ A LSIPLL++YP++A LSG   S+++NCAS+LKNV SV+I TG  ILQN 
Sbjct  350   LGHITSTRVAAVLSIPLLASYPFMAKLSGFTRSLIVNCASLLKNVFSVTIITGFNILQNN  409

Query  1439  AVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMP  1576
             AVSQ+QRGAANG+S++AMSLFK   PA GG+L SW+Q RQ A F+P
Sbjct  410   AVSQQQRGAANGMSVTAMSLFKAAAPAGGGALFSWAQSRQKASFLP  455



>ref|XP_004977467.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Setaria italica]
Length=493

 Score =   514 bits (1323),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 284/493 (58%), Positives = 355/493 (72%), Gaps = 15/493 (3%)
 Frame = +2

Query  212   EGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAA  391
             EG + PLL +++  GG +      Y E C GC V+  K A+ G+P     ++ +VTLC A
Sbjct  4     EGQSSPLL-ETKTAGGRM------YVEGCPGCAVDRRKAANPGIPYGSFIYVWIVTLCTA  56

Query  392   LPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPv  571
             LPISSLFPFLYFMIRD ++A+R EDI +YAG+VG+SFM GR LTS  WGI ADR GRKPV
Sbjct  57    LPISSLFPFLYFMIRDLNVAKRTEDIGFYAGFVGASFMFGRCLTSTAWGIAADRIGRKPV  116

Query  572   viigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISA  751
             VI G  +VV+FN +FGLSV YWMAI TRFLLGAL G++G ++AYA E+CR E+ AL +S 
Sbjct  117   VIFGIFSVVVFNTLFGLSVTYWMAIATRFLLGALNGLLGPIKAYAIEVCRPEHEALALSL  176

Query  752   VSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSF  931
             VSTAWGIGL+IGPA+GGY A PAE +P +FS ES FG+FPYFLPCL  S+FA    +   
Sbjct  177   VSTAWGIGLIIGPALGGYLALPAENFPNVFSPESLFGRFPYFLPCLCTSVFAAAVLISCI  236

Query  932   WLPETMHThkkehkeehDVSQNSKQ---PEHEVPTS-----QKSLLKNWPLISSILVYCV  1087
             W+PET+H HK    E   +         P+ +V  S     +KSL KNWPL+SSI++YC+
Sbjct  237   WMPETLHKHKGSENENQSIEALEAHLIDPKEKVEESGSLNTKKSLFKNWPLMSSIVIYCI  296

Query  1088  FQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGP  1267
             F  HD+AY E+FSLWA S +K GGLS ++ DVGQVLA+TG  LL++QLF YP + KVLGP
Sbjct  297   FSFHDMAYTEVFSLWAESDKKYGGLSLSSEDVGQVLAVTGASLLVYQLFLYPRINKVLGP  356

Query  1268  VMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVS  1447
             +  SRI A L IP+L  YPY+  LS   LS+VLN AS++KN L+V+I TG  ILQN AV 
Sbjct  357   INSSRIAAILCIPILFAYPYMTYLSEPGLSIVLNVASVIKNNLAVTIITGTFILQNNAVP  416

Query  1448  QEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellgl  1627
             Q+QRGAANG+SM+ MS FK + PA  G + SW+Q RQ   F PGDQ+VFF+LNV ELLGL
Sbjct  417   QDQRGAANGLSMTGMSFFKAVAPAGAGIVFSWAQKRQHGFFFPGDQMVFFLLNVIELLGL  476

Query  1628  IMTFKPFLQLPED  1666
             I+TFKPFL +PE 
Sbjct  477   ILTFKPFLAVPEQ  489



>ref|XP_007133369.1| hypothetical protein PHAVU_011G173400g [Phaseolus vulgaris]
 gb|ESW05363.1| hypothetical protein PHAVU_011G173400g [Phaseolus vulgaris]
Length=488

 Score =   513 bits (1322),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 261/461 (57%), Positives = 338/461 (73%), Gaps = 5/461 (1%)
 Frame = +2

Query  284   YDESCAGCRVELLKR--ADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAER  457
             Y E+C GC+V+         GVP   +F + M+ LC ALPISSLFPFLYFM+RDF IA+ 
Sbjct  16    YFENCPGCKVDKANELSEGQGVPFTKLFIVWMLVLCTALPISSLFPFLYFMVRDFKIAKT  75

Query  458   EEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYW  637
             E DIS YAGYVGS+FM GR LTS+ WG IADR GRKPV+II  ++V+IFN +FGLS ++W
Sbjct  76    EADISSYAGYVGSAFMFGRCLTSLFWGTIADRIGRKPVIIIAIISVIIFNTLFGLSTSFW  135

Query  638   MAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQP  817
             MA+I RFLLG    ++G +RAYASE+ R E+ ALG+S VS AWGIGL+IGPA+GGY +QP
Sbjct  136   MAVIVRFLLGTFNCLLGPVRAYASELFREEHQALGLSTVSAAWGIGLIIGPALGGYLSQP  195

Query  818   AEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehD---V  988
              EKYP IF  + F+ KFPYFLP  +IS  A V  +   W+PET+H H    +   D   +
Sbjct  196   VEKYPHIFPKDCFWDKFPYFLPNFVISALAFVVAIGCIWIPETLHNHNYSDESIEDAKAL  255

Query  989   SQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSY  1168
                +   ++E     ++L  NWPL+SSI+ YC+F LHDI YLE+FSLWAVSP++ GGL++
Sbjct  256   ENGNNGTDNENIQKNENLFLNWPLMSSIIAYCIFSLHDITYLEVFSLWAVSPQRFGGLNF  315

Query  1169  TTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGL  1348
             TT +VG VL+I+G  L+++QL  YP VEK  GP+ + RI + LSIP+L +YP+I LLSG+
Sbjct  316   TTDNVGNVLSISGFALIIYQLTIYPYVEKASGPISLGRISSILSIPILQSYPFIPLLSGV  375

Query  1349  CLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGG  1528
              L +VL+  S+LKN+ S++I TGLL+LQNRAV Q QRGAANGISM+ MSL   IGPA GG
Sbjct  376   ALYIVLSICSILKNIFSITIVTGLLLLQNRAVEQHQRGAANGISMTGMSLLNAIGPATGG  435

Query  1529  SLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             ++L+WSQ R DA F+PG  +VFFVLN+ + LGL+M FKPFL
Sbjct  436   AVLTWSQKRMDASFLPGTHMVFFVLNLVQALGLLMMFKPFL  476



>gb|ABG22349.1| transporter, putative, expressed [Oryza sativa Japonica Group]
Length=504

 Score =   514 bits (1323),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 286/501 (57%), Positives = 359/501 (72%), Gaps = 15/501 (3%)
 Frame = +2

Query  188   ERASESMAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFI  367
              R +E+ A     PLL++    G   E +  C  E C GC V+  K A +G+P     F+
Sbjct  7     RRQAEAAA-----PLLEKKGSTGTG-EGDGSCI-EGCPGCVVDRRKAASSGIPYGSFLFV  59

Query  368   SMVTLCAALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIA  547
              +VTLC ALPISSLFPFLYFMIRD H+A+R EDI +YAG+VG+SFM GR LTS +WGI A
Sbjct  60    WIVTLCTALPISSLFPFLYFMIRDLHVAKRTEDIGFYAGFVGASFMFGRCLTSTIWGIAA  119

Query  548   DRYGRKPvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRRE  727
             DR GRKPVV+ G   VVIFN +FGLS  YWMAI TRFLLGAL G++G ++AYA E+CR E
Sbjct  120   DRIGRKPVVVFGIFAVVIFNTLFGLSFTYWMAIATRFLLGALNGLLGPIKAYAIEVCRPE  179

Query  728   YHALGISAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFA  907
             + AL +S VSTAWGIGL+IGPA+GGY +QPAEK+P +FS +S F +FPYFLPCL IS+FA
Sbjct  180   HEALALSLVSTAWGIGLIIGPAIGGYLSQPAEKFPNVFSPDSLFARFPYFLPCLCISVFA  239

Query  908   LVATVMSFWLPETMHThkkehkeehDVSQNSKQ---PEHEVPTS-----QKSLLKNWPLI  1063
              V  +   W+PET+H HK +      V         PE +   +     +KSLL NWPL+
Sbjct  240   AVVLIGCIWMPETLHKHKADANRSQTVEALESHLIDPEEKADQNGSLDCKKSLLSNWPLM  299

Query  1064  SSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYP  1243
             SSI++YCVF  HD+AY EIFSLWA S RK GGLS ++ DVGQVLAITG  LL++QLF YP
Sbjct  300   SSIILYCVFSFHDMAYTEIFSLWAESDRKYGGLSLSSEDVGQVLAITGASLLVYQLFIYP  359

Query  1244  LVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLL  1423
              + KV+G +  SRI A L IP+L  YPY+  LSG  L+++LN AS++KN L V+I TG  
Sbjct  360   RINKVIGHIKASRIAAILCIPILFAYPYMTYLSGPGLTIILNIASVIKNNLGVTIITGCF  419

Query  1424  ILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvl  1603
             ILQN AV Q+QRGAANG++M+ MS FK + PA  G + SW+Q RQ A F+PGDQ+VFF+L
Sbjct  420   ILQNNAVPQDQRGAANGLAMTGMSFFKAVAPAGAGIVFSWAQKRQQASFLPGDQMVFFLL  479

Query  1604  nvfellglIMTFKPFLQLPED  1666
             N+FELLGLI+TFKPFL +P+ 
Sbjct  480   NLFELLGLILTFKPFLAVPQQ  500



>ref|XP_003577876.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Brachypodium distachyon]
Length=494

 Score =   513 bits (1322),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 284/477 (60%), Positives = 346/477 (73%), Gaps = 24/477 (5%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y E C GC VE  K A+AGVP     ++ +VTLC ALPISSLFPFLYFMIRD ++A+R E
Sbjct  22    YVEGCPGCGVERRKAANAGVPYGSFIYVWVVTLCTALPISSLFPFLYFMIRDLNVAKRTE  81

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG+VG+SFM GR LTS  WGI ADR GRKPV++ G  +VVIFN +FGLSV YWMA
Sbjct  82    DIGFYAGFVGASFMFGRCLTSTAWGIAADRIGRKPVIVFGIFSVVIFNTLFGLSVTYWMA  141

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TRFLLGAL G++G ++AYA E+CR E+ AL +S VSTAWGIGL+IGPA+GGY A PAE
Sbjct  142   IATRFLLGALNGLLGPIKAYAIEVCRPEHEALALSLVSTAWGIGLIIGPALGGYLALPAE  201

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             KYP+IFS +SFFG+FPYFLPCL  SMFA V  V   W+PET+H         H V++N  
Sbjct  202   KYPSIFSPDSFFGRFPYFLPCLCTSMFAAVVLVSCIWMPETLHK--------HKVNENGN  253

Query  1004  Q--PEHEVP--------------TSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWA  1135
             Q     E P               ++KSL KNWPL+SSI++YCVF  HD+AY E+FSLWA
Sbjct  254   QCVEALEAPLIDPKGNAVQSGNVDTKKSLFKNWPLMSSIIIYCVFSFHDMAYTEVFSLWA  313

Query  1136  VSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLS  1315
              S RK GGLS ++ DVGQ LAITG  LL++QLF YP + KVLG V  S+I A L IP+L 
Sbjct  314   ESDRKYGGLSLSSEDVGQTLAITGASLLVYQLFMYPRINKVLGHVRSSQIAAVLCIPILF  373

Query  1316  TYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMS  1495
              YPY+  LS   LS+VLN AS++KN L V+I TG  ILQN AV Q+QRGAANG++M+ MS
Sbjct  374   AYPYMTYLSEPGLSIVLNIASVIKNNLGVTIITGTFILQNNAVPQDQRGAANGLAMTGMS  433

Query  1496  LFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPED  1666
              FK + PA  G + SW+Q RQ A F PGDQ+VFF+LN+ ELLGL++TFKPFL +PE 
Sbjct  434   FFKAVAPAGAGIVFSWAQKRQHAFFFPGDQMVFFLLNIVELLGLVLTFKPFLAVPEQ  490



>dbj|BAK02262.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=502

 Score =   513 bits (1322),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 279/469 (59%), Positives = 343/469 (73%), Gaps = 8/469 (2%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y + C GC V+  K A+ G+P     ++  VTLC ALPISSLFPFLYFMIRD H+A+R E
Sbjct  30    YVDGCPGCAVDRRKAANPGIPYGTFIYVWTVTLCTALPISSLFPFLYFMIRDLHVAKRTE  89

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG+VG+SFM GR LTS LWGI ADR GRKPVV+ G ++VVIFN +FGLSV YWMA
Sbjct  90    DIGFYAGFVGASFMFGRCLTSTLWGIAADRIGRKPVVVFGILSVVIFNTLFGLSVTYWMA  149

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TRFLLGAL G++G M+AYA E+CR E+  L +S VSTAWGIGL+IGPA+GGY A PAE
Sbjct  150   IATRFLLGALNGLLGPMKAYAIEVCRPEHEPLALSLVSTAWGIGLIIGPALGGYLALPAE  209

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             KYP IFS +S FG+FPYFLPCL  S+FA +  +   W+PET+H HK        V     
Sbjct  210   KYPNIFSPDSLFGRFPYFLPCLCTSVFAAIVLISCIWMPETLHKHKVSDDGNQSVEALEA  269

Query  1004  Q---PEHEV-----PTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGG  1159
                 P+ EV       ++KSL KNWPL+SSI+VYC+F  HD+AY E+FSLWA S RK GG
Sbjct  270   HLIDPKEEVGQSNSSNTKKSLFKNWPLMSSIIVYCIFSFHDMAYTEVFSLWAESDRKYGG  329

Query  1160  LSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALL  1339
             LS ++ DVGQ LAITG  LL++QLF YP + KVLGP+  S+I A L IP+L  YPY+  L
Sbjct  330   LSLSSEDVGQTLAITGASLLVYQLFMYPSIIKVLGPIKSSQIAAVLCIPILFAYPYMTYL  389

Query  1340  SGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPA  1519
             SG  LS+VLN AS++KN L V+I TG  ILQN AV Q QRGAANG++M+ MS FK + PA
Sbjct  390   SGPGLSIVLNIASVIKNNLGVTIITGTFILQNNAVPQNQRGAANGLAMTGMSFFKAVAPA  449

Query  1520  AGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPED  1666
               G + SW+Q RQ A F PGDQ+VFF+LN+ ELLGL++TF+PFL +PE 
Sbjct  450   GAGIVFSWAQKRQHAFFFPGDQMVFFLLNIIELLGLVLTFRPFLAVPEQ  498



>ref|XP_010673233.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=421

 Score =   510 bits (1314),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 263/433 (61%), Positives = 332/433 (77%), Gaps = 17/433 (4%)
 Frame = +2

Query  428   MIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFN  607
             M+RDF+IA+REED+S+YAG+ GS+FM+GR LT+VLWGI+ADRYGRKPV+I  T++VVIFN
Sbjct  1     MVRDFNIAKREEDVSFYAGFEGSAFMVGRTLTAVLWGIVADRYGRKPVMIFSTLSVVIFN  60

Query  608   AVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIG  787
              +FGLS NYWMA+ +RFLLGA CG +G MRAYA+E+ RRE+ ALG++ +S+AWGIGLVIG
Sbjct  61    TMFGLSTNYWMALTSRFLLGAFCGTLGPMRAYATEVSRREHQALGVAMLSSAWGIGLVIG  120

Query  788   PAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkke  967
             PA+GGY AQPA+K+P++FS ES FG+FPYFL  L+IS+FAL  +++ FWLPET+HT K  
Sbjct  121   PALGGYLAQPADKFPSVFSQESIFGRFPYFLVSLVISIFALGVSILCFWLPETLHTCKPI  180

Query  968   hkeeh-----DVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLW  1132
                +      D+     +   +   S  SLL+NWPL+S++++YCVFQLHD+AY+EIFSLW
Sbjct  181   TDGKVQDHPHDIEDADSEKLQDTENSWLSLLQNWPLMSTVILYCVFQLHDMAYIEIFSLW  240

Query  1133  AVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLL  1312
              VSPR +GGLS  T DVGQ LA+ G GLL  QL  YP +E+ LGP+ +SR+GA LSI LL
Sbjct  241   TVSPRSVGGLSLATEDVGQALAVAGFGLLFCQLLFYPFLERKLGPITVSRVGAVLSIALL  300

Query  1313  STYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAM  1492
             S YP+ A L G  LS+V++ AS LKNVLS+SITTGL +LQNRAV Q QRGAANG+S+S M
Sbjct  301   SGYPFFANLRGTTLSIVVDLASALKNVLSISITTGLFLLQNRAVRQHQRGAANGLSLSMM  360

Query  1493  SLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPEDDI  1672
             SL K +GPA  GSLLSW+Q RQ A F+PG  +VFF+LNV E LGL+MTFKPFL       
Sbjct  361   SLCKALGPAGAGSLLSWAQTRQTASFLPGTHMVFFILNVVEFLGLVMTFKPFLAR-----  415

Query  1673  LKSKQDGAAEENC  1711
                    AAEE C
Sbjct  416   -------AAEEYC  421



>ref|XP_007133566.1| hypothetical protein PHAVU_011G189800g [Phaseolus vulgaris]
 gb|ESW05560.1| hypothetical protein PHAVU_011G189800g [Phaseolus vulgaris]
Length=491

 Score =   513 bits (1321),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 263/462 (57%), Positives = 345/462 (75%), Gaps = 6/462 (1%)
 Frame = +2

Query  284   YDESCAGCRVELLKR--ADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAER  457
             Y E+C GC+V+  K      GVP K++F I MV LCA++PISSLF +LYFM+RDF+IA+ 
Sbjct  18    YFENCPGCKVDKAKELSEGQGVPFKNLFIIWMVVLCASMPISSLFSYLYFMVRDFNIAKT  77

Query  458   EEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYW  637
             E DIS+YAGYVGS+FM GR LTSVLWGIIADRYGRKPV++IG + +V+FN +FGLS ++W
Sbjct  78    EADISFYAGYVGSAFMFGRCLTSVLWGIIADRYGRKPVIMIGIIAIVLFNTLFGLSTSFW  137

Query  638   MAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQP  817
             MA++ RFLLG   G++G + AYA+E+ R EY ALG+S+V+ +WG GL+IGPA+GGY AQP
Sbjct  138   MAVMMRFLLGCFSGLLGPVTAYATELVREEYQALGVSSVTASWGAGLIIGPALGGYLAQP  197

Query  818   AEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQ-  994
              EKYP IF   SF+ KF YF P  IIS FA V  V   W+PET+H HK  ++   +V   
Sbjct  198   VEKYPHIFPKNSFWDKFAYFFPNFIISAFAFVVAVGCIWIPETLHNHKCSNESIDNVEAL  257

Query  995   ---NSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLS  1165
                N      +    ++ L  NWPL+SSI+++CVF LHD AY E+FSLW VSP++LGGL+
Sbjct  258   EVGNRVVGIDKTIQKKEKLFLNWPLMSSIIIFCVFSLHDGAYHEVFSLWTVSPQRLGGLN  317

Query  1166  YTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSG  1345
             +TT DVG VL+I+G+ ++++QL  YP V K  GP+ I+RI   L+IPLL +Y +I  LSG
Sbjct  318   FTTNDVGNVLSISGLAVIIYQLTIYPYVRKASGPIGIARISGILTIPLLQSYTFIGYLSG  377

Query  1346  LCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAG  1525
             L + ++++ AS+LKN+L+V+ITT LL+LQNRAV Q QRGAANGISM+ +SLFK IGPA G
Sbjct  378   LAMFILISIASILKNILAVTITTCLLLLQNRAVEQYQRGAANGISMTGLSLFKAIGPAGG  437

Query  1526  GSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             G+LL+ SQ R DA F+PG Q+VFF+LN    LG +MTFKPFL
Sbjct  438   GALLTLSQKRMDASFLPGTQMVFFILNTVVALGTLMTFKPFL  479



>ref|XP_010237968.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X3 [Brachypodium distachyon]
Length=491

 Score =   511 bits (1317),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 288/507 (57%), Positives = 356/507 (70%), Gaps = 37/507 (7%)
 Frame = +2

Query  194   ASESMAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISM  373
             A E   E  + PLL+++E   G            C GC +E  K   +G+P K  F++ M
Sbjct  2     AGEEQGE-RSSPLLRKTEHQPG------------CPGCDLERRKALRSGMPYKEFFYVWM  48

Query  374   VTLCAALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADR  553
             V+L AALPISSLFPFLYFMIRD ++A+R EDI +YAG+VG+SFM GR LTS  WGI ADR
Sbjct  49    VSLTAALPISSLFPFLYFMIRDLNVAKRTEDIGFYAGFVGASFMFGRCLTSTAWGIAADR  108

Query  554   YGRKPvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYH  733
              GRKPV++ G  +VVIFN +FGLSV YWMAI TRFLLGAL G++G ++AYA E+CR E+ 
Sbjct  109   IGRKPVIVFGIFSVVIFNTLFGLSVTYWMAIATRFLLGALNGLLGPIKAYAIEVCRPEHE  168

Query  734   ALGISAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALV  913
             AL +S VSTAWGIGL+IGPA+GGY A PAEKYP+IFS +SFFG+FPYFLPCL  SMFA V
Sbjct  169   ALALSLVSTAWGIGLIIGPALGGYLALPAEKYPSIFSPDSFFGRFPYFLPCLCTSMFAAV  228

Query  914   ATVMSFWLPETMHThkkehkeehDVSQNSKQ--PEHEVP--------------TSQKSLL  1045
               V   W+PET+H         H V++N  Q     E P               ++KSL 
Sbjct  229   VLVSCIWMPETLHK--------HKVNENGNQCVEALEAPLIDPKGNAVQSGNVDTKKSLF  280

Query  1046  KNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLF  1225
             KNWPL+SSI++YCVF  HD+AY E+FSLWA S RK GGLS ++ DVGQ LAITG  LL++
Sbjct  281   KNWPLMSSIIIYCVFSFHDMAYTEVFSLWAESDRKYGGLSLSSEDVGQTLAITGASLLVY  340

Query  1226  QLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVS  1405
             QLF YP + KVLG V  S+I A L IP+L  YPY+  LS   LS+VLN AS++KN L V+
Sbjct  341   QLFMYPRINKVLGHVRSSQIAAVLCIPILFAYPYMTYLSEPGLSIVLNIASVIKNNLGVT  400

Query  1406  ITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQ  1585
             I TG  ILQN AV Q+QRGAANG++M+ MS FK + PA  G + SW+Q RQ A F PGDQ
Sbjct  401   IITGTFILQNNAVPQDQRGAANGLAMTGMSFFKAVAPAGAGIVFSWAQKRQHAFFFPGDQ  460

Query  1586  lvffvlnvfellglIMTFKPFLQLPED  1666
             +VFF+LN+ ELLGL++TFKPFL +PE 
Sbjct  461   MVFFLLNIVELLGLVLTFKPFLAVPEQ  487



>dbj|BAJ94369.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=494

 Score =   511 bits (1317),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 282/499 (57%), Positives = 351/499 (70%), Gaps = 18/499 (4%)
 Frame = +2

Query  194   ASESMAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISM  373
             ++ +  E  T PLL + E++          Y   C GC  +  K    G+P K   ++ M
Sbjct  2     SANAEEEEGTSPLLSKEERH----------YHPGCPGCDHDRTKELQTGLPYKEFAYVWM  51

Query  374   VTLCAALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADR  553
             + L  ALPISSLFPFLYFMIRD H+A+R EDI +YAG+VG+SFM GR LTS LWGI ADR
Sbjct  52    ICLTTALPISSLFPFLYFMIRDLHVAKRTEDIGFYAGFVGASFMFGRCLTSTLWGIAADR  111

Query  554   YGRKPvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYH  733
              GRKPVV+ G ++VVIFN +FGLSV YWMAI TRFLLGAL G++G M+AYA E+CR E+ 
Sbjct  112   IGRKPVVVFGILSVVIFNTLFGLSVTYWMAIATRFLLGALNGLLGPMKAYAIEVCRPEHE  171

Query  734   ALGISAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALV  913
              L +S VSTAWGIGL+IGPA+GGY A PAEKYP IFS +S FG+FPYFLPCL  S+FA +
Sbjct  172   PLALSLVSTAWGIGLIIGPALGGYLALPAEKYPNIFSPDSLFGRFPYFLPCLCTSVFAAI  231

Query  914   ATVMSFWLPETMHThkkehkeehDVSQNSKQ---PEHEV-----PTSQKSLLKNWPLISS  1069
               +   W+PET+H HK        V         P+ EV       ++KSL KNWPL+SS
Sbjct  232   VLISCIWMPETLHKHKVSDDGNQSVEALEAHLIDPKEEVGQSNSSNTKKSLFKNWPLMSS  291

Query  1070  ILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLV  1249
             I+VYC+F  HD+AY E+FSLWA S RK GGLS ++ DVGQ LAITG  LL++QLF YP +
Sbjct  292   IIVYCIFSFHDMAYTEVFSLWAESDRKYGGLSLSSEDVGQTLAITGASLLVYQLFMYPSI  351

Query  1250  EKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLIL  1429
              KVLGP+  S+I A L IP+L  YPY+  LSG  LS+VLN AS++KN L V+I TG  IL
Sbjct  352   IKVLGPIKSSQIAAVLCIPILFAYPYMTYLSGPGLSIVLNIASVIKNNLGVTIITGTFIL  411

Query  1430  QNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnv  1609
             QN AV Q QRGAANG++M+ MS FK + PA  G + SW+Q RQ A F PGDQ+VFF+LN+
Sbjct  412   QNNAVPQNQRGAANGLAMTGMSFFKAVAPAGAGIVFSWAQKRQHAFFFPGDQMVFFLLNI  471

Query  1610  fellglIMTFKPFLQLPED  1666
              ELLGL++TF+PFL +PE 
Sbjct  472   IELLGLVLTFRPFLAVPEQ  490



>ref|NP_001130901.1| carbohydrate transporter/ sugar porter/ transporter [Zea mays]
 gb|ACF79285.1| unknown [Zea mays]
 tpg|DAA39261.1| TPA: carbohydrate transporter/ sugar porter/ transporter [Zea 
mays]
Length=502

 Score =   511 bits (1316),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 273/458 (60%), Positives = 342/458 (75%), Gaps = 4/458 (1%)
 Frame = +2

Query  290   ESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREEDI  469
             + C GC V+  K A  G+P  +  ++ +VTLC ALPISSLFPFLYFMIRD ++AER EDI
Sbjct  44    DGCPGCAVDRRKAASPGIPYANFIYVWIVTLCTALPISSLFPFLYFMIRDLNVAERTEDI  103

Query  470   SYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMAII  649
              +YAG+VG+SFM GR LTS  WGI ADR GRKPVV+ G  +VV+FN +FGLSVNYWMAI 
Sbjct  104   GFYAGFVGASFMFGRCLTSTAWGIAADRIGRKPVVVFGISSVVVFNTLFGLSVNYWMAIA  163

Query  650   TRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAEKY  829
             TRFLLGAL G++G ++AYA E+CR E+ AL +S VSTAWGIGL+IGPA+GGY A PAE +
Sbjct  164   TRFLLGALNGLLGPIKAYAIEVCRPEHEALALSLVSTAWGIGLIIGPALGGYLALPAENF  223

Query  830   PTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSKQP  1009
             P IFS +S FG+FPYFLPCL  S+FA    V   W+PET+H     HK     SQ+ ++ 
Sbjct  224   PAIFSPDSVFGRFPYFLPCLCTSVFAAAVLVSCIWMPETLHR----HKVHESTSQDVEKV  279

Query  1010  EHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQ  1189
             +      +KSL +NWPL+SSI+VYC+F  HD+AY E+FSLWA S +K GGLS ++ DVGQ
Sbjct  280   QESGIRKKKSLFRNWPLMSSIIVYCIFSFHDMAYTEVFSLWAESDKKYGGLSLSSEDVGQ  339

Query  1190  VLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLN  1369
             VLA+TG  LL++QLF YP + KVLGP+  SRI A L IP+L  YPY+  +S   LS++LN
Sbjct  340   VLAVTGASLLVYQLFLYPRINKVLGPIKSSRIAAILCIPILFAYPYMTYISEPGLSIILN  399

Query  1370  CASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQ  1549
              AS +KN L+V+I TG  ILQN AV Q+QRGAANG+SM+ MS FK + PA  G + SW+Q
Sbjct  400   IASAIKNNLAVTIITGTFILQNNAVPQDQRGAANGLSMTGMSFFKALAPAGAGIVFSWAQ  459

Query  1550  LRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPE  1663
              RQ A F PGDQ+VFF+LNV EL+GLI+TFKPFL +PE
Sbjct  460   KRQHAFFFPGDQMVFFLLNVVELVGLILTFKPFLAVPE  497



>ref|XP_003578972.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Brachypodium 
distachyon]
Length=485

 Score =   510 bits (1314),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 253/461 (55%), Positives = 341/461 (74%), Gaps = 2/461 (0%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y E C GC +E  K    G P + +FF+ + T  +ALPI+SLFPFLYFMI+D H+A+REE
Sbjct  25    YHEGCPGCAMERRKENRKGAPYRELFFVGITTFASALPITSLFPFLYFMIQDLHVAQREE  84

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG++G+S+M+GR   S+ WG++ADR GRKPV++I  V+++IFN +FGLSV YWMA
Sbjct  85    DIGFYAGFLGASYMVGRGFASIFWGMVADRIGRKPVIMISIVSIIIFNTLFGLSVKYWMA  144

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TRFLLGAL G +  ++AY  E+CR +  ALG+S V+TAWGIGL+IGPA+GGY AQPA+
Sbjct  145   IATRFLLGALNGFLAPVKAYCIEVCRDDQQALGMSTVNTAWGIGLIIGPAIGGYLAQPAK  204

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             +YP IF  +S FG+FP+ LPCL IS+FA  A +   WLPE++H    + ++  + +Q S 
Sbjct  205   QYPHIFHEKSTFGRFPFLLPCLCISVFATFALITCIWLPESLHK-HNKLQKGVETAQAST  263

Query  1004  QPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADV  1183
              PE   P  +KSLLKNWPL+SSI+ YCVF LHD AY EIFSLW VS RK GGLS+++ DV
Sbjct  264   SPESADP-PKKSLLKNWPLMSSIITYCVFSLHDTAYSEIFSLWTVSDRKYGGLSFSSKDV  322

Query  1184  GQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVV  1363
             GQVL + G  LL++Q+FAY  ++K+ GP+ ++R  +ALSIP+++ YP++  LSG+ L V 
Sbjct  323   GQVLTVAGASLLVYQIFAYRWLDKIFGPINLTRTASALSIPIIAAYPFMTHLSGIRLGVP  382

Query  1364  LNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSW  1543
             L  A+M K+ L+++  +G  +LQN AV Q QRGAANGI+ + MSLFK   PAA G + SW
Sbjct  383   LYIAAMFKSCLAITRVSGTSLLQNNAVPQGQRGAANGIATTMMSLFKAFAPAAAGIIFSW  442

Query  1544  SQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPED  1666
             +Q RQ A F PGDQ+VF +LN  E+LGL++TFKPFL +PE 
Sbjct  443   AQKRQRAAFFPGDQMVFLLLNCTEVLGLLLTFKPFLAVPEH  483



>ref|XP_003526355.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Glycine max]
 gb|KHN26424.1| Protein ZINC INDUCED FACILITATOR-LIKE 1 [Glycine soja]
Length=478

 Score =   510 bits (1313),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 270/481 (56%), Positives = 352/481 (73%), Gaps = 19/481 (4%)
 Frame = +2

Query  224   EPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPIS  403
             EPLLK+              Y E+C GC+V+  K  +  V I+++  I +V LC ALP+S
Sbjct  9     EPLLKKQ-------------YYENCPGCKVDRAKELEKDVSIRNLVHIWIVVLCGALPVS  55

Query  404   SLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviig  583
             SL+PFLYFM++DF+IAE EEDIS YAGY+GS+FMLGR LTS+LWG+IADRYGRKPVVII 
Sbjct  56    SLYPFLYFMVKDFNIAEGEEDISAYAGYIGSAFMLGRCLTSMLWGMIADRYGRKPVVIIS  115

Query  584   tvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTA  763
              ++VVIFN +FGLS ++WMA+ITR  LG L G++GT++A++SEI R EY  LG+S VS A
Sbjct  116   VISVVIFNILFGLSTSFWMAVITRLFLGCLNGVMGTIKAFSSEIFREEYQPLGLSTVSAA  175

Query  764   WGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPE  943
             WG+GL +GPA+GGY AQP EKYP +FS  SF+ +FPYFLPCL+IS FA    +   WLPE
Sbjct  176   WGVGLALGPALGGYLAQPVEKYPYLFSKGSFWDRFPYFLPCLVISTFAFSVAIACIWLPE  235

Query  944   TMHThkkehkeehDVSQNSKQPEHE-VPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEI  1120
             T H H  E      +   S+ P+ + V  + +S+ +NWPL+SSI+VYCVF LHD AY E+
Sbjct  236   TNHNHNPEA-----LEIRSRAPDKDKVVQNNESVFRNWPLMSSIIVYCVFSLHDNAYSEV  290

Query  1121  FSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALS  1300
             FSLWAVSPR LGGL++TT  VG VL ++G  +++FQL  Y  ++K  GPV ++RI   LS
Sbjct  291   FSLWAVSPRWLGGLNFTTNSVGNVLVVSGFAIIIFQLGLYQSIQKTCGPVSLARISGVLS  350

Query  1301  IPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGIS  1480
             IP+L +YP++ +LSG  L   +  AS+L NV+   ITT LLILQNRAV Q+QRG ANGIS
Sbjct  351   IPILQSYPFMTMLSGFTLYAAIYIASILNNVIIEIITTCLLILQNRAVEQQQRGIANGIS  410

Query  1481  MSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLP  1660
             M+AMS FK IGPAAGG++L+ SQ R +A F+PG  L+FF LNV E LG+++TFKPFL + 
Sbjct  411   MTAMSAFKVIGPAAGGAILTSSQKRLNATFLPGTHLIFFSLNVVEGLGVLLTFKPFLTIK  470

Query  1661  E  1663
             +
Sbjct  471   K  471



>gb|KDO47755.1| hypothetical protein CISIN_1g011424mg [Citrus sinensis]
 gb|KDO47756.1| hypothetical protein CISIN_1g011424mg [Citrus sinensis]
 gb|KDO47757.1| hypothetical protein CISIN_1g011424mg [Citrus sinensis]
Length=420

 Score =   507 bits (1305),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 277/421 (66%), Positives = 342/421 (81%), Gaps = 9/421 (2%)
 Frame = +2

Query  428   MIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFN  607
             MI+DF IA+REEDI  YAGYVGSSFM GRALTSV WG++ADRYGRKPV+I+GT +VVIFN
Sbjct  1     MIKDFQIAKREEDIGSYAGYVGSSFMFGRALTSVFWGLVADRYGRKPVIIMGTASVVIFN  60

Query  608   AVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIG  787
              +FGLSVN+WMA++TRFLLG+L G++G ++AYA EI R E+ ALG+S VSTAWGIGL+IG
Sbjct  61    TLFGLSVNFWMAVLTRFLLGSLNGLLGPIKAYACEIFREEHQALGLSTVSTAWGIGLIIG  120

Query  788   PAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkke  967
             PA+GG+ AQPAEKYP +FS+ES FGKFPYFLPCL IS+FA   T+ +FWLPET+H H  +
Sbjct  121   PALGGFLAQPAEKYPNLFSSESLFGKFPYFLPCLCISLFAFGVTIAAFWLPETLHRHNDD  180

Query  968   hkeehDVSQNS--------KQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIF  1123
                  DVS ++        K+ E    T +KSLLKNWPL+SSI+VYCVF LHD+AY EIF
Sbjct  181   DDSC-DVSYDALESASAEVKEEEGREATPKKSLLKNWPLMSSIIVYCVFSLHDMAYSEIF  239

Query  1124  SLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSI  1303
             SLWA SP+KLGGL+Y+T  VG+VLAITG  LL+FQL  YP +E++LGP+M++RI   L+I
Sbjct  240   SLWANSPKKLGGLNYSTQMVGEVLAITGFSLLVFQLSLYPFLERILGPIMVARIAGVLTI  299

Query  1304  PLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISM  1483
             PLL++YPYIA+LSG  L+ +LNCAS++KN+LSVSI TGL ILQNRAV Q+QRGAANGI+M
Sbjct  300   PLLTSYPYIAMLSGFGLAFLLNCASVVKNLLSVSIITGLFILQNRAVDQDQRGAANGIAM  359

Query  1484  SAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPE  1663
             + MSLFK  GPA GG+L SW+Q R DA F+PG Q+VFFVLNV E +G++MTFKPFL    
Sbjct  360   TGMSLFKAAGPAGGGALFSWAQKRLDASFLPGSQMVFFVLNVVEAIGVLMTFKPFLAQRH  419

Query  1664  D  1666
             D
Sbjct  420   D  420



>gb|ABG21874.1| transporter, putative, expressed [Oryza sativa Japonica Group]
 gb|EEE52723.1| hypothetical protein OsJ_35137 [Oryza sativa Japonica Group]
Length=484

 Score =   509 bits (1310),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 274/469 (58%), Positives = 344/469 (73%), Gaps = 8/469 (2%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y + C GC  +  K    G+P K   ++ M+ L AALPISSLFPFLYFMIRD H+A+R E
Sbjct  12    YHQGCPGCAYDRKKEVYRGLPYKEFLYLWMICLTAALPISSLFPFLYFMIRDLHVAKRTE  71

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG+VG+SFM GR LTS +WGI ADR GRKPVV+ G   VVIFN +FGLS  YWMA
Sbjct  72    DIGFYAGFVGASFMFGRCLTSTVWGIAADRIGRKPVVVFGIFAVVIFNTLFGLSFTYWMA  131

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TRFLLGAL G++G ++AYA E+CR E+ AL +S VSTAWGIGL+IGPA+GGY +QPAE
Sbjct  132   IATRFLLGALNGLLGPIKAYAIEVCRPEHEALALSLVSTAWGIGLIIGPAIGGYLSQPAE  191

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQ---  994
             K+P +FS +S F +FPYFLPCL IS+FA V  +   W+PET+H HK +      V     
Sbjct  192   KFPNVFSPDSLFARFPYFLPCLCISVFAAVVLIGCIWMPETLHKHKADASRSQTVEALES  251

Query  995   -----NSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGG  1159
                    K  ++     +KSLL+NWPL+SSI++YCVF  HD+AY EIFSLWA S RK GG
Sbjct  252   HLIDPKEKADQNGSLDCKKSLLRNWPLMSSIILYCVFSFHDMAYTEIFSLWAESDRKYGG  311

Query  1160  LSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALL  1339
             LS ++ DVGQVLAITG+ LL++QLF YP + KV+G +  SRI A L IP+L  YPY+  L
Sbjct  312   LSLSSEDVGQVLAITGVSLLVYQLFIYPRINKVIGHIKASRIAAILCIPILFAYPYMTYL  371

Query  1340  SGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPA  1519
             SG  L+++LN AS++KN L V+I TG  ILQN AV Q+QRGAANG++M+ MS FK + PA
Sbjct  372   SGPGLTIILNIASVIKNNLGVTIITGCFILQNNAVPQDQRGAANGLAMTGMSFFKAVAPA  431

Query  1520  AGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPED  1666
               G + SW+Q RQ A F+PGDQ+VFF+LN+FELLGLI+TFKPFL +PE 
Sbjct  432   GAGIVFSWAQKRQHASFLPGDQMVFFLLNLFELLGLILTFKPFLAVPEQ  480



>ref|XP_006662713.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Oryza 
brachyantha]
Length=473

 Score =   508 bits (1309),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 260/461 (56%), Positives = 343/461 (74%), Gaps = 2/461 (0%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y + C GC +E  K    G+P K   F+++ TL ++LPISSLFPFLYFMIRD HIA  EE
Sbjct  13    YHDGCPGCAIEQRKEEHRGIPYKEFLFVAITTLASSLPISSLFPFLYFMIRDLHIARTEE  72

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG++G+S+M+GR   S+LWG++ADR GRKPV+I     V++FN +FGLS  YWMA
Sbjct  73    DIGFYAGFLGASYMIGRGFASILWGMVADRIGRKPVIIFSIFAVIVFNTLFGLSTKYWMA  132

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             + TRFLLGAL G++  ++AY+ E+CR E+ ALG+S VSTAWGIGLV+GPA+GGY AQP +
Sbjct  133   VSTRFLLGALNGLLAPIKAYSIEVCRAEHQALGLSIVSTAWGIGLVVGPAIGGYLAQPIK  192

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             +YP  F  +S FG+FPY LPCL IS+FAL+  +   WLPET+H HK   K       ++ 
Sbjct  193   QYPHNFHEKSIFGRFPYLLPCLCISLFALLVLISCIWLPETLHKHKGLEKGVETAETSAT  252

Query  1004  QPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADV  1183
             Q    V + +KSL KNWPL+SSIL YCVF LHD AY EIFSLW VS RK GGLS+++ DV
Sbjct  253   Q--ESVESHKKSLFKNWPLMSSILTYCVFSLHDTAYSEIFSLWTVSDRKYGGLSFSSKDV  310

Query  1184  GQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVV  1363
             GQVLA+ G  LL++QLF Y  V+K+LGP+  +RI +ALSIP+++ YP++  LSG+ L V 
Sbjct  311   GQVLAVAGASLLVYQLFIYRWVDKILGPINSTRIASALSIPIIAAYPFMTHLSGIRLGVS  370

Query  1364  LNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSW  1543
             L  A+M+K+VL+++I TG  +LQN+AV Q QRGAANGI+ +AMSLFK + PA  G L SW
Sbjct  371   LYIAAMVKSVLAITIITGTSLLQNKAVPQGQRGAANGIATTAMSLFKAVAPAGAGVLFSW  430

Query  1544  SQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPED  1666
             +Q RQ A F PGDQ+VF +LN+ E++GL++TFKPFL +P+ 
Sbjct  431   AQKRQHAAFFPGDQMVFLLLNLTEVIGLMLTFKPFLAVPQQ  471



>ref|XP_004978595.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Setaria 
italica]
Length=480

 Score =   508 bits (1309),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 252/461 (55%), Positives = 338/461 (73%), Gaps = 2/461 (0%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y E C GC ++  K +  GVP K + F+ + T  +ALPI+SLFPFLYFMIRD H+A+ EE
Sbjct  20    YYEGCPGCAMDKKKESRKGVPYKELLFVGITTFASALPITSLFPFLYFMIRDLHVAQTEE  79

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG++G+S+M+GR + SV WG++ADR GRKPV+ I   +V++FN +FGLSV YWMA
Sbjct  80    DIGFYAGFLGASYMIGRGIASVFWGMVADRIGRKPVIAISVFSVIVFNTLFGLSVKYWMA  139

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TRFLLGA+ G +  ++AY+ E+CR +  ALGIS VSTAWG+G++IGPA+GGY AQP +
Sbjct  140   IATRFLLGAMNGFLAPVKAYSIEVCRPDQQALGISIVSTAWGMGVIIGPAIGGYLAQPVK  199

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             +YP +F  +S FG+FPY LPCL IS+FA +  +   WLPET+H HK   +    V  ++ 
Sbjct  200   QYPHLFHEKSVFGRFPYLLPCLCISLFATLVFISCAWLPETLHKHKGLERAVEMVEGSTN  259

Query  1004  QPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADV  1183
             Q   E P  +KSLLKNWPL+SSI+ YCVF LHD AY EIFSLW VS RK GGLS+++ DV
Sbjct  260   QESTEPP--KKSLLKNWPLMSSIITYCVFSLHDTAYAEIFSLWTVSNRKYGGLSFSSKDV  317

Query  1184  GQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVV  1363
             GQVL + G  LL++QLFAY  V K  GP+  ++I +ALSIP+++ YP++  LSG+ L V 
Sbjct  318   GQVLTVAGASLLVYQLFAYRWVNKTFGPIYSTQISSALSIPIIAAYPFMTHLSGIRLGVP  377

Query  1364  LNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSW  1543
             L  A+MLK++ +++  TG  +LQN AV QEQRGAANGI+ +AMSL K   PA  G + SW
Sbjct  378   LYIAAMLKSIFAITRVTGTSLLQNNAVPQEQRGAANGIATTAMSLSKAFAPAGAGIIFSW  437

Query  1544  SQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPED  1666
             +Q RQ A F PGD ++F +LN+ E++GLI+TFKPFL +P+ 
Sbjct  438   AQKRQHAAFFPGDHMMFLLLNLTEVMGLILTFKPFLAVPQQ  478



>ref|XP_010922100.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like isoform X2 
[Elaeis guineensis]
Length=439

 Score =   507 bits (1305),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 257/434 (59%), Positives = 329/434 (76%), Gaps = 17/434 (4%)
 Frame = +2

Query  263   LEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDF  442
             LE  YF   E+C GC+ E  K  + G+P K   F+ MVTLC ALPIS LFPFLYFMIRD 
Sbjct  9     LEKVYF---ENCPGCKQEKKKDTNPGIPYKEFAFVWMVTLCTALPISILFPFLYFMIRDL  65

Query  443   HIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGL  622
             H+A+REEDI +YAG+VG+SFM GRALTS  WG++ADR GRKPV++IG   V+IFN +FGL
Sbjct  66    HVAKREEDIGFYAGFVGASFMFGRALTSAFWGLVADRCGRKPVIVIGICAVIIFNTLFGL  125

Query  623   SVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGG  802
             S  YWMAI TR LLG+L G++G ++AY+ E+CR E+ ALG+S VSTAWGIGL+IGPA+GG
Sbjct  126   STTYWMAITTRLLLGSLNGLLGPIKAYSIEVCRPEHQALGLSLVSTAWGIGLIIGPAIGG  185

Query  803   YFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeeh  982
             +FAQPAEKYP IFS +SFFG+FPYFLPC  +S+FA+   ++ FWLPET+H H     ++ 
Sbjct  186   FFAQPAEKYPNIFSQDSFFGRFPYFLPCFCVSLFAVGVFILCFWLPETLHRHNANKMQDG  245

Query  983   DV------------SQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFS  1126
              +             +N+ + E   PT  ++L KNWPL+SSI+VYCVF LHD+AY EIFS
Sbjct  246   TIEVLEAPSHGSGLKENTNECEERAPT--ENLFKNWPLMSSIIVYCVFSLHDMAYTEIFS  303

Query  1127  LWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIP  1306
             LWAVS +  GGLS+++ DVG+VLAI+G  LL++QLF YP +EK+LGP+  SR+ + LSIP
Sbjct  304   LWAVSDKIYGGLSFSSQDVGEVLAISGFSLLVYQLFLYPSLEKILGPITSSRVASVLSIP  363

Query  1307  LLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMS  1486
             LL+ +P++  LSGL LS+++NCAS+LKN+LSV+I TG  ILQN AV Q QRGAANGI+M+
Sbjct  364   LLAAFPFMTKLSGLGLSLIVNCASLLKNILSVTIITGTFILQNNAVPQHQRGAANGIAMT  423

Query  1487  AMSLFKTIGPAAGG  1528
              MSLFKT  PA  G
Sbjct  424   GMSLFKTAAPACAG  437



>ref|XP_006832881.1| hypothetical protein AMTR_s00095p00099600, partial [Amborella 
trichopoda]
 gb|ERM98159.1| hypothetical protein AMTR_s00095p00099600, partial [Amborella 
trichopoda]
Length=442

 Score =   507 bits (1305),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 263/455 (58%), Positives = 333/455 (73%), Gaps = 26/455 (6%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE N E LLK  +            Y E+C GC+V+ +K  + G P+K  FFI++V LC
Sbjct  1     MAE-NEEALLKTKD------------YYENCPGCKVDQMKEINRGFPLKECFFIAIVVLC  47

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
              ALPISSLFP+LYFMIRDF+IA++ EDI YYAG+VGSSFM GR LTS LWG+ ADRYGRK
Sbjct  48    NALPISSLFPYLYFMIRDFNIAKKVEDIGYYAGFVGSSFMFGRFLTSFLWGMAADRYGRK  107

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             P++I+GT++VV+FN +FGLSVN+WMAI  RFL G+  G++G ++AYA+E+ R EY ALG+
Sbjct  108   PIIILGTLSVVVFNTLFGLSVNFWMAIAMRFLHGSFNGMLGPLKAYATEVLREEYQALGL  167

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S V TAWGIGL++GPA+GGYFAQPA+KYP IFS  S FG+FPYFLPCL IS+FA +  + 
Sbjct  168   SIVGTAWGIGLIVGPALGGYFAQPADKYPNIFSKSSIFGRFPYFLPCLCISLFAAIVFIA  227

Query  926   SFWLPETMHThkkehkeehDVS-------------QNSKQPEHEVPTSQKSLLKNWPLIS  1066
             SFWLPET+H H  E +E  D S             +N  + E     SQKSL KNWPL+S
Sbjct  228   SFWLPETLHMHHLEREEVFDYSDALETASYGFVTKENMDEVEGRSQASQKSLWKNWPLMS  287

Query  1067  SILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPL  1246
             +I++YC+F L DI+Y EIF LWAVSP +LGG+  ++ DVGQVLAI+G GLLL QL+ +P 
Sbjct  288   NIIIYCIFSLFDISYTEIFCLWAVSPGRLGGMGLSSQDVGQVLAISGCGLLLLQLYLFPK  347

Query  1247  VEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLI  1426
             VEK+LGP+ + R G  L++PLL  YP IA LSG  L   +NCAS+LKN LSV+I T L I
Sbjct  348   VEKILGPISLIRFGTVLTVPLLLCYPSIAALSGFALRFTINCASLLKNSLSVTIVTALFI  407

Query  1427  LQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGS  1531
             LQN +V + QRGAANG+ M+ MSLFK +GPA  G+
Sbjct  408   LQNNSVPRHQRGAANGMVMTPMSLFKAVGPAGAGA  442



>ref|XP_010237969.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X4 [Brachypodium distachyon]
Length=480

 Score =   507 bits (1306),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 281/473 (59%), Positives = 344/473 (73%), Gaps = 24/473 (5%)
 Frame = +2

Query  296   CAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREEDISY  475
             C GC VE  K A+AG+P   + +I +V LC ALPISSLFPFLYFMIRD ++A+R EDI +
Sbjct  12    CPGCAVERRKAANAGIPYGSLAYIWVVILCTALPISSLFPFLYFMIRDLNVAKRTEDIGF  71

Query  476   YAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMAIITR  655
             YAG+VG+SFM GR LTS  WGI ADR GRKPV++ G  +VVIFN +FGLSV YWMAI TR
Sbjct  72    YAGFVGASFMFGRCLTSTAWGIAADRIGRKPVIVFGIFSVVIFNTLFGLSVTYWMAIATR  131

Query  656   FLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAEKYPT  835
             FLLGAL G++G ++AYA E+CR E+ AL +S VSTAWGIGL+IGPA+GGY A PAEKYP+
Sbjct  132   FLLGALNGLLGPIKAYAIEVCRPEHEALALSLVSTAWGIGLIIGPALGGYLALPAEKYPS  191

Query  836   IFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSKQ--P  1009
             IFS +SFFG+FPYFLPCL  SMFA V  V   W+PET+H         H V++N  Q   
Sbjct  192   IFSPDSFFGRFPYFLPCLCTSMFAAVVLVSCIWMPETLHK--------HKVNENGNQCVE  243

Query  1010  EHEVP--------------TSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPR  1147
               E P               ++KSL KNWPL+SSI++YCVF  HD+AY E+FSLWA S R
Sbjct  244   ALEAPLIDPKGNAVQSGNVDTKKSLFKNWPLMSSIIIYCVFSFHDMAYTEVFSLWAESDR  303

Query  1148  KLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPY  1327
             K GGLS ++ DVGQ LAITG  LL++QLF YP + KVLG V  S+I A L IP+L  YPY
Sbjct  304   KYGGLSLSSEDVGQTLAITGASLLVYQLFMYPRINKVLGHVRSSQIAAVLCIPILFAYPY  363

Query  1328  IALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKT  1507
             +  LS   LS+VLN AS++KN L V+I TG  ILQN AV Q+QRGAANG++M+ MS FK 
Sbjct  364   MTYLSEPGLSIVLNIASVIKNNLGVTIITGTFILQNNAVPQDQRGAANGLAMTGMSFFKA  423

Query  1508  IGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPED  1666
             + PA  G + SW+Q RQ A F PGDQ+VFF+LN+ ELLGL++TFKPFL +PE 
Sbjct  424   VAPAGAGIVFSWAQKRQHAFFFPGDQMVFFLLNIVELLGLVLTFKPFLAVPEQ  476



>gb|AAM12978.1| transporter-like protein [Arabidopsis thaliana]
 gb|AAM91200.1| transporter-like protein [Arabidopsis thaliana]
Length=460

 Score =   506 bits (1304),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 275/455 (60%), Positives = 347/455 (76%), Gaps = 11/455 (2%)
 Frame = +2

Query  320   LKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSS  499
             +K+   G P   + F+ ++ L  +LPISSL+PFLY+MI DF +A+ E+DI +YAG+VG S
Sbjct  1     MKQLRRGYPYLELSFVWIIVLSTSLPISSLYPFLYYMIEDFGVAKTEKDIGFYAGFVGCS  60

Query  500   FMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCG  679
             FMLGRALTSV WGI+ADRYGRKP++++GT+++ IFNA+FGLS N+WMAI TRFLLG+   
Sbjct  61    FMLGRALTSVFWGIVADRYGRKPIILLGTISIAIFNALFGLSSNFWMAIGTRFLLGSFNC  120

Query  680   IIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFF  859
             ++GTM+AYASEI R EY A  +SAVSTAWGIGL+IGPA+GG+ AQPA+KYP +FS ES F
Sbjct  121   LLGTMKAYASEIFRDEYQATAMSAVSTAWGIGLIIGPALGGFLAQPADKYPNVFSQESLF  180

Query  860   GKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSKQPEHEVPTS---  1030
             G+F Y LPC  IS FAL+ TV+  ++PET+H HK +     D     +   HE   S   
Sbjct  181   GRFRYALPCFTISAFALLVTVLCCFIPETLHNHKLDSLSHDDSYDILEAASHESSPSTGK  240

Query  1031  --------QKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVG  1186
                      +SLLKNWPL+SSI+VYCV  LHD AY EIF+LWA SPRK GGLSY+T +VG
Sbjct  241   AGKNERKASQSLLKNWPLMSSIIVYCVLCLHDTAYSEIFALWANSPRKYGGLSYSTNEVG  300

Query  1187  QVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVL  1366
              VLAI+G+GL  FQ+F YPL EK+LGPV+++R   AL IP+  +YP+IA LSGL LS++L
Sbjct  301   TVLAISGLGLFSFQVFVYPLAEKLLGPVLVTRYAGALMIPIQMSYPFIAGLSGLSLSLML  360

Query  1367  NCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWS  1546
             NCAS+L NVLSVS  TGLLILQNRAV Q QRGAANGI+M+AMSLFKT+GPA  G L SWS
Sbjct  361   NCASILINVLSVSAITGLLILQNRAVDQSQRGAANGIAMTAMSLFKTVGPAGAGILFSWS  420

Query  1547  QLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             + R +A F+PG  +VFFVLNV  ++G+ +TFKPFL
Sbjct  421   ERRLNAAFLPGSHMVFFVLNVIVVVGVALTFKPFL  455



>gb|EEC67612.1| hypothetical protein OsI_34994 [Oryza sativa Indica Group]
Length=470

 Score =   506 bits (1302),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 255/461 (55%), Positives = 342/461 (74%), Gaps = 2/461 (0%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y + C GC +E  K    G+P K   F+++ TL ++LPISSLFPFLYFMIR+ HIA  EE
Sbjct  10    YHDGCPGCAMEQRKEEHKGIPYKEFLFVAITTLASSLPISSLFPFLYFMIRELHIARTEE  69

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG++G+S+M+GR   S+LWG++ADR GRKPV+I     V++ N +FGLSV YWMA
Sbjct  70    DIGFYAGFLGASYMIGRGFASILWGMVADRIGRKPVIIFSIFAVIVLNTLFGLSVKYWMA  129

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             + TRFLLGAL G++  ++AY+ E+CR E+ ALG+S VSTAWGIGLV+GPA+GGY AQP +
Sbjct  130   VTTRFLLGALNGLLAPIKAYSIEVCRAEHQALGLSIVSTAWGIGLVVGPAIGGYLAQPVK  189

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             +YP +F  +S FG+FPY LPCL IS+FAL+  +   WLPET+H HK           ++ 
Sbjct  190   QYPHLFHEKSIFGRFPYLLPCLCISLFALLVLISCIWLPETLHKHKGLETGVEAAEASTT  249

Query  1004  QPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADV  1183
             Q   E  + +KSL +NWPL+SSI+ YCVF LHD AY EIFSLW VS RK GGLS+++ DV
Sbjct  250   QGSAE--SHKKSLFRNWPLMSSIITYCVFSLHDTAYSEIFSLWTVSDRKYGGLSFSSKDV  307

Query  1184  GQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVV  1363
             GQVLA+ G  LL++QLF Y  V+K+LGP+  +RI + LSIP+++ YP++  LSG+ L V 
Sbjct  308   GQVLAVAGASLLVYQLFIYRWVDKILGPINSTRIASVLSIPIIAAYPFMTHLSGIRLGVA  367

Query  1364  LNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSW  1543
             L  A+M+K+VL+++I TG  +LQN+AV Q QRGAANGI+ +AMSLFK + PA  G L SW
Sbjct  368   LYSAAMIKSVLAITIITGTSLLQNKAVPQGQRGAANGIATTAMSLFKAVAPAGAGVLFSW  427

Query  1544  SQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPED  1666
             +Q RQ A F PGDQ+VF +LN+ E++GL++TFKPFL +P+ 
Sbjct  428   AQKRQHAAFFPGDQMVFLLLNLTEVIGLMLTFKPFLAVPQQ  468



>ref|XP_009121734.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Brassica rapa]
Length=460

 Score =   505 bits (1301),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 271/456 (59%), Positives = 335/456 (73%), Gaps = 14/456 (3%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             + E+C GC+V+ +KR   G P   +  + ++ L  ALP+SSLFPFLYFMI DF+IA++EE
Sbjct  14    FHENCPGCKVDQMKRLRRGFPFSELVTVWLIVLSTALPVSSLFPFLYFMIGDFNIAKKEE  73

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG+VG S MLGR LTSV+WGI+ADRYGRK V++IGT +VVIFN +FGLSVNYWMA
Sbjct  74    DIGFYAGFVGCSLMLGRTLTSVVWGIVADRYGRKRVILIGTASVVIFNTLFGLSVNYWMA  133

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             IITRF LG   G++G ++AYA E  R EY  L +SAVSTAWGIGL+IGPA+GG+ AQPA+
Sbjct  134   IITRFCLGCFNGLLGPIKAYAVETFRDEYQGLALSAVSTAWGIGLIIGPAMGGFLAQPAK  193

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             +YP++FS ES FGK P  L    I   A          P    +        HD   +  
Sbjct  194   QYPSLFSEESVFGKIPETLHNHKIDDDA----------PSPDESCDASKLLSHDPESHKA  243

Query  1004  QPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADV  1183
                +E P    SLLKNWPLISSI+VYC+F LHD+AY EIFSLWA SPRK GGL Y++ADV
Sbjct  244   TERNERP----SLLKNWPLISSIIVYCIFSLHDMAYTEIFSLWANSPRKYGGLGYSSADV  299

Query  1184  GQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVV  1363
             G VLAI+G GLL+FQL  Y   E++LGP M++RI  +L++ LLSTYP IA LSGL L++ 
Sbjct  300   GSVLAISGFGLLIFQLSLYSYAERLLGPTMVTRISGSLALVLLSTYPLIAKLSGLALTLA  359

Query  1364  LNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSW  1543
             LNCAS+ KNVL+ S  TGL ILQNRAV Q+QRGAANGI+M+AMSLFK IGPAA G + SW
Sbjct  360   LNCASVAKNVLATSAITGLFILQNRAVRQDQRGAANGIAMTAMSLFKAIGPAAAGIIYSW  419

Query  1544  SQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             S+ R DA F+PG Q+VFF+LNV   LG++MTFKPFL
Sbjct  420   SEKRLDAAFLPGTQMVFFILNVVLALGVVMTFKPFL  455



>gb|KCW87280.1| hypothetical protein EUGRSUZ_B03776 [Eucalyptus grandis]
Length=450

 Score =   505 bits (1300),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 266/457 (58%), Positives = 346/457 (76%), Gaps = 27/457 (6%)
 Frame = +2

Query  206   MAEG----NTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISM  373
             MAEG    +  PLL+++             Y ++C GC+V+ LKR   G+P + + +I +
Sbjct  1     MAEGPESRDAAPLLEKA-------------YHDNCPGCKVDRLKRERRGIPYRDLSYIWI  47

Query  374   VTLCAALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADR  553
             V+LC ALPI+SLFPF+YFMIRDFHIA+REEDI +YAG+VGSSFM+GRALTSV WG++ADR
Sbjct  48    VSLCTALPITSLFPFVYFMIRDFHIAKREEDIGFYAGFVGSSFMVGRALTSVFWGVVADR  107

Query  554   YGRKPvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYH  733
             YGRKP+++IGT +VV+ NA+FGLS ++WMA+ TRFLLG    ++GT+RAYA EIC  E+ 
Sbjct  108   YGRKPIILIGTFSVVVLNALFGLSTSFWMALCTRFLLGCFNSVLGTIRAYAVEICTEEHR  167

Query  734   ALGISAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALV  913
              L +S VST+ GIGL+IGPA+GG+FAQPAEKYP +FS  S FG++PYFLPCL+IS++A  
Sbjct  168   GLTLSVVSTSRGIGLIIGPAIGGFFAQPAEKYPGLFSQSSIFGRYPYFLPCLLISIYAAG  227

Query  914   ATVMSFWLPETMH----ThkkehkeehDVSQNSKQPE------HEVPTSQKSLLKNWPLI  1063
               +  +WLPET+H    T  +   +E +VS +S           E  T +++LLKNWPL+
Sbjct  228   VFISCWWLPETLHMHERTDGRSSCDEVEVSCDSSDATKHDTEVEEQKTYEENLLKNWPLM  287

Query  1064  SSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYP  1243
             S+I+VYCVF L +IAY EIFSLWAVS RK GGL++++ DVG+VLAI+G GLLLFQL  YP
Sbjct  288   STIIVYCVFSLQEIAYSEIFSLWAVSERKFGGLNFSSQDVGEVLAISGFGLLLFQLLLYP  347

Query  1244  LVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLL  1423
              VEK+LGP+MI+R+ A +SIPLLS+YPYIA+LSGL L + +N ASML+N LSVS+ TG+ 
Sbjct  348   RVEKILGPIMITRLSAGISIPLLSSYPYIAMLSGLTLHIAINFASMLRNALSVSVVTGIF  407

Query  1424  ILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSL  1534
             IL N AV Q QRGAANGISM+AMS+ K  GPA GG L
Sbjct  408   ILLNNAVPQHQRGAANGISMTAMSISKAFGPACGGFL  444



>ref|XP_006663796.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Oryza brachyantha]
Length=486

 Score =   506 bits (1303),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 288/498 (58%), Positives = 348/498 (70%), Gaps = 24/498 (5%)
 Frame = +2

Query  200   ESMAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVT  379
             E+ AE    PLLK     G             C GC  +  K    G+P K   ++ M+ 
Sbjct  2     EAEAEA---PLLKGENHPG-------------CPGCAYDRKKELYRGLPYKEFLYLWMIC  45

Query  380   LCAALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYG  559
             L AALPISSLFPFLYFMIRD H+A+R EDI +YAG+VG+SFM GR LTS  WGI ADR G
Sbjct  46    LTAALPISSLFPFLYFMIRDLHVAKRTEDIGFYAGFVGASFMFGRCLTSTAWGIAADRIG  105

Query  560   RKPvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHAL  739
             RKPVV+ G   VVIFN +FGLSV Y MAI TRFLLGAL G++G ++AYA E+CR E+ AL
Sbjct  106   RKPVVVFGIFAVVIFNTLFGLSVTYSMAIATRFLLGALNGLLGPIKAYAIEVCRPEHEAL  165

Query  740   GISAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVAT  919
              +S VSTAWGIGL+IGPA+GGY +QPAE +P +FS +S F +FPYFLPCL IS+FA V  
Sbjct  166   ALSLVSTAWGIGLIIGPALGGYLSQPAENFPNVFSPDSLFARFPYFLPCLCISVFAAVVL  225

Query  920   VMSFWLPETMHThkkehkeehDVSQ--------NSKQPEHEVPTSQKSLLKNWPLISSIL  1075
             V   W+PET+H HK +      V            K  ++    S+KSLL NWPL+SSI+
Sbjct  226   VGCIWMPETLHKHKADVNRYETVESLESDFIDLKGKAEQNGTLNSKKSLLSNWPLMSSII  285

Query  1076  VYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEK  1255
             +YCVF  HD+AY EIFSLWA S RK GGLS ++ DVGQVLAITG  LL++QLF YP + K
Sbjct  286   LYCVFSFHDMAYTEIFSLWAESDRKYGGLSLSSEDVGQVLAITGASLLVYQLFIYPRINK  345

Query  1256  VLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQN  1435
             VLG +  SRI A   IP+L TYPY+  LSG  LS VLN AS++KN LSV+I TG  ILQN
Sbjct  346   VLGHIKASRIAAIACIPILFTYPYMTYLSGPGLSTVLNIASVIKNNLSVTIITGCFILQN  405

Query  1436  RAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfe  1615
              AV Q+QRGAANG++M+ MSLFK + PA  G + SW+Q RQDA F+PGDQ+VFF+LNVFE
Sbjct  406   NAVPQDQRGAANGLAMTGMSLFKAVAPAGAGIVFSWAQKRQDASFLPGDQMVFFLLNVFE  465

Query  1616  llglIMTFKPFLQLPEDD  1669
              LGLI+TFKPFL  PE  
Sbjct  466   FLGLILTFKPFLAFPEQQ  483



>gb|AAN33182.1| major facilitator superfamily antiporter [Oryza sativa Japonica 
Group]
Length=470

 Score =   505 bits (1301),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 255/461 (55%), Positives = 340/461 (74%), Gaps = 2/461 (0%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y + C GC +E  K    G+P +   F+++ TL ++LPISSLFPFLYFMIRD H+A  EE
Sbjct  10    YHDGCPGCAMERRKEEHKGIPYREFLFVAITTLASSLPISSLFPFLYFMIRDLHVARTEE  69

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG++G+S+M+GR   S+LWG++ADR GRKPV+I     V++ N +FGLSV YWMA
Sbjct  70    DIGFYAGFLGASYMIGRGFASILWGMVADRIGRKPVIIFSIFAVIVLNTLFGLSVKYWMA  129

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             + TRFLLGAL G++  ++AY+ E+CR E+  LG+S VSTAWGIGLV+GPA GGY AQP +
Sbjct  130   VTTRFLLGALNGLLAPIKAYSIEVCRAEHQPLGLSIVSTAWGIGLVVGPATGGYLAQPVK  189

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             +YP IF  +S FG+FPY LPCL IS+FAL+  +   WLPET+H HK           ++ 
Sbjct  190   QYPHIFHEKSIFGRFPYLLPCLCISLFALLVLLSCIWLPETLHKHKGLEVGVETAEASTT  249

Query  1004  QPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADV  1183
             Q   E  + QKSL +NWPL+SSI+ YCVF LHD AY EIFSLW VS RK GGLS+++ DV
Sbjct  250   QESAE--SHQKSLFRNWPLMSSIVTYCVFSLHDTAYSEIFSLWTVSDRKYGGLSFSSKDV  307

Query  1184  GQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVV  1363
             GQVLA+ G  LL++QLF Y  V+K+LGP+  +RI AALS+P+++ YP++  LSG+ L V 
Sbjct  308   GQVLAVAGASLLVYQLFIYGWVDKILGPIHSTRISAALSVPIIAAYPFMTHLSGIRLGVA  367

Query  1364  LNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSW  1543
             L  A+M+K+VL+++I TG  +LQN+AV Q QRGAANGI+ +AMSLFK I PA  G + SW
Sbjct  368   LYSAAMIKSVLAITIITGTSLLQNKAVPQGQRGAANGIATTAMSLFKAIAPAGAGVIFSW  427

Query  1544  SQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPED  1666
             +Q RQ   F PGDQ+VF +LN+ E++GL++TFKPFL +P+ 
Sbjct  428   AQKRQHVAFFPGDQMVFLLLNLTEVIGLMLTFKPFLAVPQQ  468



>ref|NP_001066084.1| Os12g0132800 [Oryza sativa Japonica Group]
 gb|ABA95722.1| major facilitator superfamily antiporter, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF29103.1| Os12g0132800 [Oryza sativa Japonica Group]
 gb|EEE52721.1| hypothetical protein OsJ_35134 [Oryza sativa Japonica Group]
Length=470

 Score =   505 bits (1300),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 255/461 (55%), Positives = 340/461 (74%), Gaps = 2/461 (0%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y + C GC +E  K    G+P +   F+++ TL ++LPISSLFPFLYFMIRD H+A  EE
Sbjct  10    YHDGCPGCAMEQRKEEHKGIPYREFLFVAITTLASSLPISSLFPFLYFMIRDLHVARTEE  69

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG++G+S+M+GR   S+LWG++ADR GRKPV+I     V++ N +FGLSV YWMA
Sbjct  70    DIGFYAGFLGASYMIGRGFASILWGMVADRIGRKPVIIFSIFAVIVLNTLFGLSVKYWMA  129

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             + TRFLLGAL G++  ++AY+ E+CR E+  LG+S VSTAWGIGLV+GPA GGY AQP +
Sbjct  130   VTTRFLLGALNGLLAPIKAYSIEVCRAEHQPLGLSIVSTAWGIGLVVGPATGGYLAQPVK  189

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             +YP IF  +S FG+FPY LPCL IS+FAL+  +   WLPET+H HK           ++ 
Sbjct  190   QYPHIFHEKSIFGRFPYLLPCLCISLFALLVLLSCIWLPETLHKHKGLEVGVETAEASTT  249

Query  1004  QPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADV  1183
             Q   E  + QKSL +NWPL+SSI+ YCVF LHD AY EIFSLW VS RK GGLS+++ DV
Sbjct  250   QESAE--SHQKSLFRNWPLMSSIVTYCVFSLHDTAYSEIFSLWTVSDRKYGGLSFSSKDV  307

Query  1184  GQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVV  1363
             GQVLA+ G  LL++QLF Y  V+K+LGP+  +RI AALS+P+++ YP++  LSG+ L V 
Sbjct  308   GQVLAVAGASLLVYQLFIYGWVDKILGPIHSTRISAALSVPIIAAYPFMTHLSGIRLGVA  367

Query  1364  LNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSW  1543
             L  A+M+K+VL+++I TG  +LQN+AV Q QRGAANGI+ +AMSLFK I PA  G + SW
Sbjct  368   LYSAAMIKSVLAITIITGTSLLQNKAVPQGQRGAANGIATTAMSLFKAIAPAGAGVIFSW  427

Query  1544  SQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPED  1666
             +Q RQ   F PGDQ+VF +LN+ E++GL++TFKPFL +P+ 
Sbjct  428   AQKRQHVAFFPGDQMVFLLLNLTEVIGLMLTFKPFLAVPQQ  468



>ref|XP_006663795.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Oryza 
brachyantha]
Length=473

 Score =   505 bits (1300),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 258/465 (55%), Positives = 342/465 (74%), Gaps = 2/465 (0%)
 Frame = +2

Query  272   EYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIA  451
             E   Y + C GC +E  K    G+P     F+++ TL ++LPISSLFPFLYFMIRD HIA
Sbjct  9     EAKVYHDGCPGCAIEQRKEEHTGIPYNEFLFVAITTLASSLPISSLFPFLYFMIRDLHIA  68

Query  452   EREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVN  631
               EEDI +YAG++G+S+M+GR   S+LWG++ADR GRKPV+I     V++FN +FGLS  
Sbjct  69    RTEEDIGFYAGFLGASYMIGRGFASILWGMVADRIGRKPVIIFSIFAVIVFNTLFGLSTK  128

Query  632   YWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFA  811
             YWMA+ TRFLLGAL G++  ++AY+ E+CR E+ ALG+S VSTAWGIGLV+GPA+GGY A
Sbjct  129   YWMAVSTRFLLGALNGLLAPIKAYSIEVCRAEHQALGLSIVSTAWGIGLVVGPAIGGYLA  188

Query  812   QPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVS  991
             QP ++YP  F  +S FG+FPY LPCL IS+FAL+  +   WLPET+H HK   +      
Sbjct  189   QPIKQYPHNFHEKSIFGRFPYLLPCLCISLFALLVLISCIWLPETLHKHKGLERGVETAE  248

Query  992   QNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYT  1171
              ++ Q    V + +KSL KNWPL+SSIL YCVF LHD AY EIFSLW VS RK GGLS++
Sbjct  249   SSATQ--ESVESHKKSLFKNWPLMSSILTYCVFSLHDTAYSEIFSLWTVSDRKYGGLSFS  306

Query  1172  TADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLC  1351
             + DVGQVLA+ G  LL++QL  Y  V+K+LGP+  +RI +ALSIP+++ YP++  LSG+ 
Sbjct  307   SKDVGQVLAVAGASLLVYQLLIYRWVDKILGPINSTRIASALSIPIIAAYPFMTHLSGIR  366

Query  1352  LSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGS  1531
             L V L  A+M+K+VL+++I TG  +LQN+AV Q QRGAANGI+ +AMSLFK + PA  G 
Sbjct  367   LGVSLYIAAMIKSVLAITIITGTSLLQNKAVPQGQRGAANGIATTAMSLFKAVAPAGAGV  426

Query  1532  LLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPED  1666
             L SW+Q RQ A F PGDQ+VF +LN+ E++GL++TFKPFL +P+ 
Sbjct  427   LFSWAQKRQHAAFFPGDQMVFLLLNLTEVIGLMLTFKPFLAVPQQ  471



>ref|NP_001065685.1| Os11g0135900 [Oryza sativa Japonica Group]
 gb|ABA91331.1| transporter, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF27530.1| Os11g0135900 [Oryza sativa Japonica Group]
 gb|EEC67614.1| hypothetical protein OsI_34998 [Oryza sativa Indica Group]
 gb|EEE51606.1| hypothetical protein OsJ_32870 [Oryza sativa Japonica Group]
Length=490

 Score =   505 bits (1301),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 274/469 (58%), Positives = 343/469 (73%), Gaps = 8/469 (2%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y + C GC  +  K    G+P K   ++ M+ L AALPISSLFPFLYFMIRD H+A+R E
Sbjct  18    YHQGCPGCAYDRKKEVYRGLPYKEFLYLWMICLTAALPISSLFPFLYFMIRDLHVAKRTE  77

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG+VG+SFM GR LTS +WGI ADR GRKPVV+ G   VVIFN +FGLS  YWMA
Sbjct  78    DIGFYAGFVGASFMFGRCLTSTIWGIAADRIGRKPVVVFGIFAVVIFNTLFGLSFTYWMA  137

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TRFLLGAL G++G ++AYA E+CR E+ AL +S VSTAWGIGL+IGPA+GGY +QPAE
Sbjct  138   IATRFLLGALNGLLGPIKAYAIEVCRPEHEALALSLVSTAWGIGLIIGPAIGGYLSQPAE  197

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             K+P +FS +S F +FPYFLPCL IS+FA V  +   W+PET+H HK +      V     
Sbjct  198   KFPNVFSPDSLFARFPYFLPCLCISVFAAVVLIGCIWMPETLHKHKADANRSQTVEALES  257

Query  1004  Q---PEHEVPTS-----QKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGG  1159
                 PE +   +     +KSLL NWPL+SSI++YCVF  HD+AY EIFSLWA S RK GG
Sbjct  258   HLIDPEEKADQNGSLDCKKSLLSNWPLMSSIILYCVFSFHDMAYTEIFSLWAESDRKYGG  317

Query  1160  LSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALL  1339
             LS ++ DVGQVLAITG  LL++QLF YP + KV+G +  SRI A L IP+L  YPY+  L
Sbjct  318   LSLSSEDVGQVLAITGASLLVYQLFIYPRINKVIGHIKASRIAAILCIPILFAYPYMTYL  377

Query  1340  SGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPA  1519
             SG  L+++LN AS++KN L V+I TG  ILQN AV Q+QRGAANG++M+ MS FK + PA
Sbjct  378   SGPGLTIILNIASVIKNNLGVTIITGCFILQNNAVPQDQRGAANGLAMTGMSFFKAVAPA  437

Query  1520  AGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPED  1666
               G + SW+Q RQ A F+PGDQ+VFF+LN+FELLGLI+TFKPFL +P+ 
Sbjct  438   GAGIVFSWAQKRQQASFLPGDQMVFFLLNLFELLGLILTFKPFLAVPQQ  486



>ref|XP_009403837.1| PREDICTED: probable peptide/nitrate transporter At3g43790 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=473

 Score =   505 bits (1300),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 255/471 (54%), Positives = 337/471 (72%), Gaps = 22/471 (5%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             MAE    PLL  SE+   H         E+C GCR +   R   G+P +  F++ +V LC
Sbjct  1     MAE-RAAPLLAPSEEATHH---------ENCPGCRQDRRNRLHLGIPYREFFYVWIVALC  50

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
             +ALPISSL+PFLYFMIRD  IA+REEDI +YAG+VGS+FMLGRA TS+LWG++ADRYGR+
Sbjct  51    SALPISSLYPFLYFMIRDLDIAKREEDIGFYAGFVGSAFMLGRASTSILWGMVADRYGRR  110

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PV++I  + V++FN +FGLS  YWMAI+TR  LG L G++G ++AYASE+CR+EY ALG+
Sbjct  111   PVIMISLLAVIVFNTLFGLSTRYWMAIMTRSFLGFLSGLLGPIQAYASEVCRKEYQALGL  170

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S V T+W +GLV GPA+GG+ AQPAEKYP IFSAE  FG+FPYFLPCL IS+F++ A + 
Sbjct  171   SVVDTSWAMGLVFGPAIGGFLAQPAEKYPNIFSAECLFGRFPYFLPCLCISLFSVGALIA  230

Query  926   SFWLPETMHThkkehkeehDV------SQNSKQPEHEVPTSQK------SLLKNWPLISS  1069
              FWLPET+H H +   E+  +      S  S    +   T Q+      SLLKNW L+SS
Sbjct  231   CFWLPETLHMHGESKVEDEHINVLEALSNGSNLKGYRGETKQRRLFSDQSLLKNWLLMSS  290

Query  1070  ILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLV  1249
             I+VYC+F L   AY EIFSLW+VS +K GGLS+++ +VG VLAI+GI LL++QL  +P +
Sbjct  291   IIVYCIFGLQSTAYSEIFSLWSVSNKKYGGLSFSSQEVGMVLAISGISLLVYQLVLFPHI  350

Query  1250  EKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLIL  1429
             EK LGP+ ++R  AAL IPLL++YP++  LSG  L++ +NCAS L+++ S +IT GL IL
Sbjct  351   EKHLGPINLTRAVAALLIPLLASYPFMTKLSGFILNLSVNCASSLRSIFSSTITVGLNIL  410

Query  1430  QNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGD  1582
             QN AVSQ QRGAANG++++A+SLFK   PA  G L SW+Q  Q    +PG 
Sbjct  411   QNNAVSQHQRGAANGMAVTALSLFKAFAPAGAGILFSWAQNHQGVSILPGK  461



>ref|NP_001065682.1| Os11g0135000 [Oryza sativa Japonica Group]
 gb|ABA91321.2| major facilitator superfamily antiporter, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF27527.1| Os11g0135000 [Oryza sativa Japonica Group]
 gb|EEE51603.1| hypothetical protein OsJ_32858 [Oryza sativa Japonica Group]
Length=470

 Score =   504 bits (1299),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 254/461 (55%), Positives = 342/461 (74%), Gaps = 2/461 (0%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y + C GC +E  K    G+P K   F+++ TL ++LPISSLFPFLYFMIR+ HI+  EE
Sbjct  10    YHDGCPGCAMEQRKEEHKGIPYKEFLFVAITTLASSLPISSLFPFLYFMIRELHISRTEE  69

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG++G+S+M+GR   S+LWG++ADR GRKPV+I     V++ N +FGLSV YWMA
Sbjct  70    DIGFYAGFLGASYMIGRGFASILWGMVADRIGRKPVIIFSIFAVIVLNTLFGLSVKYWMA  129

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             + TRFLLGAL G++  ++AY+ E+CR E+ ALG+S VSTAWGIGLV+GPA+GGY AQP +
Sbjct  130   VTTRFLLGALNGLLAPIKAYSIEVCRAEHQALGLSIVSTAWGIGLVVGPAIGGYLAQPVK  189

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             +YP +F  +S FG+FPY LPCL IS+FAL+  +   WLPET+H HK           ++ 
Sbjct  190   QYPHLFHEKSIFGRFPYLLPCLCISLFALLVLISCIWLPETLHKHKGLETGVEAAEASTT  249

Query  1004  QPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADV  1183
             Q   E  + +KSL +NWPL+SSI+ YCVF LHD AY EIFSLW VS RK GGLS+++ DV
Sbjct  250   QGSAE--SHKKSLFRNWPLMSSIITYCVFSLHDTAYSEIFSLWTVSDRKYGGLSFSSKDV  307

Query  1184  GQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVV  1363
             GQVLA+ G  LL++QLF Y  V+K+LGP+  +RI + LSIP+++ YP++  LSG+ L V 
Sbjct  308   GQVLAVAGASLLVYQLFIYRWVDKILGPINSTRIASVLSIPIIAAYPFMTHLSGIRLGVA  367

Query  1364  LNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSW  1543
             L  A+M+K+VL+++I TG  +LQN+AV Q QRGAANGI+ +AMSLFK + PA  G L SW
Sbjct  368   LYSAAMIKSVLAITIITGTSLLQNKAVPQGQRGAANGIATTAMSLFKAVAPAGAGVLFSW  427

Query  1544  SQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPED  1666
             +Q RQ A F PGDQ+VF +LN+ E++GL++TFKPFL +P+ 
Sbjct  428   AQKRQHAAFFPGDQMVFLLLNLTEVIGLMLTFKPFLAVPQQ  468



>ref|XP_006662714.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Oryza brachyantha]
Length=488

 Score =   505 bits (1300),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 286/496 (58%), Positives = 348/496 (70%), Gaps = 22/496 (4%)
 Frame = +2

Query  209   AEGNTE-PLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             AE   E PLLK     G             C GC  +  K    G+P K   ++ M+ L 
Sbjct  3     AEAEAEVPLLKGENHPG-------------CPGCAYDRKKELYRGLPYKEFLYLWMICLT  49

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
             AALPISSLFPFLYFMIRD H+A+R EDI +YAG+VG+SFM GR LTS  WGI ADR GRK
Sbjct  50    AALPISSLFPFLYFMIRDLHVAKRTEDIGFYAGFVGASFMFGRCLTSTAWGIAADRIGRK  109

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PVV+ G   VVIFN +FGLSV Y MAI TRFLLGAL G++G ++AYA E+CR E+ AL +
Sbjct  110   PVVVFGIFAVVIFNTLFGLSVTYSMAIATRFLLGALNGLLGPIKAYAIEVCRPEHEALAL  169

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S VSTAWGIGL+IGPA+GGY +QPAE +P +FS +S F +FPYFLPCL IS+FA V  V 
Sbjct  170   SLVSTAWGIGLIIGPALGGYLSQPAENFPNVFSPDSLFARFPYFLPCLCISVFAAVVLVG  229

Query  926   SFWLPETMHThkkehkeehDVSQ--------NSKQPEHEVPTSQKSLLKNWPLISSILVY  1081
               W+PET+H HK +      V            K  ++    S+KSLL NWPL+SSI++Y
Sbjct  230   CIWMPETLHKHKADVNRYETVESLESDFIDLKGKAEQNGTLNSKKSLLSNWPLMSSIILY  289

Query  1082  CVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVL  1261
             CVF  HD+AY EIFSLWA S RK GGLS ++ DVGQVLAITG  LL++QLF YP + KVL
Sbjct  290   CVFSFHDMAYTEIFSLWAESDRKYGGLSLSSEDVGQVLAITGASLLVYQLFIYPRINKVL  349

Query  1262  GPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRA  1441
             G +  SRI A   IP+L  YPY+  LSG  +S+VLN AS++KN LSV+I TG  ILQN A
Sbjct  350   GHIKASRIAAIACIPILFAYPYMTYLSGPGVSIVLNIASVIKNNLSVTIITGCFILQNNA  409

Query  1442  VSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfell  1621
             V Q+QRGAANG++M+ MSLFK + PA  G + SW+Q RQDA F+PGDQ+VFF+LNVFE+L
Sbjct  410   VPQDQRGAANGLAMTGMSLFKAVAPAGAGIVFSWAQKRQDASFLPGDQMVFFLLNVFEIL  469

Query  1622  glIMTFKPFLQLPEDD  1669
             GLI+TFKPFL  PE  
Sbjct  470   GLILTFKPFLAFPEQQ  485



>ref|XP_009383252.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=487

 Score =   505 bits (1300),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 278/491 (57%), Positives = 372/491 (76%), Gaps = 24/491 (5%)
 Frame = +2

Query  215   GNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAAL  394
             GN EPLLK+              Y ++C GC+ +    A  G+P K  F++ +VTLC AL
Sbjct  3     GNNEPLLKKK------------VYFDNCPGCKQDRKNEASLGIPYKEFFYVWIVTLCTAL  50

Query  395   PISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvv  574
             PISSLFPFLYFMI+D H+A+REEDI +YAG+VG+SFM+GRALTS+LWG++ADRYGRKPV+
Sbjct  51    PISSLFPFLYFMIKDLHVAKREEDIGFYAGFVGASFMVGRALTSLLWGMVADRYGRKPVI  110

Query  575   iigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAV  754
             ++  ++V+IFN +FGLS +YWM I TR LLG L G+ G ++AY+ E+CR EY ALG + V
Sbjct  111   VLSIISVIIFNTLFGLSTSYWMTITTRLLLGLLNGLSGPIKAYSIEVCREEYQALGATLV  170

Query  755   STAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFW  934
             STAWGIGL++GPA+GGYFAQPAEKYP IFS +SFF +FPYFLPC+ IS+FA+   + S W
Sbjct  171   STAWGIGLIVGPAIGGYFAQPAEKYPEIFSQDSFFARFPYFLPCICISLFAVGVLIASVW  230

Query  935   LPETMH---ThkkehkeehDVSQNSKQPE-------HEVP--TSQKSLLKNWPLISSILV  1078
             LPET+H   + + +     D+     +P+       HE      +++L KNWPL+SSI+V
Sbjct  231   LPETLHKHNSDQVKGVSIEDLETTQYKPDFKGHIGVHEESGLPRKENLFKNWPLMSSIIV  290

Query  1079  YCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKV  1258
             YC+F LHD+AY EIFSLWAVS ++ GGLS++T DVG++LAI+G+GLLLFQ   YP +EK+
Sbjct  291   YCIFSLHDMAYSEIFSLWAVSGKRYGGLSFSTKDVGEILAISGLGLLLFQTLLYPPLEKL  350

Query  1259  LGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNR  1438
             +GP+   R+ A LSIPLL  YP++A +SG+ L +++N AS+LKN  SV+I TGL ILQN 
Sbjct  351   VGPINSLRLAAILSIPLLVAYPFMAKMSGIPLMLIVNLASVLKNTFSVTIVTGLFILQNI  410

Query  1439  AVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfel  1618
             AV+Q+QRGAANGI+++ MS+FK I PAAGG++ SW+Q RQ A F+PGDQ+VFF+LNV E 
Sbjct  411   AVAQDQRGAANGIAVTTMSIFKAIAPAAGGAIFSWAQKRQHASFLPGDQMVFFILNVVEF  470

Query  1619  lglIMTFKPFL  1651
             +GL+++FKPFL
Sbjct  471   IGLLLSFKPFL  481



>gb|EEC68819.1| hypothetical protein OsI_37385 [Oryza sativa Indica Group]
Length=484

 Score =   505 bits (1300),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 272/469 (58%), Positives = 343/469 (73%), Gaps = 8/469 (2%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y + C GC  +  K    G+P K   ++ M+ L AALPISSLFPFLYFMIRD H+A+R E
Sbjct  12    YHQGCPGCAYDRKKEVYRGLPYKEFLYLWMICLTAALPISSLFPFLYFMIRDLHVAKRTE  71

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG+VG+SFM GR LTS +WGI ADR GRKPVV+ G   VVIFN +FGLS  YWMA
Sbjct  72    DIGFYAGFVGASFMFGRCLTSTVWGIAADRIGRKPVVVFGIFAVVIFNTLFGLSFTYWMA  131

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TRFLLGAL G++G ++AYA E+CR E+ AL +S VSTAWGIGL+IGPA+GGY +QPAE
Sbjct  132   IATRFLLGALNGLLGPIKAYAIEVCRPEHEALALSLVSTAWGIGLIIGPAIGGYLSQPAE  191

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQ---  994
             K+P +FS +S F +FPYFLPCL IS+FA V  +   W+PET+H HK +      V     
Sbjct  192   KFPNVFSPDSLFARFPYFLPCLCISVFAAVVLIGCIWMPETLHKHKADASRSQTVEALES  251

Query  995   -----NSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGG  1159
                    K  ++     +KSLL+NWPL+SSI++YCVF  HD+AY EIFSLWA S RK GG
Sbjct  252   HLIDPKEKADQNGSLDCKKSLLRNWPLMSSIILYCVFSFHDMAYTEIFSLWAESDRKYGG  311

Query  1160  LSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALL  1339
             LS ++ DVGQVLAITG+ LL++QLF YP + KV+G +  SRI A L IP+L  YPY+  L
Sbjct  312   LSLSSEDVGQVLAITGVSLLVYQLFIYPRINKVIGHIKASRIAAILCIPILFAYPYMTYL  371

Query  1340  SGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPA  1519
              G  L+++LN AS++KN L V+I TG  ILQN AV Q+QRGAANG++M+ MS FK + PA
Sbjct  372   LGPGLTIILNIASVIKNNLGVTIITGCFILQNNAVPQDQRGAANGLAMTGMSFFKAVAPA  431

Query  1520  AGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPED  1666
               G + SW+Q RQ A F+PGDQ+VFF+LN+FELLGLI+T+KPFL +PE 
Sbjct  432   GAGIVFSWAQKRQHASFLPGDQMVFFLLNLFELLGLILTYKPFLAVPEQ  480



>ref|XP_004977469.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X4 [Setaria italica]
Length=488

 Score =   504 bits (1299),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 281/495 (57%), Positives = 349/495 (71%), Gaps = 19/495 (4%)
 Frame = +2

Query  206   MAEGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLC  385
             M E  T PLL+  E+           Y   C GC  +  K    G+P K   ++ M++L 
Sbjct  1     MGEEATSPLLRVKEE-----------YHPGCPGCAYDRRKDLLRGMPYKEFLYVWMISLT  49

Query  386   AALPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRK  565
             AALPISSLFPFLYFMIRD ++A+R EDI +YAG+VG+SFM GR LTS  WGI ADR GRK
Sbjct  50    AALPISSLFPFLYFMIRDLNVAKRTEDIGFYAGFVGASFMFGRCLTSTAWGIAADRIGRK  109

Query  566   PvviigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGI  745
             PVVI G  +VV+FN +FGLSV YWMAI TRFLLGAL G++G ++AYA E+CR E+ AL +
Sbjct  110   PVVIFGIFSVVVFNTLFGLSVTYWMAIATRFLLGALNGLLGPIKAYAIEVCRPEHEALAL  169

Query  746   SAVSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVM  925
             S VSTAWGIGL+IGPA+GGY A PAE +P +FS ES FG+FPYFLPCL  S+FA    + 
Sbjct  170   SLVSTAWGIGLIIGPALGGYLALPAENFPNVFSPESLFGRFPYFLPCLCTSVFAAAVLIS  229

Query  926   SFWLPETMHThkkehkeehDVSQNSKQ---PEHEVPTS-----QKSLLKNWPLISSILVY  1081
               W+PET+H HK    E   +         P+ +V  S     +KSL KNWPL+SSI++Y
Sbjct  230   CIWMPETLHKHKGSENENQSIEALEAHLIDPKEKVEESGSLNTKKSLFKNWPLMSSIVIY  289

Query  1082  CVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVL  1261
             C+F  HD+AY E+FSLWA S +K GGLS ++ DVGQVLA+TG  LL++QLF YP + KVL
Sbjct  290   CIFSFHDMAYTEVFSLWAESDKKYGGLSLSSEDVGQVLAVTGASLLVYQLFLYPRINKVL  349

Query  1262  GPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRA  1441
             GP+  SRI A L IP+L  YPY+  LS   LS+VLN AS++KN L+V+I TG  ILQN A
Sbjct  350   GPINSSRIAAILCIPILFAYPYMTYLSEPGLSIVLNVASVIKNNLAVTIITGTFILQNNA  409

Query  1442  VSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfell  1621
             V Q+QRGAANG+SM+ MS FK + PA  G + SW+Q RQ   F PGDQ+VFF+LNV ELL
Sbjct  410   VPQDQRGAANGLSMTGMSFFKAVAPAGAGIVFSWAQKRQHGFFFPGDQMVFFLLNVIELL  469

Query  1622  glIMTFKPFLQLPED  1666
             GLI+TFKPFL +PE 
Sbjct  470   GLILTFKPFLAVPEQ  484



>gb|AFK38823.1| unknown [Lotus japonicus]
Length=486

 Score =   504 bits (1299),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 267/468 (57%), Positives = 352/468 (75%), Gaps = 7/468 (1%)
 Frame = +2

Query  263   LEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDF  442
             LE +Y+   + C GC+V+  K    G  + ++  I M+ +CA+LPIS L+PFLYFM++DF
Sbjct  11    LEKKYY---KDCPGCKVDQAKELKKGASVLNLLIIWMLMICASLPISCLYPFLYFMVKDF  67

Query  443   HIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGL  622
             ++A+ E DIS YAGYVGS+ MLGRALTSV WG+ +DRYGRKP +I+G ++V+IFN +FGL
Sbjct  68    NVAKTEADISTYAGYVGSTLMLGRALTSVGWGLFSDRYGRKPALIVGVMSVIIFNTLFGL  127

Query  623   SVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGG  802
             S N+WMAIITRFLLG   GIIG ++AYA+E+ R E  A+G+S VS AW IGL+IGPA+GG
Sbjct  128   STNFWMAIITRFLLGCGNGIIGPVKAYATELFREEDQAIGLSTVSAAWAIGLIIGPALGG  187

Query  803   YFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeeh  982
             Y AQP  KYP IF   SF+ KFPYFLPC IIS  A    +   W+PET+H HK  ++   
Sbjct  188   YLAQPVMKYPHIFPKGSFWDKFPYFLPCFIISGLAFPVLIACIWIPETLHNHKGGNECTD  247

Query  983   DVS--QNSKQPEHEVPTSQK--SLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRK  1150
             +    +N     ++  T+QK  +LLKNWPL+SSI+VYC+F LHD+AY E+FSLWAVSP  
Sbjct  248   EAEALENGSNRVNKGKTTQKNENLLKNWPLMSSIIVYCIFSLHDMAYTEVFSLWAVSPPS  307

Query  1151  LGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYI  1330
             LGGL++TT +VG VLAI+G+ L+++QL  YP VE+  GP+ ISRI   LSIPLL +YP+I
Sbjct  308   LGGLNFTTDNVGNVLAISGLLLIIYQLILYPYVERACGPIRISRITGMLSIPLLQSYPFI  367

Query  1331  ALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTI  1510
             A+LSG+ L +V++ AS+LKN+LS++I TGL ILQNRAV Q QRGAANGIS++ +SLFK I
Sbjct  368   AMLSGVTLYIVISLASILKNILSMTIITGLFILQNRAVKQNQRGAANGISVTCVSLFKAI  427

Query  1511  GPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQ  1654
             GP  GG+LL+WSQ R  A F+PG  ++FF++N+ E LGL+M FKPFL 
Sbjct  428   GPVVGGALLTWSQKRMHASFLPGTHMIFFIMNLVEGLGLLMMFKPFLN  475



>gb|KCW65123.1| hypothetical protein EUGRSUZ_G02629 [Eucalyptus grandis]
Length=455

 Score =   502 bits (1292),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 275/417 (66%), Positives = 336/417 (81%), Gaps = 10/417 (2%)
 Frame = +2

Query  431   IRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNA  610
             IRDFHIA+REEDI YYAGYVGSSFM GRALTSV WGI+ADRYGRKPV+I+GT+ VVIFN 
Sbjct  35    IRDFHIAKREEDIGYYAGYVGSSFMFGRALTSVFWGIVADRYGRKPVIIMGTIAVVIFNT  94

Query  611   VFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGP  790
             +FGLSVN+WMAI  RFLLG+L G++G ++AYA+EI R EY ALG+S VSTAWGIGL+IGP
Sbjct  95    LFGLSVNFWMAIAMRFLLGSLNGLLGPIKAYATEIFREEYQALGVSTVSTAWGIGLIIGP  154

Query  791   AVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkeh  970
             A+GGY AQPAEK+P+IF  ES FG+FPYFLPCL IS+FALV T+ + WLPET+H H K  
Sbjct  155   ALGGYLAQPAEKFPSIFPKESVFGRFPYFLPCLAISVFALVVTIATCWLPETLHKHHKSS  214

Query  971   keeh---DVSQ-------NSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEI  1120
             K +    DV           K  + E    +KSL +NWPL+SSI+VYCVF LHD+AY EI
Sbjct  215   KFDAACEDVETAPLMSGTKYKTQKAEGKAPKKSLFRNWPLMSSIIVYCVFSLHDMAYTEI  274

Query  1121  FSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALS  1300
             FSLWAVSPR+ GGLSYTT DVG VLAI+G GLL+FQ   YP   ++LGPV+++R+   L+
Sbjct  275   FSLWAVSPRRYGGLSYTTEDVGNVLAISGAGLLIFQTCLYPYFNRLLGPVVVARLNGVLA  334

Query  1301  IPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGIS  1480
             IPLLS+YP+IA+L+GL LS+VLNC S+ KNVLS SI T L +LQN+AV Q+QRGAANGI+
Sbjct  335   IPLLSSYPFIAMLTGLSLSIVLNCTSVAKNVLSTSIITSLFLLQNKAVDQDQRGAANGIA  394

Query  1481  MSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
             M+AMSLFK  GPA GG++ SW+Q RQDA F+PG+ +VFF+LNV E +G++MTFKPFL
Sbjct  395   MTAMSLFKAAGPAGGGAIFSWAQKRQDAAFLPGNHMVFFILNVVEAIGVLMTFKPFL  451



>ref|XP_008674224.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Zea 
mays]
Length=476

 Score =   502 bits (1293),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 249/461 (54%), Positives = 339/461 (74%), Gaps = 1/461 (0%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y + C GC ++  K A+ G+P K  FF+++ T+ +ALPISSLFPFLYFMI D H+A++E+
Sbjct  15    YVDGCPGCAMDRKKAANKGIPYKEFFFVAVTTIASALPISSLFPFLYFMIEDLHVAKKEQ  74

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI  YAG++G+S+ +GR L S  WG++ADR GRKP++I    +VV+FN +FGLSV YWMA
Sbjct  75    DIGLYAGFLGASYFVGRFLVSFFWGVVADRVGRKPIIIFSVASVVVFNTLFGLSVQYWMA  134

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TR LLGAL G++  ++AY+ EICR E+HALG+S VSTAWG+GL++GP++GGY AQPA 
Sbjct  135   ITTRLLLGALNGMLAPIKAYSIEICRPEHHALGLSVVSTAWGLGLIVGPSIGGYLAQPAR  194

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             +YP +FS ES FG+FPY LPCL IS+F+ V  V   WLPET+H   K    E ++S +S+
Sbjct  195   QYPNVFSEESIFGRFPYLLPCLSISIFSAVVLVSCIWLPETLHK-HKNIDNEVEMSGHSR  253

Query  1004  QPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADV  1183
              P+ E   + KSL KNWPL+SSI+ YCVF LHD AY EI SLW VS +K GGL +++  V
Sbjct  254   TPQTEDVDAGKSLYKNWPLMSSIIAYCVFTLHDTAYTEILSLWTVSDKKYGGLGFSSKGV  313

Query  1184  GQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVV  1363
             GQ+LAI G+GL+++Q+F Y  V + LG V   R  +ALSIPL++ +P++  LSG  L + 
Sbjct  314   GQLLAIAGLGLIVYQMFIYRPVHRYLGSVNSCRAASALSIPLIAAFPFMTHLSGSKLGLA  373

Query  1364  LNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSW  1543
             L  A++LK  L ++I TG  +LQN AV Q QRGAANG++ +AMS FK IGPA  G+L SW
Sbjct  374   LYFATILKAALGITILTGTSLLQNYAVPQHQRGAANGVAATAMSFFKAIGPAGAGALFSW  433

Query  1544  SQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPED  1666
             +Q RQDA F PGD ++FF+LN+ + +GL++T KPFL +P+ 
Sbjct  434   TQKRQDAAFFPGDHMLFFILNLVQCIGLVLTLKPFLAVPKH  474



>gb|KDO47761.1| hypothetical protein CISIN_1g011424mg [Citrus sinensis]
Length=432

 Score =   500 bits (1288),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 261/421 (62%), Positives = 328/421 (78%), Gaps = 20/421 (5%)
 Frame = +2

Query  212   EGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAA  391
             E   EP LK  ++           Y E+C GC+V+ LK   +G+PI  +F I ++ LC A
Sbjct  6     EKLREPFLKNEKR-----------YYENCPGCKVDQLKDTKSGLPITELFSIWIIVLCTA  54

Query  392   LPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPv  571
             LPISSLFPFLYFMI+DF IA+REEDI  YAGYVGSSFM GRALTSV WG++ADRYGRKPV
Sbjct  55    LPISSLFPFLYFMIKDFQIAKREEDIGSYAGYVGSSFMFGRALTSVFWGLVADRYGRKPV  114

Query  572   viigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISA  751
             +I+GT +VVIFN +FGLSVN+WMA++TRFLLG+L G++G ++AYA EI R E+ ALG+S 
Sbjct  115   IIMGTASVVIFNTLFGLSVNFWMAVLTRFLLGSLNGLLGPIKAYACEIFREEHQALGLST  174

Query  752   VSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSF  931
             VSTAWGIGL+IGPA+GG+ AQPAEKYP +FS+ES FGKFPYFLPCL IS+FA   T+ +F
Sbjct  175   VSTAWGIGLIIGPALGGFLAQPAEKYPNLFSSESLFGKFPYFLPCLCISLFAFGVTIAAF  234

Query  932   WLPETMHThkkehkeehDVSQNS--------KQPEHEVPTSQKSLLKNWPLISSILVYCV  1087
             WLPET+H    +  +  DVS ++        K+ E    T +KSLLKNWPL+SSI+VYCV
Sbjct  235   WLPETLHR-HNDDDDSCDVSYDALESASAEVKEEEGREATPKKSLLKNWPLMSSIIVYCV  293

Query  1088  FQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGP  1267
             F LHD+AY EIFSLWA SP+KLGGL+Y+T  VG+VLAITG  LL+FQL  YP +E++LGP
Sbjct  294   FSLHDMAYSEIFSLWANSPKKLGGLNYSTQMVGEVLAITGFSLLVFQLSLYPFLERILGP  353

Query  1268  VMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVS  1447
             +M++RI   L+IPLL++YPYIA+LSG  L+ +LNCAS++KN+LSVSI TGL ILQNRAV 
Sbjct  354   IMVARIAGVLTIPLLTSYPYIAMLSGFGLAFLLNCASVVKNLLSVSIITGLFILQNRAVV  413

Query  1448  Q  1450
             +
Sbjct  414   R  414



>gb|AFO67942.1| YS3 [Zea mays]
Length=476

 Score =   501 bits (1291),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 248/461 (54%), Positives = 339/461 (74%), Gaps = 1/461 (0%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y + C GC ++  K A+ G+P K  FF+++ T+ +ALPISSLFPFLYFMI D H+A++E+
Sbjct  15    YVDGCPGCAMDRKKAANKGIPYKEFFFVAVTTIASALPISSLFPFLYFMIEDLHVAKKEQ  74

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI  YAG++G+S+ +GR L S  WG++ADR GRKP++I    +VV+FN +FGLSV YWMA
Sbjct  75    DIGLYAGFLGASYFVGRFLVSFFWGVVADRVGRKPIIIFSVASVVVFNTLFGLSVQYWMA  134

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TR LLGAL G++  ++AY+ EICR E+HALG+S VSTAWG+GL++GP++GGY AQPA 
Sbjct  135   ITTRLLLGALNGMLAPIKAYSIEICRPEHHALGLSVVSTAWGLGLIVGPSIGGYLAQPAR  194

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             +YP +FS ES FG+FPY LPCL IS+F+ V  V   WLPET+H   K  + E ++S +S+
Sbjct  195   QYPNVFSEESIFGRFPYLLPCLSISIFSAVVLVSCIWLPETLHK-HKNIENEVEMSGHSR  253

Query  1004  QPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADV  1183
              P+ E   + KSL KNWPL+SSI+ YCVF LHD AY EI SLW VS +K GGL +++  V
Sbjct  254   TPQTEDVDAGKSLYKNWPLMSSIIAYCVFTLHDTAYTEILSLWTVSDKKYGGLGFSSKGV  313

Query  1184  GQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVV  1363
             GQ+LAI G+GL+++Q+F Y  V + LG V   R  +ALSIPL++ +P++  LSG  L + 
Sbjct  314   GQLLAIAGLGLIVYQMFIYRPVHRYLGSVNSCRAASALSIPLIAAFPFMTHLSGSKLGLA  373

Query  1364  LNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSW  1543
             L  A++LK  L ++I TG  +LQN AV Q QRGAANG++ +AMS FK IGPA  G+L SW
Sbjct  374   LYFATILKAALGITILTGTSLLQNYAVPQHQRGAANGVAATAMSFFKAIGPAGAGALFSW  433

Query  1544  SQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPED  1666
             +Q RQD  F PGD ++FF+LN+ + +GL++T KPFL +P+ 
Sbjct  434   TQKRQDVAFFPGDHMLFFILNLVQFIGLVLTLKPFLAVPKH  474



>ref|XP_004960719.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Setaria italica]
Length=487

 Score =   501 bits (1291),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 250/465 (54%), Positives = 341/465 (73%), Gaps = 0/465 (0%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y   C GC +E  K ++ G+P K +F++++ T+ +ALPISSLFPFLY+MI D H+A+ E+
Sbjct  23    YVYGCPGCAIERKKESNKGIPYKELFYVAITTIASALPISSLFPFLYYMIEDLHVAKTEQ  82

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI  YAG++G+S+ +GR L+S+ WG++ADR GRKP+++   ++VVIFN +FG+S  YWMA
Sbjct  83    DIGLYAGFLGASYFVGRFLSSLFWGLVADRIGRKPIIVFSVLSVVIFNTLFGVSTKYWMA  142

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TR +LGAL G++  ++AY+ EICR E+HALG+S VSTAWGIGLV+GP++GGY A+PA+
Sbjct  143   ITTRLVLGALNGMLAPIKAYSIEICRPEHHALGLSVVSTAWGIGLVVGPSIGGYLARPAQ  202

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             +YP IFS  S FG+FPY LPCL IS+FA V  V   WLPET+H HK     E ++S + +
Sbjct  203   QYPNIFSDNSIFGRFPYLLPCLCISLFAAVVLVSCIWLPETLHKHKNIGSNEIEMSSDPR  262

Query  1004  QPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADV  1183
              P+       KSL KNWPL+SSI+ YCVF +HD AY EI SLW +S RK GGLS+++ +V
Sbjct  263   TPQTTDTHGGKSLYKNWPLMSSIIAYCVFTVHDTAYSEILSLWTISDRKYGGLSFSSKEV  322

Query  1184  GQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVV  1363
             GQ+LA+ G GL+++QLF Y  + K +G V   R  +ALSIPLL+ +P++  LSG  L + 
Sbjct  323   GQLLAVAGAGLMVYQLFIYRPLHKFMGCVNSCRASSALSIPLLAVFPFMTHLSGYRLGLA  382

Query  1364  LNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSW  1543
             L  A+++K  L ++I TG  +LQN AV Q QRGAANGI+ +AMS FK IGPA  G+L SW
Sbjct  383   LYFATIVKAALGITILTGTSLLQNYAVPQSQRGAANGIATTAMSFFKAIGPAGAGALFSW  442

Query  1544  SQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPEDDILK  1678
             +Q RQ A F PGDQ++F VLNV + +GL+MTFKPFL +P+   LK
Sbjct  443   TQKRQHAAFFPGDQMLFLVLNVVQCIGLVMTFKPFLAVPQHYDLK  487



>tpg|DAA39260.1| TPA: carbohydrate transporter/ sugar porter/ transporter [Zea 
mays]
Length=492

 Score =   502 bits (1292),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 274/491 (56%), Positives = 354/491 (72%), Gaps = 16/491 (3%)
 Frame = +2

Query  215   GNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAAL  394
             G T PLL +  Q           Y   C GC  +  K    G+P K   ++ ++ L  +L
Sbjct  6     GVTSPLLLRQGQEK--------VYHPGCPGCANDRRKELQEGLPYKEFLYVWIICLATSL  57

Query  395   PISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvv  574
             P+SSLFPFLYFMIRD H+A+R EDI +YAG+VG+SFMLGR LTS +WG+ ADR+GRKPV 
Sbjct  58    PVSSLFPFLYFMIRDLHVAKRTEDIGFYAGFVGASFMLGRCLTSTVWGMAADRFGRKPVA  117

Query  575   iigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAV  754
             I+G  +VVIFN +FGLS +YWMAI TRFLLGAL G++G ++AY+ E+CR E+ ALGIS V
Sbjct  118   ILGVFSVVIFNTLFGLSTSYWMAIATRFLLGALNGLLGPIKAYSIEVCRPEHEALGISLV  177

Query  755   STAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFW  934
              TAWGIGL+IGPA+GGY AQPAEK+P +FS +SFFG+FPYFLPCL  S+FA V  V+  W
Sbjct  178   GTAWGIGLIIGPALGGYLAQPAEKFPDLFSPDSFFGRFPYFLPCLCSSLFAAVVLVICIW  237

Query  935   LPETMHThkkehkeehDVS------QNSKQPEHEVPT--SQKSLLKNWPLISSILVYCVF  1090
             +PET+H HK  H E  +         + K  + ++P+   +KSLLKNWP +SS++ YCVF
Sbjct  238   MPETLHKHKARHDENKNDEALEAHQSDYKDKDEQIPSLDDKKSLLKNWPFMSSLITYCVF  297

Query  1091  QLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPV  1270
               HD+AY E+FSLWA S RK GGLS ++ DVGQVL++TG+ LL++QL  YP   K+LGP+
Sbjct  298   SFHDMAYSEVFSLWAESDRKYGGLSLSSEDVGQVLSVTGVSLLIYQLSVYPRTNKILGPI  357

Query  1271  MISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQ  1450
               SR+ A L + +L  YPY+  LSG  LSVVLN AS+LK  L+ +I +   ILQN AV Q
Sbjct  358   KTSRVAAVLCMLILLGYPYMTHLSGTALSVVLNIASILKINLASTIISSSFILQNNAVPQ  417

Query  1451  EQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglI  1630
             +QRGAANG+S++ MSLFK+I PAA G++ SW+Q RQ A F PGDQ+VFF+LN  ELLGL+
Sbjct  418   DQRGAANGLSVTVMSLFKSIAPAAAGTVFSWAQERQHAFFFPGDQMVFFLLNAIELLGLV  477

Query  1631  MTFKPFLQLPE  1663
             +TFKPF+  PE
Sbjct  478   LTFKPFMAAPE  488



>ref|XP_006293241.1| hypothetical protein CARUB_v10019572mg, partial [Capsella rubella]
 gb|EOA26139.1| hypothetical protein CARUB_v10019572mg, partial [Capsella rubella]
Length=451

 Score =   499 bits (1285),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 258/435 (59%), Positives = 337/435 (77%), Gaps = 3/435 (1%)
 Frame = +2

Query  287   DESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREED  466
             +E+C GC ++  KR   GVP  H+ FI +V+LC ALPISSLFP+LYFMIRDF IA++EED
Sbjct  15    NEACPGCIIDQTKRQQQGVPYLHLSFIWLVSLCTALPISSLFPYLYFMIRDFGIAKQEED  74

Query  467   ISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMAI  646
             I +YAG+VGSSFM+GRALTS+ WG +ADRYGRKP+++IGT +V+IFN +FGLS ++W+A+
Sbjct  75    IGFYAGFVGSSFMIGRALTSIFWGKLADRYGRKPIILIGTFSVIIFNTLFGLSTSFWLAV  134

Query  647   ITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAEK  826
               RFLLG    ++G +RAYASE+   EY+AL +S VST+ GIGL++GPA+GGY AQPAEK
Sbjct  135   SFRFLLGCFNCLLGVIRAYASEVVSEEYNALSLSVVSTSRGIGLILGPAIGGYLAQPAEK  194

Query  827   YPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHTh--kkehkeehDVSQNS  1000
             YP IFS  S FG+ PYFLP L+IS++A    +  +WLPET+HT       +   D S+  
Sbjct  195   YPNIFSQSSIFGRLPYFLPSLVISVYATGVFIACWWLPETLHTRCGIARGRLNDDESRGE  254

Query  1001  KQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTAD  1180
                + ++  S+ SLL+N PL++ I+VYCVF L +IAY EIFSLWAVS R  GGLS+++ D
Sbjct  255   GLDDQKI-ISKPSLLRNLPLMAIIIVYCVFSLQEIAYSEIFSLWAVSDRSYGGLSFSSQD  313

Query  1181  VGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSV  1360
             VGQVLAI+G+GLLLFQL  YP ++K LG +++ R+ A L IPLLS YPYIALLSG+ L +
Sbjct  314   VGQVLAISGLGLLLFQLLVYPPLKKALGLLVLIRLSAVLLIPLLSCYPYIALLSGMTLHL  373

Query  1361  VLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLS  1540
             V+NCAS+LKN LS+S+ TGL I+ N+AV Q QRGAANGISM+AMS+FK+ GPA GG+L S
Sbjct  374   VINCASILKNALSISLVTGLFIMLNKAVPQNQRGAANGISMTAMSVFKSFGPAGGGALFS  433

Query  1541  WSQLRQDAKFMPGDQ  1585
             W+Q RQDA F+PG+ 
Sbjct  434   WAQKRQDASFLPGEN  448



>ref|XP_008676450.1| PREDICTED: uncharacterized protein LOC100191783 isoform X1 [Zea 
mays]
 gb|AFW64731.1| hypothetical protein ZEAMMB73_729659 [Zea mays]
Length=506

 Score =   501 bits (1289),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 273/475 (57%), Positives = 344/475 (72%), Gaps = 17/475 (4%)
 Frame = +2

Query  284   YDESCAGCRVE------LLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFH  445
             +   C GC  +      LL+RA    P +   +I +++L AALPISSLFPFLYFMIRD +
Sbjct  31    HRPECPGCVFDRRKDDLLLRRAK---PYREFLYIWIISLTAALPISSLFPFLYFMIRDLN  87

Query  446   IAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLS  625
             +A+R EDI +YAG+VG+SFM GR LTS +WGI ADR GRKPVV+ G  +VV+FN +FGLS
Sbjct  88    VAKRTEDIGFYAGFVGASFMFGRCLTSTVWGIAADRVGRKPVVVFGISSVVVFNTLFGLS  147

Query  626   VNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGY  805
             VNYWMAI TRFLLGAL G++G ++AYA E+CR E+ AL +S VSTAWGIGL+IGPA+GGY
Sbjct  148   VNYWMAIATRFLLGALNGLLGPIKAYAIEVCRPEHEALALSLVSTAWGIGLIIGPALGGY  207

Query  806   FAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehD  985
              A PAE +PT+FS +S FG+FPYFLPCL  S+FA V  +   W+PET+H HK       +
Sbjct  208   LALPAENFPTVFSPDSIFGRFPYFLPCLCTSIFAAVVLISCIWMPETLHKHKVHENRSRN  267

Query  986   --------VSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVS  1141
                     +  N K  E     S+KSL +NWPL+SSI+VYCVF  HD+AY E+FSLWA S
Sbjct  268   IEALEARLIDSNEKVEESGSLDSKKSLFRNWPLMSSIIVYCVFSFHDMAYTEVFSLWAES  327

Query  1142  PRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTY  1321
              +K GGLS ++ DVGQVLA+TG  LL++QLF YP + KVLGP+  SR+ A L IP+L  Y
Sbjct  328   DKKYGGLSLSSEDVGQVLAVTGASLLVYQLFLYPSINKVLGPIKSSRVAAILCIPILFAY  387

Query  1322  PYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLF  1501
             PY+  LS   LS+VLN AS++KN L V+I TG  ILQN AV Q+QRGAANG+SM+ MS F
Sbjct  388   PYMTYLSEPGLSIVLNIASVIKNNLGVTIITGTFILQNNAVPQDQRGAANGLSMTGMSFF  447

Query  1502  KTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPED  1666
             K + PA  G + SW+Q RQ A F PGDQ+VFF+LN  EL+GL++TFKPFL +PE 
Sbjct  448   KALAPAGAGIVFSWAQKRQHAFFFPGDQMVFFLLNAVELVGLLLTFKPFLAVPEQ  502



>ref|XP_004308184.1| PREDICTED: LOW QUALITY PROTEIN: protein ZINC INDUCED FACILITATOR-LIKE 
1-like [Fragaria vesca subsp. vesca]
Length=450

 Score =   498 bits (1283),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 284/496 (57%), Positives = 350/496 (71%), Gaps = 65/496 (13%)
 Frame = +2

Query  212   EGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAA  391
             E N E LLK+              Y E+C GC+VE  K    GVP++ +  I M+ L +A
Sbjct  6     EENRENLLKK-------------VYYENCPGCKVEEEKALQRGVPVRKLMAIWMIVLSSA  52

Query  392   LPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPv  571
             LPISSLFPFLYFMIRDFHIA+REEDI +YAGYVGSS+MLGRALTSV WGI+ADRYGRKPV
Sbjct  53    LPISSLFPFLYFMIRDFHIAKREEDIGFYAGYVGSSYMLGRALTSVFWGIVADRYGRKPV  112

Query  572   viigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISA  751
             +IIGT+ VV+FN +FGLSVN+WMAI TRFLLG+L G+ G ++AYASE+ R E+ ALG+S 
Sbjct  113   IIIGTIAVVVFNTLFGLSVNFWMAIATRFLLGSLNGLFGPIKAYASEVFREEHQALGMST  172

Query  752   VSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSF  931
             VSTAWGIGL+IGPA+GG+FAQPAEKYPTIF   S FG+FPYFLPCL IS+          
Sbjct  173   VSTAWGIGLIIGPALGGFFAQPAEKYPTIFPQXSIFGRFPYFLPCLCISI----------  222

Query  932   WLPETMHThkkehkeehDVSQ-----------NSKQPEHEVPTSQKSLLKNWPLISSILV  1078
                ET+H H +  +   D  +           N  +P+ E    +++L+KNWPLISSI+V
Sbjct  223   ---ETLHNHNENARLHDDSFEALESSSCGSVANEMKPKTEEQIPKENLMKNWPLISSIIV  279

Query  1079  YCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKV  1258
             YCVF LHD+AY E+                            G+GL +FQ   YP VEK+
Sbjct  280   YCVFSLHDMAYSEV----------------------------GLGLFVFQTTLYPSVEKM  311

Query  1259  LGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNR  1438
             LGP+ I+RIG  L+IPLLS+YP+IALLSGL LSV+LN AS+LKNV+S+ I TGL ILQNR
Sbjct  312   LGPIRIARIGGVLTIPLLSSYPFIALLSGLSLSVLLNIASLLKNVISIMIVTGLFILQNR  371

Query  1439  AVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfel  1618
             AV Q QRGAANGISM+AMSLFK  GPA GG++ SW+Q R DA  +PG Q+VFF+LN+ EL
Sbjct  372   AVDQRQRGAANGISMTAMSLFKAFGPAGGGAVFSWAQKRLDASILPGIQMVFFILNLVEL  431

Query  1619  lglIMTFKPFLQLPED  1666
             L ++MTFKPFL + +D
Sbjct  432   LAVLMTFKPFLTVRDD  447



>ref|XP_003598370.1| Membrane protein, putative [Medicago truncatula]
 gb|AES68621.1| zinc induced facilitator-like protein [Medicago truncatula]
Length=481

 Score =   499 bits (1286),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 261/464 (56%), Positives = 351/464 (76%), Gaps = 3/464 (1%)
 Frame = +2

Query  263   LEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDF  442
             L+ +Y  Y E+C GC+V+  K     V  ++ F I +V LC++LPI+SLFP+LYFM++DF
Sbjct  9     LKKQY--YHENCPGCKVDQAKALKKDVTFRNAFNIWIVVLCSSLPIASLFPYLYFMVKDF  66

Query  443   HIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGL  622
             +IA+ EEDIS YAGYVGS++MLGRA TS+LWG+IADRYGRKPVVIIG ++V+IFN +FGL
Sbjct  67    NIAKTEEDISSYAGYVGSAYMLGRASTSILWGMIADRYGRKPVVIIGIISVIIFNTLFGL  126

Query  623   SVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGG  802
               ++WMA+  RF+LG L G++G M+AY+SEI R EY ALG S V+ AWG+GLV GPA+GG
Sbjct  127   CTSFWMAVTMRFVLGGLNGLLGPMKAYSSEIFREEYQALGQSTVAAAWGVGLVFGPALGG  186

Query  803   YFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeeh  982
             Y AQP +KYP IF  +SF+ KFPYFLPC I+S  A V  +   WLPET+H HK    +  
Sbjct  187   YLAQPVQKYPNIFPKDSFWDKFPYFLPCFIVSAMAFVVAISCIWLPETLHNHKVSTNKIE  246

Query  983   DVSQNSKQPE-HEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGG  1159
              +   + + E ++     +SLLKNWPL+SSI+VYCVF +HD+A+ EIFSLWA SPR+LGG
Sbjct  247   ALENGTNEDEKNKTIQKDESLLKNWPLMSSIIVYCVFAIHDVAFAEIFSLWAESPRRLGG  306

Query  1160  LSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALL  1339
             L++ T DVG +LA++G+G+++FQL  Y  V+K+ GP++++RI   LSIP+L ++P++ +L
Sbjct  307   LNFGTNDVGNILAVSGVGIIMFQLGLYQSVQKICGPIVLARIAGVLSIPILQSFPFMTML  366

Query  1340  SGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPA  1519
             SG  L + +  AS+LKN+L   I+TGL ILQN+AV Q QRG ANG+ ++AMS  K IGPA
Sbjct  367   SGFTLYISIYSASILKNLLIEIISTGLFILQNKAVDQHQRGVANGLCITAMSACKVIGPA  426

Query  1520  AGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFL  1651
              GG++L+WSQ R DA F+PG  LVFFVLNV E L L++TFKPFL
Sbjct  427   GGGAILTWSQKRMDASFLPGPHLVFFVLNVIEGLALLLTFKPFL  470



>tpd|FAA01135.1| TPA: efflux transporter of phytosiderophore (mugineic acids) 
[Zea mays]
Length=476

 Score =   499 bits (1284),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 249/461 (54%), Positives = 337/461 (73%), Gaps = 1/461 (0%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y + C GC ++  K A+ G+P K  FF+++ T+ +ALPISSLFPFLYFMI D H+A++E+
Sbjct  15    YVDGCPGCAMDRKKAANKGIPYKEFFFVAVTTIASALPISSLFPFLYFMIEDLHVAKKEQ  74

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI  YAG++G+S+ +GR L S  WG++ADR GRKP++I    +VV+FN +FGLSV YWMA
Sbjct  75    DIGLYAGFLGASYFVGRFLVSFFWGVVADRVGRKPIIIFSVASVVVFNTLFGLSVQYWMA  134

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TR LLGAL G++  ++AY+ EICR E+HALG+S VSTAWG+GL++GP +GGY AQPA 
Sbjct  135   ITTRLLLGALNGMLAPIKAYSIEICRPEHHALGLSVVSTAWGLGLIVGPYIGGYLAQPAR  194

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             +YP +FS ES FG+FPY LPCL IS+F+ V  V   WLPET+H   K  + E  +S +S+
Sbjct  195   QYPNVFSEESIFGRFPYLLPCLSISIFSAVVLVSCIWLPETLHK-HKNIENEVGMSGHSR  253

Query  1004  QPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADV  1183
              P+ E   + KSL KNWPL+SSI+ YCVF LHD AY EI SLW VS +K GGL +++  V
Sbjct  254   TPQTEDVDAGKSLYKNWPLMSSIIAYCVFTLHDTAYTEILSLWTVSDKKYGGLGFSSKGV  313

Query  1184  GQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVV  1363
             GQ+LAI G+GL+++Q+F Y  V + LG V   R  +ALSIPL++ +P++  LSG  L + 
Sbjct  314   GQLLAIAGLGLIVYQMFIYRPVHRYLGSVNSCRAASALSIPLIAAFPFMTHLSGSKLGLA  373

Query  1364  LNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSW  1543
             L  A++LK  L ++I TG  +LQN AV Q QRGAANG++ +AMS FK IGPA  G+L SW
Sbjct  374   LYFATILKAALGITILTGTSLLQNYAVPQHQRGAANGVAATAMSFFKAIGPAGAGALFSW  433

Query  1544  SQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPED  1666
             +Q RQDA F PGD ++FF+LN+ + +GL +T KPFL +P+ 
Sbjct  434   TQKRQDAAFFPGDHMLFFILNLVQFIGLALTLKPFLAVPKH  474



>ref|XP_010251715.1| PREDICTED: probable peptide/nitrate transporter At3g43790 isoform 
X4 [Nelumbo nucifera]
Length=425

 Score =   496 bits (1277),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 264/425 (62%), Positives = 326/425 (77%), Gaps = 11/425 (3%)
 Frame = +2

Query  419   LYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvv  598
             +YFMIRDFHIA+REEDI +YAG+VGSSFM+GRALTSV WG++ADRYGRKPV++IGT++VV
Sbjct  1     MYFMIRDFHIAKREEDIGFYAGFVGSSFMIGRALTSVFWGVVADRYGRKPVILIGTISVV  60

Query  599   iFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGL  778
             IFN +FGLS + WMA+  RFLLG    ++G +RAYASE+C  +YHALG S  ST+ GIG 
Sbjct  61    IFNTLFGLSTSLWMAVSMRFLLGCFNCMLGPIRAYASEVCHEKYHALGQSIASTSRGIGF  120

Query  779   VIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMH--  952
             +IGPA+GG+F QPAEKYP IFS  S F +FPYFLPCLIIS+FAL A +  FW+PET+H  
Sbjct  121   IIGPAIGGFFVQPAEKYPNIFSDNSLFARFPYFLPCLIISIFALGAFISCFWIPETLHMH  180

Query  953   ---------ThkkehkeehDVSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDI  1105
                         +      D  +  K+ E   P S+ SLL+NWPL+S+I+VYC+F LH+I
Sbjct  181   NRNNKEESYDALEASSHRSDEKEEMKETEQTGPPSRLSLLRNWPLMSTIIVYCIFSLHEI  240

Query  1106  AYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRI  1285
             AY E+FSLWAVS RK GGL +++  VG+VLAI+G GLLLFQLF YP +EK LGP+M+SR+
Sbjct  241   AYAEVFSLWAVSDRKYGGLGFSSQSVGEVLAISGFGLLLFQLFLYPSIEKFLGPIMVSRL  300

Query  1286  GAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGA  1465
              A LSIPLLS+YP+IA LSG  L +V+NCAS+LKNVLSV   TGL IL N AV Q QRGA
Sbjct  301   AAVLSIPLLSSYPFIARLSGFTLQLVINCASILKNVLSVVTLTGLFILLNSAVPQHQRGA  360

Query  1466  ANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKP  1645
             ANGISM+ MS FK IGPA GGSL S +Q RQ A F+PGDQ+VFF+LNV   + +++TFKP
Sbjct  361   ANGISMTLMSTFKAIGPAGGGSLFSLAQKRQHAAFLPGDQIVFFILNVITAVEVVLTFKP  420

Query  1646  FLQLP  1660
             FL  P
Sbjct  421   FLTRP  425



>ref|XP_004977466.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Setaria italica]
Length=497

 Score =   493 bits (1269),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 262/465 (56%), Positives = 329/465 (71%), Gaps = 15/465 (3%)
 Frame = +2

Query  212   EGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAA  391
             EG + PLL +++  GG +      Y E C GC V+  K A+ G+P     ++ +VTLC A
Sbjct  4     EGQSSPLL-ETKTAGGRM------YVEGCPGCAVDRRKAANPGIPYGSFIYVWIVTLCTA  56

Query  392   LPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPv  571
             LPISSLFPFLYFMIRD ++A+R EDI +YAG+VG+SFM GR LTS  WGI ADR GRKPV
Sbjct  57    LPISSLFPFLYFMIRDLNVAKRTEDIGFYAGFVGASFMFGRCLTSTAWGIAADRIGRKPV  116

Query  572   viigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISA  751
             VI G  +VV+FN +FGLSV YWMAI TRFLLGAL G++G ++AYA E+CR E+ AL +S 
Sbjct  117   VIFGIFSVVVFNTLFGLSVTYWMAIATRFLLGALNGLLGPIKAYAIEVCRPEHEALALSL  176

Query  752   VSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSF  931
             VSTAWGIGL+IGPA+GGY A PAE +P +FS ES FG+FPYFLPCL  S+FA    +   
Sbjct  177   VSTAWGIGLIIGPALGGYLALPAENFPNVFSPESLFGRFPYFLPCLCTSVFAAAVLISCI  236

Query  932   WLPETMHThkkehkeehDVSQNSKQ---PEHEVPTS-----QKSLLKNWPLISSILVYCV  1087
             W+PET+H HK    E   +         P+ +V  S     +KSL KNWPL+SSI++YC+
Sbjct  237   WMPETLHKHKGSENENQSIEALEAHLIDPKEKVEESGSLNTKKSLFKNWPLMSSIVIYCI  296

Query  1088  FQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGP  1267
             F  HD+AY E+FSLWA S +K GGLS ++ DVGQVLA+TG  LL++QLF YP + KVLGP
Sbjct  297   FSFHDMAYTEVFSLWAESDKKYGGLSLSSEDVGQVLAVTGASLLVYQLFLYPRINKVLGP  356

Query  1268  VMISRIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVS  1447
             +  SRI A L IP+L  YPY+  LS   LS+VLN AS++KN L+V+I TG  ILQN AV 
Sbjct  357   INSSRIAAILCIPILFAYPYMTYLSEPGLSIVLNVASVIKNNLAVTIITGTFILQNNAVP  416

Query  1448  QEQRGAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGD  1582
             Q+QRGAANG+SM+ MS FK + PA  G + SW+Q RQ   F PG 
Sbjct  417   QDQRGAANGLSMTGMSFFKAVAPAGAGIVFSWAQKRQHGFFFPGK  461



>gb|ACN28887.1| unknown [Zea mays]
 gb|AFW64726.1| hypothetical protein ZEAMMB73_249414 [Zea mays]
Length=498

 Score =   493 bits (1269),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 251/483 (52%), Positives = 340/483 (70%), Gaps = 22/483 (5%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y + C GC ++  K + AGVP K + F++  T  +ALPI+SLFPFLYFMIRD  +AEREE
Sbjct  13    YYDGCPGCAMDRRKESRAGVPYKELLFVAAATFASALPITSLFPFLYFMIRDLRVAEREE  72

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG++G+++M+GR + SV WG++ADR GRKPV+    ++VV+FN +FGLS  YWMA
Sbjct  73    DIGFYAGFLGAAYMIGRGVASVFWGVVADRVGRKPVIAFSVLSVVVFNTLFGLSAKYWMA  132

Query  644   IITRFLLGALCGIIG--------------TMRAYASEICRREYHALGISAVSTAWGIGLV  781
             I TRFLLGAL G +               ++ AY+ E+CR E  ALGIS VSTAWG+G++
Sbjct  133   IATRFLLGALNGFLAPAKVRACTIQYNTYSIEAYSIEVCRPEQQALGISVVSTAWGMGVI  192

Query  782   IGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThk  961
             IGPA+GGY AQPA++YP +F  +S FG+FPY LPCL IS FA +  +   WLPET+H H+
Sbjct  193   IGPAIGGYLAQPAKQYPHLFHEKSVFGRFPYLLPCLCISFFAALVVISCAWLPETLHKHR  252

Query  962   kehkeehDVSQNSKQPEHEVPTS--------QKSLLKNWPLISSILVYCVFQLHDIAYLE  1117
                +   +V++ +        ++        + SLL+N PL+SSI+ YCVF LHD AY+E
Sbjct  253   GLERAAAEVAEGTTAAAAAQESTPEPEPEPPKSSLLRNRPLMSSIVTYCVFSLHDTAYVE  312

Query  1118  IFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAAL  1297
             IFSLW VS R  GGLS+ + DVGQVL + G  LL++Q+FAY  V K+LGPV  +R+ +AL
Sbjct  313   IFSLWTVSGRDHGGLSFASKDVGQVLTVAGASLLVYQIFAYRWVNKILGPVNSTRVSSAL  372

Query  1298  SIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGI  1477
             SIP+++ YP++  LSG+ L V L  A+MLK+VL+++  TG  +LQN AV QEQRGAANGI
Sbjct  373   SIPIIAAYPFMTRLSGIRLGVPLYVAAMLKSVLAITRVTGTSLLQNNAVPQEQRGAANGI  432

Query  1478  SMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQL  1657
             + +AMSL K   PA  G L SW+Q RQ A F PGDQ+VF +LN+ E++GL++TFKPFL +
Sbjct  433   ATTAMSLSKAFAPAVAGILFSWAQKRQHAAFFPGDQMVFLLLNLTEVIGLVLTFKPFLAV  492

Query  1658  PED  1666
             P+ 
Sbjct  493   PQQ  495



>gb|EMT05811.1| Putative membrane protein [Aegilops tauschii]
Length=481

 Score =   491 bits (1264),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 251/465 (54%), Positives = 325/465 (70%), Gaps = 18/465 (4%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y E C GC +E  K  + G P K  F++ + TL +ALPISSLFPFLYFMI+D H+A+ E+
Sbjct  35    YYEGCPGCAMERKKENNTGTPYKEFFYVGVTTLASALPISSLFPFLYFMIQDMHVAKNEQ  94

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI  YAG +G+S+M+GR   S+ WG++ADR GRKP++     +VVIFN +FGLSV YWMA
Sbjct  95    DIGVYAGLLGASYMIGRCFASLFWGVVADRIGRKPIIAFSMFSVVIFNTLFGLSVKYWMA  154

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TR LLG++ G++  ++                  VST WGIGLV+GPA+GGY AQPA+
Sbjct  155   IATRMLLGSMNGMLAPIK------------------VSTGWGIGLVVGPAIGGYLAQPAK  196

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             +YP +FS  S FG+FPY LPCL IS+ A    +   WLPET+H HK   +E   V  +  
Sbjct  197   QYPNLFSENSIFGRFPYLLPCLFISLIAFAVLISCIWLPETLHMHKNLEREVEMVGDSRA  256

Query  1004  QPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADV  1183
              P  EVP  +KSL KNWPL+SSI+ YCVF LHD AY EIFSLWAVS +K GGL++++ DV
Sbjct  257   APHREVPHPEKSLYKNWPLMSSIIAYCVFTLHDTAYSEIFSLWAVSEKKYGGLNFSSKDV  316

Query  1184  GQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVV  1363
             GQVLA++G GLLL+Q+F Y  V K LG ++ SRI AALSIPLL+TYP++  LSG  L + 
Sbjct  317   GQVLAVSGAGLLLYQIFVYRHVHKYLGSIISSRIAAALSIPLLATYPFMTHLSGTKLGLA  376

Query  1364  LNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSW  1543
             +  A+++K   + +I TG  ILQN AVSQ QRGAANGIS +AMSLFK I PA  G L SW
Sbjct  377   IYFAAVIKGAFATTILTGTCILQNSAVSQNQRGAANGISTTAMSLFKAIAPAGAGVLFSW  436

Query  1544  SQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPEDDILK  1678
             +Q RQ A F PGDQ++F +LN+ E++GL++TFKPFL +P+    K
Sbjct  437   AQKRQHAAFFPGDQMIFLILNLVEVIGLVLTFKPFLAVPKQYDFK  481



>ref|XP_004515445.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Cicer arietinum]
Length=424

 Score =   489 bits (1258),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 244/417 (59%), Positives = 324/417 (78%), Gaps = 4/417 (1%)
 Frame = +2

Query  428   MIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFN  607
             M+RDF+IA+REEDIS YAGY+GSSFMLGR+LTS+LWG+IADRYGRKPV  +G ++V+IFN
Sbjct  1     MVRDFNIAKREEDISAYAGYIGSSFMLGRSLTSILWGLIADRYGRKPVAFLGIISVIIFN  60

Query  608   AVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIG  787
              +FGLS ++WMA+ITRF LG L G++G M+AY SEI R E  ALG+S  S AWG+GL+IG
Sbjct  61    TLFGLSTSFWMAVITRFFLGCLNGLLGPMKAYCSEIFREEKQALGLSTFSAAWGMGLIIG  120

Query  788   PAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkke  967
             P++GGY AQP  KYP +F  +SF+ K+PYFLP + IS+FA VA ++  WLPET+H H   
Sbjct  121   PSLGGYLAQPTLKYPNLFPKDSFWDKYPYFLPSISISIFAFVAVIVCIWLPETLHNHPLS  180

Query  968   hkeehD---VSQNSKQPEHE-VPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWA  1135
             ++  +D   +   SK+   E +    ++L  NWPL+SSI+VYC+F L+DIAY E+FSLWA
Sbjct  181   NESSNDAEALENGSKEKVREKIIQKDENLFLNWPLMSSIIVYCIFSLYDIAYQEVFSLWA  240

Query  1136  VSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLS  1315
             VSPR+LGGL+++T DVG VLAI+GIGL++FQL  YP +E+  GP+  +RI   LSIPLL 
Sbjct  241   VSPRRLGGLNFSTDDVGNVLAISGIGLIVFQLSVYPSLERTFGPIRFARISGVLSIPLLQ  300

Query  1316  TYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMS  1495
             +YP+IA+LSG+ L +V+N AS+LKN+LSV++ TGL ++QNRAV Q QRGAANGISM+ MS
Sbjct  301   SYPFIAMLSGITLYLVINIASLLKNLLSVTVITGLFLMQNRAVEQHQRGAANGISMTGMS  360

Query  1496  LFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPED  1666
             +FK IGPA GG++L+WSQ R  A F+PG  +VFFVLNV   L +++ F PFL + + 
Sbjct  361   IFKAIGPAGGGAILAWSQKRMHASFLPGTHMVFFVLNVAGGLTVLLMFTPFLSVKKK  417



>ref|XP_008677778.1| PREDICTED: LOC541978 isoform X1 [Zea mays]
Length=836

 Score =   502 bits (1293),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 251/468 (54%), Positives = 339/468 (72%), Gaps = 8/468 (2%)
 Frame = +2

Query  284   YDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             Y + C GC ++  K + AGVP K + F++  T  +ALPI+SLFPFLYFMIRD  +AEREE
Sbjct  13    YYDGCPGCAMDRRKESRAGVPYKELLFVAAATFASALPITSLFPFLYFMIRDLRVAEREE  72

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG++G+++M+GR + SV WG++ADR GRKPV+    ++VV+FN +FGLS  YWMA
Sbjct  73    DIGFYAGFLGAAYMIGRGVASVFWGVVADRVGRKPVIAFSVLSVVVFNTLFGLSAKYWMA  132

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TRFLLGAL G +   +AY+ E+CR E  ALGIS VSTAWG+G++IGPA+GGY AQPA+
Sbjct  133   IATRFLLGALNGFLAPAKAYSIEVCRPEQQALGISVVSTAWGMGVIIGPAIGGYLAQPAK  192

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSK  1003
             +YP +F  +S FG+FPY LPCL IS FA +  +   WLPET+H H+   +   +V++ + 
Sbjct  193   QYPHLFHEKSVFGRFPYLLPCLCISFFAALVVISCAWLPETLHKHRGLERAAAEVAEGTT  252

Query  1004  QPEHEVPTS--------QKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGG  1159
                    ++        + SLL+N PL+SSI+ YCVF LHD AY+EIFSLW VS R  GG
Sbjct  253   AAAAAQESTPEPEPEPPKSSLLRNRPLMSSIVTYCVFSLHDTAYVEIFSLWTVSGRDHGG  312

Query  1160  LSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALL  1339
             LS+ + DVGQVL + G  LL++Q+FAY  V K+LGPV  +R+ +ALSIP+++ YP++  L
Sbjct  313   LSFASKDVGQVLTVAGASLLVYQIFAYRWVNKILGPVNSTRVSSALSIPIIAAYPFMTRL  372

Query  1340  SGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPA  1519
             SG+ L V L  A+MLK+VL+++  TG  +LQN AV QEQRGAANGI+ +AMSL K   PA
Sbjct  373   SGIRLGVPLYVAAMLKSVLAITRVTGTSLLQNNAVPQEQRGAANGIATTAMSLSKAFAPA  432

Query  1520  AGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPE  1663
               G L SW+Q RQ A F PGDQ+VF +LN+ E++GL++TFKPFL +P+
Sbjct  433   VAGILFSWAQKRQHAAFFPGDQMVFLLLNLTEVIGLVLTFKPFLAVPQ  480



>gb|KCW87278.1| hypothetical protein EUGRSUZ_B03776 [Eucalyptus grandis]
Length=430

 Score =   488 bits (1255),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 261/423 (62%), Positives = 335/423 (79%), Gaps = 10/423 (2%)
 Frame = +2

Query  428   MIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFN  607
             MIRDFHIA+REEDI +YAG+VGSSFM+GRALTSV WG++ADRYGRKP+++IGT +VV+ N
Sbjct  1     MIRDFHIAKREEDIGFYAGFVGSSFMVGRALTSVFWGVVADRYGRKPIILIGTFSVVVLN  60

Query  608   AVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIG  787
             A+FGLS ++WMA+ TRFLLG    ++GT+RAYA EIC  E+  L +S VST+ GIGL+IG
Sbjct  61    ALFGLSTSFWMALCTRFLLGCFNSVLGTIRAYAVEICTEEHRGLTLSVVSTSRGIGLIIG  120

Query  788   PAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMH----T  955
             PA+GG+FAQPAEKYP +FS  S FG++PYFLPCL+IS++A    +  +WLPET+H    T
Sbjct  121   PAIGGFFAQPAEKYPGLFSQSSIFGRYPYFLPCLLISIYAAGVFISCWWLPETLHMHERT  180

Query  956   hkkehkeehDVSQNSKQPE------HEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLE  1117
               +   +E +VS +S           E  T +++LLKNWPL+S+I+VYCVF L +IAY E
Sbjct  181   DGRSSCDEVEVSCDSSDATKHDTEVEEQKTYEENLLKNWPLMSTIIVYCVFSLQEIAYSE  240

Query  1118  IFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAAL  1297
             IFSLWAVS RK GGL++++ DVG+VLAI+G GLLLFQL  YP VEK+LGP+MI+R+ A +
Sbjct  241   IFSLWAVSERKFGGLNFSSQDVGEVLAISGFGLLLFQLLLYPRVEKILGPIMITRLSAGI  300

Query  1298  SIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGI  1477
             SIPLLS+YPYIA+LSGL L + +N ASML+N LSVS+ TG+ IL N AV Q QRGAANGI
Sbjct  301   SIPLLSSYPYIAMLSGLTLHIAINFASMLRNALSVSVVTGIFILLNNAVPQHQRGAANGI  360

Query  1478  SMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQL  1657
             SM+AMS+ K  GPA GG+L SW+Q RQ A F+PGDQ+VFFVLN+ +++GLI+TFKPFL  
Sbjct  361   SMTAMSISKAFGPACGGALFSWAQKRQVATFLPGDQMVFFVLNLLQMIGLILTFKPFLAQ  420

Query  1658  PED  1666
             P +
Sbjct  421   PHE  423



>ref|XP_006582392.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Glycine max]
 ref|XP_006582393.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Glycine max]
 gb|KHN26425.1| Protein ZINC INDUCED FACILITATOR-LIKE 1 [Glycine soja]
Length=478

 Score =   488 bits (1256),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 265/486 (55%), Positives = 349/486 (72%), Gaps = 17/486 (3%)
 Frame = +2

Query  212   EGNTEPLLKQSEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAA  391
             E   +PLLK+              Y E+C GC+V+  K     V  +++ +I +  LC  
Sbjct  4     EAFEKPLLKRQ-------------YHENCPGCKVDQAKELKKDVSFRNLSYIWLAVLCGT  50

Query  392   LPISSLFPFLYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPv  571
             LP++SLFPF+YFM++DF+IAE EEDIS YAGYVGS+ MLGR+LTS+LWG+++DRYGRKPV
Sbjct  51    LPVASLFPFVYFMVKDFNIAETEEDISTYAGYVGSAMMLGRSLTSILWGMVSDRYGRKPV  110

Query  572   viigtvtvviFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISA  751
             +IIG +TVVIFN +FGLS N WMA+  RFLLG+L G++G ++AYA+EI R E  ALG+S 
Sbjct  111   IIIGIITVVIFNTLFGLSTNIWMAVSMRFLLGSLNGLLGPIKAYATEIFREEEQALGLST  170

Query  752   VSTAWGIGLVIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSF  931
             V  AWG+GLVIGPA+GGY AQP  KYP IF  +SF+ +FPYFLPCL++S FA  + +   
Sbjct  171   VVAAWGVGLVIGPALGGYLAQPVLKYPHIFPKDSFWDRFPYFLPCLLVSAFAFASAIACI  230

Query  932   WLPETMHThkkehkeehDVSQ----NSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLH  1099
             WLPET+H HK   +   +V      +S+  +  +    KS+ +NWPL+SSI+VYC+F LH
Sbjct  231   WLPETLHNHKDRIESTKNVEALEVGSSEADKDRIIQRDKSIFRNWPLMSSIIVYCIFSLH  290

Query  1100  DIAYLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMIS  1279
             D+AY EIFSLWA+SP +LGGL++TT DVG VLAI+G+ +L+FQL  Y LV+K  GPV + 
Sbjct  291   DVAYQEIFSLWALSPLRLGGLNFTTDDVGNVLAISGLAILVFQLTLYRLVQKACGPVALV  350

Query  1280  RIGAALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQR  1459
             RI   LSIPLL  YP + +LSG  L +V+N AS+LKNVL  +I T L ILQN+AV Q QR
Sbjct  351   RIAGVLSIPLLQCYPLMTMLSGFTLDIVINIASILKNVLIEAIATSLFILQNKAVEQHQR  410

Query  1460  GAANGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTF  1639
             G AN I+M+ MS FKTIGPA+ G+LLSWSQ   +  F+PG  +VF  LN+ E LG+++ F
Sbjct  411   GTANSIAMTGMSAFKTIGPASAGALLSWSQKHINDSFLPGTHIVFLALNIVEGLGVLLMF  470

Query  1640  KPFLQL  1657
             KPFL +
Sbjct  471   KPFLSV  476



>ref|XP_010045121.1| PREDICTED: probable peptide/nitrate transporter At3g43790 isoform 
X3 [Eucalyptus grandis]
Length=453

 Score =   487 bits (1253),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 261/426 (61%), Positives = 335/426 (79%), Gaps = 10/426 (2%)
 Frame = +2

Query  419   LYFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvv  598
              Y  IRDFHIA+REEDI +YAG+VGSSFM+GRALTSV WG++ADRYGRKP+++IGT +VV
Sbjct  21    FYCQIRDFHIAKREEDIGFYAGFVGSSFMVGRALTSVFWGVVADRYGRKPIILIGTFSVV  80

Query  599   iFNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGL  778
             + NA+FGLS ++WMA+ TRFLLG    ++GT+RAYA EIC  E+  L +S VST+ GIGL
Sbjct  81    VLNALFGLSTSFWMALCTRFLLGCFNSVLGTIRAYAVEICTEEHRGLTLSVVSTSRGIGL  140

Query  779   VIGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMH--  952
             +IGPA+GG+FAQPAEKYP +FS  S FG++PYFLPCL+IS++A    +  +WLPET+H  
Sbjct  141   IIGPAIGGFFAQPAEKYPGLFSQSSIFGRYPYFLPCLLISIYAAGVFISCWWLPETLHMH  200

Query  953   --ThkkehkeehDVSQNSKQPE------HEVPTSQKSLLKNWPLISSILVYCVFQLHDIA  1108
               T  +   +E +VS +S           E  T +++LLKNWPL+S+I+VYCVF L +IA
Sbjct  201   ERTDGRSSCDEVEVSCDSSDATKHDTEVEEQKTYEENLLKNWPLMSTIIVYCVFSLQEIA  260

Query  1109  YLEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIG  1288
             Y EIFSLWAVS RK GGL++++ DVG+VLAI+G GLLLFQL  YP VEK+LGP+MI+R+ 
Sbjct  261   YSEIFSLWAVSERKFGGLNFSSQDVGEVLAISGFGLLLFQLLLYPRVEKILGPIMITRLS  320

Query  1289  AALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAA  1468
             A +SIPLLS+YPYIA+LSGL L + +N ASML+N LSVS+ TG+ IL N AV Q QRGAA
Sbjct  321   AGISIPLLSSYPYIAMLSGLTLHIAINFASMLRNALSVSVVTGIFILLNNAVPQHQRGAA  380

Query  1469  NGISMSAMSLFKTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPF  1648
             NGISM+AMS+ K  GPA GG+L SW+Q RQ A F+PGDQ+VFFVLN+ +++GLI+TFKPF
Sbjct  381   NGISMTAMSISKAFGPACGGALFSWAQKRQVATFLPGDQMVFFVLNLLQMIGLILTFKPF  440

Query  1649  LQLPED  1666
             L  P +
Sbjct  441   LAQPHE  446



>ref|XP_003576348.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Brachypodium distachyon]
Length=496

 Score =   487 bits (1254),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 254/475 (53%), Positives = 329/475 (69%), Gaps = 8/475 (2%)
 Frame = +2

Query  266   EDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFH  445
             E++   Y E C GC V+  K A+AGVP K  F I ++ L + LPIS LFPFLYFMIRDFH
Sbjct  18    EEKVAAYHEGCPGCAVDRRKAANAGVPYKEFFHIWIIILVSCLPISLLFPFLYFMIRDFH  77

Query  446   IAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLS  625
             IA+  EDI +YAG+VG+S+MLGRALTS  WG+IADR GRKPV++ G  + ++FN +FGLS
Sbjct  78    IAKTVEDIGFYAGFVGASYMLGRALTSTAWGMIADRIGRKPVIVFGIFSALLFNTLFGLS  137

Query  626   VNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGY  805
             VNYWMAI TRFL+G+L G++G +RAYA EICR E+ A+ +S VST+W IGL++GP +GGY
Sbjct  138   VNYWMAISTRFLIGSLNGLLGPIRAYAIEICRPEHQAIALSLVSTSWAIGLIVGPTIGGY  197

Query  806   FAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThk-------k  964
              AQP EKYP +F   S FG+FPYFLPCL IS+F     +   WLPET+H HK        
Sbjct  198   LAQPTEKYPKLFPTYSLFGRFPYFLPCLCISVFCFAVLISCIWLPETLHNHKADKKGDQA  257

Query  965   ehkeehDVSQNSKQPEHEV-PTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVS  1141
                     S   +  EH    T+ K+L KNWPL+SSI+++C+    D+AY EIFSLWA S
Sbjct  258   SESSIAHFSDPEELNEHGTSATTDKNLFKNWPLMSSIILFCIVSFEDMAYTEIFSLWAES  317

Query  1142  PRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTY  1321
              RK GGLS++T DVGQVLAI+G  +L++Q F YP +  VLGP+  SRI  +LS+ LL TY
Sbjct  318   DRKYGGLSFSTEDVGQVLAISGASILVYQTFIYPRIVGVLGPINTSRIATSLSMMLLLTY  377

Query  1322  PYIALLSGLCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLF  1501
               I  LS     + ++ AS+LKN   V++ T   ILQN +V+Q QR  ANG++ + MSLF
Sbjct  378   APITHLSRPWSQIAVSIASILKNNFVVTVVTCSFILQNNSVTQHQRATANGLATTLMSLF  437

Query  1502  KTIGPAAGGSLLSWSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLPED  1666
             KT  PA  G + SW+Q RQ A F PGDQ+VFF+L + EL+ L+ TFKPFL +P+ 
Sbjct  438   KTFAPAGAGIVFSWAQKRQHALFFPGDQMVFFLLAIVELVQLVWTFKPFLAVPQQ  492



>emb|CAB83151.1| transporter-like protein [Arabidopsis thaliana]
Length=479

 Score =   486 bits (1250),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 257/468 (55%), Positives = 346/468 (74%), Gaps = 19/468 (4%)
 Frame = +2

Query  287   DESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREED  466
             +E C GC ++  K+   GVP  H+ FI +V+LC          ++ + IRDFHIA++EED
Sbjct  14    NEDCPGCIIDRTKQQQRGVPYLHLSFIWLVSLCTEND-----QYVLWQIRDFHIAKQEED  68

Query  467   ISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMAI  646
             I +YAG+VGSSFM+GRALTS+ WG +ADRYGRKP+++IGT +V+IFN +FGLS ++W+AI
Sbjct  69    IGFYAGFVGSSFMIGRALTSIFWGKLADRYGRKPIILIGTFSVIIFNTLFGLSTSFWLAI  128

Query  647   ITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAEK  826
               RFLLG    ++G +RAYASE+   EY+AL +S VST+ GIGL++GPA+GGY AQPAEK
Sbjct  129   SVRFLLGCFNCLLGVIRAYASEVVSEEYNALSLSVVSTSRGIGLILGPAIGGYLAQPAEK  188

Query  827   YPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehk-------eehD  985
             YP IFS  S FG+FPYFLP L+IS++A    +  +WLPET+HT  +  +          D
Sbjct  189   YPNIFSQSSVFGRFPYFLPSLVISVYATAVLIACWWLPETLHTRCRIAQGRLNPTELNDD  248

Query  986   VSQNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLS  1165
              S+     E ++  ++ SLL+N PL++ I+VYCVF L +IAY EIFSLWAVS R  GGLS
Sbjct  249   ESRGGGLDEQKI-INKPSLLRNRPLMAIIIVYCVFSLQEIAYNEIFSLWAVSDRSYGGLS  307

Query  1166  YTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSG  1345
             +++ DVG+VLAI+G+GLL+FQL  YP +EK +G + + R+ A L IPLLS YPYIALLSG
Sbjct  308   FSSQDVGEVLAISGLGLLVFQLLVYPPLEKSVGLLAVIRLSAVLLIPLLSCYPYIALLSG  367

Query  1346  LCLSVVLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAG  1525
             + L +V+NCAS++KN LS+S+ TGL I+ N+AV Q QRGAANGISM+AMS+FK+ GPA G
Sbjct  368   VTLHLVINCASIIKNALSISLVTGLFIMLNKAVPQNQRGAANGISMTAMSVFKSFGPAGG  427

Query  1526  GSLLSWSQLRQDAKFMPG------DQlvffvlnvfellglIMTFKPFL  1651
             G L SW+Q RQDA F+PG      D++VF VLN+ +L+GLI+TF P++
Sbjct  428   GVLFSWAQKRQDATFLPGQIFAPCDEMVFLVLNLVQLVGLILTFIPYI  475



>ref|XP_003578976.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Brachypodium distachyon]
Length=492

 Score =   485 bits (1249),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 243/458 (53%), Positives = 334/458 (73%), Gaps = 1/458 (0%)
 Frame = +2

Query  290   ESCAGCRVELLKRADAG-VPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREED  466
             E C GC +E  K + AG +P   +FF+ + TL ++LPI+ LFPF+YFM+RDFHIA+ EED
Sbjct  29    EGCPGCAMERRKESCAGRIPYTELFFVGLTTLASSLPITCLFPFMYFMVRDFHIAKTEED  88

Query  467   ISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMAI  646
             I  YAG++ SS+M+GRA +++ WGI+ADR GRKPV+    ++VVIFN +FGL   YWMAI
Sbjct  89    IGSYAGFLASSYMVGRACSAIFWGIVADRIGRKPVIAFSILSVVIFNTLFGLCTEYWMAI  148

Query  647   ITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAEK  826
              TR +LG+L G++  ++AYA E+C+ E+ ALG+S V+TAWG GLVIGPA+GGY AQPAEK
Sbjct  149   ATRLVLGSLNGLLAPIKAYAIEVCQAEHQALGLSVVNTAWGFGLVIGPALGGYLAQPAEK  208

Query  827   YPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQNSKQ  1006
             YP  FS +S FG+FPY LP L +S+FA +  +   WLPET+H H    K    V   + +
Sbjct  209   YPQTFSKDSVFGRFPYLLPSLGVSLFAAIVLISCIWLPETIHKHGIREKGIQIVKSLASE  268

Query  1007  PEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTADVG  1186
               +     +KSLL+NWP +S+++ YC+F LHD AY EI SLWAVS RK GGLS+++ D+G
Sbjct  269   EAYWDSPRKKSLLQNWPWMSTMVPYCLFGLHDTAYSEILSLWAVSDRKYGGLSFSSEDIG  328

Query  1187  QVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSVVL  1366
             +VLA+ G  LL++QLF Y  V K LGPV+ +R+G+ALSI ++STYP++  LSG  LS+ L
Sbjct  329   EVLAVAGASLLVYQLFIYRWVHKFLGPVISARVGSALSILIVSTYPFMTYLSGAKLSLAL  388

Query  1367  NCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLSWS  1546
               A+M++ +++++ +TG+ +LQN AV QEQRG ANG+S +AMS FK + P   G L SW+
Sbjct  389   YSAAMMRGIVAITASTGVCLLQNSAVRQEQRGTANGVSTTAMSFFKAVAPVGAGILFSWA  448

Query  1547  QLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLP  1660
             Q  QD+ F PGDQ+VF  LN+ ++LGLI TF+PFL LP
Sbjct  449   QKHQDSAFFPGDQVVFLALNLVQILGLIFTFEPFLVLP  486



>ref|XP_008672742.1| PREDICTED: uncharacterized protein LOC100280090 isoform X1 [Zea 
mays]
 gb|ACN37020.1| unknown [Zea mays]
 tpg|DAA59175.1| TPA: major facilitator superfamily antiporter [Zea mays]
Length=478

 Score =   485 bits (1248),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 245/460 (53%), Positives = 339/460 (74%), Gaps = 2/460 (0%)
 Frame = +2

Query  287   DESCAGCRVELLKRADAG-VPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             +E C GC +E  K +  G +P + +FF++  +L +ALPI+ LFPFLYFM+RDF +AE EE
Sbjct  15    EEGCPGCVMERRKASSNGRIPYRELFFVAATSLASALPITCLFPFLYFMVRDFRVAETEE  74

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG++ +S+M+GR  +S+ WG+IADR GRKPV+    ++VV+F+A+FGLS  YWMA
Sbjct  75    DIGFYAGFLAASYMVGRGFSSIFWGVIADRVGRKPVITFSILSVVVFSALFGLSTTYWMA  134

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TR +LGAL G++  ++AY  E+C+ ++ ALG+S V+TAW +GL++GPA+GGY +QPAE
Sbjct  135   IATRLVLGALNGLLAPIKAYCVEVCQTQHQALGLSLVNTAWALGLIVGPALGGYLSQPAE  194

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQ-NS  1000
             KYP +FS +S FG+FPY LPCL +S FA +  +   WLPET+H HK    +       +S
Sbjct  195   KYPHVFSKDSVFGRFPYLLPCLSVSAFATLVLISCEWLPETIHKHKVPEMDTKAFKALSS  254

Query  1001  KQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTAD  1180
             K+   + P  +KSLL+N P IS++L YC F LHD AY EI SLWAVS RK GGLS++T D
Sbjct  255   KEGYCDPPRKKKSLLQNRPWISTLLPYCFFSLHDTAYSEILSLWAVSDRKYGGLSFSTED  314

Query  1181  VGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSV  1360
              GQVLA+ G  LL++QL  Y  V ++LG V  +RI +A+SI +L+TYP++  LSG+ LS+
Sbjct  315   TGQVLAMAGASLLVYQLVIYRWVHRILGTVNSARIASAVSILVLATYPFMTYLSGVKLSL  374

Query  1361  VLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLS  1540
              L  A+M+++ L++++TTG+ +LQN AV QEQRG ANGIS +AMS FK+I P   G+L S
Sbjct  375   ALCSAAMMRSALAITVTTGISLLQNNAVCQEQRGTANGISTTAMSFFKSIAPVGAGALFS  434

Query  1541  WSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLP  1660
             W+Q RQD  F+PGDQ+VF VLN+ +LLGLI TF+PFL LP
Sbjct  435   WAQKRQDVAFLPGDQVVFMVLNLVQLLGLISTFEPFLVLP  474



>gb|ACG42557.1| major facilitator superfamily antiporter [Zea mays]
Length=478

 Score =   484 bits (1247),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 245/460 (53%), Positives = 339/460 (74%), Gaps = 2/460 (0%)
 Frame = +2

Query  287   DESCAGCRVELLKRADAG-VPIKHVFFISMVTLCAALPISSLFPFLYFMIRDFHIAEREE  463
             +E C GC +E  K +  G +P + +FF++  +L +ALPI+ LFPFLYFM+RDF +AE EE
Sbjct  15    EEGCPGCVMEQRKASSNGRIPYRELFFVAATSLASALPITCLFPFLYFMVRDFRVAETEE  74

Query  464   DISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvviFNAVFGLSVNYWMA  643
             DI +YAG++ +S+M+GR  +S+ WG+IADR GRKPV+    ++VV+F+A+FGLS  YWMA
Sbjct  75    DIGFYAGFLAASYMVGRGFSSIFWGVIADRVGRKPVITFSILSVVVFSALFGLSTTYWMA  134

Query  644   IITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLVIGPAVGGYFAQPAE  823
             I TR +LGAL G++  ++AY  E+C+ ++ ALG+S V+TAW +GL++GPA+GGY +QPAE
Sbjct  135   IATRLVLGALNGLLAPIKAYCVEVCQTQHQALGLSLVNTAWALGLIVGPALGGYLSQPAE  194

Query  824   KYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThkkehkeehDVSQ-NS  1000
             KYP +FS +S FG+FPY LPCL +S FA +  +   WLPET+H HK    +       +S
Sbjct  195   KYPHVFSKDSVFGRFPYLLPCLSVSAFATLVLISCEWLPETIHKHKVPEMDTKAFKALSS  254

Query  1001  KQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAYLEIFSLWAVSPRKLGGLSYTTAD  1180
             K+   + P  +KSLL+N P IS++L YC F LHD AY EI SLWAVS RK GGLS++T D
Sbjct  255   KEGYCDPPRKKKSLLQNRPWISTLLPYCFFSLHDTAYSEILSLWAVSDRKYGGLSFSTED  314

Query  1181  VGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGAALSIPLLSTYPYIALLSGLCLSV  1360
              GQVLA+ G  LL++QL  Y  V ++LG V  +RI +A+SI +L+TYP++  LSG+ LS+
Sbjct  315   TGQVLAMAGASLLVYQLVIYRWVHRILGTVNSARIASAVSILVLATYPFMTYLSGVKLSL  374

Query  1361  VLNCASMLKNVLSVSITTGLLILQNRAVSQEQRGAANGISMSAMSLFKTIGPAAGGSLLS  1540
              L  A+M+++ L++++TTG+ +LQN AV QEQRG ANGIS +AMS FK+I P   G+L S
Sbjct  375   ALCSAAMMRSALAITVTTGISLLQNNAVCQEQRGTANGISTTAMSFFKSIAPVGAGALFS  434

Query  1541  WSQLRQDAKFMPGDQlvffvlnvfellglIMTFKPFLQLP  1660
             W+Q RQD  F+PGDQ+VF VLN+ +LLGLI TF+PFL LP
Sbjct  435   WAQKRQDVAFLPGDQVVFMVLNLVQLLGLISTFEPFLVLP  474



>gb|KCW65125.1| hypothetical protein EUGRSUZ_G02629 [Eucalyptus grandis]
Length=407

 Score =   482 bits (1240),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 253/400 (63%), Positives = 310/400 (78%), Gaps = 12/400 (3%)
 Frame = +2

Query  242   SEQNGGHLEDEYFCYDESCAGCRVELLKRADAGVPIKHVFFISMVTLCAALPISSLFPFL  421
             +E+    L ++YF   E+C GC+VE  K +  G PI+ +  I +V LC ALPISSLFPFL
Sbjct  3     AEEQEKALLEKYF--HENCPGCKVEKYKESQKGFPIRELLSIWIVVLCTALPISSLFPFL  60

Query  422   YFMIRDFHIAEREEDISYYAGYVGSSFMLGRALTSVLWGIIADRYGRKPvviigtvtvvi  601
             YFMIRDFHIA+REEDI YYAGYVGSSFM GRALTSV WGI+ADRYGRKPV+I+GT+ VVI
Sbjct  61    YFMIRDFHIAKREEDIGYYAGYVGSSFMFGRALTSVFWGIVADRYGRKPVIIMGTIAVVI  120

Query  602   FNAVFGLSVNYWMAIITRFLLGALCGIIGTMRAYASEICRREYHALGISAVSTAWGIGLV  781
             FN +FGLSVN+WMAI  RFLLG+L G++G ++AYA+EI R EY ALG+S VSTAWGIGL+
Sbjct  121   FNTLFGLSVNFWMAIAMRFLLGSLNGLLGPIKAYATEIFREEYQALGVSTVSTAWGIGLI  180

Query  782   IGPAVGGYFAQPAEKYPTIFSAESFFGKFPYFLPCLIISMFALVATVMSFWLPETMHThk  961
             IGPA+GGY AQPAEK+P+IF  ES FG+FPYFLPCL IS+FALV T+ + WLPET+H H 
Sbjct  181   IGPALGGYLAQPAEKFPSIFPKESVFGRFPYFLPCLAISVFALVVTIATCWLPETLHKHH  240

Query  962   keh---keehDVS-------QNSKQPEHEVPTSQKSLLKNWPLISSILVYCVFQLHDIAY  1111
             K         DV           K  + E    +KSL +NWPL+SSI+VYCVF LHD+AY
Sbjct  241   KSSKFDAACEDVETAPLMSGTKYKTQKAEGKAPKKSLFRNWPLMSSIIVYCVFSLHDMAY  300

Query  1112  LEIFSLWAVSPRKLGGLSYTTADVGQVLAITGIGLLLFQLFAYPLVEKVLGPVMISRIGA  1291
              EIFSLWAVSPR+ GGLSYTT DVG VLAI+G GLL+FQ   YP   ++LGPV+++R+  
Sbjct  301   TEIFSLWAVSPRRYGGLSYTTEDVGNVLAISGAGLLIFQTCLYPYFNRLLGPVVVARLNG  360

Query  1292  ALSIPLLSTYPYIALLSGLCLSVVLNCASMLKNVLSVSIT  1411
              L+IPLLS+YP+IA+L+GL LS+VLNC S+ KNVLSVS++
Sbjct  361   VLAIPLLSSYPFIAMLTGLSLSIVLNCTSVAKNVLSVSMS  400



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5802995907544