BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19021_g2_i2 len=3191 path=[6821:0-267 3654:268-1659 504:1660-3190]

Length=3191
                                                                      Score     E

ref|XP_009613733.1|  PREDICTED: C2 and GRAM domain-containing pro...   1301   0.0      
ref|XP_006344470.1|  PREDICTED: LOW QUALITY PROTEIN: C2 and GRAM ...   1286   0.0      
ref|XP_004236263.1|  PREDICTED: C2 and GRAM domain-containing pro...   1286   0.0      
ref|XP_010319015.1|  PREDICTED: C2 and GRAM domain-containing pro...   1281   0.0      
ref|XP_009797805.1|  PREDICTED: C2 and GRAM domain-containing pro...   1281   0.0      
ref|XP_009797804.1|  PREDICTED: C2 and GRAM domain-containing pro...   1276   0.0      
ref|XP_009613734.1|  PREDICTED: C2 and GRAM domain-containing pro...   1246   0.0      
ref|XP_011071944.1|  PREDICTED: C2 and GRAM domain-containing pro...   1223   0.0      
ref|XP_009797806.1|  PREDICTED: C2 and GRAM domain-containing pro...   1220   0.0      
emb|CBI14958.3|  unnamed protein product                               1194   0.0      
ref|XP_006476879.1|  PREDICTED: C2 and GRAM domain-containing pro...   1194   0.0      
ref|XP_002277671.2|  PREDICTED: C2 and GRAM domain-containing pro...   1191   0.0      Vitis vinifera
emb|CDP12735.1|  unnamed protein product                               1190   0.0      
gb|KDO69492.1|  hypothetical protein CISIN_1g001703mg                  1190   0.0      
ref|XP_006439916.1|  hypothetical protein CICLE_v10018657mg            1184   0.0      
ref|XP_008239326.1|  PREDICTED: C2 and GRAM domain-containing pro...   1155   0.0      
ref|XP_007210860.1|  hypothetical protein PRUPE_ppa015095mg            1145   0.0      
ref|XP_004299142.1|  PREDICTED: C2 and GRAM domain-containing pro...   1143   0.0      
ref|XP_002511325.1|  conserved hypothetical protein                    1142   0.0      Ricinus communis
gb|KDP31032.1|  hypothetical protein JCGZ_11408                        1141   0.0      
gb|KDO69493.1|  hypothetical protein CISIN_1g001703mg                  1126   0.0      
ref|XP_006476880.1|  PREDICTED: C2 and GRAM domain-containing pro...   1126   0.0      
ref|XP_008380532.1|  PREDICTED: C2 and GRAM domain-containing pro...   1112   0.0      
gb|KCW83290.1|  hypothetical protein EUGRSUZ_B00225                    1112   0.0      
ref|XP_009333945.1|  PREDICTED: C2 and GRAM domain-containing pro...   1109   0.0      
ref|XP_006476881.1|  PREDICTED: C2 and GRAM domain-containing pro...   1102   0.0      
gb|KDO69491.1|  hypothetical protein CISIN_1g001703mg                  1100   0.0      
ref|XP_011046227.1|  PREDICTED: C2 and GRAM domain-containing pro...   1093   0.0      
ref|XP_007036381.1|  C2 calcium/lipid-binding and GRAM domain con...   1092   0.0      
ref|XP_010678868.1|  PREDICTED: C2 and GRAM domain-containing pro...   1090   0.0      
ref|XP_002321630.1|  C2 domain-containing family protein               1089   0.0      Populus trichocarpa [western balsam poplar]
gb|EYU22179.1|  hypothetical protein MIMGU_mgv1a025186mg               1082   0.0      
ref|XP_003522401.1|  PREDICTED: C2 and GRAM domain-containing pro...   1081   0.0      
ref|XP_003528135.1|  PREDICTED: C2 and GRAM domain-containing pro...   1078   0.0      
ref|XP_010251062.1|  PREDICTED: C2 and GRAM domain-containing pro...   1077   0.0      
ref|XP_007138020.1|  hypothetical protein PHAVU_009G174400g            1064   0.0      
ref|XP_006852332.1|  hypothetical protein AMTR_s00049p00208380         1053   0.0      
ref|XP_004501875.1|  PREDICTED: C2 and GRAM domain-containing pro...   1052   0.0      
ref|XP_010929874.1|  PREDICTED: C2 and GRAM domain-containing pro...   1048   0.0      
ref|XP_006581905.1|  PREDICTED: C2 and GRAM domain-containing pro...   1042   0.0      
ref|XP_010027276.1|  PREDICTED: C2 and GRAM domain-containing pro...   1038   0.0      
ref|XP_003601189.1|  GRAM domain-containing protein 1B                 1032   0.0      
ref|XP_008777790.1|  PREDICTED: C2 and GRAM domain-containing pro...   1028   0.0      
ref|XP_006581906.1|  PREDICTED: C2 and GRAM domain-containing pro...   1016   0.0      
ref|XP_010251063.1|  PREDICTED: C2 and GRAM domain-containing pro...   1004   0.0      
ref|XP_008438821.1|  PREDICTED: C2 and GRAM domain-containing pro...   1003   0.0      
ref|XP_010533453.1|  PREDICTED: C2 and GRAM domain-containing pro...    992   0.0      
gb|KFK26649.1|  hypothetical protein AALP_AA8G275600                    991   0.0      
ref|XP_006279567.1|  hypothetical protein CARUB_v10025800mg             983   0.0      
ref|XP_010442497.1|  PREDICTED: C2 and GRAM domain-containing pro...    980   0.0      
ref|NP_199828.1|  C2 and GRAM domain-containing protein                 978   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010441655.1|  PREDICTED: C2 and GRAM domain-containing pro...    978   0.0      
ref|XP_002864041.1|  C2 domain-containing protein                       977   0.0      
ref|XP_010482323.1|  PREDICTED: C2 and GRAM domain-containing pro...    974   0.0      
gb|EPS71403.1|  hypothetical protein M569_03353                         967   0.0      
ref|XP_006402175.1|  hypothetical protein EUTSA_v10012548mg             963   0.0      
ref|XP_007026402.1|  C2 calcium/lipid-binding and GRAM domain con...    962   0.0      
ref|XP_009118896.1|  PREDICTED: C2 and GRAM domain-containing pro...    961   0.0      
emb|CDX71607.1|  BnaC09g26480D                                          959   0.0      
emb|CDY05797.1|  BnaA10g06230D                                          957   0.0      
ref|XP_008803167.1|  PREDICTED: C2 and GRAM domain-containing pro...    952   0.0      
ref|XP_010942889.1|  PREDICTED: C2 and GRAM domain-containing pro...    948   0.0      
gb|KHG17835.1|  hypothetical protein F383_00553                         946   0.0      
gb|EMT06922.1|  hypothetical protein F775_17226                         946   0.0      
ref|XP_008800282.1|  PREDICTED: C2 and GRAM domain-containing pro...    945   0.0      
gb|KHG17834.1|  hypothetical protein F383_00553                         944   0.0      
ref|XP_003581354.2|  PREDICTED: C2 and GRAM domain-containing pro...    944   0.0      
ref|XP_010928062.1|  PREDICTED: C2 and GRAM domain-containing pro...    944   0.0      
ref|XP_010928063.1|  PREDICTED: C2 and GRAM domain-containing pro...    943   0.0      
ref|XP_010245025.1|  PREDICTED: C2 and GRAM domain-containing pro...    941   0.0      
ref|XP_009403267.1|  PREDICTED: C2 and GRAM domain-containing pro...    941   0.0      
ref|XP_006467213.1|  PREDICTED: C2 and GRAM domain-containing pro...    939   0.0      
ref|XP_006857725.1|  hypothetical protein AMTR_s00061p00181260          936   0.0      
ref|XP_004975959.1|  PREDICTED: C2 and GRAM domain-containing pro...    932   0.0      
ref|XP_009374836.1|  PREDICTED: C2 and GRAM domain-containing pro...    931   0.0      
gb|KDP35532.1|  hypothetical protein JCGZ_08970                         931   0.0      
ref|XP_008224645.1|  PREDICTED: C2 and GRAM domain-containing pro...    930   0.0      
ref|XP_010646248.1|  PREDICTED: C2 and GRAM domain-containing pro...    930   0.0      
ref|XP_002264782.2|  PREDICTED: C2 and GRAM domain-containing pro...    929   0.0      Vitis vinifera
ref|XP_006449996.1|  hypothetical protein CICLE_v10014339mg             927   0.0      
ref|XP_008384200.1|  PREDICTED: C2 and GRAM domain-containing pro...    927   0.0      
ref|XP_007213702.1|  hypothetical protein PRUPE_ppa000747mg             926   0.0      
ref|XP_002446664.1|  hypothetical protein SORBIDRAFT_06g020045          924   0.0      Sorghum bicolor [broomcorn]
ref|XP_008370961.1|  PREDICTED: C2 and GRAM domain-containing pro...    923   0.0      
ref|XP_004293413.1|  PREDICTED: C2 and GRAM domain-containing pro...    922   0.0      
ref|XP_009359067.1|  PREDICTED: C2 and GRAM domain-containing pro...    921   0.0      
emb|CDP04547.1|  unnamed protein product                                921   0.0      
emb|CAH67319.1|  OSIGBa0106G07.15                                       920   0.0      Oryza sativa [red rice]
ref|XP_009407049.1|  PREDICTED: LOW QUALITY PROTEIN: C2 and GRAM ...    919   0.0      
gb|AES64583.2|  C2 and GRAM domain plant-like protein                   919   0.0      
ref|XP_003594332.1|  Synaptotagmin-1                                    918   0.0      
ref|XP_003534985.1|  PREDICTED: C2 and GRAM domain-containing pro...    913   0.0      
gb|KHN40775.1|  C2 and GRAM domain-containing protein                   912   0.0      
ref|XP_011005730.1|  PREDICTED: C2 and GRAM domain-containing pro...    912   0.0      
emb|CAE05501.2|  OSJNBa0022H21.21                                       912   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006653521.1|  PREDICTED: C2 and GRAM domain-containing pro...    910   0.0      
ref|XP_011095886.1|  PREDICTED: C2 and GRAM domain-containing pro...    908   0.0      
gb|EYU27641.1|  hypothetical protein MIMGU_mgv1a000583mg                907   0.0      
ref|XP_011095885.1|  PREDICTED: C2 and GRAM domain-containing pro...    907   0.0      
ref|NP_171836.3|  C2 calcium/lipid-binding and GRAM domain contai...    907   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006279566.1|  hypothetical protein CARUB_v10025800mg             906   0.0      
ref|XP_006373577.1|  C2 domain-containing family protein                905   0.0      
gb|KHN14410.1|  C2 and GRAM domain-containing protein                   904   0.0      
ref|XP_006398485.1|  hypothetical protein EUTSA_v10000756mg             904   0.0      
ref|XP_011040139.1|  PREDICTED: C2 and GRAM domain-containing pro...    903   0.0      
emb|CDX77802.1|  BnaC07g20560D                                          903   0.0      
ref|XP_010252840.1|  PREDICTED: C2 and GRAM domain-containing pro...    902   0.0      
ref|XP_009101380.1|  PREDICTED: C2 and GRAM domain-containing pro...    901   0.0      
gb|KFK31345.1|  hypothetical protein AALP_AA6G100200                    900   0.0      
ref|XP_010542178.1|  PREDICTED: C2 and GRAM domain-containing pro...    900   0.0      
emb|CDY17701.1|  BnaA06g35200D                                          900   0.0      
ref|XP_006306660.1|  hypothetical protein CARUB_v10008175mg             900   0.0      
ref|XP_010457346.1|  PREDICTED: C2 and GRAM domain-containing pro...    899   0.0      
ref|XP_009782111.1|  PREDICTED: C2 and GRAM domain-containing pro...    899   0.0      
ref|XP_006597618.1|  PREDICTED: C2 and GRAM domain-containing pro...    898   0.0      
ref|XP_003546208.1|  PREDICTED: C2 and GRAM domain-containing pro...    898   0.0      
ref|XP_009617773.1|  PREDICTED: C2 and GRAM domain-containing pro...    898   0.0      
ref|XP_010481954.1|  PREDICTED: C2 and GRAM domain-containing pro...    897   0.0      
ref|XP_010474962.1|  PREDICTED: C2 and GRAM domain-containing pro...    897   0.0      
gb|EMT08962.1|  E3 ubiquitin-protein ligase NEDD4-like protein          896   0.0      
ref|XP_008649312.1|  PREDICTED: C2 and GRAM domain-containing pro...    896   0.0      
ref|XP_010227754.1|  PREDICTED: C2 and GRAM domain-containing pro...    895   0.0      
ref|XP_003560795.1|  PREDICTED: C2 and GRAM domain-containing pro...    895   0.0      
ref|XP_002308750.1|  C2 domain-containing family protein                892   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010319216.1|  PREDICTED: C2 and GRAM domain-containing pro...    890   0.0      
ref|NP_001057439.1|  Os06g0297800                                       890   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEC77478.1|  hypothetical protein OsI_16308                          887   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006656035.1|  PREDICTED: C2 and GRAM domain-containing pro...    886   0.0      
ref|XP_010041253.1|  PREDICTED: C2 and GRAM domain-containing pro...    885   0.0      
ref|XP_004965266.1|  PREDICTED: C2 and GRAM domain-containing pro...    884   0.0      
ref|XP_003528713.1|  PREDICTED: C2 and GRAM domain-containing pro...    883   0.0      
gb|KEH32705.1|  C2 and GRAM domain plant-like protein                   882   0.0      
ref|XP_010686607.1|  PREDICTED: C2 and GRAM domain-containing pro...    882   0.0      
ref|XP_004507581.1|  PREDICTED: C2 and GRAM domain-containing pro...    882   0.0      
ref|XP_006350246.1|  PREDICTED: C2 and GRAM domain-containing pro...    882   0.0      
gb|EEC80442.1|  hypothetical protein OsI_22634                          881   0.0      Oryza sativa Indica Group [Indian rice]
gb|EAZ31085.1|  hypothetical protein OsJ_15182                          880   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_007147576.1|  hypothetical protein PHAVU_006G136200g             879   0.0      
ref|XP_002436905.1|  hypothetical protein SORBIDRAFT_10g010850          879   0.0      Sorghum bicolor [broomcorn]
ref|XP_010096488.1|  C2 and GRAM domain-containing protein              878   0.0      
ref|XP_007154067.1|  hypothetical protein PHAVU_003G088200g             871   0.0      
ref|XP_008464295.1|  PREDICTED: C2 and GRAM domain-containing pro...    863   0.0      
ref|XP_003637602.1|  Protein kinase C beta type                         870   0.0      
ref|XP_002889456.1|  C2 domain-containing protein                       895   0.0      
gb|KHG07899.1|  hypothetical protein F383_03817                         859   0.0      
ref|XP_006373576.1|  hypothetical protein POPTR_0016s00550g             863   0.0      
ref|XP_004139509.1|  PREDICTED: C2 and GRAM domain-containing pro...    864   0.0      
ref|XP_008464294.1|  PREDICTED: C2 and GRAM domain-containing pro...    862   0.0      
ref|XP_010059540.1|  PREDICTED: C2 and GRAM domain-containing pro...    858   0.0      
ref|XP_008659468.1|  PREDICTED: C2 and GRAM domain-containing pro...    855   0.0      
gb|KDO78670.1|  hypothetical protein CISIN_1g001764mg                   851   0.0      
gb|EMT18772.1|  Protein unc-13-C-like protein                           853   0.0      
gb|EEC83795.1|  hypothetical protein OsI_29710                          849   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006659530.1|  PREDICTED: C2 and GRAM domain-containing pro...    846   0.0      
gb|KCW44495.1|  hypothetical protein EUGRSUZ_L01993                     842   0.0      
ref|XP_004973782.1|  PREDICTED: C2 and GRAM domain-containing pro...    841   0.0      
dbj|BAD10009.1|  C2 domain/GRAM domain-containing protein-like          840   0.0      Oryza sativa Japonica Group [Japonica rice]
dbj|BAK01942.1|  predicted protein                                      839   0.0      
ref|XP_011086285.1|  PREDICTED: C2 and GRAM domain-containing pro...    838   0.0      
ref|XP_002445961.1|  hypothetical protein SORBIDRAFT_07g028720          834   0.0      Sorghum bicolor [broomcorn]
ref|XP_006601389.1|  PREDICTED: C2 and GRAM domain-containing pro...    831   0.0      
gb|KHN03556.1|  C2 and GRAM domain-containing protein                   825   0.0      
ref|XP_003574689.1|  PREDICTED: C2 and GRAM domain-containing pro...    828   0.0      
ref|XP_010227753.1|  PREDICTED: C2 and GRAM domain-containing pro...    820   0.0      
gb|EPS70354.1|  hypothetical protein M569_04402                         817   0.0      
ref|XP_008224646.1|  PREDICTED: C2 and GRAM domain-containing pro...    808   0.0      
ref|XP_008645404.1|  PREDICTED: uncharacterized protein LOC100383...    815   0.0      
ref|XP_004152568.1|  PREDICTED: C2 and GRAM domain-containing pro...    803   0.0      
ref|XP_006656227.1|  PREDICTED: C2 and GRAM domain-containing pro...    809   0.0      
ref|NP_001174893.1|  Os06g0607900                                       808   0.0      
ref|NP_001046217.1|  Os02g0199800                                       807   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006648430.1|  PREDICTED: C2 and GRAM domain-containing pro...    803   0.0      
ref|XP_004967194.1|  PREDICTED: C2 and GRAM domain-containing pro...    804   0.0      
gb|EMT06152.1|  hypothetical protein F775_19907                         798   0.0      
tpg|DAA47800.1|  TPA: hypothetical protein ZEAMMB73_755076              795   0.0      
ref|XP_010233994.1|  PREDICTED: C2 and GRAM domain-containing pro...    793   0.0      
ref|XP_004954663.1|  PREDICTED: C2 and GRAM domain-containing pro...    793   0.0      
ref|XP_003571080.1|  PREDICTED: C2 and GRAM domain-containing pro...    793   0.0      
dbj|BAJ99131.1|  predicted protein                                      790   0.0      
ref|XP_008645391.1|  PREDICTED: C2 and GRAM domain-containing pro...    786   0.0      
ref|NP_001053081.2|  Os04g0476600                                       769   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008659765.1|  PREDICTED: C2 and GRAM domain-containing pro...    780   0.0      
gb|KCW44492.1|  hypothetical protein EUGRSUZ_L01991                     776   0.0      
ref|XP_003563646.1|  PREDICTED: C2 and GRAM domain-containing pro...    783   0.0      
ref|XP_002437261.1|  hypothetical protein SORBIDRAFT_10g023780          783   0.0      Sorghum bicolor [broomcorn]
ref|XP_008659764.1|  PREDICTED: C2 and GRAM domain-containing pro...    782   0.0      
gb|AFW87239.1|  hypothetical protein ZEAMMB73_926045                    781   0.0      
gb|KCW75057.1|  hypothetical protein EUGRSUZ_E038332                    758   0.0      
gb|KCW75056.1|  hypothetical protein EUGRSUZ_E038332                    754   0.0      
ref|XP_006350247.1|  PREDICTED: C2 and GRAM domain-containing pro...    759   0.0      
gb|EMT09824.1|  hypothetical protein F775_15805                         757   0.0      
ref|XP_006584108.1|  PREDICTED: C2 and GRAM domain-containing pro...    751   0.0      
ref|XP_006584109.1|  PREDICTED: C2 and GRAM domain-containing pro...    751   0.0      
gb|KDO78674.1|  hypothetical protein CISIN_1g001764mg                   742   0.0      
gb|AFW77021.1|  hypothetical protein ZEAMMB73_177708                    734   0.0      
gb|KDO78673.1|  hypothetical protein CISIN_1g001764mg                   723   0.0      
gb|EEE56511.1|  hypothetical protein OsJ_05785                          733   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEC72691.1|  hypothetical protein OsI_06266                          733   0.0      Oryza sativa Indica Group [Indian rice]
gb|EEE65992.1|  hypothetical protein OsJ_21926                          729   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006449998.1|  hypothetical protein CICLE_v10014339mg             712   0.0      
ref|XP_008669268.1|  PREDICTED: LOW QUALITY PROTEIN: C2 and GRAM ...    716   0.0      
tpg|DAA37318.1|  TPA: hypothetical protein ZEAMMB73_013076              712   0.0      
ref|XP_010534150.1|  PREDICTED: C2 and GRAM domain-containing pro...    698   0.0      
ref|XP_002453494.1|  hypothetical protein SORBIDRAFT_04g006820          699   0.0      Sorghum bicolor [broomcorn]
ref|XP_004172925.1|  PREDICTED: C2 and GRAM domain-containing pro...    688   0.0      
gb|AFW70710.1|  hypothetical protein ZEAMMB73_250706                    691   0.0      
ref|XP_006476882.1|  PREDICTED: C2 and GRAM domain-containing pro...    686   0.0      
ref|XP_002983682.1|  hypothetical protein SELMODRAFT_118690             664   0.0      
ref|XP_001780685.1|  predicted protein                                  657   0.0      
ref|XP_008645392.1|  PREDICTED: C2 and GRAM domain-containing pro...    654   0.0      
ref|XP_001772096.1|  predicted protein                                  648   0.0      
gb|KCW75058.1|  hypothetical protein EUGRSUZ_E038332                    623   0.0      
ref|XP_001757231.1|  predicted protein                                  632   0.0      
ref|XP_002989013.1|  hypothetical protein SELMODRAFT_235662             630   0.0      
ref|XP_001780836.1|  predicted protein                                  624   0.0      
ref|XP_008645394.1|  PREDICTED: C2 and GRAM domain-containing pro...    618   0.0      
ref|XP_008645393.1|  PREDICTED: C2 and GRAM domain-containing pro...    615   0.0      
ref|XP_001764304.1|  predicted protein                                  618   0.0      
ref|XP_010041254.1|  PREDICTED: C2 and GRAM domain-containing pro...    599   0.0      
gb|EEC80948.1|  hypothetical protein OsI_23655                          594   0.0      Oryza sativa Indica Group [Indian rice]
dbj|BAK04293.1|  predicted protein                                      543   4e-178   
gb|KDO78669.1|  hypothetical protein CISIN_1g001764mg                   538   2e-170   
gb|KHN32056.1|  C2 and GRAM domain-containing protein                   518   5e-166   
gb|EEE65563.1|  hypothetical protein OsJ_21055                          482   2e-148   Oryza sativa Japonica Group [Japonica rice]
gb|EPS61881.1|  hypothetical protein M569_12912                         454   7e-143   
ref|XP_010102692.1|  hypothetical protein L484_002066                   404   4e-128   
gb|AFW77022.1|  hypothetical protein ZEAMMB73_177708                    414   1e-127   
ref|NP_001062120.2|  Os08g0492400                                       384   2e-117   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD35614.1|  C2 domain-containing protein-like                      368   9e-114   Oryza sativa Japonica Group [Japonica rice]
gb|EPS58216.1|  hypothetical protein M569_16599                         315   8e-94    
ref|NP_001169856.1|  uncharacterized protein LOC100383749               310   3e-92    Zea mays [maize]
emb|CDP19011.1|  unnamed protein product                                263   1e-74    
gb|AFW66425.1|  hypothetical protein ZEAMMB73_887274                    219   1e-57    
ref|XP_004159121.1|  PREDICTED: C2 and GRAM domain-containing pro...    171   2e-44    
gb|EEC83135.1|  hypothetical protein OsI_28316                          164   5e-42    Oryza sativa Indica Group [Indian rice]
gb|EEC80958.1|  hypothetical protein OsI_23674                          176   1e-41    Oryza sativa Indica Group [Indian rice]
gb|AFW66424.1|  hypothetical protein ZEAMMB73_887274                    133   1e-29    
ref|XP_009757623.1|  PREDICTED: C2 and GRAM domain-containing pro...    120   1e-24    
emb|CDP10870.1|  unnamed protein product                                119   2e-24    
ref|XP_004294667.1|  PREDICTED: C2 and GRAM domain-containing pro...    117   1e-23    
gb|AES90265.2|  C2 and GRAM domain plant-like protein                   115   3e-23    
ref|XP_002273984.2|  PREDICTED: C2 and GRAM domain-containing pro...    115   3e-23    Vitis vinifera
ref|XP_003608068.1|  GRAM domain-containing protein                     115   3e-23    
ref|XP_008391883.1|  PREDICTED: C2 and GRAM domain-containing pro...    115   3e-23    
ref|XP_008391885.1|  PREDICTED: C2 and GRAM domain-containing pro...    115   3e-23    
ref|XP_009618040.1|  PREDICTED: C2 and GRAM domain-containing pro...    115   4e-23    
ref|XP_008391884.1|  PREDICTED: C2 and GRAM domain-containing pro...    115   5e-23    
ref|XP_004505156.1|  PREDICTED: C2 and GRAM domain-containing pro...    114   9e-23    
ref|XP_006583859.1|  PREDICTED: C2 and GRAM domain-containing pro...    113   1e-22    
ref|XP_008222498.1|  PREDICTED: C2 and GRAM domain-containing pro...    113   2e-22    
ref|XP_003528491.1|  PREDICTED: C2 and GRAM domain-containing pro...    112   3e-22    
ref|XP_009371555.1|  PREDICTED: C2 and GRAM domain-containing pro...    112   5e-22    
ref|XP_009371557.1|  PREDICTED: C2 and GRAM domain-containing pro...    111   6e-22    
ref|XP_006583858.1|  PREDICTED: C2 and GRAM domain-containing pro...    111   8e-22    
ref|XP_009371556.1|  PREDICTED: C2 and GRAM domain-containing pro...    111   8e-22    
ref|XP_007156566.1|  hypothetical protein PHAVU_003G296800g             110   1e-21    
ref|XP_006350733.1|  PREDICTED: C2 and GRAM domain-containing pro...    109   3e-21    
ref|XP_003518872.1|  PREDICTED: C2 and GRAM domain-containing pro...    107   1e-20    
gb|KDP44241.1|  hypothetical protein JCGZ_05708                         105   4e-20    
gb|EEC77481.1|  hypothetical protein OsI_16312                          106   4e-20    Oryza sativa Indica Group [Indian rice]
ref|XP_007033741.1|  C2 domain-containing protein / GRAM domain-c...    105   5e-20    
gb|EMT19412.1|  hypothetical protein F775_29064                         103   1e-19    
ref|XP_011091547.1|  PREDICTED: C2 and GRAM domain-containing pro...    103   1e-19    
ref|XP_009801286.1|  PREDICTED: C2 and GRAM domain-containing pro...    104   1e-19    
ref|XP_004244757.1|  PREDICTED: C2 and GRAM domain-containing pro...    103   2e-19    
ref|XP_001766350.1|  predicted protein                                  102   2e-19    
ref|XP_011091545.1|  PREDICTED: C2 and GRAM domain-containing pro...    103   2e-19    
ref|XP_009801287.1|  PREDICTED: C2 and GRAM domain-containing pro...    103   2e-19    
ref|XP_009801288.1|  PREDICTED: C2 and GRAM domain-containing pro...    103   2e-19    
ref|XP_009602446.1|  PREDICTED: C2 and GRAM domain-containing pro...    103   3e-19    
ref|XP_008391886.1|  PREDICTED: C2 and GRAM domain-containing pro...    102   3e-19    
ref|XP_007033742.1|  C2 domain-containing protein / GRAM domain-c...    102   3e-19    
ref|XP_010039308.1|  PREDICTED: C2 and GRAM domain-containing pro...    103   3e-19    
gb|EYU40941.1|  hypothetical protein MIMGU_mgv1a003399mg                102   4e-19    
ref|XP_011037387.1|  PREDICTED: C2 and GRAM domain-containing pro...    102   4e-19    
ref|XP_011037388.1|  PREDICTED: C2 and GRAM domain-containing pro...    102   5e-19    
ref|XP_006478648.1|  PREDICTED: C2 and GRAM domain-containing pro...    102   6e-19    
ref|XP_009602447.1|  PREDICTED: C2 and GRAM domain-containing pro...    102   7e-19    
ref|XP_010672421.1|  PREDICTED: C2 and GRAM domain-containing pro...    101   8e-19    
ref|XP_006376441.1|  C2 domain-containing family protein                102   8e-19    
ref|XP_009602445.1|  PREDICTED: C2 and GRAM domain-containing pro...    102   8e-19    
ref|XP_010672420.1|  PREDICTED: C2 and GRAM domain-containing pro...    101   9e-19    
ref|XP_006478649.1|  PREDICTED: C2 and GRAM domain-containing pro...    101   1e-18    
ref|XP_006442786.1|  hypothetical protein CICLE_v10019435mg             101   1e-18    
ref|XP_009602448.1|  PREDICTED: C2 and GRAM domain-containing pro...    101   2e-18    
gb|AES90266.2|  C2 and GRAM domain plant-like protein                   100   2e-18    
ref|NP_001063676.1|  Os09g0516900                                       100   2e-18    
ref|XP_008788228.1|  PREDICTED: C2 and GRAM domain-containing pro...  99.8    3e-18    
ref|XP_010545876.1|  PREDICTED: C2 and GRAM domain-containing pro...  99.8    4e-18    
ref|XP_008788227.1|  PREDICTED: C2 and GRAM domain-containing pro...    100   4e-18    
ref|XP_010547404.1|  PREDICTED: C2 and GRAM domain-containing pro...  99.4    4e-18    
ref|XP_010322239.1|  PREDICTED: C2 and GRAM domain-containing pro...  99.4    5e-18    
ref|XP_009371558.1|  PREDICTED: GRAM domain-containing protein YS...  98.6    5e-18    
gb|EEE70054.1|  hypothetical protein OsJ_30019                        99.8    5e-18    
ref|XP_010258476.1|  PREDICTED: C2 and GRAM domain-containing pro...  99.8    5e-18    
ref|XP_004241139.1|  PREDICTED: C2 and GRAM domain-containing pro...  99.4    5e-18    
ref|XP_006858769.1|  hypothetical protein AMTR_s00066p00150730        98.6    8e-18    
ref|XP_010908904.1|  PREDICTED: C2 and GRAM domain-containing pro...  98.6    1e-17    
ref|XP_009104213.1|  PREDICTED: C2 and GRAM domain-containing pro...  98.2    1e-17    
emb|CDX67805.1|  BnaA07g18450D                                        98.2    1e-17    
ref|XP_004957363.1|  PREDICTED: C2 and GRAM domain-containing pro...  98.2    1e-17    
ref|XP_009385128.1|  PREDICTED: C2 and GRAM domain-containing pro...  97.8    2e-17    
ref|NP_001141459.1|  uncharacterized protein LOC100273569             97.4    2e-17    
ref|XP_006494057.1|  PREDICTED: C2 and GRAM domain-containing pro...  97.4    2e-17    
ref|XP_006402669.1|  hypothetical protein EUTSA_v10005851mg           97.4    2e-17    
ref|XP_007033743.1|  C2 domain-containing protein / GRAM domain-c...  97.1    2e-17    
ref|XP_008454047.1|  PREDICTED: C2 and GRAM domain-containing pro...  96.7    4e-17    
ref|XP_003608069.1|  GRAM domain-containing protein                   95.1    5e-17    
ref|XP_010546602.1|  PREDICTED: C2 and GRAM domain-containing pro...  95.5    7e-17    
ref|XP_008645905.1|  PREDICTED: uncharacterized protein YFL042C-like  95.5    8e-17    
ref|XP_010039309.1|  PREDICTED: C2 and GRAM domain-containing pro...  95.5    8e-17    
ref|XP_009402683.1|  PREDICTED: C2 and GRAM domain-containing pro...  95.5    1e-16    
emb|CDX98386.1|  BnaC06g17470D                                        95.1    1e-16    
ref|XP_004152131.1|  PREDICTED: C2 and GRAM domain-containing pro...  95.1    1e-16    
ref|XP_004156962.1|  PREDICTED: LOW QUALITY PROTEIN: C2 and GRAM ...  95.1    1e-16    
ref|XP_010524179.1|  PREDICTED: C2 and GRAM domain-containing pro...  94.7    1e-16    
ref|XP_006290785.1|  hypothetical protein CARUB_v10016889mg           94.7    1e-16    
gb|EEC84888.1|  hypothetical protein OsI_32049                        94.7    1e-16    
ref|XP_010524178.1|  PREDICTED: C2 and GRAM domain-containing pro...  94.7    2e-16    
ref|XP_003578445.1|  PREDICTED: C2 and GRAM domain-containing pro...  94.4    2e-16    
ref|XP_008802035.1|  PREDICTED: C2 and GRAM domain-containing pro...  94.0    3e-16    
ref|NP_191525.2|  C2 domain and GRAM domain-containing protein        93.6    3e-16    
ref|XP_008790581.1|  PREDICTED: C2 and GRAM domain-containing pro...  93.6    3e-16    
ref|XP_009392594.1|  PREDICTED: C2 and GRAM domain-containing pro...  93.6    4e-16    
gb|KHN31027.1|  C2 and GRAM domain-containing protein                 92.8    5e-16    
ref|XP_006661438.1|  PREDICTED: C2 and GRAM domain-containing pro...  92.4    8e-16    
ref|XP_006494054.1|  PREDICTED: C2 and GRAM domain-containing pro...  92.0    1e-15    
ref|XP_009116634.1|  PREDICTED: C2 and GRAM domain-containing pro...  92.0    1e-15    
gb|KHG22381.1|  hypothetical protein F383_02494                       91.7    1e-15    
ref|XP_007144096.1|  hypothetical protein PHAVU_007G128400g           85.5    1e-15    
ref|XP_002981541.1|  hypothetical protein SELMODRAFT_444923           91.7    2e-15    
ref|XP_006583860.1|  PREDICTED: C2 and GRAM domain-containing pro...  90.9    2e-15    
ref|XP_011091999.1|  PREDICTED: periaxin-like                         87.8    2e-15    
ref|XP_010258477.1|  PREDICTED: C2 and GRAM domain-containing pro...  90.1    3e-15    
gb|KCW75059.1|  hypothetical protein EUGRSUZ_E038331                  87.4    6e-15    
ref|XP_007033744.1|  C2 domain-containing protein / GRAM domain-c...  89.0    7e-15    
emb|CDY68264.1|  BnaAnng26660D                                        89.0    9e-15    
ref|XP_004955064.1|  PREDICTED: uncharacterized protein LOC101784236  89.0    1e-14    
ref|XP_007221786.1|  hypothetical protein PRUPE_ppa003846mg           88.6    1e-14    
ref|XP_010512241.1|  PREDICTED: C2 and GRAM domain-containing pro...  88.6    1e-14    
ref|XP_006494056.1|  PREDICTED: C2 and GRAM domain-containing pro...  88.2    1e-14    
ref|XP_006290786.1|  hypothetical protein CARUB_v10016889mg           88.2    2e-14    
ref|XP_002878285.1|  C2 domain-containing protein                     87.4    3e-14    
ref|XP_010101387.1|  C2 and GRAM domain-containing protein            86.7    5e-14    
ref|XP_010322238.1|  PREDICTED: C2 and GRAM domain-containing pro...  85.9    8e-14    
gb|KHN32360.1|  C2 and GRAM domain-containing protein                 83.2    8e-14    
gb|AFW72244.1|  hypothetical protein ZEAMMB73_537834                  85.1    1e-13    
ref|XP_002531896.1|  conserved hypothetical protein                   85.1    1e-13    
ref|XP_006575025.1|  PREDICTED: C2 and GRAM domain-containing pro...  82.8    1e-13    
ref|XP_006402668.1|  hypothetical protein EUTSA_v10005851mg           82.0    1e-12    
ref|XP_002462667.1|  hypothetical protein SORBIDRAFT_02g029920        81.6    2e-12    
ref|XP_010324704.1|  PREDICTED: uncharacterized protein YFL042C-l...  80.1    3e-12    
ref|XP_009801289.1|  PREDICTED: uncharacterized protein LOC104247...  79.0    9e-12    
ref|XP_002963538.1|  hypothetical protein SELMODRAFT_438370           79.0    1e-11    
ref|XP_006367738.1|  PREDICTED: C2 and GRAM domain-containing pro...  76.3    1e-11    
ref|XP_009602449.1|  PREDICTED: C2 and GRAM domain-containing pro...  77.8    3e-11    
ref|XP_010322241.1|  PREDICTED: C2 and GRAM domain-containing pro...  76.3    6e-11    
emb|CAB75463.1|  putative protein                                     76.3    8e-11    
ref|XP_007156563.1|  hypothetical protein PHAVU_003G296600g           74.7    1e-10    
ref|XP_010927901.1|  PREDICTED: uncharacterized protein LOC105049834  75.5    1e-10    
ref|XP_006575027.1|  PREDICTED: C2 and GRAM domain-containing pro...  72.8    2e-10    
ref|XP_007033745.1|  C2 domain-containing protein / GRAM domain-c...  74.3    3e-10    
ref|XP_007156562.1|  hypothetical protein PHAVU_003G296600g           73.9    3e-10    
gb|KDO63985.1|  hypothetical protein CISIN_1g0097412mg                70.9    7e-10    
gb|EPS67224.1|  hypothetical protein M569_07552                       69.3    2e-09    
gb|KDO63990.1|  hypothetical protein CISIN_1g0097412mg                67.8    7e-09    
ref|XP_006442785.1|  hypothetical protein CICLE_v100194231mg          69.3    9e-09    
ref|XP_010718820.1|  PREDICTED: rasGAP-activating-like protein 1 ...  69.7    1e-08    
ref|XP_010718821.1|  PREDICTED: rasGAP-activating-like protein 1 ...  69.7    1e-08    
ref|XP_010718819.1|  PREDICTED: rasGAP-activating-like protein 1 ...  69.7    1e-08    
ref|XP_010718815.1|  PREDICTED: rasGAP-activating-like protein 1 ...  69.7    1e-08    
ref|XP_010718818.1|  PREDICTED: rasGAP-activating-like protein 1 ...  69.7    1e-08    
ref|XP_011089290.1|  PREDICTED: GRAM domain-containing protein 1A     68.9    2e-08    
ref|XP_007033746.1|  C2 domain-containing protein / GRAM domain-c...  67.8    3e-08    
emb|CAH65455.1|  hypothetical protein RCJMB04_38n18                   65.1    5e-08    
emb|CDW81106.1|  c2 domain containing protein                         67.4    5e-08    
gb|ERL92928.1|  hypothetical protein D910_10233                       67.4    7e-08    
gb|ENN78073.1|  hypothetical protein YQE_05227                        67.4    7e-08    
ref|XP_001234363.3|  PREDICTED: LOW QUALITY PROTEIN: rasGAP-activ...  67.4    8e-08    
ref|XP_008393317.1|  PREDICTED: synaptotagmin-4-like                  66.6    1e-07    
ref|XP_010265119.1|  PREDICTED: synaptotagmin-5                       65.9    2e-07    
ref|XP_005644339.1|  hypothetical protein COCSUDRAFT_44606            64.3    2e-07    
ref|XP_006936814.1|  PREDICTED: GRAM domain-containing protein 1B     65.5    2e-07    
gb|KHG10278.1|  GRAM domain-containing 1A                             63.2    3e-07    
emb|CDQ58067.1|  unnamed protein product                              65.5    3e-07    
ref|XP_001782367.1|  predicted protein                                64.7    4e-07    
ref|XP_001010473.1|  GRAM domain containing protein                   63.9    5e-07    
ref|XP_003037441.1|  hypothetical protein SCHCODRAFT_73465            64.3    6e-07    
ref|XP_010036898.1|  PREDICTED: synaptotagmin-5 isoform X2            63.9    6e-07    
emb|CAL64987.1|  NTMC2Type3.1 protein                                 63.5    7e-07    
dbj|BAE32513.1|  unnamed protein product                              62.4    7e-07    
ref|XP_009360151.1|  PREDICTED: extended synaptotagmin-1-like         63.9    7e-07    
ref|XP_010036897.1|  PREDICTED: synaptotagmin-5 isoform X1            63.9    7e-07    
ref|XP_009380300.1|  PREDICTED: extended synaptotagmin-1 isoform X2   63.5    8e-07    
ref|XP_007134469.1|  hypothetical protein PHAVU_010G049900g           63.2    1e-06    
ref|XP_007134471.1|  hypothetical protein PHAVU_010G049900g           63.2    1e-06    
ref|XP_010238210.1|  PREDICTED: uncharacterized membrane protein ...  63.2    1e-06    
ref|XP_007134470.1|  hypothetical protein PHAVU_010G049900g           63.2    1e-06    
ref|XP_010094745.1|  RasGAP-activating-like protein 1                 63.5    1e-06    
ref|XP_007134468.1|  hypothetical protein PHAVU_010G049900g           63.2    1e-06    
ref|XP_001783326.1|  predicted protein                                63.2    1e-06    
ref|XP_006517527.1|  PREDICTED: multiple C2 domains, transmembran...  63.2    1e-06    
emb|CCH41852.1|  hypothetical protein BN7_1391                        63.2    1e-06    
ref|XP_780282.3|  PREDICTED: multiple C2 and transmembrane domain...  63.2    1e-06    
ref|XP_004968071.1|  PREDICTED: extended synaptotagmin-1-like         63.2    1e-06    
ref|XP_009292157.1|  PREDICTED: GRAM domain-containing protein 1B...  63.2    1e-06    
ref|XP_009380299.1|  PREDICTED: extended synaptotagmin-1 isoform X1   62.8    1e-06    
ref|XP_004512919.1|  PREDICTED: synaptotagmin-4-like                  62.8    2e-06    
ref|XP_006730823.1|  PREDICTED: GRAM domain-containing protein 1A     60.1    2e-06    
ref|XP_004353040.1|  C2 domain containing protein                     58.9    2e-06    
ref|XP_006517530.1|  PREDICTED: multiple C2 domains, transmembran...  62.8    2e-06    
ref|XP_683776.6|  PREDICTED: GRAM domain-containing protein 1A is...  62.4    2e-06    
ref|XP_007432263.1|  PREDICTED: GRAM domain-containing protein 1A...  62.4    2e-06    
ref|XP_005141435.1|  PREDICTED: ras GTPase-activating protein 4       62.0    2e-06    
ref|XP_004470700.1|  PREDICTED: multiple C2 and transmembrane dom...  62.4    2e-06    
ref|NP_001092921.1|  ras GTPase-activating protein 4                  62.4    2e-06    
ref|XP_009292158.1|  PREDICTED: GRAM domain-containing protein 1B...  62.4    2e-06    
ref|XP_007432264.1|  PREDICTED: GRAM domain-containing protein 1A...  62.4    2e-06    
ref|XP_005661609.1|  PREDICTED: multiple C2 and transmembrane dom...  61.6    2e-06    
ref|XP_005158319.1|  PREDICTED: GRAM domain-containing protein 1A...  62.4    2e-06    
ref|XP_005158322.1|  PREDICTED: GRAM domain-containing protein 1A...  62.0    2e-06    
ref|XP_008240262.1|  PREDICTED: extended synaptotagmin-1 isoform X2   62.0    2e-06    
ref|XP_004470698.1|  PREDICTED: multiple C2 and transmembrane dom...  62.0    2e-06    
ref|XP_005172052.1|  PREDICTED: ras GTPase-activating protein 4 i...  62.4    2e-06    
ref|XP_009290864.1|  PREDICTED: GRAM domain-containing protein 1A...  62.4    2e-06    
ref|XP_004470696.1|  PREDICTED: multiple C2 and transmembrane dom...  62.0    3e-06    
ref|XP_005382306.1|  PREDICTED: multiple C2 and transmembrane dom...  62.4    3e-06    
gb|KFP88769.1|  Ras GTPase-activating protein 4                       61.6    3e-06    
ref|XP_005871571.1|  PREDICTED: multiple C2 and transmembrane dom...  62.0    3e-06    
ref|XP_004470699.1|  PREDICTED: multiple C2 and transmembrane dom...  62.0    3e-06    
ref|XP_004470701.1|  PREDICTED: multiple C2 and transmembrane dom...  62.0    3e-06    
ref|XP_004470702.1|  PREDICTED: multiple C2 and transmembrane dom...  62.0    3e-06    
ref|XP_008672078.1|  PREDICTED: uncharacterized protein LOC100192...  62.0    3e-06    
ref|XP_008240261.1|  PREDICTED: extended synaptotagmin-1 isoform X1   62.0    3e-06    
ref|XP_004470697.1|  PREDICTED: multiple C2 and transmembrane dom...  62.0    3e-06    
ref|XP_006775598.1|  PREDICTED: multiple C2 and transmembrane dom...  61.6    3e-06    
gb|EFX68200.1|  hypothetical protein DAPPUDRAFT_32816                 58.5    3e-06    
ref|XP_005871574.1|  PREDICTED: multiple C2 and transmembrane dom...  61.6    3e-06    
ref|XP_007245318.1|  PREDICTED: ras GTPase-activating protein 4-l...  61.6    3e-06    
ref|XP_009959534.1|  PREDICTED: LOW QUALITY PROTEIN: ras GTPase-a...  60.8    3e-06    
ref|XP_002511583.1|  conserved hypothetical protein                   61.6    3e-06    
gb|KFQ39253.1|  Putative Ras GTPase-activating protein 4B             57.4    3e-06    
ref|XP_008773239.1|  PREDICTED: multiple C2 and transmembrane dom...  61.2    3e-06    
ref|XP_006517534.1|  PREDICTED: multiple C2 domains, transmembran...  61.6    3e-06    
ref|XP_009896737.1|  PREDICTED: LOW QUALITY PROTEIN: ras GTPase-a...  61.2    3e-06    
ref|XP_005842418.1|  hypothetical protein GUITHDRAFT_40140            57.8    3e-06    
dbj|BAC35795.1|  unnamed protein product                              60.8    3e-06    
ref|XP_006775597.1|  PREDICTED: multiple C2 and transmembrane dom...  61.6    4e-06    
gb|KFV68046.1|  Multiple C2 and transmembrane domain-containing p...  58.5    4e-06    
ref|XP_006775601.1|  PREDICTED: multiple C2 and transmembrane dom...  61.2    4e-06    
gb|KFM81461.1|  Multiple C2 and transmembrane domain-containing p...  58.5    4e-06    
ref|XP_005871573.1|  PREDICTED: multiple C2 and transmembrane dom...  61.6    4e-06    
ref|XP_008101266.1|  PREDICTED: multiple C2 and transmembrane dom...  61.6    4e-06    
ref|XP_006775600.1|  PREDICTED: multiple C2 and transmembrane dom...  61.2    4e-06    
ref|XP_004840166.1|  PREDICTED: LOW QUALITY PROTEIN: ras GTPase-a...  61.6    4e-06    
ref|XP_007531479.1|  PREDICTED: multiple C2 and transmembrane dom...  61.6    4e-06    
ref|XP_009414314.1|  PREDICTED: C2 and GRAM domain-containing pro...  61.2    4e-06    
ref|XP_007245317.1|  PREDICTED: ras GTPase-activating protein 4-l...  61.6    4e-06    
ref|XP_008101265.1|  PREDICTED: multiple C2 and transmembrane dom...  61.6    4e-06    
ref|XP_008101264.1|  PREDICTED: multiple C2 and transmembrane dom...  61.6    4e-06    
ref|XP_415761.4|  PREDICTED: DNA-directed RNA polymerase II subun...  61.6    4e-06    
ref|NP_001278710.1|  ras GTPase-activating protein 4                  61.6    4e-06    
ref|XP_005871572.1|  PREDICTED: multiple C2 and transmembrane dom...  61.6    4e-06    
ref|XP_004957746.1|  PREDICTED: probable ADP-ribosylation factor ...  58.2    4e-06    
ref|XP_007078971.1|  PREDICTED: multiple C2 and transmembrane dom...  61.2    4e-06    
ref|XP_006775595.1|  PREDICTED: multiple C2 and transmembrane dom...  61.6    4e-06    
ref|XP_008160257.1|  PREDICTED: multiple C2 and transmembrane dom...  61.2    4e-06    
ref|XP_006927915.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...  61.2    4e-06    
ref|XP_009555668.1|  PREDICTED: LOW QUALITY PROTEIN: rasGAP-activ...  61.2    4e-06    
gb|KFO73562.1|  RasGAP-activating-like 1                              60.8    4e-06    
ref|XP_009011940.1|  hypothetical protein HELRODRAFT_109459           60.1    4e-06    
ref|XP_010663606.1|  PREDICTED: uncharacterized protein LOC100262...  61.2    4e-06    
ref|XP_008323795.1|  PREDICTED: multiple C2 and transmembrane dom...  60.8    4e-06    
gb|EHB01665.1|  Ras GTPase-activating protein 4                       61.2    4e-06    
ref|XP_006775596.1|  PREDICTED: multiple C2 and transmembrane dom...  61.2    4e-06    
gb|EEE70134.1|  hypothetical protein OsJ_30169                        60.8    4e-06    
ref|XP_007976935.1|  PREDICTED: multiple C2 and transmembrane dom...  61.2    5e-06    
ref|XP_008583686.1|  PREDICTED: multiple C2 and transmembrane dom...  60.1    5e-06    
ref|XP_007078970.1|  PREDICTED: multiple C2 and transmembrane dom...  61.2    5e-06    
ref|XP_006739908.1|  PREDICTED: multiple C2 and transmembrane dom...  60.8    5e-06    
gb|EXX78800.1|  Ysp2p                                                 61.2    5e-06    
ref|XP_010916385.1|  PREDICTED: synaptotagmin-5 isoform X2            61.2    5e-06    
emb|CEG82225.1|  hypothetical protein RMATCC62417_16332               57.8    5e-06    
gb|EPQ10977.1|  Multiple C2 and transmembrane domain-containing p...  61.2    5e-06    
ref|XP_010916384.1|  PREDICTED: synaptotagmin-5 isoform X1            61.2    5e-06    
ref|XP_004882642.1|  PREDICTED: LOW QUALITY PROTEIN: ras GTPase-a...  61.2    5e-06    
ref|XP_004348629.1|  predicted protein                                61.2    5e-06    
ref|XP_006517528.1|  PREDICTED: multiple C2 domains, transmembran...  61.2    5e-06    
ref|XP_006081274.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...  61.2    5e-06    
ref|XP_001636713.1|  predicted protein                                60.1    5e-06    
gb|EJY75738.1|  C2 domain containing protein                          60.8    5e-06    
ref|XP_010678002.1|  PREDICTED: extended synaptotagmin-1 isoform X2   60.8    5e-06    
ref|XP_009081113.1|  PREDICTED: LOW QUALITY PROTEIN: ras GTPase-a...  60.8    5e-06    
ref|XP_009447107.1|  PREDICTED: multiple C2 and transmembrane dom...  61.2    5e-06    
ref|XP_010830240.1|  PREDICTED: multiple C2 and transmembrane dom...  60.8    5e-06    
ref|XP_007432265.1|  PREDICTED: GRAM domain-containing protein 1A...  60.8    5e-06    
ref|XP_010201137.1|  PREDICTED: multiple C2 and transmembrane dom...  60.1    5e-06    
ref|XP_002942375.1|  PREDICTED: extended synaptotagmin-1-like         60.8    5e-06    
ref|XP_005326215.1|  PREDICTED: multiple C2 and transmembrane dom...  60.8    5e-06    
ref|XP_009899696.1|  PREDICTED: multiple C2 and transmembrane dom...  58.9    5e-06    



>ref|XP_009613733.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170 isoform 
X1 [Nicotiana tomentosiformis]
Length=1020

 Score =  1301 bits (3367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 639/908 (70%), Positives = 758/908 (83%), Gaps = 14/908 (2%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSS---------PKKVLEGK  421
             GKILLTLSLHGKG D+S+NH C+V P+  ++TS++ + I  SS         PKK+ EGK
Sbjct  118   GKILLTLSLHGKGKDVSSNHVCYVNPT--NDTSREHEVISKSSQDLHGFAAHPKKISEGK  175

Query  422   QLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCE  601
              L+K+IA H EKLF KNEE+ KS+EE SKKD+SS++S+  SDYED ++E+  S   SF E
Sbjct  176   HLMKNIACHFEKLFGKNEEAKKSDEEESKKDDSSDISTTTSDYEDCLEESPVSH--SFEE  233

Query  602   AIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
             AI+ +++ +E +EMP +LQGG+LLDQTY +  KD NMLLFAPDSQFR++LAELQGT D+ 
Sbjct  234   AIERMRTTSEDKEMPGDLQGGVLLDQTYVVSSKDLNMLLFAPDSQFRKDLAELQGTTDMH  293

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             EGPW+WKSD + CLTRVVTY K  +KLV++VQATEEQTY+K DGKEF+V V VSTPDVPY
Sbjct  294   EGPWSWKSD-EMCLTRVVTYMKAPSKLVRAVQATEEQTYVKADGKEFSVFVSVSTPDVPY  352

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             GSTFK+ELLY IMPG    SGEES  LV+SWA+ F ++TMMK++IEGG +QGLK+SF +F
Sbjct  353   GSTFKIELLYKIMPGQQESSGEESARLVVSWAINFSQNTMMKSMIEGGARQGLKESFYQF  412

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             +  LA+  KV TS  VL+    LA+L +EH SD ELA+EYF NFTVVST F+VLY  +HI
Sbjct  413   AEVLARKLKVTTSKVVLEKDRALASLQTEHQSDWELAKEYFWNFTVVSTIFMVLYVLVHI  472

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
             +LS  ++L GLE+HG DLPDSVGE IT GILVL LE+VY M++ FVEARLRRG+DHGV+A
Sbjct  473   ILSEPSKLHGLEYHGFDLPDSVGEFITSGILVLQLERVYNMVSRFVEARLRRGNDHGVKA  532

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              GDGWVLTVALIEG NL SLDPTGFPDP+VVFTCNGK+RTSSVQLQTLDPQW+EILEF+ 
Sbjct  533   QGDGWVLTVALIEGMNLTSLDPTGFPDPYVVFTCNGKTRTSSVQLQTLDPQWSEILEFDA  592

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
             AEEPPS+LDVEVFDFDGPFDQA SLGHAEINFLKHTSAELAD+W+PL GKIA SSQSKLH
Sbjct  593   AEEPPSVLDVEVFDFDGPFDQASSLGHAEINFLKHTSAELADIWVPLEGKIALSSQSKLH  652

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFL+NNNGVETIRD LTKMEKEVGKKLN+RSPH+NSTFQK FGLPPEEFLIND+SCSL
Sbjct  653   LRIFLDNNNGVETIRDYLTKMEKEVGKKLNVRSPHKNSTFQKIFGLPPEEFLINDYSCSL  712

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRK+PLQGRIFLS RIVGFYANLFGHKTKFFFLWEDIE++NV+ PS+STM SP+LVI+L 
Sbjct  713   KRKMPLQGRIFLSARIVGFYANLFGHKTKFFFLWEDIEDVNVVSPSWSTMWSPALVIVLR  772

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQY  2401
             K RG DAR+GA+  DEEGRLHFCFHSFVSF  ASRTIM LW+TR   PDQKAQI E QQ 
Sbjct  773   KGRGVDARHGARYQDEEGRLHFCFHSFVSFNVASRTIMVLWRTRTLPPDQKAQIVEVQQE  832

Query  2402  KDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYV  2581
             KDE  VL E+  SYL+VEDV MSKVYS +LP++ KSLM+MF+GGDLEH+VMSKSGCLNYV
Sbjct  833   KDEKLVLSEDNASYLVVEDVQMSKVYSGELPVSVKSLMQMFDGGDLEHRVMSKSGCLNYV  892

Query  2582  TSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFS  2761
             T+SWE + P+V ER VSYK NR IS+FG EVTSTQ+KS  AND GW +NEIMA+H VPF 
Sbjct  893   TTSWETVAPNVSERLVSYKFNRFISVFGGEVTSTQQKSPIANDGGWTINEIMALHDVPFG  952

Query  2762  DHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFV  2941
             DH++VQ RY+++  ++  NSC+CDV VGVMWLKNTK E RIT+N+V KF+ R+K+++E V
Sbjct  953   DHFRVQFRYEIKDSTSVHNSCKCDVSVGVMWLKNTKFEQRITRNVVGKFTTRLKDILELV  1012

Query  2942  GREVFLSS  2965
              RE+ LSS
Sbjct  1013  EREILLSS  1020



>ref|XP_006344470.1| PREDICTED: LOW QUALITY PROTEIN: C2 and GRAM domain-containing 
protein At5g50170-like [Solanum tuberosum]
Length=1028

 Score =  1286 bits (3327),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 638/908 (70%), Positives = 747/908 (82%), Gaps = 14/908 (2%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSS---------PKKVLEGK  421
             GKILLT+SLHGKG DLSTNH  +V P+  ++T K+++   +SS          KK+ EGK
Sbjct  117   GKILLTVSLHGKGKDLSTNHVGYVNPT--NDTFKEIEVTNISSQDFHGFAAHSKKISEGK  174

Query  422   QLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCE  601
              LIK+IA H EKLF KNEE+ KS+EE  KKD+SS+LS++ SD+ED V+E   S   SF E
Sbjct  175   HLIKNIACHFEKLFGKNEEAKKSDEEEVKKDDSSDLSTVTSDFEDPVEEPPVSH--SFEE  232

Query  602   AIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
              I+ +Q  +E +EMP +LQGG+LLDQTY LP K+ N  LFAP SQFR +LAELQGT DVQ
Sbjct  233   VIERMQPTSEDKEMPGDLQGGVLLDQTYVLPSKELNTFLFAPGSQFRNDLAELQGTIDVQ  292

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             EGPWTWKSD+  C+TRVVTY K A+KLVK+VQATEEQ Y+K DGKEFAV V V+TPDVPY
Sbjct  293   EGPWTWKSDDM-CVTRVVTYIKAASKLVKAVQATEEQAYIKADGKEFAVFVSVNTPDVPY  351

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             GSTFK+ELLY IMPG    SGEES  L+ISWA+ FC++TMMK++IEGG +QGLK+SF +F
Sbjct  352   GSTFKIELLYKIMPGQQEPSGEESARLIISWAINFCQNTMMKSMIEGGARQGLKESFDQF  411

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             +  LA+  KV TS  VL+    LA+L +E  SD E+A+EYF NFTVVST F+VLY  +HI
Sbjct  412   AELLARKLKVTTSKFVLEKDRALASLQTEQQSDWEMAKEYFWNFTVVSTIFMVLYVFVHI  471

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
             LLS  ++LQGLE +G DLPDSVGEIIT GILVL LE+VY M++ FVEARLRRG+D+GV+A
Sbjct  472   LLSEPSKLQGLESYGFDLPDSVGEIITSGILVLQLERVYYMVSRFVEARLRRGNDNGVKA  531

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              GDGWVLTVALIEG NLASLDPT  PDP+VV TCNGK++TSSVQLQTLDPQW+EILEF+ 
Sbjct  532   QGDGWVLTVALIEGMNLASLDPTDPPDPYVVLTCNGKTKTSSVQLQTLDPQWSEILEFDA  591

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
             AEEPPS+LDVEVFDFDGPFDQA SLGHAEINFLKHTSAELAD+W+PL GKIA SSQSKLH
Sbjct  592   AEEPPSVLDVEVFDFDGPFDQASSLGHAEINFLKHTSAELADIWVPLEGKIALSSQSKLH  651

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFL+NNNGVETIRD LTKMEKEVGKKLNLRSPH+NS FQK FGLPPEEFLIND+SCSL
Sbjct  652   LRIFLDNNNGVETIRDYLTKMEKEVGKKLNLRSPHKNSAFQKIFGLPPEEFLINDYSCSL  711

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRK+PLQGRIFLS RIVGFYANLFGHKTKFFFLWEDIE++NV+ PS+STMGSP+LV+IL 
Sbjct  712   KRKMPLQGRIFLSARIVGFYANLFGHKTKFFFLWEDIEDVNVVSPSWSTMGSPALVMILR  771

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQY  2401
             K RG DAR+GAK  DEEGRLHFCFHSFVSF  ASRTIMALW+TRA   DQK QI E Q  
Sbjct  772   KGRGVDARHGAKCQDEEGRLHFCFHSFVSFNDASRTIMALWRTRALPLDQKEQIVEAQLE  831

Query  2402  KDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYV  2581
             KDE   L E+T SYL+VEDV MSKVYS +LP+N KSLM MF+GGDLEH+VMSKSGCLNY 
Sbjct  832   KDEKLALSEDTSSYLVVEDVQMSKVYSAELPVNVKSLMRMFDGGDLEHRVMSKSGCLNYA  891

Query  2582  TSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFS  2761
             T+SWE + PDV ER+V YK NR ISIFG EVTSTQ+KS  AN +GW +NEIM +H VPF 
Sbjct  892   TTSWETVAPDVSERQVCYKFNRFISIFGGEVTSTQQKSPIANGSGWTINEIMVLHDVPFG  951

Query  2762  DHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFV  2941
             DH++VQ RY++ES ++  NSC+CDV VGVMWLKNTK E RIT+NI+ KF+ RVK+++E V
Sbjct  952   DHFRVQFRYQIESSTSLHNSCKCDVSVGVMWLKNTKFEQRITRNIIGKFTTRVKDILELV  1011

Query  2942  GREVFLSS  2965
              +E+ LSS
Sbjct  1012  EKEILLSS  1019



>ref|XP_004236263.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170 isoform 
X2 [Solanum lycopersicum]
Length=1019

 Score =  1286 bits (3327),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 635/908 (70%), Positives = 750/908 (83%), Gaps = 14/908 (2%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSS---------PKKVLEGK  421
             GK+LLT+SLHGKG  LSTNH  +V P+  ++TSK+ +   + S          KK+ EGK
Sbjct  117   GKVLLTVSLHGKGKGLSTNHVGYVNPT--NDTSKETEVTSIPSQDFHDFAAHSKKISEGK  174

Query  422   QLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCE  601
              L+K+IA H EKLF KNEE+ KS+EE  KKD+SS++S+I SD+ D V+E   S   SF E
Sbjct  175   HLMKNIACHFEKLFSKNEEAKKSDEEEVKKDDSSDVSTITSDFGDPVEEPPVSC--SFEE  232

Query  602   AIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
              I+ +Q  +E +EMP +LQGG+LLDQTY LP K+ NM LF P SQFR++LAELQGT DVQ
Sbjct  233   VIERMQPTSEDKEMPGDLQGGVLLDQTYVLPSKELNMFLFTPSSQFRKDLAELQGTTDVQ  292

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             EGPWTWK+D+  C+TRVVTY K A+KLVK+VQATEEQTY+K DGKEFAV V V+TPDVPY
Sbjct  293   EGPWTWKTDDM-CVTRVVTYIKAASKLVKAVQATEEQTYIKADGKEFAVFVSVNTPDVPY  351

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             GSTFK+ELLY IMPG    SGEES  L+ISWA+ FC++TMMK++IEGG +QGLK+SF +F
Sbjct  352   GSTFKIELLYKIMPGQQEPSGEESARLIISWAINFCQNTMMKSIIEGGARQGLKESFDQF  411

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             +  LA+  KV TS  VL+    LA+L +E  SD E+A+EYF NFTVVST F+VLY  +HI
Sbjct  412   AELLARKLKVTTSKFVLEKDRALASLQTEQQSDWEMAKEYFWNFTVVSTIFMVLYVFVHI  471

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
             LLS  ++LQGLE +G DLPDSVGEIITCGILVL LE+VY M++ FVEARLRRG+D+GV+A
Sbjct  472   LLSEPSKLQGLESYGFDLPDSVGEIITCGILVLQLERVYYMVSRFVEARLRRGNDNGVKA  531

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              GDGWVLTVALIEG NLASLDPT  PDP+VV +CNGK++TSSVQLQTLDPQW+EILEF+ 
Sbjct  532   QGDGWVLTVALIEGMNLASLDPTDPPDPYVVLSCNGKTKTSSVQLQTLDPQWSEILEFDA  591

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
             AEEPPS+LDVEVFDFDGPFDQA SLGHAEINFLKHTSAELAD+W+PL GKIA SSQSKLH
Sbjct  592   AEEPPSVLDVEVFDFDGPFDQASSLGHAEINFLKHTSAELADIWVPLEGKIALSSQSKLH  651

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFL+NNNGVETIRD LTKMEKEVGKKLNLRSPHRNS FQK FGLPPEEFLIND+SCSL
Sbjct  652   LRIFLDNNNGVETIRDYLTKMEKEVGKKLNLRSPHRNSAFQKIFGLPPEEFLINDYSCSL  711

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRK+PLQGRIFLS RIVGFYANLFGHKTKFFFLWEDIE++NV+ PS+ST+GSP+LV+IL 
Sbjct  712   KRKMPLQGRIFLSARIVGFYANLFGHKTKFFFLWEDIEDVNVVSPSWSTVGSPALVMILR  771

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQY  2401
             K RG DAR+GAK  DEEGRLHFCFHSFVSF  ASRTIMALW+TRA  PDQK QI EEQ  
Sbjct  772   KGRGVDARHGAKCQDEEGRLHFCFHSFVSFNDASRTIMALWRTRALPPDQKEQIVEEQLE  831

Query  2402  KDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYV  2581
             KDE   + E+T SYL+VEDV MSKVYS +LP+N KSLM MF+GGDLEH+VMSKSGCLNY 
Sbjct  832   KDEKLAMSEDTSSYLVVEDVQMSKVYSAELPVNVKSLMLMFDGGDLEHRVMSKSGCLNYA  891

Query  2582  TSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFS  2761
             T+SWE + PDV ER+V YK NR IS+FG EVTSTQ+KS  A+ AGW +NEIMA+H VPF 
Sbjct  892   TTSWETVAPDVSERQVCYKFNRFISVFGGEVTSTQQKSPIADGAGWTINEIMALHDVPFG  951

Query  2762  DHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFV  2941
             DH++VQ RY++ES ++  NSC+CDV VGVMWLKNTK E RIT+N++ KF+ RVK+++E V
Sbjct  952   DHFRVQFRYQIESSTSVHNSCKCDVSVGVMWLKNTKFEQRITRNVIGKFTTRVKDILELV  1011

Query  2942  GREVFLSS  2965
              RE+ LSS
Sbjct  1012  EREILLSS  1019



>ref|XP_010319015.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170 isoform 
X1 [Solanum lycopersicum]
Length=1020

 Score =  1281 bits (3316),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 635/909 (70%), Positives = 750/909 (83%), Gaps = 15/909 (2%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSS---------PKKVLEGK  421
             GK+LLT+SLHGKG  LSTNH  +V P+  ++TSK+ +   + S          KK+ EGK
Sbjct  117   GKVLLTVSLHGKGKGLSTNHVGYVNPT--NDTSKETEVTSIPSQDFHDFAAHSKKISEGK  174

Query  422   QLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCE  601
              L+K+IA H EKLF KNEE+ KS+EE  KKD+SS++S+I SD+ D V+E   S   SF E
Sbjct  175   HLMKNIACHFEKLFSKNEEAKKSDEEEVKKDDSSDVSTITSDFGDPVEEPPVSC--SFEE  232

Query  602   AIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
              I+ +Q  +E +EMP +LQGG+LLDQTY LP K+ NM LF P SQFR++LAELQGT DVQ
Sbjct  233   VIERMQPTSEDKEMPGDLQGGVLLDQTYVLPSKELNMFLFTPSSQFRKDLAELQGTTDVQ  292

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             EGPWTWK+D+  C+TRVVTY K A+KLVK+VQATEEQTY+K DGKEFAV V V+TPDVPY
Sbjct  293   EGPWTWKTDDM-CVTRVVTYIKAASKLVKAVQATEEQTYIKADGKEFAVFVSVNTPDVPY  351

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             GSTFK+ELLY IMPG    SGEES  L+ISWA+ FC++TMMK++IEGG +QGLK+SF +F
Sbjct  352   GSTFKIELLYKIMPGQQEPSGEESARLIISWAINFCQNTMMKSIIEGGARQGLKESFDQF  411

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             +  LA+  KV TS  VL+    LA+L +E  SD E+A+EYF NFTVVST F+VLY  +HI
Sbjct  412   AELLARKLKVTTSKFVLEKDRALASLQTEQQSDWEMAKEYFWNFTVVSTIFMVLYVFVHI  471

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
             LLS  ++LQGLE +G DLPDSVGEIITCGILVL LE+VY M++ FVEARLRRG+D+GV+A
Sbjct  472   LLSEPSKLQGLESYGFDLPDSVGEIITCGILVLQLERVYYMVSRFVEARLRRGNDNGVKA  531

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              GDGWVLTVALIEG NLASLDPT  PDP+VV +CNGK++TSSVQLQTLDPQW+EILEF+ 
Sbjct  532   QGDGWVLTVALIEGMNLASLDPTDPPDPYVVLSCNGKTKTSSVQLQTLDPQWSEILEFDA  591

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
             AEEPPS+LDVEVFDFDGPFDQA SLGHAEINFLKHTSAELAD+W+PL GKIA SSQSKLH
Sbjct  592   AEEPPSVLDVEVFDFDGPFDQASSLGHAEINFLKHTSAELADIWVPLEGKIALSSQSKLH  651

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFL+NNNGVETIRD LTKMEKEVGKKLNLRSPHRNS FQK FGLPPEEFLIND+SCSL
Sbjct  652   LRIFLDNNNGVETIRDYLTKMEKEVGKKLNLRSPHRNSAFQKIFGLPPEEFLINDYSCSL  711

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRK+PLQGRIFLS RIVGFYANLFGHKTKFFFLWEDIE++NV+ PS+ST+GSP+LV+IL 
Sbjct  712   KRKMPLQGRIFLSARIVGFYANLFGHKTKFFFLWEDIEDVNVVSPSWSTVGSPALVMILR  771

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGA-SRTIMALWKTRACIPDQKAQIAEEQQ  2398
             K RG DAR+GAK  DEEGRLHFCFHSFVSF  A SRTIMALW+TRA  PDQK QI EEQ 
Sbjct  772   KGRGVDARHGAKCQDEEGRLHFCFHSFVSFNDASSRTIMALWRTRALPPDQKEQIVEEQL  831

Query  2399  YKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNY  2578
              KDE   + E+T SYL+VEDV MSKVYS +LP+N KSLM MF+GGDLEH+VMSKSGCLNY
Sbjct  832   EKDEKLAMSEDTSSYLVVEDVQMSKVYSAELPVNVKSLMLMFDGGDLEHRVMSKSGCLNY  891

Query  2579  VTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPF  2758
              T+SWE + PDV ER+V YK NR IS+FG EVTSTQ+KS  A+ AGW +NEIMA+H VPF
Sbjct  892   ATTSWETVAPDVSERQVCYKFNRFISVFGGEVTSTQQKSPIADGAGWTINEIMALHDVPF  951

Query  2759  SDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEF  2938
              DH++VQ RY++ES ++  NSC+CDV VGVMWLKNTK E RIT+N++ KF+ RVK+++E 
Sbjct  952   GDHFRVQFRYQIESSTSVHNSCKCDVSVGVMWLKNTKFEQRITRNVIGKFTTRVKDILEL  1011

Query  2939  VGREVFLSS  2965
             V RE+ LSS
Sbjct  1012  VEREILLSS  1020



>ref|XP_009797805.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170 isoform 
X2 [Nicotiana sylvestris]
Length=1020

 Score =  1281 bits (3314),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 630/908 (69%), Positives = 751/908 (83%), Gaps = 14/908 (2%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSS---------PKKVLEGK  421
             GKILLTLS HGKG D+STNH C+V P+  ++TS++ + I  SS          KK+ EGK
Sbjct  118   GKILLTLSFHGKGKDVSTNHVCYVNPT--NDTSRENEVISKSSQDLHGFATHSKKISEGK  175

Query  422   QLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCE  601
              L+K+IA H EKLF KNEE+ KS+EE SKKD+SS++S+  SDYED ++E+  S   SF E
Sbjct  176   HLMKNIACHFEKLFGKNEEAKKSDEEESKKDDSSDISTTASDYEDCLEESPVSH--SFEE  233

Query  602   AIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
              I+ +++ +E +EMP +L GG+LLDQTY    KD NMLLFAPDSQFR++LAELQGT D+ 
Sbjct  234   VIERMRTTSEDKEMPGDLHGGVLLDQTYVASSKDLNMLLFAPDSQFRKDLAELQGTTDMH  293

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             EGPW+WKSD + CLTRVVTY K A+KLVK+VQATEEQTY+K DGKEF+V V VSTPDVPY
Sbjct  294   EGPWSWKSD-ELCLTRVVTYMKAASKLVKAVQATEEQTYVKADGKEFSVFVSVSTPDVPY  352

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             GSTFK+ELLY IMPG    SGEES  LV+SWA+ F ++TMMK++IEGG +QGLK+SF +F
Sbjct  353   GSTFKIELLYKIMPGQQESSGEESARLVVSWAINFSQNTMMKSMIEGGARQGLKESFDQF  412

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             +  LA+  KV TS  VL+    LA+L +EH SD ELA+EYF NFTVVST F+VLY  +HI
Sbjct  413   AEVLARKLKVTTSKVVLEKDRALASLQTEHQSDWELAKEYFWNFTVVSTIFMVLYVLVHI  472

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
             +LS  ++L GLE+HG DLPDSVGE IT GILVL LE+VY M++ FVEARLRRG+DHGV+A
Sbjct  473   ILSEPSKLHGLEYHGFDLPDSVGEFITSGILVLQLERVYNMVSRFVEARLRRGNDHGVKA  532

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              GDGWVLTVALIEG NLASLDPTGFPDP+VVFTCNGK+RTSSVQLQTLDPQW+E+LEF+ 
Sbjct  533   QGDGWVLTVALIEGVNLASLDPTGFPDPYVVFTCNGKTRTSSVQLQTLDPQWSEMLEFDA  592

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
             AEEPPS+LDVEVFDFDGPFDQA SLGHAEINFLKHTSAELAD+W+PL GK A SSQSKLH
Sbjct  593   AEEPPSVLDVEVFDFDGPFDQASSLGHAEINFLKHTSAELADIWVPLEGKTALSSQSKLH  652

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRI+L+NNNGVETIRD LTKMEKEVGKKLN+ SPH+NSTFQK FGLPPEEFLIND+SCSL
Sbjct  653   LRIYLDNNNGVETIRDYLTKMEKEVGKKLNVHSPHKNSTFQKIFGLPPEEFLINDYSCSL  712

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRK+PLQGRIFLS RIVGFYANLFGHKTKFFFLWEDIE++NV+ PS+STM SP+L+IIL 
Sbjct  713   KRKMPLQGRIFLSARIVGFYANLFGHKTKFFFLWEDIEDVNVVSPSWSTMWSPALIIILR  772

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQY  2401
             K RG D R+GA+  DE GRLHFCFHSFVSF  ASRTIMALW+TR   PDQKA++ E QQ 
Sbjct  773   KGRGVDVRHGARYQDEGGRLHFCFHSFVSFNVASRTIMALWRTRTLPPDQKAELVEVQQE  832

Query  2402  KDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYV  2581
              DE  VL E+T SYL+VEDV MSKVYS +L ++ KSLM+MF+GGDLEH+VMSKSGCLNYV
Sbjct  833   NDEKLVLSEDTASYLVVEDVQMSKVYSAELLVSVKSLMQMFDGGDLEHRVMSKSGCLNYV  892

Query  2582  TSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFS  2761
             T+SWE +  +V ER VSYK NR IS+FG EVTSTQ+KS  AND+GW +NEIMA+H VPF 
Sbjct  893   TTSWETVALNVSERLVSYKFNRFISVFGGEVTSTQQKSPIANDSGWTINEIMALHDVPFG  952

Query  2762  DHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFV  2941
             DH++VQ RY+++  ++  NSC+CDV VGVMWLKNTK E RIT+N+V KF+ R+K+++E V
Sbjct  953   DHFRVQFRYEIKDSTSVHNSCKCDVSVGVMWLKNTKFEQRITRNVVGKFTTRLKDILELV  1012

Query  2942  GREVFLSS  2965
              RE+ LSS
Sbjct  1013  EREILLSS  1020



>ref|XP_009797804.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170 isoform 
X1 [Nicotiana sylvestris]
Length=1021

 Score =  1276 bits (3302),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 629/909 (69%), Positives = 751/909 (83%), Gaps = 15/909 (2%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSS---------PKKVLEGK  421
             GKILLTLS HGKG D+STNH C+V P+  ++TS++ + I  SS          KK+ EGK
Sbjct  118   GKILLTLSFHGKGKDVSTNHVCYVNPT--NDTSRENEVISKSSQDLHGFATHSKKISEGK  175

Query  422   QLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCE  601
              L+K+IA H EKLF KNEE+ KS+EE SKKD+SS++S+  SDYED ++E+  S   SF E
Sbjct  176   HLMKNIACHFEKLFGKNEEAKKSDEEESKKDDSSDISTTASDYEDCLEESPVSH--SFEE  233

Query  602   AIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
              I+ +++ +E +EMP +L GG+LLDQTY    KD NMLLFAPDSQFR++LAELQGT D+ 
Sbjct  234   VIERMRTTSEDKEMPGDLHGGVLLDQTYVASSKDLNMLLFAPDSQFRKDLAELQGTTDMH  293

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             EGPW+WKSD + CLTRVVTY K A+KLVK+VQATEEQTY+K DGKEF+V V VSTPDVPY
Sbjct  294   EGPWSWKSD-ELCLTRVVTYMKAASKLVKAVQATEEQTYVKADGKEFSVFVSVSTPDVPY  352

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             GSTFK+ELLY IMPG    SGEES  LV+SWA+ F ++TMMK++IEGG +QGLK+SF +F
Sbjct  353   GSTFKIELLYKIMPGQQESSGEESARLVVSWAINFSQNTMMKSMIEGGARQGLKESFDQF  412

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             +  LA+  KV TS  VL+    LA+L +EH SD ELA+EYF NFTVVST F+VLY  +HI
Sbjct  413   AEVLARKLKVTTSKVVLEKDRALASLQTEHQSDWELAKEYFWNFTVVSTIFMVLYVLVHI  472

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
             +LS  ++L GLE+HG DLPDSVGE IT GILVL LE+VY M++ FVEARLRRG+DHGV+A
Sbjct  473   ILSEPSKLHGLEYHGFDLPDSVGEFITSGILVLQLERVYNMVSRFVEARLRRGNDHGVKA  532

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              GDGWVLTVALIEG NLASLDPTGFPDP+VVFTCNGK+RTSSVQLQTLDPQW+E+LEF+ 
Sbjct  533   QGDGWVLTVALIEGVNLASLDPTGFPDPYVVFTCNGKTRTSSVQLQTLDPQWSEMLEFDA  592

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
             AEEPPS+LDVEVFDFDGPFDQA SLGHAEINFLKHTSAELAD+W+PL GK A SSQSKLH
Sbjct  593   AEEPPSVLDVEVFDFDGPFDQASSLGHAEINFLKHTSAELADIWVPLEGKTALSSQSKLH  652

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRI+L+NNNGVETIRD LTKMEKEVGKKLN+ SPH+NSTFQK FGLPPEEFLIND+SCSL
Sbjct  653   LRIYLDNNNGVETIRDYLTKMEKEVGKKLNVHSPHKNSTFQKIFGLPPEEFLINDYSCSL  712

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRK+PLQGRIFLS RIVGFYANLFGHKTKFFFLWEDIE++NV+ PS+STM SP+L+IIL 
Sbjct  713   KRKMPLQGRIFLSARIVGFYANLFGHKTKFFFLWEDIEDVNVVSPSWSTMWSPALIIILR  772

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFG-GASRTIMALWKTRACIPDQKAQIAEEQQ  2398
             K RG D R+GA+  DE GRLHFCFHSFVSF   +SRTIMALW+TR   PDQKA++ E QQ
Sbjct  773   KGRGVDVRHGARYQDEGGRLHFCFHSFVSFNVASSRTIMALWRTRTLPPDQKAELVEVQQ  832

Query  2399  YKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNY  2578
               DE  VL E+T SYL+VEDV MSKVYS +L ++ KSLM+MF+GGDLEH+VMSKSGCLNY
Sbjct  833   ENDEKLVLSEDTASYLVVEDVQMSKVYSAELLVSVKSLMQMFDGGDLEHRVMSKSGCLNY  892

Query  2579  VTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPF  2758
             VT+SWE +  +V ER VSYK NR IS+FG EVTSTQ+KS  AND+GW +NEIMA+H VPF
Sbjct  893   VTTSWETVALNVSERLVSYKFNRFISVFGGEVTSTQQKSPIANDSGWTINEIMALHDVPF  952

Query  2759  SDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEF  2938
              DH++VQ RY+++  ++  NSC+CDV VGVMWLKNTK E RIT+N+V KF+ R+K+++E 
Sbjct  953   GDHFRVQFRYEIKDSTSVHNSCKCDVSVGVMWLKNTKFEQRITRNVVGKFTTRLKDILEL  1012

Query  2939  VGREVFLSS  2965
             V RE+ LSS
Sbjct  1013  VEREILLSS  1021



>ref|XP_009613734.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170 isoform 
X2 [Nicotiana tomentosiformis]
Length=998

 Score =  1246 bits (3223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 619/908 (68%), Positives = 738/908 (81%), Gaps = 36/908 (4%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSS---------PKKVLEGK  421
             GKILLTLSLHGKG D+S+NH C+V P+  ++TS++ + I  SS         PKK+ EGK
Sbjct  118   GKILLTLSLHGKGKDVSSNHVCYVNPT--NDTSREHEVISKSSQDLHGFAAHPKKISEGK  175

Query  422   QLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCE  601
              L+K+IA H EKLF KNEE+ KS+EE SKKD+SS++S+  SDYED ++E+  S   SF E
Sbjct  176   HLMKNIACHFEKLFGKNEEAKKSDEEESKKDDSSDISTTTSDYEDCLEESPVSH--SFEE  233

Query  602   AIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
             AI+ +++ +E +EMP +LQGG+LLDQTY +  KD NMLLFAPDSQFR++LAELQGT D+ 
Sbjct  234   AIERMRTTSEDKEMPGDLQGGVLLDQTYVVSSKDLNMLLFAPDSQFRKDLAELQGTTDMH  293

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             EGPW+WKSD + CLTRVVTY K  +KLV++VQATEEQTY+K DGKEF+V V VSTPDVPY
Sbjct  294   EGPWSWKSD-EMCLTRVVTYMKAPSKLVRAVQATEEQTYVKADGKEFSVFVSVSTPDVPY  352

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             GSTFK+ELLY IMPG    SGEES  LV+SWA+ F ++TMMK++IEGG +QGLK+SF +F
Sbjct  353   GSTFKIELLYKIMPGQQESSGEESARLVVSWAINFSQNTMMKSMIEGGARQGLKESFYQF  412

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             +  LA+  KV TS  VL+    LA+L +EH SD ELA+EYF NFTVVST F+VLY  +HI
Sbjct  413   AEVLARKLKVTTSKVVLEKDRALASLQTEHQSDWELAKEYFWNFTVVSTIFMVLYVLVHI  472

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
             +LS  ++L GLE+HG DLPDSVGE IT GILVL LE+VY M++ FVEARLRRG+DHGV+A
Sbjct  473   ILSEPSKLHGLEYHGFDLPDSVGEFITSGILVLQLERVYNMVSRFVEARLRRGNDHGVKA  532

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              G                      FPDP+VVFTCNGK+RTSSVQLQTLDPQW+EILEF+ 
Sbjct  533   QG----------------------FPDPYVVFTCNGKTRTSSVQLQTLDPQWSEILEFDA  570

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
             AEEPPS+LDVEVFDFDGPFDQA SLGHAEINFLKHTSAELAD+W+PL GKIA SSQSKLH
Sbjct  571   AEEPPSVLDVEVFDFDGPFDQASSLGHAEINFLKHTSAELADIWVPLEGKIALSSQSKLH  630

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFL+NNNGVETIRD LTKMEKEVGKKLN+RSPH+NSTFQK FGLPPEEFLIND+SCSL
Sbjct  631   LRIFLDNNNGVETIRDYLTKMEKEVGKKLNVRSPHKNSTFQKIFGLPPEEFLINDYSCSL  690

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRK+PLQGRIFLS RIVGFYANLFGHKTKFFFLWEDIE++NV+ PS+STM SP+LVI+L 
Sbjct  691   KRKMPLQGRIFLSARIVGFYANLFGHKTKFFFLWEDIEDVNVVSPSWSTMWSPALVIVLR  750

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQY  2401
             K RG DAR+GA+  DEEGRLHFCFHSFVSF  ASRTIM LW+TR   PDQKAQI E QQ 
Sbjct  751   KGRGVDARHGARYQDEEGRLHFCFHSFVSFNVASRTIMVLWRTRTLPPDQKAQIVEVQQE  810

Query  2402  KDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYV  2581
             KDE  VL E+  SYL+VEDV MSKVYS +LP++ KSLM+MF+GGDLEH+VMSKSGCLNYV
Sbjct  811   KDEKLVLSEDNASYLVVEDVQMSKVYSGELPVSVKSLMQMFDGGDLEHRVMSKSGCLNYV  870

Query  2582  TSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFS  2761
             T+SWE + P+V ER VSYK NR IS+FG EVTSTQ+KS  AND GW +NEIMA+H VPF 
Sbjct  871   TTSWETVAPNVSERLVSYKFNRFISVFGGEVTSTQQKSPIANDGGWTINEIMALHDVPFG  930

Query  2762  DHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFV  2941
             DH++VQ RY+++  ++  NSC+CDV VGVMWLKNTK E RIT+N+V KF+ R+K+++E V
Sbjct  931   DHFRVQFRYEIKDSTSVHNSCKCDVSVGVMWLKNTKFEQRITRNVVGKFTTRLKDILELV  990

Query  2942  GREVFLSS  2965
              RE+ LSS
Sbjct  991   EREILLSS  998



>ref|XP_011071944.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170 [Sesamum 
indicum]
Length=1017

 Score =  1223 bits (3165),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/908 (66%), Positives = 713/908 (79%), Gaps = 19/908 (2%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSSP---------KKVLEGK  421
             GK+LL LSLHGK    +T+H  FVQ S  S      +    SSP         +K LEGK
Sbjct  119   GKLLLALSLHGKDRVTTTDHPFFVQSSPESNNLLQRNGKGTSSPDAQASAAPSRKTLEGK  178

Query  422   QLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCE  601
              L+K++AG LEKL +K E++S+ +                SDYED+++E+      SF E
Sbjct  179   PLMKALAGRLEKLLNKKEQTSRVDNSSEL--------CTSSDYEDSLEES--PSNSSFEE  228

Query  602   AIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
              I+ +QSR +  EMPENLQ G+LLDQTY + P+D NM LFAP+S+  R LAELQGT D Q
Sbjct  229   LIEFVQSRNDNIEMPENLQSGVLLDQTYVVSPEDLNMALFAPNSELGRNLAELQGTTDFQ  288

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             E PW WKSD  SCL RVV+YTK ATKLVK+V+ATEEQTYLK    EFAVLV+VSTPDVPY
Sbjct  289   EEPWKWKSDGISCLRRVVSYTKAATKLVKAVKATEEQTYLKAGRNEFAVLVNVSTPDVPY  348

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             GSTFK+ELLY IMP  GL SGEES  LV+SWA+ F ++TMMK +IEGG +QGLK+SF +F
Sbjct  349   GSTFKIELLYKIMPSVGLSSGEESARLVVSWAINFSQNTMMKGMIEGGARQGLKESFEQF  408

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             S  L+Q  K I +A++LD   +LATL +EH SD EL   YF NFT+VST  ++LY  +HI
Sbjct  409   SSLLSQRFKAIRAADMLDKDQVLATLETEHQSDSELVIPYFRNFTMVSTVIILLYVLVHI  468

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
              L   ++  GLEFHGL+LPDS GE+ITCGILV+ LE+VY MI+HFVEARLR+G+DHGV+A
Sbjct  469   FLCEPSKPHGLEFHGLELPDSFGELITCGILVIQLERVYNMISHFVEARLRKGNDHGVKA  528

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              GDGW+LT ALIEG NLAS + T  PDP+VVFTCNGK+RTSSV+LQT DPQWNEILEF+ 
Sbjct  529   QGDGWILTAALIEGVNLASSNQTEIPDPYVVFTCNGKTRTSSVKLQTRDPQWNEILEFDA  588

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
              E+PPS+LDVEVFDF+GPFDQA SLGHAEINFLKHT+AELADLW+PL GK+AQSSQSKLH
Sbjct  589   VEDPPSVLDVEVFDFEGPFDQASSLGHAEINFLKHTAAELADLWVPLEGKLAQSSQSKLH  648

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFL+NNNGVETIRD L  +EKEVGKKLNLRSPHRNS FQK FGLPPEEFLI+DFSCSL
Sbjct  649   LRIFLDNNNGVETIRDYLANLEKEVGKKLNLRSPHRNSNFQKIFGLPPEEFLISDFSCSL  708

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRK+PLQGR+FLS RIVGFYANLFGHKT+FFFLWEDIE+I VLPPS  T+GSPSL IILH
Sbjct  709   KRKMPLQGRLFLSARIVGFYANLFGHKTRFFFLWEDIEDIQVLPPSLWTVGSPSLAIILH  768

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQY  2401
             K RG D+R+GAK +DEEGRLHF FH+FVSF  ASRTIMALW+TR   PDQKAQIAEEQ  
Sbjct  769   KGRGLDSRHGAKILDEEGRLHFYFHAFVSFNVASRTIMALWRTRTLEPDQKAQIAEEQLD  828

Query  2402  KDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYV  2581
              D    L E+TGSYL+VEDV M+KVY+++LPMN KSLM+MF+GG+LEH+VMSKSGCLNY+
Sbjct  829   DDGKPCLLEDTGSYLVVEDVKMTKVYTMELPMNLKSLMKMFDGGELEHRVMSKSGCLNYI  888

Query  2582  TSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFS  2761
             T++WE    DV ERRV YK +R ISIFG EVT TQ+KS   ND GW++ EIM +H VPFS
Sbjct  889   TTTWEPATSDVQERRVCYKFSRRISIFGGEVTCTQQKSPLPNDGGWVVTEIMTLHDVPFS  948

Query  2762  DHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFV  2941
             DH++VQ RY++E  S   NSC+CDVY+GVMWLKNTK E RIT+N+V KF+ R +E+++ V
Sbjct  949   DHFRVQFRYQIEKSSFTHNSCKCDVYIGVMWLKNTKFEPRITRNVVGKFAHRSEEILQLV  1008

Query  2942  GREVFLSS  2965
              REV L+S
Sbjct  1009  EREVLLTS  1016



>ref|XP_009797806.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170 isoform 
X3 [Nicotiana sylvestris]
Length=999

 Score =  1220 bits (3156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 608/909 (67%), Positives = 730/909 (80%), Gaps = 37/909 (4%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSS---------PKKVLEGK  421
             GKILLTLS HGKG D+STNH C+V P+  ++TS++ + I  SS          KK+ EGK
Sbjct  118   GKILLTLSFHGKGKDVSTNHVCYVNPT--NDTSRENEVISKSSQDLHGFATHSKKISEGK  175

Query  422   QLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCE  601
              L+K+IA H EKLF KNEE+ KS+EE SKKD+SS++S+  SDYED ++E+  S   SF E
Sbjct  176   HLMKNIACHFEKLFGKNEEAKKSDEEESKKDDSSDISTTASDYEDCLEESPVSH--SFEE  233

Query  602   AIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
              I+ +++ +E +EMP +L GG+LLDQTY    KD NMLLFAPDSQFR++LAELQGT D+ 
Sbjct  234   VIERMRTTSEDKEMPGDLHGGVLLDQTYVASSKDLNMLLFAPDSQFRKDLAELQGTTDMH  293

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             EGPW+WKSD + CLTRVVTY K A+KLVK+VQATEEQTY+K DGKEF+V V VSTPDVPY
Sbjct  294   EGPWSWKSD-ELCLTRVVTYMKAASKLVKAVQATEEQTYVKADGKEFSVFVSVSTPDVPY  352

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             GSTFK+ELLY IMPG    SGEES  LV+SWA+ F ++TMMK++IEGG +QGLK+SF +F
Sbjct  353   GSTFKIELLYKIMPGQQESSGEESARLVVSWAINFSQNTMMKSMIEGGARQGLKESFDQF  412

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             +  LA+  KV TS  VL+    LA+L +EH SD ELA+EYF NFTVVST F+VLY  +HI
Sbjct  413   AEVLARKLKVTTSKVVLEKDRALASLQTEHQSDWELAKEYFWNFTVVSTIFMVLYVLVHI  472

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
             +LS  ++L GLE+HG DLPDSVGE IT GILVL LE+VY M++ FVEARLRRG+DHGV+A
Sbjct  473   ILSEPSKLHGLEYHGFDLPDSVGEFITSGILVLQLERVYNMVSRFVEARLRRGNDHGVKA  532

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              G                      FPDP+VVFTCNGK+RTSSVQLQTLDPQW+E+LEF+ 
Sbjct  533   QG----------------------FPDPYVVFTCNGKTRTSSVQLQTLDPQWSEMLEFDA  570

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
             AEEPPS+LDVEVFDFDGPFDQA SLGHAEINFLKHTSAELAD+W+PL GK A SSQSKLH
Sbjct  571   AEEPPSVLDVEVFDFDGPFDQASSLGHAEINFLKHTSAELADIWVPLEGKTALSSQSKLH  630

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRI+L+NNNGVETIRD LTKMEKEVGKKLN+ SPH+NSTFQK FGLPPEEFLIND+SCSL
Sbjct  631   LRIYLDNNNGVETIRDYLTKMEKEVGKKLNVHSPHKNSTFQKIFGLPPEEFLINDYSCSL  690

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRK+PLQGRIFLS RIVGFYANLFGHKTKFFFLWEDIE++NV+ PS+STM SP+L+IIL 
Sbjct  691   KRKMPLQGRIFLSARIVGFYANLFGHKTKFFFLWEDIEDVNVVSPSWSTMWSPALIIILR  750

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFG-GASRTIMALWKTRACIPDQKAQIAEEQQ  2398
             K RG D R+GA+  DE GRLHFCFHSFVSF   +SRTIMALW+TR   PDQKA++ E QQ
Sbjct  751   KGRGVDVRHGARYQDEGGRLHFCFHSFVSFNVASSRTIMALWRTRTLPPDQKAELVEVQQ  810

Query  2399  YKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNY  2578
               DE  VL E+T SYL+VEDV MSKVYS +L ++ KSLM+MF+GGDLEH+VMSKSGCLNY
Sbjct  811   ENDEKLVLSEDTASYLVVEDVQMSKVYSAELLVSVKSLMQMFDGGDLEHRVMSKSGCLNY  870

Query  2579  VTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPF  2758
             VT+SWE +  +V ER VSYK NR IS+FG EVTSTQ+KS  AND+GW +NEIMA+H VPF
Sbjct  871   VTTSWETVALNVSERLVSYKFNRFISVFGGEVTSTQQKSPIANDSGWTINEIMALHDVPF  930

Query  2759  SDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEF  2938
              DH++VQ RY+++  ++  NSC+CDV VGVMWLKNTK E RIT+N+V KF+ R+K+++E 
Sbjct  931   GDHFRVQFRYEIKDSTSVHNSCKCDVSVGVMWLKNTKFEQRITRNVVGKFTTRLKDILEL  990

Query  2939  VGREVFLSS  2965
             V RE+ LSS
Sbjct  991   VEREILLSS  999



>emb|CBI14958.3| unnamed protein product [Vitis vinifera]
Length=1060

 Score =  1194 bits (3089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/916 (64%), Positives = 720/916 (79%), Gaps = 16/916 (2%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVS--------SPKKVLEGKQ  424
             GKILLT+SLHG+  D + +H  +    V +   K+ + +  S        S  KV EGKQ
Sbjct  118   GKILLTISLHGRSQDTTADHPLYAHSRVKTRDFKEWEGLVESEDIVSSNTSTWKVPEGKQ  177

Query  425   LIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCEA  604
             L+K+IA  LEKL  KNEE+SK ++          +SSIPSDYED ++E  R    SF EA
Sbjct  178   LMKAIASRLEKLLGKNEETSKMDDSSE-------VSSIPSDYEDCIEEQ-RPSCCSFEEA  229

Query  605   IKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQE  784
             I+L+QSR   +EMPENLQGGILLDQTY +  K  NMLLFAP+SQFR++LAELQ T +++E
Sbjct  230   IELMQSRNGEQEMPENLQGGILLDQTYIVASKVLNMLLFAPNSQFRQDLAELQRTTNMKE  289

Query  785   GPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYG  964
             GPWTWKS   SCLTRVV+YT+ ATKLVK+V A EEQTY+K DG+EFAVLV+V TPDVPYG
Sbjct  290   GPWTWKSGALSCLTRVVSYTQAATKLVKAVDALEEQTYIKADGREFAVLVNVDTPDVPYG  349

Query  965   STFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFS  1144
             ++FKVELLY IMPGP L SGEES+HLV+SW + F ++T+M+ +IEGG +QGLK+SF +F+
Sbjct  350   NSFKVELLYKIMPGPELSSGEESSHLVVSWGLSFSQNTIMRGMIEGGARQGLKESFDQFA  409

Query  1145  RFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHIL  1324
               LAQ+ K + S + LD   +LATL +E  SD ELA EYF NFTVVS  F+V+Y  +HIL
Sbjct  410   NLLAQNFKTLGSIDSLDKDQMLATLQTEQQSDWELATEYFGNFTVVSAFFMVIYILVHIL  469

Query  1325  LSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAH  1504
             LS  ++ QGLEF GLDLPDS GE+ITCGILV+ LE+VY MI HFV+AR +RGSDHGV+A 
Sbjct  470   LSVRSEQQGLEFSGLDLPDSFGELITCGILVIQLERVYAMILHFVQARFQRGSDHGVKAQ  529

Query  1505  GDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPA  1684
             GDGWVLTVALIEG NLASLD TG  DP+VVFTCNGK+RTSSV+LQT DPQWNEILEF+  
Sbjct  530   GDGWVLTVALIEGINLASLDSTGLSDPYVVFTCNGKTRTSSVKLQTHDPQWNEILEFDAM  589

Query  1685  EEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHL  1864
             EEPP++LDVEVFDFDGPFD+A SLGHAEINFL+HTS ELAD+W+ L GK+AQSSQSKLHL
Sbjct  590   EEPPAVLDVEVFDFDGPFDEAASLGHAEINFLRHTSTELADMWVSLEGKLAQSSQSKLHL  649

Query  1865  RIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLK  2044
             RIFL+NNNGVETI++ L KMEKEVGKK+ L+SPHRNSTF   FGLPPEEFLINDF+C LK
Sbjct  650   RIFLDNNNGVETIKEYLAKMEKEVGKKITLQSPHRNSTFLALFGLPPEEFLINDFTCYLK  709

Query  2045  RKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHK  2224
             RK+PLQGR+FLS RIVGFYANLFGHKTKFFFLWEDIE+I V PPS +++GSPSLVIIL K
Sbjct  710   RKVPLQGRLFLSARIVGFYANLFGHKTKFFFLWEDIEDIQVHPPSLASLGSPSLVIILRK  769

Query  2225  DRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYK  2404
              RG DAR+GAKS DEEGRL F F SFVSF  ASRTIMALW+TR   P+QKAQIA+EQQ +
Sbjct  770   GRGLDARHGAKSQDEEGRLKFYFQSFVSFNVASRTIMALWRTRTLTPEQKAQIADEQQDE  829

Query  2405  DENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVT  2584
             D +++L E+ GS   VE+  MSKVYS +LP++ KSLMEMF+GG+LEHK+M KSG LNY  
Sbjct  830   DGSSLLLEDPGSVFNVEEAKMSKVYSAELPIDIKSLMEMFDGGNLEHKIMEKSGYLNYKA  889

Query  2585  SSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSD  2764
             + WE ++PD+YER + +K NR +SIFG EVT TQ+KS   ND GWILNE+MA+H +PF D
Sbjct  890   TGWETVKPDLYERHLCFKFNRHVSIFGGEVTCTQKKSPIGNDNGWILNEVMALHDIPFGD  949

Query  2765  HYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVG  2944
             H++V  RY++E+   A   C+C+V++ ++WLK+T  + RIT+NI  KF+ R+KE+IE V 
Sbjct  950   HFRVHFRYQIENFGLAPGKCKCEVHMEILWLKSTVFQQRITRNITEKFTSRLKEIIELVE  1009

Query  2945  REVFLSS*KHYCCKML  2992
             RE  L+  +   C++L
Sbjct  1010  REALLNCPQDKFCRIL  1025



>ref|XP_006476879.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170-like 
isoform X1 [Citrus sinensis]
Length=1024

 Score =  1194 bits (3089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 578/908 (64%), Positives = 713/908 (79%), Gaps = 19/908 (2%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVD-----AIKVSSPKK----VLEGK  421
             GKILLT+SLHGKGH+LS+NH  +   +V S  SK+++     +  VS  K     V EG 
Sbjct  121   GKILLTISLHGKGHNLSSNHLLYPHSNVSSNESKELEDPCVLSHDVSCSKAPCLDVTEGN  180

Query  422   QLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCE  601
              L+K++  HLEK+F+KN++  K+ +          LSS PSDYED V+E   S   +F E
Sbjct  181   HLMKAMVSHLEKIFNKNDQGLKTEDSSE-------LSSTPSDYEDCVEEHPPSH--NFEE  231

Query  602   AIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
             AIK++QSR    +MPENLQGGILLDQ Y + P D N  LFAPDSQFR++LAELQGTKDVQ
Sbjct  232   AIKMMQSRENEGDMPENLQGGILLDQLYQVSPCDLNTFLFAPDSQFRKDLAELQGTKDVQ  291

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             EGPW WKS   +CLTR V+Y K ATKLVK+V+ATE+QTYLK +G+EFA+LV VSTPDVPY
Sbjct  292   EGPWEWKSGEMTCLTRAVSYMKAATKLVKAVKATEQQTYLKANGQEFAILVTVSTPDVPY  351

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             G+TF V+LLY I+PGP L SGE+S+HL+ISW + F +STMM+ +IEGG +QGLK+SF +F
Sbjct  352   GNTFNVQLLYKIIPGPELSSGEDSSHLIISWGIDFHQSTMMRGMIEGGARQGLKESFEQF  411

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             +  LAQ+ K++ S +  D  H+LATL +E  SD ELA EYF NFTVVS  F++LY  +HI
Sbjct  412   ANLLAQNLKILDSKDASDKDHMLATLQTEQQSDWELASEYFWNFTVVSAGFMILYVIVHI  471

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
             LL   ++ QGLEF+GLDLPDS GE+I+CGILV+ LEQV+ M+ HFV ARLR+GSDHGV+A
Sbjct  472   LLCEPSKRQGLEFYGLDLPDSFGELISCGILVIQLEQVFNMVGHFVRARLRKGSDHGVKA  531

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              GDGWVLTVAL+EG NLAS + TG  DP+VVFTCNGK+RTSSVQLQT DPQW++ILEF+ 
Sbjct  532   QGDGWVLTVALVEGVNLASSEMTGLSDPYVVFTCNGKTRTSSVQLQTCDPQWHDILEFDA  591

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
              EEPPS+LDVEVFDFDGPFDQA SLGHAEINFLKHTS ELAD+W+ L GK+AQS+QSK+H
Sbjct  592   MEEPPSVLDVEVFDFDGPFDQATSLGHAEINFLKHTSTELADMWVSLEGKLAQSAQSKVH  651

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFL NNNGVETI++ LTKMEKEVGKKLNLRSPHRNSTFQK F LPPEEFLI DF+C L
Sbjct  652   LRIFLENNNGVETIKEYLTKMEKEVGKKLNLRSPHRNSTFQKLFALPPEEFLIKDFTCYL  711

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRK+PLQGR+F+S RIVGFYANLFG+KTKFFFLWEDIE+I +LPPS +T+GSP LVIIL 
Sbjct  712   KRKMPLQGRLFISARIVGFYANLFGNKTKFFFLWEDIEDIQILPPSLATVGSPLLVIILR  771

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQY  2401
             K RG DAR+GAKS DEEGRL F F SFVSF  ASRTIMALW+TR     QK QIAEEQ+ 
Sbjct  772   KGRGLDARHGAKSQDEEGRLRFYFQSFVSFNDASRTIMALWRTRTLTTYQKEQIAEEQEV  831

Query  2402  KDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYV  2581
             ++E +   +  GS    ED  MSKVY+ +LP++ K+LMEMF+GG LEH+VM KSGC NYV
Sbjct  832   QEEMSTAADR-GSVPNFEDAKMSKVYNAELPISVKALMEMFDGGKLEHQVMEKSGCHNYV  890

Query  2582  TSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFS  2761
             T+ W+L++P V ER +SY+ NR +SIFG EVT TQ+KS  A+  GWI+NE+M++H VPF 
Sbjct  891   TTPWDLVKPGVCERHLSYRFNRHVSIFGGEVTCTQQKSPLASGEGWIVNEVMSLHDVPFD  950

Query  2762  DHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFV  2941
             DH++V  RY++E    A N+C+C +Y+G+ WLK+TK + RIT+NI  KF+ R+KEMIE V
Sbjct  951   DHFRVHFRYEIEKSPLAHNACKCAIYIGISWLKSTKFQQRITQNITEKFTHRLKEMIELV  1010

Query  2942  GREVFLSS  2965
              RE+  ++
Sbjct  1011  EREILFAT  1018



>ref|XP_002277671.2| PREDICTED: C2 and GRAM domain-containing protein At5g50170 [Vitis 
vinifera]
Length=1021

 Score =  1191 bits (3082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 584/906 (64%), Positives = 715/906 (79%), Gaps = 16/906 (2%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVS--------SPKKVLEGKQ  424
             GKILLT+SLHG+  D + +H  +    V +   K+ + +  S        S  KV EGKQ
Sbjct  117   GKILLTISLHGRSQDTTADHPLYAHSRVKTRDFKEWEGLVESEDIVSSNTSTWKVPEGKQ  176

Query  425   LIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCEA  604
             L+K+IA  LEKL  KNEE+SK ++          +SSIPSDYED ++E  R    SF EA
Sbjct  177   LMKAIASRLEKLLGKNEETSKMDDSSE-------VSSIPSDYEDCIEEQ-RPSCCSFEEA  228

Query  605   IKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQE  784
             I+L+QSR   +EMPENLQGGILLDQTY +  K  NMLLFAP+SQFR++LAELQ T +++E
Sbjct  229   IELMQSRNGEQEMPENLQGGILLDQTYIVASKVLNMLLFAPNSQFRQDLAELQRTTNMKE  288

Query  785   GPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYG  964
             GPWTWKS   SCLTRVV+YT+ ATKLVK+V A EEQTY+K DG+EFAVLV+V TPDVPYG
Sbjct  289   GPWTWKSGALSCLTRVVSYTQAATKLVKAVDALEEQTYIKADGREFAVLVNVDTPDVPYG  348

Query  965   STFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFS  1144
             ++FKVELLY IMPGP L SGEES+HLV+SW + F ++T+M+ +IEGG +QGLK+SF +F+
Sbjct  349   NSFKVELLYKIMPGPELSSGEESSHLVVSWGLSFSQNTIMRGMIEGGARQGLKESFDQFA  408

Query  1145  RFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHIL  1324
               LAQ+ K + S + LD   +LATL +E  SD ELA EYF NFTVVS  F+V+Y  +HIL
Sbjct  409   NLLAQNFKTLGSIDSLDKDQMLATLQTEQQSDWELATEYFGNFTVVSAFFMVIYILVHIL  468

Query  1325  LSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAH  1504
             LS  ++ QGLEF GLDLPDS GE+ITCGILV+ LE+VY MI HFV+AR +RGSDHGV+A 
Sbjct  469   LSVRSEQQGLEFSGLDLPDSFGELITCGILVIQLERVYAMILHFVQARFQRGSDHGVKAQ  528

Query  1505  GDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPA  1684
             GDGWVLTVALIEG NLASLD TG  DP+VVFTCNGK+RTSSV+LQT DPQWNEILEF+  
Sbjct  529   GDGWVLTVALIEGINLASLDSTGLSDPYVVFTCNGKTRTSSVKLQTHDPQWNEILEFDAM  588

Query  1685  EEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHL  1864
             EEPP++LDVEVFDFDGPFD+A SLGHAEINFL+HTS ELAD+W+ L GK+AQSSQSKLHL
Sbjct  589   EEPPAVLDVEVFDFDGPFDEAASLGHAEINFLRHTSTELADMWVSLEGKLAQSSQSKLHL  648

Query  1865  RIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLK  2044
             RIFL+NNNGVETI++ L KMEKEVGKK+ L+SPHRNSTF   FGLPPEEFLINDF+C LK
Sbjct  649   RIFLDNNNGVETIKEYLAKMEKEVGKKITLQSPHRNSTFLALFGLPPEEFLINDFTCYLK  708

Query  2045  RKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHK  2224
             RK+PLQGR+FLS RIVGFYANLFGHKTKFFFLWEDIE+I V PPS +++GSPSLVIIL K
Sbjct  709   RKVPLQGRLFLSARIVGFYANLFGHKTKFFFLWEDIEDIQVHPPSLASLGSPSLVIILRK  768

Query  2225  DRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYK  2404
              RG DAR+GAKS DEEGRL F F SFVSF  ASRTIMALW+TR   P+QKAQIA+EQQ +
Sbjct  769   GRGLDARHGAKSQDEEGRLKFYFQSFVSFNVASRTIMALWRTRTLTPEQKAQIADEQQDE  828

Query  2405  DENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVT  2584
             D +++L E+ GS   VE+  MSKVYS +LP++ KSLMEMF+GG+LEHK+M KSG LNY  
Sbjct  829   DGSSLLLEDPGSVFNVEEAKMSKVYSAELPIDIKSLMEMFDGGNLEHKIMEKSGYLNYKA  888

Query  2585  SSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSD  2764
             + WE ++PD+YER + +K NR +SIFG EVT TQ+KS   ND GWILNE+MA+H +PF D
Sbjct  889   TGWETVKPDLYERHLCFKFNRHVSIFGGEVTCTQKKSPIGNDNGWILNEVMALHDIPFGD  948

Query  2765  HYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVG  2944
             H++V  RY++E+   A   C+C+V++ ++WLK+T  + RIT+NI  KF+ R+KE+IE V 
Sbjct  949   HFRVHFRYQIENFGLAPGKCKCEVHMEILWLKSTVFQQRITRNITEKFTSRLKEIIELVE  1008

Query  2945  REVFLS  2962
             RE  L+
Sbjct  1009  REALLN  1014



>emb|CDP12735.1| unnamed protein product [Coffea canephora]
Length=1063

 Score =  1190 bits (3078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/915 (64%), Positives = 714/915 (78%), Gaps = 20/915 (2%)
 Frame = +2

Query  254   FSTNPGKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSS---------PKK  406
             F T    ILLTLSL G+G  + ++H  +V PS  +E + +     VSS          KK
Sbjct  157   FCTPVPSILLTLSLQGRGEQVCSDHLLYVHPSCRAENTDEYGDKCVSSQDIFSCTPPTKK  216

Query  407   VLEGKQLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQT  586
             +LEGK L+K IAG LEKLF+KNE++S + +          LS+  SD E+N+ + T +  
Sbjct  217   ILEGKHLVKVIAGRLEKLFNKNEDASGTEDSSE-------LSTTISDNEENLADPTSNS-  268

Query  587   QSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQG  766
              +F E I++LQS  E  +MPENL+GGILLDQ YA+PPKD NMLLFAP SQF R LAELQG
Sbjct  269   -NFEELIEMLQSSNEQTDMPENLEGGILLDQAYAIPPKDLNMLLFAPKSQFMRALAELQG  327

Query  767   TKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVST  946
             T DVQEGPWTWKS +KSCL RVVTYTK ATKLVK+V+ATEEQTY+K +GKEF V VDV+T
Sbjct  328   TTDVQEGPWTWKSADKSCLARVVTYTKAATKLVKTVKATEEQTYIKANGKEFIVFVDVNT  387

Query  947   PDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKD  1126
             P+VPYG+TFKV+LLY I PGP L S E+S HLVISWA+ F +STMMK +IE G +QGLK+
Sbjct  388   PEVPYGNTFKVDLLYKITPGPELFSIEKSAHLVISWALNFHQSTMMKGLIERGARQGLKE  447

Query  1127  SFSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLY  1306
             SF +FS  LA++ KVI    + D GH +ATL  E  SD ELA EYF NFTVV+  F+VLY
Sbjct  448   SFEQFSDLLAKNLKVINLVNMPDKGHTVATLQEERQSDWELATEYFWNFTVVAALFMVLY  507

Query  1307  FSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRG--  1480
                HI L    +LQGLEF GLDLPDSVGEIIT  ILV+ L++VY M++HFV+ARL+RG  
Sbjct  508   IGFHIWLCGEFKLQGLEFDGLDLPDSVGEIITSAILVIQLKKVYDMVSHFVQARLKRGNR  567

Query  1481  SDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWN  1660
             SDHGV+  GDGWVLT+ALIEG  LASLD T  PDP+VVFTCNGKSRTSS +LQTL+P WN
Sbjct  568   SDHGVKVQGDGWVLTIALIEGAKLASLDSTELPDPYVVFTCNGKSRTSSAKLQTLNPHWN  627

Query  1661  EILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQ  1840
             EILEF+ +EEPPS+LDVEV DFDGPFDQA SLGHAEINFLKHTS ELAD+W+PL GK+AQ
Sbjct  628   EILEFDASEEPPSVLDVEVLDFDGPFDQACSLGHAEINFLKHTSTELADIWVPLDGKLAQ  687

Query  1841  SSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLI  2020
             SSQSKLHLRIFLNN NG ETIRD L KMEKEVGKKLNLRS HRNS FQK FGLPPEEFLI
Sbjct  688   SSQSKLHLRIFLNNTNGAETIRDYLKKMEKEVGKKLNLRSLHRNSAFQKIFGLPPEEFLI  747

Query  2021  NDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSP  2200
             +DFSCSLKRK+PLQGR+FLS RIVGFYANLFGHKTKFFFLWEDIE I+ LP +  T+GSP
Sbjct  748   SDFSCSLKRKMPLQGRLFLSARIVGFYANLFGHKTKFFFLWEDIEHIHELPSTLGTVGSP  807

Query  2201  SLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQ  2380
             SLVIIL K  G DAR+GAK  DEEGRLHF FHSF+SF  ASRT+MALW+TR   PDQ+AQ
Sbjct  808   SLVIILSKGHGNDARHGAKYQDEEGRLHFYFHSFISFNVASRTVMALWRTRTLGPDQRAQ  867

Query  2381  IAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSK  2560
             IA EQQ +DE   L E   SYLI++D  ++KV SV+LP+N + +++MF+GGD E++VM+K
Sbjct  868   IAAEQQDRDEKPSLFEVPSSYLIIQDAKLAKVLSVELPVNIRLVLQMFDGGDFEYRVMAK  927

Query  2561  SGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMA  2740
             SGCLNY T+ WE + PDV+ERR SYK +R IS+FG EVT TQ+K   ++D GWI+NEIM 
Sbjct  928   SGCLNYTTTPWEPVTPDVHERRTSYKFDRSISVFGGEVTCTQQKMPFSSDGGWIVNEIMT  987

Query  2741  IHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRV  2920
             +H VP  ++++VQL+Y++E+ + AR +C+CD YVGV WL++TK E+RIT+N+VRKFS+  
Sbjct  988   LHDVPSGEYFRVQLKYELENPALARGTCKCDAYVGVAWLRSTKFEERITRNVVRKFSRWS  1047

Query  2921  KEMIEFVGREVFLSS  2965
             KE+++ V RE+ L++
Sbjct  1048  KEVLQLVEREILLAT  1062



>gb|KDO69492.1| hypothetical protein CISIN_1g001703mg [Citrus sinensis]
Length=1024

 Score =  1190 bits (3078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 577/908 (64%), Positives = 713/908 (79%), Gaps = 19/908 (2%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVD-----AIKVSSPKK----VLEGK  421
             GKILLT+SL+GKGH+LS+N   ++  +V S  SK+++     +  VS  K     V EG 
Sbjct  121   GKILLTISLNGKGHNLSSNRLLYLHSNVSSNESKELEDPCVLSHDVSCSKAPCLDVTEGN  180

Query  422   QLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCE  601
              L+K++  HLEK+F+KN++  K+ +          LSS PSDYED V+E   S   +F E
Sbjct  181   HLMKAMVSHLEKIFNKNDQGLKTEDSSE-------LSSTPSDYEDCVEEHPPSH--NFEE  231

Query  602   AIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
             AIK++QSR    +MPENLQGGILLDQ Y + P D N  LFAPDSQFR++LAELQGTKDVQ
Sbjct  232   AIKMMQSRENEGDMPENLQGGILLDQLYQVSPCDLNTFLFAPDSQFRKDLAELQGTKDVQ  291

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             EGPW WKS   +CLTR V+Y K ATKLVK+V+ATE+QTYLK +G+EFA+LV VSTPDVPY
Sbjct  292   EGPWEWKSGEMTCLTRAVSYMKAATKLVKAVKATEQQTYLKANGQEFAILVTVSTPDVPY  351

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             G+TF V+LLY I+PGP L SGE+S+HL+ISW + F +STMM+ +IEGG +QGLK+SF +F
Sbjct  352   GNTFNVQLLYKIIPGPELSSGEDSSHLIISWGIDFHQSTMMRGMIEGGARQGLKESFEQF  411

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             +  LAQ+ K++ S +  D  H+LATL +E  SD ELA EYF NFTVVS  F++LY  +HI
Sbjct  412   ANLLAQNLKILDSKDASDKDHMLATLQTEQQSDWELASEYFWNFTVVSAGFMILYVVVHI  471

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
             LL   ++ QGLEF+GLDLPDS GE+I+CGILV+ LEQV+ M+ HFV ARLR+GSDHGV+A
Sbjct  472   LLCEPSKRQGLEFYGLDLPDSFGELISCGILVIQLEQVFNMVGHFVRARLRKGSDHGVKA  531

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              GDGWVLTVAL+EG NLAS + TG  DP+VVFTCNGK+RTSSVQLQT DPQW++ILEF+ 
Sbjct  532   QGDGWVLTVALVEGVNLASSEMTGLSDPYVVFTCNGKTRTSSVQLQTCDPQWHDILEFDA  591

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
              EEPPS+LDVEVFDFDGPFDQA SLGHAEINFLKHTS ELAD+W+ L GK+AQS+QSK+H
Sbjct  592   MEEPPSVLDVEVFDFDGPFDQATSLGHAEINFLKHTSTELADMWVSLEGKLAQSAQSKVH  651

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFL NNNGVETI++ LTKMEKEVGKKLNLRSPHRNSTFQK F LPPEEFLI DF+C L
Sbjct  652   LRIFLENNNGVETIKEYLTKMEKEVGKKLNLRSPHRNSTFQKLFALPPEEFLIKDFTCYL  711

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRK+PLQGR+FLS RIVGFYANLFG+KTKFFFLWEDIE+I +L PS +T+GSPSLVIIL 
Sbjct  712   KRKMPLQGRLFLSARIVGFYANLFGNKTKFFFLWEDIEDIQILSPSLATVGSPSLVIILW  771

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQY  2401
             K RG DAR+GAKS DEEGRL F F SFVSF  ASRTIMALW++R     QK QIAEEQQ 
Sbjct  772   KGRGLDARHGAKSQDEEGRLRFYFQSFVSFNDASRTIMALWRSRTLTAYQKEQIAEEQQV  831

Query  2402  KDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYV  2581
             ++E +   +  GS    ED  MSKVY+ +LP++ K+LMEMF+GG LEH+VM KSGC NYV
Sbjct  832   QEEMSTAADR-GSVPNFEDAKMSKVYNAELPISVKALMEMFDGGKLEHQVMEKSGCHNYV  890

Query  2582  TSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFS  2761
             T+ W+L++P V ER +SY+ NR +SIFG EVT TQ+KS  A+  GWI+NE+M++H VPF 
Sbjct  891   TTPWDLVKPGVCERHLSYRFNRHVSIFGGEVTCTQQKSPLASGEGWIVNEVMSLHDVPFD  950

Query  2762  DHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFV  2941
             DH++V  RY++E    A N+C+C +Y+G+ WLK+TK + RIT+NI  KF+ R+KEMIE V
Sbjct  951   DHFRVHFRYEIEKSPLAHNACKCAIYIGISWLKSTKFQQRITQNITEKFTHRLKEMIELV  1010

Query  2942  GREVFLSS  2965
              RE+  ++
Sbjct  1011  EREILFAT  1018



>ref|XP_006439916.1| hypothetical protein CICLE_v10018657mg [Citrus clementina]
 gb|ESR53156.1| hypothetical protein CICLE_v10018657mg [Citrus clementina]
Length=1024

 Score =  1184 bits (3062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 574/908 (63%), Positives = 709/908 (78%), Gaps = 19/908 (2%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSSPK---------KVLEGK  421
             GKILLT+SL+GKGH+LS+N   ++  +V S  SK+++   V SP           + EGK
Sbjct  121   GKILLTISLNGKGHNLSSNRLLYLHSNVSSNESKELEDPCVLSPDVSCSKAPRLDITEGK  180

Query  422   QLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCE  601
              L+K++   LEK F+KN+   K+ +          LSS PSDYED V+E   S   +F E
Sbjct  181   HLMKAMVSCLEKCFNKNDRGLKTEDSSE-------LSSTPSDYEDCVEEHPPSH--NFEE  231

Query  602   AIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
             A K++QSR   ++MPENLQGGILLDQ Y + P D N  LFAPDSQFR++LAELQGTKDVQ
Sbjct  232   ATKMMQSRENEQDMPENLQGGILLDQLYQVSPCDLNTFLFAPDSQFRKDLAELQGTKDVQ  291

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             EGPW WKS   +CLTR V+Y K ATKLVK+V+ATE+QTYLK +G+EFA+LV VSTPDVPY
Sbjct  292   EGPWEWKSGEMTCLTRAVSYMKAATKLVKAVKATEQQTYLKANGQEFAILVTVSTPDVPY  351

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             G+TF V+LLY I+PGP L SGE+S+HL+ISW + F +STMM+ +IEGG +QGLK+SF +F
Sbjct  352   GNTFNVQLLYKIIPGPELSSGEDSSHLIISWGIDFHQSTMMRGMIEGGARQGLKESFEQF  411

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             +  LAQ+ K++ S +  D  H+LATL +E  SD ELA EYF NFTVVS  F++LY  +HI
Sbjct  412   ANLLAQNLKILDSKDASDKDHMLATLQTEQQSDWELASEYFWNFTVVSAGFMILYVVVHI  471

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
             LL   ++ QGLEF+GLDLPDS GE+I+CGILV+ LEQV+ M+ HFV ARLR+GSDHGV+A
Sbjct  472   LLCEPSKRQGLEFYGLDLPDSFGELISCGILVIQLEQVFNMVGHFVRARLRKGSDHGVKA  531

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              GDGWVLTVAL+EG NLASL+ TG  DP+VVFTCNGK+RTSSVQLQT DPQW++ILEF+ 
Sbjct  532   QGDGWVLTVALVEGVNLASLEMTGLSDPYVVFTCNGKTRTSSVQLQTCDPQWHDILEFDA  591

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
              EEPPS+LDVEVFDFDGPFDQA SLGHAEINFLKHTS ELAD+W+ L GK+AQS+QSK+H
Sbjct  592   MEEPPSVLDVEVFDFDGPFDQATSLGHAEINFLKHTSTELADMWVSLEGKLAQSAQSKVH  651

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFL NNNGVETI++ LTKMEKEVGKKLNLRSPHRNSTFQK F LPPEEFLI DF+C L
Sbjct  652   LRIFLENNNGVETIKEYLTKMEKEVGKKLNLRSPHRNSTFQKLFALPPEEFLIKDFTCYL  711

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRK+PLQGR+FLS RIVGFYANLFG+KTKFFFLWEDIE+I +L PS +T+GSPSLVIIL 
Sbjct  712   KRKMPLQGRLFLSARIVGFYANLFGNKTKFFFLWEDIEDIQILSPSLATVGSPSLVIILW  771

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQY  2401
             K RG DAR+GAKS DEEGRL F F SFVSF  ASRTIMALW++R     QK QIAEEQQ 
Sbjct  772   KGRGLDARHGAKSQDEEGRLRFYFQSFVSFNDASRTIMALWRSRTLTAYQKEQIAEEQQV  831

Query  2402  KDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYV  2581
             ++E +   +  GS    ED  MSKVY+ +LP++ K+LMEMF+GG LEH+VM KSGC NY+
Sbjct  832   QEEMSTAADR-GSVPNFEDAKMSKVYNAELPISVKALMEMFDGGKLEHQVMEKSGCHNYI  890

Query  2582  TSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFS  2761
             T+ W+ ++P V ER +SY+ NR +SIFG EVT TQ+KS  A+  GWI+NE M++H VPF 
Sbjct  891   TTPWDPVKPGVCERHLSYRFNRHVSIFGGEVTCTQQKSPLASGEGWIVNEGMSLHDVPFD  950

Query  2762  DHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFV  2941
             DH++V  RY++E    A N+C+C +Y+G+ WLK+TK + RIT+NI  KF+ R+KEMIE V
Sbjct  951   DHFRVHFRYEIEKSPLAHNACKCAIYIGISWLKSTKFQQRITQNITEKFTHRLKEMIELV  1010

Query  2942  GREVFLSS  2965
              RE+  ++
Sbjct  1011  EREILFAT  1018



>ref|XP_008239326.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170 [Prunus 
mume]
Length=1019

 Score =  1155 bits (2987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 571/907 (63%), Positives = 708/907 (78%), Gaps = 23/907 (3%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSSPK---------KVLEGK  421
             GKILLTLSLH KGHD    H    QP++  E +K++D+  +SS           K+  GK
Sbjct  117   GKILLTLSLHEKGHD----HLLRAQPNISIEETKELDSPFMSSHGVFGSKSPCVKIPGGK  172

Query  422   QLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCE  601
             QL+K+I   ++KL  KN+E+ K+++           SS  SDYED V+E       SF E
Sbjct  173   QLMKAIIRRVDKLLHKNDEALKTDDSSEF-------SSSVSDYEDCVEE--HHTICSFEE  223

Query  602   AIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
             +++L+QSR   ++MPENLQGGIL+DQ Y +   D N  LF P+SQFRR+LAELQ T DV 
Sbjct  224   SLELMQSRVSEQQMPENLQGGILIDQAYFVSQHDLNASLFTPNSQFRRDLAELQRTTDVH  283

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             EGPWTW S    CLTR VTYTK A+KLVK+V+ATEEQTY+  DGKEFAV V V TPDVPY
Sbjct  284   EGPWTWTSGEIPCLTRFVTYTKAASKLVKAVKATEEQTYMTADGKEFAVFVSVRTPDVPY  343

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             G++FKVELLY IMPGP L SGEES+ LV+SW V F ++T M+ +IEGG +QGLK+SF +F
Sbjct  344   GNSFKVELLYKIMPGPELPSGEESSCLVVSWGVNFLQNTFMRGMIEGGVKQGLKESFDQF  403

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             S  LAQ+ K + S ++ D  H+LA+  + H SD ELAR+YF N T+V+T F+VLY  +HI
Sbjct  404   SSLLAQNFKTLDSTDLSDKDHILASTQAGHQSDWELARKYFWNLTLVTTTFMVLYVLVHI  463

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
             LL   ++LQGLEF+GLDLPDSVGE+ITCGILVL LE+VY M+ HFV+ARL++GSD+GV+A
Sbjct  464   LLCEPSKLQGLEFNGLDLPDSVGELITCGILVLQLERVYNMVLHFVQARLKKGSDNGVKA  523

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              GDGWVLTVALIEG NLASLD +GF DP+VVFTCNGK+RTSSV+LQT DPQWNEILEF+ 
Sbjct  524   QGDGWVLTVALIEGNNLASLDSSGFSDPYVVFTCNGKTRTSSVKLQTSDPQWNEILEFDA  583

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
              EEPPS+LDVEVFDFDGPFDQA SLGHAEINFLK ++ ELAD+W+ L GK+AQSS SKLH
Sbjct  584   MEEPPSVLDVEVFDFDGPFDQAMSLGHAEINFLKQSATELADMWVSLEGKLAQSSHSKLH  643

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFL+NN GVETIR+ +TKMEKEVGKKLNLRSPHRNSTFQK FGLPPEEFLI+DF+CSL
Sbjct  644   LRIFLDNNKGVETIREYMTKMEKEVGKKLNLRSPHRNSTFQKLFGLPPEEFLISDFTCSL  703

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRK+PLQGR++LS RIVGFYANLFGHKTKFFFLWEDIE+I  LPPS S++GSP LVI+L 
Sbjct  704   KRKMPLQGRLYLSARIVGFYANLFGHKTKFFFLWEDIEDIQELPPSLSSVGSPLLVIVLK  763

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQY  2401
             KDRG DAR+GAK  DEEGRL F F SFVSF    RTIM LW+TR   PDQKAQI+EE+  
Sbjct  764   KDRGLDARHGAKCQDEEGRLRFHFQSFVSFNSVIRTIMGLWRTRTLSPDQKAQISEERND  823

Query  2402  KDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYV  2581
             +++ + + E+T S L +ED  MSKVY+ +LP+N KSLMEMF GG LEHK+M KSGCLNY 
Sbjct  824   QEDRSTMLEDTESILNLEDAKMSKVYTAELPINTKSLMEMFEGGTLEHKIMEKSGCLNYA  883

Query  2582  TSSWELI-EPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPF  2758
             T++WE   +PDV+ER +SY+ NR +SIFG EVT  Q+K+   +  GW+++E+MA+HGVPF
Sbjct  884   TTAWEPTKKPDVFERHLSYRFNRQVSIFGGEVTCRQQKTPIEDGEGWVVDEVMALHGVPF  943

Query  2759  SDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEF  2938
              DH++VQ RY++E+ + A N+ +C+V+V V WLK+TK ++RIT NI+ KF+ R+KE+ EF
Sbjct  944   EDHFRVQFRYQIENSTLAHNASKCNVHVRVTWLKSTKFQERITHNIIEKFAHRLKEIFEF  1003

Query  2939  VGREVFL  2959
             V RE+ L
Sbjct  1004  VEREILL  1010



>ref|XP_007210860.1| hypothetical protein PRUPE_ppa015095mg [Prunus persica]
 gb|EMJ12059.1| hypothetical protein PRUPE_ppa015095mg [Prunus persica]
Length=1022

 Score =  1145 bits (2963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/904 (63%), Positives = 703/904 (78%), Gaps = 23/904 (3%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSS--------PK-KVLEGK  421
             G+ILLTLSLH KGHD    H    Q ++  E  K++D+  +SS        P+ K+  GK
Sbjct  117   GRILLTLSLHEKGHD----HLLCAQSNISIEEPKELDSPFMSSHGVFGSKSPRAKIPGGK  172

Query  422   QLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCE  601
             QL+K+I   ++KL  KN+E+ K+++           SS  SDYED V+E       SF E
Sbjct  173   QLMKAIIRRVDKLLHKNDEALKTDDSSEF-------SSSVSDYEDCVEE--HHTICSFEE  223

Query  602   AIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
             +++L+QSR   ++MPENLQGGIL+DQ Y +   D N  LF P+SQFRR+LAELQ T DV 
Sbjct  224   SLELMQSRVSEQQMPENLQGGILIDQAYFVSQHDLNASLFTPNSQFRRDLAELQRTTDVH  283

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             EGPWTW S    CLTR VTYTK A+KLVK+V+ATEEQTY+  DGKEFAVL  VSTPDVPY
Sbjct  284   EGPWTWTSGEIPCLTRFVTYTKAASKLVKAVKATEEQTYMTADGKEFAVLATVSTPDVPY  343

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             G++FKVELLY IMP P L SGEES+ LV+SW V F ++T M+ +IEGG +QGLK+SF +F
Sbjct  344   GNSFKVELLYKIMPRPELPSGEESSRLVVSWGVNFLQNTFMRGMIEGGVKQGLKESFDQF  403

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             S  LAQ+ K + S ++ D  H+LA+  + H SD ELAR+YF N T+V+T F+VLY  +HI
Sbjct  404   SSLLAQNFKTLDSTDMSDKDHILASTQAGHQSDWELARKYFWNLTLVTTTFMVLYVLVHI  463

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
             LL   ++LQGLEF+GLDLPDSVGE+ITCGILVL LE++Y M+ HFV+ARL++G D+GV+A
Sbjct  464   LLCEPSKLQGLEFNGLDLPDSVGELITCGILVLQLERIYNMVLHFVQARLQKGGDNGVKA  523

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              GDGWVLTVALIEG  LASLD +GF DP+VVFTCNGK+RTSSV+LQT DPQWNEILEF+ 
Sbjct  524   QGDGWVLTVALIEGNYLASLDSSGFSDPYVVFTCNGKTRTSSVKLQTSDPQWNEILEFDA  583

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
              EEPPS+LD+EVFDFDGPFDQA SLGHAEINFLKH++ ELAD+W+ L GK+AQSSQSKLH
Sbjct  584   MEEPPSVLDIEVFDFDGPFDQAMSLGHAEINFLKHSATELADMWVSLEGKLAQSSQSKLH  643

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFL+NN GVETIR+ +TKMEKEVGKKLNLRSPHRNSTFQK FGLPPEEFLI+DF+CSL
Sbjct  644   LRIFLDNNKGVETIREYMTKMEKEVGKKLNLRSPHRNSTFQKLFGLPPEEFLISDFTCSL  703

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRK+PLQGR++LS RIVGFYANLFGHKTKFFFLWEDIE+I  LPPS S++GSP LVI+L 
Sbjct  704   KRKMPLQGRLYLSARIVGFYANLFGHKTKFFFLWEDIEDIQELPPSLSSVGSPLLVIVLK  763

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQY  2401
             K+RG DAR+GAK  DEEGRL F F SFVSF    RTIM LW+TR   PDQKAQI EE   
Sbjct  764   KERGLDARHGAKCQDEEGRLRFHFQSFVSFNSVIRTIMGLWRTRTLSPDQKAQICEEHND  823

Query  2402  KDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYV  2581
             +D+ + + E+T S L +ED  MSKVY+ +LP+N KSLMEMF GG LEHK+M KSGCLNY 
Sbjct  824   QDDRSTMLEDTESVLNLEDAKMSKVYTAELPINTKSLMEMFEGGTLEHKIMEKSGCLNYA  883

Query  2582  TSSWELIEP-DVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPF  2758
             T +WE  +  DV+ER +SY+ NR +SIFG EVT  Q+K+   +  GW+++E+MA+HGVPF
Sbjct  884   TIAWEPTKKLDVFERHLSYRFNRQVSIFGGEVTCRQQKTPIEDGEGWVVDEVMALHGVPF  943

Query  2759  SDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEF  2938
              DH++VQ RY++E+ + A N+C+C+V+V V WLK+TK +DRIT NI+ KF+ R+KE+ EF
Sbjct  944   EDHFRVQFRYQIENSTLAHNACKCNVHVRVTWLKSTKFQDRITHNIIEKFAHRLKEIFEF  1003

Query  2939  VGRE  2950
             V RE
Sbjct  1004  VERE  1007



>ref|XP_004299142.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170-like 
[Fragaria vesca subsp. vesca]
Length=1024

 Score =  1143 bits (2956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 563/907 (62%), Positives = 705/907 (78%), Gaps = 19/907 (2%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSS--------PK-KVLEGK  421
             GK+LLTLSLH KGH+++ N       ++ +E  K+ D+  VSS        P+ K L GK
Sbjct  120   GKVLLTLSLHEKGHNVAANDLPCSHSNI-TEEPKETDSPFVSSNCVLCSKSPRGKTLGGK  178

Query  422   QLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCE  601
             QL+K++   +++L  KNEE S++++           SS  SDYED ++E  +    SF E
Sbjct  179   QLMKALRRRMDRLLHKNEEGSRTDDSSEL-------SSSVSDYEDCMEE--QHSGFSFEE  229

Query  602   AIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
             +++++QSR   + MPENLQGGIL+D+ Y + P D N  LF+P+SQFRR+LAE QGT D++
Sbjct  230   SLEMMQSRESKQRMPENLQGGILIDRAYVVSPNDLNAFLFSPNSQFRRDLAERQGTTDLR  289

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             EGPWTWKS   SCLTRVVTY   ATKLVK+V+ATEEQTYL  +G+EFAVL  V TP+VPY
Sbjct  290   EGPWTWKSGELSCLTRVVTYINAATKLVKAVKATEEQTYLIANGREFAVLASVCTPEVPY  349

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             GS+FKVELLY I PGP L SGEES+ LV+SW V F  ST+MK +IEGG +QGL DSF +F
Sbjct  350   GSSFKVELLYKISPGPDLPSGEESSRLVVSWVVNFLHSTLMKGMIEGGVRQGLMDSFEQF  409

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             S  +AQ  KV+ S ++ D  H+LA++ + H SD ELA+EYF N TVVST  +VLY  +HI
Sbjct  410   SSLMAQKFKVLDSTDLSDKDHILASMQAGHQSDWELAKEYFWNMTVVSTICMVLYILVHI  469

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
             LL   ++LQGLEFHG+DLPDS+GE ITCGILVL LE++Y M  HFV+ARL++G+DHGV++
Sbjct  470   LLCEPSKLQGLEFHGVDLPDSIGEFITCGILVLQLERIYNMAHHFVQARLQQGNDHGVKS  529

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              GDGWVLTVALIEGTNLASL+ +GF DP+VVFT NGK+RTSSV+LQT DPQWN+ILEF+ 
Sbjct  530   QGDGWVLTVALIEGTNLASLNSSGFSDPYVVFTSNGKTRTSSVRLQTTDPQWNDILEFDA  589

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
              EEPPS+LDVEVFDFDGPFDQA SLGHAEINFLKH++ ELAD+W+PL GK+AQSSQSKLH
Sbjct  590   MEEPPSVLDVEVFDFDGPFDQAMSLGHAEINFLKHSATELADMWVPLEGKLAQSSQSKLH  649

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFL+N  G+ETI++ +TKMEKEVGKKL+LRSPHRNSTFQK FGLPPEEFL++DF+C+L
Sbjct  650   LRIFLDNTKGLETIKEYMTKMEKEVGKKLDLRSPHRNSTFQKLFGLPPEEFLVSDFTCAL  709

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRK+ +QGR+FLS RIVGFYANLFGHKTKFFFLWEDIE+I   PPS S+MGSP LVI+L 
Sbjct  710   KRKMLVQGRLFLSARIVGFYANLFGHKTKFFFLWEDIEDIQEHPPSLSSMGSPLLVIVLK  769

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQY  2401
             KDRG DAR+GAK  DEEGRL F F SF+SF  ASRTI+ LW+TRA  PDQKAQI E+Q  
Sbjct  770   KDRGVDARHGAKCQDEEGRLRFYFQSFLSFSSASRTIVGLWRTRALSPDQKAQIVEDQDD  829

Query  2402  KDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYV  2581
              +E + + E+T   L +ED  MSKVY+ ++P+N KSLMEMFNGG+LEHK+M KSGCLNY 
Sbjct  830   YEERSKMVEDTEYILDLEDTKMSKVYTAEIPVNTKSLMEMFNGGELEHKIMGKSGCLNYA  889

Query  2582  TSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFS  2761
             T++WE I+PDV+ERR+SY+ NR +SIFG EV   QRKS  AN  GWI++E+MA+ GVPF 
Sbjct  890   TTAWESIKPDVFERRLSYRFNRNVSIFGGEVACRQRKSPIANGEGWIIDEVMALQGVPFG  949

Query  2762  DHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFV  2941
             D ++VQLRY++E    A N+C+C VYV V WLK+T   +RI  NI  KF+ R+K++ E  
Sbjct  950   DRFRVQLRYRIEKSGLAHNACKCIVYVRVTWLKSTMFLERIKHNITEKFAHRMKDIFELG  1009

Query  2942  GREVFLS  2962
              RE+ L+
Sbjct  1010  QREILLT  1016



>ref|XP_002511325.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51927.1| conserved hypothetical protein [Ricinus communis]
Length=1022

 Score =  1142 bits (2955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 561/911 (62%), Positives = 710/911 (78%), Gaps = 22/911 (2%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSSPK---------KVLEGK  421
             GKILLTLSLHGKGHD +TNH      +   E  K+ +   VSS           K+ +GK
Sbjct  114   GKILLTLSLHGKGHDFATNHFINANANPTDEGHKEYEGPYVSSGGMCCSKAPLLKLTDGK  173

Query  422   QLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCE  601
             +L+K+IA  LE++F+KNEE+ + +            +S  SDYED  +E   S   SF E
Sbjct  174   KLMKTIASRLERVFNKNEEALRVDSSSES-------ASASSDYEDCPEEPPSSC--SFEE  224

Query  602   AIKLLQSR---TEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTK  772
             A++++ S     E  EMPENL GGILLDQ YA+P  D N  LFAPDSQFR+++AE+QGT 
Sbjct  225   AMEIMNSNGNEEEEEEMPENLHGGILLDQIYAVPSCDLNKFLFAPDSQFRKDIAEMQGTT  284

Query  773   DVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPD  952
             DV+EGPWTWKS N S LTR+VTYTK ATKLVK+V+ATEEQTY++ DG++FAV V+VSTPD
Sbjct  285   DVEEGPWTWKSVNMSHLTRIVTYTKAATKLVKAVKATEEQTYIRADGRQFAVFVNVSTPD  344

Query  953   VPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSF  1132
             VPYG TF +ELLY I+PGP + SGEES+ L+ISW + F ++TM+K +IEGG +QGLK+SF
Sbjct  345   VPYGRTFHIELLYKIVPGPQVPSGEESSRLIISWGINFHQNTMLKGMIEGGARQGLKESF  404

Query  1133  SEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFS  1312
              +F+  LA++ K++ S ++    H+L TL +EH SD E+A EYF NFTVVST F+  Y  
Sbjct  405   DQFANLLAKNFKILDSTDLSKKDHVLTTLEAEHESDWEMASEYFLNFTVVSTVFMTFYVV  464

Query  1313  IHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHG  1492
             +HILL   +++QGLE +GLDLPDS G++ TC ILV  LE+VY M++HF++ARL+RGSDHG
Sbjct  465   LHILLCEPSKVQGLEINGLDLPDSFGQLFTCAILVTQLERVYNMVSHFIQARLQRGSDHG  524

Query  1493  VRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILE  1672
             ++AHG+GWVLTVALIEG NLASLD TG  DP+VVFTCNGK+RTSSV+LQ+ +PQWN+ILE
Sbjct  525   IKAHGNGWVLTVALIEGINLASLDSTGLSDPYVVFTCNGKTRTSSVKLQSSNPQWNDILE  584

Query  1673  FEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQS  1852
             F+  EEPPS+LDVEVFDFDGPFDQA SLGH EINFLKHTS ELAD+W+ L GK+AQSSQS
Sbjct  585   FDAMEEPPSVLDVEVFDFDGPFDQATSLGHTEINFLKHTSTELADMWISLEGKLAQSSQS  644

Query  1853  KLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFS  2032
             KLHLRI+L+N+ GVETI++ +TK+EKEVG KLNLRSPHRNSTFQK FGLPPEEFLI+DF+
Sbjct  645   KLHLRIYLDNSKGVETIKEYITKVEKEVGTKLNLRSPHRNSTFQKLFGLPPEEFLISDFT  704

Query  2033  CSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVI  2212
             C LKRK+PLQGR+FLS+RIVGFYANLFGHKTKFFFLWEDIE+I+VLPPS S++G P+LVI
Sbjct  705   CYLKRKMPLQGRLFLSSRIVGFYANLFGHKTKFFFLWEDIEDIHVLPPSLSSVGIPTLVI  764

Query  2213  ILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEE  2392
             +L K RG DAR+GAK++DEEGRL + F SFVSF  ASRTIMALW+TR   P+QKA IAEE
Sbjct  765   VLRKGRGLDARHGAKTLDEEGRLRYHFQSFVSFNTASRTIMALWRTRMLTPEQKALIAEE  824

Query  2393  QQYKDENN-VLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGC  2569
             QQ   E + V+ E++G  L+ E+  MS+VYS +LP++ KSLME+F GG +EHK+M KSGC
Sbjct  825   QQQDQEESPVMLEDSGPLLVAEEAKMSRVYSAELPISIKSLMEIFGGGKMEHKIMEKSGC  884

Query  2570  LNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHG  2749
             LNY T++WE ++  V+ER VSYK NR +SIFG EV+ TQ+KS   ND GWI+NE+M +  
Sbjct  885   LNYATTAWESVKSGVFERHVSYKFNRHVSIFGGEVSCTQQKSPIENDGGWIVNEVMVLQS  944

Query  2750  VPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEM  2929
             VPF DH++V +RY++E  S A ++CRCDVYVG  WLK+TK + RIT+NI  KF+ R+ E+
Sbjct  945   VPFGDHFRVNVRYRIEQSSLAHSACRCDVYVGTTWLKSTKFQQRITRNITEKFTHRMNEI  1004

Query  2930  IEFVGREVFLS  2962
              E + REV  +
Sbjct  1005  FELLEREVLFT  1015



>gb|KDP31032.1| hypothetical protein JCGZ_11408 [Jatropha curcas]
Length=1021

 Score =  1141 bits (2951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 566/910 (62%), Positives = 713/910 (78%), Gaps = 20/910 (2%)
 Frame = +2

Query  263   NPGKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSSPK---------KVLE  415
             + GKILL+LSLHGKGH  STN+       + ++  K+ +   VSS           K+ E
Sbjct  115   DSGKILLSLSLHGKGHRSSTNYFPCANSKIKNDEHKEFEGPLVSSHGIYCSKAPFLKMAE  174

Query  416   GKQLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSF  595
             GK+L+K+IA HLE++F+KNEE+SK++            +S  SD+ED V+E   S + SF
Sbjct  175   GKKLMKTIANHLERVFNKNEEASKTDNSSDS-------ASASSDFEDCVEEF--STSCSF  225

Query  596   CEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKD  775
              EA+++++S +E  ++PENL GGILLDQ Y +   D N  LFAPDS+FR+ELAELQGT D
Sbjct  226   EEAMEIMKS-SETEQIPENLSGGILLDQLYLVSSSDLNKFLFAPDSKFRKELAELQGTTD  284

Query  776   VQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDV  955
             V+E PWTWK  N S LTR VTY K ATKLVK+V+ATEEQTY++ DG++FA+L++VSTPDV
Sbjct  285   VEEEPWTWKKGNMSHLTRTVTYKKAATKLVKAVKATEEQTYVRADGRQFALLINVSTPDV  344

Query  956   PYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFS  1135
             PYGSTF V LLY I+PGP L SGEES+HLVISW + F +STMM+ +IEGG +QGLK+SF 
Sbjct  345   PYGSTFNVMLLYKIVPGPELSSGEESSHLVISWGINFHQSTMMRGMIEGGVRQGLKESFD  404

Query  1136  EFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSI  1315
             +F+  LA++ K++ S +  +  H+L TL +EH SD ELA  YF NFTV+ST F+V Y  +
Sbjct  405   QFANLLAKNVKLLDSTDSSEKNHVLTTLEAEHESDWELASYYFWNFTVLSTIFMVSYVIL  464

Query  1316  HILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGV  1495
             HILL    + QGLEF+GL LPDS G++IT  ILV+ +E VY M++HF++ARL+RGSDHG+
Sbjct  465   HILLCEPREAQGLEFNGLALPDSFGQLITSAILVIQVEGVYYMVSHFIQARLQRGSDHGI  524

Query  1496  RAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEF  1675
             RA G GWVLTVALIEGTNLASLD TGF DP+V FTCNGK+RTSSV+LQT +PQWN+ILEF
Sbjct  525   RAQGSGWVLTVALIEGTNLASLDSTGFSDPYVAFTCNGKTRTSSVKLQTSNPQWNDILEF  584

Query  1676  EPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSK  1855
             +  EEPPS+LDVEVFDFDGPFDQA SLGHAEINFLKH+S ELAD+W+ L GK+AQS QSK
Sbjct  585   DAMEEPPSVLDVEVFDFDGPFDQATSLGHAEINFLKHSSTELADMWISLEGKLAQSFQSK  644

Query  1856  LHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSC  2035
             LHLRIFL+NNNGV+TI++ LTKMEKEVGKKL+LRSPH NSTFQK FGLPPEEFLI+DF+C
Sbjct  645   LHLRIFLDNNNGVQTIKEYLTKMEKEVGKKLDLRSPHSNSTFQKLFGLPPEEFLISDFTC  704

Query  2036  SLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVII  2215
              LKRK+PLQGR+FLS RIVGFYAN FGHKTKFFFLWEDIE+I VLPPS S++GSPSLVI+
Sbjct  705   HLKRKMPLQGRLFLSPRIVGFYANFFGHKTKFFFLWEDIEDIRVLPPSLSSVGSPSLVIV  764

Query  2216  LHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQ  2395
             L K RG DA++GAK+ DEEGRL + F SFVSF  ASRTIMALW+TR   P+QKAQIAEEQ
Sbjct  765   LRKGRGLDAKHGAKAQDEEGRLMYFFQSFVSFNVASRTIMALWRTRTLSPEQKAQIAEEQ  824

Query  2396  QYKDENN-VLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCL  2572
               + E + ++  ++GS L  E+  MSKVYS +LP++  SLME+F+GG +EHK+M KSGCL
Sbjct  825   LQEQEESPIMLADSGSLLEGEEAKMSKVYSAELPISTNSLMEIFDGGKMEHKIMEKSGCL  884

Query  2573  NYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGV  2752
             NY T++WE ++P ++ER VSYK NR +SIFG EVT TQ+KS  A+D GWI+NE+M +H V
Sbjct  885   NYATTTWESVKPGIFERHVSYKFNRHVSIFGGEVTCTQQKSPIADDRGWIVNEVMVLHNV  944

Query  2753  PFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMI  2932
             PF DH++V  RY++E C+ A ++C+CDVYVG  WLK+TK + RIT+NI  KF+ R+KE+ 
Sbjct  945   PFGDHFRVNFRYQIEQCTLAHSACKCDVYVGTNWLKSTKFQQRITRNITEKFTHRLKEIF  1004

Query  2933  EFVGREVFLS  2962
             E + REV  S
Sbjct  1005  ELLEREVLFS  1014



>gb|KDO69493.1| hypothetical protein CISIN_1g001703mg [Citrus sinensis]
Length=790

 Score =  1126 bits (2913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/785 (67%), Positives = 639/785 (81%), Gaps = 1/785 (0%)
 Frame = +2

Query  611   LLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEGP  790
             ++QSR    +MPENLQGGILLDQ Y + P D N  LFAPDSQFR++LAELQGTKDVQEGP
Sbjct  1     MMQSRENEGDMPENLQGGILLDQLYQVSPCDLNTFLFAPDSQFRKDLAELQGTKDVQEGP  60

Query  791   WTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGST  970
             W WKS   +CLTR V+Y K ATKLVK+V+ATE+QTYLK +G+EFA+LV VSTPDVPYG+T
Sbjct  61    WEWKSGEMTCLTRAVSYMKAATKLVKAVKATEQQTYLKANGQEFAILVTVSTPDVPYGNT  120

Query  971   FKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRF  1150
             F V+LLY I+PGP L SGE+S+HL+ISW + F +STMM+ +IEGG +QGLK+SF +F+  
Sbjct  121   FNVQLLYKIIPGPELSSGEDSSHLIISWGIDFHQSTMMRGMIEGGARQGLKESFEQFANL  180

Query  1151  LAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHILLS  1330
             LAQ+ K++ S +  D  H+LATL +E  SD ELA EYF NFTVVS  F++LY  +HILL 
Sbjct  181   LAQNLKILDSKDASDKDHMLATLQTEQQSDWELASEYFWNFTVVSAGFMILYVVVHILLC  240

Query  1331  RSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHGD  1510
               ++ QGLEF+GLDLPDS GE+I+CGILV+ LEQV+ M+ HFV ARLR+GSDHGV+A GD
Sbjct  241   EPSKRQGLEFYGLDLPDSFGELISCGILVIQLEQVFNMVGHFVRARLRKGSDHGVKAQGD  300

Query  1511  GWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEE  1690
             GWVLTVAL+EG NLAS + TG  DP+VVFTCNGK+RTSSVQLQT DPQW++ILEF+  EE
Sbjct  301   GWVLTVALVEGVNLASSEMTGLSDPYVVFTCNGKTRTSSVQLQTCDPQWHDILEFDAMEE  360

Query  1691  PPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRI  1870
             PPS+LDVEVFDFDGPFDQA SLGHAEINFLKHTS ELAD+W+ L GK+AQS+QSK+HLRI
Sbjct  361   PPSVLDVEVFDFDGPFDQATSLGHAEINFLKHTSTELADMWVSLEGKLAQSAQSKVHLRI  420

Query  1871  FLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRK  2050
             FL NNNGVETI++ LTKMEKEVGKKLNLRSPHRNSTFQK F LPPEEFLI DF+C LKRK
Sbjct  421   FLENNNGVETIKEYLTKMEKEVGKKLNLRSPHRNSTFQKLFALPPEEFLIKDFTCYLKRK  480

Query  2051  LPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDR  2230
             +PLQGR+FLS RIVGFYANLFG+KTKFFFLWEDIE+I +L PS +T+GSPSLVIIL K R
Sbjct  481   MPLQGRLFLSARIVGFYANLFGNKTKFFFLWEDIEDIQILSPSLATVGSPSLVIILWKGR  540

Query  2231  GTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKDE  2410
             G DAR+GAKS DEEGRL F F SFVSF  ASRTIMALW++R     QK QIAEEQQ ++E
Sbjct  541   GLDARHGAKSQDEEGRLRFYFQSFVSFNDASRTIMALWRSRTLTAYQKEQIAEEQQVQEE  600

Query  2411  NNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSS  2590
              +   +  GS    ED  MSKVY+ +LP++ K+LMEMF+GG LEH+VM KSGC NYVT+ 
Sbjct  601   MSTAADR-GSVPNFEDAKMSKVYNAELPISVKALMEMFDGGKLEHQVMEKSGCHNYVTTP  659

Query  2591  WELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHY  2770
             W+L++P V ER +SY+ NR +SIFG EVT TQ+KS  A+  GWI+NE+M++H VPF DH+
Sbjct  660   WDLVKPGVCERHLSYRFNRHVSIFGGEVTCTQQKSPLASGEGWIVNEVMSLHDVPFDDHF  719

Query  2771  QVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGRE  2950
             +V  RY++E    A N+C+C +Y+G+ WLK+TK + RIT+NI  KF+ R+KEMIE V RE
Sbjct  720   RVHFRYEIEKSPLAHNACKCAIYIGISWLKSTKFQQRITQNITEKFTHRLKEMIELVERE  779

Query  2951  VFLSS  2965
             +  ++
Sbjct  780   ILFAT  784



>ref|XP_006476880.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170-like 
isoform X2 [Citrus sinensis]
Length=994

 Score =  1126 bits (2913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 553/908 (61%), Positives = 685/908 (75%), Gaps = 49/908 (5%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVD-----AIKVSSPKK----VLEGK  421
             GKILLT+SLHGKGH+LS+NH  +   +V S  SK+++     +  VS  K     V EG 
Sbjct  121   GKILLTISLHGKGHNLSSNHLLYPHSNVSSNESKELEDPCVLSHDVSCSKAPCLDVTEGN  180

Query  422   QLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCE  601
              L+K++  HLEK+F+KN++  K+ +          LSS PSDYED V+E   S   +F E
Sbjct  181   HLMKAMVSHLEKIFNKNDQGLKTEDSSE-------LSSTPSDYEDCVEEHPPSH--NFEE  231

Query  602   AIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
             AIK++QSR    +MPENLQGGILLDQ Y + P D N  LFAPDSQFR++LAELQGTKDVQ
Sbjct  232   AIKMMQSRENEGDMPENLQGGILLDQLYQVSPCDLNTFLFAPDSQFRKDLAELQGTKDVQ  291

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             EGPW WKS   +CLTR V+Y K ATKLVK+V+ATE+QTYLK +G+EFA+LV VSTPDVPY
Sbjct  292   EGPWEWKSGEMTCLTRAVSYMKAATKLVKAVKATEQQTYLKANGQEFAILVTVSTPDVPY  351

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             G+TF V+LLY I+PGP L SGE+S+HL+ISW + F +STMM+ +IEGG +QGLK+SF +F
Sbjct  352   GNTFNVQLLYKIIPGPELSSGEDSSHLIISWGIDFHQSTMMRGMIEGGARQGLKESFEQF  411

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             +  LAQ+ K++ S +  D  H+LATL +E  SD ELA EYF NFTVVS  F++LY  +HI
Sbjct  412   ANLLAQNLKILDSKDASDKDHMLATLQTEQQSDWELASEYFWNFTVVSAGFMILYVIVHI  471

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
             LL   ++ QGLEF+GLDLPDS GE+I+CGILV+ LEQV+ M+ HFV ARLR+GSDHGV+A
Sbjct  472   LLCEPSKRQGLEFYGLDLPDSFGELISCGILVIQLEQVFNMVGHFVRARLRKGSDHGVKA  531

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              GDGWVLTVAL+EG NLAS + TG  DP+VVFTCNGK+RTSSVQLQT DPQW++ILEF+ 
Sbjct  532   QGDGWVLTVALVEGVNLASSEMTGLSDPYVVFTCNGKTRTSSVQLQTCDPQWHDILEFDA  591

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
              EEPPS+LDVEVFDFDGPFDQA SLGHAEINFLKHTS ELAD+W+ L GK+AQS+QS   
Sbjct  592   MEEPPSVLDVEVFDFDGPFDQATSLGHAEINFLKHTSTELADMWVSLEGKLAQSAQS---  648

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
                                        KLNLRSPHRNSTFQK F LPPEEFLI DF+C L
Sbjct  649   ---------------------------KLNLRSPHRNSTFQKLFALPPEEFLIKDFTCYL  681

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRK+PLQGR+F+S RIVGFYANLFG+KTKFFFLWEDIE+I +LPPS +T+GSP LVIIL 
Sbjct  682   KRKMPLQGRLFISARIVGFYANLFGNKTKFFFLWEDIEDIQILPPSLATVGSPLLVIILR  741

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQY  2401
             K RG DAR+GAKS DEEGRL F F SFVSF  ASRTIMALW+TR     QK QIAEEQ+ 
Sbjct  742   KGRGLDARHGAKSQDEEGRLRFYFQSFVSFNDASRTIMALWRTRTLTTYQKEQIAEEQEV  801

Query  2402  KDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYV  2581
             ++E +   +  GS    ED  MSKVY+ +LP++ K+LMEMF+GG LEH+VM KSGC NYV
Sbjct  802   QEEMSTAADR-GSVPNFEDAKMSKVYNAELPISVKALMEMFDGGKLEHQVMEKSGCHNYV  860

Query  2582  TSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFS  2761
             T+ W+L++P V ER +SY+ NR +SIFG EVT TQ+KS  A+  GWI+NE+M++H VPF 
Sbjct  861   TTPWDLVKPGVCERHLSYRFNRHVSIFGGEVTCTQQKSPLASGEGWIVNEVMSLHDVPFD  920

Query  2762  DHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFV  2941
             DH++V  RY++E    A N+C+C +Y+G+ WLK+TK + RIT+NI  KF+ R+KEMIE V
Sbjct  921   DHFRVHFRYEIEKSPLAHNACKCAIYIGISWLKSTKFQQRITQNITEKFTHRLKEMIELV  980

Query  2942  GREVFLSS  2965
              RE+  ++
Sbjct  981   EREILFAT  988



>ref|XP_008380532.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170 [Malus 
domestica]
 ref|XP_008380533.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170 [Malus 
domestica]
 ref|XP_008380534.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170 [Malus 
domestica]
Length=1023

 Score =  1112 bits (2876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/911 (60%), Positives = 698/911 (77%), Gaps = 19/911 (2%)
 Frame = +2

Query  257   STNPGKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSSPK---------KV  409
             S + GKILLTLSLH KGHD S ++      ++  E   +VD+  +S+           K+
Sbjct  114   SKDCGKILLTLSLHEKGHDASIDYLLSDHSNISLEEPNEVDSPFMSTHSVFSSKSLCSKM  173

Query  410   LEGKQLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQ  589
               G QL+K+I   ++KL          N+E SK  +SSELS+  SDYED V+E     + 
Sbjct  174   PGGXQLLKAIVRRMDKLM-------HKNDEASKTGDSSELSTPVSDYEDCVEE--HQSSC  224

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             SF E++++++SR   +++PENL GGIL+DQ YA+   D N  LF P+SQFR +LAELQGT
Sbjct  225   SFKESLEMMRSRGSEQKLPENLLGGILIDQAYAVSQHDLNASLFTPNSQFRTDLAELQGT  284

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
              D+QEGPWTWKS    CLTRVV+YTK A+KLVK+ +ATEEQTY+  DGKEFAVL+  STP
Sbjct  285   TDLQEGPWTWKSGEMPCLTRVVSYTKAASKLVKAAKATEEQTYITADGKEFAVLISASTP  344

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             DVPYG++FKVELLY IM GP L S E+S+ LV+SW + F ++TMMK +IE G +QGL++S
Sbjct  345   DVPYGNSFKVELLYKIMSGPELPSXEQSSRLVVSWDINFLQNTMMKGMIERGVRQGLEES  404

Query  1130  FSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYF  1309
             F +FS  LA++ K + S ++ D  H+LA+  +   SDL+LA EYF NFT+V+T F+VLY 
Sbjct  405   FGQFSSLLARNFKTLDSTDLSDKDHILASTKAGQQSDLKLATEYFWNFTLVTTIFMVLYV  464

Query  1310  SIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDH  1489
              +HILL   +  QGLEF GLDLP S GE+ITCGIL+L LE+VY M+ HFV+ARL++GSD+
Sbjct  465   LVHILLCEPSTPQGLEFIGLDLPHSFGELITCGILILQLERVYNMVLHFVQARLQKGSDN  524

Query  1490  GVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEIL  1669
             GV+A GDGWVLTVALIEG +LASL  +GF DP+VVFTCNGK+R SSV+LQT DPQWN+IL
Sbjct  525   GVKAQGDGWVLTVALIEGNSLASLHSSGFSDPYVVFTCNGKTRASSVKLQTSDPQWNDIL  584

Query  1670  EFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQ  1849
             EF+  EEPPS+LDVEVFDFDGPFD+A SLGHAEINFLKH++ ELADLW+ L GK+AQSSQ
Sbjct  585   EFDAMEEPPSVLDVEVFDFDGPFDRATSLGHAEINFLKHSATELADLWVSLDGKLAQSSQ  644

Query  1850  SKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDF  2029
             SKLH+RIFL+ N G ETIR+ +TKME+EVG KLNLRSPHRNSTFQK FGLPPEEFLI+DF
Sbjct  645   SKLHVRIFLDKNKGAETIREYMTKMEREVGMKLNLRSPHRNSTFQKLFGLPPEEFLISDF  704

Query  2030  SCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLV  2209
             +CSL+RK+PLQGR+FLS RIVGFY++LFGHKTKFFFLWEDIE+I VLPPS S++GSP L 
Sbjct  705   TCSLRRKMPLQGRLFLSARIVGFYSSLFGHKTKFFFLWEDIEDIQVLPPSLSSVGSPLLA  764

Query  2210  IILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAE  2389
             I+L KDRG DAR+GA+  D+EGRL F F SF+S   ASRTIM LW+TR    DQK QIAE
Sbjct  765   IVLKKDRGIDARHGARCQDDEGRLKFHFQSFLSSNSASRTIMGLWRTRTLSADQKTQIAE  824

Query  2390  EQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGC  2569
             E   +++  ++ E+T S   +ED  MSKVY+ +LP+N KSLME+F GG LEHK+M KS C
Sbjct  825   EHFDQEDIPIMFEDTESIFNLEDAKMSKVYTAELPINIKSLMEIFEGGKLEHKIMGKSCC  884

Query  2570  LNYVTSSWELI-EPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIH  2746
             LNYVT++WE   +PDV+ER +SY+ NR +SIFG EVT  Q KS  AN  GWI++E+MA+ 
Sbjct  885   LNYVTTAWEPTKKPDVFERHLSYRFNRQVSIFGGEVTCRQEKSPLANGEGWIVDEVMALQ  944

Query  2747  GVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKE  2926
             GVPF DH++VQLR+++E  + A N+C+C+V+V V WLK TK +DR+T NIV KF+ R+KE
Sbjct  945   GVPFEDHFRVQLRFRIEKSAMAXNACKCNVHVRVFWLKRTKFQDRVTXNIVGKFAHRLKE  1004

Query  2927  MIEFVGREVFL  2959
             + EFV +E+ L
Sbjct  1005  IFEFVKQEILL  1015



>gb|KCW83290.1| hypothetical protein EUGRSUZ_B00225 [Eucalyptus grandis]
Length=1000

 Score =  1112 bits (2875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 537/893 (60%), Positives = 691/893 (77%), Gaps = 12/893 (1%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSSPKKVLEGKQLIKSIAGH  448
             GKIL+++SLHG   D S++   F   ++ S  +++  A+  S  +K+ +GK  +K+IA  
Sbjct  118   GKILVSISLHGSLQDTSSDSPLFPSLNINSNQAEEEMALAKSQAQKIQDGKHWMKAIANR  177

Query  449   LEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCEAIKLLQSRT  628
             LEK+F         +E+ S+   SSE+S  PSDYED V++  +    SF EA+ ++QSR 
Sbjct  178   LEKIF-------AKHEDVSETCASSEVSGTPSDYEDCVEK--QQSDYSFEEALSMMQSRD  228

Query  629   EGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEGPWTWKSD  808
               REMPE+LQGGIL DQ Y + P D N+ LFAPDS+FRR+LA L+GT D++E  WT K +
Sbjct  229   CQREMPEDLQGGILCDQIYVVRPYDLNIFLFAPDSKFRRDLANLEGTTDLEEELWTLKQE  288

Query  809   NKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGSTFKVELL  988
             +   LTR VT TK ATKLVK+V+ATE+Q+YLK DGK FA+ V+VSTP+VPYG+ FKVELL
Sbjct  289   DPPLLTRTVTSTKAATKLVKAVKATEQQSYLKADGKHFAIFVEVSTPEVPYGNAFKVELL  348

Query  989   YNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRFLAQHCK  1168
             Y IMPGP   SGEES  L+ISW V F + TMM+ +IEGG +QGLKDSF  F   LAQ  +
Sbjct  349   YKIMPGPEEGSGEESARLIISWRVNFHQKTMMRGMIEGGARQGLKDSFYHFENLLAQSFR  408

Query  1169  VITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHILLSRSTQLQ  1348
              + SAE+ D G ++A+L +E  SD +LA +YFCNFT++ST  +V+Y  IHILL + ++ +
Sbjct  409   TLDSAELSDKGQIIASLENEQQSDWQLAIKYFCNFTMLSTICMVVYVIIHILLCKPSEPR  468

Query  1349  GLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHGDGWVLTV  1528
             GLEF G+DLPDS+GE+I CGI+ + +++V+ M +HFV+ARL+RGSDHGV+A GDGW+LT+
Sbjct  469   GLEFLGIDLPDSLGELIACGIITIQVQRVFYMASHFVQARLQRGSDHGVKAQGDGWILTI  528

Query  1529  ALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEEPPSMLD  1708
             ALIEGTN+ASL  TG+ DP+VVFTCNG+++TSSV+LQT DPQWNEI+EF+  EEPPS+LD
Sbjct  529   ALIEGTNVASLSSTGYSDPYVVFTCNGRTKTSSVKLQTCDPQWNEIVEFDAMEEPPSILD  588

Query  1709  VEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRIFLNNNN  1888
             VEVFDFDGPFDQA SLGHAEINFLKHTS +LAD+W+ L GK+AQS+QSKLHLRIFL+NNN
Sbjct  589   VEVFDFDGPFDQATSLGHAEINFLKHTSTDLADMWIFLEGKLAQSAQSKLHLRIFLDNNN  648

Query  1889  GVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRKLPLQGR  2068
             GVETI++ LTKMEKEVGKKL++RSPHRNSTFQK F LPP+EFLI+DF+CSLKRKLPLQGR
Sbjct  649   GVETIKEYLTKMEKEVGKKLSMRSPHRNSTFQKLFKLPPDEFLISDFACSLKRKLPLQGR  708

Query  2069  IFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDRGTDARN  2248
             +FLS+RIVGFYANLFGHKT+FFFLWEDIE+I  LPPSF ++GSPSLVIIL K RG DA +
Sbjct  709   LFLSSRIVGFYANLFGHKTRFFFLWEDIEDIQELPPSFISVGSPSLVIILRKGRGMDAMH  768

Query  2249  GAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKDENNVLPE  2428
             GAKS DEEGRL F F SFVSF  ASRTI+ALW+TRA +P+Q  QIA+E QY  EN  +  
Sbjct  769   GAKSQDEEGRLRFHFQSFVSFNSASRTIVALWRTRALMPEQTEQIAKE-QYDQENTTVLV  827

Query  2429  ETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEP  2608
             +  + L  +D  MSK+YS +LP+   SLME+F GG  EH++M KSGCLNY  + WE ++P
Sbjct  828   DEATILDKKDADMSKIYSAELPIEMSSLMELFGGGKKEHRIMEKSGCLNYSATEWEPVKP  887

Query  2609  DVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRY  2788
               +ER VSYK NR ISIFG EVT TQ+K   + D GW ++E+MA+H +PF ++Y+VQL+Y
Sbjct  888   GTFERSVSYKFNRHISIFGGEVTITQQKV--STDDGWTVDEVMALHNIPFEEYYRVQLKY  945

Query  2789  KVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGR  2947
             K+E      +SC+CDVY+ ++WLK+TK + RIT+NI  K SQR+K++ E V R
Sbjct  946   KIEKSGQDHSSCKCDVYIHIIWLKSTKFQHRITRNITSKLSQRLKDIFELVER  998



>ref|XP_009333945.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170 [Pyrus 
x bretschneideri]
 ref|XP_009333946.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170 [Pyrus 
x bretschneideri]
Length=1023

 Score =  1109 bits (2869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/912 (60%), Positives = 697/912 (76%), Gaps = 19/912 (2%)
 Frame = +2

Query  257   STNPGKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSSP---------KKV  409
             S + GKILLTLSLH KGHD S +H      ++  E   +VD+  +S+           K+
Sbjct  114   SKDCGKILLTLSLHEKGHDASIDHVLSDHSNISLEEPNEVDSPFMSTHGVFSSKSLCSKM  173

Query  410   LEGKQLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQ  589
               G  L+K+I   ++KL          N+E SK D+SSELS+  SDYED V+E   S   
Sbjct  174   PGGILLLKAIVRRMDKLM-------HKNDEASKTDDSSELSTSVSDYEDCVEEHQSSC--  224

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             SF E++++++ R   +++PE L GGIL+DQ YA+   + N  LF P+SQF R+LAELQGT
Sbjct  225   SFEESLEMMRLRGSEQKLPEKLLGGILIDQEYAVSQHELNASLFTPNSQFWRDLAELQGT  284

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
              D+QEGPW WKS    CLTRVV+YT+ A+KLVK+V+ATEEQTY+  DGKEFAVL+ VSTP
Sbjct  285   TDLQEGPWMWKSGEMPCLTRVVSYTRAASKLVKAVKATEEQTYITADGKEFAVLISVSTP  344

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             DVPYG++FK++LLY IM GP L S E+S+ LV+SW + F ++TMMK +IE G +QGL++S
Sbjct  345   DVPYGNSFKIQLLYKIMSGPELPSVEQSSRLVVSWDINFLQNTMMKGMIERGVRQGLEES  404

Query  1130  FSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYF  1309
             F +FS  LA++ K++ S ++ D  H+LA++ +   SDL+LA EYFCNFT+ +T F+VLY 
Sbjct  405   FGQFSSLLARNFKMLDSTDLSDKDHILASMQAGQQSDLKLATEYFCNFTLFTTIFMVLYV  464

Query  1310  SIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDH  1489
              +HILL   +  Q LEF GLDLPDS GE+ITCGIL+L LE+VY M+ HFV+ARL++G D+
Sbjct  465   LVHILLCEPSTPQALEFIGLDLPDSFGELITCGILILQLERVYNMVLHFVQARLQKGGDN  524

Query  1490  GVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEIL  1669
             GV+A GDGWVLTVALIEG +LASLD +GF DP+VVFTCNGK+R SSV+LQT DPQWN+IL
Sbjct  525   GVKAQGDGWVLTVALIEGNSLASLDSSGFSDPYVVFTCNGKTRASSVKLQTSDPQWNDIL  584

Query  1670  EFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQ  1849
             EF   EEPPS+LDVEVFDFDGPFD+A SLGHAEINFLKH++ ELADLW+ L GK+AQSSQ
Sbjct  585   EFGAMEEPPSVLDVEVFDFDGPFDRATSLGHAEINFLKHSATELADLWVSLDGKLAQSSQ  644

Query  1850  SKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDF  2029
             SKLH+RIFL+NN G ETIRD +TKMEKEVGKKLNLRSP RNSTFQK FGLPPEEFLI+DF
Sbjct  645   SKLHVRIFLDNNKGAETIRDYMTKMEKEVGKKLNLRSPQRNSTFQKLFGLPPEEFLISDF  704

Query  2030  SCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLV  2209
             +CSL+RK+PLQGR+FLS RIVGFY+NLFGHKTKFFFLWEDIE+I VLPPS S++GSP L 
Sbjct  705   TCSLRRKMPLQGRLFLSARIVGFYSNLFGHKTKFFFLWEDIEDIQVLPPSLSSVGSPLLA  764

Query  2210  IILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAE  2389
              +L KDRG DAR+GAK  D+EGRL F F SFVS   ASRTIM LW+ R    DQK QIAE
Sbjct  765   FVLKKDRGIDARHGAKCQDDEGRLKFHFQSFVSSNSASRTIMGLWRMRTLSADQKTQIAE  824

Query  2390  EQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGC  2569
                 + +  ++ E+T S L +E   MSKVY+ +LP+N KSLME+F GG LEHK+M KS C
Sbjct  825   GHFDQKDIPIMLEDTESILNLEYEKMSKVYTAELPINTKSLMEIFEGGKLEHKIMGKSCC  884

Query  2570  LNYVTSSWELI-EPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIH  2746
             LNYVT++WE   +PDV+ER++SY+ NR +SIFG EVT  Q KS  AN  GWI++E+MA+H
Sbjct  885   LNYVTTAWEPTKKPDVFERQLSYRFNRQVSIFGGEVTCRQEKSPLANGEGWIVDEVMALH  944

Query  2747  GVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKE  2926
             G+PF DH++VQLRY++E  + A N+C+C+V+V V WLK TK +DR+T+NI+ KF+   KE
Sbjct  945   GIPFEDHFRVQLRYRIEKSAMAHNACKCNVHVRVFWLKRTKFQDRVTRNIIGKFAHGFKE  1004

Query  2927  MIEFVGREVFLS  2962
             + EFV RE+ L+
Sbjct  1005  IFEFVEREILLA  1016



>ref|XP_006476881.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170-like 
isoform X3 [Citrus sinensis]
Length=985

 Score =  1102 bits (2850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/908 (60%), Positives = 678/908 (75%), Gaps = 58/908 (6%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVD-----AIKVSSPKK----VLEGK  421
             GKILLT+SLHGKGH+LS+NH  +   +V S  SK+++     +  VS  K     V EG 
Sbjct  121   GKILLTISLHGKGHNLSSNHLLYPHSNVSSNESKELEDPCVLSHDVSCSKAPCLDVTEGN  180

Query  422   QLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCE  601
              L+K++  HLEK+F+KN++  K+ +          LSS PSDYED V+E   S   +F E
Sbjct  181   HLMKAMVSHLEKIFNKNDQGLKTEDSSE-------LSSTPSDYEDCVEEHPPSH--NFEE  231

Query  602   AIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
             AIK++QSR    +MPENLQGGILLDQ Y + P D N  LFAPDSQFR++LAELQGTKDVQ
Sbjct  232   AIKMMQSRENEGDMPENLQGGILLDQLYQVSPCDLNTFLFAPDSQFRKDLAELQGTKDVQ  291

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             EGPW WKS   +CLTR V+Y K ATKLVK+V+ATE+QTYLK +G+EFA+LV VSTPDVPY
Sbjct  292   EGPWEWKSGEMTCLTRAVSYMKAATKLVKAVKATEQQTYLKANGQEFAILVTVSTPDVPY  351

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             G+TF V+LLY I+PGP L SGE+S+HL+ISW + F +STMM+ +IEGG +QGLK+SF +F
Sbjct  352   GNTFNVQLLYKIIPGPELSSGEDSSHLIISWGIDFHQSTMMRGMIEGGARQGLKESFEQF  411

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             +  LAQ+ K++ S +  D  H+LATL +E  SD ELA EYF NFTVVS  F++LY  +HI
Sbjct  412   ANLLAQNLKILDSKDASDKDHMLATLQTEQQSDWELASEYFWNFTVVSAGFMILYVIVHI  471

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
             LL   ++ QGLEF+GLDLPDS GE+I+CGILV+ LEQV+ M+ HFV ARLR+GSDHGV+A
Sbjct  472   LLCEPSKRQGLEFYGLDLPDSFGELISCGILVIQLEQVFNMVGHFVRARLRKGSDHGVKA  531

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              GDGWVLTVAL+EG NLAS + TG  DP+VVFTCNGK+RTSSVQLQT DPQW++ILEF+ 
Sbjct  532   QGDGWVLTVALVEGVNLASSEMTGLSDPYVVFTCNGKTRTSSVQLQTCDPQWHDILEFDA  591

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
              EEPPS+LDVEVFDFDGPFDQA SLGHAEINFLKHTS ELAD+W+ L GK+AQS+QSK+H
Sbjct  592   MEEPPSVLDVEVFDFDGPFDQATSLGHAEINFLKHTSTELADMWVSLEGKLAQSAQSKVH  651

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFL NNNGVETI++ LTKMEKEVGKK                                
Sbjct  652   LRIFLENNNGVETIKEYLTKMEKEVGKK--------------------------------  679

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
                    GR+F+S RIVGFYANLFG+KTKFFFLWEDIE+I +LPPS +T+GSP LVIIL 
Sbjct  680   -------GRLFISARIVGFYANLFGNKTKFFFLWEDIEDIQILPPSLATVGSPLLVIILR  732

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQY  2401
             K RG DAR+GAKS DEEGRL F F SFVSF  ASRTIMALW+TR     QK QIAEEQ+ 
Sbjct  733   KGRGLDARHGAKSQDEEGRLRFYFQSFVSFNDASRTIMALWRTRTLTTYQKEQIAEEQEV  792

Query  2402  KDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYV  2581
             ++E +   +  GS    ED  MSKVY+ +LP++ K+LMEMF+GG LEH+VM KSGC NYV
Sbjct  793   QEEMSTAADR-GSVPNFEDAKMSKVYNAELPISVKALMEMFDGGKLEHQVMEKSGCHNYV  851

Query  2582  TSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFS  2761
             T+ W+L++P V ER +SY+ NR +SIFG EVT TQ+KS  A+  GWI+NE+M++H VPF 
Sbjct  852   TTPWDLVKPGVCERHLSYRFNRHVSIFGGEVTCTQQKSPLASGEGWIVNEVMSLHDVPFD  911

Query  2762  DHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFV  2941
             DH++V  RY++E    A N+C+C +Y+G+ WLK+TK + RIT+NI  KF+ R+KEMIE V
Sbjct  912   DHFRVHFRYEIEKSPLAHNACKCAIYIGISWLKSTKFQQRITQNITEKFTHRLKEMIELV  971

Query  2942  GREVFLSS  2965
              RE+  ++
Sbjct  972   EREILFAT  979



>gb|KDO69491.1| hypothetical protein CISIN_1g001703mg [Citrus sinensis]
Length=985

 Score =  1100 bits (2844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/908 (60%), Positives = 678/908 (75%), Gaps = 58/908 (6%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVD-----AIKVSSPKK----VLEGK  421
             GKILLT+SL+GKGH+LS+N   ++  +V S  SK+++     +  VS  K     V EG 
Sbjct  121   GKILLTISLNGKGHNLSSNRLLYLHSNVSSNESKELEDPCVLSHDVSCSKAPCLDVTEGN  180

Query  422   QLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCE  601
              L+K++  HLEK+F+KN++  K+ +          LSS PSDYED V+E   S   +F E
Sbjct  181   HLMKAMVSHLEKIFNKNDQGLKTEDSSE-------LSSTPSDYEDCVEEHPPSH--NFEE  231

Query  602   AIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
             AIK++QSR    +MPENLQGGILLDQ Y + P D N  LFAPDSQFR++LAELQGTKDVQ
Sbjct  232   AIKMMQSRENEGDMPENLQGGILLDQLYQVSPCDLNTFLFAPDSQFRKDLAELQGTKDVQ  291

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             EGPW WKS   +CLTR V+Y K ATKLVK+V+ATE+QTYLK +G+EFA+LV VSTPDVPY
Sbjct  292   EGPWEWKSGEMTCLTRAVSYMKAATKLVKAVKATEQQTYLKANGQEFAILVTVSTPDVPY  351

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             G+TF V+LLY I+PGP L SGE+S+HL+ISW + F +STMM+ +IEGG +QGLK+SF +F
Sbjct  352   GNTFNVQLLYKIIPGPELSSGEDSSHLIISWGIDFHQSTMMRGMIEGGARQGLKESFEQF  411

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             +  LAQ+ K++ S +  D  H+LATL +E  SD ELA EYF NFTVVS  F++LY  +HI
Sbjct  412   ANLLAQNLKILDSKDASDKDHMLATLQTEQQSDWELASEYFWNFTVVSAGFMILYVVVHI  471

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
             LL   ++ QGLEF+GLDLPDS GE+I+CGILV+ LEQV+ M+ HFV ARLR+GSDHGV+A
Sbjct  472   LLCEPSKRQGLEFYGLDLPDSFGELISCGILVIQLEQVFNMVGHFVRARLRKGSDHGVKA  531

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              GDGWVLTVAL+EG NLAS + TG  DP+VVFTCNGK+RTSSVQLQT DPQW++ILEF+ 
Sbjct  532   QGDGWVLTVALVEGVNLASSEMTGLSDPYVVFTCNGKTRTSSVQLQTCDPQWHDILEFDA  591

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
              EEPPS+LDVEVFDFDGPFDQA SLGHAEINFLKHTS ELAD+W+ L GK+AQS+QSK+H
Sbjct  592   MEEPPSVLDVEVFDFDGPFDQATSLGHAEINFLKHTSTELADMWVSLEGKLAQSAQSKVH  651

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFL NNNGVETI++ LTKMEKEVGKK                                
Sbjct  652   LRIFLENNNGVETIKEYLTKMEKEVGKK--------------------------------  679

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
                    GR+FLS RIVGFYANLFG+KTKFFFLWEDIE+I +L PS +T+GSPSLVIIL 
Sbjct  680   -------GRLFLSARIVGFYANLFGNKTKFFFLWEDIEDIQILSPSLATVGSPSLVIILW  732

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQY  2401
             K RG DAR+GAKS DEEGRL F F SFVSF  ASRTIMALW++R     QK QIAEEQQ 
Sbjct  733   KGRGLDARHGAKSQDEEGRLRFYFQSFVSFNDASRTIMALWRSRTLTAYQKEQIAEEQQV  792

Query  2402  KDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYV  2581
             ++E +   +  GS    ED  MSKVY+ +LP++ K+LMEMF+GG LEH+VM KSGC NYV
Sbjct  793   QEEMSTAADR-GSVPNFEDAKMSKVYNAELPISVKALMEMFDGGKLEHQVMEKSGCHNYV  851

Query  2582  TSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFS  2761
             T+ W+L++P V ER +SY+ NR +SIFG EVT TQ+KS  A+  GWI+NE+M++H VPF 
Sbjct  852   TTPWDLVKPGVCERHLSYRFNRHVSIFGGEVTCTQQKSPLASGEGWIVNEVMSLHDVPFD  911

Query  2762  DHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFV  2941
             DH++V  RY++E    A N+C+C +Y+G+ WLK+TK + RIT+NI  KF+ R+KEMIE V
Sbjct  912   DHFRVHFRYEIEKSPLAHNACKCAIYIGISWLKSTKFQQRITQNITEKFTHRLKEMIELV  971

Query  2942  GREVFLSS  2965
              RE+  ++
Sbjct  972   EREILFAT  979



>ref|XP_011046227.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170 isoform 
X1 [Populus euphratica]
 ref|XP_011046228.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170 isoform 
X2 [Populus euphratica]
Length=1033

 Score =  1093 bits (2827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/909 (59%), Positives = 693/909 (76%), Gaps = 22/909 (2%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSS--------PK-KVLEGK  421
             GKILL+LSL  K    STNH  +   +V +E  K+ +   +SS        P+ K+ EGK
Sbjct  122   GKILLSLSLTRKCDKSSTNHFVYANTNV-NEDCKESEGPCISSHGLHGCKAPRIKIAEGK  180

Query  422   QLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCE  601
             +L+K+I   LE++F+K+EE+S++++          L+S  SD ED       S + SF E
Sbjct  181   KLMKTIMSRLERVFNKHEENSRTDDSSE-------LTSASSDCED----CDHSSSCSFVE  229

Query  602   AIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
              ++++ SR   +EMPENLQGG+LLD+ Y +P  D NM LFAP+SQFR++L ELQGT D +
Sbjct  230   GLEIMSSRDNEQEMPENLQGGVLLDKIYVVPSSDLNMFLFAPNSQFRKDLEELQGTTDAE  289

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             EGPWTWKS N S LTR+V+YTK ATKLVKSV+ATEEQTY   DGKEFAVL +VSTP+VPY
Sbjct  290   EGPWTWKSANMSYLTRIVSYTKAATKLVKSVKATEEQTYKNADGKEFAVLTNVSTPEVPY  349

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             G+TF +ELLY I+PGP + SGE S+HL+ISW + FCKSTMMK +IEGG +QGLK+SF +F
Sbjct  350   GNTFNIELLYKILPGPEISSGEASSHLLISWGINFCKSTMMKGMIEGGARQGLKESFDQF  409

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             +  LAQ+ K + S +  +  H+LA L + H S+ +LA +YF NFT VS  F++LY  +HI
Sbjct  410   ANLLAQNFKTMDSMDSSNKDHMLAKLEAAHQSEWQLASDYFWNFTAVSAIFMILYVVVHI  469

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
             +    +++QGLEF+GLDLPDS G++IT  ILV+ LE+V  M+ HF++ARL+RG+DHGVRA
Sbjct  470   VFCEPSRVQGLEFNGLDLPDSFGQLITSAILVIQLERVCNMMKHFIQARLQRGNDHGVRA  529

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              G+GWVLTVAL+EGTNL SLD TG  DP+VV TCNGK+RTSS+QL + DPQWNEI EF+ 
Sbjct  530   QGEGWVLTVALVEGTNLPSLDSTGLSDPYVVLTCNGKTRTSSIQLHSSDPQWNEIQEFDA  589

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
              +EPPS+LDVEVFDFDGPFDQA SLGHAEI FLKHTS ELAD+W+PL GK++QSSQSKLH
Sbjct  590   MDEPPSVLDVEVFDFDGPFDQATSLGHAEIMFLKHTSTELADMWIPLEGKLSQSSQSKLH  649

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIF++N+ GVET+   LTKMEKEVGKKLNL SPHRNSTFQK FGLPPEE+LIN F+C L
Sbjct  650   LRIFIDNDKGVETVMGYLTKMEKEVGKKLNLPSPHRNSTFQKLFGLPPEEYLINHFTCHL  709

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRK+PLQGR+FLS RI+GFYANLFG+KTKFFFL EDIE+I V PPS S++GSP LVIIL 
Sbjct  710   KRKMPLQGRLFLSARILGFYANLFGNKTKFFFLLEDIEDIQVHPPSLSSVGSPFLVIILR  769

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQ-Q  2398
             K RG  AR  AKS DEEGRL + F SF+SF  ASRTIMALWKT+  IP+ KAQ+AEEQ Q
Sbjct  770   KGRGLHARRWAKSQDEEGRLRYHFQSFISFNIASRTIMALWKTKTMIPEHKAQLAEEQPQ  829

Query  2399  YKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNY  2578
              +++ +++ E+ G ++  E+V M K++S +LP++ +SLMEMF+GG +EH++M KSG L+Y
Sbjct  830   DEEKRSIMLEDYGCFVSAEEVKMPKIFSAELPISVESLMEMFDGGKMEHEIMEKSGRLSY  889

Query  2579  VTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPF  2758
              T++WE ++P V+ER+++Y+    ISIFG EVT TQ KS   ND GW +NE+  +H VPF
Sbjct  890   ATTAWESVKPGVFERQITYRFKHHISIFGGEVTCTQHKSPLENDKGWTVNELTVMHDVPF  949

Query  2759  SDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEF  2938
             +D++ V LRY++E  S A  +C+C V+VG+ WLK+TK + RIT+NI  KF+Q +KE+ E 
Sbjct  950   ADYFHVNLRYQIEKSSLAHGACKCGVHVGITWLKSTKFQQRITRNISDKFTQIIKEVFEL  1009

Query  2939  VGREVFLSS  2965
             + RE   ++
Sbjct  1010  IKREKLFAN  1018



>ref|XP_007036381.1| C2 calcium/lipid-binding and GRAM domain containing protein, 
putative [Theobroma cacao]
 gb|EOY20882.1| C2 calcium/lipid-binding and GRAM domain containing protein, 
putative [Theobroma cacao]
Length=980

 Score =  1092 bits (2824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/908 (60%), Positives = 673/908 (74%), Gaps = 57/908 (6%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDV--------DAIKVSSP-KKVLEGK  421
             GKILLT+SLHGKGHD S +H  + Q  +  E  K++        D     +P  K+ EGK
Sbjct  117   GKILLTISLHGKGHDNSASHLLYAQSDIHHEDYKELESTCKLSHDIFSFKAPCLKITEGK  176

Query  422   QLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCE  601
              L+K+IAG LEKLF+KNEE+S++++  SK       S+  SD+ED+++    S   S  E
Sbjct  177   HLVKAIAGRLEKLFNKNEETSRTDDSSSKL------STTLSDHEDSLEGLPSSC--SLEE  228

Query  602   AIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
             AIKL+QS+    EMPENL+GGILLD+ YAL   D N   FAPDSQFR++LAELQGT +VQ
Sbjct  229   AIKLMQSKHNQHEMPENLEGGILLDRMYALSSYDLNKFFFAPDSQFRKDLAELQGTTEVQ  288

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             EG WTWKS    CLTRVVTYTK ATKLVK+V+ATEEQ Y+K +G+EFA+L+  STP+   
Sbjct  289   EGSWTWKSGYDFCLTRVVTYTKAATKLVKAVKATEEQIYIKANGQEFAILISASTPE---  345

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
                                                  STMM ++IEGG +QGLK+SF +F
Sbjct  346   -------------------------------------STMMGSMIEGGVKQGLKESFDQF  368

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             +  LAQ  K++ S E+ D  H+L+TL +E  SD ELA EYF NFTVV T F+  +F +H+
Sbjct  369   ASLLAQKLKILDSMELSDRDHMLSTLQTEQQSDWELATEYFWNFTVVFTIFMFSFFIVHL  428

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
             +L  S+++QGLE  GLDLPDS GE+IT GIL++ L++ Y M++ F++ARL+RGSDHGV+A
Sbjct  429   ILCDSSKVQGLEIDGLDLPDSFGELITGGILIILLQRAYNMVSRFMQARLQRGSDHGVKA  488

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              GDGWVLTV LIEG NLASLD TGF DP+VVFTCNGK+RTSSV+LQT DPQWNEILEF+ 
Sbjct  489   QGDGWVLTVTLIEGVNLASLDSTGFSDPYVVFTCNGKTRTSSVKLQTRDPQWNEILEFDA  548

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
              EEPPS+LD+EVFDFDGPFDQA SLGHAEINFLKH S ELADLW+ L GK+AQSSQSKLH
Sbjct  549   MEEPPSVLDIEVFDFDGPFDQATSLGHAEINFLKHKSTELADLWVSLEGKLAQSSQSKLH  608

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFL+NN GVE I++ LTKMEKEVGK+LNLRSPH+NSTFQK FGLPPEEFLI+DF+C L
Sbjct  609   LRIFLDNNKGVEAIKEYLTKMEKEVGKQLNLRSPHKNSTFQKLFGLPPEEFLISDFTCYL  668

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRKLP+QGR+FLS RIVGFYANLFGHKTKFFFLWEDIE I VLPPS +++GSPSLVIIL 
Sbjct  669   KRKLPVQGRLFLSARIVGFYANLFGHKTKFFFLWEDIEYIQVLPPSLASLGSPSLVIILR  728

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQY  2401
             KDRG DAR+GAKS DEEGRL F F SFVSF  ASRTIMALW+ R    DQKAQIAEEQQ 
Sbjct  729   KDRGLDARHGAKSQDEEGRLRFYFQSFVSFNVASRTIMALWRARTLTLDQKAQIAEEQQD  788

Query  2402  KDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYV  2581
             ++E  +  EE GS   VE   MSK+YS +LP++  SLME+F+GG+LE K+M KS C+NYV
Sbjct  789   QEERRITLEEVGSIRDVEITKMSKIYSAELPISVTSLMEIFDGGNLERKIMEKSACINYV  848

Query  2582  TSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFS  2761
              + WE ++P V ERR+SYK NR +SIFG EVT TQ+KS  AND GWILNE+M +H VPF 
Sbjct  849   MTIWEPVKPGVSERRISYKFNRHVSIFGGEVTCTQQKSPIANDEGWILNEVMVLHDVPFG  908

Query  2762  DHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFV  2941
             DH+ V   Y++E    A N+C+CD Y+G+ WLK+TK + RIT+NI  KF  R+KE+ E V
Sbjct  909   DHFHVHFMYQIEKSGLAHNACKCDAYIGITWLKSTKFQLRITRNITEKFIHRLKEIFELV  968

Query  2942  GREVFLSS  2965
              RE+  ++
Sbjct  969   EREILFAT  976



>ref|XP_010678868.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170 [Beta 
vulgaris subsp. vulgaris]
Length=1023

 Score =  1090 bits (2820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/909 (59%), Positives = 690/909 (76%), Gaps = 16/909 (2%)
 Frame = +2

Query  263   NPGKILLTLSLHGKGHDLSTNHACFVQPSVGSE----TSKDVDAIKVSSP----KKVLEG  418
             N GKILLTL+LHG+G D + + +   QP+ G+      S D   +   SP    KK+L G
Sbjct  119   NSGKILLTLTLHGRGDDANADLSLSEQPNTGTNYTQGESPDHAPVNTFSPTAPSKKILHG  178

Query  419   KQLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFC  598
             K+++K++   LEKL          N E +K D SS+LS  PS++ED+VQE + S + SF 
Sbjct  179   KKMVKAVTKRLEKLL-------HKNGEPAKSDESSDLSVSPSEFEDSVQEESLSPS-SFE  230

Query  599   EAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDV  778
             EA+ ++Q+R E  ++PENLQGGILLD+TY +  KD N  LFAP+S FRRELAELQG  D+
Sbjct  231   EAVAMMQNRDEEVDLPENLQGGILLDRTYVITSKDLNAFLFAPESPFRRELAELQGITDM  290

Query  779   QEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVP  958
             QE PWT KS +  CLTR VTYT+ A+KLVK+V+ATEEQTY+K DG EFAV V V+TPDVP
Sbjct  291   QEDPWTCKSGDSPCLTRFVTYTQPASKLVKAVKATEEQTYVKADGVEFAVFVSVATPDVP  350

Query  959   YGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSE  1138
             YG+TF+VE+LY IMPGP L SGEES+ L+ISW + F +ST MK++IEGG +QG+K+SF  
Sbjct  351   YGNTFRVEVLYKIMPGPELSSGEESSRLLISWGINFSQSTFMKSMIEGGAKQGVKESFDL  410

Query  1139  FSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIH  1318
             F + LAQ  K++ S +  +  H+L  L  EH SD ELA EYF N TV+S  FL LY  +H
Sbjct  411   FDKLLAQKLKLLDSEDSSEKDHVLEALQREHQSDWELATEYFGNLTVISATFLTLYVIVH  470

Query  1319  ILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVR  1498
             ILLS   + QGLE +GLDLPDS G++ITCGIL L LE+VY MI+ FV+ARLR GSDHG+R
Sbjct  471   ILLSEPHKPQGLEIYGLDLPDSFGQLITCGILALLLERVYNMISLFVQARLRVGSDHGIR  530

Query  1499  AHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFE  1678
             + GDGWV+TVAL+E  NL SLD  G  DPFVV TCNGK+RTSSVQLQT DPQWNEILEF+
Sbjct  531   SQGDGWVVTVALVEAVNLPSLDTLGSSDPFVVLTCNGKTRTSSVQLQTCDPQWNEILEFD  590

Query  1679  PAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKL  1858
              +EE PS+LDVEV+DFDGPFDQA SLGH EINFLKHT+ ELAD+W+PL GK A SSQ+KL
Sbjct  591   ASEELPSVLDVEVYDFDGPFDQAASLGHTEINFLKHTATELADMWVPLEGKQAVSSQAKL  650

Query  1859  HLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCS  2038
             HLRIF+ N  GVETI++ L KMEKEVGKKLNLRSPH+NS+FQK F LPPEEFLI D+SCS
Sbjct  651   HLRIFVENKKGVETIKEYLNKMEKEVGKKLNLRSPHKNSSFQKLFNLPPEEFLIKDYSCS  710

Query  2039  LKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIIL  2218
             L+RK+PLQGR+FLS RIVGFYAN FGHK KFFFLW+DIE+I V+ P+ ++ GSP+LVIIL
Sbjct  711   LRRKMPLQGRLFLSARIVGFYANFFGHKIKFFFLWDDIEDIEVVDPTMASFGSPTLVIIL  770

Query  2219  HKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQ  2398
              K RG DAR+GAK+ DEEGRL F F SF+ F  AS+TI ALWK R   P++K  IAEE+ 
Sbjct  771   RKGRGLDARHGAKTQDEEGRLKFYFQSFIPFDVASKTITALWKARTVAPEKKTLIAEERG  830

Query  2399  YKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNY  2578
              ++   V  E+  S   VE+ +MSK+YS  LP++ KSLM+MF GG+LE KVM+KSGCL+Y
Sbjct  831   NQESLLVPHEDDSSLFNVENSNMSKIYSTILPVDIKSLMKMFGGGNLERKVMAKSGCLDY  890

Query  2579  VTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPF  2758
             VT+ W++++PDVYER++SYK N  +S+FG EV STQRK +  +  GWI+NE MA+H +PF
Sbjct  891   VTTQWQVVKPDVYERQLSYKFNYEVSVFGGEVRSTQRKMLLGDIDGWIVNEAMALHDIPF  950

Query  2759  SDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEF  2938
              DH++V L Y +ES +++ ++C+CDVY+G++WLK+ K + RI K+I  KF++R+K + E 
Sbjct  951   GDHFRVHLSYNLESLASSEDACKCDVYIGILWLKDCKFQQRIAKSINEKFARRLKTIFEL  1010

Query  2939  VGREVFLSS  2965
             V +E+ L++
Sbjct  1011  VKKEILLAN  1019



>ref|XP_002321630.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEF05757.1| C2 domain-containing family protein [Populus trichocarpa]
Length=1039

 Score =  1089 bits (2816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 537/913 (59%), Positives = 691/913 (76%), Gaps = 26/913 (3%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSS--------PK-KVLEGK  421
             GKILL+LSL  K    STNH  +   +V +E  K+ +   +SS        P+ K+ EGK
Sbjct  124   GKILLSLSLSRKCDKSSTNHFVYANSNV-NEDYKESEGPCISSHGMHGCKAPRVKIAEGK  182

Query  422   QLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCE  601
             +L+K+I   LE++F+K+EE+S++++          L+S  SD ED       S + SF E
Sbjct  183   KLMKTIVSRLERVFNKHEENSRTDDSSE-------LTSASSDCED----CDHSSSCSFVE  231

Query  602   AIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
              ++++ SR   +EMPENLQGGILLD+ Y +P  D NM LFAP+S F ++L ELQGT D +
Sbjct  232   GLEIMSSRDNEQEMPENLQGGILLDKIYVVPSWDLNMFLFAPNSLFMKDLEELQGTTDAE  291

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             EGPW  KS N S LTR V+YTK ATKLVKSV+ATEEQTY+K DGKEFAVL +VSTP+VPY
Sbjct  292   EGPWKRKSANMSHLTRTVSYTKAATKLVKSVKATEEQTYIKADGKEFAVLTNVSTPEVPY  351

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             G+TF +ELLY I+PGP + SGE S+HL+ISW + FCKSTMMK +IEGG +QGLK+SF +F
Sbjct  352   GNTFNIELLYKILPGPEISSGEASSHLLISWGINFCKSTMMKGMIEGGARQGLKESFDQF  411

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             +  LAQ+ K + S +  +  H+LA L + H S+ +LA ++F NFT VST F++LY  +HI
Sbjct  412   ANLLAQNFKTMDSMDSSNKDHMLAKLEAAHQSEWQLASDFFWNFTAVSTIFMILYVVVHI  471

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
                  + +QGLEF+GLDLPDS G++ITC ILV+ LE+V  M+ HF++ARL+RGSDHGVRA
Sbjct  472   FFCEPSIVQGLEFNGLDLPDSFGQLITCAILVIQLERVCNMMKHFIQARLQRGSDHGVRA  531

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              G+GWVLTVALIEGTNL SLD TG  DP+VV TCNGK+RTSS+QL T DPQWNEILEF+ 
Sbjct  532   QGEGWVLTVALIEGTNLPSLDSTGLSDPYVVLTCNGKTRTSSIQLHTSDPQWNEILEFDA  591

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
              +EPPS+LDVEVFDFDGPFDQA SLGHAEI FLKHTS ELAD+W+PL GK++QSSQSKLH
Sbjct  592   MDEPPSVLDVEVFDFDGPFDQATSLGHAEIMFLKHTSTELADMWIPLEGKLSQSSQSKLH  651

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIF++N+ GVET+++ LTKMEKEVGKKLNL SPHRNSTFQK F LPPEEFLINDF+C L
Sbjct  652   LRIFIDNDKGVETVKEYLTKMEKEVGKKLNLPSPHRNSTFQKLFELPPEEFLINDFTCQL  711

Query  2042  KRKLPLQ----GRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLV  2209
             KRK+PLQ    GR+FLS RI+GFY+NLFGHKTKFFFLWEDIE+I V PPS S++GSP LV
Sbjct  712   KRKMPLQVRVTGRLFLSARILGFYSNLFGHKTKFFFLWEDIEDIQVHPPSLSSVGSPFLV  771

Query  2210  IILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAE  2389
             IIL + RG  AR  AKS DEEGRL + F SF+SF  ASRTIMALWKT+  IP+ K Q+AE
Sbjct  772   IILRRGRGLHARRWAKSQDEEGRLRYHFQSFISFNIASRTIMALWKTKTMIPEHKTQLAE  831

Query  2390  EQ-QYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSG  2566
             EQ Q +++ +++ E+ G  +  E+V M K++S +LP + +SLMEMF+GG +EH++M KSG
Sbjct  832   EQPQDEEKRSIMLEDYGCSVSPEEVKMPKIFSAELPFSVESLMEMFDGGKMEHEIMEKSG  891

Query  2567  CLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIH  2746
              L+Y T++WE ++P V+ER+++Y+    ISIFG EVT TQ KS   ND GW +NE+  +H
Sbjct  892   RLSYATTAWESVKPGVFERQITYRFKHHISIFGGEVTCTQHKSPLENDKGWTVNELTVMH  951

Query  2747  GVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKE  2926
              VPF+D++ V LRY++E  S A  +C+C VYVG+ WLK+TK + RIT+NI  KF+Q +KE
Sbjct  952   DVPFADYFHVNLRYQIEKSSLAHCACKCGVYVGITWLKSTKFQQRITRNITDKFTQIMKE  1011

Query  2927  MIEFVGREVFLSS  2965
             + E + RE   ++
Sbjct  1012  VFELIKREKLFAN  1024



>gb|EYU22179.1| hypothetical protein MIMGU_mgv1a025186mg [Erythranthe guttata]
Length=1005

 Score =  1082 bits (2799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 554/876 (63%), Positives = 676/876 (77%), Gaps = 15/876 (2%)
 Frame = +2

Query  356   SETSKDVDAIKVSSPKKVLEGKQLIKSIAGHLEKLFDkneessksneegskkdnsseLSS  535
             S  SK   +    S +K+ E K L+KS+AG LEKL  K +E   +++  S +      S+
Sbjct  136   SNESKLTSSNDSHSSRKIGESKHLMKSLAGRLEKLLHKKDEIPTTSDNSSSEV-----SA  190

Query  536   IPSDYEDNVQETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNML  715
               SD+ED+  E + +   +F E+I+L++S     E PENL GGILLDQT+ + PKD N +
Sbjct  191   AASDHEDSAPEPSETSC-TFEESIELVKSTNGNNETPENLPGGILLDQTFGVSPKDLNKI  249

Query  716   LFAPDSQFRRELAELQGTKDVQEGPWTWKSD--NKSCLTRVVTYTKGATKLVKSVQATEE  889
             LFAP+S F   LAELQGT D+ E PW   S+   KSCL RVVTYTK ATKLVK+V+ATEE
Sbjct  250   LFAPNSDFMTNLAELQGTTDIHEEPWKLISEEGGKSCLRRVVTYTKAATKLVKAVKATEE  309

Query  890   QTYLKGDGK-EFAVLVDVSTPDVPYGSTFKVELLYNIMPG---PGLRSGEESTHLVISWA  1057
             Q Y+K +   EFA+ V VSTPDVPYG+TFKVELLY I+PG       SGEES  LV+SWA
Sbjct  310   QIYIKANNNNEFAIHVIVSTPDVPYGNTFKVELLYKIIPGGVMMSSSSGEESARLVVSWA  369

Query  1058  VKFCKSTMMKTVIEGGTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPS  1237
             V F + TMMK +IEGG +QGLK+SF +F   L+Q  KV+   ++ D   +LA L +EH S
Sbjct  370   VNFSQQTMMKGMIEGGARQGLKESFDQFLSLLSQRFKVV--KDISDKDQMLANLETEHKS  427

Query  1238  DLELAREYFCNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILV  1417
              LELA +YF NFTVVST F++LY  +HI L  S +L+GLEF GLDLPDS GEIITC +LV
Sbjct  428   CLELAVQYFWNFTVVSTVFMLLYVLVHIFLCGSHELRGLEFGGLDLPDSFGEIITCAVLV  487

Query  1418  LHLEQVYRMIAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVF  1597
             L LE+VY MI +FVEA LRR +DHG++A GDGWVLTVALIEG NLAS + T  PDP+VVF
Sbjct  488   LQLERVYYMILYFVEATLRRENDHGIKARGDGWVLTVALIEGANLASTNSTETPDPYVVF  547

Query  1598  TCNGKSRTSSVQLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINF  1777
             TCNGK++TSSV+LQ LDPQWNEILEF+  EEPPS+LD+EVFDFDGPFDQ  SLGHAEINF
Sbjct  548   TCNGKTKTSSVKLQALDPQWNEILEFDAVEEPPSVLDLEVFDFDGPFDQVSSLGHAEINF  607

Query  1778  LKHTSAELADLWLPLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLR  1957
             LKHTSAELADLW+PL GK+AQS QSKLHLRIFL+NNNGVETIRD L  + KEVGKKLNLR
Sbjct  608   LKHTSAELADLWVPLDGKLAQSCQSKLHLRIFLDNNNGVETIRDYLANLGKEVGKKLNLR  667

Query  1958  SPHRNSTFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFF  2137
             SPHRNSTFQK FGLPPEEFL++DFSCSLKRK+PLQGR+FLS RIVGFYANLFGHKT+FFF
Sbjct  668   SPHRNSTFQKHFGLPPEEFLVSDFSCSLKRKMPLQGRLFLSARIVGFYANLFGHKTRFFF  727

Query  2138  LWEDIEEINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGG  2317
             LWEDIE+I VLPPS +++GSP L IILHK RG D+R+GAK +DE+GRLHF FHSFVSF  
Sbjct  728   LWEDIEDIRVLPPSLASVGSPLLEIILHKGRGLDSRHGAKVLDEQGRLHFYFHSFVSFNV  787

Query  2318  ASRTIMALWKTRACIPDQKAQIAEEQQYKDENNV-LPEETGSYLIVEDVSMSKVYSVDLP  2494
             ASRTIMALWKTR   PDQKA+I E+++  D     L EE+G +  VED  M+KVY+++LP
Sbjct  788   ASRTIMALWKTRTLEPDQKAEIEEDERDDDGGKAFLLEESGPHFAVEDAKMTKVYTMELP  847

Query  2495  MNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEV  2674
             +N KSLM+MF GG+LEHKVMSKSGCLNYVT++WE +  +V ERRV YK +  ISIFG EV
Sbjct  848   LNIKSLMKMFEGGELEHKVMSKSGCLNYVTATWENVTSEVQERRVCYKFSHRISIFGGEV  907

Query  2675  TSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMW  2854
              STQ+KS   ND GWI+NEIM +H VPF DH++VQ RY++E    A NSC+CD+Y+G++W
Sbjct  908   NSTQQKSTLPNDNGWIVNEIMTLHNVPFGDHFRVQFRYQMEKSLFAHNSCKCDLYIGLIW  967

Query  2855  LKNTKLEDRITKNIVRKFSQRVKEMIEFVGREVFLS  2962
             LKNTK E RITKN++  F++R +E+++ V RE+ L+
Sbjct  968   LKNTKFEPRITKNVIGMFTRRSQEILQLVEREILLT  1003



>ref|XP_003522401.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170-like 
[Glycine max]
 gb|KHN30947.1| C2 and GRAM domain-containing protein [Glycine soja]
Length=1014

 Score =  1081 bits (2795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/907 (59%), Positives = 686/907 (76%), Gaps = 15/907 (2%)
 Frame = +2

Query  254   FSTNPGKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSSP---KKVLEGKQ  424
             F+   GKILLT+SLHGKG     NH      ++  + S+D++ + V+      K+  GKQ
Sbjct  115   FNEYCGKILLTVSLHGKGRSSFINHKHSSNSTIAVDNSRDLEGLHVACQVPCDKMGAGKQ  174

Query  425   LIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCEA  604
             L+K+IA  L ++F K EE+SKS +          LS+  SDYED+VQE   S   SF EA
Sbjct  175   LLKAIANGLHRIFKKKEENSKSGDSSE-------LSTSLSDYEDSVQEN--SSPCSFEEA  225

Query  605   IKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQE  784
             I L++S  +  EMPENL GG+L+DQ Y + P D N+ LFAP+SQF +++ ELQGT +VQE
Sbjct  226   IALMESGDDKPEMPENLPGGVLVDQIYLVSPNDLNVFLFAPNSQFSKDMVELQGTTNVQE  285

Query  785   GPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYG  964
             GPWTWK+ + SCLTRVVTYTK ATKL+K+V A EEQTY++   KEFA+LV VSTP+VPYG
Sbjct  286   GPWTWKNGDMSCLTRVVTYTKAATKLIKAVNAIEEQTYIRVSRKEFAILVSVSTPEVPYG  345

Query  965   STFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFS  1144
             ++F++ELLY IMPG    SGEES+HLV+SW + F +STMMK +IEGG +QGLK+S  +FS
Sbjct  346   NSFRIELLYKIMPGEA-SSGEESSHLVVSWGIVFLQSTMMKGMIEGGARQGLKESLVQFS  404

Query  1145  RFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHIL  1324
               LA + KV+  A++ D  HLLATL +E   +      YF NFTV ST F+ LY  +HIL
Sbjct  405   DQLALNFKVLDKADLPDKEHLLATLQTEDQWNWWQTITYFWNFTVASTIFMFLYVLVHIL  464

Query  1325  LSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAH  1504
                 +  QGLEF GL+LPDS GE+IT GIL++ L++VY M++HFV+AR + G+DHG++A+
Sbjct  465   RCGPSLPQGLEFSGLELPDSFGELITSGILIIQLQRVYNMVSHFVQARFQMGTDHGLKAN  524

Query  1505  GDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPA  1684
             GDGWVLTVALIEG +LASL+  G  DP+VVFTCNG++R+SSV+LQ  DP WNEILEF+  
Sbjct  525   GDGWVLTVALIEGVDLASLESEGLSDPYVVFTCNGQTRSSSVKLQMPDPLWNEILEFDAM  584

Query  1685  EEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHL  1864
             EEPPS+L VEVFDFDGPFDQ  SLGHAEINFLKHTS ELAD+W+ L GK+AQSSQSKLHL
Sbjct  585   EEPPSVLHVEVFDFDGPFDQDVSLGHAEINFLKHTSTELADMWVMLEGKLAQSSQSKLHL  644

Query  1865  RIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLK  2044
             RIFL+NNNGVETI++ L KMEKEVGKKLNLRSP RNSTFQK F LPPEEFLI DF+C LK
Sbjct  645   RIFLDNNNGVETIKEYLEKMEKEVGKKLNLRSPQRNSTFQKLFALPPEEFLIKDFTCYLK  704

Query  2045  RKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHK  2224
             RK+PLQGR+FLS RI+GF+ANLFGHKTKFFFLWEDIEEI VLPPS +T+GSP+LVIIL +
Sbjct  705   RKMPLQGRLFLSARILGFHANLFGHKTKFFFLWEDIEEIQVLPPSLATLGSPTLVIILRR  764

Query  2225  DRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYK  2404
              RG DAR+GAK+ DEEGRL F F SFVSF  ASRTI ALW+TR   P QK QI+EE +  
Sbjct  765   GRGLDARHGAKTQDEEGRLRFHFQSFVSFSAASRTIKALWRTRILNPYQKEQISEEHE-D  823

Query  2405  DENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVT  2584
              E+ V+ E++ S L  E+  MS+++S +LP+  KS+M +F+GG+LEHK+M ++GC+NY T
Sbjct  824   QESFVILEDSASILEDEE-KMSRIFSAELPIKMKSVMGIFDGGNLEHKIMQRTGCMNYET  882

Query  2585  SSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSD  2764
             +SWE ++PD +ER VSY+ NR +S+FG EVT TQ+K  + N  GW + E+MA+H VPF+D
Sbjct  883   TSWEQVKPDFFERHVSYQFNRHVSVFGGEVTCTQQKFPNTNTGGWTVIEVMALHSVPFAD  942

Query  2765  HYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVG  2944
             H+ +  RY++E  S    +C+CD Y+G+MWLK++K + RI +NI  KF+ R+KE+ E V 
Sbjct  943   HFHIHFRYEIEKSSLGDCACKCDAYIGIMWLKSSKFQQRINRNITAKFNLRLKEIFELVQ  1002

Query  2945  REVFLSS  2965
             +E+ L S
Sbjct  1003  KEILLMS  1009



>ref|XP_003528135.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170-like 
isoform X1 [Glycine max]
 gb|KHN19259.1| C2 and GRAM domain-containing protein [Glycine soja]
Length=1017

 Score =  1078 bits (2788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/908 (59%), Positives = 684/908 (75%), Gaps = 17/908 (2%)
 Frame = +2

Query  254   FSTNPGKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKV---SSPKKVLEGKQ  424
             F+   GKILLT+SLHGKG     NH      ++  E S+D++ +     S   K+  GKQ
Sbjct  118   FNKYCGKILLTVSLHGKGRSF-MNHKHSPNSTIAVENSRDLEGLHFLCQSHCDKMGVGKQ  176

Query  425   LIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCEA  604
             L+K IA  L ++F K E +S   +           SS  SDYED+V E T     SF E+
Sbjct  177   LLKDIANGLHRIFKKKEGNSNFGDSSEL-------SSSLSDYEDSVHENTFPC--SFEES  227

Query  605   IKLLQSRTEGR-EMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
             I L++SR + + EMPENL  GIL+DQ Y + P D N+ LFAP+SQF +++AELQGT +VQ
Sbjct  228   IALMESRDDNKPEMPENLPVGILVDQIYLVSPNDLNVFLFAPNSQFSKDMAELQGTTNVQ  287

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             EGPWTWK+ + SCLTRVVTY K ATKL+K+V A EEQTY++   KEFA+LV VSTP+VPY
Sbjct  288   EGPWTWKNGDTSCLTRVVTYMKAATKLIKAVNAIEEQTYIRVSRKEFAILVSVSTPEVPY  347

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             G++F++ELLY IMPG  + SGEES+HLV+SW + F +STMMK +IEGG +QGLK+SFS+F
Sbjct  348   GNSFRIELLYKIMPGE-VSSGEESSHLVVSWGIVFLQSTMMKGMIEGGARQGLKESFSQF  406

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             S  LA++ KV+  A++ D  HLLATL +E          YF NFTV ST F+ LY  +HI
Sbjct  407   SDQLARNFKVLDKADLPDKEHLLATLQTEDQWYWWQTITYFWNFTVASTIFMFLYVLVHI  466

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
             L      LQGLEF GL+LPDS GE+IT GIL++ L++VY M++HFV+AR + G+DHG++A
Sbjct  467   LRCGPNLLQGLEFSGLELPDSFGELITSGILIIQLQRVYNMVSHFVQARFQMGTDHGLKA  526

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
             HGDGWVLTVALIEG +LASL+  G  DP+VVFTCNG++R+SSV+LQT DPQWNEILEF+ 
Sbjct  527   HGDGWVLTVALIEGVDLASLESEGLSDPYVVFTCNGQTRSSSVKLQTSDPQWNEILEFDA  586

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
              EEPPS+L VEVFDFDGPFDQ  SLGHAEINFL+HTS ELAD+W+ L GK+AQSSQSKLH
Sbjct  587   MEEPPSVLHVEVFDFDGPFDQDVSLGHAEINFLRHTSTELADMWVMLEGKLAQSSQSKLH  646

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFL+NNNGVETI++ L KMEKEVGKKLNLRSP RNSTFQK F LPPEEFLI DF+C L
Sbjct  647   LRIFLDNNNGVETIKEYLEKMEKEVGKKLNLRSPQRNSTFQKLFALPPEEFLIKDFTCYL  706

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRK+PLQGR+FLS RI+GF+ANLFGHKTKFFFLWEDIEEI VLPPS +T+GSP+LVI+L 
Sbjct  707   KRKMPLQGRLFLSARILGFHANLFGHKTKFFFLWEDIEEIQVLPPSLATLGSPTLVIVLR  766

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQY  2401
             + RG DAR+GAK+ DEEGRL F F SFVSF  ASR I ALW+TR   P QK QI+EE + 
Sbjct  767   RGRGLDARHGAKTQDEEGRLRFHFQSFVSFSAASRAIKALWRTRILNPYQKEQISEEHE-  825

Query  2402  KDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYV  2581
               E  V+PE++ S L  E+  MS+++S +LP+  KS+M +F+GG+LEHK+M ++GC NY 
Sbjct  826   DQERFVIPEDSASILEDEE-KMSRIFSAELPIKMKSVMGIFDGGNLEHKIMQRTGCTNYE  884

Query  2582  TSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFS  2761
             T+SWE ++ DV+ERRVSY+ NR +S FG EVT TQ+K  +AN  GW + E+M +HGVPF+
Sbjct  885   TTSWEQVKHDVFERRVSYQFNRHVSAFGGEVTCTQQKFPNANTGGWTVIEVMDLHGVPFA  944

Query  2762  DHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFV  2941
             DH+ +  RY++E  S    +C+CD Y+G+MWLK++K + RI +NI  KF+ R+KE+ E V
Sbjct  945   DHFHIHFRYEIEKSSLGDCACKCDAYIGIMWLKSSKFQQRINRNITAKFNLRLKEIFELV  1004

Query  2942  GREVFLSS  2965
              +E+ L S
Sbjct  1005  QKEILLMS  1012



>ref|XP_010251062.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170 isoform 
X1 [Nelumbo nucifera]
Length=1017

 Score =  1077 bits (2785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/903 (59%), Positives = 673/903 (75%), Gaps = 16/903 (2%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIK--------VSSPKKVLEGKQ  424
             GKILLTL L G+ +D S  H      S   +  + VD  +        V+S +K+ E KQ
Sbjct  121   GKILLTLCLCGRINDTSNIHTFLRSGSNTKDLKEQVDPAEQSQGMLSSVASFRKIPEWKQ  180

Query  425   LIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCEA  604
             L+K IA  LE+L +KNEE+               L S  SDY+D++ E T     SF EA
Sbjct  181   LVKVIASWLERLLNKNEETVTCKSTTDYSSE---LYSTTSDYQDSMDEPTPGC--SFEEA  235

Query  605   IKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQE  784
             I L++SR E +E+PE+L GGILLDQTY +  +  N +LF P+SQF+++LAELQG  D+QE
Sbjct  236   IDLIKSRDEKQELPEDLPGGILLDQTYMVSSRHLNSILFEPNSQFKKDLAELQGITDLQE  295

Query  785   GPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYG  964
             GPWTWK      LTRV+TYTK ATKLVK+++ATE+QTYL  DG+EF VL DVSTPD PYG
Sbjct  296   GPWTWKLGK--ILTRVITYTKPATKLVKAIKATEDQTYLYADGREFVVLTDVSTPDAPYG  353

Query  965   STFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFS  1144
               FK+E LY IMPGP    GEE + LV+SW + F + T+M+ +IEG  QQG+K+S  +F+
Sbjct  354   HYFKMEFLYRIMPGPESSVGEEFSRLVVSWNINFLQRTVMRRMIEGRVQQGMKESNEQFA  413

Query  1145  RFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHIL  1324
             R L+Q  + I S  +LD   +LA L  EH S+ ELA EYF NF VVST F+VLY  +HI 
Sbjct  414   RLLSQKIRPIGSTALLDKEQMLAKLQQEHQSNWELAIEYFWNFNVVSTIFMVLYVLLHIF  473

Query  1325  LSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAH  1504
             LS    +QGLEF+GLDLPD+ GE+ITCGIL L +E V+ MI+HFV+ARL+RGSD GV++ 
Sbjct  474   LS-GHGIQGLEFNGLDLPDTFGELITCGILALQVEHVFNMISHFVQARLKRGSDRGVKSR  532

Query  1505  GDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPA  1684
             GDGWVLTVAL+EG NLASLD TG  DP+VVFTCNGKSRTSS++LQT DPQWNE+LEF+  
Sbjct  533   GDGWVLTVALVEGNNLASLDSTGLSDPYVVFTCNGKSRTSSIKLQTSDPQWNEVLEFDAM  592

Query  1685  EEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHL  1864
             EEPPS+LDVEVFDFDGPFD   SLGH EINFLKHTS ELAD+W+ L GK+AQ SQSKLH+
Sbjct  593   EEPPSVLDVEVFDFDGPFDLDASLGHVEINFLKHTSTELADMWVTLEGKLAQISQSKLHV  652

Query  1865  RIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLK  2044
             RIFL N+ GVET+++ LTKMEKEVGKKL+L++P+RNSTFQK FGLPPEEFLI+DFSCSLK
Sbjct  653   RIFLENSKGVETVKEYLTKMEKEVGKKLDLQTPYRNSTFQKIFGLPPEEFLIDDFSCSLK  712

Query  2045  RKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHK  2224
             RK+PLQGR+FLS RI+GFYANLFGHKTKFFFLWEDIE+I ++PPS S++GSPSL+IILHK
Sbjct  713   RKMPLQGRLFLSARIIGFYANLFGHKTKFFFLWEDIEDIQLIPPSLSSVGSPSLIIILHK  772

Query  2225  DRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYK  2404
              +G DA++GAKS DEEGRL F F SFVSF  ASRTIMALW+TR  IP+QK QI E  +  
Sbjct  773   GQGLDAKHGAKSQDEEGRLRFHFQSFVSFNVASRTIMALWRTRTSIPEQKDQIEETHKDH  832

Query  2405  DENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVT  2584
             D    L  +TGS+  +ED++MSK+Y  +L ++ + LME+F GGDLEH+VM KSGCLNY T
Sbjct  833   DGKPFLIGDTGSFWGLEDMNMSKIYFAELLVHIELLMEVFGGGDLEHRVMEKSGCLNYAT  892

Query  2585  SSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSD  2764
             + WE  +P+VYER + YK N  +SI+G EV S Q+KS   +  GW + E+M +H VPF D
Sbjct  893   TPWEATKPNVYERHICYKFNHHVSIYGAEVISIQQKSPTEDGNGWTVVEVMTLHEVPFGD  952

Query  2765  HYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVG  2944
             +++V L+Y++++   A  +C+CDVY+G+ WLK TKL+ RIT+NI  KF+ R K++ E V 
Sbjct  953   YFRVHLKYQIKTTIVASGACQCDVYIGIEWLKTTKLQKRITRNITEKFTHRSKDIFELVE  1012

Query  2945  REV  2953
              E+
Sbjct  1013  EEI  1015



>ref|XP_007138020.1| hypothetical protein PHAVU_009G174400g [Phaseolus vulgaris]
 gb|ESW10014.1| hypothetical protein PHAVU_009G174400g [Phaseolus vulgaris]
Length=1012

 Score =  1064 bits (2752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/907 (60%), Positives = 680/907 (75%), Gaps = 15/907 (2%)
 Frame = +2

Query  254   FSTNPGKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVS--SP-KKVLEGKQ  424
             F+   GKILLT+SLHGK     T H      +   E SKD++ +  S  +P  K+  GKQ
Sbjct  113   FNKYCGKILLTVSLHGKCCASFTKHKHPPNSTFAVENSKDLECLHTSCRAPCDKMGLGKQ  172

Query  425   LIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCEA  604
             L K IA  + K+F K E +SK+ +          LS++ SD ED+VQE   S   SF EA
Sbjct  173   L-KVIANVVHKIFKKKEGNSKTGDSSE-------LSTMLSDCEDSVQED--SSPCSFEEA  222

Query  605   IKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQE  784
             + L++S     EMPENL GG+L+DQ Y + P D N+ LFAP+SQFR++LAELQGT +VQE
Sbjct  223   LALMESGDSKPEMPENLSGGVLVDQIYLVSPSDLNVFLFAPNSQFRKDLAELQGTTNVQE  282

Query  785   GPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYG  964
             GPWTWK+ + S LTRVV+YTK ATKL+K+V ATEEQ Y++   KEFA+LV VSTP+VPYG
Sbjct  283   GPWTWKNGDMSSLTRVVSYTKAATKLIKAVTATEEQKYIRVCRKEFAILVSVSTPEVPYG  342

Query  965   STFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFS  1144
             +TF++E LY IMPG  + SGEES+HLV+SW++ F  STMMK++IE G +QGLK+SFS FS
Sbjct  343   NTFRIEFLYKIMPGGEVSSGEESSHLVVSWSIVFLHSTMMKSMIESGARQGLKESFSLFS  402

Query  1145  RFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHIL  1324
               LAQ+ KV   A   D  H LATL +E       A  YFCNFTVVST F+ LY  +HIL
Sbjct  403   EKLAQNFKVQNKANFSDKEHFLATLQTEDQWHWWQAITYFCNFTVVSTIFMCLYVVVHIL  462

Query  1325  LSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAH  1504
                 +  QGLEF GL+LPDS GE+I  G+L+  L++VY M++HFV+AR + G+DHG++AH
Sbjct  463   YCGPSLPQGLEFKGLELPDSFGELIISGVLITQLQRVYNMLSHFVQARFQMGTDHGLKAH  522

Query  1505  GDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPA  1684
             G GWVLTVALIEG +LASL+  G  DP+VVFTCNG++R+SSV+LQT +PQWNEILEF+  
Sbjct  523   GVGWVLTVALIEGVDLASLESEGLSDPYVVFTCNGQTRSSSVKLQTSNPQWNEILEFDAM  582

Query  1685  EEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHL  1864
             EEPPS+LDVEVFDFDGPFDQ  SLGHAEINFLKHTS ELAD+WL L GK+AQSSQSKLHL
Sbjct  583   EEPPSVLDVEVFDFDGPFDQDVSLGHAEINFLKHTSTELADMWLLLEGKLAQSSQSKLHL  642

Query  1865  RIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLK  2044
             RIFL+NN GVETI++ L KMEKEVGKKLNL SP RNSTFQK F LPPEEFLI DF+C LK
Sbjct  643   RIFLDNNKGVETIKEYLEKMEKEVGKKLNLTSPQRNSTFQKLFALPPEEFLIKDFTCYLK  702

Query  2045  RKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHK  2224
             RK+PLQGR+FLS RI+GF+AN FGHKTKFFFLWEDIEEI VLPPS++T+GSP+LVIIL +
Sbjct  703   RKMPLQGRLFLSARILGFHANFFGHKTKFFFLWEDIEEIQVLPPSWATLGSPTLVIILRR  762

Query  2225  DRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYK  2404
              RG DAR GAK+ DEEGRL F F SF SF  ASRTI ALW+TR   P Q+ QI EE +  
Sbjct  763   GRGLDARYGAKTQDEEGRLRFHFQSFSSFSAASRTIKALWRTRILNPYQREQITEEHE-D  821

Query  2405  DENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVT  2584
              E  V+PE++ S L  E+  MS+++S +LP+   S+M +F GG+LEHK+M ++GC+NY T
Sbjct  822   QEGFVIPEDSASILENEE-KMSRIFSAELPIKMISVMGIFGGGNLEHKIMQRTGCMNYET  880

Query  2585  SSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSD  2764
             +SWEL++PDV+ERRVSY+ NR +S FG EVT TQ+K  +AN  GW + E+MA+HGVPF+D
Sbjct  881   TSWELVKPDVFERRVSYQFNRQVSAFGGEVTCTQQKCQNANTGGWTVIEVMALHGVPFAD  940

Query  2765  HYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVG  2944
             H+ + LRY++E  S    +C+CD Y+GVMWLK++K + RI +NI+ KF+ R+KE+ E   
Sbjct  941   HFHIHLRYEIEKSSLGECACKCDAYIGVMWLKSSKFQQRINRNIIAKFNLRLKEIFELAQ  1000

Query  2945  REVFLSS  2965
             +E+ L S
Sbjct  1001  KEILLMS  1007



>ref|XP_006852332.1| hypothetical protein AMTR_s00049p00208380 [Amborella trichopoda]
 gb|ERN13799.1| hypothetical protein AMTR_s00049p00208380 [Amborella trichopoda]
Length=1018

 Score =  1053 bits (2724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/898 (58%), Positives = 672/898 (75%), Gaps = 15/898 (2%)
 Frame = +2

Query  269   GKILLTLSLHGK-GHDLSTNHAC---FVQPSVGSETSKDVDAIKVSSPKK-----VLEGK  421
             G+ILL +SL+G+  ++ S  H     F++ S  + +S +   +  + P K     + E K
Sbjct  117   GEILLIISLYGRPNNNPSAIHPLPSDFLKLSDSAHSSVE-HKLAPTKPSKTGLDDLAEEK  175

Query  422   QLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCE  601
                +++AG L K F    ++  SN   +K  +S + SS  SD    + E + S   +F E
Sbjct  176   PSFQALAGRLVKRF--LSKNDNSNAPTTKNMDSLDCSSTISDDARELDEGS-SLDSTFEE  232

Query  602   AIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
             A+ +LQSR +  E+P+NL GG+L++Q Y + P D N +LFAP+SQF RE  ELQG  D++
Sbjct  233   ALSILQSRDQQNELPDNLPGGVLINQAYKVKPNDLNSILFAPNSQFSREFIELQGITDLR  292

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             EGPW W +D ++ L R + Y K ATKLVKSV+ATEEQTYLK  GK FA+   VS PDVPY
Sbjct  293   EGPWKWDNDGET-LKRTLQYKKPATKLVKSVRATEEQTYLKASGKSFAIFNSVSVPDVPY  351

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             GS+F+VELLY +M GP L SGEE++ LVISW + F +S M+K +IEGGT+ GLK+S+ +F
Sbjct  352   GSSFQVELLYKVMRGPELSSGEETSLLVISWHLNFLQSVMLKGIIEGGTRAGLKESYDQF  411

Query  1142  SRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIH  1318
             + FLA+  K + S EV LD   +LA++  +  SD +L  EYF NFTVV+T F+ LYF  H
Sbjct  412   TDFLAKKVKAVDSREVDLDKELVLASVQMDQQSDWKLPVEYFWNFTVVTTIFMGLYFLCH  471

Query  1319  ILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVR  1498
             I+L+  + +QGLEF GLDLPDS GE++T G+LVL +E+V  M++HFV+ARLRRGSD+G++
Sbjct  472   IILAGPSTIQGLEFTGLDLPDSFGELLTAGLLVLQVERVLEMVSHFVQARLRRGSDNGIK  531

Query  1499  AHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFE  1678
             A GDGW+LTVAL+EG+NLAS+  TG  DP+VVFTC+GK+RTSS++LQT DPQWNEI EF+
Sbjct  532   AQGDGWLLTVALLEGSNLASVGATGLSDPYVVFTCDGKARTSSIKLQTKDPQWNEIFEFD  591

Query  1679  PAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKL  1858
               EEPPSMLDVEVFD+DGPFD+A SLGHAEINFLKH SAELAD+W+PL GK+AQ+SQSKL
Sbjct  592   AMEEPPSMLDVEVFDYDGPFDEATSLGHAEINFLKHNSAELADIWVPLEGKLAQASQSKL  651

Query  1859  HLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCS  2038
             HLRIFL+N  G E I++ L +MEKEVG+K+NLRSPHRNS FQK FGLPPEEFLINDFSC 
Sbjct  652   HLRIFLDNTKGAEIIKEYLARMEKEVGEKINLRSPHRNSMFQKLFGLPPEEFLINDFSCY  711

Query  2039  LKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIIL  2218
             LKRK+PLQGR+FLS RI+GFYANLFGHKTKFFFLWEDIE+I V+PPS +++GSPSL+I L
Sbjct  712   LKRKMPLQGRLFLSARIIGFYANLFGHKTKFFFLWEDIEDIQVVPPSLASVGSPSLMITL  771

Query  2219  HKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQ  2398
             HK RG DAR+GAK+ DEEGRL F F SFVSF  ASRTIMALW+TR   P+ KAQIA++Q 
Sbjct  772   HKGRGLDARHGAKTQDEEGRLKFHFQSFVSFNVASRTIMALWRTRNLTPEMKAQIADDQH  831

Query  2399  YKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNY  2578
               D      EE GS+L VED +MSK YS  LP++  SLMEMF GG L+ K+M K+GCLNY
Sbjct  832   CPDGKITPTEECGSFLGVEDANMSKAYSASLPVSINSLMEMFGGGYLDRKIMDKAGCLNY  891

Query  2579  VTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPF  2758
              T+ WE + P+VYER +SYKLNR IS FG EVTSTQ+KS+ A+  GW+++E+M +H VPF
Sbjct  892   TTTPWEAVRPEVYERHISYKLNRHISNFGEEVTSTQQKSLMADGIGWVVDEVMTLHNVPF  951

Query  2759  SDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMI  2932
              DH++V LRY++E  +    +C C VYVG+ WLK+T  ++RITKNI  K +QRVK M 
Sbjct  952   GDHFRVHLRYQIEDSATLLETCNCHVYVGIAWLKSTMFQERITKNIFEKLTQRVKHMF  1009



>ref|XP_004501875.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170-like 
[Cicer arietinum]
Length=1536

 Score =  1052 bits (2720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/903 (58%), Positives = 682/903 (76%), Gaps = 15/903 (2%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLS-TNHACFVQPSVGSETSKDVDAIKVSS---PKKVLEGKQLIKS  436
             GKILLT+SLH KG+  S  NH       +  E S+D++ I +SS    +K+ EGK L+K 
Sbjct  121   GKILLTISLHCKGNANSFMNHKHSPNSDIAIENSRDLEGIHISSQPLSRKMGEGKHLLKV  180

Query  437   IAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCEAIKLL  616
             I   L ++ +K E +SKS +           S+  SDYED+      S   SF E I ++
Sbjct  181   ITNRLNRILNKKEGNSKSADCSET-------SNSLSDYEDSNSVQENSPPCSFEEGIAVM  233

Query  617   QSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEGPWT  796
             +SR    E PENLQGGIL+D+ YA+ P + N++LFAP+SQFR++LAELQGT ++QEG W+
Sbjct  234   ESRDSQPESPENLQGGILVDKIYAVSPYNLNIVLFAPNSQFRKDLAELQGTTNLQEGAWS  293

Query  797   WKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGSTFK  976
             WK ++ SCLTR+V+YTK A+KLVK+V ATEEQTY+K    E+AVLV V TP+VPYG +F+
Sbjct  294   WKDEDMSCLTRIVSYTKAASKLVKAVNATEEQTYIKVTKDEYAVLVSVCTPEVPYGKSFR  353

Query  977   VELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRFLA  1156
             VELLY IMPG  + S +ES++LV+SW + F +STMMK VIE G +QGLK+SF +FS  L 
Sbjct  354   VELLYKIMPGGDVSSEDESSNLVVSWGIVFLQSTMMKGVIESGAKQGLKESFDQFSDLLG  413

Query  1157  QHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHILLSRS  1336
             +  KV+   ++++  HLLATL +E   +   A  YF NFTVVST F++LY   HIL    
Sbjct  414   RSFKVVDKTDLMNKEHLLATLQTESQMNWWQAITYFWNFTVVSTIFMLLYVLFHILKCGP  473

Query  1337  TQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHGDGW  1516
              Q QGLEF G++LPDS GE++T GIL++ L++VY M++HFV+AR + G+DHG++AHGDGW
Sbjct  474   NQPQGLEFRGIELPDSFGELVTSGILIIQLQRVYDMVSHFVQARFQMGTDHGLKAHGDGW  533

Query  1517  VLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEEPP  1696
             VLTVALIEG +LASL+  G  DP+VVFTCNG++R+SSV+L+T DPQWNEILEF+  EEPP
Sbjct  534   VLTVALIEGVDLASLESVGLSDPYVVFTCNGQTRSSSVKLETSDPQWNEILEFDAMEEPP  593

Query  1697  SMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRIFL  1876
             S+LDVEVFDFDGPFDQ  SLGHAEINFLKHTS ELAD+W+ L GK+AQS+QSKLHLRIFL
Sbjct  594   SVLDVEVFDFDGPFDQDVSLGHAEINFLKHTSTELADMWVILEGKLAQSAQSKLHLRIFL  653

Query  1877  NNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRKLP  2056
             +NN GVETI+D L K EKEVGKKLN++SPHRNSTFQK FGLP EEFLINDF+C LKRK+P
Sbjct  654   DNNKGVETIKDYLEKKEKEVGKKLNIQSPHRNSTFQKLFGLPTEEFLINDFTCYLKRKMP  713

Query  2057  LQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDRGT  2236
             LQGR+FLS RI+GFYANLFGHKTKFFFLWEDIE I VLPPS +++GSP+LVIIL   RG 
Sbjct  714   LQGRLFLSARILGFYANLFGHKTKFFFLWEDIENIQVLPPSLASIGSPTLVIILRSGRGI  773

Query  2237  DARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKDENN  2416
             DAR+GAK  DEEGRL F F SFVSFG ASRTI+ LW+ R   P QK QI EE + + E  
Sbjct  774   DARHGAKVQDEEGRLRFHFQSFVSFGAASRTIIGLWRARILNPYQKEQITEEHE-EQEVL  832

Query  2417  VLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWE  2596
             V+PE++GS ++ ++  MSK+YS +LP+   S+ME+F GG+LEHK+M ++GC+NY T+SWE
Sbjct  833   VIPEDSGS-ILEDEAKMSKIYSAELPIKMTSVMEIFYGGNLEHKIMKRTGCMNYDTTSWE  891

Query  2597  LIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQV  2776
              ++PDV ER VSY+ NR +S+F  +VTSTQ+K  + N  GWI+NE+M ++GVPF+DH+++
Sbjct  892   PVKPDVLERHVSYQFNRHVSVF--DVTSTQQKFPNTNTGGWIVNEVMVLNGVPFADHFRI  949

Query  2777  QLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGREVF  2956
               RY++E       +C+CDVY+G+ W +++K + RI +NI  KF+ R+KE+ E V +E  
Sbjct  950   HFRYEIEKSVLGECACKCDVYIGIKWHRSSKFQQRINRNITAKFNIRLKEIFELVQKESI  1009

Query  2957  LSS  2965
             ++S
Sbjct  1010  INS  1012



>ref|XP_010929874.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170 [Elaeis 
guineensis]
Length=1040

 Score =  1048 bits (2709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/916 (57%), Positives = 665/916 (73%), Gaps = 31/916 (3%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIK--VSSPKKVLEGKQ------  424
             GKILLT +L+G+ +  S NH     P     +S +V  +K   S+P  VL+G +      
Sbjct  126   GKILLTSTLYGRSNSNSVNHTS--PPCSSLVSSANVRELKDSASTPHNVLQGTESPTMTN  183

Query  425   LIKSI------------AGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQE  568
             + KSI            AGHL +      ++  S    S+  +  E S + S  E N   
Sbjct  184   MTKSISVVEQTPSIQAHAGHLTE--RHPSKNEASFSVVSRIHDLLEFSDVLSGDESN---  238

Query  569   TTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRE  748
               +     F +A++++Q+R E   MP NL+GGILL++TY +  KD N LLF P++QFRRE
Sbjct  239   --KGANVLFEDAMQIMQTREE-TNMPANLEGGILLEETYMIETKDLNSLLFKPNAQFRRE  295

Query  749   LAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAV  928
             LAELQGT + +E PW WK  +  CL R+VTYTK ATK VK+V A EEQTY+K DGK FAV
Sbjct  296   LAELQGTTNYEEKPWKWKCKDPPCLGRLVTYTKAATKFVKAVNAIEEQTYMKADGKNFAV  355

Query  929   LVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGT  1108
             L   STP+VPYG  F+V LLY IMPGP L SGEES+H VISW ++F +ST+MK++IEG  
Sbjct  356   LTRASTPEVPYGKCFQVVLLYKIMPGPQLSSGEESSHFVISWNLEFNQSTVMKSIIEGTA  415

Query  1109  QQGLKDSFSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVS  1285
             +QGL+DS+  FS  L+Q+ K + S+E+  D   LLA L  +H SD ELA EYFCNFTVV 
Sbjct  416   RQGLEDSYESFSDLLSQYIKPVVSSELSKDKEQLLAPLQLDHQSDWELAIEYFCNFTVVC  475

Query  1286  TAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEA  1465
             T F+ LY   HI+L R     GLEF+GLDLPD+ GE+IT GIL L  E+++ MI+HFV+A
Sbjct  476   TIFMCLYVLTHIVLLRHGASWGLEFNGLDLPDTFGELITSGILFLQGERIFNMISHFVQA  535

Query  1466  RLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTL  1645
             RLRRGSDHGV+A GDGW+LTVALIEG NL S   +GF DP+VVF+CNG++RTSSVQLQTL
Sbjct  536   RLRRGSDHGVKAQGDGWLLTVALIEGCNLPSAASSGFSDPYVVFSCNGETRTSSVQLQTL  595

Query  1646  DPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLG  1825
             DPQWNEILEF+  +EPPS+LDVEVFDFDGPFD A SLGHAEINFLKHTSAELAD+W+PL 
Sbjct  596   DPQWNEILEFDAMQEPPSVLDVEVFDFDGPFDLAASLGHAEINFLKHTSAELADMWIPLK  655

Query  1826  GKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPP  2005
             GK+AQ+SQSKLHLRIFL+N  G+ET+++ LTKMEKEVG+KLN+RSPHRNS FQK F LPP
Sbjct  656   GKLAQTSQSKLHLRIFLDNTRGMETVKEYLTKMEKEVGRKLNIRSPHRNSMFQKLFALPP  715

Query  2006  EEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFS  2185
             EEFLINDFSC LKRK+PLQGR+FLS RIVGFYANLFGHKTKFF LWED+E+I V+PPSFS
Sbjct  716   EEFLINDFSCYLKRKMPLQGRLFLSARIVGFYANLFGHKTKFFLLWEDMEDIQVIPPSFS  775

Query  2186  TMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIP  2365
             T GSP+L IIL   RG DAR+GAKS DEEGRL F F SFVSF  ASRTIMALW+TR    
Sbjct  776   TFGSPALQIILRSGRGLDARHGAKSQDEEGRLRFQFQSFVSFNIASRTIMALWRTRTLNT  835

Query  2366  DQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEH  2545
             +Q+A++ E+QQ +   +V  ++T + L   D+++SK YS ++P++   L+E+F GG+LE 
Sbjct  836   EQRAKLEEDQQNQGIRSVQIQDTETLLNFGDINLSKAYSSEVPLHVNLLIELFEGGNLEK  895

Query  2546  KVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWIL  2725
             K+M K GCLNY+ + WE + P+VYER + YK NR +SIFG E  S+Q+K+  A   GWI+
Sbjct  896   KIMDKVGCLNYLVTQWEALRPNVYERHIRYKFNRHMSIFGGEAVSSQQKTPTAAGNGWIV  955

Query  2726  NEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRK  2905
             +E+M IH VPF DH++V LRYK+E+     ++ +CDV+VG  W+++TK + RITKNI  K
Sbjct  956   DEVMTIHNVPFDDHFRVHLRYKIETLLHISSTSQCDVFVGTEWIRSTKFQKRITKNICDK  1015

Query  2906  FSQRVKEMIEFVGREV  2953
              + R KE+ E   RE+
Sbjct  1016  LAHRSKEIFELAEREL  1031



>ref|XP_006581905.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170-like 
isoform X2 [Glycine max]
Length=987

 Score =  1042 bits (2695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/908 (58%), Positives = 672/908 (74%), Gaps = 47/908 (5%)
 Frame = +2

Query  254   FSTNPGKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKV---SSPKKVLEGKQ  424
             F+   GKILLT+SLHGKG     NH      ++  E S+D++ +     S   K+  GKQ
Sbjct  118   FNKYCGKILLTVSLHGKGRSF-MNHKHSPNSTIAVENSRDLEGLHFLCQSHCDKMGVGKQ  176

Query  425   LIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCEA  604
             L+K IA  L ++F K E +S   +           SS  SDYED+V E T     SF E+
Sbjct  177   LLKDIANGLHRIFKKKEGNSNFGDSSEL-------SSSLSDYEDSVHENTFPC--SFEES  227

Query  605   IKLLQSRTEGR-EMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
             I L++SR + + EMPENL  GIL+DQ Y + P D N+ LFAP+SQF +++AELQGT +VQ
Sbjct  228   IALMESRDDNKPEMPENLPVGILVDQIYLVSPNDLNVFLFAPNSQFSKDMAELQGTTNVQ  287

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             EGPWTWK+ + SCLTRVVTY K ATKL+K+V A EEQTY++   KEFA+LV VSTP+VPY
Sbjct  288   EGPWTWKNGDTSCLTRVVTYMKAATKLIKAVNAIEEQTYIRVSRKEFAILVSVSTPEVPY  347

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             G++F++ELLY IMPG  + SGEES+HLV+SW + F +STMMK +IEGG +QGLK+SFS+F
Sbjct  348   GNSFRIELLYKIMPGE-VSSGEESSHLVVSWGIVFLQSTMMKGMIEGGARQGLKESFSQF  406

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             S  LA++ KV+  A++ D  HLLATL +E         + +C   +              
Sbjct  407   SDQLARNFKVLDKADLPDKEHLLATLQTE---------DQWCGPNL--------------  443

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
                    LQGLEF GL+LPDS GE+IT GIL++ L++VY M++HFV+AR + G+DHG++A
Sbjct  444   -------LQGLEFSGLELPDSFGELITSGILIIQLQRVYNMVSHFVQARFQMGTDHGLKA  496

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
             HGDGWVLTVALIEG +LASL+  G  DP+VVFTCNG++R+SSV+LQT DPQWNEILEF+ 
Sbjct  497   HGDGWVLTVALIEGVDLASLESEGLSDPYVVFTCNGQTRSSSVKLQTSDPQWNEILEFDA  556

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
              EEPPS+L VEVFDFDGPFDQ  SLGHAEINFL+HTS ELAD+W+ L GK+AQSSQSKLH
Sbjct  557   MEEPPSVLHVEVFDFDGPFDQDVSLGHAEINFLRHTSTELADMWVMLEGKLAQSSQSKLH  616

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFL+NNNGVETI++ L KMEKEVGKKLNLRSP RNSTFQK F LPPEEFLI DF+C L
Sbjct  617   LRIFLDNNNGVETIKEYLEKMEKEVGKKLNLRSPQRNSTFQKLFALPPEEFLIKDFTCYL  676

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRK+PLQGR+FLS RI+GF+ANLFGHKTKFFFLWEDIEEI VLPPS +T+GSP+LVI+L 
Sbjct  677   KRKMPLQGRLFLSARILGFHANLFGHKTKFFFLWEDIEEIQVLPPSLATLGSPTLVIVLR  736

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQY  2401
             + RG DAR+GAK+ DEEGRL F F SFVSF  ASR I ALW+TR   P QK QI+EE + 
Sbjct  737   RGRGLDARHGAKTQDEEGRLRFHFQSFVSFSAASRAIKALWRTRILNPYQKEQISEEHE-  795

Query  2402  KDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYV  2581
               E  V+PE++ S L  E+  MS+++S +LP+  KS+M +F+GG+LEHK+M ++GC NY 
Sbjct  796   DQERFVIPEDSASILEDEE-KMSRIFSAELPIKMKSVMGIFDGGNLEHKIMQRTGCTNYE  854

Query  2582  TSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFS  2761
             T+SWE ++ DV+ERRVSY+ NR +S FG EVT TQ+K  +AN  GW + E+M +HGVPF+
Sbjct  855   TTSWEQVKHDVFERRVSYQFNRHVSAFGGEVTCTQQKFPNANTGGWTVIEVMDLHGVPFA  914

Query  2762  DHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFV  2941
             DH+ +  RY++E  S    +C+CD Y+G+MWLK++K + RI +NI  KF+ R+KE+ E V
Sbjct  915   DHFHIHFRYEIEKSSLGDCACKCDAYIGIMWLKSSKFQQRINRNITAKFNLRLKEIFELV  974

Query  2942  GREVFLSS  2965
              +E+ L S
Sbjct  975   QKEILLMS  982



>ref|XP_010027276.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170 [Eucalyptus 
grandis]
Length=960

 Score =  1038 bits (2684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/893 (57%), Positives = 661/893 (74%), Gaps = 52/893 (6%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSSPKKVLEGKQLIKSIAGH  448
             GKIL+++SLHG   D S++   F   ++ S  +++  A+  S  +K+ +GK  +K+IA  
Sbjct  118   GKILVSISLHGSLQDTSSDSPLFPSLNINSNQAEEEMALAKSQAQKIQDGKHWMKAIANR  177

Query  449   LEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCEAIKLLQSRT  628
             LEK+F         +E+ S+   SSE+S  PSDYED V++  +    SF EA+ ++QSR 
Sbjct  178   LEKIF-------AKHEDVSETCASSEVSGTPSDYEDCVEK--QQSDYSFEEALSMMQSRD  228

Query  629   EGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEGPWTWKSD  808
               REMPE+LQGGIL DQ Y + P D N+ LFAPDS+FRR+LA L+GT D++E  WT K +
Sbjct  229   CQREMPEDLQGGILCDQIYVVRPYDLNIFLFAPDSKFRRDLANLEGTTDLEEELWTLKQE  288

Query  809   NKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGSTFKVELL  988
             +   LTR VT TK ATKLVK+V+ATE+Q+YLK DGK FA+ V+VSTP+            
Sbjct  289   DPPLLTRTVTSTKAATKLVKAVKATEQQSYLKADGKHFAIFVEVSTPE------------  336

Query  989   YNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRFLAQHCK  1168
                                          TMM+ +IEGG +QGLKDSF  F   LAQ  +
Sbjct  337   ----------------------------KTMMRGMIEGGARQGLKDSFYHFENLLAQSFR  368

Query  1169  VITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHILLSRSTQLQ  1348
              + SAE+ D G ++A+L +E  SD +LA +YFCNFT++ST  +V+Y  IHILL + ++ +
Sbjct  369   TLDSAELSDKGQIIASLENEQQSDWQLAIKYFCNFTMLSTICMVVYVIIHILLCKPSEPR  428

Query  1349  GLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHGDGWVLTV  1528
             GLEF G+DLPDS+GE+I CGI+ + +++V+ M +HFV+ARL+RGSDHGV+A GDGW+LT+
Sbjct  429   GLEFLGIDLPDSLGELIACGIITIQVQRVFYMASHFVQARLQRGSDHGVKAQGDGWILTI  488

Query  1529  ALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEEPPSMLD  1708
             ALIEGTN+ASL  TG+ DP+VVFTCNG+++TSSV+LQT DPQWNEI+EF+  EEPPS+LD
Sbjct  489   ALIEGTNVASLSSTGYSDPYVVFTCNGRTKTSSVKLQTCDPQWNEIVEFDAMEEPPSILD  548

Query  1709  VEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRIFLNNNN  1888
             VEVFDFDGPFDQA SLGHAEINFLKHTS +LAD+W+ L GK+AQS+QSKLHLRIFL+NNN
Sbjct  549   VEVFDFDGPFDQATSLGHAEINFLKHTSTDLADMWIFLEGKLAQSAQSKLHLRIFLDNNN  608

Query  1889  GVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRKLPLQGR  2068
             GVETI++ LTKMEKEVGKKL++RSPHRNSTFQK F LPP+EFLI+DF+CSLKRKLPLQGR
Sbjct  609   GVETIKEYLTKMEKEVGKKLSMRSPHRNSTFQKLFKLPPDEFLISDFACSLKRKLPLQGR  668

Query  2069  IFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDRGTDARN  2248
             +FLS+RIVGFYANLFGHKT+FFFLWEDIE+I  LPPSF ++GSPSLVIIL K RG DA +
Sbjct  669   LFLSSRIVGFYANLFGHKTRFFFLWEDIEDIQELPPSFISVGSPSLVIILRKGRGMDAMH  728

Query  2249  GAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKDENNVLPE  2428
             GAKS DEEGRL F F SFVSF  ASRTI+ALW+TRA +P+Q  QIA+E QY  EN  +  
Sbjct  729   GAKSQDEEGRLRFHFQSFVSFNSASRTIVALWRTRALMPEQTEQIAKE-QYDQENTTVLV  787

Query  2429  ETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEP  2608
             +  + L  +D  MSK+YS +LP+   SLME+F GG  EH++M KSGCLNY  + WE ++P
Sbjct  788   DEATILDKKDADMSKIYSAELPIEMSSLMELFGGGKKEHRIMEKSGCLNYSATEWEPVKP  847

Query  2609  DVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRY  2788
               +ER VSYK NR ISIFG EVT TQ+K   + D GW ++E+MA+H +PF ++Y+VQL+Y
Sbjct  848   GTFERSVSYKFNRHISIFGGEVTITQQKV--STDDGWTVDEVMALHNIPFEEYYRVQLKY  905

Query  2789  KVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGR  2947
             K+E      +SC+CDVY+ ++WLK+TK + RIT+NI  K SQR+K++ E V R
Sbjct  906   KIEKSGQDHSSCKCDVYIHIIWLKSTKFQHRITRNITSKLSQRLKDIFELVER  958



>ref|XP_003601189.1| GRAM domain-containing protein 1B [Medicago truncatula]
 gb|AES71440.1| C2 and GRAM domain plant-like protein [Medicago truncatula]
Length=1014

 Score =  1032 bits (2669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/912 (56%), Positives = 680/912 (75%), Gaps = 19/912 (2%)
 Frame = +2

Query  254   FSTNPGKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSS------PKKVLE  415
             F+   GKILLT+SLH K H    NH      +   + S + + + +SS       +K+ E
Sbjct  113   FNKFCGKILLTISLHYKDHVSFMNHKHSPNSTASIKDSTESERLHISSHQSFHKNRKMGE  172

Query  416   GKQLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSF  595
             GK L+K+IA  LE++  K E +SK  +           S+  SDYED+VQE   S   SF
Sbjct  173   GKHLLKAIADRLERILHKKERNSKPVDCSET-------SNSLSDYEDSVQEN--SPPCSF  223

Query  596   CEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKD  775
              E I L+QSR    E PENLQGGIL+D+ Y + P + N++LF PDSQFR++LAE QGT +
Sbjct  224   EEGIALMQSRDNQPESPENLQGGILVDKIYEVSPYNLNVVLFVPDSQFRKDLAEQQGTTN  283

Query  776   VQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDV  955
             +QEG W+WK ++ SCLTRVV YTK A+KLVK++  TEEQTY++    EF VLV V TP+V
Sbjct  284   LQEGAWSWKDEDMSCLTRVVNYTKAASKLVKALNTTEEQTYIRATKDEFDVLVSVCTPEV  343

Query  956   PYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFS  1135
             PYG++F+VE+LY IMPG  +   +ES+HLVI+W + F +STMMK VIE G +QGLK+SF 
Sbjct  344   PYGNSFRVEILYKIMPGEDVSCVKESSHLVITWGMVFLQSTMMKGVIENGAKQGLKESFD  403

Query  1136  EFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSI  1315
             +F+  LAQ  KV+   ++++  HLLATL +E   +   A  YF NFTVVST F+ LY  +
Sbjct  404   QFANLLAQRFKVLDKEDLINKEHLLATLQTESQWNWWQAITYFWNFTVVSTFFMCLYVLL  463

Query  1316  HILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGV  1495
             HIL    +Q +GLEF G++LPDS+GE++T GILV+ LE+VY M++HFV+AR + G+DHG+
Sbjct  464   HILRCGPSQPRGLEFRGIELPDSLGELVTSGILVIQLERVYHMVSHFVQARFQMGTDHGM  523

Query  1496  RAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEF  1675
             +AHGDGWV+TVALIEG +L SL+ TG  DP+VVFTCNG++R+SSV+L+T DPQWNEILEF
Sbjct  524   KAHGDGWVVTVALIEGVDLVSLESTGLSDPYVVFTCNGQTRSSSVKLETSDPQWNEILEF  583

Query  1676  EPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSK  1855
             +  EEPPS+L VEVFDFDGPFDQ  SLGHAEINFLKHTS ELAD+W+ L GK+AQS+QSK
Sbjct  584   DAMEEPPSVLYVEVFDFDGPFDQDVSLGHAEINFLKHTSTELADMWVVLEGKLAQSAQSK  643

Query  1856  LHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSC  2035
             LHLRIFL+NN GV  I+D L K EKEVGKK NL SP RNSTFQK FGLPPEEFLINDF+C
Sbjct  644   LHLRIFLDNNKGVAIIKDYLEKKEKEVGKKFNLPSPQRNSTFQKLFGLPPEEFLINDFTC  703

Query  2036  SLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVII  2215
             SLKRKL LQGR+FLS R++GFYANLFGHKTKFFFLWEDI+ I VLPPS +++GSP+L +I
Sbjct  704   SLKRKLHLQGRLFLSARVLGFYANLFGHKTKFFFLWEDIDNIQVLPPSLASLGSPTLAVI  763

Query  2216  LHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQ  2395
             L + RG DAR+GAK+ DEEGRL F F SFVSFG ASRTIMALW+ R   P QK QI EE 
Sbjct  764   LRRGRGIDARHGAKTQDEEGRLRFHFQSFVSFGSASRTIMALWRARILNPYQKEQITEEH  823

Query  2396  QYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLN  2575
             +   E  V+PE++GS ++ ++  MS++YS +LP+  +S+M +F+GG++EHK+M ++GC++
Sbjct  824   E-DQEVLVMPEDSGS-ILEDEAKMSRIYSAELPIKIRSMMGIFDGGNIEHKIMKRTGCMD  881

Query  2576  YVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVP  2755
             Y T+ WE ++PDV ER V+Y+ NR +S+F  +VTSTQ+K  + N  GWI+NE+M ++GVP
Sbjct  882   YDTTPWEPVKPDVLERHVTYQFNRHVSVF--DVTSTQQKYPNTNTEGWIVNEVMILNGVP  939

Query  2756  FSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIE  2935
             FSDH+++  RY++E  +    +C+CDVY+G+MWL+++K + RI +NI  KF  R++E+ E
Sbjct  940   FSDHFRIHFRYEIEKSALGECACKCDVYIGIMWLRSSKFQKRINRNITSKFKIRLEEIFE  999

Query  2936  FVGREVFLSS*K  2971
              + +E+ L S K
Sbjct  1000  LLQKEILLMSHK  1011



>ref|XP_008777790.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170 [Phoenix 
dactylifera]
Length=1040

 Score =  1028 bits (2658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/917 (56%), Positives = 662/917 (72%), Gaps = 31/917 (3%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSSPKK--VLEGKQ------  424
             GKILLTL+L+G+    S NH     P     +S +V  +K S+  +  VL G +      
Sbjct  128   GKILLTLTLYGRCSSNSVNHTS--PPCSSLYSSANVRELKESASTRHNVLRGTESPTMTN  185

Query  425   LIKSIA------------GHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQE  568
             + KSI+            GHL +      ++  S    S+  +  ELS + S  E N   
Sbjct  186   MSKSISVVEQTPSLQAHVGHLTE--RHPSKNEASFSVVSRNHDLLELSDVLSGDESN---  240

Query  569   TTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRE  748
               +     F +A++++Q+R E   MPENL+GGILL Q Y +  KD N  LF P++QFRRE
Sbjct  241   --KDANVLFEDAMEIMQTREE-TNMPENLEGGILLQQAYMIETKDLNSFLFKPNAQFRRE  297

Query  749   LAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAV  928
             LA LQGT + +E PW W+  +  CL R+VTYTK +TK VK+  A EEQTY+K DGK FAV
Sbjct  298   LAGLQGTTNYEEKPWKWECKDPPCLGRLVTYTKASTKFVKAFNAIEEQTYIKADGKNFAV  357

Query  929   LVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGT  1108
             L  VSTP+VPYG  F+V LLY IMPGP L SGEES++ VISW ++F +ST+MK++IEG  
Sbjct  358   LTRVSTPEVPYGKCFQVVLLYKIMPGPQLSSGEESSNFVISWNLEFNQSTVMKSIIEGTA  417

Query  1109  QQGLKDSFSEFSRFLAQHCKVITSAEVL-DNGHLLATLPSEHPSDLELAREYFCNFTVVS  1285
             +QGL+DS+  F+  L+Q+ K + S+E+L D   LL  L  +H SD  LA EYFC+FTVV 
Sbjct  418   RQGLEDSYESFADLLSQYIKPVVSSELLMDKEQLLVPLQLDHQSDWRLAVEYFCSFTVVC  477

Query  1286  TAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEA  1465
             T F+ LY  +HI+  R     GLEF+GLDLPD+ GE+IT GIL L  E+++ MI+HFV+A
Sbjct  478   TIFMCLYVLMHIVFLRHGASWGLEFNGLDLPDTFGELITSGILFLQGERIFNMISHFVQA  537

Query  1466  RLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTL  1645
             RL+RGSDHGV+A GDGW+LTVALIEG NL S   +GF DP+VVF+CNG++RTSSVQLQTL
Sbjct  538   RLQRGSDHGVKAQGDGWLLTVALIEGCNLPSAASSGFSDPYVVFSCNGETRTSSVQLQTL  597

Query  1646  DPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLG  1825
             DPQWNEILEF+  +EPPS+LDVEVFDFDGPFD A SLGHAEINFLKH+SAELAD+W+PL 
Sbjct  598   DPQWNEILEFDAMQEPPSVLDVEVFDFDGPFDLAASLGHAEINFLKHSSAELADMWIPLK  657

Query  1826  GKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPP  2005
             GK+AQ+SQSKLHLRIFL+N  G+ET+++ LTKMEKEVG+KLN+RSPHRNSTFQK F LPP
Sbjct  658   GKLAQTSQSKLHLRIFLDNTKGMETVKEYLTKMEKEVGRKLNIRSPHRNSTFQKLFALPP  717

Query  2006  EEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFS  2185
             EEFLINDFSC LKRK+PLQGR+FLS RIVGFYANLFGHKTKFFFLWEDIE+I V+PPSFS
Sbjct  718   EEFLINDFSCYLKRKMPLQGRLFLSARIVGFYANLFGHKTKFFFLWEDIEDIQVIPPSFS  777

Query  2186  TMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIP  2365
             T GSP+L IIL   RG DAR+GAKS DEEGRL F F SFVSF   SRTIMALW+TRA   
Sbjct  778   TFGSPALQIILRSGRGLDARHGAKSQDEEGRLRFQFQSFVSFNIVSRTIMALWRTRALNI  837

Query  2366  DQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEH  2545
             +Q+A++ E+QQ     +V  E++ + L  ED++ S+ YS ++P++   LME+F GG+LE 
Sbjct  838   EQRAKMEEDQQNHALRSVQIEDSETLLKFEDINFSEAYSSEVPLHANLLMELFEGGNLEK  897

Query  2546  KVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWIL  2725
             K+M K GCLNY  + WE++  +VYER + YK NR  SIFG E  S+Q+K+  A+  GWI+
Sbjct  898   KIMDKVGCLNYSVTQWEVVRSNVYERHIRYKFNRHASIFGGEAVSSQQKTPTADGNGWIV  957

Query  2726  NEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRK  2905
             +E+M IH VPF DH++V LRYK+E+     ++ RCDV+VG+ W+++TK + +IT+N+  K
Sbjct  958   DEVMTIHNVPFGDHFRVHLRYKIETLLHVSSTSRCDVFVGIEWIRSTKFQKQITRNVCDK  1017

Query  2906  FSQRVKEMIEFVGREVF  2956
              + R K++ E   RE+ 
Sbjct  1018  LAHRSKDIFELAERELL  1034



>ref|XP_006581906.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170-like 
isoform X3 [Glycine max]
Length=982

 Score =  1016 bits (2626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/908 (57%), Positives = 657/908 (72%), Gaps = 52/908 (6%)
 Frame = +2

Query  254   FSTNPGKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKV---SSPKKVLEGKQ  424
             F+   GKILLT+SLHGKG     NH      ++  E S+D++ +     S   K+  GKQ
Sbjct  118   FNKYCGKILLTVSLHGKGRSF-MNHKHSPNSTIAVENSRDLEGLHFLCQSHCDKMGVGKQ  176

Query  425   LIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCEA  604
             L+K IA  L ++F K E +S   +           SS  SDYED+V E T     SF E+
Sbjct  177   LLKDIANGLHRIFKKKEGNSNFGDSSEL-------SSSLSDYEDSVHENTFPC--SFEES  227

Query  605   IKLLQSRTEGR-EMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
             I L++SR + + EMPENL G                                   T +VQ
Sbjct  228   IALMESRDDNKPEMPENLPG-----------------------------------TTNVQ  252

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             EGPWTWK+ + SCLTRVVTY K ATKL+K+V A EEQTY++   KEFA+LV VSTP+VPY
Sbjct  253   EGPWTWKNGDTSCLTRVVTYMKAATKLIKAVNAIEEQTYIRVSRKEFAILVSVSTPEVPY  312

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             G++F++ELLY IMPG  + SGEES+HLV+SW + F +STMMK +IEGG +QGLK+SFS+F
Sbjct  313   GNSFRIELLYKIMPGE-VSSGEESSHLVVSWGIVFLQSTMMKGMIEGGARQGLKESFSQF  371

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             S  LA++ KV+  A++ D  HLLATL +E          YF NFTV ST F+ LY  +HI
Sbjct  372   SDQLARNFKVLDKADLPDKEHLLATLQTEDQWYWWQTITYFWNFTVASTIFMFLYVLVHI  431

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
             L      LQGLEF GL+LPDS GE+IT GIL++ L++VY M++HFV+AR + G+DHG++A
Sbjct  432   LRCGPNLLQGLEFSGLELPDSFGELITSGILIIQLQRVYNMVSHFVQARFQMGTDHGLKA  491

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
             HGDGWVLTVALIEG +LASL+  G  DP+VVFTCNG++R+SSV+LQT DPQWNEILEF+ 
Sbjct  492   HGDGWVLTVALIEGVDLASLESEGLSDPYVVFTCNGQTRSSSVKLQTSDPQWNEILEFDA  551

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
              EEPPS+L VEVFDFDGPFDQ  SLGHAEINFL+HTS ELAD+W+ L GK+AQSSQSKLH
Sbjct  552   MEEPPSVLHVEVFDFDGPFDQDVSLGHAEINFLRHTSTELADMWVMLEGKLAQSSQSKLH  611

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFL+NNNGVETI++ L KMEKEVGKKLNLRSP RNSTFQK F LPPEEFLI DF+C L
Sbjct  612   LRIFLDNNNGVETIKEYLEKMEKEVGKKLNLRSPQRNSTFQKLFALPPEEFLIKDFTCYL  671

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRK+PLQGR+FLS RI+GF+ANLFGHKTKFFFLWEDIEEI VLPPS +T+GSP+LVI+L 
Sbjct  672   KRKMPLQGRLFLSARILGFHANLFGHKTKFFFLWEDIEEIQVLPPSLATLGSPTLVIVLR  731

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQY  2401
             + RG DAR+GAK+ DEEGRL F F SFVSF  ASR I ALW+TR   P QK QI+EE + 
Sbjct  732   RGRGLDARHGAKTQDEEGRLRFHFQSFVSFSAASRAIKALWRTRILNPYQKEQISEEHE-  790

Query  2402  KDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYV  2581
               E  V+PE++ S L  E+  MS+++S +LP+  KS+M +F+GG+LEHK+M ++GC NY 
Sbjct  791   DQERFVIPEDSASILEDEE-KMSRIFSAELPIKMKSVMGIFDGGNLEHKIMQRTGCTNYE  849

Query  2582  TSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFS  2761
             T+SWE ++ DV+ERRVSY+ NR +S FG EVT TQ+K  +AN  GW + E+M +HGVPF+
Sbjct  850   TTSWEQVKHDVFERRVSYQFNRHVSAFGGEVTCTQQKFPNANTGGWTVIEVMDLHGVPFA  909

Query  2762  DHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFV  2941
             DH+ +  RY++E  S    +C+CD Y+G+MWLK++K + RI +NI  KF+ R+KE+ E V
Sbjct  910   DHFHIHFRYEIEKSSLGDCACKCDAYIGIMWLKSSKFQQRINRNITAKFNLRLKEIFELV  969

Query  2942  GREVFLSS  2965
              +E+ L S
Sbjct  970   QKEILLMS  977



>ref|XP_010251063.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170 isoform 
X2 [Nelumbo nucifera]
Length=969

 Score =  1004 bits (2595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/838 (60%), Positives = 626/838 (75%), Gaps = 16/838 (2%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIK--------VSSPKKVLEGKQ  424
             GKILLTL L G+ +D S  H      S   +  + VD  +        V+S +K+ E KQ
Sbjct  121   GKILLTLCLCGRINDTSNIHTFLRSGSNTKDLKEQVDPAEQSQGMLSSVASFRKIPEWKQ  180

Query  425   LIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCEA  604
             L+K IA  LE+L +KNEE+               L S  SDY+D++ E T     SF EA
Sbjct  181   LVKVIASWLERLLNKNEETVTCKSTTDYSSE---LYSTTSDYQDSMDEPTPGC--SFEEA  235

Query  605   IKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQE  784
             I L++SR E +E+PE+L GGILLDQTY +  +  N +LF P+SQF+++LAELQG  D+QE
Sbjct  236   IDLIKSRDEKQELPEDLPGGILLDQTYMVSSRHLNSILFEPNSQFKKDLAELQGITDLQE  295

Query  785   GPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYG  964
             GPWTWK      LTRV+TYTK ATKLVK+++ATE+QTYL  DG+EF VL DVSTPD PYG
Sbjct  296   GPWTWKLGK--ILTRVITYTKPATKLVKAIKATEDQTYLYADGREFVVLTDVSTPDAPYG  353

Query  965   STFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFS  1144
               FK+E LY IMPGP    GEE + LV+SW + F + T+M+ +IEG  QQG+K+S  +F+
Sbjct  354   HYFKMEFLYRIMPGPESSVGEEFSRLVVSWNINFLQRTVMRRMIEGRVQQGMKESNEQFA  413

Query  1145  RFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHIL  1324
             R L+Q  + I S  +LD   +LA L  EH S+ ELA EYF NF VVST F+VLY  +HI 
Sbjct  414   RLLSQKIRPIGSTALLDKEQMLAKLQQEHQSNWELAIEYFWNFNVVSTIFMVLYVLLHIF  473

Query  1325  LSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAH  1504
             LS    +QGLEF+GLDLPD+ GE+ITCGIL L +E V+ MI+HFV+ARL+RGSD GV++ 
Sbjct  474   LS-GHGIQGLEFNGLDLPDTFGELITCGILALQVEHVFNMISHFVQARLKRGSDRGVKSR  532

Query  1505  GDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPA  1684
             GDGWVLTVAL+EG NLASLD TG  DP+VVFTCNGKSRTSS++LQT DPQWNE+LEF+  
Sbjct  533   GDGWVLTVALVEGNNLASLDSTGLSDPYVVFTCNGKSRTSSIKLQTSDPQWNEVLEFDAM  592

Query  1685  EEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHL  1864
             EEPPS+LDVEVFDFDGPFD   SLGH EINFLKHTS ELAD+W+ L GK+AQ SQSKLH+
Sbjct  593   EEPPSVLDVEVFDFDGPFDLDASLGHVEINFLKHTSTELADMWVTLEGKLAQISQSKLHV  652

Query  1865  RIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLK  2044
             RIFL N+ GVET+++ LTKMEKEVGKKL+L++P+RNSTFQK FGLPPEEFLI+DFSCSLK
Sbjct  653   RIFLENSKGVETVKEYLTKMEKEVGKKLDLQTPYRNSTFQKIFGLPPEEFLIDDFSCSLK  712

Query  2045  RKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHK  2224
             RK+PLQGR+FLS RI+GFYANLFGHKTKFFFLWEDIE+I ++PPS S++GSPSL+IILHK
Sbjct  713   RKMPLQGRLFLSARIIGFYANLFGHKTKFFFLWEDIEDIQLIPPSLSSVGSPSLIIILHK  772

Query  2225  DRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYK  2404
              +G DA++GAKS DEEGRL F F SFVSF  ASRTIMALW+TR  IP+QK QI E  +  
Sbjct  773   GQGLDAKHGAKSQDEEGRLRFHFQSFVSFNVASRTIMALWRTRTSIPEQKDQIEETHKDH  832

Query  2405  DENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVT  2584
             D    L  +TGS+  +ED++MSK+Y  +L ++ + LME+F GGDLEH+VM KSGCLNY T
Sbjct  833   DGKPFLIGDTGSFWGLEDMNMSKIYFAELLVHIELLMEVFGGGDLEHRVMEKSGCLNYAT  892

Query  2585  SSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPF  2758
             + WE  +P+VYER + YK N  +SI+G EV S Q+KS   +  GW + E+M +H VPF
Sbjct  893   TPWEATKPNVYERHICYKFNHHVSIYGAEVISIQQKSPTEDGNGWTVVEVMTLHEVPF  950



>ref|XP_008438821.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170 [Cucumis 
melo]
Length=1014

 Score =  1003 bits (2592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/908 (56%), Positives = 667/908 (73%), Gaps = 19/908 (2%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSV---GSETSKDVDAIKVSSPKKVLEGKQLIKSI  439
             GK+LL +SLHGKG+ ++ +      P      S + +D+   K SS  K ++ K   KSI
Sbjct  117   GKVLLIVSLHGKGNVINQSSVTNTNPKPLEDSSASPQDLIGAK-SSSNKAVKWKPNKKSI  175

Query  440   AGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCEAIKLLQ  619
                LE+LF K++E ++++           LSS  SD E+ +         SF EAI+ LQ
Sbjct  176   VSRLERLFHKSDEDTRTDNSSE-------LSSATSDTEERI--NGHLSESSFDEAIETLQ  226

Query  620   SRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEGPWTW  799
              R+ G EMPENL GG+L+DQ Y + P D N LLF+  SQFRRELAE QG  +++EG W+W
Sbjct  227   LRSNGEEMPENLSGGVLVDQVYVVSPGDLNKLLFSTGSQFRRELAEHQGITNLEEGTWSW  286

Query  800   KSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGSTFKV  979
             K  +  CL+R+V+Y K ATK+V ++ ATEEQTY+KGDG EFAVLV+V+TP+VP+G+ F V
Sbjct  287   KRGDVPCLSRIVSYRKPATKVVGAINATEEQTYIKGDGWEFAVLVNVNTPEVPFGNAFNV  346

Query  980   ELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRFLAQ  1159
             ELLY IMPGP L SGEE++H V+SW + F  STMMK +IE G +QGL+++F +FS  LAQ
Sbjct  347   ELLYKIMPGPELISGEETSHFVVSWGINFLHSTMMKGMIEKGARQGLEENFVQFSNLLAQ  406

Query  1160  HCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHILLSRST  1339
             H K+  S E+L+ GH+L+   +   S+ ELAR+YF NFTV ST F++LY  +HI+LS+  
Sbjct  407   HLKIPNSTELLNKGHVLSAFENNRQSNFELARQYFWNFTVFSTLFVLLYVLVHIILSKRK  466

Query  1340  QLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHGDGWV  1519
               QGLEF G+DLPDS+GE++T GILVL LE+VY M++HF++ARL+RG DHGV+  GDGW+
Sbjct  467   TTQGLEFIGMDLPDSLGELVTSGILVLQLERVYYMVSHFIQARLKRGGDHGVKGQGDGWI  526

Query  1520  LTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEEPPS  1699
             LT+ L+EG N++S D  G  DP VVFTCNGK RTSSV+LQT +PQWNEILEF+  +EPPS
Sbjct  527   LTIVLLEGVNISSSDSVGSSDPCVVFTCNGKKRTSSVELQTHEPQWNEILEFDAMKEPPS  586

Query  1700  MLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRIFLN  1879
             +L VEVFDFDGPFDQA SLGHAEINFLK+ S+ELAD+W+PL GK+AQSSQSKLHLRIFL 
Sbjct  587   VLYVEVFDFDGPFDQATSLGHAEINFLKYKSSELADIWVPLEGKLAQSSQSKLHLRIFLE  646

Query  1880  NNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRKLPL  2059
             N +G+ETIR  L+   KEVGKKL+ RSP+RNSTFQK FGLP EEFL++DF+CSLKRK+ L
Sbjct  647   NTDGIETIRQYLSMKGKEVGKKLHPRSPYRNSTFQKLFGLPAEEFLVSDFTCSLKRKMLL  706

Query  2060  QGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDRGTD  2239
             QGR+F+S R++GFYAN FG KTKFFFLWEDIE+I VL PS S++GSPSLVIIL K RG +
Sbjct  707   QGRLFVSARVIGFYANFFGQKTKFFFLWEDIEDIEVLHPSLSSLGSPSLVIILKKGRGLE  766

Query  2240  ARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKDENNV  2419
             A +GAKS DEEGRL F   SFVSF  ASRTI+ +W+TR    DQKAQ+AE     +E +V
Sbjct  767   ASHGAKSQDEEGRLRFYLQSFVSFNVASRTIIGMWRTRTSTLDQKAQVAEMSNDSEERSV  826

Query  2420  LPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWEL  2599
             L E+   +L VED  MSK+Y  +LP+N KSLME F GG LEH+VM KSGCL+Y T+ W+ 
Sbjct  827   LVEDMECFLDVEDTKMSKLYVAELPINIKSLMEFFEGGKLEHRVMEKSGCLDYATTPWKS  886

Query  2600  IEPDVYERRVSYKLNRLISIFGVEVTSTQRK-SVHANDAG-----WILNEIMAIHGVPFS  2761
             ++P + ERR+SY+ N  ISIF  +VT  Q+K  + A + G     W++NE+M++H VPF 
Sbjct  887   VKPGLLERRISYQFNHNISIFEGKVTCIQQKFPMAAANTGNDEEEWVVNEVMSLHDVPFG  946

Query  2762  DHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFV  2941
             + +++  RY+ E C  A+N+C+C+ + G+ WLK+T+L+ +IT+N+  +F  R+K + E +
Sbjct  947   ECFRIHFRYRFEDCELAKNACKCEAFYGITWLKSTELQQKITQNVADEFGHRLKVLFELM  1006

Query  2942  GREVFLSS  2965
              RE+ L++
Sbjct  1007  EREILLAT  1014



>ref|XP_010533453.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170 [Tarenaya 
hassleriana]
 ref|XP_010533454.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170 [Tarenaya 
hassleriana]
Length=1025

 Score =   992 bits (2565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/908 (54%), Positives = 655/908 (72%), Gaps = 19/908 (2%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSK-------DVDAIKVSSPKKVLEGKQL  427
             GKILL+LSL GK   +  +     +P + +E SK       D+ + KV    K  EGK+L
Sbjct  119   GKILLSLSLQGKLEGIPNDQDLCDEPGINTEDSKEYEGPAKDLVSSKVGRRSKHHEGKKL  178

Query  428   IKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETT-RSQTQSFCEA  604
             +K+I  +L+KLF K E+ +K N+    +       S  S++ED+   ++   ++  F + 
Sbjct  179   MKAIVNNLDKLFHKKEDMTKGNDNDPSE------HSSASNFEDSTDGSSIPYKSTGFEDG  232

Query  605   IKLLQSR-TEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
             + L+QSR +E  +MPENL GG+L+DQ Y + P D N  LF P SQFR+ELAE+QG  D+Q
Sbjct  233   LDLMQSRDSENDDMPENLPGGVLVDQNYLVSPSDLNRFLFLPSSQFRKELAEIQGITDLQ  292

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             E PW  K  +   L RV+TY   ATK+VKSV+ATEEQ YLK  G+ FAV   V+TP+VPY
Sbjct  293   EEPWIMKQGDNPSLARVLTYMTAATKMVKSVKATEEQVYLKAKGQHFAVHATVNTPNVPY  352

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             GSTFKVELLY I PG  L SGEE++ L++SW + F +STMMK +IEGG +QGL++SF +F
Sbjct  353   GSTFKVELLYKIQPGIELPSGEETSRLIVSWRIHFHQSTMMKGMIEGGARQGLRESFEQF  412

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             +  LA++ K + S  +LD   +LATL  + P DL+ A +YF +F V+    + +Y   HI
Sbjct  413   AELLAKNYKTLDSVSLLDKDQVLATLSEQKP-DLKSAFQYFWSFYVICAVLMFVYVMAHI  471

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
             L    +++QG EF+GLDLPD++GE+ T GILVL L++VYRMI HFVEA L RG DHGV+A
Sbjct  472   LHCEPSKVQGYEFYGLDLPDTLGELFTSGILVLLLQRVYRMIMHFVEANLHRGCDHGVKA  531

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              G GW+LT+ALI+GTNLAS++ T   DP+VVFTCNGK+RTSSV+LQ  +PQWNE++EF+ 
Sbjct  532   SGKGWILTIALIKGTNLASVESTELFDPYVVFTCNGKTRTSSVKLQAQEPQWNEVIEFDA  591

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
              EEPPS+LDVEVFDFDGPFDQ  SLGHAEINFLK T  ELADLW+PL G +AQ+SQSKLH
Sbjct  592   MEEPPSVLDVEVFDFDGPFDQGASLGHAEINFLKLTPDELADLWVPLEGNLAQASQSKLH  651

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFL NNNGVET++D LTK+EKEVGKKLN+RSP +NS FQK FGLP EEFL+ +++C L
Sbjct  652   LRIFLENNNGVETMKDYLTKVEKEVGKKLNIRSPQKNSAFQKLFGLPHEEFLLKEYTCQL  711

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRK+PLQG++FLS RIV FY+N FGHKTKF+FLWEDI+EI VLPP+F+++GSP L+IIL 
Sbjct  712   KRKMPLQGKLFLSARIVAFYSNFFGHKTKFYFLWEDIDEIQVLPPTFASLGSPLLLIILK  771

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQY  2401
             KDRG DA++GAKS DEEGRL F F SFV+F   SRT MA+WKTR    D + ++A+E++ 
Sbjct  772   KDRGLDAKHGAKSQDEEGRLWFYFQSFVTFDATSRTTMAIWKTRVLSGDHREEMAKEEET  831

Query  2402  KDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYV  2581
                   LP++  S    ++  MSK+Y+ D P+N    ME+F GG++E K+M KSGCL+Y 
Sbjct  832   GG-IPFLPKDVVS--DADEFKMSKLYTCDSPINVDLAMEIFGGGEIERKIMEKSGCLSYT  888

Query  2582  TSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFS  2761
             ++ WE +EPDV ERR+SYK N  +SIFG  VT  Q+KS  ++  GWI+ E + +H VPF 
Sbjct  889   STMWESVEPDVSERRISYKFNHHVSIFGGSVTCEQQKSPASDGEGWIVTEGVTLHDVPFG  948

Query  2762  DHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFV  2941
             DH++V +RY+++    A  + +CDVYVG+ WLK TK + RIT+N++ KF  R+KEM + +
Sbjct  949   DHFRVYMRYEIKRSGVACEASKCDVYVGIRWLKATKFQQRITRNVLEKFRIRLKEMFDLL  1008

Query  2942  GREVFLSS  2965
              ++V  SS
Sbjct  1009  QKQVLTSS  1016



>gb|KFK26649.1| hypothetical protein AALP_AA8G275600 [Arabis alpina]
Length=1022

 Score =   991 bits (2562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 498/903 (55%), Positives = 653/903 (72%), Gaps = 16/903 (2%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSET-------SKDVDAIKVSSPKKVLEGKQL  427
             GKILL+LSL GK   +  +  C  +  +  E+       +KD+ + K    +K  +GK +
Sbjct  117   GKILLSLSLQGKWESIPGDEVCHDKQDINLESVKELEGPAKDLGSSKDGRRRKHHDGKHI  176

Query  428   IKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQT-QSFCEA  604
             +K+    ++KLF K EE SK   + S         S  S+YED   +++ S T  SF E 
Sbjct  177   MKNFVHQIDKLFHKKEEISKRLHDDSSG------QSETSNYEDPTDKSSSSATCTSFEEG  230

Query  605   IKLLQSR-TEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
             + L+QS  +E  EMPENL GGIL+DQ Y + P D N  LF P SQFRRELAE+QG  DVQ
Sbjct  231   LDLMQSSDSEKEEMPENLLGGILIDQQYLVSPCDLNKFLFMPSSQFRRELAEIQGLTDVQ  290

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             EGPWT   ++   LTRVVTY + ATKLVK+ +ATE Q Y K  GK+F+V V VSTPDVPY
Sbjct  291   EGPWTMIQEDNPRLTRVVTYIRPATKLVKAGKATENQVYRKASGKQFSVFVSVSTPDVPY  350

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             G+TFKVELLY ++PG    +G ES+ L+ISW ++F +ST+MK +IEGG +QGLK+SF +F
Sbjct  351   GNTFKVELLYKVLPGTEPNAGGESSRLIISWGIQFSQSTIMKGMIEGGARQGLKESFEQF  410

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             S  LA++ K + SA +LD   +LAT+ SE  +DL+ A  YF + +VV    L +Y  +HI
Sbjct  411   SDLLAKNYKTLDSAALLDKEQVLATVQSEKKTDLK-AFLYFWSSSVVCAVLLSVYVVVHI  469

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
             L    ++ QG+EF+GLDLPDS GE+ T GILVL LE+VY M  HF++ARL RG DHGV+A
Sbjct  470   LHCEPSKFQGVEFYGLDLPDSFGELFTSGILVLLLERVYTMTVHFIQARLHRGRDHGVKA  529

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
             +  GW+LT+ALI+GTNLAS++ T   DP+VVFTCNGK+RTSSV+LQ+ DPQWNE++EF+ 
Sbjct  530   NSKGWILTIALIKGTNLASVEATELFDPYVVFTCNGKTRTSSVKLQSQDPQWNEVIEFDA  589

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
              EEPPS+LDVEVFDFDGPFDQ  SLGHAEINFLKHT+ ELADL +PL G  AQ+SQSKL 
Sbjct  590   MEEPPSVLDVEVFDFDGPFDQGASLGHAEINFLKHTADELADLCVPLVGHHAQASQSKLQ  649

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFL N NGVET++D L+K+EKEVGKKLN+RSP +NS FQK F LP EEFL+ +++C L
Sbjct  650   LRIFLENKNGVETMKDYLSKVEKEVGKKLNIRSPQKNSAFQKLFSLPHEEFLLKEYTCYL  709

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRKLP+QG++FLS RIV F++NLFGHKTKF+FLWEDI++I VLPP+ +++GSP L+IIL 
Sbjct  710   KRKLPVQGKLFLSARIVAFHSNLFGHKTKFYFLWEDIDDIQVLPPTLASLGSPLLLIILK  769

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQY  2401
             K+RG DA++GAKS DE GRL F F SFVSF   SRTIMALWKTR    D +AQIAEE+Q 
Sbjct  770   KNRGLDAKHGAKSQDEAGRLWFYFQSFVSFDATSRTIMALWKTRTLSVDHRAQIAEEEQD  829

Query  2402  KDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYV  2581
               +  VLPE+T      +   MSKVY+ DLP + + +M++F GG++E K+M KSGCL+Y 
Sbjct  830   AADPFVLPEDTAVVSDADASKMSKVYTCDLPCDVELVMKIFGGGEMERKIMEKSGCLSYE  889

Query  2582  TSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFS  2761
             T++WE  +P VYERR+SYK N  +S+FG  VT +Q+KS   ND GWILNEI+A+H VPF+
Sbjct  890   TTTWESKKPGVYERRLSYKYNHYVSVFGGGVTCSQQKSPAPNDEGWILNEIVALHDVPFA  949

Query  2762  DHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFV  2941
             DH++V LRY+V+       + +C+VY+ + WLK  K E R++K+I+ KF  R+K + +  
Sbjct  950   DHFRVHLRYEVKKAGGDCKTSKCEVYLKIRWLKTIKFEQRVSKSIMEKFRNRLKVIFDLF  1009

Query  2942  GRE  2950
              +E
Sbjct  1010  QKE  1012



>ref|XP_006279567.1| hypothetical protein CARUB_v10025800mg [Capsella rubella]
 gb|EOA12465.1| hypothetical protein CARUB_v10025800mg [Capsella rubella]
Length=1028

 Score =   983 bits (2542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/913 (54%), Positives = 652/913 (71%), Gaps = 23/913 (3%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSSPKKVL------------  412
             GKILL+LSL GK    S       +  +  E  K+++     SPK +             
Sbjct  120   GKILLSLSLQGKWESNSGEKVQNDKQDIMLEGVKELEG----SPKDLSSSKDGKKRKHHH  175

Query  413   EGKQLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQT-Q  589
             +GK ++K+    ++KLF K EE SK   + S          I S+YED   +++ S T  
Sbjct  176   DGKHIMKNFVNQIDKLFHKKEEISKRLHDDSSGG-----QGITSNYEDATDKSSCSATCT  230

Query  590   SFCEAIKLLQSR-TEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQG  766
             SF E + L+QS  +E  EMPENL GG+L+DQ Y + P + N  LFAP S+FR+E+AELQG
Sbjct  231   SFEEGLDLMQSSDSEKEEMPENLTGGVLVDQKYLVSPCNLNKFLFAPSSEFRKEVAELQG  290

Query  767   TKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVST  946
               DVQEGPWT   ++   LTRVVTY + ATK+VK+V+ATE Q Y K +GKEFAV V VST
Sbjct  291   LSDVQEGPWTMMQEDTPHLTRVVTYMRAATKMVKAVKATENQIYRKANGKEFAVFVSVST  350

Query  947   PDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKD  1126
             PDVPYGSTFKVELLY I+P     +G ES+ L+ISW ++F +ST+MK +IEGG +QGL++
Sbjct  351   PDVPYGSTFKVELLYKILPETEPTAGGESSRLIISWGIQFNQSTIMKGMIEGGAKQGLRE  410

Query  1127  SFSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLY  1306
             SF +FS  LA+  K +  A VLD   ++AT+ SE  +DL+ A  YF + +V+    L +Y
Sbjct  411   SFEQFSDLLAKTYKTLDPAVVLDKDQVIATVQSEQKTDLKSAFLYFWSSSVICAVLLSIY  470

Query  1307  FSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSD  1486
               +HIL    +++QGLEF+GLDLPDS GE+ + G+LVL LE+VY M  HF++ARL RG D
Sbjct  471   VVVHILHCEPSKIQGLEFYGLDLPDSFGELFSSGMLVLLLERVYMMTVHFIQARLHRGRD  530

Query  1487  HGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEI  1666
             HGV+++G GW+LT+ALI+GTNLAS++ T   DP+V+FTCNGK+RTSSV+LQ  DPQWNE+
Sbjct  531   HGVKSNGKGWILTIALIKGTNLASVEATELFDPYVIFTCNGKTRTSSVKLQAQDPQWNEV  590

Query  1667  LEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSS  1846
             +EF+  EEPPS+LDVEVFDFDGPFDQ  SLGHAEINF KHT+ ELADL +PL G  AQ+S
Sbjct  591   IEFDAMEEPPSVLDVEVFDFDGPFDQGASLGHAEINFFKHTADELADLCVPLVGHHAQAS  650

Query  1847  QSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
             QSKL LRIFL N NGVET++D L+K+EKEVGKKLN+RSP +N  FQK FGLP EEFL+ +
Sbjct  651   QSKLQLRIFLENKNGVETMKDYLSKVEKEVGKKLNIRSPQKNCAFQKLFGLPHEEFLLKE  710

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             ++C LKRKLP+QG+++LS RIV FY+N+FGHKTKF+FLWEDI++I VLPP+F+++GSP L
Sbjct  711   YTCYLKRKLPVQGKLYLSARIVAFYSNVFGHKTKFYFLWEDIDDIQVLPPTFASLGSPLL  770

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIA  2386
             +IIL K+RG DA++GAKS+D+EGRL F F SFVSF   SRTIMALWKTR    D +AQIA
Sbjct  771   LIILKKNRGLDAKHGAKSLDDEGRLWFYFQSFVSFDATSRTIMALWKTRTLSVDHRAQIA  830

Query  2387  EEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSG  2566
             EE+Q   +  +LPE+       + + MSKVY+ DLP + + +M++F GG+LE K+M KSG
Sbjct  831   EEEQDVSDPFLLPEDVAVVSDSDALKMSKVYTRDLPCDVELVMKIFGGGELERKIMEKSG  890

Query  2567  CLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIH  2746
             CLNY +++WE   P VYERR+SYK N  +S+FG  VT  Q+KS+  +D GWILNEI+A+H
Sbjct  891   CLNYASTTWESKNPGVYERRLSYKYNHYVSVFGGGVTCAQQKSLAPSDEGWILNEIVALH  950

Query  2747  GVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKE  2926
              VPF DH++V LRY+V+       + +CDVY+ + WLK  K E RI+K+I+ KF  R+  
Sbjct  951   DVPFGDHFRVHLRYEVKKAGVDCKTSKCDVYLKIRWLKTIKFEQRISKSIMEKFRTRLNV  1010

Query  2927  MIEFVGREVFLSS  2965
             + +   +E   +S
Sbjct  1011  IFDLFQKESVANS  1023



>ref|XP_010442497.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170-like 
[Camelina sativa]
Length=1028

 Score =   980 bits (2533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/910 (54%), Positives = 650/910 (71%), Gaps = 19/910 (2%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSE-------TSKDVDAIKVSSPKKVLEGKQL  427
             GKILL+LSL GK  D++      VQ  +  E       + KD+   K    +K  +GK +
Sbjct  122   GKILLSLSLQGKW-DITAGEK--VQNDINLEGVKELEGSPKDLSCSKDGKRRKHHDGKHI  178

Query  428   IKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQ---SFC  598
             +K++   ++KLF K EE SK   + S         S+ S+YED   +++ S T    SF 
Sbjct  179   MKNLVNQIDKLFHKKEEMSKRLHDDSSGG-----QSVTSNYEDATDKSSCSATSTCTSFE  233

Query  599   EAIKLLQSR-TEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKD  775
             E + L+QS  +E  EMPENL GG+L+DQ Y + P D N  LF P SQFR+ELAELQG  D
Sbjct  234   EGLDLMQSSDSEREEMPENLTGGVLVDQKYLVSPCDLNKFLFTPSSQFRKELAELQGLSD  293

Query  776   VQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDV  955
             VQEGPWT   ++   LTRVVTY + ATK+VK+V+ATE Q Y K  GK+FAV V VSTPDV
Sbjct  294   VQEGPWTMMQEDTPRLTRVVTYMRAATKMVKAVKATENQVYRKASGKQFAVFVSVSTPDV  353

Query  956   PYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFS  1135
             PYG+TFK+ELLY I+      +G E + L+ISW ++F +ST+MK +IEGG +QGL++SF 
Sbjct  354   PYGNTFKIELLYKILSETEPTAGGEPSRLIISWGIQFSQSTIMKGMIEGGARQGLRESFE  413

Query  1136  EFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSI  1315
             +FS  LA+  K +  A VLD   ++AT+ SE  +DL+ A  YF + +V+    L +Y  +
Sbjct  414   QFSDLLAKTYKTLDPAVVLDKEQVIATVQSEKKTDLKSAFLYFWSSSVICAVLLSVYVVV  473

Query  1316  HILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGV  1495
             HIL S  +++QG EF+GLDLPDS GE+++ G+LVL LE+VY M  HF++ARL RG DHGV
Sbjct  474   HILHSEPSKIQGFEFYGLDLPDSFGEVLSSGMLVLLLERVYMMTVHFIQARLHRGKDHGV  533

Query  1496  RAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEF  1675
             +A+G GW+LT+ALI+GTNLAS++ T   DP+VVFTCNGK+RTSSV+LQ  DPQWNE++EF
Sbjct  534   KANGKGWILTIALIKGTNLASVEATEIFDPYVVFTCNGKTRTSSVKLQAQDPQWNEVIEF  593

Query  1676  EPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSK  1855
             +  EEPPS+LDVEVFDFDGPFDQ  SLGHAEINFLKHT+ ELAD  +PL G  AQ+SQSK
Sbjct  594   DAMEEPPSVLDVEVFDFDGPFDQGASLGHAEINFLKHTADELADFSVPLVGHHAQASQSK  653

Query  1856  LHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSC  2035
             L LRIFL N NGVET++D L+K+EKEVGKKLN+RSP +NS FQK FGLP EEFL+ +++C
Sbjct  654   LQLRIFLENKNGVETMKDYLSKVEKEVGKKLNIRSPQKNSAFQKLFGLPHEEFLLKEYTC  713

Query  2036  SLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVII  2215
              LKRKLP+QG+++LS RIV FY+N+FGHKTKF+FLWEDI++I VLPP+F+++GSP L+II
Sbjct  714   YLKRKLPVQGKLYLSARIVAFYSNVFGHKTKFYFLWEDIDDIQVLPPTFASLGSPLLLII  773

Query  2216  LHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQ  2395
             L K+RG DA++GAKS D+EGR+ F F SFVSF   SRTIMALWKTR      +AQIAEE+
Sbjct  774   LKKNRGLDAKHGAKSQDDEGRVWFYFQSFVSFDATSRTIMALWKTRTLSVYHRAQIAEEE  833

Query  2396  QYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLN  2575
             Q   +  +LPE+       + + MSKVY+ DLP + + +M +F GG+LE KVM KSGCL+
Sbjct  834   QDLSDPFLLPEDVAVVSDSDALKMSKVYTCDLPCDVELVMRIFGGGELERKVMEKSGCLS  893

Query  2576  YVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVP  2755
             Y +++WE   P VYERR+SYK N  +S+FG  VT  Q+KS   ND GWILNEI+A+H VP
Sbjct  894   YASTTWESKNPGVYERRLSYKYNHYVSVFGGGVTCAQQKSPAPNDDGWILNEIVALHDVP  953

Query  2756  FSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIE  2935
             F DH++V LRY+V+       + +C+VY+ + WLK  K E RI+K+I+ KF  R+  + +
Sbjct  954   FGDHFRVHLRYEVKKAGVDCKTSKCEVYLKIRWLKTIKFEQRISKSIMEKFRNRLNVIFD  1013

Query  2936  FVGREVFLSS  2965
                +E   +S
Sbjct  1014  LFQKESVANS  1023



>ref|NP_199828.1| C2 and GRAM domain-containing protein [Arabidopsis thaliana]
 sp|Q9FGS8.1|C2GR2_ARATH RecName: Full=C2 and GRAM domain-containing protein At5g50170 
[Arabidopsis thaliana]
 dbj|BAB09388.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL07002.1| AT5g50170/K6A12_3 [Arabidopsis thaliana]
 gb|AAP88330.1| At5g50170/K6A12_3 [Arabidopsis thaliana]
 gb|AED95906.1| C2 and GRAM domain-containing protein [Arabidopsis thaliana]
Length=1027

 Score =   978 bits (2529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/909 (54%), Positives = 647/909 (71%), Gaps = 15/909 (2%)
 Frame = +2

Query  269   GKILLTLSLHGK-----GHDLSTNHACFVQPSVGSE---TSKDVDAIKVSSPKKVLEGKQ  424
             GKILL+LSL GK     G  +  +    +      E   + KD+ + +    +K  +GK 
Sbjct  119   GKILLSLSLQGKWESTSGEKVLNDKQDIINLEGVKELEGSPKDLISSRDGKRRKHHDGKH  178

Query  425   LIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQT-QSFCE  601
             ++K+I  H++KLF K EE SK   + S         S+ S+YED   + + S T   F E
Sbjct  179   IMKNIVNHIDKLFHKKEEISKRLHDESSVG-----QSVNSNYEDATDQCSSSATCTGFEE  233

Query  602   AIKLLQSR-TEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDV  778
              + L+QS  +E  EMPENL GG+L+DQ Y + P + N  LF P SQFR+ELAELQG  DV
Sbjct  234   GLDLMQSSDSEREEMPENLTGGVLVDQKYLVSPCELNKFLFTPSSQFRKELAELQGLSDV  293

Query  779   QEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVP  958
             QEGPWT   ++   LTRVVTY + ATK+VK+V+ATE Q Y K  GK+FAV V VSTPDVP
Sbjct  294   QEGPWTMMQEDTPRLTRVVTYMRAATKMVKAVKATENQVYRKASGKQFAVFVSVSTPDVP  353

Query  959   YGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSE  1138
             YG+TFK+ELLY I+P     +G E++ L+ISW ++F +ST+MK +IEGG +QGLK+SF +
Sbjct  354   YGNTFKIELLYKILPETEPTAGGEASRLIISWGIQFSQSTIMKGMIEGGARQGLKESFEQ  413

Query  1139  FSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIH  1318
             FS  LA+  K +  A VLD   ++AT+ SE  +DL+ A  YF + +V+    L +Y  +H
Sbjct  414   FSNLLAKTYKTLDPAVVLDKEQVIATVQSEPKTDLKSAFLYFWSSSVICAVLLSVYVVVH  473

Query  1319  ILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVR  1498
             +L    +++QG EF+GLDLPDS GE+ + GILVL LE+VY M  HFV+ARL RG D GV+
Sbjct  474   MLHCEPSKIQGFEFYGLDLPDSFGELFSSGILVLLLERVYIMTVHFVQARLHRGRDQGVK  533

Query  1499  AHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFE  1678
             A+G GW+LT+ALI+GTNLAS++ T   DP+VVFTCNGK+RTSSV+LQ  DPQWNE++EF+
Sbjct  534   ANGKGWILTIALIKGTNLASVEATELFDPYVVFTCNGKTRTSSVKLQAQDPQWNEVIEFD  593

Query  1679  PAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKL  1858
               EEPPS+LDVEVFDFDGPFDQ  SLGHAEINFLKHT+ ELADL + L G  AQ+SQSKL
Sbjct  594   AMEEPPSVLDVEVFDFDGPFDQGASLGHAEINFLKHTADELADLSVALVGNHAQASQSKL  653

Query  1859  HLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCS  2038
              LRIFL N NGVET++D L+K+EKEVGKKLN+RSP +NS FQK FGLP EEFL+ +++C 
Sbjct  654   QLRIFLENKNGVETMKDYLSKVEKEVGKKLNIRSPQKNSAFQKLFGLPHEEFLLKEYTCY  713

Query  2039  LKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIIL  2218
             LKRKLP+QG++FLS RIV FY+N+FGHKTKF+FLWEDI++I VLPP+F+++GSP L+IIL
Sbjct  714   LKRKLPVQGKLFLSARIVAFYSNVFGHKTKFYFLWEDIDDIQVLPPTFASLGSPLLLIIL  773

Query  2219  HKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQ  2398
              K+RG DA++GAKS D+EGRL F F SFVSF   SRTIMALWKTR    D +AQI EE Q
Sbjct  774   KKNRGLDAKHGAKSQDDEGRLSFYFQSFVSFDATSRTIMALWKTRTLSVDHRAQIVEEDQ  833

Query  2399  YKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNY  2578
                +  +LPE        + + MSKVY+ DLP + + +M++F GG+LE K+M KSGCL+Y
Sbjct  834   DVADPFLLPEAVTVVSDADALMMSKVYTCDLPCDVELVMKIFGGGELERKIMEKSGCLSY  893

Query  2579  VTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPF  2758
              +++WE  +P VYERR+SYK N  +S+FG  VT  Q+KS   ND GWILNEI+A+H VPF
Sbjct  894   ASTTWESKKPGVYERRLSYKYNHYVSVFGGGVTCAQQKSPAPNDEGWILNEIVALHDVPF  953

Query  2759  SDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEF  2938
              DH++V +RY+V+       + +C+VY+ + WLK  K E RI+K+I+ KF  R K + + 
Sbjct  954   GDHFRVHIRYEVKKAGVDCKTSKCEVYLKIRWLKTIKFEQRISKSIMEKFRNRFKVIFDL  1013

Query  2939  VGREVFLSS  2965
               +E   +S
Sbjct  1014  FQKESVANS  1022



>ref|XP_010441655.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170 [Camelina 
sativa]
Length=1030

 Score =   978 bits (2527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/903 (54%), Positives = 645/903 (71%), Gaps = 14/903 (2%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSE-------TSKDVDAIKVSSPKKVLEGKQL  427
             GKILL+LSL GK    S       +  +  E       + KD+   K    +K  +GK +
Sbjct  123   GKILLSLSLQGKWDITSGEKVQNDKQDINLEGVKELEGSPKDLSCSKDGKRRKHHDGKHI  182

Query  428   IKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQT-QSFCEA  604
             +K++   ++KLF K EE SK   + S         S+ S+YED   +++ S T   F + 
Sbjct  183   MKNLVNQIDKLFHKKEEMSKRLHDDSSGG-----QSVTSNYEDATDKSSCSATCTGFEDG  237

Query  605   IKLLQSR-TEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
             + L+QS  +E  EMPENL GG+L+DQ Y + P D N  LF P SQFR+ELAELQG  DVQ
Sbjct  238   LDLMQSSDSEKEEMPENLTGGVLVDQKYLVSPCDLNKFLFTPSSQFRKELAELQGLSDVQ  297

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             EGPWT   ++   LTRVVTY + ATK+VK+V+ATE Q Y K  GK+FAV V VSTPDVPY
Sbjct  298   EGPWTMMQEDTPRLTRVVTYMRAATKMVKAVKATENQVYRKASGKQFAVFVSVSTPDVPY  357

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             G+TFK+ELLY I+      +  ES+ L+ISW ++F  ST+MK +IEGG +QGL++SF +F
Sbjct  358   GNTFKIELLYKILSELEPTASGESSRLIISWGIQFSHSTIMKGMIEGGARQGLRESFEQF  417

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             S  LA+  K +  A VLD   ++AT+ SE  +DL+ A  YF + +V+    L +Y  +HI
Sbjct  418   SDLLAKTYKTLDPAVVLDKEQVIATVQSEQKTDLKSAFLYFWSSSVICALLLSVYVVVHI  477

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
             L S  +++QG EF+GLDLPDS GE+ + G+LVL LE+VY M  HF++ARL RG DHGV+A
Sbjct  478   LHSEPSKIQGFEFYGLDLPDSFGELFSSGMLVLLLERVYMMTVHFIQARLHRGKDHGVKA  537

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
             +G GW+LT+ALI+GTNLAS++ T   DP+VVFTCNGK+RTSSV+LQ  DPQWNE++EF+ 
Sbjct  538   NGKGWILTIALIKGTNLASVEATEIFDPYVVFTCNGKTRTSSVKLQAQDPQWNEVIEFDA  597

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
              EEPPS+LDVEVFDFDGPFDQ  SLGHAEINFLKHT+ ELADL +PL G  AQ+SQSKL 
Sbjct  598   MEEPPSVLDVEVFDFDGPFDQGASLGHAEINFLKHTADELADLCVPLVGHHAQASQSKLQ  657

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFL N NGVET++D L+K+EKEVGKKLN+RSP +NS FQK FGLP EEFL+ +++C L
Sbjct  658   LRIFLENKNGVETMKDYLSKVEKEVGKKLNIRSPQKNSAFQKLFGLPHEEFLLKEYTCYL  717

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRKLP+QG+++LS RIV FY+N+FGHKTKF+FLWEDI++I VLPP+F+++GSP L+IIL 
Sbjct  718   KRKLPVQGKLYLSARIVAFYSNVFGHKTKFYFLWEDIDDIQVLPPTFASLGSPLLLIILK  777

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQY  2401
             K+RG DA++GAKS D+EGR+ F F SFVSF   SRTIMALWKTR      +AQIAEE+Q 
Sbjct  778   KNRGLDAKHGAKSQDDEGRVWFYFQSFVSFDATSRTIMALWKTRKLSVYHRAQIAEEEQD  837

Query  2402  KDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYV  2581
               +  +LPE+       + + MSKVYS DLP + + +M++F GG+LE KVM KSGCLNY 
Sbjct  838   LSDPFLLPEDVAVVSDSDALKMSKVYSCDLPCDVELVMKIFGGGELERKVMEKSGCLNYA  897

Query  2582  TSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFS  2761
             +++WE   P VYERR+SYK N  +S+FG  VT  Q+KS   ND GWILNEI+A+H VPF 
Sbjct  898   STTWESKNPGVYERRLSYKYNHYVSVFGGGVTCAQQKSPAPNDEGWILNEIVALHDVPFG  957

Query  2762  DHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFV  2941
             D+++V LRY+V+       + +C+VY+ + WLK  K E RI+K+I+ KF  R+K + +  
Sbjct  958   DYFRVHLRYEVKKAGVDCKTSKCEVYLKIRWLKTIKFEQRISKSIMEKFRNRLKVIFDLF  1017

Query  2942  GRE  2950
              +E
Sbjct  1018  QKE  1020



>ref|XP_002864041.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40300.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=1028

 Score =   977 bits (2525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/908 (54%), Positives = 646/908 (71%), Gaps = 14/908 (2%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSE-------TSKDVDAIKVSSPKKVLEGKQL  427
             GKILL+LSL GK    S       +  +  E       + KD+ + K    +K  +GK +
Sbjct  121   GKILLSLSLQGKWESTSGEKVLNDKQDINLEGVKELQGSPKDLISSKDGRRRKHHDGKHI  180

Query  428   IKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQT-QSFCEA  604
             +K+    ++KLF K EE SK   + S  D      ++ S+YED   + + S T   F E 
Sbjct  181   MKNFVNQIDKLFHKKEEISKRLHDDSSVD-----QTVNSNYEDATDKCSSSATCTGFEEG  235

Query  605   IKLLQS-RTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
             + L+QS  +E  EMPENLQGGILLDQ Y + P D N  LF P SQFR+ELAELQG  DVQ
Sbjct  236   LDLMQSCDSEREEMPENLQGGILLDQKYLVSPCDLNKYLFTPSSQFRKELAELQGLSDVQ  295

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             EGPWT   ++   LTRVVTY + A+K+VK+V+ATE Q Y K  GK+FAV V VSTPDVPY
Sbjct  296   EGPWTVMQEDTPRLTRVVTYMRAASKMVKAVKATENQVYRKASGKQFAVFVSVSTPDVPY  355

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             G+TFK+ELLY I+P     +  ES+ L+ISW ++F +ST+MK +IEGG +QGL++SF +F
Sbjct  356   GNTFKIELLYKILPETEPTADGESSRLIISWGIQFNQSTIMKGMIEGGARQGLRESFEQF  415

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             +  L +  K +  A VLD   ++AT+ SE  +DL+ A  YF + +V     L +Y   H+
Sbjct  416   ANLLTKTYKTLDPAAVLDKDQVIATVQSEQKTDLKSAFLYFWSSSVFCAVLLSVYVVAHM  475

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
             L    +++QG EF+GLDLPDS GE+++ GILVL LE+VY M  HF++ARL RG D GV+A
Sbjct  476   LHCEPSKIQGFEFYGLDLPDSFGELLSSGILVLLLERVYMMTVHFIQARLHRGRDQGVKA  535

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
             +G GW+LT+ALI+GTNLAS++ T   DP+VVFTCNGK+RTSSV+LQ  DPQWNE++EF+ 
Sbjct  536   NGKGWILTIALIKGTNLASVEATELFDPYVVFTCNGKTRTSSVKLQAQDPQWNEVIEFDA  595

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
              EEPPS+LDVEVFDFDGPFDQ  SLGHAEINFLKHT+ ELAD+ +PL G  AQ+SQSKL 
Sbjct  596   MEEPPSVLDVEVFDFDGPFDQGASLGHAEINFLKHTADELADMSVPLVGHHAQASQSKLQ  655

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFL N NGVET++D L+K+EKEVGKKLN+RSP +NS FQK FGLP EEFL+ +++C L
Sbjct  656   LRIFLENKNGVETMKDYLSKVEKEVGKKLNIRSPQKNSAFQKLFGLPHEEFLLKEYTCYL  715

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRKLP+QG++FLS RIV FY+N+FGHKTKF+FLWEDI++I VLPP+F+++GSP L+IIL 
Sbjct  716   KRKLPVQGKLFLSARIVAFYSNVFGHKTKFYFLWEDIDDIQVLPPTFASLGSPLLLIILK  775

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQY  2401
             K+RG DA++GAKS D+EGRL F F SFVSF   SRTIMALWKTR    D +AQIAEE Q 
Sbjct  776   KNRGLDAKHGAKSQDDEGRLWFYFQSFVSFDATSRTIMALWKTRTLSVDHRAQIAEEDQD  835

Query  2402  KDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYV  2581
               +  +LPE        + + MSKVY+ DLP + + +M++F GG+LE K+M KSGCL+Y 
Sbjct  836   VADPFLLPEAVAVVSDTDALMMSKVYTCDLPGDVELVMKIFGGGELERKIMEKSGCLSYA  895

Query  2582  TSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFS  2761
             +++WE  +P +YERR+SYK N  +S+FG  VT TQ+KS   ND GWI+NEI+A+H VPF 
Sbjct  896   STTWESKKPGIYERRLSYKYNHYVSVFGGGVTCTQQKSPAPNDEGWIINEIVALHDVPFG  955

Query  2762  DHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFV  2941
             DH++V +RY+V+       + +C+VY+ + WLK  K E RI+K+I+ KF  R K + +  
Sbjct  956   DHFRVHIRYEVKKAGVDCKTSKCEVYLKIRWLKTIKFEQRISKSIMEKFRNRFKVIFDLF  1015

Query  2942  GREVFLSS  2965
              +E   +S
Sbjct  1016  QKESVANS  1023



>ref|XP_010482323.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170-like 
[Camelina sativa]
Length=1029

 Score =   974 bits (2519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/905 (54%), Positives = 645/905 (71%), Gaps = 18/905 (2%)
 Frame = +2

Query  269   GKILLTLSLHGK---------GHDLSTNHACFVQPSVGSETSKDVDAIKVSSPKKVLEGK  421
             GKILL+LSL GK          +D    +   V+   GS   KD+   K    +K  +GK
Sbjct  122   GKILLSLSLQGKWDITSGEKVQNDKQDTNLEGVKEIEGS--PKDLSCSKDGKRRKHHDGK  179

Query  422   QLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQT-QSFC  598
              ++K+    ++KLF K EE SK   + S         S+ S+YED   +++ S T   F 
Sbjct  180   HIMKNFVNQIDKLFHKKEEMSKRLHDDSSGG-----QSVTSNYEDATDKSSCSATCTGFE  234

Query  599   EAIKLLQSR-TEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKD  775
             E + L+QS  +E  EMPENL GG+L+DQ Y + P + N  LF P SQFR+ELAELQG  D
Sbjct  235   EGLDLMQSSDSEKEEMPENLTGGVLVDQKYLVSPCELNKFLFTPSSQFRKELAELQGLSD  294

Query  776   VQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDV  955
             VQEGPWT   ++   LTRVVTY + ATK+VK+V+ATE Q Y K  GK+FAV V VSTPDV
Sbjct  295   VQEGPWTMMQEDSPRLTRVVTYMRAATKMVKAVKATENQVYRKASGKQFAVFVSVSTPDV  354

Query  956   PYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFS  1135
             PYGSTFK+ELLY I+      +G ES+ L+ISW ++F  ST+MK +IEGG +QGL++SF 
Sbjct  355   PYGSTFKIELLYKILSELEPTAGGESSRLIISWGIQFSHSTIMKGMIEGGARQGLRESFD  414

Query  1136  EFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSI  1315
             +FS  LA+  K +  A VLD   ++AT+ SE  +DL+ A  YF + +V+    L +Y  +
Sbjct  415   QFSDLLAKTYKTLDPAVVLDKEQVIATVQSEQKTDLKSAFLYFWSSSVICAVLLSVYVVV  474

Query  1316  HILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGV  1495
             HIL S  +++QG EF+GLDLPDS GE+ + G+LVL LE+VY M  HF++ARL RG DHGV
Sbjct  475   HILHSEPSKIQGFEFYGLDLPDSFGEVFSSGMLVLLLERVYMMTVHFIQARLHRGKDHGV  534

Query  1496  RAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEF  1675
             +A+G GW+LT+ALI+GTNLAS++ T   DP+VVFTCNGK+RTSSV+LQ  DPQWNE++EF
Sbjct  535   KANGKGWILTIALIKGTNLASVEATEIFDPYVVFTCNGKTRTSSVKLQAQDPQWNEVIEF  594

Query  1676  EPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSK  1855
             +  EEPPS+LDVEVFDFDGPFDQ  SLGHAEINFLKHT+ ELADL +PL G  AQ+SQSK
Sbjct  595   DAMEEPPSVLDVEVFDFDGPFDQGASLGHAEINFLKHTADELADLCVPLVGHHAQASQSK  654

Query  1856  LHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSC  2035
             L LRIFL N NGVET++D L+K+EKEVGKKLN+RSP +NS FQK FGLP EEFL+ +++C
Sbjct  655   LQLRIFLENKNGVETMKDYLSKVEKEVGKKLNIRSPQKNSAFQKLFGLPHEEFLLKEYTC  714

Query  2036  SLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVII  2215
              LKRKLP+QG+++LS RIV FY+N+FGHKTKF+FLWEDI++I VLPP+F+++GSP L+II
Sbjct  715   YLKRKLPVQGKLYLSARIVAFYSNVFGHKTKFYFLWEDIDDIQVLPPTFASLGSPLLLII  774

Query  2216  LHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQ  2395
             L K+RG DA++GAKS D+ GR+ F F SFVSF   +RTIMALWKTR      +AQIAEE+
Sbjct  775   LKKNRGLDAKHGAKSQDDGGRVWFYFQSFVSFDATTRTIMALWKTRTLSVYHRAQIAEEE  834

Query  2396  QYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLN  2575
             Q   +  +LPE+       + + MSKVY+ DLP + + +M++F GG+LE KVM KSGCLN
Sbjct  835   QDLSDPFLLPEDVAVVSDSDALKMSKVYTCDLPCDVELVMKIFGGGELERKVMEKSGCLN  894

Query  2576  YVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVP  2755
             Y +++WE   P VYERR+SYK N  +S+FG  VT  Q+KS   ND GWILNEI+A+H VP
Sbjct  895   YASTTWESKNPGVYERRLSYKYNHYVSVFGGGVTCAQQKSPAPNDDGWILNEIVALHDVP  954

Query  2756  FSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIE  2935
             F DH++V LRY+V+       + +C+VY+ + WLK  K E RI+K+I+ KF  R+  + +
Sbjct  955   FGDHFRVHLRYEVKKAGVDCKTSKCEVYLKIRWLKTIKFEQRISKSIMEKFRNRLNVIFD  1014

Query  2936  FVGRE  2950
                +E
Sbjct  1015  LFQKE  1019



>gb|EPS71403.1| hypothetical protein M569_03353, partial [Genlisea aurea]
Length=989

 Score =   967 bits (2499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/895 (55%), Positives = 647/895 (72%), Gaps = 33/895 (4%)
 Frame = +2

Query  272   KILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSSP--KKVLEGKQLIKSIAG  445
             K+L+ LSLHGKG D S++    +  S  +E +   DA +  S   K  LE K ++K+IAG
Sbjct  116   KLLIALSLHGKGQDASSSEKSKLLNS-DAEFAFSHDAYRGPSSFSKMALEVKPMMKTIAG  174

Query  446   HLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCEAIKLLQSR  625
             H E+LF K E+   +    S + +        S Y +   E T +Q  SF E I+ LQS 
Sbjct  175   HFERLFPKKEDEVSAGNVSSPEPSV-------STYVEESSEETPTQP-SFQELIQRLQSN  226

Query  626   TEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEGPWTWKS  805
              E +  PENLQ GILLD+ +     D NM +F+PDS+  +   ELQGT + +E PW WKS
Sbjct  227   GEMQASPENLQNGILLDEVFVGSSHDLNMAIFSPDSELVKSFGELQGTTEYKEEPWKWKS  286

Query  806   DNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGSTFKVEL  985
             D    L RVV+YTK ATKLVKSV+ATEEQ Y+K DGKE+AVLVDVS PD PYG+ FKVEL
Sbjct  287   DCIPSLRRVVSYTKAATKLVKSVKATEEQVYVKADGKEYAVLVDVSIPDAPYGNIFKVEL  346

Query  986   LYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRFLAQHC  1165
             LY IMPG    +GEE+T LVISWA+ F ++TM++ +IEGG ++G+K++F +F   L+Q  
Sbjct  347   LYKIMPGMESSTGEETTRLVISWAINFSQNTMVRGMIEGGARKGMKENFEQFGNLLSQKF  406

Query  1166  KVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHILLSRS--T  1339
             +   +AE+     +LAT+ +++ S L L R YF NFT VST  +++Y  +HI  S +  +
Sbjct  407   RKAGAAEISGKDQILATVGTQNRS-LSLVR-YFWNFTFVSTMLMLIYTCLHIFFSVTYPS  464

Query  1340  QLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHGDGWV  1519
             +    EF G+DLPDS+GE+IT G+L + +E+VY M++HF+ ARLRRGSD GVRA G+GW+
Sbjct  465   KKWRFEFEGIDLPDSLGELITGGLLAIQMERVYEMVSHFIAARLRRGSDPGVRAQGEGWI  524

Query  1520  LTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEEPPS  1699
             LTVALIE ++LAS DP    DPFV+ TCNG++RTSSV+LQT +PQW+EILEF+  EEPPS
Sbjct  525   LTVALIEASDLASNDPKETLDPFVMLTCNGQTRTSSVKLQTDEPQWDEILEFDALEEPPS  584

Query  1700  MLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRIFLN  1879
             +L+V VF+F+G FDQA SLG+AEINFLKH++A+LAD+W+PL GK+AQ+S+SKL LRIFL+
Sbjct  585   VLEVAVFNFEGLFDQASSLGYAEINFLKHSAAQLADIWVPLEGKLAQTSRSKLRLRIFLD  644

Query  1880  NNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRKLPL  2059
             NNNGV+TIRD L+ +EKEVGKKLNLRSPHR STFQK F LPPEEFLI+DFSCSLKRK+PL
Sbjct  645   NNNGVDTIRDYLSNLEKEVGKKLNLRSPHRTSTFQKIFSLPPEEFLISDFSCSLKRKMPL  704

Query  2060  QGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDRGTD  2239
             QGR+FLS RIVGFYANLFGHKT FFFLWEDI +I +LPPS ST+GSP LVI+LHK RG D
Sbjct  705   QGRLFLSARIVGFYANLFGHKTIFFFLWEDIADIQILPPSISTVGSPILVIVLHKGRGLD  764

Query  2240  ARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKDENNV  2419
             AR+GAK++D+EGRLHF FHSFVS   ASRTI ALW+TR   P QK          D++  
Sbjct  765   ARHGAKALDDEGRLHFYFHSFVSLNAASRTITALWRTRTSDPAQKMD--------DDSGG  816

Query  2420  LPE-----ETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVT  2584
              P      E G+ ++VE+V MSKVYS  LP N  SLM+MF+GG+ E  +M +SGC +YV+
Sbjct  817   KPTQCQLGEKGAAIVVENVEMSKVYSSQLPTNIASLMKMFDGGEFEATLMRRSGCHDYVS  876

Query  2585  SSWELIEP-DVYERRVSYKLNRLISIFGVEVTSTQRKS--VHANDAGWILNEIMAIHGVP  2755
             + WE   P +  ERR+ Y+ +R +SIFG EVT TQRKS  +  + AGW ++E+M  H +P
Sbjct  877   TPWERAGPAEELERRLCYRFSRRVSIFGGEVTCTQRKSPLLPESSAGWSIHEVMTFHDIP  936

Query  2756  FSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRV  2920
             F+D+++VQ RY++E  S  R  C+ + Y+G++WL+  K E RITK++V KFS+R+
Sbjct  937   FADNFRVQFRYRMEESSEDR--CKFEAYIGMVWLRRNKFEPRITKSVVGKFSRRI  989



>ref|XP_006402175.1| hypothetical protein EUTSA_v10012548mg [Eutrema salsugineum]
 gb|ESQ43628.1| hypothetical protein EUTSA_v10012548mg [Eutrema salsugineum]
Length=1024

 Score =   963 bits (2489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/912 (54%), Positives = 651/912 (71%), Gaps = 23/912 (3%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSSPK-----------KVLE  415
             GKILL+LSL GK   +S + A   +  +  E  K+++     SPK           K  +
Sbjct  118   GKILLSLSLQGKWESISGDKAINDKQDISLEGVKELEG----SPKEPGCSKDVRRRKHHD  173

Query  416   GKQLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNV-QETTRSQTQS  592
             GK L+K+I   ++KLF K EE SK   + S  +       + S+YED   + ++ S   S
Sbjct  174   GKHLMKNIVNQIDKLFHKKEEMSKRLNDLSAGEI------VTSNYEDATDKSSSSSTCTS  227

Query  593   FCEAIKLLQSR-TEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             F E + L+QS  +E  EMPENL GGILLDQ Y + P D N  LF+P+SQFR+ELAELQG 
Sbjct  228   FEEGLGLMQSSDSEKEEMPENLPGGILLDQKYLVSPSDLNKFLFSPNSQFRKELAELQGL  287

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
              DVQEGPWT   ++ + LTRVVTY + ATKLVK+ +ATE Q Y K  G++FAV V VSTP
Sbjct  288   SDVQEGPWTMIHEDNTRLTRVVTYIRPATKLVKAGKATENQVYRKASGQKFAVFVSVSTP  347

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             DVPYG+TFKVELLY ++PG    +G ES+ L+ISW ++F +ST+MK +IEGG +QGLK+S
Sbjct  348   DVPYGNTFKVELLYKVLPGTEQNAGGESSRLIISWGIQFSQSTIMKGMIEGGARQGLKES  407

Query  1130  FSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYF  1309
             F +F+  LA++ K +    VLD   ++AT+ SEH +DL+ A  YF + +VV    + +Y 
Sbjct  408   FEKFADLLAKNYKTLDPGVVLDKEQVIATVQSEHKADLKSAFLYFWSSSVVCAVLVSVYV  467

Query  1310  SIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDH  1489
              +HI      ++QGLEF+GLDLPDS GE+ + GILVL LE+VY M  HF++ARL RG D 
Sbjct  468   VVHIFHCEPNKIQGLEFYGLDLPDSFGELFSSGILVLLLERVYMMTVHFIQARLHRGRDQ  527

Query  1490  GVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEIL  1669
             GV+A+G GW+LT+ALI+GTNLAS++ T   DP+VVFTCNGK+RTSSV+LQ  DPQWNE++
Sbjct  528   GVKANGKGWILTIALIKGTNLASVEATELFDPYVVFTCNGKTRTSSVKLQDQDPQWNEVI  587

Query  1670  EFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQ  1849
             EF+  EEPPS+LDVEVFDFDGPFDQ  SLGHAEINFLK T+ ELADL +PL G  AQ+SQ
Sbjct  588   EFDAMEEPPSVLDVEVFDFDGPFDQGASLGHAEINFLKLTADELADLCVPLVGHHAQASQ  647

Query  1850  SKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDF  2029
             SKL LRIFL N NGVET++D L+K+EKEVGKKLN+RSP +NS FQK FGLP EEFL+ ++
Sbjct  648   SKLQLRIFLENKNGVETMKDYLSKVEKEVGKKLNIRSPQKNSAFQKLFGLPHEEFLLKEY  707

Query  2030  SCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLV  2209
             +C LKRKLP+QG++FLS RIV FY+N+FGHKTKF+FLWEDI++I +LPP+ +++GSP L+
Sbjct  708   TCYLKRKLPVQGKLFLSARIVAFYSNIFGHKTKFYFLWEDIDDIQLLPPTLASIGSPLLL  767

Query  2210  IILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAE  2389
             IIL K+RG DA+ GAKS DEEGRL F F SFVSF   SRTIMALWKTR    D +AQIAE
Sbjct  768   IILKKNRGLDAKYGAKSQDEEGRLWFYFQSFVSFDATSRTIMALWKTRTLSIDHRAQIAE  827

Query  2390  EQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGC  2569
             E+    +  +LPE+  +    +   MSKVYS DLP + + +M++F GG++E K+M KSGC
Sbjct  828   EELDVADPFLLPEDVTAASDADAPKMSKVYSCDLPGDVELVMKIFGGGEMERKIMEKSGC  887

Query  2570  LNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHG  2749
             LNY +++WE     VYERR+SYK N  +S+FG  VT +Q+K    ND GWIL+EI+A+H 
Sbjct  888   LNYASTTWESKSSGVYERRLSYKYNHYVSVFGGGVTCSQQKFPAPNDEGWILHEIVALHD  947

Query  2750  VPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEM  2929
             VPF DH++V LRY+V+       + +C+VY+ + WLK  K E RI+K+I+ KF  R+K +
Sbjct  948   VPFGDHFRVHLRYEVKKAGVDCKTTKCEVYLRIRWLKPIKFEQRISKSIMEKFRNRLKVI  1007

Query  2930  IEFVGREVFLSS  2965
              +   +E   +S
Sbjct  1008  FDLFQKESVANS  1019



>ref|XP_007026402.1| C2 calcium/lipid-binding and GRAM domain containing protein [Theobroma 
cacao]
 gb|EOY29024.1| C2 calcium/lipid-binding and GRAM domain containing protein [Theobroma 
cacao]
Length=1025

 Score =   962 bits (2486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/841 (55%), Positives = 620/841 (74%), Gaps = 6/841 (1%)
 Frame = +2

Query  431   KSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCEAIK  610
             KS+AG + ++F+KN +++ +    S         S     +DN  +  +S + SF EA+K
Sbjct  186   KSLAGRIAQMFNKNMDTAPTTSAKSTDLMEIPEISRADISDDNADD--QSSSVSFEEAMK  243

Query  611   LLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEGP  790
              L+SR +G E+P NL GG+LLDQ Y + P + N LLF+PDS F R LAE+QG+ D Q GP
Sbjct  244   ALESRDQGSEIPINLPGGVLLDQLYVIAPTELNFLLFSPDSSFPRSLAEVQGSTDPQFGP  303

Query  791   WTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGST  970
             W +++  + CL RV +Y +  TKL+K+V+ATEEQTY+K DGK+FAVL  VSTPDV YGST
Sbjct  304   WKFENGGE-CLKRVYSYIRAPTKLIKAVKATEEQTYIKADGKDFAVLAGVSTPDVMYGST  362

Query  971   FKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRF  1150
             F+ E+LY I PGP L SGE+S+HLVISW + F +STMMK +IE G +QGLK+SF +F+  
Sbjct  363   FRTEVLYCITPGPELPSGEQSSHLVISWRMNFLQSTMMKGMIENGARQGLKESFEQFATL  422

Query  1151  LAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHILL  1327
             LAQ  K + S ++ L+  HLL +L +E  SD +LA +YF NFT+ ST F+ +Y  +HI L
Sbjct  423   LAQTIKPVDSKDIGLNKEHLLGSLQAEPQSDWKLAVQYFANFTLASTVFMSIYVIVHIWL  482

Query  1328  SRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHG  1507
             +  + +QGLEF GLDLPDS+GE I CG+LVL  E+V ++ + F++AR ++GSDHGV+A G
Sbjct  483   AAPSAIQGLEFVGLDLPDSIGEFIVCGVLVLQGERVLQLFSRFMQARAQKGSDHGVKAQG  542

Query  1508  DGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAE  1687
             +GW+LTVAL+EG+NLA++D +GF DP+VVFTCNGK+RTSS++ Q   PQWNEI EF+  +
Sbjct  543   NGWLLTVALLEGSNLAAVDSSGFCDPYVVFTCNGKTRTSSIKFQKSGPQWNEIFEFDAMD  602

Query  1688  EPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLR  1867
             EPPS+LDVEV+DFDGPFD+A SLGHAEINF+K   ++LAD+W+PL GK+AQ+ QSKLHLR
Sbjct  603   EPPSVLDVEVYDFDGPFDEATSLGHAEINFVKSNISDLADVWVPLQGKLAQACQSKLHLR  662

Query  1868  IFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKR  2047
             IFL+N  G   +++ L+KMEKEVGKK+N+RSP  NS FQK FGLPPEEFLINDF+C LKR
Sbjct  663   IFLDNTRGGNVVKEYLSKMEKEVGKKINVRSPQTNSAFQKLFGLPPEEFLINDFTCHLKR  722

Query  2048  KLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKD  2227
             K+PLQGR+FLS RI+GF+ANLFGHKTKFFFLWEDIE+I VL P+ ++MGSP +V  L   
Sbjct  723   KMPLQGRLFLSARIIGFHANLFGHKTKFFFLWEDIEDIQVLTPTLASMGSPIIVTTLRLG  782

Query  2228  RGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKD  2407
             RG DAR+GAK+ DEEGRL F FHSFVSF  A RTIMALWK R+  P+QK QI EE    +
Sbjct  783   RGMDARHGAKTQDEEGRLKFHFHSFVSFNVAHRTIMALWKARSLSPEQKVQIVEEDS--E  840

Query  2408  ENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTS  2587
               ++  EE+GS+L +EDVSMS+VYS  LP+     ME+FNGG+L+ K M ++GCLNY  S
Sbjct  841   AKSLQTEESGSFLGLEDVSMSEVYSSALPVPTSFFMELFNGGELDRKAMERAGCLNYSCS  900

Query  2588  SWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDH  2767
              WE    DVYER++ Y+ ++ +S +  EVTSTQ+KS  ++  GW++ E+M +HGVP  D+
Sbjct  901   PWESERADVYERQIYYRFDKRVSRYRGEVTSTQQKSPLSDKNGWLIEEVMTLHGVPLGDY  960

Query  2768  YQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGR  2947
             + + LRY++E   +    C+  V+ G+ WLK+T+ + RI KNI+     R+K  +  + +
Sbjct  961   FNLHLRYQIEDLPSRSKGCQVRVFFGIAWLKSTRHQKRIAKNILLNLEDRLKVTLGVIEK  1020

Query  2948  E  2950
             E
Sbjct  1021  E  1021



>ref|XP_009118896.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170 [Brassica 
rapa]
Length=1020

 Score =   961 bits (2483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/905 (54%), Positives = 641/905 (71%), Gaps = 12/905 (1%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVD-AIKVSSPKKVLEGKQLIKSIAG  445
             GKILL++SL GK    S       +  V  E  K+V  + K    +K  +GK ++K++  
Sbjct  117   GKILLSMSLQGKSESTSDEKVLPDKQDVSLEDVKEVQGSAKEGKRRKHHDGKHIMKNLVN  176

Query  446   HLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQS---FCEAIKLL  616
              ++KLF K EE SK   +           S+ S+YED    +  S   +   F E + L+
Sbjct  177   QIDKLFHKKEEISKRLNDEPAG------DSVTSNYEDATDNSCSSAATTCTGFEEGLDLM  230

Query  617   QSRT-EGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEGPW  793
             QS   E  EMPENL GGIL+DQ Y + P D N  LF+P+SQFR+ELAELQ   DVQEGPW
Sbjct  231   QSSDGEIEEMPENLLGGILVDQKYLVSPSDLNKFLFSPNSQFRKELAELQSLTDVQEGPW  290

Query  794   TW-KSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGST  970
             T  + D    LTR+VTY + ATKLVK+ +ATE Q Y K  G +FAV V VSTPDVPYG+T
Sbjct  291   TMVQEDITPRLTRLVTYMRPATKLVKAGKATESQVYRKASGNQFAVFVSVSTPDVPYGNT  350

Query  971   FKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRF  1150
             FKVELLY + P     +  ES+ L+ISW ++F +ST+MK +IEGG +QGLK+SF +FS  
Sbjct  351   FKVELLYKVEPVTEPNAVGESSRLIISWGIQFSQSTIMKGMIEGGARQGLKESFEQFSDL  410

Query  1151  LAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHILLS  1330
             LA++ K +  A VLD   ++AT+ SE  +DL+ A  YF + +VV    L +Y  +H+L  
Sbjct  411   LAKNYKTLDPAVVLDKEQVIATVQSEPKTDLKSAFLYFWSSSVVCAVLLSVYVVVHMLHC  470

Query  1331  RSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHGD  1510
               +++QG+EF+GLDLPDS GE+ + GILVL LE+VY M  HF++ARL RG D G +A+G 
Sbjct  471   EPSKIQGVEFYGLDLPDSFGELFSSGILVLLLERVYMMTVHFIQARLHRGRDQGGKANGK  530

Query  1511  GWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEE  1690
             GW+LT+ALI+GTNLAS++ T   DP+VVFTCNGK+RTSSV+LQ  DPQWNE++EF+  EE
Sbjct  531   GWILTIALIKGTNLASVEATELFDPYVVFTCNGKTRTSSVKLQAQDPQWNEVIEFDAMEE  590

Query  1691  PPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRI  1870
             PPS+LDVEVFDFDGPFDQ  SLGHAEINFLK T+ ELADL +PL G  AQ+SQSKL LRI
Sbjct  591   PPSVLDVEVFDFDGPFDQGVSLGHAEINFLKLTADELADLCVPLVGHHAQASQSKLQLRI  650

Query  1871  FLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRK  2050
             FL N NGVET++D L+K+EKEVGKKLN+RSP +NS FQK FGLP EEFL+ +++C LKRK
Sbjct  651   FLENKNGVETMKDYLSKVEKEVGKKLNIRSPQKNSAFQKLFGLPHEEFLLKEYTCYLKRK  710

Query  2051  LPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDR  2230
             LP+QG++FLS RIV FY+N+FGHKTKF+FLWED+++I VLPP+ +++GSP L+IIL K+R
Sbjct  711   LPVQGKLFLSARIVAFYSNIFGHKTKFYFLWEDMDDIQVLPPTLASLGSPLLLIILKKNR  770

Query  2231  GTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKDE  2410
             G DA++GAKS DEEGRL F F SFVSF   SRTIMALWKTR    DQ+A IAEE+    +
Sbjct  771   GLDAKHGAKSQDEEGRLWFYFQSFVSFDATSRTIMALWKTRTLSVDQRAHIAEEESDVSD  830

Query  2411  NNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSS  2590
                LP +       + + MSKVY+ DLP + + +M++F GG++E K+M KSGCLNY +++
Sbjct  831   PFFLPGDVAVVSDADPLQMSKVYACDLPGDVELVMKIFGGGEMERKIMEKSGCLNYASTT  890

Query  2591  WELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHY  2770
             WE  +P +YERRVSYK N  +S+FG  VTS+Q+KS   ND GWILN+I+A+H VPF DH+
Sbjct  891   WESKKPGIYERRVSYKYNHTVSVFGGGVTSSQQKSTAPNDEGWILNDIVALHDVPFGDHF  950

Query  2771  QVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGRE  2950
             +V LRY+V+       + +C+VY+ + WLK  K E RI+K+I+ KF  R+K + +   +E
Sbjct  951   RVHLRYEVKKAGVDCKTSKCEVYLRIRWLKPIKFEQRISKSIMEKFRNRLKVIFDLFQKE  1010

Query  2951  VFLSS  2965
                +S
Sbjct  1011  SVANS  1015



>emb|CDX71607.1| BnaC09g26480D [Brassica napus]
Length=1023

 Score =   959 bits (2478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/905 (54%), Positives = 640/905 (71%), Gaps = 12/905 (1%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVD-AIKVSSPKKVLEGKQLIKSIAG  445
             GKILL++SL GK    S       +  V  E  K+V  + K    +K  +GK ++K++  
Sbjct  120   GKILLSMSLQGKSESTSDEKVLPYKQDVTLEAVKEVQGSAKEGKRRKHHDGKHIMKNLVN  179

Query  446   HLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQ---SFCEAIKLL  616
              ++KLF K EE SK   +           S+ S+YED   ++  S      SF E + L+
Sbjct  180   QIDKLFHKKEEISKRLNDEPAG------DSVTSNYEDATDKSCSSAATTCTSFEEGLDLM  233

Query  617   QSRT-EGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEGPW  793
             QS   E  EMPENL GGIL+DQ Y + P D N  LF+P+SQFR+ELAELQ   DVQEGPW
Sbjct  234   QSSDGEIEEMPENLVGGILVDQKYLVSPSDLNKFLFSPNSQFRKELAELQSLTDVQEGPW  293

Query  794   TW-KSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGST  970
             T  + D    LTR+VTY + ATKLVK+ +ATE Q Y K  G +FAV V VSTPDVPYG+T
Sbjct  294   TMIQEDITPRLTRLVTYMRPATKLVKAGKATESQVYRKASGNQFAVFVSVSTPDVPYGNT  353

Query  971   FKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRF  1150
             FKVELLY I P     +  ES+ L+ISW ++F +ST+MK +IEGG +QGLK+SF +FS  
Sbjct  354   FKVELLYKIEPVTEPNAVGESSRLIISWGIQFSQSTIMKGMIEGGARQGLKESFEQFSDL  413

Query  1151  LAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHILLS  1330
             LA++ K +  A VLD   ++AT+ SE  +DL+ A  YF + +VV    L +Y  +H+L  
Sbjct  414   LAKNYKTLDPAVVLDKEQVIATVQSEQKTDLKSAFLYFWSSSVVCAVLLSVYVVVHMLHC  473

Query  1331  RSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHGD  1510
               +++QG+EF+GLDLPDS GE+ + G LVL LE+VY M  HF++ARL RG D G +A+G 
Sbjct  474   EPSKIQGVEFYGLDLPDSFGELFSSGTLVLLLERVYMMTVHFIQARLHRGRDQGGKANGK  533

Query  1511  GWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEE  1690
             GW+LT+ALI+GTNLAS++ T   DP+VVFTCNGK+RTSSV+LQ  DPQWNE++EF+  EE
Sbjct  534   GWILTIALIKGTNLASVEATELFDPYVVFTCNGKTRTSSVKLQAQDPQWNEVIEFDAMEE  593

Query  1691  PPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRI  1870
             PPS+LDVEVFDFDGPFDQ  SLGHAEINFLK T+ ELADL +PL G  AQ+SQSKL LRI
Sbjct  594   PPSVLDVEVFDFDGPFDQGVSLGHAEINFLKLTADELADLCVPLVGHHAQASQSKLQLRI  653

Query  1871  FLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRK  2050
             FL N NGVET++D L+K+EKEVGKKLN+RSP +NS FQK FGLP EEFL+ +++C LKRK
Sbjct  654   FLENKNGVETMKDYLSKVEKEVGKKLNIRSPQKNSAFQKLFGLPHEEFLLKEYTCYLKRK  713

Query  2051  LPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDR  2230
             LP+QG++FLS RIV FY+N+FGHKTKF+FLWED+++I VLPP+ +++GSP L+IIL K+R
Sbjct  714   LPVQGKLFLSARIVAFYSNIFGHKTKFYFLWEDMDDIQVLPPTLASLGSPLLLIILKKNR  773

Query  2231  GTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKDE  2410
             G DA++GAKS DEEGRL F F SFVSF   SRTIMALWKTR    DQ+A IAEE+    +
Sbjct  774   GLDAKHGAKSQDEEGRLWFYFQSFVSFDATSRTIMALWKTRTLSVDQRAHIAEEESDVSD  833

Query  2411  NNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSS  2590
                LP +       + + MSKVY+ DLP + + +M++F GG++E K+M KSGCLNY +++
Sbjct  834   PFFLPGDVAVVSDADPLQMSKVYACDLPGDVELVMKIFGGGEMERKIMEKSGCLNYASTT  893

Query  2591  WELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHY  2770
             WE  +P +YERRVSYK N  +S+FG  VT +Q+KS   ND GWILN+I+A+H VPF D++
Sbjct  894   WESKKPGIYERRVSYKYNHTVSVFGGGVTCSQQKSTAPNDEGWILNDIVALHDVPFGDNF  953

Query  2771  QVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGRE  2950
             +V LRY+V+       + +C+VY+ + WLK  K E RI+K+I+ KF  R+K + +   +E
Sbjct  954   RVHLRYEVKKAGVDCKTSKCEVYLRIRWLKPIKFEQRISKSIMEKFRNRLKVIFDLFQKE  1013

Query  2951  VFLSS  2965
                +S
Sbjct  1014  SVANS  1018



>emb|CDY05797.1| BnaA10g06230D [Brassica napus]
Length=1020

 Score =   957 bits (2474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/905 (54%), Positives = 639/905 (71%), Gaps = 12/905 (1%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVD-AIKVSSPKKVLEGKQLIKSIAG  445
             GKILL++SL GK    S       +  V  E  K+V  + K    +K  +GK ++K++  
Sbjct  117   GKILLSMSLQGKSESTSDEKVLPDKQDVSLEDVKEVQGSAKEGKRRKHHDGKHIMKNLVN  176

Query  446   HLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQS---FCEAIKLL  616
              ++KLF K EE SK   +           S+ S+YED    +  S   +   F E + L+
Sbjct  177   QIDKLFHKKEEISKRLNDEPAG------DSVTSNYEDATDNSCSSAATTCTGFEEGLDLM  230

Query  617   QSRT-EGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEGPW  793
             QS   E  EMPENL GGIL+DQ Y + P D N  LF+P+SQFR+ELAELQ   DVQEGPW
Sbjct  231   QSSDGEIEEMPENLLGGILVDQKYLVSPSDLNKFLFSPNSQFRKELAELQSLTDVQEGPW  290

Query  794   TW-KSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGST  970
             T  + D    LTR+VTY + ATKLVK+ +ATE Q Y K  G +FAV V VSTPDVPYG+ 
Sbjct  291   TMVQEDITPRLTRLVTYMRSATKLVKAGKATESQVYRKASGNQFAVFVSVSTPDVPYGNN  350

Query  971   FKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRF  1150
             FKVELLY I P     +  ES+ L+ISW ++F +ST+MK +IEGG +QGLK+SF +FS  
Sbjct  351   FKVELLYKIEPVTEPNAVGESSRLIISWGIQFSQSTIMKGMIEGGARQGLKESFEQFSDL  410

Query  1151  LAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHILLS  1330
             LA++ K +  A VLD   ++AT+ SE  +DL+ A  YF + +VV    L +Y  +H+L  
Sbjct  411   LAKNYKTLDPAVVLDKEQVIATVQSEPKTDLKSAFLYFWSSSVVCAVLLSVYVVVHMLHC  470

Query  1331  RSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHGD  1510
               +++QG+EF+GLDLPDS GE+ + GILVL LE+VY M  HF++ARL RG D G +A+G 
Sbjct  471   EPSKIQGVEFYGLDLPDSFGELFSSGILVLLLERVYMMTVHFIQARLHRGRDQGGKANGK  530

Query  1511  GWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEE  1690
             GW+LT+ALI+GTNLAS++ T   DP+VVFTCNGK+RTSSV+LQ  DPQWNE++EF+  EE
Sbjct  531   GWILTIALIKGTNLASVEATELFDPYVVFTCNGKTRTSSVKLQAQDPQWNEVIEFDAMEE  590

Query  1691  PPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRI  1870
             PPS+LDVEVFDFDGPFDQ  SLGHAEINFLK T+ ELADL +PL G  AQ+SQSKL LRI
Sbjct  591   PPSVLDVEVFDFDGPFDQGVSLGHAEINFLKLTADELADLCVPLVGHHAQASQSKLQLRI  650

Query  1871  FLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRK  2050
             FL N NGVET++D L+K+EKEVGKKLN+RSP +NS FQK FGLP EEFL+ +++C LKRK
Sbjct  651   FLENKNGVETMKDYLSKVEKEVGKKLNIRSPQKNSAFQKLFGLPHEEFLLKEYTCYLKRK  710

Query  2051  LPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDR  2230
             LP+QG++FLS RIV FY+N+FGHKTKF+FLWED+++I VLPP+ +++GSP L+IIL K+R
Sbjct  711   LPVQGKLFLSARIVAFYSNIFGHKTKFYFLWEDMDDIQVLPPTLASLGSPLLLIILKKNR  770

Query  2231  GTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKDE  2410
             G DA++GAKS D EGRL F F SFVSF   SRTIMALWKTR    DQ+A IAEE+    +
Sbjct  771   GLDAKHGAKSQDVEGRLWFYFQSFVSFDATSRTIMALWKTRTLSVDQRAHIAEEESDVSD  830

Query  2411  NNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSS  2590
                LP +       + + MSKVY+ DLP + + +M++F GG++E K+M KSGCLNY +++
Sbjct  831   PFFLPGDVAVVSDADPLQMSKVYACDLPGDVELVMKIFGGGEMERKIMEKSGCLNYASTT  890

Query  2591  WELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHY  2770
             WE  +P +YERRVSYK N  +S+FG  VTS+Q+KS   ND GWILN+I+A+H VPF DH+
Sbjct  891   WESKKPGIYERRVSYKYNHTVSVFGGGVTSSQQKSTAPNDEGWILNDIVALHDVPFGDHF  950

Query  2771  QVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGRE  2950
             +V LRY+V+       + +C+VY+ + WLK  K E RI+K+I+ KF  R+K + +   +E
Sbjct  951   RVHLRYEVKKAGVDCKTSKCEVYLRIRWLKPIKFEQRISKSIMEKFRNRLKVIFDLFQKE  1010

Query  2951  VFLSS  2965
                +S
Sbjct  1011  SVANS  1015



>ref|XP_008803167.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Phoenix dactylifera]
Length=1031

 Score =   952 bits (2462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/827 (55%), Positives = 606/827 (73%), Gaps = 20/827 (2%)
 Frame = +2

Query  530   SSIPS----DYEDNVQETT------RSQTQSFC------EAIKLLQSRTEGREMPENLQG  661
             +++PS    D  +N+QE +       SQT   C      E +K ++S+ +  EMP NLQG
Sbjct  206   AALPSSRDLDCPENLQEASASPEISESQTDDACSNITFDELLKTMESKDQEVEMPRNLQG  265

Query  662   GILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTY  841
             GILLDQ+Y + P D N LLF+P S F + LAELQGT  +Q   W   +  +S L RV+TY
Sbjct  266   GILLDQSYVVAPGDLNSLLFSPSSNFLQSLAELQGTTGLQTESWRHANGGES-LKRVITY  324

Query  842   TKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRS  1021
             T+ ATKLVK+V+ATEEQTYLK DGK +AVL   STPD P+G+ F+VELL+ IMPGP   S
Sbjct  325   TRAATKLVKAVKATEEQTYLKADGKNYAVLASTSTPDAPFGNCFRVELLFCIMPGPDSPS  384

Query  1022  GEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNG  1201
               +S+ LVISW + F +STMMK++IE G +QGLKD +++F+  L+Q+ K +   ++  N 
Sbjct  385   ENQSSRLVISWGMNFLQSTMMKSMIENGVKQGLKDGYAQFADLLSQNVKPLDQKDMGSNK  444

Query  1202  -HLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLP  1378
               LLA++ +E  SD +LA   F N +++S+ F+  Y  IHILL+  +  QGLEF GLDLP
Sbjct  445   EQLLASIETEQESDWKLAFRLFGNLSIISSVFVAFYVLIHILLANPSITQGLEFPGLDLP  504

Query  1379  DSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLAS  1558
             DS+GE++ CG+LVL  ++V  MI  F++AR +RGSDHGV+A GDGW+LT+ALIEG+NLA+
Sbjct  505   DSIGEVVVCGVLVLQGQRVLNMIGRFLQARNQRGSDHGVKAQGDGWLLTIALIEGSNLAA  564

Query  1559  LDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPF  1738
             +D TG+ DP+VVFTCNGK++TSS++ QTL+PQWNEI EF+  ++PPSM+DV+V+DFDGPF
Sbjct  565   VDSTGYSDPYVVFTCNGKTKTSSIKFQTLEPQWNEIFEFDAMDDPPSMMDVDVYDFDGPF  624

Query  1739  DQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLT  1918
             D+A SLGH EINF+K   +ELAD+W+PL GK+AQ+ QSKLHLRIFLNN  G E +R+ LT
Sbjct  625   DEATSLGHIEINFVKSNLSELADIWIPLQGKLAQACQSKLHLRIFLNNTRGTEVVREYLT  684

Query  1919  KMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGF  2098
             KMEKEVGKK+NLRSP  NS FQK FGLPPEEFLINDF+C LKRK+P+QGR+FLS RI+GF
Sbjct  685   KMEKEVGKKINLRSPQTNSAFQKLFGLPPEEFLINDFTCHLKRKMPMQGRLFLSPRIIGF  744

Query  2099  YANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGR  2278
             YANLFGHKTKFFFLWEDIE+I V+PP+ ++M SPSL+IIL + RG DA++GA+++D++GR
Sbjct  745   YANLFGHKTKFFFLWEDIEDIQVIPPTLASMASPSLLIILRRGRGMDAKHGARTVDQDGR  804

Query  2279  LHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKDENNVLPEETGSYLIVED  2458
             L F F SFV+F  A+RTIMALWK R+   +QK QI EE+   +   +  EE+GS+L +ED
Sbjct  805   LRFHFQSFVTFNVANRTIMALWKARSLSTEQKMQIVEEE--SEAKALDSEESGSFLGIED  862

Query  2459  VSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYK  2638
              +MS+V+S  +P+   SLME+F G  LE +VM K GC+NY  ++WE ++PDVY+R+V YK
Sbjct  863   ANMSEVFSSAIPVAMNSLMEIFEGTSLERRVMEKVGCVNYCITAWEAVKPDVYQRQVHYK  922

Query  2639  LNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARN  2818
               + +S +G EVTSTQ+KS   +  G+I+ E+M + GV   D Y + LRY++E       
Sbjct  923   FAKSLSRYGGEVTSTQQKSPLPDRNGYIVEEVMTLQGVLLGDCYNLHLRYQIEDLGPKLT  982

Query  2819  SCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGREVFL  2959
             +C   VY+G+ WLK+TK + RITKN++   S R KEM   V  E  +
Sbjct  983   ACNVQVYLGIAWLKSTKNQKRITKNVISNSSARFKEMFSQVENEFMM  1029



>ref|XP_010942889.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Elaeis guineensis]
Length=1031

 Score =   948 bits (2450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/805 (55%), Positives = 603/805 (75%), Gaps = 12/805 (1%)
 Frame = +2

Query  566   ETTRSQTQSFC------EAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAP  727
             ET+ SQT   C      E +K ++S+ +G EMP+NLQGGILLDQ+Y + P D N L+F+P
Sbjct  228   ETSESQTDDACSNITFDELLKTIESKDQGCEMPQNLQGGILLDQSYVVAPGDLNSLIFSP  287

Query  728   DSQFRRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKG  907
              S F + LAELQG+  +Q  PW  ++  +S L RV+TYT+ ATKLVK+V+ATEEQ YLK 
Sbjct  288   SSNFLQSLAELQGSTGLQTEPWRLENGGES-LKRVITYTRAATKLVKAVKATEEQVYLKA  346

Query  908   DGKEFAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMK  1087
             DGK +AVL   STPD P+G+ F+VE+L+ IMPGP L S ++S+ LV+SW + F +STMMK
Sbjct  347   DGKNYAVLASASTPDAPFGNCFRVEVLFCIMPGPDLPSEDQSSRLVVSWGMNFLQSTMMK  406

Query  1088  TVIEGGTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYF  1264
              +IE G +QGLKDS+++F+  ++Q+ K +   +   N   +LA++  E  SD +LA  +F
Sbjct  407   GMIENGAKQGLKDSYAQFADLISQNVKPLDQKDTGSNKEQILASIQIEQESDWKLAFRFF  466

Query  1265  CNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRM  1444
              NF+V+S+ F+  Y  IHILL+    +QGLEF GLDLPDS+GE++ CG+LVL  ++V  M
Sbjct  467   GNFSVISSVFVAFYVLIHILLANPGTIQGLEFPGLDLPDSIGEVVVCGVLVLQGQRVLNM  526

Query  1445  IAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTS  1624
             I  F++AR +RGSDHG++A GDGW+LT+ALIEG+NLA++D +G+ DP+VVFTCNGK++TS
Sbjct  527   IGRFLQARNQRGSDHGLKAQGDGWLLTIALIEGSNLAAVDSSGYSDPYVVFTCNGKNKTS  586

Query  1625  SVQLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELA  1804
             S++ QTL+PQWNEI EF+  ++PPSM+DV+V+DFDGPFD+A SLGHAEINF+K   +ELA
Sbjct  587   SIKFQTLEPQWNEIFEFDAMDDPPSMMDVDVYDFDGPFDEATSLGHAEINFVKSNLSELA  646

Query  1805  DLWLPLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQ  1984
             D+W+PL GK+AQ+ QSKLHLRIFLNN  G E + + L KMEKEVGKK+NLRSP  NS FQ
Sbjct  647   DVWIPLQGKLAQACQSKLHLRIFLNNTRGTEVVTEYLRKMEKEVGKKINLRSPQTNSAFQ  706

Query  1985  KTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEIN  2164
             K F LPPEEFLINDF+C LKRK+P+QGR+FLS RI+GFYANLFGHKTKFFFLWEDI++I 
Sbjct  707   KLFDLPPEEFLINDFTCHLKRKMPMQGRLFLSPRIIGFYANLFGHKTKFFFLWEDIDDIQ  766

Query  2165  VLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALW  2344
             V+PP+ ++M +PSL+IIL + RG DA++GAK++D++GRL F F SF SF  A+RTIMALW
Sbjct  767   VIPPTLASMATPSLLIILRRGRGMDAKHGAKTVDQDGRLRFHFQSFGSFNVANRTIMALW  826

Query  2345  KTRACIPDQKAQIAEEQQYKDENNVL-PEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEM  2521
             K R+   +QK QIAEE+    E  +L  +E+GS+L +ED +MS+V+S  +P+   SLM++
Sbjct  827   KARSLSTEQKMQIAEEES---EAKILNSDESGSFLGIEDANMSEVFSSAIPVPMNSLMKV  883

Query  2522  FNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVH  2701
             F G  LE  VM K GC++Y  ++WE ++PDVY+R+V YK  + +S +G EVTSTQ+KS+ 
Sbjct  884   FEGTSLEQSVMDKVGCVDYNITAWESVKPDVYQRQVHYKFAKSVSRYGGEVTSTQQKSLL  943

Query  2702  ANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDR  2881
              +  G+I+ E+M + G+P  D++ + LRY++E       +C   V +G+ WLK+TK + R
Sbjct  944   PDRNGYIVEEVMTLEGLPLGDYFNLHLRYQIEDLGPKLRACNVQVSLGIAWLKSTKNQKR  1003

Query  2882  ITKNIVRKFSQRVKEMIEFVGREVF  2956
             ITKN++   S R+KEM   V  EV 
Sbjct  1004  ITKNVISSSSARLKEMFSQVENEVM  1028



>gb|KHG17835.1| hypothetical protein F383_00553 [Gossypium arboreum]
Length=1023

 Score =   946 bits (2445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/791 (57%), Positives = 594/791 (75%), Gaps = 4/791 (1%)
 Frame = +2

Query  581   QTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAEL  760
             Q+ SF EA++ L SR +G E+P NL GG+LLDQ Y + PK+ N LLF+PDS F R LAE+
Sbjct  232   QSSSFEEAMEALCSRDQGSEIPSNLPGGVLLDQLYVIAPKELNSLLFSPDSSFPRSLAEV  291

Query  761   QGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDV  940
             QG+ D+Q GPW +++  +S L R+ +Y +  TKL+K+V+ATEEQTY+K DGK FAVL  V
Sbjct  292   QGSTDLQIGPWKFENGGES-LKRIYSYIRAPTKLIKAVKATEEQTYIKADGKTFAVLASV  350

Query  941   STPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGL  1120
             STPDV YGSTFKVE+LY I PGP L SGEES+HLVISW + F +STMMK++IE G +QGL
Sbjct  351   STPDVMYGSTFKVEVLYCISPGPELPSGEESSHLVISWRMNFLQSTMMKSMIENGARQGL  410

Query  1121  KDSFSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFL  1297
             K+SF +F+  L Q  K + S ++ L    +L +L +E  SD +LA +YF NFT+VST F+
Sbjct  411   KESFEQFTTLLEQTIKPVDSKDIGLSKEQILGSLQAEPESDWKLAVQYFANFTMVSTVFM  470

Query  1298  VLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRR  1477
              LY  +HI L+  + +QGLEF GLDLPDS+GE I CGILVL  E+V ++I+ F+ AR+++
Sbjct  471   SLYVIVHICLAAPSTIQGLEFLGLDLPDSIGEFIVCGILVLQGERVLQLISRFMHARVQK  530

Query  1478  GSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQW  1657
             GSDHGV+A GDGW+LTVALIEG+NLA++D +G+ DP+VVFTCNGK+RTSS++ Q   PQW
Sbjct  531   GSDHGVKAQGDGWLLTVALIEGSNLAAVDSSGYCDPYVVFTCNGKTRTSSIKYQKSAPQW  590

Query  1658  NEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIA  1837
             NEI EF+  +EPPS+LD+EVFDFDGPFD+A SLGHAE+NF++   ++LAD+W+PL GK+A
Sbjct  591   NEIFEFDAMKEPPSVLDLEVFDFDGPFDEATSLGHAEVNFVRSNISDLADVWVPLHGKLA  650

Query  1838  QSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFL  2017
             Q+ QSKLHLRIF+ N  G   + + L KMEKEVGKK+N+RSP  NS FQK FGLPPEEFL
Sbjct  651   QACQSKLHLRIFVENTRGGNVVTEYLRKMEKEVGKKINVRSPQTNSAFQKLFGLPPEEFL  710

Query  2018  INDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGS  2197
             INDF+C LKRK+PLQGR+FLS RI+GF+ANLFGHKTKFFFLWEDIE+I VLPP+ ++MGS
Sbjct  711   INDFTCHLKRKMPLQGRLFLSPRIIGFHANLFGHKTKFFFLWEDIEDIQVLPPTLASMGS  770

Query  2198  PSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKA  2377
             P +V+ L   RG DAR+GAK+ DEEGRL F + SFVSF  A RTIMALWK RA  P+QK 
Sbjct  771   PVIVVTLRPGRGMDARHGAKTRDEEGRLKFHYQSFVSFNVAYRTIMALWKARALSPEQKV  830

Query  2378  QIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMS  2557
             QI EE+   +  ++  + +GS+L +EDVSMS+VYS  LP+     ME+F+GG+LE+K M 
Sbjct  831   QIVEEES--EAKSLQSDGSGSFLGLEDVSMSEVYSCALPVPTGFCMELFSGGELEYKAMK  888

Query  2558  KSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIM  2737
             K+G L+Y  + WE  + D YER++ YK ++ +S +  E+TSTQ+KS   N  GW + E+M
Sbjct  889   KAGGLDYSCTPWESEKDDAYERQICYKFDKRVSRYRGEMTSTQQKSQLPNKNGWHIEEVM  948

Query  2738  AIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQR  2917
              + GVP  D++ + LRY++E   +    C+  V+ G+ WLK+T  + RITKNI+    QR
Sbjct  949   TLQGVPLGDYFNIHLRYQIEDLHSKAEGCQVRVFFGIAWLKSTWHQKRITKNIISNLQQR  1008

Query  2918  VKEMIEFVGRE  2950
             +K +   V +E
Sbjct  1009  LKVIFGVVEKE  1019



>gb|EMT06922.1| hypothetical protein F775_17226 [Aegilops tauschii]
Length=911

 Score =   946 bits (2445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/902 (52%), Positives = 628/902 (70%), Gaps = 15/902 (2%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDV-----DAIKVSSPKKVLEGKQLIK  433
             GKILLT SL+G+  D +  H+    P   S +  DV     D  + S    V+       
Sbjct  9     GKILLTFSLYGENSDNTVIHS---SPCPSSRSGTDVEIERSDCREHSGANGVVLDSARSS  65

Query  434   SIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCEAIKL  613
             ++        D++ ++                ++      D+  E + S   SF EA++ 
Sbjct  66    AVENTSADYSDRSIQADSETVSEDDGLVEPSAAATTKSAHDSDAEPSVSDA-SFEEAMET  124

Query  614   LQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEGPW  793
             +++ +   +MP++L GG++ + TY +  KD N LLF PDSQF R+L ELQGT D  E PW
Sbjct  125   MKAASSTPDMPDDLGGGVMFEHTYLVEAKDLNSLLFGPDSQFSRDLRELQGTTDYDEQPW  184

Query  794   TWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGSTF  973
             TWKS +   LTR   YTKGA+KL+K V+  EEQTYLK DGK FA++  V TP+VP+G+ F
Sbjct  185   TWKSQDPPSLTRTCRYTKGASKLMKDVKTIEEQTYLKADGKNFAIMTRVRTPEVPFGNCF  244

Query  974   KVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRFL  1153
             +V LLY I   P    GEES+HL +S+ V+F +ST+MK++IEG  + GLK++F  F+  L
Sbjct  245   EVVLLYKITHSPESSPGEESSHLTVSYNVEFLQSTLMKSMIEGSVRDGLKENFESFAEIL  304

Query  1154  AQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHILLSR  1333
             +QH K+  +A  +D   LLA L ++  S + LA +YFCNFTV+ST  + +Y  +HILLSR
Sbjct  305   SQHVKLADAAG-MDKEQLLAPLQTDRQSHIRLAYKYFCNFTVISTVIMAVYVLVHILLSR  363

Query  1334  STQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHGDG  1513
                L GLEF GLDLPD+ GE+IT GILVL +E+   M+ HFV+AR++RG DHGV+A+GDG
Sbjct  364   PGPLMGLEFSGLDLPDTFGELITSGILVLQMERFLNMVYHFVQARIQRGGDHGVKANGDG  423

Query  1514  WVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEEP  1693
             W+LTVAL+E T+L  +   G  DP+VVF+CNG +RTSSVQLQT +PQWNEI+EF+  EEP
Sbjct  424   WLLTVALLEATSLPPVS-CGSVDPYVVFSCNGVTRTSSVQLQTQEPQWNEIMEFDAMEEP  482

Query  1694  PSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRIF  1873
             P+MLDVEVF+FDGPFD A SLGHAEINFLKHT  ELAD+W+PL GK+AQ+ QS+LHLRIF
Sbjct  483   PAMLDVEVFNFDGPFDLAISLGHAEINFLKHTPTELADIWVPLEGKLAQTCQSRLHLRIF  542

Query  1874  LNNNNGVET-IRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRK  2050
             L N  G ET +RD L KMEKEVGKKL++RSPHRNSTFQK F LP EEFLI D++CSLKRK
Sbjct  543   LENTKGPETSMRDYLNKMEKEVGKKLHVRSPHRNSTFQKLFALPHEEFLIADYACSLKRK  602

Query  2051  LPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDR  2230
             LPLQGR+FLSTRIVGFYANLFGHKTKFFFLW+D+EE+ VLPPSF+T+G+PSLV +L   R
Sbjct  603   LPLQGRLFLSTRIVGFYANLFGHKTKFFFLWDDVEEVEVLPPSFTTVGTPSLVFMLKSGR  662

Query  2231  GTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKDE  2410
             G DA+NGAKS D+EGRL F FHSF SF  ASRTI+ LWKT++   +Q+A++  E+ + DE
Sbjct  663   GLDAKNGAKSQDKEGRLKFQFHSFASFNKASRTIIGLWKTKSSAIEQRAKL--EEDHGDE  720

Query  2411  NNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSS  2590
             +    ++  S L + DV++SK Y+V+ P++   LM +F+GG LE + MS+ GCL+Y  + 
Sbjct  721   SYDDLDDVQSMLSIGDVTLSKEYTVEHPIDADLLMGVFDGGPLETRTMSRVGCLDYTATP  780

Query  2591  WELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHY  2770
             WE  +P V ER  SYK NR +SIFG EV STQ KS   +  GW + ++M +  VPF D++
Sbjct  781   WEETKPGVLERHASYKFNRYMSIFGGEVVSTQLKSPSEDGDGWTVYDVMTLRNVPFGDYF  840

Query  2771  QVQLRYKVESCSAAR-NSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGR  2947
             +V LRY V S +++   SCRC+V VG+ WLK++K + RI +NI  K + R KE++E  G+
Sbjct  841   RVHLRYDVRSVASSEPPSCRCEVLVGIEWLKSSKFQKRIARNICDKLAHRAKEVLEVAGK  900

Query  2948  EV  2953
             E+
Sbjct  901   EI  902



>ref|XP_008800282.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Phoenix dactylifera]
Length=1030

 Score =   945 bits (2443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/805 (56%), Positives = 606/805 (75%), Gaps = 17/805 (2%)
 Frame = +2

Query  566   ETTRSQTQSFC------EAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAP  727
             ET+  QT   C      E +K ++S+ +G EMP NL+GG+LLDQ+Y + P+D N LL +P
Sbjct  228   ETSERQTNDTCSNITFDELLKTIESKDQGSEMPGNLRGGVLLDQSYVVAPRDLNSLLLSP  287

Query  728   DSQFRRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKG  907
              S F + LAELQGT  +Q  PW  ++  +S L RV+TYTK ATKLVK+V+ATEEQTYLK 
Sbjct  288   SSNFLQSLAELQGTTSLQTEPWRLENGGES-LKRVITYTKAATKLVKAVKATEEQTYLKA  346

Query  908   DGKEFAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMK  1087
             DGK +AVL +VSTPDVP+G+ F+ E+L+ IMPGP L S ++S+ L+ISW + F +ST+MK
Sbjct  347   DGKNYAVLTNVSTPDVPFGNCFRTEVLFCIMPGPDLPSEDQSSRLLISWRMNFLQSTIMK  406

Query  1088  TVIEGGTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNGH----LLATLPSEHPSDLELAR  1255
              +IE G +QGLKDSF++F+  L+Q+ K +      D GH    +LA+L +E  SD +LA 
Sbjct  407   GMIENGAKQGLKDSFAQFADLLSQNIKPLDQE---DTGHNKDQILASLQNEQESDWKLAF  463

Query  1256  EYFCNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQV  1435
              +F NFTV+S+ F+  Y  +HILL+  + +QGLEF GLDLPDS+GE++ CG+LVL  ++V
Sbjct  464   RFFGNFTVISSVFVAFYVLVHILLASPSIVQGLEFRGLDLPDSIGEVVVCGVLVLQGQRV  523

Query  1436  YRMIAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKS  1615
               MI  F++AR RRGSDHGV+A GDGW+LT+ALIEG+NLA++D TG+ DP+VVFTCNGK+
Sbjct  524   LDMIGRFLQARKRRGSDHGVKAQGDGWLLTIALIEGSNLAAVDSTGYSDPYVVFTCNGKT  583

Query  1616  RTSSVQLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSA  1795
             +TSS++ QTL+PQWNEI EF+   +PPSM+DV+V+DFDGPFD+A SLGHAE+NF+K   +
Sbjct  584   KTSSIKFQTLEPQWNEIFEFDAMHDPPSMMDVDVYDFDGPFDEATSLGHAEVNFVKSNLS  643

Query  1796  ELADLWLPLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNS  1975
             ELAD W+PL GK+AQ+ QSKLHLRIFLNN  G + + + LTKMEKEVGKK+NLRSP  N 
Sbjct  644   ELADFWIPLQGKLAQACQSKLHLRIFLNNTRGTDIVTEYLTKMEKEVGKKINLRSPQTNF  703

Query  1976  TFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIE  2155
              FQK FGLPPEEFLINDF+C LKRK+P+QGR+FLS RI+GFYANLFGHKTKFFFLWEDIE
Sbjct  704   AFQKLFGLPPEEFLINDFTCHLKRKMPMQGRLFLSPRIIGFYANLFGHKTKFFFLWEDIE  763

Query  2156  EINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIM  2335
             +I V+PP+ ++M SPSL+IIL + +G DA++GAK++D++GRL F F SFVSF  A+RTIM
Sbjct  764   DIQVIPPTLASMASPSLLIILRRGKGMDAKHGAKTVDQDGRLRFHFQSFVSFNVANRTIM  823

Query  2336  ALWKTRACIPDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLM  2515
             ALWK R+  P+Q  Q+ EE+    E  +  EE+GS+L +ED +MS+V+S  + ++  SLM
Sbjct  824   ALWKARSLSPEQIVQMVEEES---EATLHSEESGSFLGIEDANMSEVFSSTISIDMNSLM  880

Query  2516  EMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKS  2695
             E+F G  LE +VM K GC+NY  S+WE ++PD+Y+R+V YK ++ +S +G EVTSTQ+K 
Sbjct  881   EVFEGTSLERRVMEKVGCVNYSISAWEPVKPDIYQRQVHYKFDKSLSRYGGEVTSTQQKC  940

Query  2696  VHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLE  2875
               A+  GWI+ E+M + GV   D++ + LRY++E  +    +C   V +G+ WLK+TK +
Sbjct  941   PLADKNGWIIEEVMTLQGVLLGDYFNLHLRYQMEDLAPKLKACNVQVSLGIAWLKSTKHQ  1000

Query  2876  DRITKNIVRKFSQRVKEMIEFVGRE  2950
              RITKN++   S R+KEM   V +E
Sbjct  1001  KRITKNVMSNSSARLKEMFSQVEKE  1025



>gb|KHG17834.1| hypothetical protein F383_00553 [Gossypium arboreum]
Length=1016

 Score =   944 bits (2441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/782 (57%), Positives = 590/782 (75%), Gaps = 4/782 (1%)
 Frame = +2

Query  581   QTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAEL  760
             Q+ SF EA++ L SR +G E+P NL GG+LLDQ Y + PK+ N LLF+PDS F R LAE+
Sbjct  232   QSSSFEEAMEALCSRDQGSEIPSNLPGGVLLDQLYVIAPKELNSLLFSPDSSFPRSLAEV  291

Query  761   QGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDV  940
             QG+ D+Q GPW +++  +S L R+ +Y +  TKL+K+V+ATEEQTY+K DGK FAVL  V
Sbjct  292   QGSTDLQIGPWKFENGGES-LKRIYSYIRAPTKLIKAVKATEEQTYIKADGKTFAVLASV  350

Query  941   STPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGL  1120
             STPDV YGSTFKVE+LY I PGP L SGEES+HLVISW + F +STMMK++IE G +QGL
Sbjct  351   STPDVMYGSTFKVEVLYCISPGPELPSGEESSHLVISWRMNFLQSTMMKSMIENGARQGL  410

Query  1121  KDSFSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFL  1297
             K+SF +F+  L Q  K + S ++ L    +L +L +E  SD +LA +YF NFT+VST F+
Sbjct  411   KESFEQFTTLLEQTIKPVDSKDIGLSKEQILGSLQAEPESDWKLAVQYFANFTMVSTVFM  470

Query  1298  VLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRR  1477
              LY  +HI L+  + +QGLEF GLDLPDS+GE I CGILVL  E+V ++I+ F+ AR+++
Sbjct  471   SLYVIVHICLAAPSTIQGLEFLGLDLPDSIGEFIVCGILVLQGERVLQLISRFMHARVQK  530

Query  1478  GSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQW  1657
             GSDHGV+A GDGW+LTVALIEG+NLA++D +G+ DP+VVFTCNGK+RTSS++ Q   PQW
Sbjct  531   GSDHGVKAQGDGWLLTVALIEGSNLAAVDSSGYCDPYVVFTCNGKTRTSSIKYQKSAPQW  590

Query  1658  NEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIA  1837
             NEI EF+  +EPPS+LD+EVFDFDGPFD+A SLGHAE+NF++   ++LAD+W+PL GK+A
Sbjct  591   NEIFEFDAMKEPPSVLDLEVFDFDGPFDEATSLGHAEVNFVRSNISDLADVWVPLHGKLA  650

Query  1838  QSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFL  2017
             Q+ QSKLHLRIF+ N  G   + + L KMEKEVGKK+N+RSP  NS FQK FGLPPEEFL
Sbjct  651   QACQSKLHLRIFVENTRGGNVVTEYLRKMEKEVGKKINVRSPQTNSAFQKLFGLPPEEFL  710

Query  2018  INDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGS  2197
             INDF+C LKRK+PLQGR+FLS RI+GF+ANLFGHKTKFFFLWEDIE+I VLPP+ ++MGS
Sbjct  711   INDFTCHLKRKMPLQGRLFLSPRIIGFHANLFGHKTKFFFLWEDIEDIQVLPPTLASMGS  770

Query  2198  PSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKA  2377
             P +V+ L   RG DAR+GAK+ DEEGRL F + SFVSF  A RTIMALWK RA  P+QK 
Sbjct  771   PVIVVTLRPGRGMDARHGAKTRDEEGRLKFHYQSFVSFNVAYRTIMALWKARALSPEQKV  830

Query  2378  QIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMS  2557
             QI EE+   +  ++  + +GS+L +EDVSMS+VYS  LP+     ME+F+GG+LE+K M 
Sbjct  831   QIVEEE--SEAKSLQSDGSGSFLGLEDVSMSEVYSCALPVPTGFCMELFSGGELEYKAMK  888

Query  2558  KSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIM  2737
             K+G L+Y  + WE  + D YER++ YK ++ +S +  E+TSTQ+KS   N  GW + E+M
Sbjct  889   KAGGLDYSCTPWESEKDDAYERQICYKFDKRVSRYRGEMTSTQQKSQLPNKNGWHIEEVM  948

Query  2738  AIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQR  2917
              + GVP  D++ + LRY++E   +    C+  V+ G+ WLK+T  + RITKNI+    QR
Sbjct  949   TLQGVPLGDYFNIHLRYQIEDLHSKAEGCQVRVFFGIAWLKSTWHQKRITKNIISNLQQR  1008

Query  2918  VK  2923
             +K
Sbjct  1009  LK  1010



>ref|XP_003581354.2| PREDICTED: C2 and GRAM domain-containing protein At5g50170-like 
[Brachypodium distachyon]
Length=920

 Score =   944 bits (2441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/917 (52%), Positives = 641/917 (70%), Gaps = 39/917 (4%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETS-----------KDVDAIKVSSPKKV--  409
             GKILLT+SL+G+ +D +  H+    PS  S+T             D++   V SP+    
Sbjct  22    GKILLTVSLYGENNDNALIHSSPC-PSSRSDTDVEFERSTCREHSDLNGGAVDSPRNSAV  80

Query  410   ----LEGKQLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTR  577
                 L+G    +SI  H   + + ++    S              ++ SD E  + +   
Sbjct  81    ERVSLDGSD--RSIKAHSNSISEDDDTIESSPSTSKM--------ALDSDTEPPIPDA--  128

Query  578   SQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAE  757
                 SF EA++ ++S+    ++PE+L GG + + TY +  KD N LLF PDSQF R+L +
Sbjct  129   ----SFEEAMETMKSKGSTADIPEDLAGGKIFEHTYLVESKDLNSLLFGPDSQFSRDLRD  184

Query  758   LQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVD  937
             LQGT D  E PWTWKS +   LTR   YTKG+TKL+K V+  EEQTYLK DGK F ++  
Sbjct  185   LQGTMDYDEQPWTWKSQDPPSLTRTCRYTKGSTKLMKDVKTIEEQTYLKADGKNFVIMTR  244

Query  938   VSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQG  1117
             V TP+VP+G+ F+V LLY I   P L SGEE +HL +S+ V+F +ST+MK++IEG  + G
Sbjct  245   VRTPEVPFGNCFEVVLLYKITHCPELSSGEECSHLTVSYNVEFLQSTLMKSMIEGSVRDG  304

Query  1118  LKDSFSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFL  1297
             +K++F  F+  L++H K+  SA  +D   LLA L ++H S + LA +YFCNFTV+ST  +
Sbjct  305   VKENFESFTEILSRHVKLADSAG-MDKEQLLAPLQTDHQSHIRLACKYFCNFTVMSTVIM  363

Query  1298  VLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRR  1477
              +Y  +HILLS+   L GLEF GLDLPD+ GE+IT GILVL +E++  MI+ FVEAR++R
Sbjct  364   AMYVLVHILLSKPGPLMGLEFTGLDLPDTFGELITSGILVLQMERLLNMISRFVEARIQR  423

Query  1478  GSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQW  1657
             G DHGV+A GDGW+LTVAL+E T+L  +   G  DP+VVF+CNG +RTSSVQLQT +PQW
Sbjct  424   GGDHGVKATGDGWLLTVALLEATSLPPVS-CGSVDPYVVFSCNGITRTSSVQLQTQEPQW  482

Query  1658  NEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIA  1837
             NEI+EF+  EEPP+ LDVEVF+FDGPFD A SLGHAEINFLKHTSAELAD+W+PL GK+A
Sbjct  483   NEIMEFDAMEEPPATLDVEVFNFDGPFDLAISLGHAEINFLKHTSAELADIWVPLVGKLA  542

Query  1838  QSSQSKLHLRIFLNNNNGVETI-RDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEF  2014
             Q+ QS+LHLRIFL N  G ET  R+ L+KMEKEVGKKL++RSPHRNSTFQK F LP EEF
Sbjct  543   QTCQSRLHLRIFLENTKGPETSKREYLSKMEKEVGKKLHVRSPHRNSTFQKLFSLPHEEF  602

Query  2015  LINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMG  2194
             LI D++CSLKRKLPLQGR+FLS R+VGFYANLFGHKTKFFFLWED+EE+ VLPPSF+T+G
Sbjct  603   LIADYACSLKRKLPLQGRLFLSARLVGFYANLFGHKTKFFFLWEDVEEVEVLPPSFTTVG  662

Query  2195  SPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQK  2374
             +PSLV  L   RG DA++GAKS D+EGRL F FHSF SF  A+RTI+ LWKT++   +Q+
Sbjct  663   TPSLVFTLKSGRGLDAKSGAKSQDKEGRLKFQFHSFASFSKANRTIIGLWKTKSSAIEQR  722

Query  2375  AQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVM  2554
             A++ E+++  DE+    ++  + L   DVS+SK Y+V+ P++   LM +F+GG LE + M
Sbjct  723   AKLEEDRE--DESYDELDDVQTVLSTGDVSLSKEYTVEHPIDANLLMGVFDGGPLETRTM  780

Query  2555  SKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEI  2734
             SK GCL+Y  + WE  +P V ER  SYK NR +SIFG EV STQ KS   + AGW+++++
Sbjct  781   SKVGCLDYTATPWEQTKPGVLERHASYKFNRYMSIFGGEVVSTQLKSPSEDGAGWMVHDV  840

Query  2735  MAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQ  2914
             M +H VPF D+++V LRY + S ++   S RC+VYVG+ WLK++K + RI +NI  K + 
Sbjct  841   MTLHNVPFGDYFRVHLRYDIRSVASEPASSRCEVYVGIEWLKSSKFQKRIARNICDKLAN  900

Query  2915  RVKEMIEFVGREVFLSS  2965
             R KE++E  G+E+  S+
Sbjct  901   RAKEVLEVAGKEITTSA  917



>ref|XP_010928062.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
isoform X1 [Elaeis guineensis]
Length=1036

 Score =   944 bits (2439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/788 (55%), Positives = 596/788 (76%), Gaps = 5/788 (1%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             SF E +K ++++ +G EMP +LQGG+LLDQ+Y + P D N L+F+P S F + LAELQGT
Sbjct  242   SFDELLKTMEAKDQGGEMPGSLQGGVLLDQSYVVAPGDLNFLIFSPSSNFLQSLAELQGT  301

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
              ++Q   W  ++  +S L RV+TYTK ATKLVK+V+ATEEQTYLK DGK +AVL  V TP
Sbjct  302   TNLQTESWRLENGGES-LKRVITYTKAATKLVKAVKATEEQTYLKADGKNYAVLASVGTP  360

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             DVP+G+ F+ E+L+ IMPGP L S ++S+ L+ISW + F +STMMK +IE G +QGLKDS
Sbjct  361   DVPFGNCFRTEVLFCIMPGPDLPSEDQSSRLLISWRMNFLQSTMMKGMIENGAKQGLKDS  420

Query  1130  FSEFSRFLAQHCKVITSAEVLDN-GHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLY  1306
             F++F+  L+Q+   +   +   N   +LA+L +E  S  +LA  +F NFT +S+  +  Y
Sbjct  421   FAQFADLLSQNINPLDQKDTGSNKDQILASLQNEQESGWKLAFRFFGNFTAISSVCVAFY  480

Query  1307  FSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSD  1486
               IHILL++ + +QGLEF GLDLPDS+GE++ CG+LVL  ++V  MI  F++AR +RGSD
Sbjct  481   VLIHILLAKPSIVQGLEFPGLDLPDSIGELVVCGVLVLQGQRVLDMIGRFLQARKQRGSD  540

Query  1487  HGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEI  1666
             HGV+A GDGW+LT+ALIEG NLA++D TG+ DP+VVFTCNGK++TSS++ QTL+PQWNEI
Sbjct  541   HGVKAQGDGWLLTIALIEGNNLAAVDSTGYSDPYVVFTCNGKTKTSSIKFQTLEPQWNEI  600

Query  1667  LEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSS  1846
              EF+  ++PPSM+DV+V+DFDGPFD+A SLGHAE+NF+K   +ELAD+W+PL GK+AQ+ 
Sbjct  601   FEFDAMDDPPSMMDVDVYDFDGPFDEATSLGHAEVNFVKSNLSELADVWIPLQGKLAQAC  660

Query  1847  QSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
             QSKLHLR+FLNN  G + + + LTKMEKEVGKK+NLRSP  N  FQK FGLPPEEFLIND
Sbjct  661   QSKLHLRVFLNNTRGTDIVTEYLTKMEKEVGKKINLRSPQTNCAFQKLFGLPPEEFLIND  720

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             FSC LKRK+P+QGR+FLS RI+GFYANLFGHKTKFFFLWEDIE+I V+PP+ ++M SPSL
Sbjct  721   FSCHLKRKMPMQGRLFLSPRIIGFYANLFGHKTKFFFLWEDIEDIQVIPPTLASMASPSL  780

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIA  2386
             +IIL K +G DA++GAK++D++GRL F F SFVSF  A+RTIMALWK R+  P+QK QI 
Sbjct  781   LIILRKGKGMDAKHGAKTVDQDGRLKFHFQSFVSFNVANRTIMALWKARSLSPEQKVQIV  840

Query  2387  EEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSG  2566
             EE+    E  +  EE+GS+L  E  +MS+V+S  +P++   LM++F G  LE +VM K G
Sbjct  841   EEES---EATLHGEESGSFLGTEYANMSEVFSSTIPIDMNLLMKVFGGTSLEQRVMEKVG  897

Query  2567  CLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIH  2746
             C+NY  ++WE ++PDVY+R+V YK ++ +S +G EVTSTQ+KS   +  GWI+ E+M + 
Sbjct  898   CVNYSITAWEPVKPDVYQRQVYYKFDKSLSRYGGEVTSTQQKSPLPDRNGWIIEEVMTLQ  957

Query  2747  GVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKE  2926
             GV   D++ + LRY++E  +    +C   V +G+ WLK+T+ + RITKN++   S R+KE
Sbjct  958   GVLLGDYFNLHLRYQMEDLTPRLKACNVQVSLGIAWLKSTEHQKRITKNVISNSSARLKE  1017

Query  2927  MIEFVGRE  2950
             M   V +E
Sbjct  1018  MFSQVEKE  1025



>ref|XP_010928063.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
isoform X2 [Elaeis guineensis]
Length=1021

 Score =   943 bits (2437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/788 (55%), Positives = 596/788 (76%), Gaps = 5/788 (1%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             SF E +K ++++ +G EMP +LQGG+LLDQ+Y + P D N L+F+P S F + LAELQGT
Sbjct  227   SFDELLKTMEAKDQGGEMPGSLQGGVLLDQSYVVAPGDLNFLIFSPSSNFLQSLAELQGT  286

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
              ++Q   W  ++  +S L RV+TYTK ATKLVK+V+ATEEQTYLK DGK +AVL  V TP
Sbjct  287   TNLQTESWRLENGGES-LKRVITYTKAATKLVKAVKATEEQTYLKADGKNYAVLASVGTP  345

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             DVP+G+ F+ E+L+ IMPGP L S ++S+ L+ISW + F +STMMK +IE G +QGLKDS
Sbjct  346   DVPFGNCFRTEVLFCIMPGPDLPSEDQSSRLLISWRMNFLQSTMMKGMIENGAKQGLKDS  405

Query  1130  FSEFSRFLAQHCKVITSAEVLDN-GHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLY  1306
             F++F+  L+Q+   +   +   N   +LA+L +E  S  +LA  +F NFT +S+  +  Y
Sbjct  406   FAQFADLLSQNINPLDQKDTGSNKDQILASLQNEQESGWKLAFRFFGNFTAISSVCVAFY  465

Query  1307  FSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSD  1486
               IHILL++ + +QGLEF GLDLPDS+GE++ CG+LVL  ++V  MI  F++AR +RGSD
Sbjct  466   VLIHILLAKPSIVQGLEFPGLDLPDSIGELVVCGVLVLQGQRVLDMIGRFLQARKQRGSD  525

Query  1487  HGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEI  1666
             HGV+A GDGW+LT+ALIEG NLA++D TG+ DP+VVFTCNGK++TSS++ QTL+PQWNEI
Sbjct  526   HGVKAQGDGWLLTIALIEGNNLAAVDSTGYSDPYVVFTCNGKTKTSSIKFQTLEPQWNEI  585

Query  1667  LEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSS  1846
              EF+  ++PPSM+DV+V+DFDGPFD+A SLGHAE+NF+K   +ELAD+W+PL GK+AQ+ 
Sbjct  586   FEFDAMDDPPSMMDVDVYDFDGPFDEATSLGHAEVNFVKSNLSELADVWIPLQGKLAQAC  645

Query  1847  QSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
             QSKLHLR+FLNN  G + + + LTKMEKEVGKK+NLRSP  N  FQK FGLPPEEFLIND
Sbjct  646   QSKLHLRVFLNNTRGTDIVTEYLTKMEKEVGKKINLRSPQTNCAFQKLFGLPPEEFLIND  705

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             FSC LKRK+P+QGR+FLS RI+GFYANLFGHKTKFFFLWEDIE+I V+PP+ ++M SPSL
Sbjct  706   FSCHLKRKMPMQGRLFLSPRIIGFYANLFGHKTKFFFLWEDIEDIQVIPPTLASMASPSL  765

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIA  2386
             +IIL K +G DA++GAK++D++GRL F F SFVSF  A+RTIMALWK R+  P+QK QI 
Sbjct  766   LIILRKGKGMDAKHGAKTVDQDGRLKFHFQSFVSFNVANRTIMALWKARSLSPEQKVQIV  825

Query  2387  EEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSG  2566
             EE+    E  +  EE+GS+L  E  +MS+V+S  +P++   LM++F G  LE +VM K G
Sbjct  826   EEES---EATLHGEESGSFLGTEYANMSEVFSSTIPIDMNLLMKVFGGTSLEQRVMEKVG  882

Query  2567  CLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIH  2746
             C+NY  ++WE ++PDVY+R+V YK ++ +S +G EVTSTQ+KS   +  GWI+ E+M + 
Sbjct  883   CVNYSITAWEPVKPDVYQRQVYYKFDKSLSRYGGEVTSTQQKSPLPDRNGWIIEEVMTLQ  942

Query  2747  GVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKE  2926
             GV   D++ + LRY++E  +    +C   V +G+ WLK+T+ + RITKN++   S R+KE
Sbjct  943   GVLLGDYFNLHLRYQMEDLTPRLKACNVQVSLGIAWLKSTEHQKRITKNVISNSSARLKE  1002

Query  2927  MIEFVGRE  2950
             M   V +E
Sbjct  1003  MFSQVEKE  1010



>ref|XP_010245025.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Nelumbo nucifera]
Length=1023

 Score =   941 bits (2431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/788 (56%), Positives = 586/788 (74%), Gaps = 4/788 (1%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             SF EA++ +  R +G E+P NL GGILLDQ+Y + P D N LLF+PDS F + LAELQGT
Sbjct  234   SFEEAMRSMSERDQGGEVPSNLPGGILLDQSYVVSPSDLNFLLFSPDSDFLKSLAELQGT  293

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
              ++Q+G W +++     L RVVTY K ATKL+K+V+ATEEQ YLK D K FAVL  VSTP
Sbjct  294   TELQQGAWRFENGTDK-LKRVVTYVKAATKLIKAVKATEEQVYLKADEKVFAVLSSVSTP  352

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             DV  GSTFK ELL+ I PGP L   E+S+ LVISW + F ++TMMK +IEGG +QGLKD+
Sbjct  353   DVMCGSTFKTELLFCITPGPELPDEEQSSRLVISWRMNFLQNTMMKGMIEGGARQGLKDN  412

Query  1130  FSEFSRFLAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLY  1306
             + +F+  L+Q+ K +   ++  N   +L++L  E  SD +LA +YF NFTVVST  + +Y
Sbjct  413   YEQFANLLSQNVKKVDLKDLGSNKEQVLSSLQVEPQSDRKLAIQYFANFTVVSTILMGIY  472

Query  1307  FSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSD  1486
                HI L+  + +QGLEF GLDLPDS+GE+I CGILVL  E+V  +IA F++AR+++GSD
Sbjct  473   VLAHIFLAMPSTIQGLEFDGLDLPDSIGEVIVCGILVLQGERVLELIARFMQARVQKGSD  532

Query  1487  HGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEI  1666
             HGV+A GDGW+LTVALIEG+N+A++D +GFPDP+VVFTCNGK+RTSS++ Q  DPQWNEI
Sbjct  533   HGVKAQGDGWLLTVALIEGSNIAAVDSSGFPDPYVVFTCNGKTRTSSIKFQRTDPQWNEI  592

Query  1667  LEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSS  1846
              EF+  ++PPSMLDVEV+DFDGPFD A SLGHAEINF+K   ++LAD+W+PL GK+AQ+ 
Sbjct  593   FEFDAMDDPPSMLDVEVYDFDGPFDDAISLGHAEINFVKSNISDLADVWIPLQGKLAQAC  652

Query  1847  QSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
              SKLHLRIFLNN  G   +++ LTKMEKEVGKK+NLRSP  NS FQK FGLPPEEFLIND
Sbjct  653   HSKLHLRIFLNNTRGSNIVKEYLTKMEKEVGKKINLRSPQTNSAFQKLFGLPPEEFLIND  712

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             F+C L+RK+PLQGR+FLS R +GF+ANLFGHKTKFFFLWEDIE+I V+PP+ S+M SP +
Sbjct  713   FTCHLRRKMPLQGRLFLSARTIGFHANLFGHKTKFFFLWEDIEDIQVVPPTLSSMVSPII  772

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIA  2386
             +I L K RG DAR+GA++ DE+GRL F FHSFVSF  A RTIMALWK ++  P+QK QI 
Sbjct  773   IITLRKGRGIDARHGARTQDEQGRLKFHFHSFVSFNVAHRTIMALWKEKSLSPEQKVQIV  832

Query  2387  EEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSG  2566
             EE+   +  ++  EE+GS+L +ED  MS+V+S  LP+     ME+F GG L+ K+M K G
Sbjct  833   EEE--SESKSLQTEESGSFLGLEDAKMSEVHSSVLPVPTNYFMELFGGGYLDRKIMEKVG  890

Query  2567  CLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIH  2746
             CLNY  + WE  + D+Y+R++ YK +R +S +  EVTSTQ+KS  +   GW + E+M +H
Sbjct  891   CLNYSYTPWEREKADIYQRQICYKFDRHVSHYSGEVTSTQQKSPLSERNGWTVEEVMTLH  950

Query  2747  GVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKE  2926
             GVP  D++ + LRY++E   +  N C   V+ G+ WLK+T+ + RIT+NI+     R+K 
Sbjct  951   GVPLGDYFTLHLRYQIEDLPSRSNECNVQVFFGIAWLKSTRNQKRITENILSNLQYRLKM  1010

Query  2927  MIEFVGRE  2950
             M   V +E
Sbjct  1011  MFNLVEKE  1018



>ref|XP_009403267.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 [Musa 
acuminata subsp. malaccensis]
Length=1029

 Score =   941 bits (2431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/802 (55%), Positives = 597/802 (74%), Gaps = 5/802 (1%)
 Frame = +2

Query  527   LSSIPSDYEDNVQETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDF  706
             +  +P+D +   Q         F E +K ++S+ +  EMP NL GG+LLDQ+Y++ P D 
Sbjct  220   MQDVPADEDCEEQMVEACADLPFDELLKTMESKVQS-EMPANLPGGVLLDQSYSVAPGDL  278

Query  707   NMLLFAPDSQFRRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATE  886
             N  LF+P S F + LAE+QGT   Q  PW  ++  +S L RVVTYTK ATKLVK+V ATE
Sbjct  279   NSFLFSPSSNFWQSLAEVQGTTGFQAEPWRLENGGES-LKRVVTYTKAATKLVKAVTATE  337

Query  887   EQTYLKGDGKEFAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKF  1066
             EQTYLK DGK FAVL  VSTPDVP+GS+F+ ELL+ IMPGP L S E+S+ LVISW   F
Sbjct  338   EQTYLKADGKNFAVLASVSTPDVPFGSSFRTELLFCIMPGPELSSEEQSSRLVISWRTNF  397

Query  1067  CKSTMMKTVIEGGTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNG-HLLATLPSEHPSDL  1243
              +STMMK +IE G +QGLKDS+ +F+  L+Q  K +   E   +   +LA++ +E  SD 
Sbjct  398   LQSTMMKGIIENGARQGLKDSYIQFAELLSQSIKPVDLKETASSKEQILASMQAEQESDW  457

Query  1244  ELAREYFCNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLH  1423
             +LA  +F NFTV+S+ F VLY   H+LL+  + +QGLEF GLDLPDS+GEI+ CG+LVL 
Sbjct  458   KLACRFFGNFTVISSVFAVLYVLAHLLLANPSTIQGLEFPGLDLPDSIGEIVVCGVLVLQ  517

Query  1424  LEQVYRMIAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTC  1603
              E+V   +  F++AR +RGSDHG++A GDGW+LTVALIEG+NLA++D TG+ DP+VVFTC
Sbjct  518   GERVLNRVGRFLQARKQRGSDHGIKAQGDGWLLTVALIEGSNLAAVDSTGYSDPYVVFTC  577

Query  1604  NGKSRTSSVQLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLK  1783
             NGK++TSS++ QTLDPQW+EI EF+  ++PPSM++V+V+DFDGPFD+A SLGHAE+NFLK
Sbjct  578   NGKTKTSSIKFQTLDPQWSEIFEFDAMDDPPSMMNVDVYDFDGPFDEATSLGHAEVNFLK  637

Query  1784  HTSAELADLWLPLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSP  1963
                ++LAD+W+PL GK+AQ+ QSKLHLR+FLNN  G + + + ++KMEKEVGKK+ LRSP
Sbjct  638   SNLSDLADVWIPLQGKLAQACQSKLHLRVFLNNTRGNDVVTEYISKMEKEVGKKIILRSP  697

Query  1964  HRNSTFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLW  2143
               NS FQK FGLP EEFLINDF+C LKRKLP+QGR+FLS RI+GFYANLFGHKTKFFFLW
Sbjct  698   QTNSAFQKLFGLPAEEFLINDFTCHLKRKLPMQGRLFLSPRIIGFYANLFGHKTKFFFLW  757

Query  2144  EDIEEINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGAS  2323
             EDI++I V+PPS +TMG PSL+IIL + RG DA++GAK++D +GRL F F SFVSF  A+
Sbjct  758   EDIDDIQVIPPSLATMGGPSLLIILRRGRGMDAKHGAKALDPDGRLRFQFQSFVSFSVAN  817

Query  2324  RTIMALWKTRACIPDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNH  2503
             RTIMALWK RA  P+QK QIAEE+       +  EE GS+L++ED +MS+V+S  + ++ 
Sbjct  818   RTIMALWKARALSPEQKVQIAEEE--SGARTLQGEEIGSFLVLEDANMSEVFSSAVDVDI  875

Query  2504  KSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTST  2683
              +LME+F+G  LE +VM K GC++Y  + WE ++ DVY+R++ +K ++ +S +G EVTST
Sbjct  876   NTLMELFDGSSLERRVMEKVGCVDYSVTPWEAVKGDVYQRQIYFKFDKNLSRYGGEVTST  935

Query  2684  QRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKN  2863
             Q+K+   N  GW++ E+MA+ GV   D++ + LRY+++  S    +C   V +G+ WLK+
Sbjct  936   QQKAPLPNKNGWLVEEVMALQGVLLGDYFNLHLRYQIDDLSPKLKACDVHVSLGIAWLKS  995

Query  2864  TKLEDRITKNIVRKFSQRVKEM  2929
             TK + RITK+++   S R+KEM
Sbjct  996   TKHQKRITKSVISNSSLRLKEM  1017



>ref|XP_006467213.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Citrus sinensis]
 gb|KDO78671.1| hypothetical protein CISIN_1g001764mg [Citrus sinensis]
 gb|KDO78672.1| hypothetical protein CISIN_1g001764mg [Citrus sinensis]
Length=1016

 Score =   939 bits (2427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/793 (57%), Positives = 589/793 (74%), Gaps = 5/793 (1%)
 Frame = +2

Query  575   RSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELA  754
             +S + SF EA+K ++ R  G E+P NL GG+L+DQ Y + P+D N LLF+PDS F R  A
Sbjct  224   QSSSASFEEAMKTMEPRDLGSEVPSNLPGGVLVDQMYVIAPQDLNTLLFSPDSNFPRTWA  283

Query  755   ELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLV  934
             E QG  ++Q GPW +++  +S L R VTY K A KL+K+ +  EEQTYLK DGK FA+L 
Sbjct  284   EEQGNTELQIGPWRFENGCES-LKRDVTYIKAANKLIKATKGFEEQTYLKADGKVFAILA  342

Query  935   DVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQ  1114
              VSTP+V YG +FK ELL+ I PGP L SGE+S+HLVISW + F +STMMK +IE G + 
Sbjct  343   SVSTPEVMYGGSFKTELLFCITPGPELSSGEQSSHLVISWRMNFLQSTMMKGMIENGARS  402

Query  1115  GLKDSFSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTA  1291
              L++++ +F+ FL+Q    + S ++ L+   +LA+L  E  SD +LA  YF NFTVVS+ 
Sbjct  403   ALRETYEQFATFLSQTITPVDSNDMGLNKEQILASLQPEPQSDWKLAVHYFANFTVVSSF  462

Query  1292  FLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARL  1471
             F+ +Y  IHI L+ ST +QGLEF GLDLPDS+GE I CG+LVL  E+  ++I+ F++AR 
Sbjct  463   FMGIYVLIHIWLATSTTIQGLEFVGLDLPDSIGEFIVCGVLVLQGERFLQLISRFMQARK  522

Query  1472  RRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDP  1651
             ++GSDHGV+A GDGW+LTVALI+G NLA++D +GF DP+VVFTCNGKSRTSS++ Q  DP
Sbjct  523   QKGSDHGVKAQGDGWLLTVALIKGDNLAAVDSSGFCDPYVVFTCNGKSRTSSIKFQQCDP  582

Query  1652  QWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGK  1831
              WNEI E++  +EPPSMLDVEV+DFDGPF++A SLGHAEINF+K   ++LAD+W+PL GK
Sbjct  583   MWNEIFEYDAMDEPPSMLDVEVYDFDGPFNEATSLGHAEINFVKSDISDLADVWIPLQGK  642

Query  1832  IAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEE  2011
             +AQ+ QSKLHLRIFLNN  G   +++ LTKMEKEVGKK+NLRSP  NS FQK FGLPPEE
Sbjct  643   LAQACQSKLHLRIFLNNTKGSNVVKEYLTKMEKEVGKKINLRSPQTNSAFQKLFGLPPEE  702

Query  2012  FLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTM  2191
             FLINDF+C LKRK+ LQGR+FLS RI+GF+ANLFGHKT FFFLWEDIE+I VLPPS S+M
Sbjct  703   FLINDFTCHLKRKMLLQGRLFLSARIIGFHANLFGHKTNFFFLWEDIEDIQVLPPSLSSM  762

Query  2192  GSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQ  2371
             GSP +V+ L + RG DAR+GAK+ DEEGRL F FHSFVS+  A RTIMALWK R+  P+Q
Sbjct  763   GSPVIVMTLRQGRGMDARHGAKTQDEEGRLKFHFHSFVSYNVAHRTIMALWKARSLSPEQ  822

Query  2372  KAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKV  2551
             K QI EE + K   ++  EE G++L +EDV+MS+VYS  LP+     ME+F GG+LE  V
Sbjct  823   KVQIVEESEAK---SLQSEEGGTFLGLEDVTMSEVYSSVLPVPMSFFMELFGGGELERAV  879

Query  2552  MSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNE  2731
             M K+GC++Y  SSWE  + DVYER++ Y+ ++ IS +  EVTSTQ+KS   N  GW++ E
Sbjct  880   MEKAGCVSYSCSSWESEKLDVYERQIYYRFDKCISRYRGEVTSTQQKSPLPNGNGWLVEE  939

Query  2732  IMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFS  2911
             +M +HGVP  D++ + LRY+VE   +    C   VY+GV WLK+T+ + RITKNIV    
Sbjct  940   VMTLHGVPLGDYFNLHLRYQVEDSPSRPKGCLAQVYLGVAWLKSTRHQKRITKNIVSNLE  999

Query  2912  QRVKEMIEFVGRE  2950
              R++  +  + +E
Sbjct  1000  DRLRVKLSVIEKE  1012



>ref|XP_006857725.1| hypothetical protein AMTR_s00061p00181260 [Amborella trichopoda]
 gb|ERN19192.1| hypothetical protein AMTR_s00061p00181260 [Amborella trichopoda]
Length=1035

 Score =   936 bits (2419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/814 (54%), Positives = 603/814 (74%), Gaps = 10/814 (1%)
 Frame = +2

Query  527   LSSIPSDYEDNVQETTRSQTQ-SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKD  703
             +S +P    +N      S  Q +F EA+ ++QS+ +  EMP NL GG++LDQTY + PKD
Sbjct  219   ISDLPDTLSNNRTSENNSGDQPTFEEALNIIQSKEKMPEMPPNLPGGVVLDQTYVISPKD  278

Query  704   FNMLLFAPDSQFRRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQAT  883
              N+LLFAPD +F + LAE+QG  DVQEG  +W+ +N++ L RVVT TK  ++LVKSV+AT
Sbjct  279   LNLLLFAPDCEFMKSLAEVQGNTDVQEG--SWRMENEA-LKRVVTCTKPPSRLVKSVKAT  335

Query  884   EEQTYLKGDGKEFAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVK  1063
             E+Q YLK DGK FA+L  VSTPDVP G+ F+ E+L+ I PGP L  GEES+ LVISW + 
Sbjct  336   EDQVYLKADGKTFAILASVSTPDVPMGNCFRAEILFCISPGPELSCGEESSRLVISWRMN  395

Query  1064  FCKSTMMKTVIEGGTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDL  1243
             F +STMMK VIEGG +QG+KDS+ +++R LA+  +V+ S+    N  +L +L  E  SD 
Sbjct  396   FLQSTMMKGVIEGGARQGIKDSYEQYARLLAEKVRVLDSSGSERN-QVLDSLQVEEISDW  454

Query  1244  ELAREYFCNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLH  1423
             +LA  YF NFT+VS  F+ LY  +H+ L   + +QGLEF G+DLPDS+GE+I  GILVL 
Sbjct  455   KLAALYFWNFTMVSAVFMGLYVLVHLFLVMPSPIQGLEFGGIDLPDSIGEVIVGGILVLQ  514

Query  1424  LEQVYRMIAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTC  1603
              ++V  M++ F++A  +RGSDHG++A GDGW+LTVALIEG NLA++D TGF DP+VVFTC
Sbjct  515   AQRVLEMLSRFIQATAQRGSDHGIKAQGDGWLLTVALIEGKNLAAVDSTGFSDPYVVFTC  574

Query  1604  NGKSRTSSVQLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLK  1783
             NGK+RTSS++ QTLDPQWNEI  F+  EEPPS++DVEVFDFDGPFD+A SLGH EINFLK
Sbjct  575   NGKTRTSSIKFQTLDPQWNEIFAFDAMEEPPSVMDVEVFDFDGPFDEATSLGHLEINFLK  634

Query  1784  HTSAELADLWLPLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSP  1963
              +  ELAD W+PL GK+A + QSKLHLR+FL+N  G E ++  +TK+E+ VGKK+N+RSP
Sbjct  635   CSITELADTWIPLQGKLALAYQSKLHLRVFLDNTRGTEVVKQYITKIEEAVGKKINIRSP  694

Query  1964  HRNSTFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLW  2143
               N  FQK FGLPPEEFLINDF+C LKRKLP+QGR+FLS R++GF+ANLFGHKTKFFFLW
Sbjct  695   QTNLAFQKLFGLPPEEFLINDFTCHLKRKLPMQGRLFLSPRMIGFHANLFGHKTKFFFLW  754

Query  2144  EDIEEINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGAS  2323
             EDIE++ V+PPS +T+GSPSL+IIL + RG+DA++GAK +DEEGRL F F SFVSF  A+
Sbjct  755   EDIEDLQVVPPSLATVGSPSLLIILRRGRGSDAKHGAKMLDEEGRLRFHFQSFVSFHAAN  814

Query  2324  RTIMALWKTRACIPDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNH  2503
             RTI ALWK R+  P+QK QI E     +   +  E++G  L +ED  MS+VYS  L +  
Sbjct  815   RTITALWKARSLSPEQKVQIVE----ANSGPLQTEDSGCVLDLEDAKMSEVYSRSLSVPI  870

Query  2504  KSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTST  2683
               +ME+F GG  + +VM K+GCLNY  + WE  +P+VY+R+++Y+ ++ +S +G +VT T
Sbjct  871   DLVMELFEGGPFDRRVMGKAGCLNYSPTPWEFTKPEVYQRQINYEFDKRVSRYGGQVTGT  930

Query  2684  QRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVES-CSAARNSCRCDVYVGVMWLK  2860
             Q+KS+ ++  GW+++E+M  HGVPF D++ ++LRY++ES  + ++ +    V +G+ WLK
Sbjct  931   QQKSLLSDRNGWVIDEVMTFHGVPFGDYFNLRLRYQIESPLNTSKTASNVQVLLGIAWLK  990

Query  2861  NTKLEDRITKNIVRKFSQRVKEMIEFVGREVFLS  2962
             +TK + +IT NIV + S  +KE+ E    E+ +S
Sbjct  991   STKHQRKITGNIVSRLSDLLKEIFELAEMEILMS  1024



>ref|XP_004975959.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170-like 
[Setaria italica]
Length=876

 Score =   932 bits (2408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/789 (57%), Positives = 592/789 (75%), Gaps = 5/789 (1%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             SF EA+++++SR+   +MPE+L GGI+ + TY +  K+ N LLF PDSQF +EL ELQGT
Sbjct  86    SFEEAMEVMKSRSTP-DMPEDLDGGIIFEHTYLVESKELNHLLFRPDSQFFKELRELQGT  144

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
              D +E PWTWKS +   LTR   YTKGA+K +K+V+ +EEQTY K DGK F V+  V TP
Sbjct  145   IDYEEQPWTWKSKDPPSLTRTCQYTKGASKFMKAVKTSEEQTYHKADGKNFVVMARVRTP  204

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             +VP+G+ F V LLY I+   GL  GEES HL +S+ V+F +STMM+++IEG  + GLK++
Sbjct  205   EVPFGNCFAVVLLYKIIHSTGLSGGEESAHLTVSYNVEFLQSTMMRSMIEGSVRDGLKEN  264

Query  1130  FSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYF  1309
             F  F+  L++H K+  S   +D   LLA L +E  + + LA +YFCNFT VST    LY 
Sbjct  265   FEGFAEVLSRHVKLADSVG-MDKEQLLAPLQAERQTIIRLAYKYFCNFTAVSTVLFTLYV  323

Query  1310  SIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDH  1489
              +HILLS+   L GLEF+GLDLPDS GE+IT GILVL LE+V  M++HFV+AR++RGSDH
Sbjct  324   LVHILLSKPGPLMGLEFNGLDLPDSFGELITAGILVLQLERVLNMVSHFVQARVQRGSDH  383

Query  1490  GVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEIL  1669
             GV+A+GDGW+LTVAL+E T+L  +   G  DP+VVF+CNG +RTSSVQLQT +PQWNEI+
Sbjct  384   GVKANGDGWLLTVALLEATSLPPVS-CGSVDPYVVFSCNGITRTSSVQLQTQEPQWNEIM  442

Query  1670  EFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQ  1849
             EF+  EEPP++LDVEVF+FDGPFD A SLGHAEINFLKHTS ELAD+W+PL GK+AQ+ Q
Sbjct  443   EFDAMEEPPAVLDVEVFNFDGPFDLAISLGHAEINFLKHTSVELADIWVPLEGKLAQTCQ  502

Query  1850  SKLHLRIFLNNNNGVET-IRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
             S+LHLR+FL N  G ET +R+ L+KMEKEVGKKL++RSPHRNSTFQK F LP EEFLI D
Sbjct  503   SRLHLRVFLENTKGPETSMREYLSKMEKEVGKKLHVRSPHRNSTFQKLFSLPHEEFLIAD  562

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             ++CSLKRKLPLQGR+F+S RIVGFYANLFGHKTKFFFLWED+EEI VL PSF+T+G+PSL
Sbjct  563   YACSLKRKLPLQGRLFVSARIVGFYANLFGHKTKFFFLWEDVEEIEVLQPSFTTVGTPSL  622

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIA  2386
             +  L   RG DA++GAKS D+EGRL F FHSF SF  AS+TI+ LWKT++   +Q+A++ 
Sbjct  623   LFTLKSGRGLDAKSGAKSQDKEGRLKFQFHSFASFSKASKTIIGLWKTKSSAIEQRAKM-  681

Query  2387  EEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSG  2566
             EE Q +D ++V  ++  + L + DV +SK Y+++ P++   LM +F+GG LE + MS+ G
Sbjct  682   EEDQEEDVSSVDLDDVHAVLSIGDVPLSKEYTLEHPIDADLLMGVFDGGPLETRTMSRVG  741

Query  2567  CLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIH  2746
             CL+Y  + WE   P V ER VSYK NR +SIFG EV STQ K    +  GW +++++ +H
Sbjct  742   CLDYSATPWEAARPGVVERHVSYKFNRYMSIFGGEVVSTQLKFPAEDGCGWAIHDVVTLH  801

Query  2747  GVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKE  2926
              VPF D+++V LRY V+S ++   S RC++ VG+ WLK++K + RI +NI  K + R KE
Sbjct  802   NVPFGDYFRVHLRYNVQSVTSEAPSSRCEILVGIEWLKSSKFQKRIARNICEKLAHRAKE  861

Query  2927  MIEFVGREV  2953
             ++E  G+E+
Sbjct  862   VLEAAGKEI  870



>ref|XP_009374836.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Pyrus x bretschneideri]
Length=1018

 Score =   931 bits (2406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/793 (56%), Positives = 588/793 (74%), Gaps = 5/793 (1%)
 Frame = +2

Query  575   RSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELA  754
             +S + +F E +K +QSR +  E P NL GG+L+DQ Y  PP+D N LLF+ DS F++E+A
Sbjct  227   QSSSATFEELMKTIQSRDQESETPTNLPGGVLVDQLYVTPPQDLNTLLFSTDSGFQKEVA  286

Query  755   ELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLV  934
             + QGT ++  G W   +  +S + RVVTY K ATKL+K+V+ TE+QTYLK DGK FAVL 
Sbjct  287   DAQGTTELDPGQWKLDTSTES-VKRVVTYVKAATKLIKAVKGTEDQTYLKADGKVFAVLA  345

Query  935   DVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQ  1114
              VSTPDVPYG TFK ELLY I PGP L SGE+S+ LVISW + F +STMMK +IE G +Q
Sbjct  346   SVSTPDVPYGRTFKTELLYCITPGPELPSGEQSSRLVISWRMNFLQSTMMKGMIENGARQ  405

Query  1115  GLKDSFSEFSRFLAQHCKVITSAEVLDN-GHLLATLPSEHPSDLELAREYFCNFTVVSTA  1291
             GLK+SF  ++  L+Q+ K + S ++  N   +LA+L +E  SD +LA +YF NFTV+ST 
Sbjct  406   GLKESFDHYATILSQNVKPVDSKDLGSNKDQVLASLQAEPQSDWKLAVQYFANFTVISTL  465

Query  1292  FLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARL  1471
             F+ LY  +HI L++ + +QGLEF GLDLPDS+GE I CG+LVL  E+V  +I+ F++AR 
Sbjct  466   FIGLYMFVHIWLAQPSTIQGLEFVGLDLPDSIGEFIVCGVLVLQGERVLGLISRFMQARA  525

Query  1472  RRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDP  1651
             + GSDHGV+A GDGW+LTVALIEG+N+A++D +GF DP+VVFTCNGK+RTSS++ Q  DP
Sbjct  526   QNGSDHGVKAQGDGWLLTVALIEGSNIAAVDSSGFSDPYVVFTCNGKTRTSSIKFQKCDP  585

Query  1652  QWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGK  1831
              WNEI EF+  +EPPS+LDVEV+DFDGPFD+A SLGHAEINF+K   ++LADLW+PL GK
Sbjct  586   TWNEIFEFDAMDEPPSVLDVEVYDFDGPFDEAISLGHAEINFVKTNISDLADLWVPLQGK  645

Query  1832  IAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEE  2011
             +AQ+ QSKLHLRIFLNN  G   +   LTKMEKEVGKK+ +RSP  NS FQK FGLPPEE
Sbjct  646   LAQACQSKLHLRIFLNNTRGGNVVNQFLTKMEKEVGKKITVRSPQTNSAFQKLFGLPPEE  705

Query  2012  FLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTM  2191
             FLINDF+C LKRK+PLQGR+FLS RI+GF+ANLFGHKTKFFFLWEDIE+I V+PP+ S+M
Sbjct  706   FLINDFTCHLKRKMPLQGRLFLSARIIGFHANLFGHKTKFFFLWEDIEDIQVVPPTLSSM  765

Query  2192  GSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQ  2371
             GSP +V+ L + RG DAR+GAK+ DEEGRL F F SFVSF  A+RTIMALWK R+  P+Q
Sbjct  766   GSPIIVMTLRQGRGMDARHGAKTQDEEGRLKFHFQSFVSFNVANRTIMALWKARSLSPEQ  825

Query  2372  KAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKV  2551
             K +I EE+    +  +  EE+GS+L ++DVSMS+VYS    +     +E+F GG+L+ +V
Sbjct  826   KVKIVEEES---DVKIQAEESGSFLGLDDVSMSEVYSAAHSVPTNFFIELFGGGELDRRV  882

Query  2552  MSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNE  2731
             M K+GCLNY  + WE  + DV  R++ Y+ ++ +S +  EVTSTQ+KS   +  GW++ E
Sbjct  883   MEKAGCLNYSYTPWESEKGDVCVRQIYYRFDKRVSQYRGEVTSTQQKSRLPDRNGWLVQE  942

Query  2732  IMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFS  2911
             +  +H VP  D++ + +RY++E   +    C+  VY GV WLK+T+ + RITKN+++   
Sbjct  943   VSTLHAVPLGDYFNLHVRYQIEDLPSTPKGCQVKVYFGVEWLKSTRHQKRITKNVLKNLQ  1002

Query  2912  QRVKEMIEFVGRE  2950
              R+K+    V +E
Sbjct  1003  DRLKDTFSVVEKE  1015



>gb|KDP35532.1| hypothetical protein JCGZ_08970 [Jatropha curcas]
Length=1025

 Score =   931 bits (2405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/796 (56%), Positives = 593/796 (74%), Gaps = 12/796 (2%)
 Frame = +2

Query  578   SQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAE  757
             S  + F E +++++S+  G E+P NL GG+L+DQ+Y + P+D N ++FAPDS F+R LAE
Sbjct  233   SSPEDFVEIMRVMESKDVGNEIPSNLPGGVLIDQSYVIAPQDLNSMIFAPDSSFQRSLAE  292

Query  758   LQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVD  937
             +QGT + Q GPW +++  +S L R+VTY K ATKLV++V+  EEQTYLK DGK FAV V 
Sbjct  293   VQGTTEQQFGPWKFENGGES-LKRMVTYMKAATKLVRAVKVYEEQTYLKADGKAFAVFVV  351

Query  938   VSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQG  1117
              STPDV YG+TFK+ELLY I  GP L SGE+++HLV+SW + F +STMMK +IE G +QG
Sbjct  352   SSTPDVMYGNTFKIELLYCITSGPELSSGEQTSHLVLSWRMNFLQSTMMKGMIENGAKQG  411

Query  1118  LKDSFSEFSRFLAQHCKVITSAEVLDNG----HLLATLPSEHPSDLELAREYFCNFTVVS  1285
             LKDS+ +FS  L+Q  K +   ++ D G     +LA+L +E  S+ +LA +YF NFTVVS
Sbjct  412   LKDSYEQFSSVLSQTVKPV---DLKDMGSTKEQVLASLQAESQSNWKLAVQYFANFTVVS  468

Query  1286  TAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEA  1465
             T F+ LY  +HI +S S+ +QGLEF GLDLPDS+GE+I CG+LVL  E+V  +++ F++A
Sbjct  469   TVFIGLYVLLHIWISPSSTIQGLEFVGLDLPDSIGEVIVCGVLVLQCERVLELLSRFMQA  528

Query  1466  RLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTL  1645
             R+++GSDHGV+A GDGW+LTVALIEG NLA++D +GF DP+VVFTCNGK+RTSS++ Q  
Sbjct  529   RVQKGSDHGVKAQGDGWLLTVALIEGNNLAAVDASGFCDPYVVFTCNGKTRTSSIKFQKS  588

Query  1646  DPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLG  1825
             DP WNEI EF+  +EPPS+LDVEV+DFDGPFD+A SLGHAEINFLK   ++LAD+W+PL 
Sbjct  589   DPLWNEIFEFDAMDEPPSVLDVEVYDFDGPFDEATSLGHAEINFLKSNISDLADVWVPLK  648

Query  1826  GKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPP  2005
             GK+AQ+ QSKLHLRIFLNN  G    ++ + KMEKEVGKK+NLRSP  NS FQK FGLPP
Sbjct  649   GKLAQACQSKLHLRIFLNNTRGSNIAKEYINKMEKEVGKKINLRSPQTNSAFQKLFGLPP  708

Query  2006  EEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFS  2185
             EEFLINDF+C LKRK+PLQGR+FLS RI+GF+ANLFG KTKFFFLWEDIE+I V  P  S
Sbjct  709   EEFLINDFTCHLKRKMPLQGRLFLSARIIGFHANLFGQKTKFFFLWEDIEDIQVYAPKLS  768

Query  2186  TMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIP  2365
             +MGSP++V+ L K RG DAR+GAK+ DEEGRL F F SFVSF  A RTIMALWK R+  P
Sbjct  769   SMGSPTIVMTLRKGRGMDARHGAKTQDEEGRLKFHFQSFVSFNVAHRTIMALWKARSLTP  828

Query  2366  DQKAQIAEEQQYKDENNVL-PEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLE  2542
             +QK QI EE     E  +L  +E+GS L +EDV+MS+VYS  + +    LM +F GG+LE
Sbjct  829   EQKVQIVEEDS---ETKLLHSDESGSLLDLEDVNMSEVYSSSVSVPTNFLMGLFGGGELE  885

Query  2543  HKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWI  2722
              K M K+GCLNY  + WEL++ DVYER++ Y+ ++ IS +  EVTSTQ+K   ++  GW+
Sbjct  886   RKAMEKAGCLNYSYTPWELVKADVYERQIYYRYDQSISHYRGEVTSTQQKYPQSDRKGWL  945

Query  2723  LNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVR  2902
             + E+M +HGVP  D++ + LRY++E   A    C   V++G+ W K+TK + RITKNI+ 
Sbjct  946   VEEVMTLHGVPLGDNFNLHLRYQIEDLPARPKCCYVHVFMGIAWQKSTKHQKRITKNILS  1005

Query  2903  KFSQRVKEMIEFVGRE  2950
                  +K +   + RE
Sbjct  1006  NLEDWLKVIFSLIERE  1021



>ref|XP_008224645.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 isoform 
X1 [Prunus mume]
Length=1015

 Score =   930 bits (2404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/789 (57%), Positives = 580/789 (74%), Gaps = 7/789 (1%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             +F E ++ +QSR +  E P NL GG+LLDQ Y  PP+D N  LF PDS F + LAE+QGT
Sbjct  229   TFEELMRTMQSRDQVSETPSNLPGGVLLDQLYVTPPQDINTFLFLPDSGFPKSLAEVQGT  288

Query  770   KDVQEGPWTWKSDNKS-CLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVST  946
              +++ GPW  K DN S  + RVVTY K ATKL+K+ + TE+Q YLK DGK FAVL  VST
Sbjct  289   TELEVGPW--KLDNSSESVKRVVTYVKAATKLIKACKGTEDQVYLKADGKVFAVLSSVST  346

Query  947   PDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKD  1126
             PDVPYG TF+ ELLY I PGP L SGE+S+ LVISW + F +STMMK +IE G +QGLKD
Sbjct  347   PDVPYGRTFRTELLYCITPGPELPSGEQSSRLVISWRMNFLQSTMMKGMIENGARQGLKD  406

Query  1127  SFSEFSRFLAQHCKVITSAEVLDN-GHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVL  1303
             SF +F+  L+Q+ K + S ++  N   +LA+L +E  SD +LA +YF NFTVVST F+ L
Sbjct  407   SFDQFATLLSQNVKPVDSKDLGSNKDQVLASLQAEPQSDWKLAVQYFGNFTVVSTVFIGL  466

Query  1304  YFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGS  1483
             Y  +HI L+  + +QGLEF GLDLPDS+GE I CG+LVL  E+V  +I+ F++AR ++GS
Sbjct  467   YMLVHIWLATPSTIQGLEFVGLDLPDSIGEFIVCGVLVLQGERVLGLISRFMQARAQKGS  526

Query  1484  DHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNE  1663
             DHGV+A GDGW+LTVALIEG+N+A++D +GF DP+VVFTCNGK+RTSS++ Q  DP WNE
Sbjct  527   DHGVKAQGDGWLLTVALIEGSNIAAVDSSGFSDPYVVFTCNGKTRTSSIKFQKCDPTWNE  586

Query  1664  ILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQS  1843
             I EF+  +EPPS+LDVE++DFDGPFD+A SLGHAEINF+K   ++LADLW+PL GK+AQ+
Sbjct  587   IFEFDAMDEPPSVLDVEIYDFDGPFDEAISLGHAEINFVKTNISDLADLWVPLRGKLAQA  646

Query  1844  SQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIN  2023
              QSKLHLRIFLNN  G       LTKMEKEVGKK+ +RSP  NS FQK FGLPPEEFLIN
Sbjct  647   CQSKLHLRIFLNNTRGGNVANHFLTKMEKEVGKKITVRSPQTNSAFQKLFGLPPEEFLIN  706

Query  2024  DFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPS  2203
             DF+C LKRK+PLQGR+FLS RI+GF+ANLFGHKTKFFFLWEDIEEI V+PPS S+MGSP 
Sbjct  707   DFTCHLKRKMPLQGRLFLSARIIGFHANLFGHKTKFFFLWEDIEEIQVVPPSLSSMGSPI  766

Query  2204  LVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQI  2383
             +V+ L   RG DAR+GAK+ D EGRL F F SFVSF  A RTIMALWK R+  P+QK QI
Sbjct  767   VVMTLRPGRGMDARHGAKTQDGEGRLKFHFQSFVSFNVAHRTIMALWKARSLSPEQKVQI  826

Query  2384  AEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKS  2563
              EE+    E  +  EE+GS+L ++DVSMS+VYS    +     +E+F GG+L+ +VM K+
Sbjct  827   VEEES---EVKIQSEESGSFLGLDDVSMSEVYSSAHSVPTNFFVELFGGGELDRRVMEKA  883

Query  2564  GCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAI  2743
             GCLNY  + WE  + DV  R++ Y+ ++ +S +  EVTSTQ+KS  ++  GW++ E+  +
Sbjct  884   GCLNYSYTPWESEKGDVCVRQIYYRFDKRVSQYRGEVTSTQQKSRLSDRNGWLVQEVSTL  943

Query  2744  HGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVK  2923
             H VP  D++ + +RY++E   +    C+  VY GV WLK T+ + RITKN+++    R+K
Sbjct  944   HAVPLGDYFNLHIRYQIEDLPSNSKGCQVKVYFGVEWLKGTRHQKRITKNVLKNLQDRLK  1003

Query  2924  EMIEFVGRE  2950
             +    V  E
Sbjct  1004  DTFSVVETE  1012



>ref|XP_010646248.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 isoform 
X2 [Vitis vinifera]
Length=899

 Score =   930 bits (2403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/841 (54%), Positives = 611/841 (73%), Gaps = 6/841 (1%)
 Frame = +2

Query  431   KSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCEAIK  610
             K+IAG + ++F KN + +     GS   +    +SIP  YE+ ++E + S      E++K
Sbjct  59    KTIAGRIAQIFVKNGDLASCTSAGSIDSSELSETSIPEVYENKLEEQSSSSCSF-EESMK  117

Query  611   LLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEGP  790
              ++S  +G E   NL GG+LLDQ Y +   + N  LFAPDS F R LA+LQGT ++Q+GP
Sbjct  118   RMESTDQGNECLSNLPGGVLLDQLYVVASSELNSFLFAPDSNFPRALADLQGTTELQQGP  177

Query  791   WTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGST  970
             W +++   S L RVVTY K A+KL+K+V+ATE+QTYLK DGK FAVL  VSTPDV YGST
Sbjct  178   WVFENGGDS-LKRVVTYIKAASKLIKAVKATEDQTYLKADGKVFAVLASVSTPDVMYGST  236

Query  971   FKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRF  1150
             FK E+LY I PGP + SGE+S+ LVISW + F ++TMMK++IEGG +QGLKDS++++   
Sbjct  237   FKAEVLYCITPGPEMPSGEQSSRLVISWRMNFSQNTMMKSMIEGGARQGLKDSYAQYGNL  296

Query  1151  LAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHILL  1327
             LAQ+ K +   +   N   +LA+L +E  SD +LA +YF N TVVST F VLY S HI +
Sbjct  297   LAQNVKPVDPNDAGSNKEQVLASLQAERQSDWKLAVQYFVNITVVSTIFAVLYVSTHIWI  356

Query  1328  SRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHG  1507
             +  + +QGLEF GLDLPDS+GE+I C +LV+  E+V +MIA F++AR ++GSDHGV+A G
Sbjct  357   ATPSPIQGLEFVGLDLPDSIGEVIVCILLVIQGERVLKMIARFMQARAQKGSDHGVKAQG  416

Query  1508  DGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAE  1687
             DGW+LTVALIEG+NLA++D +GF DP+VVFT NGK+RTSS++ Q  DP WNEI EF+  +
Sbjct  417   DGWLLTVALIEGSNLAAVDSSGFSDPYVVFTTNGKTRTSSIKFQKSDPLWNEIFEFDAMD  476

Query  1688  EPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLR  1867
             EPPSMLDVEV DFDGPFD+A SLGHAEINF+K   ++LAD+W+PL GK+AQ+ QSKLHLR
Sbjct  477   EPPSMLDVEVLDFDGPFDEATSLGHAEINFVKTNLSDLADVWIPLQGKLAQACQSKLHLR  536

Query  1868  IFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKR  2047
             IFLNN  G   +++ LTKMEKEVGKK+NLRSP  NS FQK FGLPPEEFLINDF+C LKR
Sbjct  537   IFLNNTRGNNVVKEYLTKMEKEVGKKINLRSPQTNSAFQKLFGLPPEEFLINDFTCHLKR  596

Query  2048  KLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKD  2227
             K+P+QGR+F+S RI+GF+ANLFGHKTKFFFLWEDI++I     + S+MGSP +V+ L K 
Sbjct  597   KMPMQGRLFMSARIIGFHANLFGHKTKFFFLWEDIDDIQFETATLSSMGSPIIVMTLRKG  656

Query  2228  RGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKD  2407
             RG DAR+GAKS D +GRL F FHSFVSF  A RTIMALWK R+  P+QK +I EE + K 
Sbjct  657   RGMDARHGAKSQDAQGRLKFHFHSFVSFNVAQRTIMALWKARSLSPEQKVRIVEESESK-  715

Query  2408  ENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTS  2587
               ++  EETGS+L +EDV M +VYS  L +     +E+F GG+LE++VM K+GCLNY  +
Sbjct  716   --SLQTEETGSFLGLEDVYMPEVYSSVLSLPANFCVELFGGGELEYRVMQKAGCLNYSLT  773

Query  2588  SWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDH  2767
              WEL +  +Y R++ YK ++ +S +  E  STQ++S+  +  GW++ E++ +HGVP  DH
Sbjct  774   PWELDKDGIYVRQICYKFDKCVSRYRGEAVSTQQRSLLPDRNGWVIEEVLTLHGVPLGDH  833

Query  2768  YQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGR  2947
             + +  RY++E   +   +C   VY G+ WLK+T+ + RI+KNI      R+K M+  V +
Sbjct  834   FNLHFRYQIEHAPSKGKACHICVYFGIAWLKSTRHQKRISKNIHSNLQDRLKLMVGEVEK  893

Query  2948  E  2950
             E
Sbjct  894   E  894



>ref|XP_002264782.2| PREDICTED: C2 and GRAM domain-containing protein At1g03370 isoform 
X1 [Vitis vinifera]
 emb|CBI25738.3| unnamed protein product [Vitis vinifera]
Length=1030

 Score =   929 bits (2400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/841 (54%), Positives = 611/841 (73%), Gaps = 6/841 (1%)
 Frame = +2

Query  431   KSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCEAIK  610
             K+IAG + ++F KN + +     GS   +    +SIP  YE+ ++E + S      E++K
Sbjct  190   KTIAGRIAQIFVKNGDLASCTSAGSIDSSELSETSIPEVYENKLEEQSSSSCSF-EESMK  248

Query  611   LLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEGP  790
              ++S  +G E   NL GG+LLDQ Y +   + N  LFAPDS F R LA+LQGT ++Q+GP
Sbjct  249   RMESTDQGNECLSNLPGGVLLDQLYVVASSELNSFLFAPDSNFPRALADLQGTTELQQGP  308

Query  791   WTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGST  970
             W +++   S L RVVTY K A+KL+K+V+ATE+QTYLK DGK FAVL  VSTPDV YGST
Sbjct  309   WVFENGGDS-LKRVVTYIKAASKLIKAVKATEDQTYLKADGKVFAVLASVSTPDVMYGST  367

Query  971   FKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRF  1150
             FK E+LY I PGP + SGE+S+ LVISW + F ++TMMK++IEGG +QGLKDS++++   
Sbjct  368   FKAEVLYCITPGPEMPSGEQSSRLVISWRMNFSQNTMMKSMIEGGARQGLKDSYAQYGNL  427

Query  1151  LAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHILL  1327
             LAQ+ K +   +   N   +LA+L +E  SD +LA +YF N TVVST F VLY S HI +
Sbjct  428   LAQNVKPVDPNDAGSNKEQVLASLQAERQSDWKLAVQYFVNITVVSTIFAVLYVSTHIWI  487

Query  1328  SRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHG  1507
             +  + +QGLEF GLDLPDS+GE+I C +LV+  E+V +MIA F++AR ++GSDHGV+A G
Sbjct  488   ATPSPIQGLEFVGLDLPDSIGEVIVCILLVIQGERVLKMIARFMQARAQKGSDHGVKAQG  547

Query  1508  DGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAE  1687
             DGW+LTVALIEG+NLA++D +GF DP+VVFT NGK+RTSS++ Q  DP WNEI EF+  +
Sbjct  548   DGWLLTVALIEGSNLAAVDSSGFSDPYVVFTTNGKTRTSSIKFQKSDPLWNEIFEFDAMD  607

Query  1688  EPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLR  1867
             EPPSMLDVEV DFDGPFD+A SLGHAEINF+K   ++LAD+W+PL GK+AQ+ QSKLHLR
Sbjct  608   EPPSMLDVEVLDFDGPFDEATSLGHAEINFVKTNLSDLADVWIPLQGKLAQACQSKLHLR  667

Query  1868  IFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKR  2047
             IFLNN  G   +++ LTKMEKEVGKK+NLRSP  NS FQK FGLPPEEFLINDF+C LKR
Sbjct  668   IFLNNTRGNNVVKEYLTKMEKEVGKKINLRSPQTNSAFQKLFGLPPEEFLINDFTCHLKR  727

Query  2048  KLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKD  2227
             K+P+QGR+F+S RI+GF+ANLFGHKTKFFFLWEDI++I     + S+MGSP +V+ L K 
Sbjct  728   KMPMQGRLFMSARIIGFHANLFGHKTKFFFLWEDIDDIQFETATLSSMGSPIIVMTLRKG  787

Query  2228  RGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKD  2407
             RG DAR+GAKS D +GRL F FHSFVSF  A RTIMALWK R+  P+QK +I EE + K 
Sbjct  788   RGMDARHGAKSQDAQGRLKFHFHSFVSFNVAQRTIMALWKARSLSPEQKVRIVEESESK-  846

Query  2408  ENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTS  2587
               ++  EETGS+L +EDV M +VYS  L +     +E+F GG+LE++VM K+GCLNY  +
Sbjct  847   --SLQTEETGSFLGLEDVYMPEVYSSVLSLPANFCVELFGGGELEYRVMQKAGCLNYSLT  904

Query  2588  SWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDH  2767
              WEL +  +Y R++ YK ++ +S +  E  STQ++S+  +  GW++ E++ +HGVP  DH
Sbjct  905   PWELDKDGIYVRQICYKFDKCVSRYRGEAVSTQQRSLLPDRNGWVIEEVLTLHGVPLGDH  964

Query  2768  YQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGR  2947
             + +  RY++E   +   +C   VY G+ WLK+T+ + RI+KNI      R+K M+  V +
Sbjct  965   FNLHFRYQIEHAPSKGKACHICVYFGIAWLKSTRHQKRISKNIHSNLQDRLKLMVGEVEK  1024

Query  2948  E  2950
             E
Sbjct  1025  E  1025



>ref|XP_006449996.1| hypothetical protein CICLE_v10014339mg [Citrus clementina]
 ref|XP_006449997.1| hypothetical protein CICLE_v10014339mg [Citrus clementina]
 gb|ESR63236.1| hypothetical protein CICLE_v10014339mg [Citrus clementina]
 gb|ESR63237.1| hypothetical protein CICLE_v10014339mg [Citrus clementina]
Length=783

 Score =   927 bits (2397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/783 (57%), Positives = 582/783 (74%), Gaps = 5/783 (1%)
 Frame = +2

Query  605   IKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQE  784
             +K ++ R  G E+P NL GG+L+DQ Y + P+D N LLF+PDS F R  AE QG  ++Q 
Sbjct  1     MKTMEPRDLGSEVPSNLPGGVLVDQMYVIAPQDLNTLLFSPDSNFPRTWAEEQGNTELQI  60

Query  785   GPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYG  964
             GPW +++  +S L R VTY K A KL+K+ +  EEQTYLK DGK FA+L  VSTP+V YG
Sbjct  61    GPWRFENGCES-LKRDVTYIKAANKLIKATKGFEEQTYLKADGKVFAILASVSTPEVMYG  119

Query  965   STFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFS  1144
              +FK ELL+ I PGP L SGE+S+HLVISW + F +STMMK +IE G +  L++++ +F+
Sbjct  120   GSFKTELLFCITPGPELSSGEQSSHLVISWRMNFLQSTMMKGMIENGARSALRETYEQFA  179

Query  1145  RFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
              FL+Q    + S ++ L+   +LA+L  E  SD +LA  YF NFTVVS+ F+ +Y  +HI
Sbjct  180   TFLSQTITPVDSNDMGLNKEQILASLQPEPQSDWKLAVHYFANFTVVSSFFMGIYVLVHI  239

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
              L+ ST +QGLEF GLDLPDS+GE I CG+LVL  E+  ++I+ F++AR ++GSDHGV+A
Sbjct  240   WLATSTTIQGLEFVGLDLPDSIGEFIVCGVLVLQGERFLQLISRFMQARKQKGSDHGVKA  299

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              GDGW+LTVALI+G NLA++D +GF DP+VVFTCNGKSRTSS++ Q  DP WNEI E++ 
Sbjct  300   QGDGWLLTVALIKGDNLAAVDSSGFCDPYVVFTCNGKSRTSSIKFQQCDPMWNEIFEYDA  359

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
              +EPPSMLDVEV+DFDGPF++A SLGHAEINF+K   ++LAD+W+PL GK+AQ+ QSKLH
Sbjct  360   MDEPPSMLDVEVYDFDGPFNEATSLGHAEINFVKSDISDLADVWIPLQGKLAQACQSKLH  419

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFLNN  G   +++ LTKMEKEVGKK+NLRSP  NS FQK FGLPPEEFLINDF+C L
Sbjct  420   LRIFLNNTKGSNVVKEYLTKMEKEVGKKINLRSPQTNSAFQKLFGLPPEEFLINDFTCHL  479

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRK+ LQGR+FLS RI+GF+ANLFGHKT FFFLWEDIE+I VLPPS S+MGSP +V+ L 
Sbjct  480   KRKMLLQGRLFLSARIIGFHANLFGHKTNFFFLWEDIEDIQVLPPSLSSMGSPVIVMTLR  539

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQY  2401
             + RG DAR+GAK+ DEEGRL F FHSFVS+  A RTIMALWK R+  P+QK QI EE + 
Sbjct  540   QGRGMDARHGAKTQDEEGRLKFHFHSFVSYNVAHRTIMALWKARSLSPEQKVQIVEESEA  599

Query  2402  KDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYV  2581
             K   ++  EE G++L +EDV+MS+VYS  LP+     ME+F GG+LE  VM K+GC++Y 
Sbjct  600   K---SLQSEEGGTFLGLEDVTMSEVYSSVLPVPMSFFMELFGGGELERAVMEKAGCVSYS  656

Query  2582  TSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFS  2761
              SSWE  + DVYER++ Y+ ++ IS +  EVTSTQ+KS   N  GW++ E+M +HGVP  
Sbjct  657   CSSWESEKLDVYERQIYYRFDKCISRYRGEVTSTQQKSPLPNGNGWLVEEVMTLHGVPLG  716

Query  2762  DHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFV  2941
             D++ + LRY+VE   +    C   VY+GV WLK+T+ + RITKNIV     R++  +  +
Sbjct  717   DYFNLHLRYQVEDSPSRPKGCLAQVYLGVAWLKSTRHQKRITKNIVSNLEDRLRVKLSVI  776

Query  2942  GRE  2950
              +E
Sbjct  777   EKE  779



>ref|XP_008384200.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Malus domestica]
 ref|XP_008366095.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Malus domestica]
Length=1018

 Score =   927 bits (2396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/793 (55%), Positives = 585/793 (74%), Gaps = 5/793 (1%)
 Frame = +2

Query  575   RSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELA  754
             +S + +F E +K +QSR +  E P NL GG+L+DQ Y  PP+D N LLF+ DS F++E+A
Sbjct  227   QSSSATFEELMKTIQSRDQESETPTNLPGGVLVDQLYVTPPQDLNTLLFSTDSGFQKEVA  286

Query  755   ELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLV  934
               QGT ++  G W   +  +S + RVVTY K ATKL+K+V+ TE+QTYLK DGK FAVL 
Sbjct  287   XAQGTTELDPGQWKLDTSTES-VKRVVTYVKAATKLIKAVKGTEDQTYLKADGKVFAVLA  345

Query  935   DVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQ  1114
              VSTPDVPYG TFK ELLY I PGP L SGE+S+ LVISW + F +STMMK +IE G +Q
Sbjct  346   SVSTPDVPYGRTFKTELLYCITPGPELPSGEQSSRLVISWRMNFLQSTMMKGMIENGARQ  405

Query  1115  GLKDSFSEFSRFLAQHCKVITSAEVLDN-GHLLATLPSEHPSDLELAREYFCNFTVVSTA  1291
             GLK+SF  ++  L+Q+ K + S ++  N   +LA+L +E  SD +LA +YF NF V+ST 
Sbjct  406   GLKESFDHYATILSQNVKPVDSKDLGSNKDQVLASLQAEPQSDWKLAVQYFANFPVISTL  465

Query  1292  FLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARL  1471
             F+ LY  +HI L++ + +QGLEF GLDLPDS+GE I CG+LVL  E+V  +I+ F++AR 
Sbjct  466   FIGLYMFVHIWLAQPSTIQGLEFVGLDLPDSIGEFIVCGVLVLQGERVLGLISRFMQARA  525

Query  1472  RRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDP  1651
             + GSDHGV+A GDGW+LTVALIEG+N+A++D +GF DP+VVFTCNGK+RTSS++ Q  DP
Sbjct  526   QNGSDHGVKAQGDGWLLTVALIEGSNIAAVDSSGFSDPYVVFTCNGKTRTSSIKFQKCDP  585

Query  1652  QWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGK  1831
              WNEI EF+  +EPPS+LDVEV+DFDGPFD+A SLGHAEINF+K   ++LADLW+PL GK
Sbjct  586   TWNEIFEFDAMDEPPSVLDVEVYDFDGPFDEAISLGHAEINFVKTNISDLADLWVPLQGK  645

Query  1832  IAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEE  2011
             +AQ+ QSKLHLRIFLNN  G   +   LTKMEKEVGKK+ +RSP  NS FQK FGLPPEE
Sbjct  646   LAQACQSKLHLRIFLNNTRGGNVVNQFLTKMEKEVGKKITVRSPQTNSAFQKLFGLPPEE  705

Query  2012  FLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTM  2191
             FLINDF+C LKRK+PLQGR+FLS RI+GF+ANLFGHKTKFFFLWEDIE+I V+PP+ S+M
Sbjct  706   FLINDFTCHLKRKMPLQGRLFLSARIIGFHANLFGHKTKFFFLWEDIEDIQVVPPTLSSM  765

Query  2192  GSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQ  2371
             GSP +V+ L + RG DAR+GAK+ DEEGRL F F SFVSF  A+RTIMALWK R+  P+Q
Sbjct  766   GSPIIVMTLRQGRGMDARHGAKTQDEEGRLKFHFQSFVSFNVANRTIMALWKARSLSPEQ  825

Query  2372  KAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKV  2551
             K +I EE+    +  +  EE+GS+L ++DVSMS+VYS    +     +E+F GG+L+ +V
Sbjct  826   KVKIVEEES---DVKIQAEESGSFLGLDDVSMSEVYSAAHSVPTNFFIELFGGGELDRRV  882

Query  2552  MSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNE  2731
             M K+GCLNY  + WE  + DV  R++ Y+ ++ +S +  EVTSTQ+KS   +  GW++ E
Sbjct  883   MEKAGCLNYSYTPWESEKGDVCVRQIYYRFDKRVSQYRGEVTSTQQKSRLPDRNGWLVQE  942

Query  2732  IMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFS  2911
             +  +H VP  D++ + +RY++E   +    C   VY GV WLK+T+ + RITKN+++   
Sbjct  943   VSXLHAVPLGDYFNLHVRYQIEDLPSTPKGCXVXVYFGVEWLKSTRHQKRITKNVLKNLQ  1002

Query  2912  QRVKEMIEFVGRE  2950
              R+K+    V +E
Sbjct  1003  DRLKDTFSVVEKE  1015



>ref|XP_007213702.1| hypothetical protein PRUPE_ppa000747mg [Prunus persica]
 gb|EMJ14901.1| hypothetical protein PRUPE_ppa000747mg [Prunus persica]
Length=1015

 Score =   926 bits (2392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/789 (56%), Positives = 579/789 (73%), Gaps = 7/789 (1%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             +F E ++ +QSR +  E P NL GG+LLDQ Y  PP+D N  LF+PDS F + LAE+ GT
Sbjct  229   TFEELMRTMQSRDQASETPSNLPGGVLLDQLYVTPPQDINTFLFSPDSGFPKSLAEVHGT  288

Query  770   KDVQEGPWTWKSDNKS-CLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVST  946
              +++ G   WK DN S  + RVVTY K ATKL+K+ + TE+Q YLK DGK FAVL  VST
Sbjct  289   TELEVG--LWKLDNSSESVKRVVTYIKAATKLIKACKGTEDQVYLKADGKVFAVLSSVST  346

Query  947   PDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKD  1126
             PDVPYG TF+ ELLY I PGP L SGE+S+ LVISW + F +STMMK +IE G +QGLKD
Sbjct  347   PDVPYGRTFRTELLYCISPGPELPSGEQSSRLVISWRMNFLQSTMMKGMIENGARQGLKD  406

Query  1127  SFSEFSRFLAQHCKVITSAEVLDN-GHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVL  1303
             SF +F+  L+Q+ K + S ++  N   +LA+L +E  SD +LA +YF NFTVVST F+ L
Sbjct  407   SFDQFATLLSQNVKPVDSKDLGSNKDQVLASLQAEPQSDWKLAVQYFGNFTVVSTVFIGL  466

Query  1304  YFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGS  1483
             Y  +HI L+  + +QGLEF GLDLPDS+GE I CG+LVL  E+V  +I+ F++AR ++GS
Sbjct  467   YMLVHIWLATPSTIQGLEFVGLDLPDSIGEFIVCGVLVLQGERVLGLISRFMQARAQKGS  526

Query  1484  DHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNE  1663
             DHGV+A GDGW+LTVALIEG+N+A++D +GF DP+VVFTCNGK+RTSS++ Q  DP WNE
Sbjct  527   DHGVKAQGDGWLLTVALIEGSNIAAVDSSGFSDPYVVFTCNGKTRTSSIKFQKCDPTWNE  586

Query  1664  ILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQS  1843
             I EF+  +EPPS+LDVE++DFDGPFD+A SLGHAEINF+K   ++LADLW+PL GK+AQ+
Sbjct  587   IFEFDAMDEPPSVLDVEIYDFDGPFDEAISLGHAEINFVKTNISDLADLWVPLRGKLAQA  646

Query  1844  SQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIN  2023
              QSKLHLRIFLNN  G       LTKMEKEVGKK+ +RSP  NS FQK FGLPPEEFLIN
Sbjct  647   CQSKLHLRIFLNNTRGGNVANHFLTKMEKEVGKKITVRSPQTNSAFQKLFGLPPEEFLIN  706

Query  2024  DFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPS  2203
             DF+C LKRK+PLQGR+FLS RI+GF+ANLFGHKTKFFFLWEDIEEI V+PPS S+MGSP 
Sbjct  707   DFTCHLKRKMPLQGRLFLSARIIGFHANLFGHKTKFFFLWEDIEEIQVVPPSLSSMGSPI  766

Query  2204  LVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQI  2383
             +V+ L   RG DAR+GAK+ D EGRL F F SFVSF  A RTIMALWK R+  P+QK QI
Sbjct  767   VVMTLRPGRGMDARHGAKTQDGEGRLKFHFQSFVSFNVAHRTIMALWKARSLSPEQKVQI  826

Query  2384  AEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKS  2563
              EE+    E  +  EE+GS+L ++DVSMS+VYS    +     +E+F GG+L+ +VM K+
Sbjct  827   VEEES---EVKIQSEESGSFLGLDDVSMSEVYSSAHSVPTNFFVELFGGGELDRRVMEKA  883

Query  2564  GCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAI  2743
             GCLNY  + WE  + DV  R++ Y+ ++ +S +  EVTSTQ+KS  ++  GW++ E+  +
Sbjct  884   GCLNYSYTPWESEKGDVCVRQIYYRFDKRVSQYRGEVTSTQQKSRLSDRNGWLVQEVSTL  943

Query  2744  HGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVK  2923
             H VP  D++ + +RY++E   +    C+  VY GV WLK T+ + RITKN+++    R+K
Sbjct  944   HAVPLGDYFNLHIRYQIEDLPSNSKGCQVKVYFGVEWLKGTRHQKRITKNVLKNLQDRLK  1003

Query  2924  EMIEFVGRE  2950
             +    V  E
Sbjct  1004  DTFSVVETE  1012



>ref|XP_002446664.1| hypothetical protein SORBIDRAFT_06g020045 [Sorghum bicolor]
 gb|EES10992.1| hypothetical protein SORBIDRAFT_06g020045 [Sorghum bicolor]
Length=1051

 Score =   924 bits (2387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/795 (56%), Positives = 590/795 (74%), Gaps = 11/795 (1%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             SF EA+++++SR+   EMPE+L GGI+ + TY +  K+ N LLF PDSQF + L ELQGT
Sbjct  255   SFEEAMEIMKSRSTP-EMPEDLDGGIIFEHTYLVESKELNHLLFRPDSQFLKGLRELQGT  313

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
              D +E PWTWKS +   LTR   YTKGA+K +K+V+ +EEQTYLK DGK F ++  V TP
Sbjct  314   MDYEEQPWTWKSMDPPSLTRTCHYTKGASKFMKAVKTSEEQTYLKADGKNFVIMTRVRTP  373

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             +VP+G+ F V LLY I+   GL  GEES HL +S+ V+F +STMM+++IEG  + GLK++
Sbjct  374   EVPFGNCFAVVLLYKIIHCTGLSGGEESAHLTVSYNVEFLQSTMMRSMIEGSVRDGLKEN  433

Query  1130  FSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYF  1309
             F  F+  L++H K+  S   +D   LLA L  EH SD+ LA +YF NFT +ST    LY 
Sbjct  434   FEGFAEVLSRHVKMADSVG-MDKEQLLAPLQVEHQSDIRLAYKYFFNFTAISTVLFALYV  492

Query  1310  SIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDH  1489
              +HI LS+   + GLEF+GLDLPDS GE+IT GILVL L+++  M++HFV ARL+RGSDH
Sbjct  493   LVHIFLSKPGPIMGLEFNGLDLPDSFGELITAGILVLQLQRLLNMVSHFVLARLQRGSDH  552

Query  1490  GVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEIL  1669
             GV+A+GDGW+LTVAL+E T+L  +   G  DP+VVF+CNG +RTSSVQLQT +PQWNEI+
Sbjct  553   GVKANGDGWLLTVALLEATSLPPVS-CGSVDPYVVFSCNGITRTSSVQLQTQEPQWNEIM  611

Query  1670  EFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQ  1849
             EF+  EEPP++LDVEVF+FDGPFD A SLGHAEINFLKHTS ELAD+W+PL GK+AQ+ Q
Sbjct  612   EFDAMEEPPAVLDVEVFNFDGPFDLAISLGHAEINFLKHTSVELADIWVPLEGKLAQTCQ  671

Query  1850  SKLHLRIFLNNNNGVET-IRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
             S+LHLR+FL N  G ET +R+ L+KMEKEVGKKL++RSPHRNSTFQK F LP EEFLI D
Sbjct  672   SRLHLRVFLENTKGPETSMREYLSKMEKEVGKKLHVRSPHRNSTFQKLFNLPHEEFLIAD  731

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             ++CSLKRKLPLQGR+F+S RIVGFYANLFGHKTKFFFLWED+EEI VL PSF+T+G+PSL
Sbjct  732   YACSLKRKLPLQGRLFVSARIVGFYANLFGHKTKFFFLWEDVEEIEVLQPSFTTVGTPSL  791

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIA  2386
             + IL   RG DA++GAKS D+EGRL F FHSF SF  ASRTI+ LWKT++   + +A++ 
Sbjct  792   LFILKSGRGLDAKSGAKSQDKEGRLKFQFHSFASFSKASRTIIGLWKTKSSAIEHRAKL-  850

Query  2387  EEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSG  2566
             EE   +D ++V  +E  + L + DV +SK Y+++ P++   LM +F+GG LE + MS+ G
Sbjct  851   EEDHEEDASSVDLDEVQAVLSIGDVPLSKEYTLEHPIDADLLMGVFDGGALETRTMSRVG  910

Query  2567  CLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIH  2746
             CL+Y  + WE + P V ER VSYK NR +SIFG EV STQ K    +  GW +++++ +H
Sbjct  911   CLDYSATPWEAVRPGVLERHVSYKFNRYMSIFGGEVVSTQLKFPAEDGGGWTIHDVVTLH  970

Query  2747  GVPFSDHY------QVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKF  2908
              VPF D++      +V LRY V+S ++   S RC++ VG+ WLK++K + RI +NI  K 
Sbjct  971   NVPFGDYFRVYIRARVHLRYNVQSATSEAPSSRCEILVGIEWLKSSKFQKRIARNICEKL  1030

Query  2909  SQRVKEMIEFVGREV  2953
             + R KE++E  G+E+
Sbjct  1031  AHRAKEVLEVAGKEI  1045



>ref|XP_008370961.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Malus domestica]
Length=1018

 Score =   923 bits (2385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/788 (56%), Positives = 583/788 (74%), Gaps = 5/788 (1%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             +F E +K + SR +  E P NL GG+LLDQ Y  PP+D N LLF+ DS F +E+A++ GT
Sbjct  232   TFEELMKTILSRDQESETPTNLPGGVLLDQLYVTPPQDLNTLLFSTDSGFHKEVADVHGT  291

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
              ++  G W   +  ++ + RVVTY K ATKL+K+V+ TE+QTYLK DGK FAVL  VSTP
Sbjct  292   TELDLGQWKLDTSTET-VKRVVTYIKSATKLIKAVKGTEDQTYLKADGKVFAVLASVSTP  350

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             DVPYG TFK ELLY I PGP L SGE+S+ LVISW + F +STMMK +IE G +QGLKDS
Sbjct  351   DVPYGRTFKTELLYCITPGPELPSGEQSSRLVISWRMNFLQSTMMKGMIENGARQGLKDS  410

Query  1130  FSEFSRFLAQHCKVITSAEVLDN-GHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLY  1306
             F  F+  L+Q+ K + S ++  N   +LA+L +E  SD +LA +YF NF+V+ST F+ LY
Sbjct  411   FDHFATLLSQNVKPVDSKDLGSNKDQVLASLQAEPQSDWKLAVQYFANFSVISTLFIGLY  470

Query  1307  FSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSD  1486
               +HI L++ + +QGLEF GLDLPDS+GE I CG+LVL  E+V  +I+ F++AR + GSD
Sbjct  471   MLVHIWLAQPSTIQGLEFVGLDLPDSIGEFIVCGVLVLQGERVLGLISRFMQARAQNGSD  530

Query  1487  HGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEI  1666
             HGV+A GDGW+LTVALIEG+N+A++D +GF DP+VVFTCNGK+RTSS++ Q  +P WNEI
Sbjct  531   HGVKAQGDGWLLTVALIEGSNIAAVDTSGFSDPYVVFTCNGKTRTSSIKFQKCNPTWNEI  590

Query  1667  LEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSS  1846
              EF+  +EPPS+LDVEV+DFDGPFD+A SLGHAEINF+K   ++LADLW+PL GK+AQ+ 
Sbjct  591   FEFDAMDEPPSVLDVEVYDFDGPFDEATSLGHAEINFVKTNISDLADLWVPLQGKLAQAC  650

Query  1847  QSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
             QSKLHLRIFLNN  G       LTKMEKEVGKK+ +RSP  NS FQK FGLPPEEFLIND
Sbjct  651   QSKLHLRIFLNNTRGGNVANHFLTKMEKEVGKKITVRSPQTNSAFQKLFGLPPEEFLIND  710

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             F+C LKRK+PLQGR+FLS RI+GF+ANLFGHKTKFFFLWEDIE+I V+PP+ S+MGSP +
Sbjct  711   FTCHLKRKMPLQGRLFLSARIIGFHANLFGHKTKFFFLWEDIEDIQVVPPTLSSMGSPIV  770

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIA  2386
             V+ L + RG DAR+GAK+ DEEGRL F F SFVSF  A+RTIMALWK R+  P+QK QI 
Sbjct  771   VMTLRQGRGMDARHGAKTQDEEGRLKFHFQSFVSFNVANRTIMALWKARSLSPEQKVQIV  830

Query  2387  EEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSG  2566
             EE+    +  +  EE+GS+L ++DVSMS+VYS    +     +E+F GG+L+ +VM K+G
Sbjct  831   EEES---DVKIQAEESGSFLGLDDVSMSEVYSAAHSVPTNFFIELFGGGELDRRVMEKAG  887

Query  2567  CLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIH  2746
             CLNY  + WE  + DV  R++ Y+ ++ +S +  EVTSTQ+KS  ++  GW++ E+  +H
Sbjct  888   CLNYSYTPWESEKGDVCVRQIYYRFDKRVSQYRGEVTSTQQKSRLSDRNGWLVQEVSTLH  947

Query  2747  GVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKE  2926
              VP  D++ + +RY++E   +    C+  VY GV WLK+T+ + RITKN+++    R+K+
Sbjct  948   AVPLGDYFNLHVRYQIEDLPSTPKGCQVKVYFGVEWLKSTRHQKRITKNVLKNLQDRLKD  1007

Query  2927  MIEFVGRE  2950
                 V +E
Sbjct  1008  TFSVVEKE  1015



>ref|XP_004293413.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Fragaria vesca subsp. vesca]
Length=1012

 Score =   922 bits (2382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/905 (51%), Positives = 637/905 (70%), Gaps = 24/905 (3%)
 Frame = +2

Query  269   GKILLTLSL--HGKGHDLSTNHACFVQPS-VGSETSKDVDAIKVSSPKK-VLEGKQ----  424
             G+ILL +S   +    D ++    F + S VG+E+       + +SP++  L+ K+    
Sbjct  117   GEILLNISFITNNAFSDSASEGDHFRRDSDVGAESPSRSFVSETASPQRGKLDDKEEKEK  176

Query  425   --LIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFC  598
                 KS+AG L ++F+KN +    +   S K + +EL  I     ++      S +  F 
Sbjct  177   SLAQKSLAGRLVQMFNKNPDVPAISSTHSSKTDLTELVDIAEATSED-----HSASVPFD  231

Query  599   EAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDV  778
             E +K +QSR +  E PENL GG+LLDQ Y   PK  N L+F+PDS F + LA++ GT ++
Sbjct  232   ELMKTMQSREQPAETPENLPGGVLLDQMYVTEPKHLNTLIFSPDSTFPKALADVHGTTEL  291

Query  779   QEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVP  958
             ++GPW +++D   CL RVVTY K A+KLVK+ +ATE+Q YLK DGK FAVL  VSTPDVP
Sbjct  292   EQGPWKFEND---CLKRVVTYVKAASKLVKACKATEDQQYLKADGKVFAVLASVSTPDVP  348

Query  959   YGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSE  1138
             YG TF+ ELL+ I PGP L SGE+ T  VISW + F +STMMK +IE G +QGLKDS+ +
Sbjct  349   YGKTFRTELLFCITPGPELPSGEQCTRFVISWRMNFLQSTMMKGMIENGARQGLKDSYEQ  408

Query  1139  FSRFLAQHCKVITSAEVLDN-GHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSI  1315
             ++  L+Q+ K   S ++  N   +LA+L +E  SD +LA +YF NFTVVST F+  Y  +
Sbjct  409   YATLLSQNVKPADSKDLGSNKDQVLASLQAEPQSDWKLAVQYFANFTVVSTFFIGFYMMV  468

Query  1316  HILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGV  1495
             HI L+  + +QGLEF GLDLPDS+GE I CG+L L  E+V  +I+ F++AR+++GSDHGV
Sbjct  469   HIWLATPSTIQGLEFVGLDLPDSLGEFIVCGVLALQGERVLGLISRFMQARVQKGSDHGV  528

Query  1496  RAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEF  1675
             +A GDGW+LTVALIEG+N+A++D TGF DP+VVF+CNGK+RTSS++ Q  DP WNEI EF
Sbjct  529   KARGDGWLLTVALIEGSNIAAVDSTGFSDPYVVFSCNGKTRTSSIKFQKCDPMWNEIFEF  588

Query  1676  EPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSK  1855
             +  +EPPS+LDVE++DFDGPFD+A SLGHAEINF+K   ++LADLW+PL GK+AQ+ QSK
Sbjct  589   DAMDEPPSVLDVEIYDFDGPFDEATSLGHAEINFVKTNISDLADLWIPLQGKLAQACQSK  648

Query  1856  LHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSC  2035
             LHLRIFLNN  G   +   + KMEKEVGKK+ +RSP  NS FQK FGLPPEEFLINDF+C
Sbjct  649   LHLRIFLNNTRGGNVVNHFINKMEKEVGKKITVRSPQTNSAFQKLFGLPPEEFLINDFTC  708

Query  2036  SLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVII  2215
              LKRK+PLQGR+FLS RI+GF+ANLFG KTKFFFLWEDIE+I+++PP+ S+MGSP++V+ 
Sbjct  709   HLKRKMPLQGRLFLSARIIGFHANLFGRKTKFFFLWEDIEDIHIVPPTLSSMGSPTIVMT  768

Query  2216  LHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQ  2395
             L + RG DAR+GAK+ DEEGRL F F SFVSF  A+RTIMALWK R+  P+QK QI EE+
Sbjct  769   LRQGRGMDARHGAKTQDEEGRLKFHFQSFVSFNVANRTIMALWKARSLSPEQKVQIIEEE  828

Query  2396  QYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLN  2575
                +  ++  +E+GS+L ++DVSMS+V+S    +     +E+F GGDL+ +VM K+GCLN
Sbjct  829   S--EVKSLQTDESGSFLGLDDVSMSEVHSSSHAVPANFFVELFGGGDLDRRVMEKAGCLN  886

Query  2576  YVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVP  2755
             Y  + WE  + DVY R++ Y+ ++ +S +  EVTSTQ+KS  ++  GW+  E+M +H +P
Sbjct  887   YSHTPWESEKGDVYVRQIYYRYDKRVSQYRGEVTSTQQKSCLSDKNGWLFQEVMTLHAIP  946

Query  2756  FSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIE  2935
               D++ V +RY++E        C+  V  G+ WLK+TK + RITKN+++    R+K    
Sbjct  947   LGDYFNVHIRYQIEDTPPG---CQVKVSFGIEWLKSTKHQKRITKNVLKNLQDRLKVSFA  1003

Query  2936  FVGRE  2950
              V +E
Sbjct  1004  VVEKE  1008



>ref|XP_009359067.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Pyrus x bretschneideri]
Length=1018

 Score =   921 bits (2381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/789 (56%), Positives = 583/789 (74%), Gaps = 7/789 (1%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             +F E +K + SR +  E P NL GG+LLDQ Y  PP+D N LLF+ DS F +E+A++ GT
Sbjct  232   TFEELMKTILSRDQESETPTNLPGGVLLDQLYVTPPQDLNTLLFSTDSGFHKEVADVHGT  291

Query  770   KDVQEGPWTWKSDNKS-CLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVST  946
              ++  G   WK DN +  + RVVTY K ATKL+K+V+ TE+QTYLK DGK FAVL  VST
Sbjct  292   TELDLG--QWKLDNSTESVKRVVTYIKSATKLIKAVKGTEDQTYLKADGKVFAVLASVST  349

Query  947   PDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKD  1126
             PDVPYG TFK ELLY I PGP L SGE+S+ LVISW + F +STMMK +IE G +QGLKD
Sbjct  350   PDVPYGRTFKTELLYCITPGPELPSGEQSSRLVISWRMNFLQSTMMKGMIENGARQGLKD  409

Query  1127  SFSEFSRFLAQHCKVITSAEVLDN-GHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVL  1303
             SF  F+  L+Q+ K + S ++  N   +LA+L +E  SD +LA +YF NF+V+ST F+ L
Sbjct  410   SFDHFATLLSQNVKPVDSKDLGSNKDQVLASLQAEPQSDWKLAVQYFANFSVISTLFIGL  469

Query  1304  YFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGS  1483
             Y  +HI L++ + +QGLEF GLDLPDS+GE I CG+LVL  E+V  +I+ F++AR + GS
Sbjct  470   YMLVHIWLTQPSTIQGLEFVGLDLPDSIGEFIVCGVLVLQGERVLGLISRFMQARAQNGS  529

Query  1484  DHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNE  1663
             DHGV+A GDGW+LTVALIEG+N+A++D +GF DP+VVFTCNGK+RTSS++ Q  +P WNE
Sbjct  530   DHGVKAQGDGWLLTVALIEGSNIAAVDSSGFSDPYVVFTCNGKTRTSSIKFQKCNPTWNE  589

Query  1664  ILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQS  1843
             I EF+  +EPPS+LDVEV+DFDGPFD+A SLGHAEINF+K   ++LADLW+PL GK+AQ+
Sbjct  590   IFEFDAMDEPPSVLDVEVYDFDGPFDEATSLGHAEINFVKTNISDLADLWVPLQGKLAQA  649

Query  1844  SQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIN  2023
              QSKLHLRIFLNN  G       LTKMEKEVGKK+ +RSP  NS FQK FGLPPEEFLIN
Sbjct  650   CQSKLHLRIFLNNTRGGNVANHFLTKMEKEVGKKITVRSPQTNSAFQKLFGLPPEEFLIN  709

Query  2024  DFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPS  2203
             DF+C LKRK+PLQGR+FLS RI+GF+ANLFGHKTKFFFLWEDIE+I V+PP+ S+MGSP 
Sbjct  710   DFTCHLKRKMPLQGRLFLSARIIGFHANLFGHKTKFFFLWEDIEDIQVVPPTLSSMGSPI  769

Query  2204  LVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQI  2383
             +V+ L + RG DAR+GAK+ DEEGRL F F SFVSF  A+RTIMALWK R+  P+QK QI
Sbjct  770   VVMTLRQGRGMDARHGAKTQDEEGRLKFHFQSFVSFNVANRTIMALWKARSLSPEQKVQI  829

Query  2384  AEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKS  2563
              EE+    +  +  EE+GS+L ++DV+MS+VYS    +      E+F GG+L+ +VM K+
Sbjct  830   VEEES---DVKIQAEESGSFLGLDDVNMSEVYSAAHSVPTNFFTELFGGGELDRRVMEKA  886

Query  2564  GCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAI  2743
             GCLNY  + WE  + DV  R++ Y+ ++ +S +  EVTSTQ+KS  ++  GW++ E+  +
Sbjct  887   GCLNYSYTPWESEKGDVCVRQIYYRFDKRVSQYRGEVTSTQQKSRLSDRNGWLVQEVSTL  946

Query  2744  HGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVK  2923
             H VP  D++ + +RY++E   +    C+  VY GV WLK+T+ + RITKN+++    R+K
Sbjct  947   HAVPLGDYFNLHVRYQIEDLPSTPKGCQVKVYFGVEWLKSTRHQKRITKNVLKNLQDRLK  1006

Query  2924  EMIEFVGRE  2950
             +    V +E
Sbjct  1007  DTFSVVEKE  1015



>emb|CDP04547.1| unnamed protein product [Coffea canephora]
Length=1042

 Score =   921 bits (2381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/924 (50%), Positives = 632/924 (68%), Gaps = 33/924 (4%)
 Frame = +2

Query  269   GKILLTLSLH-----------GKGHDLSTNHACFV-----QPSVGSETSKDVDAIKVSSP  400
             G+ILLT+ L            G    LS  +A        +P+ G   S     ++ ++P
Sbjct  117   GEILLTICLSQSNSFVDSQSVGDNGPLSRKYADMTMGSPSRPANGPPRSPSPVRLEEAAP  176

Query  401   KKVLEGKQLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRS  580
                 E +   ++ AG + ++F+KN +++ +             S+  +D ED   +   S
Sbjct  177   APSKEERSHAQTFAGRIAQMFNKNGDTASAATNKVPDVLEPFESANSADDEDKSDDQPSS  236

Query  581   QTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAEL  760
                SF E ++ L+++ +G ++P NL GG++LDQ YA+ P + N LLF+ DS F +   ++
Sbjct  237   S--SFEELMRSLEAKEQGGDIPSNLPGGVVLDQMYAIAPHELNSLLFSQDSNFFKSATDM  294

Query  761   QGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDV  940
             QG+ +++ GPW +++  ++ LTR V+Y K ATKL+K+++ATE+QTYLK DG  FAV   V
Sbjct  295   QGSTELRVGPWKFENGGEN-LTRTVSYIKAATKLIKALRATEDQTYLKADGNTFAVFSSV  353

Query  941   STPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGL  1120
             STPD PYGS F+ E+LY I  GP L SGE+S+ LV+SW + F +STMMK +IE G +QG+
Sbjct  354   STPDAPYGSCFRAEVLYCITSGPELPSGEQSSRLVVSWRMNFLQSTMMKGMIESGARQGI  413

Query  1121  KDSFSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFL  1297
             KDSF  +   L+Q  K +   +V  +   +LA+L  E  SD +LA EYF NFTV+ST F+
Sbjct  414   KDSFVVYGNLLSQTVKPVDMKDVSTEKEQVLASLKVEQQSDWKLAVEYFANFTVISTIFV  473

Query  1298  VLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRR  1477
              LY  +HI L+    +QGLEF GLDLPDS+GE++ CGILVL  ++V  +++ F++AR+R+
Sbjct  474   GLYVFVHISLAMPGTIQGLEFVGLDLPDSIGELVVCGILVLQGKRVLELMSRFMQARVRK  533

Query  1478  GSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQW  1657
             GSDHG++A GDGW+LTVALIEG NLA++D +G+ DP+VVFTCNGK+RTSS++ Q  DP W
Sbjct  534   GSDHGIKAQGDGWLLTVALIEGNNLAAVDSSGYSDPYVVFTCNGKTRTSSIKFQKSDPLW  593

Query  1658  NEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIA  1837
             NEI EF+  +EPPS+L+VE+FDFDGPFD+A SLGH EINFLK   ++L+D+W+PL GK+A
Sbjct  594   NEIFEFDAMDEPPSVLEVEIFDFDGPFDEATSLGHTEINFLKSNISDLSDVWVPLQGKLA  653

Query  1838  QSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFL  2017
             Q+ QSKLHLRIFLNN  G   ++D L+KMEKEVGKK+ LRSP  NS FQK FGLPPEEFL
Sbjct  654   QACQSKLHLRIFLNNTRGTNVVKDFLSKMEKEVGKKIRLRSPQTNSAFQKLFGLPPEEFL  713

Query  2018  INDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGS  2197
             INDF+C LKRK+PLQGR+FLS RI+GF+A+LFGHKTKFFFLWEDIE+I V+ P+ S+MGS
Sbjct  714   INDFTCHLKRKMPLQGRLFLSARIIGFHADLFGHKTKFFFLWEDIEDIQVVAPTLSSMGS  773

Query  2198  PSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKA  2377
             P +++ L   RG DAR+GAK+ DE GRL F FHSFVSF  A+RTIMALWK RA  P+QK 
Sbjct  774   PIVIMTLKPGRGFDARHGAKTQDEAGRLKFHFHSFVSFNIANRTIMALWKARALSPEQKV  833

Query  2378  QIAEEQ---------QYKDEN----NVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLME  2518
             QI EE+         Q  DE+    ++  EETGS+L VEDVSMS +YS  L +     ME
Sbjct  834   QIVEEESETKNLQVSQETDEDSESKSLHAEETGSFLGVEDVSMSLLYSSVLSIPMSFFME  893

Query  2519  MFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSV  2698
             +F G D++ KVM + GCLNY  S WE  +PDVY+R++ YK ++ IS +  EVTSTQ+KS 
Sbjct  894   LFGGNDIDRKVMERVGCLNYSYSPWESEKPDVYQRQLYYKFDKRISRYRGEVTSTQQKSR  953

Query  2699  HANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLED  2878
              +   GW++ E+M +HGVP  D++ + +RY+VE   +    C   VY G+ WLK T+ + 
Sbjct  954   LSERNGWVIEEVMTLHGVPLGDYFNLHMRYQVEDAPSRSMGCSVQVYFGLAWLKYTRHQK  1013

Query  2879  RITKNIVRKFSQRVKEMIEFVGRE  2950
             RITKNI+    +R+  M   + +E
Sbjct  1014  RITKNILVNLQERLLVMFSVLEKE  1037



>emb|CAH67319.1| OSIGBa0106G07.15 [Oryza sativa Indica Group]
Length=1039

 Score =   920 bits (2377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/795 (56%), Positives = 588/795 (74%), Gaps = 12/795 (2%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             SF EA+++++S++   +MPE+L GG++ D TY +  K+ N L+F PDSQF +EL ELQGT
Sbjct  244   SFEEAMEIMKSKSIP-DMPEDLSGGVMFDHTYLVDSKNLNSLVFGPDSQFSKELRELQGT  302

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
              D +E PWTW ++N   LTR   YTKGATK +K+V+  EEQTYLK DGK + ++  V TP
Sbjct  303   TDYEEQPWTWNNNNPPSLTRTCQYTKGATKFMKAVKTIEEQTYLKADGKSYVIMTRVRTP  362

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             +VP+G+ F+V +LY I+  P   SGE  +HL +S+ V+F +STMMK++IEG  + GLK++
Sbjct  363   EVPFGNCFEVVMLYKIIHYPESSSGEGMSHLTVSYNVEFLQSTMMKSMIEGSVRDGLKEN  422

Query  1130  FSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYF  1309
             F  ++  L++H K+  SA  +D   LLA L ++H SD+ LA +YFCNFTV+ST  + LY 
Sbjct  423   FESYAEILSRHVKIADSAG-MDKERLLAPLQTDHQSDIRLAYKYFCNFTVISTVIMALYV  481

Query  1310  SIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDH  1489
              +HI LSR   L GLEF GLDLPD+ GE+I  GILVL LE++  MI+ FVEAR++RGSDH
Sbjct  482   LVHIFLSRPGPLMGLEFKGLDLPDTFGELIISGILVLQLERLLSMISRFVEARVQRGSDH  541

Query  1490  GVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEIL  1669
             G++A+GDGW+LTVAL+E T+L  +  +G  DP+VVF+CNG +RTSSVQLQT DPQWNEI+
Sbjct  542   GIKANGDGWLLTVALLEATSLPPVS-SGSVDPYVVFSCNGITRTSSVQLQTHDPQWNEIM  600

Query  1670  EFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQ  1849
             EF+  EEPP+ LDVEVF+FDGPFD A SLGHAEINFLKHTSAELAD+W+PL GK+AQ+ Q
Sbjct  601   EFDAMEEPPATLDVEVFNFDGPFDLAVSLGHAEINFLKHTSAELADIWVPLEGKLAQTCQ  660

Query  1850  SKLHLRIFLNNNNGVET-IRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
             S+LHLRIFL N  G ET +R+ L+KMEKEVGKKL+++SPHRN+TFQK FGLP EEFLI D
Sbjct  661   SRLHLRIFLENTKGPETSMREYLSKMEKEVGKKLHVQSPHRNATFQKLFGLPHEEFLIAD  720

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             ++CSLKRKLPLQGR+FLS RIVGFYANLFGHKTKFFFLWED+EEI  L PSF+T+G+PSL
Sbjct  721   YACSLKRKLPLQGRLFLSARIVGFYANLFGHKTKFFFLWEDVEEIEELTPSFTTVGTPSL  780

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIA  2386
             + +L   RG DA+NGAKS D+EGRL F FHSF SF  ASRTI+ LWKT++   +Q+A++ 
Sbjct  781   LFVLKSGRGLDAKNGAKSQDKEGRLKFQFHSFASFSKASRTIIGLWKTKSSAIEQRAKLE  840

Query  2387  EEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSG  2566
             E+Q+  DEN V   +  S L + DV +SK Y+++LP++   LM +F+GG LE K MS+ G
Sbjct  841   EDQE--DENYVDLNDVQSVLSIGDVPLSKEYTLELPIDADLLMGVFDGGPLEAKAMSRVG  898

Query  2567  CLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIH  2746
             CL+Y  + W+   P V ER  SYK NR +SIFG EV STQ +    +  GW + +++ + 
Sbjct  899   CLDYAATPWQDARPGVLERHASYKFNRYMSIFGGEVVSTQLRLPSDDGDGWTVYDVITLR  958

Query  2747  GVPFSDHYQVQLRYKVESC------SAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKF  2908
              VPF D ++V LR+ + S       +A  +  RC++ VG+ W+K +K + RI +NI  K 
Sbjct  959   NVPFGDFFRVHLRHNIRSVEAASSEAATSSGSRCEILVGIEWVKRSKFQKRIARNICEKL  1018

Query  2909  SQRVKEMIEFVGREV  2953
             + R KE++E   RE+
Sbjct  1019  AHRAKEVLEAAAREI  1033



>ref|XP_009407049.1| PREDICTED: LOW QUALITY PROTEIN: C2 and GRAM domain-containing 
protein At1g03370 [Musa acuminata subsp. malaccensis]
Length=1084

 Score =   919 bits (2375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/796 (55%), Positives = 586/796 (74%), Gaps = 16/796 (2%)
 Frame = +2

Query  566   ETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRR  745
             E  +S   +F +A++++Q+R +  ++PENLQGGILL+QTY + PK  N LL+ P+SQFRR
Sbjct  299   EDAKSLDGTFEDAMEIMQTRDQ-IDIPENLQGGILLEQTYMIEPKHLNSLLYKPNSQFRR  357

Query  746   ELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFA  925
             +LA+ QG+ D +E PW W+  +  CL+R V+YTK ATKLVK+V+ATEEQ YLK DGK+FA
Sbjct  358   DLAQQQGSLDYEEKPWKWRCQDNPCLSRFVSYTKSATKLVKAVKATEEQVYLKADGKKFA  417

Query  926   VLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGG  1105
             VL  V TP+VPYG+ F+V LLY I PGP L SGE S+ L ISW + F +ST+MK++IE  
Sbjct  418   VLNRVCTPNVPYGNCFQVLLLYKITPGPDLSSGETSSCLSISWDINFHQSTVMKSIIEAT  477

Query  1106  TQQGLKDSFSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVS  1285
              +QGLK+S+  F+  L+ H K ++S E     HLLA L  +H S+ +L  +YFCN TV S
Sbjct  478   ARQGLKESYESFAELLSHHIKPLSSKE-----HLLAPLQLDHRSNWKLFMQYFCNPTVCS  532

Query  1286  TAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEA  1465
             T  + LY   HILLS   ++QGLEF G DLPD+ GE+I  GIL L ++ V  MI+HFV+A
Sbjct  533   TILMALYVFCHILLSEPQKIQGLEFDGFDLPDTFGELIVAGILFLQVQHVVTMISHFVQA  592

Query  1466  RLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTL  1645
             RL+RGSDHG+ AHGDGW+LTVAL+EG+ L S  P GFPDP+VVF+CNG+SRTSSVQLQT 
Sbjct  593   RLQRGSDHGIEAHGDGWLLTVALVEGSRLPSAAP-GFPDPYVVFSCNGRSRTSSVQLQTA  651

Query  1646  DPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLG  1825
             +PQWN+ILEF+   EPPS+LDV+VF F+GPFD+   LGHAEI+FL+HT  ELAD+W+ L 
Sbjct  652   NPQWNDILEFDAMREPPSVLDVQVFSFEGPFDRELCLGHAEISFLRHTREELADMWISLE  711

Query  1826  GKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPP  2005
             G++A+SS+SKLHLRIF+ +  G ETIR+ L KMEKEVGKKLN  SP++NSTFQK F LPP
Sbjct  712   GRLARSSRSKLHLRIFVGSTGGAETIREYLRKMEKEVGKKLNFPSPNKNSTFQKIFALPP  771

Query  2006  EEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFS  2185
             EEFLI++FSC LKRKLPLQG+++LS R+ GFYAN FG+KTKFFFLWEDIE+I+VL PS +
Sbjct  772   EEFLIHEFSCCLKRKLPLQGKVYLSARVFGFYANFFGYKTKFFFLWEDIEDIHVLSPSLT  831

Query  2186  TMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIP  2365
             T+GSP+LV+ L   RG DAR GAK++D+EGRL F F SF SFG ASRTIMALW +++   
Sbjct  832   TVGSPALVVTLRSGRGLDARRGAKTLDDEGRLKFQFQSFASFGKASRTIMALWGSKSRAG  891

Query  2366  DQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEH  2545
             +Q A++ E+Q  +         + S L  ED  +SK YS++LP++   LME+F+GG LE 
Sbjct  892   EQHAKVEEDQVDQVMCCDKRGNSDSILSSEDFDLSKAYSLELPLDVDVLMEVFDGGCLEK  951

Query  2546  KVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWIL  2725
             K+M K GCLNY  + WE  + D Y+R V YK N  + +FG EV STQRK+   +  GW +
Sbjct  952   KIMGKVGCLNYRVTQWEATKLDCYQRSVDYKFNSHMCVFGGEVCSTQRKNRTIDGDGWKV  1011

Query  2726  NEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRK  2905
             +E M IH VP  DH++V+         +  ++ +CDV++GV W++++KL+ RIT+N+  K
Sbjct  1012  DEAMTIHNVPLEDHFRVR---------SNXSASKCDVWIGVEWIRSSKLQKRITRNVCEK  1062

Query  2906  FSQRVKEMIEFVGREV  2953
              ++R KE++E V +E 
Sbjct  1063  LAERWKEILELVEKEA  1078



>gb|AES64583.2| C2 and GRAM domain plant-like protein [Medicago truncatula]
Length=1023

 Score =   919 bits (2375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/800 (54%), Positives = 580/800 (73%), Gaps = 4/800 (1%)
 Frame = +2

Query  560   VQETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQF  739
             V+   +S   +F EA+K LQS  +G E+P NL GG+L+DQ Y + P+D N LLF+ +S F
Sbjct  225   VKTEDQSSDMTFDEAMKKLQSSDQGSEIPTNLPGGLLVDQYYTIAPEDLNTLLFSSESNF  284

Query  740   RRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKE  919
              R LA++Q + ++Q GPW +++  +S L R+V+Y K  +KL+K+V+A EEQTYLK DGK 
Sbjct  285   LRSLADVQVSTELQLGPWKFENGGES-LKRLVSYVKAPSKLIKAVKAFEEQTYLKADGKN  343

Query  920   FAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIE  1099
             FAVLV VSTPDV YGSTF+VE+LY I PGP L SGE+ +HLVISW + F +STMMK +IE
Sbjct  344   FAVLVSVSTPDVVYGSTFRVEILYTITPGPELPSGEQCSHLVISWRMNFLQSTMMKGMIE  403

Query  1100  GGTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYFCNFT  1276
              G +QG+KDSF +++  LAQ  K +   E+  N    LA+L +E  SD +LA +YF NFT
Sbjct  404   NGARQGVKDSFEQYANLLAQDVKPVDPTELSSNKEQALASLQAEPQSDWKLAVQYFANFT  463

Query  1277  VVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHF  1456
             VVST F+ LY  +HI L+  + +QGLEF GLDLPDS+GE + C +LVL  E++   I+ F
Sbjct  464   VVSTVFIGLYVLVHIWLAAPSTIQGLEFAGLDLPDSIGEFVVCAVLVLQGERMLGFISRF  523

Query  1457  VEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQL  1636
             ++AR ++GSDHG++A GDGW+LTVALIEG NLAS+D  G+ DP+VVFTCNGK RTSS++ 
Sbjct  524   IKARAQKGSDHGIKAQGDGWLLTVALIEGNNLASVDSGGYSDPYVVFTCNGKVRTSSIKF  583

Query  1637  QTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWL  1816
             Q  +P WNEI EF+  ++PPS++DVEV+DFDGPFD    LGHAEINFLK   ++LAD+W+
Sbjct  584   QKSNPLWNEIFEFDAMDDPPSVMDVEVYDFDGPFDATTCLGHAEINFLKVNISDLADIWV  643

Query  1817  PLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFG  1996
             PL GK+A + QSKLHLRIFL+N  G    +D L KMEKEVGKK+N+RSP  NS FQK F 
Sbjct  644   PLEGKLASACQSKLHLRIFLDNTRGGNVAKDYLNKMEKEVGKKINMRSPQTNSAFQKLFA  703

Query  1997  LPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPP  2176
             LPPEEFLINDF+C LKRK+PLQGR+FLS RI+GF+ANLFG KTKFFFLWEDIEEI V+PP
Sbjct  704   LPPEEFLINDFTCHLKRKMPLQGRLFLSPRIIGFHANLFGKKTKFFFLWEDIEEIQVVPP  763

Query  2177  SFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRA  2356
             +FS+MGSP +VI L   RG DAR+GAK+ DE+GRL F F SFVSF  A RTIMALWK R+
Sbjct  764   TFSSMGSPIVVITLRPGRGVDARHGAKTQDEQGRLKFHFQSFVSFSVAHRTIMALWKARS  823

Query  2357  CIPDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGD  2536
               P+QK +  E++   +   ++ E++  +L+V+DVSMS++YS  LP+    LME+F+GG+
Sbjct  824   LTPEQKMKFVEQES--ETKTLISEDSCPFLVVDDVSMSEIYSCSLPIPASFLMEIFSGGE  881

Query  2537  LEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAG  2716
             ++ +VM  SGCLNY  + W     D+ ER V YK  + IS +  EVTSTQ++S   +  G
Sbjct  882   VDRRVMENSGCLNYSYTPWVSENSDISERAVYYKFEKHISSYKGEVTSTQQRSPLLDGKG  941

Query  2717  WILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNI  2896
             W++ E++ +HGVP  D++ + +RY +E        CR  V+ GV WLK+TK + RITKNI
Sbjct  942   WVVEEVLNLHGVPLGDYFNIHIRYHIEDLPPKAKGCRVQVFFGVEWLKSTKNQKRITKNI  1001

Query  2897  VRKFSQRVKEMIEFVGREVF  2956
             ++   +R+K       +E+ 
Sbjct  1002  LQNLQERLKVTFSLAEKELL  1021



>ref|XP_003594332.1| Synaptotagmin-1 [Medicago truncatula]
Length=1042

 Score =   918 bits (2373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/800 (54%), Positives = 580/800 (73%), Gaps = 4/800 (1%)
 Frame = +2

Query  560   VQETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQF  739
             V+   +S   +F EA+K LQS  +G E+P NL GG+L+DQ Y + P+D N LLF+ +S F
Sbjct  244   VKTEDQSSDMTFDEAMKKLQSSDQGSEIPTNLPGGLLVDQYYTIAPEDLNTLLFSSESNF  303

Query  740   RRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKE  919
              R LA++Q + ++Q GPW +++  +S L R+V+Y K  +KL+K+V+A EEQTYLK DGK 
Sbjct  304   LRSLADVQVSTELQLGPWKFENGGES-LKRLVSYVKAPSKLIKAVKAFEEQTYLKADGKN  362

Query  920   FAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIE  1099
             FAVLV VSTPDV YGSTF+VE+LY I PGP L SGE+ +HLVISW + F +STMMK +IE
Sbjct  363   FAVLVSVSTPDVVYGSTFRVEILYTITPGPELPSGEQCSHLVISWRMNFLQSTMMKGMIE  422

Query  1100  GGTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYFCNFT  1276
              G +QG+KDSF +++  LAQ  K +   E+  N    LA+L +E  SD +LA +YF NFT
Sbjct  423   NGARQGVKDSFEQYANLLAQDVKPVDPTELSSNKEQALASLQAEPQSDWKLAVQYFANFT  482

Query  1277  VVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHF  1456
             VVST F+ LY  +HI L+  + +QGLEF GLDLPDS+GE + C +LVL  E++   I+ F
Sbjct  483   VVSTVFIGLYVLVHIWLAAPSTIQGLEFAGLDLPDSIGEFVVCAVLVLQGERMLGFISRF  542

Query  1457  VEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQL  1636
             ++AR ++GSDHG++A GDGW+LTVALIEG NLAS+D  G+ DP+VVFTCNGK RTSS++ 
Sbjct  543   IKARAQKGSDHGIKAQGDGWLLTVALIEGNNLASVDSGGYSDPYVVFTCNGKVRTSSIKF  602

Query  1637  QTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWL  1816
             Q  +P WNEI EF+  ++PPS++DVEV+DFDGPFD    LGHAEINFLK   ++LAD+W+
Sbjct  603   QKSNPLWNEIFEFDAMDDPPSVMDVEVYDFDGPFDATTCLGHAEINFLKVNISDLADIWV  662

Query  1817  PLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFG  1996
             PL GK+A + QSKLHLRIFL+N  G    +D L KMEKEVGKK+N+RSP  NS FQK F 
Sbjct  663   PLEGKLASACQSKLHLRIFLDNTRGGNVAKDYLNKMEKEVGKKINMRSPQTNSAFQKLFA  722

Query  1997  LPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPP  2176
             LPPEEFLINDF+C LKRK+PLQGR+FLS RI+GF+ANLFG KTKFFFLWEDIEEI V+PP
Sbjct  723   LPPEEFLINDFTCHLKRKMPLQGRLFLSPRIIGFHANLFGKKTKFFFLWEDIEEIQVVPP  782

Query  2177  SFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRA  2356
             +FS+MGSP +VI L   RG DAR+GAK+ DE+GRL F F SFVSF  A RTIMALWK R+
Sbjct  783   TFSSMGSPIVVITLRPGRGVDARHGAKTQDEQGRLKFHFQSFVSFSVAHRTIMALWKARS  842

Query  2357  CIPDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGD  2536
               P+QK +  E++   +   ++ E++  +L+V+DVSMS++YS  LP+    LME+F+GG+
Sbjct  843   LTPEQKMKFVEQES--ETKTLISEDSCPFLVVDDVSMSEIYSCSLPIPASFLMEIFSGGE  900

Query  2537  LEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAG  2716
             ++ +VM  SGCLNY  + W     D+ ER V YK  + IS +  EVTSTQ++S   +  G
Sbjct  901   VDRRVMENSGCLNYSYTPWVSENSDISERAVYYKFEKHISSYKGEVTSTQQRSPLLDGKG  960

Query  2717  WILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNI  2896
             W++ E++ +HGVP  D++ + +RY +E        CR  V+ GV WLK+TK + RITKNI
Sbjct  961   WVVEEVLNLHGVPLGDYFNIHIRYHIEDLPPKAKGCRVQVFFGVEWLKSTKNQKRITKNI  1020

Query  2897  VRKFSQRVKEMIEFVGREVF  2956
             ++   +R+K       +E+ 
Sbjct  1021  LQNLQERLKVTFSLAEKELL  1040



>ref|XP_003534985.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Glycine max]
Length=1018

 Score =   913 bits (2360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/795 (54%), Positives = 577/795 (73%), Gaps = 4/795 (1%)
 Frame = +2

Query  575   RSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELA  754
             +S  ++F EA++ LQS  +G E+P NL  G+ +DQ Y + P+D N LLF+ DS F + LA
Sbjct  225   QSSNETFEEAMRKLQSADQGSEIPSNLPAGVFIDQQYVIAPEDLNELLFSSDSNFLKSLA  284

Query  755   ELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLV  934
             E+QG  +++ GPW +++D +    R+VTY K  +KL+K+V+A EE TYLK DGK FAVLV
Sbjct  285   EVQGNTELEIGPWKFENDGE-IFKRLVTYLKAPSKLIKAVKAYEEHTYLKADGKNFAVLV  343

Query  935   DVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQ  1114
              VSTPDV YGSTF+VE+LY I PGP   +GE+ + LV+SW + F +STMMK +IE G +Q
Sbjct  344   SVSTPDVMYGSTFRVEVLYVITPGPEFPTGEQCSRLVVSWRMNFLQSTMMKGMIENGARQ  403

Query  1115  GLKDSFSEFSRFLAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYFCNFTVVSTA  1291
             G+KDSF +++  L+Q  K     ++  N    LA+L +E  SD  LA  YF NFTV +T 
Sbjct  404   GMKDSFDQYATLLSQTVKTADVKDLSSNKEQALASLHAEPESDWRLAVRYFANFTVFTTV  463

Query  1292  FLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARL  1471
             F+ LY  +HI L+  + +QGLEF GLDLPDS+GE + C ILVL  E++  +I+ F++AR 
Sbjct  464   FMGLYVIVHIWLAAPSTIQGLEFGGLDLPDSIGEFVVCAILVLQGERMLGIISRFIKARA  523

Query  1472  RRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDP  1651
             ++GSDHG++A GDGW+LTVALIEG++LAS+D +G  DP+VVFTCNGK+RTSS++ Q  +P
Sbjct  524   QKGSDHGIKAQGDGWLLTVALIEGSSLASVDSSGLSDPYVVFTCNGKTRTSSIKFQKSNP  583

Query  1652  QWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGK  1831
              WNEI EF+  ++PPS+LDV V+DFDGPFD+A SLGHAEINFLK   A+LAD+W+PL GK
Sbjct  584   TWNEIFEFDAMDDPPSVLDVVVYDFDGPFDEAASLGHAEINFLKANIADLADIWVPLEGK  643

Query  1832  IAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEE  2011
             +A + QSKLHLRIFL+N  G    +D L++MEKEVGKK+NLRSP  NS FQK FGLPPEE
Sbjct  644   LALACQSKLHLRIFLDNTRGGNVAKDYLSRMEKEVGKKINLRSPQTNSAFQKLFGLPPEE  703

Query  2012  FLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTM  2191
             FLINDF+C LKRK+PLQGR+FLS RI+GF+ANLFG+KTKFFFLWEDIEEI V+PP+FS+M
Sbjct  704   FLINDFTCHLKRKMPLQGRLFLSARIIGFHANLFGNKTKFFFLWEDIEEIQVIPPTFSSM  763

Query  2192  GSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQ  2371
             GSP +VI L K RG DAR+GAK+ DE+GRL F F SFVSF  A RTIMALWK R+  P+Q
Sbjct  764   GSPIIVITLRKGRGVDARHGAKTQDEQGRLKFHFQSFVSFNVAHRTIMALWKARSLSPEQ  823

Query  2372  KAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKV  2551
             K +  EEQ   D  +++ EE+GS+L ++DVSMS++YS  L +    LME+F+GG+L+ +V
Sbjct  824   KVEFVEEQS--DSKSLISEESGSFLGLDDVSMSEIYSCSLSIPASYLMEIFSGGELDRRV  881

Query  2552  MSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNE  2731
             M K G LNY  + W     D+ ER V YK  + IS +  EVTSTQ++S  A+  GW++ E
Sbjct  882   MEKLGYLNYSYTPWVSENHDISERAVYYKFEKRISSYKGEVTSTQQRSPLADGKGWLVEE  941

Query  2732  IMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFS  2911
             +M +HGVP  D++ + LRY++E        CR  V  G+ WLK++K + R+TKNI+    
Sbjct  942   LMNLHGVPLGDYFNIHLRYQIEDLPPKAKGCRVQVLFGMEWLKSSKNQKRLTKNILENLL  1001

Query  2912  QRVKEMIEFVGREVF  2956
             +R K       +E+ 
Sbjct  1002  ERFKVTFSLAEKELL  1016



>gb|KHN40775.1| C2 and GRAM domain-containing protein [Glycine soja]
Length=1018

 Score =   912 bits (2358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/795 (54%), Positives = 576/795 (72%), Gaps = 4/795 (1%)
 Frame = +2

Query  575   RSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELA  754
             +S  ++F EA++ LQS  +G E+P NL  G+ +DQ Y + P+D N LLF+ DS F + LA
Sbjct  225   QSSNETFEEAMRKLQSADQGSEIPSNLPAGVFIDQQYVIAPEDLNELLFSSDSNFLKSLA  284

Query  755   ELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLV  934
             E+QG  +++ GPW +++D +    R+VTY K  +KL+K+V+A EE TYLK DGK FAVLV
Sbjct  285   EVQGNTELEIGPWKFENDGE-IFKRLVTYLKAPSKLIKAVKAYEEHTYLKADGKNFAVLV  343

Query  935   DVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQ  1114
              VSTPDV YGSTF+VE+LY I PGP   +GE+   LV+SW + F +STMMK +IE G +Q
Sbjct  344   SVSTPDVMYGSTFRVEVLYVITPGPEFPTGEQCARLVVSWRMNFLQSTMMKGMIENGARQ  403

Query  1115  GLKDSFSEFSRFLAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYFCNFTVVSTA  1291
             G+KDSF +++  L+Q  K     ++  N    LA+L +E  SD  LA  YF NFTV +T 
Sbjct  404   GMKDSFDQYATLLSQTVKTADVKDLSSNKEQALASLHAEPESDWRLAVRYFANFTVFTTV  463

Query  1292  FLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARL  1471
             F+ LY  +HI L+  + +QGLEF GLDLPDS+GE + C ILVL  E++  +I+ F++AR 
Sbjct  464   FMGLYVIVHIWLAAPSTIQGLEFGGLDLPDSIGEFVVCAILVLQGERMLGIISRFIKARA  523

Query  1472  RRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDP  1651
             ++GSDHG++A GDGW+LTVALIEG++LAS+D +G  DP+VVFTCNGK+RTSS++ Q  +P
Sbjct  524   QKGSDHGIKAQGDGWLLTVALIEGSSLASVDSSGLSDPYVVFTCNGKTRTSSIKFQKSNP  583

Query  1652  QWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGK  1831
              WNEI EF+  ++PPS+LDV V+DFDGPFD+A SLGHAEINFLK   A+LAD+W+PL GK
Sbjct  584   TWNEIFEFDAMDDPPSVLDVVVYDFDGPFDEAASLGHAEINFLKANIADLADIWVPLEGK  643

Query  1832  IAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEE  2011
             +A + QSKLHLRIFL+N  G    +D L++MEKEVGKK+NLRSP  NS FQK FGLPPEE
Sbjct  644   LALACQSKLHLRIFLDNTRGGNVAKDYLSRMEKEVGKKINLRSPQTNSAFQKLFGLPPEE  703

Query  2012  FLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTM  2191
             FLINDF+C LKRK+PLQGR+FLS RI+GF+ANLFG+KTKFFFLWEDIEEI V+PP+FS+M
Sbjct  704   FLINDFTCHLKRKMPLQGRLFLSARIIGFHANLFGNKTKFFFLWEDIEEIQVIPPTFSSM  763

Query  2192  GSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQ  2371
             GSP +VI L K RG DAR+GAK+ DE+GRL F F SFVSF  A RTIMALWK R+  P+Q
Sbjct  764   GSPIIVITLRKGRGVDARHGAKTQDEQGRLKFHFQSFVSFNVAHRTIMALWKARSLSPEQ  823

Query  2372  KAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKV  2551
             K +  EEQ   D  +++ EE+GS+L ++DVSMS++YS  L +    LME+F+GG+L+ +V
Sbjct  824   KVEFVEEQS--DSKSLISEESGSFLGLDDVSMSEIYSCSLSIPASYLMEIFSGGELDRRV  881

Query  2552  MSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNE  2731
             M K G LNY  + W     D+ ER V YK  + IS +  EVTSTQ++S  A+  GW++ E
Sbjct  882   MEKLGYLNYSYTPWVSENHDISERAVYYKFEKRISSYKGEVTSTQQRSPLADGKGWLVEE  941

Query  2732  IMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFS  2911
             +M +HGVP  D++ + LRY++E        CR  V  G+ WLK++K + R+TKNI+    
Sbjct  942   LMNLHGVPLGDYFNIHLRYQIEDLPPKAKGCRVQVLFGMEWLKSSKNQKRLTKNILENLL  1001

Query  2912  QRVKEMIEFVGREVF  2956
             +R K       +E+ 
Sbjct  1002  ERFKVTFSLAEKELL  1016



>ref|XP_011005730.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Populus euphratica]
Length=1021

 Score =   912 bits (2356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/793 (55%), Positives = 585/793 (74%), Gaps = 4/793 (1%)
 Frame = +2

Query  575   RSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELA  754
             +S + +F E +K ++SR  G E+P NL GGIL+DQ+Y + P D N   F+PDS   R L+
Sbjct  228   QSSSVNFEELMKEMESRDVGSEVPNNLPGGILVDQSYVISPPDLNSFFFSPDSSLARLLS  287

Query  755   ELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLV  934
             +  G  + Q GPW +++  +S L RV+TY K  TKLV +++A+EEQTYLK DGK FAVL+
Sbjct  288   DFVGNSEQQFGPWRFENSCES-LKRVITYVKAPTKLVGALKASEEQTYLKADGKIFAVLI  346

Query  935   DVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQ  1114
              VSTPDV YGSTFKVELLY I PGP L SGE+++HLVISW + F +S+M K++IE G + 
Sbjct  347   SVSTPDVMYGSTFKVELLYCITPGPELPSGEKTSHLVISWRMNFLQSSMFKSMIENGARS  406

Query  1115  GLKDSFSEFSRFLAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYFCNFTVVSTA  1291
             GLKDSF + S FL+Q+ K +   ++  +   +LA+L  E  SD +LA +YF NFTVVS  
Sbjct  407   GLKDSFEQVSIFLSQNVKPVDLKDLGSSKEQVLASLKVEPQSDGKLAIQYFANFTVVSAV  466

Query  1292  FLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARL  1471
             F+ LY  +H+ L+  + +QGLEF GLDLPDS+GE+I CG+L L  E+V  +++ F++AR 
Sbjct  467   FMALYVFVHVWLAAPSAIQGLEFVGLDLPDSIGEVIVCGVLTLQCERVLGLLSRFMQARA  526

Query  1472  RRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDP  1651
             ++G+DHGV+A GDGWVLTVALIEG++L ++D +GF DP+VVFTCNGK+RTSS++ Q  DP
Sbjct  527   QKGTDHGVKAQGDGWVLTVALIEGSHLPAVDSSGFCDPYVVFTCNGKTRTSSIKFQKSDP  586

Query  1652  QWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGK  1831
              WNEI EF+  ++PPS+LDVEV+DFDGPF++A SLGH EINF+K   ++LAD+W+PL GK
Sbjct  587   LWNEIFEFDAMDDPPSVLDVEVYDFDGPFNEAMSLGHTEINFVKSNLSDLADVWVPLQGK  646

Query  1832  IAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEE  2011
             +AQ+ QSKLHLRIFLNN  G   +++ L+KMEKEVGKK+NLRSP  NS FQK FGLPPEE
Sbjct  647   LAQACQSKLHLRIFLNNTRGSNVVKEYLSKMEKEVGKKINLRSPQTNSAFQKVFGLPPEE  706

Query  2012  FLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTM  2191
             FLINDF+C LKRK+PLQGR+FLS RI+GFYANLF  KTKFFFLWEDI +I V  P+ ++M
Sbjct  707   FLINDFTCHLKRKMPLQGRLFLSARIIGFYANLFRQKTKFFFLWEDIVDIQVDTPTLASM  766

Query  2192  GSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQ  2371
             GSP +VI L + RG DAR+GAK+ID+EGRL F F SFVSF  A+RTIMALWK R+  P+Q
Sbjct  767   GSPIIVITLRQGRGMDARHGAKTIDDEGRLKFHFQSFVSFNVANRTIMALWKARSLSPEQ  826

Query  2372  KAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKV  2551
             K QI EE+   +   +  EE+G++L +EDVSMS+VY+  L +    L E+F GG+L+ KV
Sbjct  827   KVQIVEEES--ETKFLQTEESGTFLGLEDVSMSEVYACSLSVPINFLSELFGGGELDRKV  884

Query  2552  MSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNE  2731
             M K+GCL+Y  + WE ++ DVYER++ Y+ ++ IS FG EVTSTQ+K   ++  GWI+ E
Sbjct  885   MEKAGCLSYSYTPWESVKTDVYERQLYYRFDKHISRFGGEVTSTQQKYPLSDRKGWIVEE  944

Query  2732  IMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFS  2911
             +M +HGVP  D + + LRY++E   +    C   V +G+ WLK+T  + RI+KNI+    
Sbjct  945   VMTLHGVPLGDFFNLHLRYQIEDFPSRLKGCHVRVSIGIAWLKSTWHQKRISKNIISSLQ  1004

Query  2912  QRVKEMIEFVGRE  2950
              R+K +   V +E
Sbjct  1005  DRLKLIFNAVEKE  1017



>emb|CAE05501.2| OSJNBa0022H21.21 [Oryza sativa Japonica Group]
Length=1036

 Score =   912 bits (2356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/795 (55%), Positives = 588/795 (74%), Gaps = 12/795 (2%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             SF EA+++++S++   +MPE+L GG++ D TY +  K+ N L+F PDSQF +EL ELQGT
Sbjct  241   SFEEAMEIMKSKSIP-DMPEDLNGGVMFDHTYLVDSKNLNSLIFGPDSQFSKELRELQGT  299

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
              D +E PWTW ++N   LTR   YTKGATK +K+V+  EEQTYLK DGK + ++  V TP
Sbjct  300   MDYEEQPWTWNNNNPPSLTRTCQYTKGATKFMKAVKTIEEQTYLKADGKSYVIMTRVRTP  359

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             +VP+G+ F+V +LY I+  P L S E  +HL +S+ V+F +STMMK++IEG  + GLK++
Sbjct  360   EVPFGNCFEVVMLYKIIHYPELSSSEGMSHLTVSYNVEFLQSTMMKSMIEGSVRDGLKEN  419

Query  1130  FSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYF  1309
             F  ++  L++H K+  SA  +D   LLA L ++H SD+ LA +YFCNFTV+ST  + LY 
Sbjct  420   FESYAEILSRHVKIADSAG-MDKERLLAPLQTDHQSDIRLAYKYFCNFTVISTVIMALYV  478

Query  1310  SIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDH  1489
              +HI LSR   L GLEF GLDLPD+ GE+I  GILVL LE++  MI+ FVE R++RGSDH
Sbjct  479   LVHIFLSRPGPLMGLEFKGLDLPDTFGELIISGILVLQLERLLSMISRFVEVRVQRGSDH  538

Query  1490  GVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEIL  1669
             G++A+GDGW+LTVAL+E T+L  +  +G  DP+VVF+CNG +RTSSVQLQT DPQWNEI+
Sbjct  539   GIKANGDGWLLTVALLEATSLPPVS-SGSVDPYVVFSCNGITRTSSVQLQTHDPQWNEIM  597

Query  1670  EFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQ  1849
             EF+  EEPP+ LDVEVF+FDGPFD A SLGHAEINFLKHTSAELAD+W+PL GK+AQ+ Q
Sbjct  598   EFDAMEEPPATLDVEVFNFDGPFDLAVSLGHAEINFLKHTSAELADIWVPLEGKLAQTCQ  657

Query  1850  SKLHLRIFLNNNNGVET-IRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
             S+LHLRIFL N  G ET +R+ L+KMEKEVGKKL+++SPHRN+TFQK FGLP EEFLI  
Sbjct  658   SRLHLRIFLENTKGPETSMREYLSKMEKEVGKKLHVQSPHRNATFQKLFGLPHEEFLIAV  717

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             ++CSLKRKLPLQGR+FLS RIVGFYANLFGHKTKFFFLWED+EEI  L PSF+T+G+PSL
Sbjct  718   YACSLKRKLPLQGRLFLSARIVGFYANLFGHKTKFFFLWEDVEEIEELTPSFTTVGTPSL  777

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIA  2386
             + +L   RG DA+NGAKS D+EGRL F FHSF SF  ASRTI+ LWKT++   +Q+A++ 
Sbjct  778   LFVLKSGRGLDAKNGAKSQDKEGRLKFQFHSFASFSKASRTIIGLWKTKSSAIEQRAKLE  837

Query  2387  EEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSG  2566
             E+Q+  DEN V   +  S L + DV +SK Y+++LP++   LM +F+GG LE K MS++G
Sbjct  838   EDQE--DENYVDLNDVQSVLSIGDVPLSKEYTLELPIDADLLMGVFDGGPLEAKAMSRAG  895

Query  2567  CLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIH  2746
             CL+Y  + W+   P V ER  SYK NR +SIFG EV STQ +    +  GW + +++ + 
Sbjct  896   CLDYAATPWQDARPGVLERHASYKFNRYMSIFGGEVVSTQLRLPSDDGDGWTVYDVITLR  955

Query  2747  GVPFSDHYQVQLRYKV------ESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKF  2908
              VPF D +++ LR+ +       S +AA +  RC++ VG+ W+K +K + RI +NI  K 
Sbjct  956   NVPFGDFFRLHLRHNIWSVEAASSEAAASSGSRCEILVGIEWVKRSKFQKRIARNICEKL  1015

Query  2909  SQRVKEMIEFVGREV  2953
             + R KE++E   RE+
Sbjct  1016  AHRAKEVLEAAAREI  1030



>ref|XP_006653521.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170-like 
[Oryza brachyantha]
Length=970

 Score =   910 bits (2353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/795 (55%), Positives = 583/795 (73%), Gaps = 12/795 (2%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             SF EA+++++SR+   EMPE+L  G++ D TY +  K+ N L+F PDSQF +EL ELQG 
Sbjct  172   SFEEAMEIMKSRSMP-EMPEDLSCGVMFDHTYLVDSKNLNSLVFGPDSQFSKELRELQGI  230

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
              D +E PWTW + N   LTR   YTKGATK +K+V+  EEQTYLK DGK F ++  V TP
Sbjct  231   TDYEEQPWTWNNKNPPSLTRTCHYTKGATKFMKAVKTIEEQTYLKADGKNFVIITRVRTP  290

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             +VP+G+ F+V LLY I+  P   SGEE +HL +S+ ++F +STMMK++IEG  + GLK++
Sbjct  291   EVPFGNCFEVVLLYKIIHYPESSSGEEMSHLTVSYNLEFHQSTMMKSMIEGSVRDGLKEN  350

Query  1130  FSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYF  1309
             F  +   L++  K+  SA  +D   LLA L ++H SD+ LA +YFCNFTV+ T  + LY 
Sbjct  351   FETYEEILSRRVKLADSAG-MDKEQLLAPLQTDHMSDIRLAYKYFCNFTVIFTVIMALYV  409

Query  1310  SIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDH  1489
              +HI LSR   L GLEF+GLDLPD+ GE+IT GILVL LE++  MI+HFVEAR++RGSDH
Sbjct  410   LVHIFLSRPGPLMGLEFNGLDLPDTFGELITSGILVLQLERLLSMISHFVEARVQRGSDH  469

Query  1490  GVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEIL  1669
             G++A+GDGW+LTVAL+E T+L  +   G  DP+VVF+CNG +RTSSVQLQT DPQWNEI+
Sbjct  470   GIKANGDGWLLTVALLEATSLPPVS-NGSVDPYVVFSCNGITRTSSVQLQTHDPQWNEIM  528

Query  1670  EFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQ  1849
             EF+  EEPP+ LDVEV +FDGPFD A SLGHAEINFLKHTSAELAD+W+PL GK+AQ+ Q
Sbjct  529   EFDAMEEPPATLDVEVLNFDGPFDLAVSLGHAEINFLKHTSAELADIWVPLEGKLAQTCQ  588

Query  1850  SKLHLRIFLNNNNGVET-IRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
             S+LHLR+FL N  G ET +R+ L+KMEKEVGKKL+++SPHRN+TFQK FGLP EEFLI D
Sbjct  589   SRLHLRVFLENTKGPETSMREYLSKMEKEVGKKLHVQSPHRNATFQKLFGLPHEEFLIAD  648

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             ++CSLKR+LPLQGR+FLS RIVGFYANLFGHKTKFFFLWED+E+I  LPPSF+T+G+PSL
Sbjct  649   YACSLKRRLPLQGRLFLSARIVGFYANLFGHKTKFFFLWEDVEQIEELPPSFTTVGTPSL  708

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIA  2386
             +  L   RG DA++GAKS D+EGRL F FHSF SF  ASRTI  LWKT++   +Q+A++ 
Sbjct  709   LFALKSGRGLDAKSGAKSQDKEGRLKFQFHSFASFSKASRTITGLWKTKSSAIEQRAKLE  768

Query  2387  EEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSG  2566
             E+Q   DEN V   +  S L + DV +SK Y+ +LP++   LM +F+GG LE K MS+ G
Sbjct  769   EDQD--DENYVDVNDVQSLLSIGDVPLSKEYNFELPIDADLLMGVFDGGPLETKTMSRVG  826

Query  2567  CLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIH  2746
             CL+Y  + W+   P V ERR SYK NR +S+FG EV S Q +    +  GW + ++M +H
Sbjct  827   CLDYAATPWQHARPGVLERRASYKFNRYMSLFGGEVVSAQLRLPSDDGDGWTVYDVMTLH  886

Query  2747  GVPFSDHYQVQLRYKVESCS------AARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKF  2908
              VPF D ++V LR+ +          ++ +S RC++ VG+ W+K++K + RI +NI  K 
Sbjct  887   NVPFGDFFRVHLRHNIRRVEAAAGAASSSSSSRCEILVGIEWVKSSKFQKRIARNICEKL  946

Query  2909  SQRVKEMIEFVGREV  2953
             +QR KE++E    E+
Sbjct  947   AQRAKEVLEAAASEI  961



>ref|XP_011095886.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 isoform 
X2 [Sesamum indicum]
Length=1034

 Score =   908 bits (2346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/821 (52%), Positives = 587/821 (71%), Gaps = 36/821 (4%)
 Frame = +2

Query  593   FCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTK  772
             F E +K ++ + +G E+P +L GG++LDQ Y + P++ N LLF+ DS F + LA++QG+ 
Sbjct  210   FEEILKNMEVKNQGGEVPSSLSGGVVLDQLYGIAPRELNTLLFSSDSNFLKSLADIQGST  269

Query  773   DVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPD  952
             ++Q G W +++  +S L RV+ YTK A+KL+K+++ TEEQTYLK DGK FAVL  VSTPD
Sbjct  270   ELQIGTWKYENGGES-LKRVILYTKAASKLIKALKTTEEQTYLKADGKCFAVLSSVSTPD  328

Query  953   VPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSF  1132
              PYG TFKVE+LY I  GP   SGE+S+ L +SW V F +STMMK +IEGGT+QG+K+SF
Sbjct  329   APYGKTFKVEVLYCITSGPEQPSGEQSSRLEVSWRVNFSQSTMMKGMIEGGTRQGIKESF  388

Query  1133  SEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYF  1309
              ++ + L+Q  K +   ++  +   LLA+L  E  SD +LA +YF NFTV+ST F+ +Y 
Sbjct  389   EQYEKLLSQTVKPLDIKDIGSEKDQLLASLQVERQSDWKLAVQYFANFTVISTIFMGIYA  448

Query  1310  SIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDH  1489
              +H+ L+  + +QGLEF GLDLPDS+GE++ CG+LVL  ++V  +++ F++AR ++GSDH
Sbjct  449   LVHVWLAMPSTIQGLEFVGLDLPDSIGELVVCGVLVLQGKRVLELMSRFMQARAQKGSDH  508

Query  1490  GVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEIL  1669
             G++A GDGW+LTVALIEG+NLA++D +GF DP+VVFTCNGK+RTSS++ Q  DP WNEI 
Sbjct  509   GIKAQGDGWLLTVALIEGSNLAAVDSSGFSDPYVVFTCNGKTRTSSIKFQKSDPLWNEIF  568

Query  1670  EFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQ  1849
             EF+  E+PPS+LDVEVFDFDGPFD+A SLG AEINFLK   ++L+D+W+PL GK+AQ+ Q
Sbjct  569   EFDAMEDPPSVLDVEVFDFDGPFDEATSLGRAEINFLKSNISDLSDIWIPLQGKLAQACQ  628

Query  1850  SKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDF  2029
             SKLHLRIFLNN+ G   ++D +TKMEKEVGKK+ LRSP  NS FQK FGLPPEEFLINDF
Sbjct  629   SKLHLRIFLNNSRGGNVVKDYITKMEKEVGKKIRLRSPQTNSAFQKLFGLPPEEFLINDF  688

Query  2030  SCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLV  2209
             +C L+R++PLQGR+FLS RI+GF+A+LFGHKTKFFFLWEDIE+I V+PP+ S+MGSP ++
Sbjct  689   ACHLRRRMPLQGRLFLSARIIGFHADLFGHKTKFFFLWEDIEDIQVIPPTLSSMGSPIII  748

Query  2210  IILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAE  2389
             + L   RG DAR+GA++ D +GRL + FHSFVSF  A RTIMALWK RA  P+QK QI E
Sbjct  749   MTLRPGRGFDARHGARTQDADGRLKYHFHSFVSFNVAHRTIMALWKARALTPEQKVQIVE  808

Query  2390  EQ------------------------------QYKDENN----VLPEETGSYLIVEDVSM  2467
             E+                              Q  DE +    +  EE+GS+L VEDV+M
Sbjct  809   EESEANGIHTAEEESIARNLQSSEFEGEAKSLQVVDEESEAKGLHTEESGSFLGVEDVNM  868

Query  2468  SKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNR  2647
             S VYS  L +     ME+F G +++ +VM ++GCLNY  S WE  +PDVY+R++ YK ++
Sbjct  869   SVVYSSVLSIPTSFFMELFRGSEIDRRVMERAGCLNYSPSPWESEKPDVYQRQLYYKFDK  928

Query  2648  LISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCR  2827
              IS +  EVTSTQ+KS      GW++ E+M +H +P  D++ + LRY+VE   +    C 
Sbjct  929   RISRYRGEVTSTQQKSRLPGKNGWLIEEVMTLHEIPLGDYFTLHLRYQVEDLPSRSVGCN  988

Query  2828  CDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGRE  2950
               VY G+ WLK T+ + RITKNIV     R+K M   + +E
Sbjct  989   VQVYFGIAWLKYTRHQKRITKNIVSNLQDRLKVMFSVLEKE  1029



>gb|EYU27641.1| hypothetical protein MIMGU_mgv1a000583mg [Erythranthe guttata]
Length=1058

 Score =   907 bits (2344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/950 (48%), Positives = 638/950 (67%), Gaps = 69/950 (7%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSET---SKDVDAI----------KVSSPKK-  406
             G+ILLT+         STN+  F  PS G       K  D+I          + SSP + 
Sbjct  117   GEILLTICF-------STNNTLFDFPSSGDPVVLPRKYADSILDSPTRSSPRRTSSPMRG  169

Query  407   -----VLEGKQLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQET  571
                    E KQ   + AG   ++F+KN   S S       D     S +P   +  +   
Sbjct  170   EDFFTSKEEKQPAPTFAGRFAQIFNKNVVDSASVTSTEATDQ----SDLPETLDSFLDNK  225

Query  572   TRSQTQS--FCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRR  745
             +  QT S  F E +K + ++ +G E+P  L GG++LDQ YA  P++ N LLF+ D+ F++
Sbjct  226   SEEQTSSVDFEELMKNITTKDQGSEVPSTLTGGVVLDQIYATTPQELNSLLFS-DANFQK  284

Query  746   ELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFA  925
              +A++QG+ D+Q GPW +++ ++S + RVV+YTK  +KL+K+++ATEEQ ++K DGK FA
Sbjct  285   SVADVQGSTDLQIGPWKYENGSES-VQRVVSYTKAPSKLIKALKATEEQAFIKADGKVFA  343

Query  926   VLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGG  1105
             VL  VSTPD PYG TFK E+LY I  GP   SGE+S+ L +SW + F +STMMK++IEGG
Sbjct  344   VLSSVSTPDAPYGKTFKAEVLYCITQGPEQPSGEQSSRLEVSWRMNFLQSTMMKSMIEGG  403

Query  1106  TQQGLKDSFSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVV  1282
              +QG+K+SF ++ + L QH K +    +  +   +LA+L  E  SD +LA +YF NFTVV
Sbjct  404   ARQGIKESFEQYGKVLTQHVKPLDLKNIGSEKDQMLASLQVERQSDWKLAVQYFANFTVV  463

Query  1283  STAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVE  1462
             ST  +  Y  +H+ L+  + +QGLEF GLDLPDS+GE+I CG+LVL  ++V  +++ F++
Sbjct  464   STVLMGFYVLVHVWLAMPSTVQGLEFVGLDLPDSIGELIVCGMLVLQGKRVLELMSRFMQ  523

Query  1463  ARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQT  1642
             AR+++GSDHG++A GDGW+LTVALIEG+NLA++D +GF DP+VVFTCNGK+R+SS++ Q 
Sbjct  524   ARVQKGSDHGIKAQGDGWLLTVALIEGSNLAAVDSSGFSDPYVVFTCNGKTRSSSIKFQK  583

Query  1643  LDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPL  1822
              DP WNEI EF+  +EPPS+LDVEVFDFDGPFD+A SLG AEINFLK+  ++L+D+W+PL
Sbjct  584   SDPLWNEIFEFDAMDEPPSVLDVEVFDFDGPFDEATSLGRAEINFLKYNISDLSDIWIPL  643

Query  1823  GGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLP  2002
              GK+AQ+ QSKLHLRIFLNNN G   ++D +TKMEKEVGKK+ LRSP  NS FQK FGLP
Sbjct  644   QGKLAQACQSKLHLRIFLNNNRGTNVVQDYITKMEKEVGKKIKLRSPQTNSAFQKLFGLP  703

Query  2003  PEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSF  2182
             PEEFLINDF+C LKR++PLQGR+FLS RI+GF+A+LFGHKTKFFFLWEDIE+I ++PP+ 
Sbjct  704   PEEFLINDFACHLKRRMPLQGRLFLSARIIGFHADLFGHKTKFFFLWEDIEDIQIIPPTL  763

Query  2183  STMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACI  2362
             S+MGSP +++ L + RG DAR+GA++ D EGRL + FHSFVSF  A RTIMALWK RA  
Sbjct  764   SSMGSPIVIVTLRQGRGFDARHGARTQDTEGRLKYHFHSFVSFNVAHRTIMALWKARALT  823

Query  2363  PDQKAQIAEE-------QQYKDEN---------------------------NVLPEETGS  2440
             P+QK QI EE       Q  ++E+                           ++L  E+GS
Sbjct  824   PEQKVQIVEEAAEATTVQTAEEESLAKNLQASEEEIEARSLHGVDEESETKSLLSVESGS  883

Query  2441  YLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYE  2620
             +L V DV+MS VYS  L +     ME+F G +++ +VM ++GCLNY  S WE  +PDVY+
Sbjct  884   FLGVGDVNMSVVYSSMLSLPTSFFMELFRGSEIDRRVMERAGCLNYSHSPWESEKPDVYQ  943

Query  2621  RRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVES  2800
             R++ YK ++ IS +  EVTSTQ+KS  +   GW++ E+M +HGVP  D++ + +RY+VE 
Sbjct  944   RQLYYKFDKHISRYRGEVTSTQQKSRLSGRNGWLIEEVMTLHGVPLGDYFTLHVRYQVED  1003

Query  2801  CSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGRE  2950
               +    C   V  G+ WLK T+ + ++TKNIV    +RVK M   + +E
Sbjct  1004  LPSRSVGCSIQVNFGIAWLKYTRQQKKMTKNIVLNLQERVKVMFSVLEKE  1053



>ref|XP_011095885.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 isoform 
X1 [Sesamum indicum]
Length=1058

 Score =   907 bits (2343),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/821 (52%), Positives = 587/821 (71%), Gaps = 36/821 (4%)
 Frame = +2

Query  593   FCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTK  772
             F E +K ++ + +G E+P +L GG++LDQ Y + P++ N LLF+ DS F + LA++QG+ 
Sbjct  234   FEEILKNMEVKNQGGEVPSSLSGGVVLDQLYGIAPRELNTLLFSSDSNFLKSLADIQGST  293

Query  773   DVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPD  952
             ++Q G W +++  +S L RV+ YTK A+KL+K+++ TEEQTYLK DGK FAVL  VSTPD
Sbjct  294   ELQIGTWKYENGGES-LKRVILYTKAASKLIKALKTTEEQTYLKADGKCFAVLSSVSTPD  352

Query  953   VPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSF  1132
              PYG TFKVE+LY I  GP   SGE+S+ L +SW V F +STMMK +IEGGT+QG+K+SF
Sbjct  353   APYGKTFKVEVLYCITSGPEQPSGEQSSRLEVSWRVNFSQSTMMKGMIEGGTRQGIKESF  412

Query  1133  SEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYF  1309
              ++ + L+Q  K +   ++  +   LLA+L  E  SD +LA +YF NFTV+ST F+ +Y 
Sbjct  413   EQYEKLLSQTVKPLDIKDIGSEKDQLLASLQVERQSDWKLAVQYFANFTVISTIFMGIYA  472

Query  1310  SIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDH  1489
              +H+ L+  + +QGLEF GLDLPDS+GE++ CG+LVL  ++V  +++ F++AR ++GSDH
Sbjct  473   LVHVWLAMPSTIQGLEFVGLDLPDSIGELVVCGVLVLQGKRVLELMSRFMQARAQKGSDH  532

Query  1490  GVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEIL  1669
             G++A GDGW+LTVALIEG+NLA++D +GF DP+VVFTCNGK+RTSS++ Q  DP WNEI 
Sbjct  533   GIKAQGDGWLLTVALIEGSNLAAVDSSGFSDPYVVFTCNGKTRTSSIKFQKSDPLWNEIF  592

Query  1670  EFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQ  1849
             EF+  E+PPS+LDVEVFDFDGPFD+A SLG AEINFLK   ++L+D+W+PL GK+AQ+ Q
Sbjct  593   EFDAMEDPPSVLDVEVFDFDGPFDEATSLGRAEINFLKSNISDLSDIWIPLQGKLAQACQ  652

Query  1850  SKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDF  2029
             SKLHLRIFLNN+ G   ++D +TKMEKEVGKK+ LRSP  NS FQK FGLPPEEFLINDF
Sbjct  653   SKLHLRIFLNNSRGGNVVKDYITKMEKEVGKKIRLRSPQTNSAFQKLFGLPPEEFLINDF  712

Query  2030  SCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLV  2209
             +C L+R++PLQGR+FLS RI+GF+A+LFGHKTKFFFLWEDIE+I V+PP+ S+MGSP ++
Sbjct  713   ACHLRRRMPLQGRLFLSARIIGFHADLFGHKTKFFFLWEDIEDIQVIPPTLSSMGSPIII  772

Query  2210  IILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAE  2389
             + L   RG DAR+GA++ D +GRL + FHSFVSF  A RTIMALWK RA  P+QK QI E
Sbjct  773   MTLRPGRGFDARHGARTQDADGRLKYHFHSFVSFNVAHRTIMALWKARALTPEQKVQIVE  832

Query  2390  EQ------------------------------QYKDENN----VLPEETGSYLIVEDVSM  2467
             E+                              Q  DE +    +  EE+GS+L VEDV+M
Sbjct  833   EESEANGIHTAEEESIARNLQSSEFEGEAKSLQVVDEESEAKGLHTEESGSFLGVEDVNM  892

Query  2468  SKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNR  2647
             S VYS  L +     ME+F G +++ +VM ++GCLNY  S WE  +PDVY+R++ YK ++
Sbjct  893   SVVYSSVLSIPTSFFMELFRGSEIDRRVMERAGCLNYSPSPWESEKPDVYQRQLYYKFDK  952

Query  2648  LISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCR  2827
              IS +  EVTSTQ+KS      GW++ E+M +H +P  D++ + LRY+VE   +    C 
Sbjct  953   RISRYRGEVTSTQQKSRLPGKNGWLIEEVMTLHEIPLGDYFTLHLRYQVEDLPSRSVGCN  1012

Query  2828  CDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGRE  2950
               VY G+ WLK T+ + RITKNIV     R+K M   + +E
Sbjct  1013  VQVYFGIAWLKYTRHQKRITKNIVSNLQDRLKVMFSVLEKE  1053



>ref|NP_171836.3| C2 calcium/lipid-binding and GRAM domain containing protein [Arabidopsis 
thaliana]
 sp|Q9ZVT9.4|C2GR1_ARATH RecName: Full=C2 and GRAM domain-containing protein At1g03370 
[Arabidopsis thaliana]
 gb|AAC72128.2| Contains similarity to gb|AB011110 KIAA0538 protein from Homo 
sapiens brain and to phospholipid-binding domain C2 PF|00168. 
ESTs gb|AA585988 and gb|T04384 come from this gene [Arabidopsis 
thaliana]
 gb|AAM53329.1| unknown protein [Arabidopsis thaliana]
 gb|AEE27565.1| C2 calcium/lipid-binding and GRAM domain containing protein [Arabidopsis 
thaliana]
Length=1020

 Score =   907 bits (2343),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/792 (54%), Positives = 587/792 (74%), Gaps = 6/792 (1%)
 Frame = +2

Query  578   SQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAE  757
             S + SF E +K ++S+ +G E P NL GG+++DQ + + P D N++LFA DS F   L E
Sbjct  223   SSSTSFEELLKAMESKDQGSEPPSNLSGGVVVDQLFMISPSDLNIVLFASDSSFYASLTE  282

Query  758   LQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVD  937
             LQGT +VQ GPW  ++D +S + RVV+Y K ATKL+K+V+ TEEQTYLK DG+ +AVL  
Sbjct  283   LQGTTEVQIGPWKAENDGES-VKRVVSYLKAATKLIKAVKGTEEQTYLKADGEVYAVLAS  341

Query  938   VSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQG  1117
             V+TPDVP+G TFKVE+LY I PGP L SGE+ + LV+SW + F +STMM+ +IE G +QG
Sbjct  342   VATPDVPFGGTFKVEVLYCISPGPELPSGEQCSRLVVSWRLNFLQSTMMRGMIENGARQG  401

Query  1118  LKDSFSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAF  1294
             LKD+F +++  LAQ  K + S ++ L+    L++L +E  SD +LA +YF NFTV+ST  
Sbjct  402   LKDNFEQYANLLAQSVKPVDSKDIGLNKEQALSSLQAEPQSDWKLAVQYFANFTVLSTFL  461

Query  1295  LVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLR  1474
             + +Y  +HI+ +  + +QGLEF+GLDLPDS+GE +  G+LVL  E+V ++I+ F++AR +
Sbjct  462   IGIYVFVHIVFAIPSAIQGLEFNGLDLPDSIGEFVVSGVLVLQCERVLQLISRFMQARKQ  521

Query  1475  RGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQ  1654
             +GSDHG++AHGDGW+LTVALIEG +LA++DP+G  DP++VFT NGK+RTSS++ Q  +PQ
Sbjct  522   KGSDHGIKAHGDGWLLTVALIEGVDLAAVDPSGHCDPYIVFTSNGKTRTSSIKFQKSNPQ  581

Query  1655  WNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKI  1834
             WNEI EF+   +PPS+L+VEVFDFDGPFD+A SLGHAE+NF++   ++LAD+W+PL GK+
Sbjct  582   WNEIFEFDAMADPPSVLNVEVFDFDGPFDEAVSLGHAEVNFVRSNISDLADVWVPLQGKL  641

Query  1835  AQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEF  2014
             AQ+ QSKLHLRIFL++  G + +RD L KMEKEVGKK+N+RSP  NS FQK FGLP EEF
Sbjct  642   AQACQSKLHLRIFLDHTGGGDVVRDYLNKMEKEVGKKINVRSPQTNSAFQKLFGLPQEEF  701

Query  2015  LINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMG  2194
             LINDF+C LKRK+PLQGR+FLS RIVGFYA++FG+KTKFFFLWEDIEEI VLPP+ ++MG
Sbjct  702   LINDFTCHLKRKMPLQGRLFLSARIVGFYASIFGNKTKFFFLWEDIEEIQVLPPTLASMG  761

Query  2195  SPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQK  2374
             SP +V+ L  +RG DAR GAK+ DEEGRL F FHSFVSF  A +TIMALWK ++  P+QK
Sbjct  762   SPIVVMTLRPNRGLDARIGAKTHDEEGRLKFHFHSFVSFNVAQKTIMALWKAKSLTPEQK  821

Query  2375  AQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVM  2554
              Q  EE+    E  +  EE+G +L V+DV  S+V+S+ LP+     ME+F GG+++ K M
Sbjct  822   VQAVEEE---SEQKLQSEESGLFLGVDDVRFSEVFSLTLPVPVSFFMELFGGGEVDRKAM  878

Query  2555  SKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEI  2734
              ++GC +Y  S WE  + DVYER+  Y+  R IS +  EVTSTQ+KS+     GW++ E+
Sbjct  879   ERAGCQSYSCSPWESEKDDVYERQTYYRDKR-ISRYRGEVTSTQQKSLVPEKNGWLVEEV  937

Query  2735  MAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQ  2914
             M +HGVP  D++ + LRY++E  ++   +    VY G+ WLK+T+ + R+TKNI+     
Sbjct  938   MTLHGVPLGDYFNLHLRYQMEESTSKPKTTYVRVYFGIEWLKSTRHQKRVTKNILVNLQD  997

Query  2915  RVKEMIEFVGRE  2950
             R+K    F+ +E
Sbjct  998   RLKMTFGFLEKE  1009



>ref|XP_006279566.1| hypothetical protein CARUB_v10025800mg [Capsella rubella]
 gb|EOA12464.1| hypothetical protein CARUB_v10025800mg [Capsella rubella]
Length=993

 Score =   906 bits (2342),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/913 (51%), Positives = 621/913 (68%), Gaps = 58/913 (6%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKVSSPKKVL------------  412
             GKILL+LSL GK    S       +  +  E  K+++     SPK +             
Sbjct  120   GKILLSLSLQGKWESNSGEKVQNDKQDIMLEGVKELEG----SPKDLSSSKDGKKRKHHH  175

Query  413   EGKQLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQT-Q  589
             +GK ++K+    ++KLF K EE SK   + S          I S+YED   +++ S T  
Sbjct  176   DGKHIMKNFVNQIDKLFHKKEEISKRLHDDSSGG-----QGITSNYEDATDKSSCSATCT  230

Query  590   SFCEAIKLLQSR-TEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQG  766
             SF E + L+QS  +E  EMPENL GG+L+DQ Y + P + N  LFAP S+FR+E+AELQG
Sbjct  231   SFEEGLDLMQSSDSEKEEMPENLTGGVLVDQKYLVSPCNLNKFLFAPSSEFRKEVAELQG  290

Query  767   TKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVST  946
               DVQEGPWT   ++   LTRVVTY + ATK+VK+V+ATE Q Y K +GKEFAV V VST
Sbjct  291   LSDVQEGPWTMMQEDTPHLTRVVTYMRAATKMVKAVKATENQIYRKANGKEFAVFVSVST  350

Query  947   PDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKD  1126
             PDVPYGSTFKVELLY I+P     +G ES+ L+ISW ++F +ST+MK +IEGG +QGL++
Sbjct  351   PDVPYGSTFKVELLYKILPETEPTAGGESSRLIISWGIQFNQSTIMKGMIEGGAKQGLRE  410

Query  1127  SFSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLY  1306
             SF +FS  LA+  K +  A VLD   ++AT+ SE  +DL+ A  YF + +V+    L +Y
Sbjct  411   SFEQFSDLLAKTYKTLDPAVVLDKDQVIATVQSEQKTDLKSAFLYFWSSSVICAVLLSIY  470

Query  1307  FSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSD  1486
               +HIL    +++QGLEF+GLDLPDS GE+ + G+LVL LE+VY M  HF++ARL RG D
Sbjct  471   VVVHILHCEPSKIQGLEFYGLDLPDSFGELFSSGMLVLLLERVYMMTVHFIQARLHRGRD  530

Query  1487  HGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEI  1666
             HGV+++G GW+LT+ALI+GTNLAS++ T   DP+V+FTCNGK+RTSSV+LQ  DPQWN  
Sbjct  531   HGVKSNGKGWILTIALIKGTNLASVEATELFDPYVIFTCNGKTRTSSVKLQAQDPQWN--  588

Query  1667  LEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSS  1846
                                              EINF KHT+ ELADL +PL G  AQ+S
Sbjct  589   ---------------------------------EINFFKHTADELADLCVPLVGHHAQAS  615

Query  1847  QSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
             QSKL LRIFL N NGVET++D L+K+EKEVGKKLN+RSP +N  FQK FGLP EEFL+ +
Sbjct  616   QSKLQLRIFLENKNGVETMKDYLSKVEKEVGKKLNIRSPQKNCAFQKLFGLPHEEFLLKE  675

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             ++C LKRKLP+QG+++LS RIV FY+N+FGHKTKF+FLWEDI++I VLPP+F+++GSP L
Sbjct  676   YTCYLKRKLPVQGKLYLSARIVAFYSNVFGHKTKFYFLWEDIDDIQVLPPTFASLGSPLL  735

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIA  2386
             +IIL K+RG DA++GAKS+D+EGRL F F SFVSF   SRTIMALWKTR    D +AQIA
Sbjct  736   LIILKKNRGLDAKHGAKSLDDEGRLWFYFQSFVSFDATSRTIMALWKTRTLSVDHRAQIA  795

Query  2387  EEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSG  2566
             EE+Q   +  +LPE+       + + MSKVY+ DLP + + +M++F GG+LE K+M KSG
Sbjct  796   EEEQDVSDPFLLPEDVAVVSDSDALKMSKVYTRDLPCDVELVMKIFGGGELERKIMEKSG  855

Query  2567  CLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIH  2746
             CLNY +++WE   P VYERR+SYK N  +S+FG  VT  Q+KS+  +D GWILNEI+A+H
Sbjct  856   CLNYASTTWESKNPGVYERRLSYKYNHYVSVFGGGVTCAQQKSLAPSDEGWILNEIVALH  915

Query  2747  GVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKE  2926
              VPF DH++V LRY+V+       + +CDVY+ + WLK  K E RI+K+I+ KF  R+  
Sbjct  916   DVPFGDHFRVHLRYEVKKAGVDCKTSKCDVYLKIRWLKTIKFEQRISKSIMEKFRTRLNV  975

Query  2927  MIEFVGREVFLSS  2965
             + +   +E   +S
Sbjct  976   IFDLFQKESVANS  988



>ref|XP_006373577.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|ERP51374.1| C2 domain-containing family protein [Populus trichocarpa]
Length=1020

 Score =   905 bits (2340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/798 (54%), Positives = 589/798 (74%), Gaps = 13/798 (2%)
 Frame = +2

Query  575   RSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELA  754
             +S + +F E +K ++SR  G E+P+NL GG+L+DQ+Y +   D N LLF+PDS F R L+
Sbjct  226   QSSSDNFEELMKEMKSRDVGSEVPKNLPGGVLVDQSYLIATPDLNSLLFSPDSSFARSLS  285

Query  755   ELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLV  934
             +  G  + Q GPW +++ + S L RV+TY +  +KLV +V+A+E+Q Y+K DGK FA+L 
Sbjct  286   DFLGNSEQQFGPWKFENGSGS-LKRVITYVRAPSKLVGAVKASEDQIYVKVDGKTFAILN  344

Query  935   DVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQ  1114
              VSTPDV YGSTFKVELLY I PGP L SGEE++HLVISW + F +STM K++IE G + 
Sbjct  345   CVSTPDVMYGSTFKVELLYCITPGPELPSGEETSHLVISWRMNFLQSTMFKSMIENGARA  404

Query  1115  GLKDSFSEFSRFLAQHCKVITSAEVLDNG----HLLATLPSEHPSDLELAREYFCNFTVV  1282
             GLKDSF +FS FL+Q  K +   ++ D G     +LA+L +E  SD +LA +YF NFTVV
Sbjct  405   GLKDSFEQFSTFLSQTVKPV---DLKDMGSSKEQVLASLKAEPQSDRKLAVQYFANFTVV  461

Query  1283  STAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVE  1462
             S  F+ LY  +HI L+  + +QGLEF GLDLPDS+GE++ C +L L  E+V  +++ F++
Sbjct  462   SAFFMGLYVFVHIWLAAPSAIQGLEFLGLDLPDSIGEVLVCSVLALQCERVLGLLSRFMQ  521

Query  1463  ARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQT  1642
             AR ++G+DHGV+A GDGW+LTVALIEG++L ++D +GF DP+VVFTCNGK++TSS++ Q 
Sbjct  522   ARAQKGTDHGVKAQGDGWLLTVALIEGSHLPTVDSSGFCDPYVVFTCNGKTKTSSIKFQK  581

Query  1643  LDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPL  1822
              DP WNEI EF+  ++PPS+LDV+V+DFDGPFD+A SLGH EINF+K   ++LAD+W+PL
Sbjct  582   SDPLWNEIFEFDAMDDPPSVLDVDVYDFDGPFDEAMSLGHTEINFVKSNLSDLADVWVPL  641

Query  1823  GGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLP  2002
              GK+AQ+ QSKLHLRIFLNN  G   +++ L+KMEKEVGKK+N+RSP  NS FQK FGLP
Sbjct  642   QGKLAQACQSKLHLRIFLNNTRGSNVVKEYLSKMEKEVGKKINVRSPQTNSAFQKVFGLP  701

Query  2003  PEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSF  2182
             PEEFLINDF+C LKRK+PLQGR+FLS RI+GFYANLF  KTKFFFLWEDIE+I +  P+ 
Sbjct  702   PEEFLINDFTCHLKRKMPLQGRLFLSARIIGFYANLFRQKTKFFFLWEDIEDIQIYTPTL  761

Query  2183  STMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGA-SRTIMALWKTRAC  2359
             S+MGSP +VI L + +G DAR+GAK+ID+EGRL F F SFVSF  A SRTIMALWK R+ 
Sbjct  762   SSMGSPVIVITLRQGKGMDARHGAKNIDDEGRLKFHFQSFVSFNVAHSRTIMALWKARSL  821

Query  2360  IPDQKAQIAEEQQYKDENNVL-PEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGD  2536
               +QK QI EE     E  +L  EE+GS+L +EDVSMS+VY+    +    +MEMF GG+
Sbjct  822   SLEQKVQIVEEDS---ETKILQTEESGSFLGLEDVSMSEVYAASFSVPTNFVMEMFGGGE  878

Query  2537  LEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAG  2716
             L+ KVM K+GCL+Y  + WE ++ DV+ER++ Y+ ++ IS FG EVTSTQ+K   ++  G
Sbjct  879   LDRKVMEKAGCLSYSYTPWESVKTDVHERQIYYRFDKRISRFGGEVTSTQQKYPLSDRKG  938

Query  2717  WILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNI  2896
             W++ E+M +HGVP  D++ + LRY+VE   +    C   V +G+ WLK+T+ + RI+KNI
Sbjct  939   WLVEEVMTLHGVPLGDYFNLHLRYQVEDFPSRLKGCHVRVSIGIQWLKSTRHQKRISKNI  998

Query  2897  VRKFSQRVKEMIEFVGRE  2950
             +     R+K +   V +E
Sbjct  999   LSNLQDRLKVIFSLVEKE  1016



>gb|KHN14410.1| C2 and GRAM domain-containing protein [Glycine soja]
Length=1002

 Score =   904 bits (2337),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/795 (54%), Positives = 577/795 (73%), Gaps = 4/795 (1%)
 Frame = +2

Query  575   RSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELA  754
             +S  ++F EA++ LQS  +G E+P NL  G+ +DQ Y + P+D N LLF+ DS F + LA
Sbjct  209   QSSNETFEEAMRKLQSADQGSEIPSNLPAGVFIDQQYVIAPEDLNELLFSSDSNFLKSLA  268

Query  755   ELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLV  934
             E+QG  +++ GPW +++D +    R+VTY K  +KL+K+V+A EE TYLK DGK FAVLV
Sbjct  269   EVQGNTELEIGPWKFENDGE-IFKRLVTYVKAPSKLIKAVKAYEEHTYLKADGKNFAVLV  327

Query  935   DVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQ  1114
              VSTPDV YGSTF+VE+LY I PGP L +GE+ + LV+SW + F +STMMK +IE G +Q
Sbjct  328   SVSTPDVMYGSTFRVEVLYVITPGPELPTGEQCSCLVVSWRMNFLQSTMMKGMIENGARQ  387

Query  1115  GLKDSFSEFSRFLAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYFCNFTVVSTA  1291
             G+KDSF +++  L+Q  K     ++  N    LA+L +E  SD  LA  YF NFTV +T 
Sbjct  388   GMKDSFDQYATLLSQTVKPADVKDLSSNKEQALASLHAEPESDWRLAVRYFANFTVFTTV  447

Query  1292  FLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARL  1471
             F+ LY  +HI L+  + +QGLEF GLDLPDS+GE + C ILVL  E++  +I+ F++AR 
Sbjct  448   FMGLYVIVHIWLAAPSTIQGLEFGGLDLPDSIGEFVVCAILVLQGERMLGIISRFIKARA  507

Query  1472  RRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDP  1651
             ++GSDHG++A GDGW+LTVALIEG++LAS+D +G  DP+VVFTCNGK+RTSS++ Q  + 
Sbjct  508   QKGSDHGIKAQGDGWLLTVALIEGSSLASVDSSGLSDPYVVFTCNGKTRTSSIKFQKSNL  567

Query  1652  QWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGK  1831
              WNEI EF+  ++PPS+LDV V+DFDGPFD+A SLGHAEINFLK   A+LAD+W+PL GK
Sbjct  568   TWNEIFEFDAMDDPPSVLDVVVYDFDGPFDEAASLGHAEINFLKANIADLADIWVPLEGK  627

Query  1832  IAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEE  2011
             +A + QSKLHLRIFL+N  G    +D L++MEKEVGKK+NLRSP  NS FQK FGLPPEE
Sbjct  628   LALACQSKLHLRIFLDNTRGGNVAKDYLSRMEKEVGKKINLRSPQANSAFQKLFGLPPEE  687

Query  2012  FLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTM  2191
             FLINDF+C LKRK+PLQGR+FLS RI+GF+ANLFG+KTKFFFLWEDIE+I V+PP+FS+M
Sbjct  688   FLINDFTCHLKRKMPLQGRLFLSARIIGFHANLFGNKTKFFFLWEDIEDIQVIPPTFSSM  747

Query  2192  GSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQ  2371
             GSP +VI L K RG DAR+GAK+ DE+GRL F F SFVSF  A RTIMALWK R+  P+Q
Sbjct  748   GSPIIVITLRKGRGVDARHGAKTQDEQGRLRFHFQSFVSFNVAHRTIMALWKVRSLSPEQ  807

Query  2372  KAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKV  2551
             K +  EEQ   D  +++ +E+GS+L ++DVSMS++YS  L +    LME+F+GG+L+ +V
Sbjct  808   KVEFVEEQS--DSKSLISDESGSFLGLDDVSMSEIYSCSLLIPASYLMEIFSGGELDRRV  865

Query  2552  MSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNE  2731
             M K G LNY  + W     D+ ER V YK  + IS +  EVTSTQ++S  A+  GW++ E
Sbjct  866   MEKLGYLNYSYTPWVSENHDISERAVYYKFEKRISSYKGEVTSTQQRSPLADGKGWLVEE  925

Query  2732  IMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFS  2911
             +M +HGVP  D++ + LRY++E        CR  V  G+ WLK++K + R+TKNI+    
Sbjct  926   LMNLHGVPLGDYFNIHLRYQIEDLPPKAKGCRVQVLFGMEWLKSSKNQKRLTKNILENLL  985

Query  2912  QRVKEMIEFVGREVF  2956
             +R K       +E+ 
Sbjct  986   ERFKVTFSLAEKELL  1000



>ref|XP_006398485.1| hypothetical protein EUTSA_v10000756mg [Eutrema salsugineum]
 gb|ESQ39938.1| hypothetical protein EUTSA_v10000756mg [Eutrema salsugineum]
Length=1020

 Score =   904 bits (2335),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/798 (54%), Positives = 586/798 (73%), Gaps = 6/798 (1%)
 Frame = +2

Query  560   VQETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQF  739
             + E   S   SF E +K ++SR +G E P NL GGIL+DQ + + P D N +LFA DS F
Sbjct  218   LSEDESSPAASFEEVMKAVESRDQGNEPPSNLPGGILVDQLFMISPSDLNTVLFASDSSF  277

Query  740   RRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKE  919
                L ELQGT +VQ GPW  +++ +S + RVV+Y K  TKL+K+V+ TEEQTYLK DG+ 
Sbjct  278   YASLTELQGTTEVQIGPWKIENEGES-VKRVVSYLKAPTKLIKAVKGTEEQTYLKADGEV  336

Query  920   FAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIE  1099
             +AVL  V+TPDVP+GSTFKVE+LY I PGP L SGE+ + LVISW + F +STMMK +IE
Sbjct  337   YAVLASVTTPDVPFGSTFKVEVLYCISPGPELPSGEKCSRLVISWRLNFLQSTMMKGMIE  396

Query  1100  GGTQQGLKDSFSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFT  1276
              G +QGLKDSF +++  LAQ+ K + S ++ L+    L++L +E  SD +LA +YF NFT
Sbjct  397   NGARQGLKDSFEQYANLLAQNVKPVDSKDIGLNKEQALSSLQAEPQSDWKLAVQYFANFT  456

Query  1277  VVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHF  1456
             V ST  + +Y  +HI+ +  + +QGLEF+GLDLPDS+GE +  G+LVL  E+V ++I+ F
Sbjct  457   VFSTFVMGVYVFVHIVFALPSAIQGLEFNGLDLPDSIGEFVVSGVLVLQCERVLQLISRF  516

Query  1457  VEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQL  1636
             ++AR ++GSDHG++AHGDGW+LTVALIEG +LA++DP+G  DP++VFT NGK+RTSS++ 
Sbjct  517   MQARKQKGSDHGIKAHGDGWLLTVALIEGVDLAAVDPSGHCDPYIVFTSNGKTRTSSIKF  576

Query  1637  QTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWL  1816
             Q   PQWNEI EF+   +PPS+L++EV+DFDGPFD+A SLGHAEINF++   ++LAD+W+
Sbjct  577   QKSHPQWNEIFEFDAMADPPSVLNIEVYDFDGPFDEAVSLGHAEINFVRSNISDLADVWI  636

Query  1817  PLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFG  1996
             PL GK+AQ+ QSKLHLRIFL++  G + +RD L KMEKEVGKK+N+RSP  NS FQK FG
Sbjct  637   PLQGKLAQACQSKLHLRIFLDHTGGGDVVRDYLNKMEKEVGKKINVRSPQTNSAFQKLFG  696

Query  1997  LPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPP  2176
             LP EEFLINDF+C LKRK+PLQGR+FLS RIVGFYA+LFG+KTKFFFLWEDIE+I VLPP
Sbjct  697   LPQEEFLINDFTCHLKRKMPLQGRLFLSARIVGFYASLFGNKTKFFFLWEDIEDIQVLPP  756

Query  2177  SFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRA  2356
             + ++MGSP +V+ L   RG DAR GAK+ DEEGRL F FHSFVSF  A +TIMALWK ++
Sbjct  757   TLASMGSPIIVMTLRPGRGMDARIGAKTHDEEGRLKFHFHSFVSFNVAQKTIMALWKAKS  816

Query  2357  CIPDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGD  2536
               P+QK Q  EE+    E  +  EE+G +L V+DV  S+VYS+ L +     ME+F GG+
Sbjct  817   LTPEQKVQAVEEES---EQKLQSEESGLFLGVDDVRFSEVYSLTLSVPVSFFMELFGGGE  873

Query  2537  LEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAG  2716
             ++ K M ++GC +Y  S WE  + DVYER+  Y+  R IS +  EVTSTQ+KS+  +  G
Sbjct  874   VDRKAMERAGCQSYSCSPWESEKADVYERQTYYRDKR-ISRYRGEVTSTQQKSLVPDKNG  932

Query  2717  WILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNI  2896
             W++ E+M +HGVP  D++ + LRY++E  ++   +    VY G+ WLK+++ + R+TKNI
Sbjct  933   WLVEEVMTLHGVPLGDYFNLHLRYQMEEVASKPKTTYVRVYFGIEWLKSSRHQKRVTKNI  992

Query  2897  VRKFSQRVKEMIEFVGRE  2950
             +     R+K +  F+ +E
Sbjct  993   LVNLQDRLKMIFGFLEKE  1010



>ref|XP_011040139.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Populus euphratica]
Length=1019

 Score =   903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/794 (54%), Positives = 585/794 (74%), Gaps = 6/794 (1%)
 Frame = +2

Query  575   RSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELA  754
             +S + +F E +K ++SR  G E+P+NL GG+L+DQ+Y +   D N LLF+PDS F R L 
Sbjct  226   QSSSVNFEELMKEMKSRDVGSEVPKNLPGGVLVDQSYLIATPDLNSLLFSPDSSFARSLP  285

Query  755   ELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLV  934
             +  G  + Q GPW +++ ++S L RV+TY +  +KLV +V+A+E+Q Y+K DGK FA+L 
Sbjct  286   DFLGNSEQQFGPWKFENGSES-LKRVITYVRAPSKLVGAVKASEDQIYVKVDGKTFAILN  344

Query  935   DVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQ  1114
              VSTPDV YGSTFKVELLY I PGP L SGEE++HLVISW + F +STM K++IE G + 
Sbjct  345   CVSTPDVMYGSTFKVELLYCITPGPELPSGEETSHLVISWRMNFLQSTMFKSMIENGARA  404

Query  1115  GLKDSFSEFSRFLAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYFCNFTVVSTA  1291
             GLKDSF  FS FL+Q+ K +   +V  +   +LA+L +E  SD +LA  YF NFTVVS  
Sbjct  405   GLKDSFELFSTFLSQNVKPVDLKDVGSSKEQVLASLKAEPQSDRKLAVRYFGNFTVVSAF  464

Query  1292  FLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARL  1471
             F+ LY  +HI L+    +QGLEF GLDLPDS+GE++ C +L L  E+V  +++ F++AR 
Sbjct  465   FMGLYVFVHIWLAAPNAIQGLEFLGLDLPDSIGEVLVCSVLALQCERVLGLLSRFMQARA  524

Query  1472  RRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDP  1651
             ++G+DHGV+A GDGW+LTVALIEG++L ++D +GF DP+VVFTCNGK++TSS++ Q  DP
Sbjct  525   QKGTDHGVKAQGDGWLLTVALIEGSHLPTVDSSGFCDPYVVFTCNGKTKTSSIKFQKSDP  584

Query  1652  QWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGK  1831
              WNEI EF+  ++PPS+LDV+V+DFDGPFD+A SLGH EINF+K   ++LAD+W+PL GK
Sbjct  585   LWNEIFEFDAMDDPPSVLDVDVYDFDGPFDEAMSLGHTEINFVKSNLSDLADVWVPLQGK  644

Query  1832  IAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEE  2011
             +AQ+ QSKLHLRIFLNN  G   +++ L+KMEKEVGKK+N+RSP  NS FQK FGLPPEE
Sbjct  645   LAQACQSKLHLRIFLNNTRGSNVVKEYLSKMEKEVGKKINVRSPQTNSAFQKVFGLPPEE  704

Query  2012  FLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTM  2191
             FLINDF+C LKRK+PLQGR+FLS RI+GFYANLF  KTKFFFLWEDIE+I +  P+ S+M
Sbjct  705   FLINDFTCHLKRKMPLQGRLFLSARIIGFYANLFRQKTKFFFLWEDIEDIQIYTPTLSSM  764

Query  2192  GSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQ  2371
             GSP +VI L + RG DAR+GAK+ID+EGRL F F SFVSF  A RTIMALWK R+   +Q
Sbjct  765   GSPVIVITLRQGRGMDARHGAKNIDDEGRLKFHFQSFVSFNVAHRTIMALWKARSLSLEQ  824

Query  2372  KAQIAEEQQYKDENNVL-PEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHK  2548
             K QI EE     E  +L  EE+GS+L +E+VSMS+VY+    +    +MEMF GG+L+ K
Sbjct  825   KVQIVEEDS---ETKILQTEESGSFLGLEEVSMSEVYAASFSVPTNFVMEMFGGGELDRK  881

Query  2549  VMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILN  2728
             VM K+GCL+Y  + WE ++ DV+ER++ Y+ ++ +S FG +VTSTQ+K   ++  GW++ 
Sbjct  882   VMEKAGCLSYSYTPWESVKTDVHERQIYYRFDKRVSRFGGDVTSTQQKYPLSDRKGWLVE  941

Query  2729  EIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKF  2908
             E+M +HGVP  D++ + LRY+VE   +    C   V +GV WLK+T+ + RI+KNI+   
Sbjct  942   EVMTLHGVPLGDYFNLHLRYQVEDFPSRLKGCHVRVSIGVAWLKSTRHQKRISKNILSNL  1001

Query  2909  SQRVKEMIEFVGRE  2950
               R+K +   V +E
Sbjct  1002  QDRLKVIFSLVEKE  1015



>emb|CDX77802.1| BnaC07g20560D [Brassica napus]
Length=1020

 Score =   903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/792 (54%), Positives = 585/792 (74%), Gaps = 6/792 (1%)
 Frame = +2

Query  578   SQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAE  757
             S   SF E +K ++SR +  E P NL GGIL+DQ + + P D N +LFAPDS F   L E
Sbjct  224   SSPASFDEVMKAIESRDQEVETPSNLPGGILVDQLFMITPSDLNTVLFAPDSSFYTSLTE  283

Query  758   LQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVD  937
             LQGT +VQ  PW  +++ +S   RVV+Y K ATKL+K+V+ TEEQ YLK DG+ ++VL  
Sbjct  284   LQGTTEVQITPWKLENEGESA-KRVVSYLKAATKLIKAVKGTEEQAYLKADGEVYSVLAI  342

Query  938   VSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQG  1117
             VSTPDVP+GSTFKVE+LY I PGP L SGE+ + LVISW + F +STMMK +IE G +QG
Sbjct  343   VSTPDVPFGSTFKVEVLYCISPGPELPSGEQCSRLVISWRLNFLQSTMMKGMIENGARQG  402

Query  1118  LKDSFSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAF  1294
             LKDSF +++  LAQ+ K + S ++ ++    L++L +E  SD +LA +YF NFTV ST  
Sbjct  403   LKDSFEQYATLLAQNVKPVDSKDIGVNKDQALSSLHAEPQSDWKLAVQYFANFTVFSTFL  462

Query  1295  LVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLR  1474
             + +Y  +HI+LS  + +QGLEF GLDLPDS+GE +  G+LVL  E+V ++I+ F++AR +
Sbjct  463   IGVYVFVHIMLSLPSAIQGLEFSGLDLPDSIGEFVVSGVLVLQCERVLQLISRFMQARKQ  522

Query  1475  RGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQ  1654
             +GSDHGV+AHGDGW+LTVALIEG +LA++DP+G  DP++VFT NGK+RTSS++ Q   P 
Sbjct  523   KGSDHGVKAHGDGWLLTVALIEGVDLAAVDPSGHCDPYIVFTSNGKTRTSSIKFQKSHPL  582

Query  1655  WNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKI  1834
             WNEI EF+   +PPS+L++EV+DFDGPFD+A SLGHAE+NF++   ++LAD+W+PL GK+
Sbjct  583   WNEIFEFDAMADPPSVLNIEVYDFDGPFDEAVSLGHAEVNFVRSNISDLADVWIPLQGKL  642

Query  1835  AQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEF  2014
             AQ+ QSKLHLRIFL++  G + +RD LTKMEKEVGKK+N+RSP  NS FQK FGLP EEF
Sbjct  643   AQACQSKLHLRIFLDHTGGGDVVRDYLTKMEKEVGKKINVRSPQTNSAFQKLFGLPQEEF  702

Query  2015  LINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMG  2194
             LINDF+C LKRK+PLQGR+FLS RIVGFYA+LFG+KTKFFFLWEDIE+I VLPP+ ++MG
Sbjct  703   LINDFTCHLKRKMPLQGRLFLSARIVGFYASLFGNKTKFFFLWEDIEDIQVLPPTLASMG  762

Query  2195  SPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQK  2374
             SP++V+ L  +RGTDAR GAK+ DEEGRL F FHSFVSF  A +TIMALWK ++  P+QK
Sbjct  763   SPTVVMTLRPNRGTDARIGAKTHDEEGRLKFHFHSFVSFNVAQKTIMALWKAKSLTPEQK  822

Query  2375  AQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVM  2554
              Q  EE+    E  +  EE GS+L ++DV  S+VYS+ L +     ME+F GG+++ K M
Sbjct  823   VQAVEEES---EQKLQSEECGSFLGIDDVRFSEVYSLTLSVPVSFFMELFGGGEVDRKAM  879

Query  2555  SKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEI  2734
              ++ C +Y  S WE  + DVYER+  Y+  R IS +  EVTSTQ+K++  +  GW++ E+
Sbjct  880   ERACCQSYSCSPWESEKADVYERQTYYRDKR-ISRYRGEVTSTQQKTLVPDKNGWLVEEV  938

Query  2735  MAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQ  2914
             M +HGVP  D++ + LRY++E  ++  N+    VY G+ WLK+++ + R+TKNI+     
Sbjct  939   MTLHGVPLGDYFNLHLRYQIEEVASKPNTTYVRVYFGIEWLKSSRHQKRVTKNILVNLQD  998

Query  2915  RVKEMIEFVGRE  2950
             R+K +  F+ +E
Sbjct  999   RLKMVFGFLEKE  1010



>ref|XP_010252840.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Nelumbo nucifera]
Length=1030

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/799 (55%), Positives = 581/799 (73%), Gaps = 11/799 (1%)
 Frame = +2

Query  575   RSQTQSFC----EAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFR  742
             +S+ QSF     EAI+ +  R +G E+P NL GGILLDQ+Y + P   N LLF+PDS F+
Sbjct  231   KSEEQSFGGNFEEAIRSMSERDQGGEVPGNLPGGILLDQSYIIAPSSLNSLLFSPDSDFQ  290

Query  743   RELAELQGTKDVQEGPWTWKSDN-KSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKE  919
             + LAE+QGT ++Q+GPW  + DN    L RV+TYTK ATKL+K+V+ATEEQ YLK DGK 
Sbjct  291   KSLAEVQGTTEIQQGPW--RCDNCTENLKRVITYTKAATKLIKAVKATEEQVYLKADGKV  348

Query  920   FAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIE  1099
             FAVL  VSTPDV YGSTFK ELL+ I PGP L   E S+ L+ISW + F +STMMK++IE
Sbjct  349   FAVLSSVSTPDVMYGSTFKTELLFCITPGPELPREELSSRLIISWRMNFIQSTMMKSMIE  408

Query  1100  GGTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNGHL-LATLPSEHPSDLELAREYFCNFT  1276
             GG +QGLKDSF +F+  L+Q+ K +   ++  +  L LA+L  E  S  +LA +YF NFT
Sbjct  409   GGARQGLKDSFEQFADLLSQNVKKVDLKDLGSDKELVLASLQVEPQSGWKLAFQYFANFT  468

Query  1277  VVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHF  1456
             VVST  + +Y   HILL+  + +QGLEF GLDLPDSV E+I  GILVL  +++  +IA F
Sbjct  469   VVSTIVMGVYVIAHILLAMPSLVQGLEFVGLDLPDSVSEVIVSGILVLQSQRLLGLIARF  528

Query  1457  VEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQL  1636
             ++AR+++GSDHG++A GDGW+LTVALIEG+N+A++D  GF DP+VVFTCNGK+R+SS+  
Sbjct  529   LQARVQKGSDHGIKAQGDGWLLTVALIEGSNIAAVDSKGFSDPYVVFTCNGKTRSSSITF  588

Query  1637  QTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWL  1816
             Q  DP+WNEI EF+  +EPPS+LDVEV+DFDG F +A  LGHAEINF+K   ++LAD+W+
Sbjct  589   QKADPEWNEIFEFDAMDEPPSVLDVEVYDFDGSFVEAECLGHAEINFVKSNISDLADVWI  648

Query  1817  PLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFG  1996
             PL G++AQ+ QSKLHLRIFLNN  G   +++ L KMEKEVGKK+NLRSP  NS FQK FG
Sbjct  649   PLQGRLAQACQSKLHLRIFLNNTRGSNVVKEYLVKMEKEVGKKINLRSPQTNSAFQKLFG  708

Query  1997  LPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPP  2176
             LPPEEFLINDF+C LKRK+PLQGR+FLS RI+GF+ +LFGHKT FFFLW+DIE+I V P 
Sbjct  709   LPPEEFLINDFTCHLKRKMPLQGRLFLSARIIGFHTSLFGHKTTFFFLWKDIEDIQVFPA  768

Query  2177  SFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRA  2356
             + ++MGSP ++I L + RG DAR+GAK+ DE+GRL F F +FVSF  A RTIMA+WK   
Sbjct  769   TLASMGSPFIIITLQQGRGMDARHGAKTQDEQGRLKFHFQAFVSFNVAIRTIMAVWKANF  828

Query  2357  CIPDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGD  2536
               P+QK +I EE+   +  N+  E+ GS L VED  MS+VYS  LP+    L+EMF GG 
Sbjct  829   LSPEQKVEIDEEE--SETKNLQTEDNGSILGVEDARMSEVYSCLLPVPINLLIEMFGGGP  886

Query  2537  LEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAG  2716
             LE K+M + GC NY  + WEL + D+YER++SY L++ +  +  EVTSTQ+KS  ++  G
Sbjct  887   LERKIMEQVGCSNYCYTPWELEKADLYERQISYILDKSLFRYSGEVTSTQQKSPLSDRNG  946

Query  2717  WILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSC-RCDVYVGVMWLKNTKLEDRITKN  2893
             WI+ E+M I GVP +DH+ + LRY+++  ++    C    V+ G+ WLK+TK + +I K+
Sbjct  947   WIIEEVMTIQGVPLADHFTLHLRYQIQDLASRSKGCLYVQVFFGIGWLKSTKHQKKIKKS  1006

Query  2894  IVRKFSQRVKEMIEFVGRE  2950
             I      R+K+M     +E
Sbjct  1007  ISSNLQDRLKKMFSLFEKE  1025



>ref|XP_009101380.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 [Brassica 
rapa]
Length=1022

 Score =   901 bits (2328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/902 (50%), Positives = 625/902 (69%), Gaps = 13/902 (1%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPS-VGSETSKDVD--AIKVSSPKKVLEGKQLIKSI  439
             G ILL +    K   +  N     + S VG ETS D    A    S       K   KS+
Sbjct  116   GDILLGIWFSQKNSVVDLNSIADQRTSDVGMETSADPSTCASPCRSEDAASSSKDSQKSL  175

Query  440   AGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQS----FCEAI  607
             AG + ++F KN   + S         S + S   S+   ++     S+ +S    F E +
Sbjct  176   AGRIAQIFQKNGSDAASAAPTPSISRSIDASEPSSEMSRSIFSLELSEDESSPASFEEVM  235

Query  608   KLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEG  787
             K ++SR +  E P NL GGIL+DQ + + P D N +LFAPDS F   L ELQGT +VQ  
Sbjct  236   KAMESRDQEVESPSNLPGGILVDQLFMITPSDLNTVLFAPDSSFYASLTELQGTTEVQIT  295

Query  788   PWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGS  967
             PW  +++ +S   RVV+Y K ATKL+K+V+ TEEQ Y K DG+ ++VL  VSTPDVP+GS
Sbjct  296   PWKLENEGESA-KRVVSYLKAATKLIKAVKGTEEQAYHKADGEVYSVLAIVSTPDVPFGS  354

Query  968   TFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSR  1147
             TFKVE+LY I PGP L SGE+ + LVISW + F +STMMK +IE G +QGLKDSF +++ 
Sbjct  355   TFKVEVLYCISPGPELPSGEQCSRLVISWRLNFLQSTMMKGMIENGARQGLKDSFEQYAT  414

Query  1148  FLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHIL  1324
              LAQ+ K + S ++ ++    L++L +E  SD +LA +YF NFTV ST  + +Y  +HI+
Sbjct  415   LLAQNVKPVDSKDIGVNKEQALSSLHAEPQSDWKLAVQYFANFTVFSTFLIGVYVFVHIM  474

Query  1325  LSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAH  1504
             LS  + +QGLEF GLDLPDS+GE +  G+LVL  E+V ++I+ F++AR ++GSDHGV+AH
Sbjct  475   LSLPSAIQGLEFSGLDLPDSIGEFVVSGVLVLQCERVLQLISRFMQARKQKGSDHGVKAH  534

Query  1505  GDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPA  1684
             GDGW+LTVALIEG +LA++DP+G  DP++VFT NGK+RTSS++ Q   P WNEI EF+  
Sbjct  535   GDGWLLTVALIEGVDLAAVDPSGHCDPYIVFTSNGKTRTSSIKFQKSHPLWNEIFEFDAM  594

Query  1685  EEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHL  1864
              +PPS+L++EV+DFDGPFD+A SLGHAEINF++   ++LAD+W+PL GK+AQ+ QSKLHL
Sbjct  595   ADPPSVLNIEVYDFDGPFDEAVSLGHAEINFVRSNISDLADVWIPLQGKLAQACQSKLHL  654

Query  1865  RIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLK  2044
             RIFL++  G + +RD LTKMEKEVGKK+N+RSP  NS FQK F LP EEFLINDF+C LK
Sbjct  655   RIFLDHTGGGDVVRDYLTKMEKEVGKKINVRSPQTNSAFQKLFSLPQEEFLINDFTCHLK  714

Query  2045  RKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHK  2224
             RK+PLQGR+FLS RIVGFYA+LFG+KTKFFFLWEDIE+I VLPP+ ++MGSP++V+ L  
Sbjct  715   RKMPLQGRLFLSARIVGFYASLFGNKTKFFFLWEDIEDIQVLPPTLASMGSPTVVMTLRP  774

Query  2225  DRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYK  2404
             +RGTDAR GAK+ DEEGRL F FHSFVSF  A +TIMALWK ++  P+QK Q  EE+   
Sbjct  775   NRGTDARIGAKTHDEEGRLKFHFHSFVSFNVAQKTIMALWKAKSLTPEQKVQAVEEES--  832

Query  2405  DENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVT  2584
              E  +  EE+GS+L ++DV  S+VYS+ L +     ME+F GG+++ K M ++ C +Y  
Sbjct  833   -EQKLQSEESGSFLGIDDVRFSEVYSLTLSVPVSFFMELFGGGEVDRKAMERACCQSYSC  891

Query  2585  SSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSD  2764
             S WE  + DVYER+  Y+  R IS +  EVTSTQ+K++  +  GW++ E+M +HGVP  D
Sbjct  892   SPWESEKADVYERQTYYRDKR-ISRYRGEVTSTQQKTLVPDKNGWLVEEVMTLHGVPLGD  950

Query  2765  HYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVG  2944
             ++ + LRY++E  ++  N+    VY G+ WLK+++ + R+TKNI+     R+K +  F+ 
Sbjct  951   YFNLHLRYQMEEVASKPNTTYVRVYFGIEWLKSSRHQKRVTKNILVNLQDRLKMVFGFLE  1010

Query  2945  RE  2950
             +E
Sbjct  1011  KE  1012



>gb|KFK31345.1| hypothetical protein AALP_AA6G100200 [Arabis alpina]
Length=1021

 Score =   900 bits (2327),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/798 (53%), Positives = 589/798 (74%), Gaps = 6/798 (1%)
 Frame = +2

Query  560   VQETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQF  739
             + E     + SF + +K ++S+ +G E+P NL GGI++DQ + + P D N+LLFAPDS  
Sbjct  217   MSEEDSPSSASFEQVMKAMESKDQGSELPSNLPGGIVVDQLFMITPSDLNILLFAPDSTL  276

Query  740   RRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKE  919
                  ELQGT +VQ GPW  +++ +S + RVV+Y K  TKL+K+V+ TEEQ+YLK DG+ 
Sbjct  277   YASFTELQGTTEVQIGPWKLENEAES-VKRVVSYLKAPTKLIKAVKGTEEQSYLKADGES  335

Query  920   FAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIE  1099
             +A+   V+TPDVP+GSTFKVE+LY I PGP L SGE+ + LVISW + F +STMMK +IE
Sbjct  336   YAIFASVATPDVPFGSTFKVEVLYCITPGPELPSGEQCSRLVISWRLNFLQSTMMKGMIE  395

Query  1100  GGTQQGLKDSFSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFT  1276
              G +QGLKD+F +++  +AQ+ K + S ++ ++    L++L +E  SD +LA +YF NFT
Sbjct  396   NGARQGLKDNFEQYANLVAQNVKPVDSKDIGVNKEQALSSLQAEPQSDWKLAIQYFANFT  455

Query  1277  VVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHF  1456
             V ST  + +Y  +HI+ +  + +QGLEF+GLDLPDS+GE +  G+LVL  E+V ++I+ F
Sbjct  456   VFSTFMIGVYVFVHIMCALPSAMQGLEFNGLDLPDSIGEFVVSGVLVLQCERVLQLISRF  515

Query  1457  VEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQL  1636
             ++AR ++GSDHG++AHGDGW+LTVALIEG +LA++DP+G  DP++VFT NGK+RTSS++ 
Sbjct  516   MQARKQKGSDHGIKAHGDGWLLTVALIEGVDLAAVDPSGQCDPYIVFTSNGKARTSSIKF  575

Query  1637  QTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWL  1816
             Q  +PQWNEI EF+   +PPS+L+VEV+DFDGPFD+A SLGHAEINF++   ++LAD+W+
Sbjct  576   QKSNPQWNEIFEFDAMADPPSVLNVEVYDFDGPFDEAVSLGHAEINFVRSNISDLADVWI  635

Query  1817  PLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFG  1996
             PL GK+AQ+ QSKLHLRIFL++  G + +RD L KMEKEVGKK+N+RSP  NS FQK FG
Sbjct  636   PLQGKLAQACQSKLHLRIFLDHTGGGDVVRDYLNKMEKEVGKKINVRSPQTNSAFQKLFG  695

Query  1997  LPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPP  2176
             LP EEFLINDF+C LKRK+PLQGR+FLS RIVGFYA+LFG+KTKFFF+WEDIEEI VLPP
Sbjct  696   LPQEEFLINDFTCHLKRKMPLQGRLFLSARIVGFYASLFGNKTKFFFMWEDIEEIQVLPP  755

Query  2177  SFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRA  2356
             + ++MGSP +V+ L   RG DAR GAK  DEEGRL F FHSFVSF  A +TIMALWK ++
Sbjct  756   TLASMGSPIIVMTLRPGRGMDARIGAKIHDEEGRLKFHFHSFVSFNVAQKTIMALWKAKS  815

Query  2357  CIPDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGD  2536
               P+QK Q  EE+    E  +  EE+G +L ++DV  ++VYS+ LP+     ME+F GG+
Sbjct  816   LTPEQKVQAVEEE---SEQKLQSEESGLFLGIDDVRFNEVYSLTLPVPVSFFMELFGGGE  872

Query  2537  LEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAG  2716
             ++ K M ++GC +Y  S WE  + DV+ER+  Y+ +R IS +  EVTSTQ+KS+ A+  G
Sbjct  873   VDRKAMDRAGCQSYSCSPWESEKADVFERQTYYR-DRRISRYRGEVTSTQQKSLVADKNG  931

Query  2717  WILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNI  2896
             WI+ E+M +HGVP  D++ + LRY++E  ++   +    VY G+ WLK+T+ + R+TKNI
Sbjct  932   WIVEEVMTLHGVPLGDYFNLHLRYQMEEVASKPMTTFVRVYFGIEWLKSTRHQKRVTKNI  991

Query  2897  VRKFSQRVKEMIEFVGRE  2950
             +     R+K +  F+ +E
Sbjct  992   LVNLQDRLKMIFGFLEKE  1009



>ref|XP_010542178.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 [Tarenaya 
hassleriana]
Length=1012

 Score =   900 bits (2326),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/802 (54%), Positives = 583/802 (73%), Gaps = 6/802 (1%)
 Frame = +2

Query  563   QETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFR  742
             Q    S + SF E +K ++SR E  E P +L GGILLDQ Y + P D N L+F+ DS F 
Sbjct  216   QSEDESSSASFEEVMKSMESRDEESETPSDLPGGILLDQLYMIAPSDLNALIFSLDSNFY  275

Query  743   RELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEF  922
                 E QGT +V  GPW ++++ +S L R+VTY K  TKL+K+V+ TE+QTYLK DGK +
Sbjct  276   TSFTESQGTTEVHIGPWKFENEGES-LKRIVTYLKAPTKLIKAVRGTEDQTYLKADGKVY  334

Query  923   AVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEG  1102
             AVL  VSTPDVPYGSTFKVELLY I PGP L +G++ + LV+SW + F +STMM+ +IE 
Sbjct  335   AVLASVSTPDVPYGSTFKVELLYCITPGPELPAGDQCSRLVVSWRMNFLQSTMMRGMIEN  394

Query  1103  GTQQGLKDSFSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTV  1279
             G +QGLKD+F +++  LAQ  K + S ++ L+    L++L  E  SD +LA +YF NFTV
Sbjct  395   GARQGLKDNFEQYANLLAQTVKPVDSKDIGLNKEQALSSLQVETQSDWKLAVQYFANFTV  454

Query  1280  VSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFV  1459
              ST  + +Y  IHI+L+  + +QGLEF+GLDLPDSVGE +  G+LVL  E+V  +I+ F+
Sbjct  455   FSTFLIGVYILIHIMLALPSTIQGLEFNGLDLPDSVGEFVVSGVLVLQAERVLHLISRFI  514

Query  1460  EARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQ  1639
             +AR ++G+DHGV+AHGDGW+LTVALIEG +LA++D  G  DP+VVFTCNGK+RTSS++ Q
Sbjct  515   QARKQKGTDHGVKAHGDGWLLTVALIEGIDLAAVDSNGHCDPYVVFTCNGKTRTSSIKFQ  574

Query  1640  TLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLP  1819
                PQWNEI EF+  ++PPS+L+VEV+DFDGPFD+A SLGHAEINF++   ++LAD+W+P
Sbjct  575   KSHPQWNEIFEFDAMDDPPSVLNVEVYDFDGPFDEAVSLGHAEINFVRSNISDLADVWIP  634

Query  1820  LGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGL  1999
             L GK+AQ+ QSKLHLRIFL++  G   +R+ L KMEKEVGKK+N+RSP  NS FQK FGL
Sbjct  635   LQGKLAQACQSKLHLRIFLDHTGGGNVVREYLNKMEKEVGKKINVRSPQTNSAFQKLFGL  694

Query  2000  PPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPS  2179
             P EEFLINDF+C LKRK+P+QGR+FLS RI+GFYA+LFG+KTKFFFLWEDIE+I VLPP+
Sbjct  695   PQEEFLINDFTCHLKRKMPMQGRLFLSARIIGFYASLFGNKTKFFFLWEDIEDIQVLPPT  754

Query  2180  FSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRAC  2359
              ++MGSP +V+ L   RG DAR GAK+ DEEGRL F FHSFVSF  A +TIMALWK ++ 
Sbjct  755   LASMGSPIIVMTLRPGRGMDARVGAKTQDEEGRLKFHFHSFVSFNVAQKTIMALWKAKSL  814

Query  2360  IPDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDL  2539
              P+QK Q  EE+    E+ +  EE+GS+L V+DV  ++VYS  LP+     ME+F GG+L
Sbjct  815   SPEQKVQAVEEES---EDKLHSEESGSFLGVDDVRFAEVYSSTLPVPVSFFMELFGGGEL  871

Query  2540  EHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGW  2719
             + K M ++GC +Y  S WE  + DVYER+  Y+  R IS +  EVTSTQ+KS+  + +GW
Sbjct  872   DRKAMERAGCQSYSCSPWESEKADVYERQTYYRDKR-ISRYRGEVTSTQQKSLLLDRSGW  930

Query  2720  ILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIV  2899
             ++ E++ IHGVP  D++ + LRY+VE   +   +    V+ G+ WLK+++ + R+TKNI+
Sbjct  931   LVEEVLTIHGVPLGDYFNLHLRYQVEDLPSRPKTTYVRVFFGIEWLKSSRHQKRVTKNIL  990

Query  2900  RKFSQRVKEMIEFVGREVFLSS  2965
                  R+K    F+ +E   SS
Sbjct  991   VNLQDRLKLTFGFLEKEYGSSS  1012



>emb|CDY17701.1| BnaA06g35200D [Brassica napus]
Length=1022

 Score =   900 bits (2326),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/902 (50%), Positives = 625/902 (69%), Gaps = 13/902 (1%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPS-VGSETSKDVD--AIKVSSPKKVLEGKQLIKSI  439
             G ILL +    K   +  N     + S VG ETS D    A    S       K   KS+
Sbjct  116   GDILLGIWFSQKNSVVDLNSIADQRTSDVGMETSADPSTCASPCRSEDAASSSKDSQKSL  175

Query  440   AGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQS----FCEAI  607
             AG + ++F KN   + S         S + S   S+   ++     S+ +S    F E +
Sbjct  176   AGRIAQIFQKNGSDAASAAPTPSISRSIDASEPSSEMSRSIFSLELSEDESSPASFEEVM  235

Query  608   KLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEG  787
             K ++SR +  E P NL GGIL+DQ + + P D N +LFAPDS F   L ELQGT +VQ  
Sbjct  236   KAMESRDQEVETPSNLPGGILVDQLFMITPSDLNTVLFAPDSSFYASLTELQGTTEVQIT  295

Query  788   PWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGS  967
             PW  +++ +S   RVV+Y K ATKL+K+V+ TEEQ Y K DG+ ++VL  VSTPDVP+GS
Sbjct  296   PWKLENEGESA-KRVVSYLKAATKLIKAVKGTEEQAYHKADGEVYSVLAIVSTPDVPFGS  354

Query  968   TFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSR  1147
             TFKVE+LY I PGP L SGE+ + LVISW + F +STMMK +IE G +QGLKDSF +++ 
Sbjct  355   TFKVEVLYCISPGPELPSGEQCSRLVISWRLNFLQSTMMKGMIENGARQGLKDSFEQYAT  414

Query  1148  FLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHIL  1324
              LAQ+ K + S ++ ++    L++L +E  SD +LA +YF NFTV ST  + +Y  +HI+
Sbjct  415   LLAQNVKPVDSKDIGVNKEQALSSLHAEPQSDWKLAVQYFANFTVFSTFLIGVYVFVHIM  474

Query  1325  LSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAH  1504
             LS  + +QGLEF GLDLPDS+GE +  G+LVL  E+V ++I+ F++AR ++GSDHGV+AH
Sbjct  475   LSLPSAIQGLEFSGLDLPDSIGEFVVSGVLVLQCERVLQLISRFMQARKQKGSDHGVKAH  534

Query  1505  GDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPA  1684
             GDGW+LTVALIEG +LA++DP+G  DP++VF+ NGK+RTSS++ Q   P WNEI EF+  
Sbjct  535   GDGWLLTVALIEGVDLAAVDPSGHCDPYIVFSSNGKTRTSSIKFQKSHPLWNEIFEFDAM  594

Query  1685  EEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHL  1864
              +PPS+L++EV+DFDGPFD+A SLGHAEINF++   ++LAD+W+PL GK+AQ+ QSKLHL
Sbjct  595   ADPPSVLNIEVYDFDGPFDEAVSLGHAEINFVRSNISDLADVWIPLQGKLAQACQSKLHL  654

Query  1865  RIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLK  2044
             RIFL++  G + +RD LTKMEKEVGKK+N+RSP  NS FQK F LP EEFLINDF+C LK
Sbjct  655   RIFLDHTGGGDVVRDYLTKMEKEVGKKINVRSPQTNSAFQKLFSLPQEEFLINDFTCHLK  714

Query  2045  RKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHK  2224
             RK+PLQGR+FLS RIVGFYA+LFG+KTKFFFLWEDIE+I VLPP+ ++MGSP++V+ L  
Sbjct  715   RKMPLQGRLFLSARIVGFYASLFGNKTKFFFLWEDIEDIQVLPPTLASMGSPTVVMTLRP  774

Query  2225  DRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYK  2404
             +RGTDAR GAK+ DEEGRL F FHSFVSF  A +TIMALWK ++  P+QK Q  EE+   
Sbjct  775   NRGTDARIGAKTHDEEGRLKFHFHSFVSFNVAQKTIMALWKAKSLTPEQKVQAVEEES--  832

Query  2405  DENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVT  2584
              E  +  EE+GS+L ++DV  S+VYS+ L +     ME+F GG+++ K M ++ C +Y  
Sbjct  833   -EQKLQSEESGSFLGIDDVRFSEVYSLTLSVPVSFFMELFGGGEVDRKAMERACCQSYSC  891

Query  2585  SSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSD  2764
             S WE  + DVYER+  Y+  R IS +  EVTSTQ+K++  +  GW++ E+M +HGVP  D
Sbjct  892   SPWESEKADVYERQTYYRDKR-ISRYRGEVTSTQQKTLVPDKNGWLVEEVMTLHGVPLGD  950

Query  2765  HYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVG  2944
             ++ + LRY++E  ++  N+    VY G+ WLK+++ + R+TKNI+     R+K +  F+ 
Sbjct  951   YFNLHLRYQMEEVASKPNTTYVRVYFGIEWLKSSRHQKRVTKNILVNLQDRLKMVFGFLE  1010

Query  2945  RE  2950
             +E
Sbjct  1011  KE  1012



>ref|XP_006306660.1| hypothetical protein CARUB_v10008175mg [Capsella rubella]
 gb|EOA39558.1| hypothetical protein CARUB_v10008175mg [Capsella rubella]
Length=1024

 Score =   900 bits (2325),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/800 (54%), Positives = 590/800 (74%), Gaps = 7/800 (1%)
 Frame = +2

Query  578   SQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAE  757
             S + SF E +K ++S+ +G E P NL GGIL+DQ + + P D N+LLF+ DS F   L E
Sbjct  229   SSSASFEELMKAMKSKDQGSEPPSNLPGGILVDQLFMISPSDLNILLFSSDSSFYTSLTE  288

Query  758   LQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVD  937
             LQGT +VQ GPW  +++ +S + R+V+Y K  TKL+K+V+ TEEQTYLK DG+ +AVL  
Sbjct  289   LQGTTEVQIGPWKAENEGES-VKRIVSYLKAPTKLIKAVKGTEEQTYLKADGEVYAVLAS  347

Query  938   VSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQG  1117
             V+TPDVP+GSTFKVE+LY I PGP L SGE+ + LV+SW + F +STMMK +IE G +QG
Sbjct  348   VATPDVPFGSTFKVEVLYCISPGPELPSGEQCSRLVVSWRLNFLQSTMMKGMIENGARQG  407

Query  1118  LKDSFSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAF  1294
             LKD+F +++  LAQ+ K + S ++ ++    L++L +E  SD +LA +YF NFTV ST  
Sbjct  408   LKDNFEQYANLLAQNVKPVDSKDIGVNKEQALSSLQAEPQSDWKLAVQYFANFTVFSTFL  467

Query  1295  LVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLR  1474
             + +Y  +HI+ S  + +QGLEF+GLDLPDS+GE +  G+LVL  E+V ++I+ F++AR +
Sbjct  468   IGIYVFVHIVFSIPSAIQGLEFNGLDLPDSIGEFVVSGVLVLQCERVLQLISRFMQARKQ  527

Query  1475  RGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQ  1654
             +GSDHG++AHGDGW+LTVALIEG +LA++DP+G  DP++VFT NGK+RTSS++ Q  +PQ
Sbjct  528   KGSDHGIKAHGDGWLLTVALIEGVDLAAVDPSGHCDPYIVFTSNGKTRTSSIKFQKSNPQ  587

Query  1655  WNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKI  1834
             WNEI EF+   +PPS+L+VEVFDFDGPFD+A SLG AEINF++   ++LAD+W+PL GK+
Sbjct  588   WNEIFEFDAMADPPSVLNVEVFDFDGPFDEAVSLGQAEINFVRSNISDLADVWVPLQGKL  647

Query  1835  AQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEF  2014
             AQ+ QSKLHLRIFL++  G + +RD L KMEKEVGKK+N+RSP  NS FQK FGLP EEF
Sbjct  648   AQACQSKLHLRIFLDHTGGGDVVRDYLNKMEKEVGKKINVRSPQTNSAFQKLFGLPQEEF  707

Query  2015  LINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMG  2194
             LINDF+C LKRK+PLQGR+FLS RIVGFYA+LFG+KTKFFFLWEDIE+I VLPP+ ++MG
Sbjct  708   LINDFTCHLKRKMPLQGRLFLSARIVGFYASLFGNKTKFFFLWEDIEDIQVLPPTLASMG  767

Query  2195  SPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQK  2374
             SP +V+ L   RG +AR GAK+ DEEGRL F FHSFVSF  A +TIMALWK ++  P+QK
Sbjct  768   SPIIVMTLRPGRGNEARIGAKTHDEEGRLKFHFHSFVSFNVAQKTIMALWKAKSLTPEQK  827

Query  2375  AQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVM  2554
              Q  EE+    E  +  EE+G +L ++DV  S+V+S+ LP+     ME+F GG+++ K M
Sbjct  828   VQAVEEES---EQKLQSEESGLFLGIDDVRFSEVFSLTLPVPVNFFMELFGGGEVDRKAM  884

Query  2555  SKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEI  2734
              ++GC +Y  S WE  + DVYER+  Y+  R IS +  EVTSTQ+KS+     GW++ E+
Sbjct  885   ERAGCQSYSCSPWESEKADVYERQTYYRDKR-ISRYRGEVTSTQQKSLVPEKNGWLVEEV  943

Query  2735  MAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQ  2914
             M +HGVP  D++ + LRY++E  ++   +    VY G+ WLK+T+ + R+TKNI+     
Sbjct  944   MTLHGVPLGDYFNLHLRYQMEETASKPKTTYVRVYFGIEWLKSTRHQKRVTKNILVNLQD  1003

Query  2915  RVKEMIEFVGREVFLSS*KH  2974
             R+K    F+ +E + SS +H
Sbjct  1004  RLKMTFGFLEKE-YSSSKEH  1022



>ref|XP_010457346.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 [Camelina 
sativa]
Length=1029

 Score =   899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/793 (54%), Positives = 586/793 (74%), Gaps = 7/793 (1%)
 Frame = +2

Query  578   SQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAE  757
             S + SF E +K ++S+ +G E P NL GGIL+DQ + + P D N+LLF+ DS F   L+E
Sbjct  231   SSSASFEELMKAMESKDQGSEPPSNLPGGILVDQLFMISPSDLNVLLFSSDSSFYTSLSE  290

Query  758   LQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVD  937
             LQGT +VQ GPW  +++ +S + RVV+Y K  TKL+K+V+ TEEQTYLK DG+ +AVL  
Sbjct  291   LQGTTEVQVGPWKAENEGES-VKRVVSYLKAPTKLIKAVKGTEEQTYLKADGEVYAVLAS  349

Query  938   VSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQG  1117
             V+TPDVP+GSTFKVE+LY I PGP L SGE+ + LV+SW + F +STMMK +IE G +QG
Sbjct  350   VATPDVPFGSTFKVEVLYCISPGPELPSGEQCSRLVVSWRLNFLQSTMMKGMIENGARQG  409

Query  1118  LKDSFSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAF  1294
             LKDSF +++  LAQ  K + S ++ ++    L++L +E  SD +LA +YF NFTV ST  
Sbjct  410   LKDSFDQYANLLAQSVKPVDSKDIGVNKEQALSSLQAEPQSDWKLAVQYFANFTVFSTFL  469

Query  1295  LVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLR  1474
             + +Y  +HI+ +  + +QGLEF+GLDLPDS+GE +  G+LVL  E+V ++I+ F++AR +
Sbjct  470   IGVYVFVHIVFAIPSAIQGLEFNGLDLPDSIGEFVVSGVLVLQCERVLQLISRFLQARKQ  529

Query  1475  RGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQ  1654
             +GSDHG++AHGDGW+LTVALIEG +LAS+DP+G  DP++VFT NGK+RTSS++ Q  +PQ
Sbjct  530   KGSDHGIKAHGDGWLLTVALIEGVDLASVDPSGHCDPYIVFTSNGKTRTSSIKFQKSNPQ  589

Query  1655  WNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKI  1834
             WNEI EF+   +PPS+L+VEVFDFDGPFD+A SLGHAEINF++   ++LAD+W+PL GK+
Sbjct  590   WNEIFEFDAMADPPSVLNVEVFDFDGPFDEAVSLGHAEINFVRSNISDLADVWVPLQGKL  649

Query  1835  AQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEF  2014
             AQ+ QSKLHLRIFL++  G + +RD L KMEKEVGKK+N+RSP  NS FQK FGLP EEF
Sbjct  650   AQACQSKLHLRIFLDHTGGGDVVRDYLNKMEKEVGKKINVRSPQTNSAFQKLFGLPQEEF  709

Query  2015  LINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMG  2194
             LINDF+C LKRK+PLQGR+FLS RIVGFYA+LFG+KTKFFFLWEDIEEI VLPP+ ++MG
Sbjct  710   LINDFTCHLKRKMPLQGRLFLSARIVGFYASLFGNKTKFFFLWEDIEEIQVLPPTLASMG  769

Query  2195  SPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQK  2374
             SP +V+ L   RG +AR GAK+ DEE RL F FHSFVSF  A +TIMALWK ++  P+QK
Sbjct  770   SPIIVMTLRPGRGKEARIGAKTHDEEDRLKFHFHSFVSFNVAQKTIMALWKAKSLTPEQK  829

Query  2375  AQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVM  2554
              Q  EE+    E  +  EE+G +L ++DV  ++V+S+ LP+     ME+F GG+++ K M
Sbjct  830   VQAVEEES---EQKLQSEESGLFLGIDDVRFTEVFSLTLPVPVSFFMELFEGGEMDRKAM  886

Query  2555  SKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEI  2734
              ++GC +Y  S WE  + DVYER+  Y+  R IS +  EVTSTQ+KS+  +  GW++ E+
Sbjct  887   DRAGCQSYSCSPWESEKADVYERQTYYRDKR-ISRYRGEVTSTQQKSLVPDKNGWLVEEV  945

Query  2735  MAIHGVPFSDHYQVQLRYKV-ESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFS  2911
             M +HGVP  D++ + LRY++ ES    + +    VY G+ WLK+T+ + R+TKNI+    
Sbjct  946   MTLHGVPLGDYFNLHLRYQMEESAPKPKTTTYVRVYFGIEWLKSTRHQKRVTKNILVNLQ  1005

Query  2912  QRVKEMIEFVGRE  2950
              R+K    F+ +E
Sbjct  1006  DRLKMTFGFLEKE  1018



>ref|XP_009782111.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 [Nicotiana 
sylvestris]
Length=1052

 Score =   899 bits (2322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/822 (53%), Positives = 600/822 (73%), Gaps = 27/822 (3%)
 Frame = +2

Query  554   DNVQETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDS  733
             +N QE  +S + +F E IK +++R +G E+  NL G +++DQ YA+ P + N  LF+PDS
Sbjct  225   ENAQEE-QSTSGNFQELIKSMEAREQGSEV-SNLPG-VVVDQLYAIAPHELNSFLFSPDS  281

Query  734   QFRRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDG  913
              F + LA++QG+ +++ GPW  ++  +S L RVVT+TK A++LVK+++ TE+QTYLK DG
Sbjct  282   TFFKSLADIQGSTELRIGPWKLENGGES-LKRVVTFTKAASRLVKALKTTEDQTYLKADG  340

Query  914   KEFAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTV  1093
             K FA+ V VSTPD PYGSTF+ ELLYNI PGP L SGE+S+ LV+SW + F +STMMK +
Sbjct  341   KSFALSVIVSTPDAPYGSTFRTELLYNITPGPELPSGEQSSRLVVSWRMNFLQSTMMKGM  400

Query  1094  IEGGTQQGLKDSFSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCN  1270
             IE G +QG+K+SF +++  L+Q+ K + + ++  +   +LA+L  EH SD +LA +YF N
Sbjct  401   IENGARQGIKESFEQYANLLSQNVKPVDAKDIGSEKEQVLASLEVEHQSDWKLAFQYFAN  460

Query  1271  FTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIA  1450
             FTV+ST F+ +Y  +HILL+  + +QGLEF GLDLPDS+GE+I CG+LVL  ++V  +I+
Sbjct  461   FTVISTFFIGIYVFLHILLAMPSTIQGLEFVGLDLPDSIGEVIVCGVLVLQGKRVLELIS  520

Query  1451  HFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSV  1630
              F+ AR+++GSDHG++A GDGW+LTVALIEG NLA++D +GF DP+VVFTCNGK+RTSS+
Sbjct  521   RFMRARVQKGSDHGIKAQGDGWLLTVALIEGNNLAAVDSSGFSDPYVVFTCNGKTRTSSI  580

Query  1631  QLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADL  1810
             + Q  +P WNEI EF+  +EPPS+LDVEVFDFDGPF +A SLGHAEINF+K    +L+D+
Sbjct  581   KFQKSNPTWNEIFEFDAMDEPPSVLDVEVFDFDGPFSEATSLGHAEINFVKTNITDLSDV  640

Query  1811  WLPLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKT  1990
             W+PL GK+AQ+ QSKLHLR+FLNN  G   ++D L+KMEKEVGKK+ LRSP  NS FQK 
Sbjct  641   WVPLQGKLAQACQSKLHLRVFLNNTKGTNVVKDYLSKMEKEVGKKIKLRSPQTNSAFQKL  700

Query  1991  FGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVL  2170
             F LPPEEFLINDF+C LKRK+PLQGR+FLS RI+GF+++LFGHKTKFF LWEDIE+I V 
Sbjct  701   FALPPEEFLINDFACHLKRKMPLQGRLFLSARIIGFHSDLFGHKTKFFLLWEDIEDIQVE  760

Query  2171  PPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKT  2350
              P+ ++MGSP++++ L   +G DAR+GAK+ DE+GRL F FHSFVSF  A RTIMALWK 
Sbjct  761   SPTLASMGSPNVIMTLKPGKGFDARHGAKTQDEQGRLKFHFHSFVSFNVAHRTIMALWKA  820

Query  2351  RACIPDQKAQIAEEQ------------------QYKDEN----NVLPEETGSYLIVEDVS  2464
             RA  P+QK Q+ EE+                  Q  D++    ++  EE+GS++ VED++
Sbjct  821   RALSPEQKVQLVEEESEAKGLQMAEEDAISSDFQAADDDSEGKSLQSEESGSFVGVEDIN  880

Query  2465  MSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLN  2644
             MS VYS  L +     ME+F+G +L+ K+M K GCLNY  S WE  +PDVY+R++ YK +
Sbjct  881   MSVVYSSVLSVPTDFFMELFSGNELDRKIMEKVGCLNYSFSPWESEKPDVYQRQLYYKFD  940

Query  2645  RLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSC  2824
             + IS +  EVTSTQ+KS  ++  GW++ E+M +HGVP  D + + LRY+VE   +    C
Sbjct  941   KCISRYRGEVTSTQQKSRLSDKNGWLVEEVMTLHGVPLGDFFNLHLRYQVEVVPSRSTRC  1000

Query  2825  RCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGRE  2950
                V++G+ WLK ++ + RITKNIV    +R+  M   V +E
Sbjct  1001  NVQVHLGIAWLKCSRHQKRITKNIVSNLQERLLVMFSGVEKE  1042



>ref|XP_006597618.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
isoform X2 [Glycine max]
Length=887

 Score =   898 bits (2321),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/795 (54%), Positives = 575/795 (72%), Gaps = 4/795 (1%)
 Frame = +2

Query  575   RSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELA  754
             +S  ++F EA++ LQS  +G E+P NL  G+ +DQ Y + P+D N LLF+ DS F + LA
Sbjct  94    QSSNETFEEAMRKLQSADQGSEIPSNLPAGVFIDQQYVIAPEDLNELLFSSDSNFLKSLA  153

Query  755   ELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLV  934
             E+QG  +++ GPW +++D +    R+VTY K  +KL+K+V+A EE TYLK DGK FAVLV
Sbjct  154   EVQGNTELEIGPWKFENDGE-IFKRLVTYVKAPSKLIKAVKAYEEHTYLKADGKNFAVLV  212

Query  935   DVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQ  1114
              VSTPDV YGSTF+VE+LY I PGP L +GE+ + LV+SW + F +STMMK +IE G +Q
Sbjct  213   SVSTPDVMYGSTFRVEVLYVITPGPELPTGEQCSCLVVSWRMNFLQSTMMKGMIENGARQ  272

Query  1115  GLKDSFSEFSRFLAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYFCNFTVVSTA  1291
             G+KDSF +++  L+Q  K     ++  N    LA+L +E  SD  LA +YF NFTV +T 
Sbjct  273   GMKDSFDQYATLLSQTVKPADLKDLSSNKEQALASLHAEPESDWRLAVQYFGNFTVFATV  332

Query  1292  FLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARL  1471
             F+ LY  +HI L+  + +QGLEF GLDLPDS+GE + C +LVL  E +   I+ F++AR 
Sbjct  333   FMGLYVLVHIWLAAPSTIQGLEFGGLDLPDSIGEFVVCAVLVLQGECMLGKISRFIKARA  392

Query  1472  RRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDP  1651
             ++GSDHG++A GDGW+LTVALIEG++LAS+D +G  DP+VVFTCNGK+RTSS++ Q  + 
Sbjct  393   QKGSDHGIKAQGDGWLLTVALIEGSSLASVDSSGLSDPYVVFTCNGKTRTSSIKFQKSNL  452

Query  1652  QWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGK  1831
              WNEI EF+  ++PPS+LDV V+DFDGPFD+A SLGHAEINFLK   A+LAD+W+PL GK
Sbjct  453   TWNEIFEFDAMDDPPSVLDVVVYDFDGPFDEAASLGHAEINFLKANIADLADIWVPLEGK  512

Query  1832  IAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEE  2011
             +A + QSKLHLRIFL+N  G    +D L++MEKEVGKK+NLRSP  NS FQK FGLPPEE
Sbjct  513   LALACQSKLHLRIFLDNTRGGNVAKDYLSRMEKEVGKKINLRSPQANSAFQKLFGLPPEE  572

Query  2012  FLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTM  2191
             FLINDF+C LKRK+PLQGR+FLS RI+GF+ANLFG+KTKFFFLWEDIE+I V+PP+FS+M
Sbjct  573   FLINDFTCHLKRKMPLQGRLFLSARIIGFHANLFGNKTKFFFLWEDIEDIQVIPPTFSSM  632

Query  2192  GSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQ  2371
             GSP +VI L K RG DAR+GAK+ DE+GRL F F SFVSF  A RTIMALWK R+  P+Q
Sbjct  633   GSPIIVITLRKGRGVDARHGAKTQDEQGRLRFHFQSFVSFNVAHRTIMALWKVRSLSPEQ  692

Query  2372  KAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKV  2551
             K +  EEQ   D  +++ +E+GS+L ++DVSMS++YS  L +    LME+F+GG+L+ +V
Sbjct  693   KVEFVEEQS--DSKSLISDESGSFLGLDDVSMSEIYSCSLLIPASYLMEIFSGGELDRRV  750

Query  2552  MSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNE  2731
             M K G LNY  + W     D+ ER V YK  + IS +  EVTSTQ++S   +  GW++ E
Sbjct  751   MEKLGYLNYSYTPWVSENLDISERAVYYKFEKRISSYKGEVTSTQQRSPLPDGKGWLVEE  810

Query  2732  IMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFS  2911
             +M +HGVP  D++ + LRY++E        CR  V  G+ WLK++K + R+TKNI+    
Sbjct  811   LMNLHGVPLGDYFNIHLRYQIEDLPPKAKGCRVQVLFGMEWLKSSKNQKRLTKNILENLL  870

Query  2912  QRVKEMIEFVGREVF  2956
             +R K       +E+ 
Sbjct  871   ERFKVTFSLAEKELL  885



>ref|XP_003546208.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
isoform X1 [Glycine max]
Length=1018

 Score =   898 bits (2321),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/795 (54%), Positives = 575/795 (72%), Gaps = 4/795 (1%)
 Frame = +2

Query  575   RSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELA  754
             +S  ++F EA++ LQS  +G E+P NL  G+ +DQ Y + P+D N LLF+ DS F + LA
Sbjct  225   QSSNETFEEAMRKLQSADQGSEIPSNLPAGVFIDQQYVIAPEDLNELLFSSDSNFLKSLA  284

Query  755   ELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLV  934
             E+QG  +++ GPW +++D +    R+VTY K  +KL+K+V+A EE TYLK DGK FAVLV
Sbjct  285   EVQGNTELEIGPWKFENDGE-IFKRLVTYVKAPSKLIKAVKAYEEHTYLKADGKNFAVLV  343

Query  935   DVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQ  1114
              VSTPDV YGSTF+VE+LY I PGP L +GE+ + LV+SW + F +STMMK +IE G +Q
Sbjct  344   SVSTPDVMYGSTFRVEVLYVITPGPELPTGEQCSCLVVSWRMNFLQSTMMKGMIENGARQ  403

Query  1115  GLKDSFSEFSRFLAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYFCNFTVVSTA  1291
             G+KDSF +++  L+Q  K     ++  N    LA+L +E  SD  LA +YF NFTV +T 
Sbjct  404   GMKDSFDQYATLLSQTVKPADLKDLSSNKEQALASLHAEPESDWRLAVQYFGNFTVFATV  463

Query  1292  FLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARL  1471
             F+ LY  +HI L+  + +QGLEF GLDLPDS+GE + C +LVL  E +   I+ F++AR 
Sbjct  464   FMGLYVLVHIWLAAPSTIQGLEFGGLDLPDSIGEFVVCAVLVLQGECMLGKISRFIKARA  523

Query  1472  RRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDP  1651
             ++GSDHG++A GDGW+LTVALIEG++LAS+D +G  DP+VVFTCNGK+RTSS++ Q  + 
Sbjct  524   QKGSDHGIKAQGDGWLLTVALIEGSSLASVDSSGLSDPYVVFTCNGKTRTSSIKFQKSNL  583

Query  1652  QWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGK  1831
              WNEI EF+  ++PPS+LDV V+DFDGPFD+A SLGHAEINFLK   A+LAD+W+PL GK
Sbjct  584   TWNEIFEFDAMDDPPSVLDVVVYDFDGPFDEAASLGHAEINFLKANIADLADIWVPLEGK  643

Query  1832  IAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEE  2011
             +A + QSKLHLRIFL+N  G    +D L++MEKEVGKK+NLRSP  NS FQK FGLPPEE
Sbjct  644   LALACQSKLHLRIFLDNTRGGNVAKDYLSRMEKEVGKKINLRSPQANSAFQKLFGLPPEE  703

Query  2012  FLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTM  2191
             FLINDF+C LKRK+PLQGR+FLS RI+GF+ANLFG+KTKFFFLWEDIE+I V+PP+FS+M
Sbjct  704   FLINDFTCHLKRKMPLQGRLFLSARIIGFHANLFGNKTKFFFLWEDIEDIQVIPPTFSSM  763

Query  2192  GSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQ  2371
             GSP +VI L K RG DAR+GAK+ DE+GRL F F SFVSF  A RTIMALWK R+  P+Q
Sbjct  764   GSPIIVITLRKGRGVDARHGAKTQDEQGRLRFHFQSFVSFNVAHRTIMALWKVRSLSPEQ  823

Query  2372  KAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKV  2551
             K +  EEQ   D  +++ +E+GS+L ++DVSMS++YS  L +    LME+F+GG+L+ +V
Sbjct  824   KVEFVEEQS--DSKSLISDESGSFLGLDDVSMSEIYSCSLLIPASYLMEIFSGGELDRRV  881

Query  2552  MSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNE  2731
             M K G LNY  + W     D+ ER V YK  + IS +  EVTSTQ++S   +  GW++ E
Sbjct  882   MEKLGYLNYSYTPWVSENLDISERAVYYKFEKRISSYKGEVTSTQQRSPLPDGKGWLVEE  941

Query  2732  IMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFS  2911
             +M +HGVP  D++ + LRY++E        CR  V  G+ WLK++K + R+TKNI+    
Sbjct  942   LMNLHGVPLGDYFNIHLRYQIEDLPPKAKGCRVQVLFGMEWLKSSKNQKRLTKNILENLL  1001

Query  2912  QRVKEMIEFVGREVF  2956
             +R K       +E+ 
Sbjct  1002  ERFKVTFSLAEKELL  1016



>ref|XP_009617773.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 [Nicotiana 
tomentosiformis]
Length=1052

 Score =   898 bits (2320),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/822 (53%), Positives = 599/822 (73%), Gaps = 27/822 (3%)
 Frame = +2

Query  554   DNVQETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDS  733
             +N QE  +S + +F E IK +++R +G E+  NL G +++DQ YA+ P + N  LF+PDS
Sbjct  225   ENAQEE-QSTSGNFQELIKSMEAREQGSEI-SNLPG-VVVDQLYAIAPHELNSFLFSPDS  281

Query  734   QFRRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDG  913
              F + LA++QG+ +++ GPW  ++  +S L RVVT+TK A++LVK+++ TE+QTYLK DG
Sbjct  282   NFFKSLADIQGSTELRIGPWKLENGGES-LKRVVTFTKAASRLVKALKTTEDQTYLKADG  340

Query  914   KEFAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTV  1093
             K FA+   VSTPD PYGSTF+ ELLYNI PGP L SGE+S+ LV+SW + F +STMMK +
Sbjct  341   KSFALSAIVSTPDAPYGSTFRTELLYNITPGPELPSGEQSSRLVVSWRMNFLQSTMMKGM  400

Query  1094  IEGGTQQGLKDSFSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCN  1270
             IE G +QG+K+SF +++  L+Q+ K + + ++  +   +LA+L  EH SD +LA +YF N
Sbjct  401   IENGARQGIKESFEQYANLLSQNVKPVDAKDIGSEKEQVLASLEVEHQSDWKLAFQYFAN  460

Query  1271  FTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIA  1450
             FTV+ST F+ +Y  +HILL+  + +QGLEF GLDLPDS+GE+I CG+LVL  ++V  +I+
Sbjct  461   FTVISTFFIGIYVFLHILLAMPSTIQGLEFVGLDLPDSIGEVIVCGVLVLQGKRVLELIS  520

Query  1451  HFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSV  1630
              F+ AR+++GSDHGV+A GDGW+LTVALIEG NLA++D +GF DP+VVFTCNGK+RTSS+
Sbjct  521   RFMRARVQKGSDHGVKAQGDGWLLTVALIEGNNLAAVDSSGFSDPYVVFTCNGKTRTSSI  580

Query  1631  QLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADL  1810
             + Q  +P WNEI EF+  +EPPS+LDVEVFDFDGPF +A SLGHAEINF+K    +L+D+
Sbjct  581   KFQKSNPTWNEIFEFDAMDEPPSVLDVEVFDFDGPFSEATSLGHAEINFVKTNITDLSDV  640

Query  1811  WLPLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKT  1990
             W+PL GK+AQ+ QSKLHLR+FLNN  G   ++D L+KMEKEVGKK+ LRSP  NS FQK 
Sbjct  641   WVPLQGKLAQACQSKLHLRVFLNNTKGTNVVKDYLSKMEKEVGKKIKLRSPQTNSAFQKL  700

Query  1991  FGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVL  2170
             F LPPEEFLINDF+C LKRK+PLQGR+FLS RI+GF+++LFGHKTKFF LWEDIE+I V 
Sbjct  701   FALPPEEFLINDFACHLKRKMPLQGRLFLSARIIGFHSDLFGHKTKFFLLWEDIEDIQVE  760

Query  2171  PPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKT  2350
              P+ ++MGSP++++ L   +G DAR+GAK+ DE+GRL F FHSFVSF  A RTIMALWK 
Sbjct  761   SPTLASMGSPNVIMTLKPGKGFDARHGAKTQDEQGRLKFHFHSFVSFNVAHRTIMALWKA  820

Query  2351  RACIPDQKAQIAEEQ------------------QYKDEN----NVLPEETGSYLIVEDVS  2464
             RA  P+QK Q+ EE+                  Q  D++    ++  EE+GS++ VED++
Sbjct  821   RALSPEQKVQLVEEESEAKGLQMAEEDALSSDFQAADDDSEGKSLQSEESGSFVGVEDIN  880

Query  2465  MSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLN  2644
             MS VYS  L +     ME+F+G +L+ K+M K GCLNY  S WE  +PDVY+R++ YK +
Sbjct  881   MSVVYSSVLSVPTDFFMELFSGNELDRKIMEKVGCLNYSFSPWESEKPDVYQRQLYYKFD  940

Query  2645  RLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSC  2824
             + IS +  EVTSTQ+KS  ++  GW++ E+M +HGVP  D + + LRY+VE   +    C
Sbjct  941   KCISRYRGEVTSTQQKSRLSDKNGWLVEEVMTLHGVPLGDFFNLHLRYQVEVVPSRSTRC  1000

Query  2825  RCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGRE  2950
                V++G+ WLK ++ + RITKNIV    +R+  M   V +E
Sbjct  1001  NVQVHLGIAWLKCSRHQKRITKNIVSNLQERLLVMFSGVEKE  1042



>ref|XP_010481954.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Camelina sativa]
Length=1030

 Score =   897 bits (2319),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/793 (54%), Positives = 586/793 (74%), Gaps = 7/793 (1%)
 Frame = +2

Query  578   SQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAE  757
             S + SF E +K ++S+ +G E P NL GGIL+DQ + + P D N+LLF+ DS F   L+E
Sbjct  232   SSSASFEELMKAMESKDQGSEPPCNLPGGILVDQLFMISPSDLNVLLFSSDSSFYTSLSE  291

Query  758   LQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVD  937
             LQGT +VQ GPW  +++ +S + RVV+Y K  TKL+K+V+ TEEQTYLK DG+ +AVL  
Sbjct  292   LQGTTEVQVGPWKAENEGES-VKRVVSYLKAPTKLIKAVKGTEEQTYLKADGEVYAVLAS  350

Query  938   VSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQG  1117
             V+TPDVP+GSTFKVE+LY I PGP L SGE+ + LV+SW + F +STMMK +IE G +QG
Sbjct  351   VATPDVPFGSTFKVEVLYCISPGPELPSGEQCSRLVVSWRLNFLQSTMMKGMIENGARQG  410

Query  1118  LKDSFSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAF  1294
             LKDSF +++  LAQ  K + S ++ ++    L++L +E  SD +LA +YF NFTV ST  
Sbjct  411   LKDSFDQYANLLAQSVKPVDSKDIGVNKEQALSSLQAEPQSDWKLAVQYFANFTVFSTFL  470

Query  1295  LVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLR  1474
             + +Y  +HI+L+  + +QGLEF+GLDLPDS+GE +  G+LVL  E+V ++I+ F++AR +
Sbjct  471   IGIYVFVHIVLAIPSAIQGLEFNGLDLPDSIGEFVVSGVLVLQCERVLQLISRFMQARKQ  530

Query  1475  RGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQ  1654
             +GSDHG++AHGDGW+LTVALIEG +LAS+DP+G  DP++VFT NGK+RTSS++ Q  +PQ
Sbjct  531   KGSDHGIKAHGDGWLLTVALIEGVDLASVDPSGHCDPYIVFTSNGKTRTSSIKFQKSNPQ  590

Query  1655  WNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKI  1834
             WNEI EF+   +PPS+L+VEVFDFDGPFD+A SLGHAEINF++   ++LAD+W+ L GK+
Sbjct  591   WNEIFEFDAMADPPSVLNVEVFDFDGPFDEAVSLGHAEINFVRSNISDLADVWVTLQGKL  650

Query  1835  AQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEF  2014
             AQ+ QSKLHLRIFL++  G + +RD L KMEKEVGKK+N+RSP  NS FQK FGLP EEF
Sbjct  651   AQACQSKLHLRIFLDHTGGGDVVRDYLNKMEKEVGKKINVRSPQTNSAFQKLFGLPQEEF  710

Query  2015  LINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMG  2194
             LINDF+C LKRK+PLQGR+FLS RIVGFYA+LFG+KTKFFFLWEDIEEI VLPP+ ++MG
Sbjct  711   LINDFTCHLKRKMPLQGRLFLSARIVGFYASLFGNKTKFFFLWEDIEEIQVLPPTLASMG  770

Query  2195  SPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQK  2374
             SP +V+ L   RG +AR GAK+ DEE RL F FHSFVSF  A +TIMALWK ++  P+QK
Sbjct  771   SPIIVMTLRPGRGKEARIGAKTHDEEDRLKFHFHSFVSFNVAQKTIMALWKAKSLTPEQK  830

Query  2375  AQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVM  2554
              Q  EE+    E  +  EE+G +L ++DV  ++V+S+ LP+     ME+F GG+++ K M
Sbjct  831   VQAVEEES---EQKLQSEESGLFLGIDDVRFTEVFSLTLPVPVSFFMELFEGGEMDRKAM  887

Query  2555  SKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEI  2734
              ++GC +Y  S WE  + DVYER+  Y+  R IS +  EVTSTQ+KS+  +  GW++ E+
Sbjct  888   DRAGCQSYSCSPWESEKADVYERQTYYRDKR-ISRYRGEVTSTQQKSLVPDKNGWLVEEV  946

Query  2735  MAIHGVPFSDHYQVQLRYKV-ESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFS  2911
             M +HGVP  D++ + LRY++ ES    + +    VY G+ WLK+T+ + R+TKNI+    
Sbjct  947   MTLHGVPLGDYFNLHLRYQMEESAPKPKTTTYVRVYFGIEWLKSTRHQKRVTKNILVNLQ  1006

Query  2912  QRVKEMIEFVGRE  2950
              R+K    F+ +E
Sbjct  1007  DRLKMTFGFLEKE  1019



>ref|XP_010474962.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Camelina sativa]
Length=1030

 Score =   897 bits (2318),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/793 (54%), Positives = 588/793 (74%), Gaps = 7/793 (1%)
 Frame = +2

Query  578   SQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAE  757
             S + SF E +K+++S+ +G E P NL GGIL+DQ + + P D N+LLF+ DS F   L+E
Sbjct  231   SSSVSFEELMKVMESKDQGSEPPCNLPGGILVDQLFMITPFDLNVLLFSSDSSFYTSLSE  290

Query  758   LQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVD  937
             LQGT +VQ GPW  +++ +S + RVV+Y K  TKL+K+V+ TEEQTYLK DG+ +AVL  
Sbjct  291   LQGTTEVQVGPWKAENEGES-VKRVVSYLKAPTKLIKAVKGTEEQTYLKADGEVYAVLAS  349

Query  938   VSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQG  1117
             V+TPDVP+GSTFKVE+LY I PGP L SGE+ + LVISW + F +STMMK +IE G +QG
Sbjct  350   VATPDVPFGSTFKVEVLYCISPGPELPSGEQCSRLVISWRLNFLQSTMMKGMIENGARQG  409

Query  1118  LKDSFSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAF  1294
             LKDSF +++  LAQ  K + S ++ ++    L++L +E  SD +LA +YF NFTV ST  
Sbjct  410   LKDSFDQYANLLAQSVKPVDSKDIGVNKEQALSSLQAEPQSDWKLAVQYFANFTVFSTFL  469

Query  1295  LVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLR  1474
             + +Y  +HI+L+  + +QGLEF+GLDLPDS+GE++  G+LVL  E+V ++I+ F++AR +
Sbjct  470   IGIYVFVHIVLAIPSAIQGLEFNGLDLPDSIGELVVSGVLVLQCERVLQLISRFMQARKQ  529

Query  1475  RGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQ  1654
             +GSDHG++AHGDGW+LTVALIEG +LAS+DP+G  DP++VFT NGK+RTSS++ Q  +PQ
Sbjct  530   KGSDHGIKAHGDGWLLTVALIEGVDLASVDPSGHCDPYIVFTSNGKTRTSSIKFQKSNPQ  589

Query  1655  WNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKI  1834
             WNEI EF+   +PPS+L+VEVFDFDGPFD+A SLGHAEINF++   ++LAD+W+ L GK+
Sbjct  590   WNEIFEFDAMADPPSVLNVEVFDFDGPFDEAVSLGHAEINFVRSNISDLADVWVTLQGKL  649

Query  1835  AQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEF  2014
             AQ+ QSKLHLRIFL++  G + +RD L KMEKEVGKK+N+RSP  NS FQK FGLP EEF
Sbjct  650   AQACQSKLHLRIFLDHTGGGDVVRDYLNKMEKEVGKKINVRSPQTNSAFQKLFGLPQEEF  709

Query  2015  LINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMG  2194
             LINDF+C LKRK+PLQGR+FLS RIVGFYA+LFG+KTKFFFLWEDIEEI VLPP+ ++MG
Sbjct  710   LINDFTCHLKRKMPLQGRLFLSARIVGFYASLFGNKTKFFFLWEDIEEIQVLPPTLASMG  769

Query  2195  SPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQK  2374
             SP +V+ L   RG +AR GAK+ DEE RL F FHSFVSF  A +TIMALWK ++  P+QK
Sbjct  770   SPIIVMTLRPGRGKEARIGAKTHDEEDRLKFHFHSFVSFNVAQKTIMALWKAKSLTPEQK  829

Query  2375  AQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVM  2554
              Q  EE+    E  +  EE+G +L ++DV  ++V+S+ LP+     ME+F GG+++ K M
Sbjct  830   VQAVEEES---EQKLQSEESGLFLGIDDVRFTEVFSLTLPVPVSFFMELFEGGEMDRKAM  886

Query  2555  SKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEI  2734
              ++GC +Y  S WE  + DVYER+  Y+  R IS +  EVTSTQ+KS+  +  GW++ E+
Sbjct  887   DRAGCQSYSCSPWESEKADVYERQTYYRDKR-ISRYRGEVTSTQQKSLVPDKNGWLVEEV  945

Query  2735  MAIHGVPFSDHYQVQLRYKV-ESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFS  2911
             M +HGVP  D++ + LRY++ ES    + +    VY G+ WLK+T+ + R+TKNI+    
Sbjct  946   MTLHGVPLGDYFNLHLRYQMEESAPKPKTTTYVRVYFGIEWLKSTRHQKRVTKNILVNLQ  1005

Query  2912  QRVKEMIEFVGRE  2950
              R+K    F+ +E
Sbjct  1006  DRLKMTFGFLEKE  1018



>gb|EMT08962.1| E3 ubiquitin-protein ligase NEDD4-like protein [Aegilops tauschii]
Length=1034

 Score =   896 bits (2315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/810 (52%), Positives = 582/810 (72%), Gaps = 5/810 (1%)
 Frame = +2

Query  530   SSIPSDYEDNVQETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFN  709
             + + S    N Q+   S   SF E +K   S+ EG +MP NL GG+L+DQ YA+ P D N
Sbjct  226   TPLTSSQHSNEQDLETSANMSFDELLKSFASKHEGNDMPGNLSGGVLIDQVYAVAPSDLN  285

Query  710   MLLFAPDSQFRRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEE  889
              LLF+P S F + LA++QGT  +    W  ++D +  L RVVTYTK ATKLVK+V+ATE+
Sbjct  286   TLLFSPTSDFLQSLAKMQGTTGLDIQQWRLENDGE-ILKRVVTYTKAATKLVKAVKATED  344

Query  890   QTYLKGDGKEFAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFC  1069
               YLK DG  +AVL DVSTP+VP+G+ F+VE+L  IMPGP LR  E S+ LVISW + F 
Sbjct  345   VAYLKADGDMYAVLADVSTPEVPFGNNFRVEILTCIMPGPELRDDEISSRLVISWRLNFM  404

Query  1070  KSTMMKTVIEGGTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLEL  1249
             +STMMK +IE G +QGLKD+F++FS  LAQ+ + + + +   N   L+++  E  SD +L
Sbjct  405   QSTMMKGMIENGAKQGLKDNFNQFSELLAQNVRPVDAKDTTTNNESLSSVQPETESDWKL  464

Query  1250  AREYFCNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLE  1429
             A   F NFTV+S+    +Y   HI+L+  + +QGLEF GLDLPDSVGE++ CG+LVL  +
Sbjct  465   AFRIFGNFTVLSSVIAFIYVFAHIILASPSIIQGLEFPGLDLPDSVGEVVVCGVLVLQGQ  524

Query  1430  QVYRMIAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNG  1609
             +V  MIA FV+AR +RG DHGV+A GDGW+LTVALI+GTNL++   +G+ DP+VVFTCNG
Sbjct  525   RVLNMIARFVQARRQRGGDHGVKAKGDGWLLTVALIDGTNLSATKSSGYSDPYVVFTCNG  584

Query  1610  KSRTSSVQLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHT  1789
             +++TSS++  TL+PQWNEI EF+  E+PPS++++ V+DFDGPFD+  SLGH E+NFLK++
Sbjct  585   QTKTSSIKFHTLEPQWNEIFEFDAMEDPPSVMEINVYDFDGPFDEVASLGHVEVNFLKYS  644

Query  1790  SAELADLWLPLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHR  1969
               ELAD+W+PL GK+AQ+ QSKLHLRIFLNN+ G E ++D L +MEKEVG+K+ +RSPH 
Sbjct  645   IPELADIWIPLKGKLAQACQSKLHLRIFLNNSRGTEVVKDYLDRMEKEVGRKIAMRSPHT  704

Query  1970  NSTFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWED  2149
             N  FQK F LPPEEFLINDF+C LKRK+  QGR+FLS RI+GFY NLFGHKTKFFFLWED
Sbjct  705   NLEFQKIFSLPPEEFLINDFTCHLKRKMLTQGRLFLSPRIIGFYTNLFGHKTKFFFLWED  764

Query  2150  IEEINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRT  2329
             IEEI +LP + S+MGSPSL+I L K RG DAR+GAK +D+EGRL F   SFVSF  A +T
Sbjct  765   IEEIQLLPATLSSMGSPSLLITLRKGRGMDARHGAKQLDDEGRLKFHLQSFVSFNAAHKT  824

Query  2330  IMALWKTRACIPDQKAQIAEEQ-QYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHK  2506
             IMALWK R+  P++K Q+ EE+ + KD  N   EE GS+L +EDV MS+V+S  +P +  
Sbjct  825   IMALWKARSLTPEEKIQLVEEESETKDLQN---EEGGSFLGIEDVKMSEVFSSTIPFDVP  881

Query  2507  SLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQ  2686
              LM +F GG +E ++M K GC++Y  ++WE +  DV++R+V  +L++ ++    EV STQ
Sbjct  882   VLMGIFEGGPVERRIMEKVGCMDYSVTAWEPVRADVHQRQVHCRLDKKVARRDGEVMSTQ  941

Query  2687  RKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNT  2866
             +KS   +  GW++ E+M + G+P  + + + +RY++E  S+ + SC   V++G+ WLK+ 
Sbjct  942   QKSPLPDKNGWLVEEVMTLEGIPLGEFFNLHIRYQLEQTSSKQKSCSVQVFIGMAWLKSC  1001

Query  2867  KLEDRITKNIVRKFSQRVKEMIEFVGREVF  2956
             K   +IT+ +  K S R+K++   + +E+ 
Sbjct  1002  KNRKKITQEVASKLSSRLKKIFSQLEKELI  1031



>ref|XP_008649312.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Zea mays]
 ref|XP_008649313.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Zea mays]
 gb|AFW77020.1| hypothetical protein ZEAMMB73_177708 [Zea mays]
Length=1035

 Score =   896 bits (2315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/798 (53%), Positives = 580/798 (73%), Gaps = 7/798 (1%)
 Frame = +2

Query  563   QETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFR  742
             Q+   S T +F E +K   S+ EG+EMPENL GG++LDQ YA+ P D N LLF+P S F 
Sbjct  238   QDHDVSATMTFDELLKAFGSQHEGKEMPENLSGGVVLDQVYAVAPSDLNTLLFSPSSDFL  297

Query  743   RELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEF  922
             + LAE+QGT  ++   W  ++D +  L RVV+YTK  TKLVK+V+ATE+ TYLK DG+ F
Sbjct  298   QSLAEIQGTTGLEIQQWRLENDGE-ILRRVVSYTKAPTKLVKAVKATEDMTYLKADGEMF  356

Query  923   AVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEG  1102
             AV  DVSTP+VP+G+TF+VE+L  IMPGP LR  E+S+ L++SW + F +STMMK++IE 
Sbjct  357   AVFADVSTPEVPFGNTFRVEVLTCIMPGPELRGDEKSSRLMVSWHINFVQSTMMKSMIEN  416

Query  1103  GTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVV  1282
             G +QGLKD++ +FS  LA+HC+ + + +   +  +L+++  E  SD +LA   F NF ++
Sbjct  417   GAKQGLKDNYVQFSELLAKHCRPVDTKDTTSSNEVLSSVQPEQESDWKLAFRIFGNFALL  476

Query  1283  STAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVE  1462
             S+ F   Y S HI+L+  + +QGLEF GLDLPDS GE++ CG+LVL  ++V  MIA F++
Sbjct  477   SSVFAFFYVSAHIILASPSIIQGLEFPGLDLPDSAGEVVVCGVLVLQGQRVLNMIARFIQ  536

Query  1463  ARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQT  1642
             A+ +RG DHGV+A GDGW+LTVAL+EGTNLA+   +G+ DP+VVFTCNGK++TSS+   T
Sbjct  537   AKRQRG-DHGVKAQGDGWLLTVALMEGTNLAATKSSGYSDPYVVFTCNGKTKTSSINFHT  595

Query  1643  LDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTS-AELADLWLP  1819
             LDPQWNEI EF+  E+PPS++ + V+DFDGPFD+  SLGHAE+NFLK+ + +ELAD+W+P
Sbjct  596   LDPQWNEIFEFDAMEDPPSVMKIHVYDFDGPFDEVASLGHAEVNFLKYNNISELADIWIP  655

Query  1820  LGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGL  1999
             L GK+AQ+ QSKLHLRIFLNN  G E ++D L K+EKEVGKK+ +RSPH N  FQK F L
Sbjct  656   LKGKLAQACQSKLHLRIFLNNTRGTEVVKDYLDKVEKEVGKKIAMRSPHTNLAFQKIFSL  715

Query  2000  PPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPS  2179
             PPEEFLINDF+C LKRK+  QGRIFLS RI GFY NLFGHKTKFFFLWEDIE+I ++P +
Sbjct  716   PPEEFLINDFTCHLKRKMLTQGRIFLSPRIFGFYTNLFGHKTKFFFLWEDIEDILLVPAT  775

Query  2180  FSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRAC  2359
              S+MGSPSLVIIL KDRG DA++GAK +D +GRL F F SFVSF  A +TI ALWK R+ 
Sbjct  776   LSSMGSPSLVIILRKDRGMDAKHGAKQLDSQGRLKFHFQSFVSFNVAHKTITALWKARSL  835

Query  2360  IPDQKAQIAEEQ-QYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGD  2536
              P+QK Q+ EE+ + +D  N   EE  S L +ED  MS V+S   P +  +LM +F GG 
Sbjct  836   TPEQKVQLVEEESETEDFQN---EEGESLLGIEDAKMSGVFSCTKPFDVSTLMGIFEGGP  892

Query  2537  LEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAG  2716
             LE +VM K GC++Y  ++WE +  D+Y+R+V YK ++  +  G E  STQ+KS  +N  G
Sbjct  893   LECRVMEKVGCMDYSVTAWEPVRADIYQRQVHYKFDKKSARHGGEAMSTQQKSPLSNKNG  952

Query  2717  WILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNI  2896
             W++ E+M + G+P  + + + +RY++ES ++   +C   V++G++WLK+ K   +IT+++
Sbjct  953   WLVEEVMTLEGIPVGECFNLHIRYQLESNASKHKTCTIQVFIGIVWLKSCKNRKKITQDV  1012

Query  2897  VRKFSQRVKEMIEFVGRE  2950
                 S R+K++   + +E
Sbjct  1013  ATSASSRLKKIFNQLEKE  1030



>ref|XP_010227754.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 isoform 
X3 [Brachypodium distachyon]
Length=897

 Score =   895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/802 (52%), Positives = 583/802 (73%), Gaps = 9/802 (1%)
 Frame = +2

Query  563   QETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFR  742
             Q++  S   SF E +K  +SR EG EMP NL GG+L+DQ YA+ P D N LLF+P S F 
Sbjct  104   QDSESSVNMSFDELLKAFESRHEGNEMPANLSGGVLVDQVYAVAPSDLNTLLFSPSSDFL  163

Query  743   RELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEF  922
             R LA++QGT  +    W  ++D  + L RVV+YTK ATKLVK+V+ATE+ TYLK DG  +
Sbjct  164   RSLADMQGTTGLDIQQWRLENDG-AVLKRVVSYTKAATKLVKAVKATEDMTYLKADGDRY  222

Query  923   AVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEG  1102
             AVL DVSTP+VP+G+TF+VE+L  +MPGP L S    + LV+SW + F +STMMK +IE 
Sbjct  223   AVLADVSTPEVPFGNTFRVEILTCLMPGPELNS----SRLVVSWRLNFVQSTMMKGMIEN  278

Query  1103  GTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVV  1282
             G +QGLKD+F++FS  LAQ+ + + + +   N   L+++  E  SD +LA   F NFTVV
Sbjct  279   GAKQGLKDNFNQFSELLAQNVRPVDAKDTTANNQSLSSVQPERESDWKLAFRIFGNFTVV  338

Query  1283  STAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVE  1462
             S+ F  +Y   HI+L+  + +QGLEF GLDLPDS GE++ CG+LVL  ++V  MIA F++
Sbjct  339   SSFFAFIYVFSHIILASPSIIQGLEFPGLDLPDSAGEVVVCGVLVLQGQRVLNMIARFIQ  398

Query  1463  ARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQT  1642
             A+ +RGSDHGV+A GDGW+LTVALI+GTNLA+   +G+ DP+VVFTCNGK++TSS++  T
Sbjct  399   AKRQRGSDHGVKAKGDGWLLTVALIDGTNLAATKSSGYSDPYVVFTCNGKTKTSSIKFHT  458

Query  1643  LDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPL  1822
             L+PQWNEI EF+  E+PPS++++ V+DFDGPFD+  SLGH E+NFL+++ +ELAD+W+PL
Sbjct  459   LEPQWNEIFEFDAMEDPPSVMEINVYDFDGPFDEVASLGHVEVNFLRYSISELADIWIPL  518

Query  1823  GGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLP  2002
              GK+AQ+ Q+KLHLRIFLNN+ G E +++ L +MEKEVG+K+ +RSPH N  FQK F LP
Sbjct  519   KGKLAQACQTKLHLRIFLNNSRGTEIVKNYLDRMEKEVGRKIAVRSPHTNLEFQKIFSLP  578

Query  2003  PEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSF  2182
             PEEFLINDF+C LKRK+  QGR+FLS RI+GFY NLFGHKTKFFFLWEDIEEI ++P + 
Sbjct  579   PEEFLINDFTCHLKRKMLTQGRLFLSPRIIGFYTNLFGHKTKFFFLWEDIEEIQLVPATL  638

Query  2183  STMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACI  2362
             S+MGSPSL+I L K RG DAR+GAK +DEEGRL F   SFVSF  A +TIMALWK R+  
Sbjct  639   SSMGSPSLLITLRKGRGMDARHGAKQLDEEGRLKFHLQSFVSFNAAHKTIMALWKARSLT  698

Query  2363  PDQKAQIAEEQ-QYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDL  2539
             P++K Q+ EE+ + KD  N   EE+GS+L +ED  MS+V+S   P +   LM +F GG +
Sbjct  699   PEEKIQLVEEESETKDLQN---EESGSFLGIEDAKMSEVFSSTKPFDVPILMGIFEGGPV  755

Query  2540  EHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGW  2719
             EH+VM K GC++Y  ++WE +   +Y+R+V Y+ +  ++    EV STQ+KS+  +  GW
Sbjct  756   EHRVMEKVGCVDYSVTTWEPVRAGIYQRQVHYRFDMKLARREGEVMSTQQKSLLPDKNGW  815

Query  2720  ILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIV  2899
             ++ E+M + G+P  +++ + +RY++E  ++ + SC   V++G+ WLK+ K + +IT+ + 
Sbjct  816   LVEEVMTLEGIPVGEYFNLHIRYQLEQIASKQKSCSVQVFIGMAWLKSCKNQKKITQEVK  875

Query  2900  RKFSQRVKEMIEFVGREVFLSS  2965
                S R+K++   + +E   +S
Sbjct  876   SNASSRLKKIFSQLEKEFIPAS  897



>ref|XP_003560795.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 isoform 
X1 [Brachypodium distachyon]
Length=1030

 Score =   895 bits (2312),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/802 (52%), Positives = 583/802 (73%), Gaps = 9/802 (1%)
 Frame = +2

Query  563   QETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFR  742
             Q++  S   SF E +K  +SR EG EMP NL GG+L+DQ YA+ P D N LLF+P S F 
Sbjct  237   QDSESSVNMSFDELLKAFESRHEGNEMPANLSGGVLVDQVYAVAPSDLNTLLFSPSSDFL  296

Query  743   RELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEF  922
             R LA++QGT  +    W  ++D  + L RVV+YTK ATKLVK+V+ATE+ TYLK DG  +
Sbjct  297   RSLADMQGTTGLDIQQWRLENDG-AVLKRVVSYTKAATKLVKAVKATEDMTYLKADGDRY  355

Query  923   AVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEG  1102
             AVL DVSTP+VP+G+TF+VE+L  +MPGP L S    + LV+SW + F +STMMK +IE 
Sbjct  356   AVLADVSTPEVPFGNTFRVEILTCLMPGPELNS----SRLVVSWRLNFVQSTMMKGMIEN  411

Query  1103  GTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVV  1282
             G +QGLKD+F++FS  LAQ+ + + + +   N   L+++  E  SD +LA   F NFTVV
Sbjct  412   GAKQGLKDNFNQFSELLAQNVRPVDAKDTTANNQSLSSVQPERESDWKLAFRIFGNFTVV  471

Query  1283  STAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVE  1462
             S+ F  +Y   HI+L+  + +QGLEF GLDLPDS GE++ CG+LVL  ++V  MIA F++
Sbjct  472   SSFFAFIYVFSHIILASPSIIQGLEFPGLDLPDSAGEVVVCGVLVLQGQRVLNMIARFIQ  531

Query  1463  ARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQT  1642
             A+ +RGSDHGV+A GDGW+LTVALI+GTNLA+   +G+ DP+VVFTCNGK++TSS++  T
Sbjct  532   AKRQRGSDHGVKAKGDGWLLTVALIDGTNLAATKSSGYSDPYVVFTCNGKTKTSSIKFHT  591

Query  1643  LDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPL  1822
             L+PQWNEI EF+  E+PPS++++ V+DFDGPFD+  SLGH E+NFL+++ +ELAD+W+PL
Sbjct  592   LEPQWNEIFEFDAMEDPPSVMEINVYDFDGPFDEVASLGHVEVNFLRYSISELADIWIPL  651

Query  1823  GGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLP  2002
              GK+AQ+ Q+KLHLRIFLNN+ G E +++ L +MEKEVG+K+ +RSPH N  FQK F LP
Sbjct  652   KGKLAQACQTKLHLRIFLNNSRGTEIVKNYLDRMEKEVGRKIAVRSPHTNLEFQKIFSLP  711

Query  2003  PEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSF  2182
             PEEFLINDF+C LKRK+  QGR+FLS RI+GFY NLFGHKTKFFFLWEDIEEI ++P + 
Sbjct  712   PEEFLINDFTCHLKRKMLTQGRLFLSPRIIGFYTNLFGHKTKFFFLWEDIEEIQLVPATL  771

Query  2183  STMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACI  2362
             S+MGSPSL+I L K RG DAR+GAK +DEEGRL F   SFVSF  A +TIMALWK R+  
Sbjct  772   SSMGSPSLLITLRKGRGMDARHGAKQLDEEGRLKFHLQSFVSFNAAHKTIMALWKARSLT  831

Query  2363  PDQKAQIAEEQ-QYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDL  2539
             P++K Q+ EE+ + KD  N   EE+GS+L +ED  MS+V+S   P +   LM +F GG +
Sbjct  832   PEEKIQLVEEESETKDLQN---EESGSFLGIEDAKMSEVFSSTKPFDVPILMGIFEGGPV  888

Query  2540  EHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGW  2719
             EH+VM K GC++Y  ++WE +   +Y+R+V Y+ +  ++    EV STQ+KS+  +  GW
Sbjct  889   EHRVMEKVGCVDYSVTTWEPVRAGIYQRQVHYRFDMKLARREGEVMSTQQKSLLPDKNGW  948

Query  2720  ILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIV  2899
             ++ E+M + G+P  +++ + +RY++E  ++ + SC   V++G+ WLK+ K + +IT+ + 
Sbjct  949   LVEEVMTLEGIPVGEYFNLHIRYQLEQIASKQKSCSVQVFIGMAWLKSCKNQKKITQEVK  1008

Query  2900  RKFSQRVKEMIEFVGREVFLSS  2965
                S R+K++   + +E   +S
Sbjct  1009  SNASSRLKKIFSQLEKEFIPAS  1030



>ref|XP_002308750.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEE92273.1| C2 domain-containing family protein [Populus trichocarpa]
Length=1012

 Score =   892 bits (2306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/793 (54%), Positives = 581/793 (73%), Gaps = 13/793 (2%)
 Frame = +2

Query  575   RSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELA  754
             +S + +F E +K ++SR  G E+P NL GGIL+DQ+Y + P D N   F+PDS   R L+
Sbjct  228   QSSSGNFEELMKEMESRDVGSEVPNNLPGGILVDQSYVISPPDLNSFFFSPDSSLARLLS  287

Query  755   ELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLV  934
             +  G  + Q GPW +++ +++ L RV+TY K  TKLV +++A+EEQTYLK DGK FAVL+
Sbjct  288   DFVGNSEQQFGPWRFENSSEN-LKRVITYVKAPTKLVGALKASEEQTYLKADGKIFAVLI  346

Query  935   DVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQ  1114
              VSTPDV YGSTFKVELLY I  GP L SGE+++HLVISW + F +S+M K++IE G + 
Sbjct  347   SVSTPDVMYGSTFKVELLYCITSGPELPSGEKTSHLVISWRMNFLQSSMFKSMIENGARS  406

Query  1115  GLKDSFSEFSRFLAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYFCNFTVVSTA  1291
             G+KDSF + S FL+Q+ K +   ++  +   +LA+L  E  SD +LA +YF NFTVVS  
Sbjct  407   GVKDSFEQVSTFLSQNVKPVDLKDLGSSKEQVLASLKVEPQSDGKLAIQYFANFTVVSAV  466

Query  1292  FLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARL  1471
             F+ LY  +H+ L+  + +QGLEF GLDLPDS+GE+I CG+L L  E+V  +++ F++AR 
Sbjct  467   FMALYVFVHVWLAAPSAIQGLEFVGLDLPDSIGEVIVCGVLTLQCERVLGLLSRFMQARA  526

Query  1472  RRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDP  1651
             ++G+DHGV+A GDGWVLTVALIEG++L ++D +GF DP+VVFTCNGK+RTSS++ Q  DP
Sbjct  527   QKGTDHGVKAQGDGWVLTVALIEGSHLPAVDSSGFCDPYVVFTCNGKTRTSSIKFQKSDP  586

Query  1652  QWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGK  1831
              WNEI EF+  ++PPS+LDVEV+DFDGPF+++ SLGH EINF+K   ++LAD+W+PL GK
Sbjct  587   LWNEIFEFDAMDDPPSVLDVEVYDFDGPFNESMSLGHTEINFVKSNLSDLADVWVPLQGK  646

Query  1832  IAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEE  2011
             +AQ+ QS+LHLRIFLNN  G   +++ L+KMEKEVGKK+NLRSP  NS FQK FGLPPEE
Sbjct  647   LAQACQSRLHLRIFLNNTRGSNVVKEYLSKMEKEVGKKINLRSPQTNSAFQKVFGLPPEE  706

Query  2012  FLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTM  2191
             FLINDF+C LKRK+PLQGR+FLS RI+GFYANLF  KTKFFFLWEDI +I V  P+ S+M
Sbjct  707   FLINDFTCHLKRKMPLQGRLFLSARIIGFYANLFRQKTKFFFLWEDIVDIQVDTPTLSSM  766

Query  2192  GSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQ  2371
             GSP +VI L + RG DAR+GAK+ID+EGRL F F SFVSF  A+RTIMALWK R+  P+Q
Sbjct  767   GSPVIVITLRQGRGMDARHGAKTIDDEGRLKFHFQSFVSFNVANRTIMALWKARSLSPEQ  826

Query  2372  KAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKV  2551
             K QI EE+   +   +  EE+GS+L +EDVSMS++           L E+F GG+L+ KV
Sbjct  827   KVQIVEEES--ETKFLQTEESGSFLGLEDVSMSEI---------NFLSELFGGGELDRKV  875

Query  2552  MSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNE  2731
             M K+GCL+Y  + WE ++ +VYER++ Y+ ++ +S FG EVTSTQ+K   ++  GWI+ E
Sbjct  876   MEKAGCLSYSYTPWESVKTEVYERQLYYRFDKHVSRFGGEVTSTQQKYPLSDRKGWIVEE  935

Query  2732  IMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFS  2911
             +M +HGVP  D + + LRY++E   +    C   V +G+ WLK++  + RI+KNI+    
Sbjct  936   VMTLHGVPLGDFFNLHLRYQIEDFPSRLKGCHVRVSMGIAWLKSSWHQKRISKNIISSLQ  995

Query  2912  QRVKEMIEFVGRE  2950
              R+K +   V +E
Sbjct  996   DRLKLIFNAVEKE  1008



>ref|XP_010319216.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 [Solanum 
lycopersicum]
Length=1054

 Score =   890 bits (2300),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/830 (51%), Positives = 601/830 (72%), Gaps = 27/830 (3%)
 Frame = +2

Query  533   SIPSDYEDNVQETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNM  712
             ++ S   +N QE  +S + +F E +K +++R +  ++P NL GG+++DQ YA+ P + N+
Sbjct  218   TVSSTASENAQEE-QSTSGNFQELLKSIEAREQPSDVP-NLPGGVVVDQLYAIAPHELNL  275

Query  713   LLFAPDSQFRRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQ  892
              LF+PDS F + L ++QG+ +++ GPW  ++  +S L R V + K A++LVK+++ TEEQ
Sbjct  276   FLFSPDSAFFKSLVDIQGSTELRVGPWKLENGGES-LKRGVNFIKAASRLVKALKTTEEQ  334

Query  893   TYLKGDGKEFAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCK  1072
             TYLK DGK F++L  VSTPD PYGSTFKVE+LY+I PGP L SGE+S+ LV+SW + F +
Sbjct  335   TYLKADGKSFSLLAIVSTPDAPYGSTFKVEVLYSITPGPELPSGEQSSRLVVSWRMNFLQ  394

Query  1073  STMMKTVIEGGTQQGLKDSFSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLEL  1249
             STMMK +IE G +QG+K+SF +++  L+Q+ K + + ++  +   +LA++  EH SD +L
Sbjct  395   STMMKGMIENGARQGIKESFDQYANLLSQNVKPVDAKDLGSEKEQILASIEVEHQSDWKL  454

Query  1250  AREYFCNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLE  1429
             A +YF NFTV+ST F+ LY  +H+LL+  + +QGLEF GLDLPDS+GEII CG+LVL  +
Sbjct  455   AFQYFANFTVISTFFIGLYVFVHVLLAMPSTIQGLEFVGLDLPDSIGEIIVCGVLVLQGK  514

Query  1430  QVYRMIAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNG  1609
             +V  +I+ F+ AR+++GSDHG++A GDGW+LTVALIEG NLA++D +GF DP+VVFTCNG
Sbjct  515   RVLELISRFMRARVQKGSDHGIKAQGDGWLLTVALIEGNNLAAVDASGFSDPYVVFTCNG  574

Query  1610  KSRTSSVQLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHT  1789
             K+RTSS++ Q   P+WNEI EF+  ++PPS+LDVEVFDFDGPF +A SLGHAEINF+K  
Sbjct  575   KTRTSSIKFQKSSPKWNEIFEFDAMDDPPSVLDVEVFDFDGPFSEATSLGHAEINFVKTN  634

Query  1790  SAELADLWLPLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHR  1969
              ++L+D+ +PL GK+AQ+ QSKLHLR+FLNN  G   ++D L+KMEKEVGKK+ +RSP  
Sbjct  635   ISDLSDVVVPLQGKLAQACQSKLHLRVFLNNTKGSNVVKDYLSKMEKEVGKKIKVRSPQT  694

Query  1970  NSTFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWED  2149
             NS FQK FGLPPEEFLINDF+C LKRK+PLQGR+FLS RI+GF+++LFGHKTKFF LWED
Sbjct  695   NSAFQKLFGLPPEEFLINDFACHLKRKMPLQGRLFLSARIIGFHSDLFGHKTKFFLLWED  754

Query  2150  IEEINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRT  2329
             IE+I V  P+ ++MGSP++++ L   RG DAR+GAK+ DEEGRL F FHSFVSF  A RT
Sbjct  755   IEDIQVESPTLASMGSPNVIMTLKPGRGFDARHGAKTQDEEGRLKFHFHSFVSFNVAHRT  814

Query  2330  IMALWKTRACIPDQKAQIAEEQ------QYKDENNV----------------LPEETGSY  2443
              MALWK RA  P+QK QI E +      Q  +E+++                  EE+GS+
Sbjct  815   FMALWKARALSPEQKVQIVEAEAEAKNLQMAEEDSIGSDFQAADDDSEGKSLQSEESGSF  874

Query  2444  LIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIE-PDVYE  2620
             + +ED +MS VYS  L +     ME+F+GG+L+ KVM + GCLNY  S WE  E PDV++
Sbjct  875   VGMEDTNMSIVYSSVLSVPTDFFMELFSGGELDRKVMERVGCLNYSFSPWEESEKPDVHQ  934

Query  2621  RRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVES  2800
             R++ YK ++ IS +  EVTSTQ++S  ++   W++ E+M +HGVP  D++ ++L Y+VE+
Sbjct  935   RQLYYKFDKCISRYRGEVTSTQQRSRLSDKNDWLIEEVMTLHGVPLGDYFNLRLGYQVEN  994

Query  2801  CSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGRE  2950
               +    C   V +G+ WLK ++ + RITKNI+    +R+  M   V +E
Sbjct  995   VPSRSTRCSVQVQLGIAWLKYSRHQKRITKNIISNLQERLLVMCSGVEKE  1044



>ref|NP_001057439.1| Os06g0297800 [Oryza sativa Japonica Group]
 dbj|BAD54435.1| putative Osnop [Oryza sativa Japonica Group]
 dbj|BAF19353.1| Os06g0297800 [Oryza sativa Japonica Group]
Length=1037

 Score =   890 bits (2299),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/809 (52%), Positives = 577/809 (71%), Gaps = 6/809 (1%)
 Frame = +2

Query  533   SIPSDYEDNVQETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNM  712
             S  S+  DN Q+     T SF E +K   S  EG E+PENL GG+L+DQ YA+ P D N 
Sbjct  231   STSSELPDN-QDYETGVTMSFDEQLKAFGSCHEGNEIPENLSGGVLIDQVYAVAPSDLNG  289

Query  713   LLFAPDSQFRRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQ  892
             LLF+P S F + LAE+QGT  ++   W  ++D +  L RVV+YTK  T LVK+V+ATE+ 
Sbjct  290   LLFSPSSDFLQSLAEMQGTTGLEIQQWRLENDGE-VLKRVVSYTKAPTALVKAVKATEDV  348

Query  893   TYLKGDGKEFAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCK  1072
             +YLK DG  +A L DVSTPDVP+G++F+VE+L  IMPGP L   E+S+ LV+SW + F +
Sbjct  349   SYLKADGDIYATLADVSTPDVPFGNSFRVEVLTCIMPGPELPDNEKSSRLVVSWRLNFIQ  408

Query  1073  STMMKTVIEGGTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELA  1252
             STMMK +IE G +QGLKD++ +FS  LA++ + + S +      +L+++  E  SD +LA
Sbjct  409   STMMKGMIENGAKQGLKDNYIQFSELLARNIRPVDSKDAAATDKVLSSVQPEQESDWKLA  468

Query  1253  REYFCNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQ  1432
                F NFTVVS+    +Y   HI+L+  + +QGLEF GLDLPDSVGE++ CG+LVL  ++
Sbjct  469   FRIFGNFTVVSSLVAFIYVFSHIILASPSIIQGLEFPGLDLPDSVGEVVVCGVLVLQGQR  528

Query  1433  VYRMIAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGK  1612
             V  MIA F++A+ +RGSDHGV+A G+GW+LTVALI+GTNLA+   +G+ DP+VVFTCNGK
Sbjct  529   VLNMIARFIQAKRQRGSDHGVKAQGNGWLLTVALIDGTNLAATKSSGYSDPYVVFTCNGK  588

Query  1613  SRTSSVQLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTS  1792
             ++TSS++  TL+P+WNEI EF+  E+PPS++ + V+DFDGPFD+  SLGHAE+NFLK   
Sbjct  589   TKTSSIKFHTLEPRWNEIFEFDAMEDPPSVMKINVYDFDGPFDEVESLGHAEVNFLKSNL  648

Query  1793  AELADLWLPLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRN  1972
             +EL+D+W+PL GK+AQ+ QSKLHLRI LNN+ G E ++D L KMEKEVGKK+ +RSPH N
Sbjct  649   SELSDIWIPLKGKLAQACQSKLHLRIILNNSRGTEVMKDYLDKMEKEVGKKIAVRSPHTN  708

Query  1973  STFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDI  2152
             S FQK F LPPEEFLINDF+C LKRK+  QGR+FLS RI+GFY NLFGHKTKFFFLWEDI
Sbjct  709   SAFQKIFSLPPEEFLINDFTCHLKRKMLTQGRLFLSPRIIGFYTNLFGHKTKFFFLWEDI  768

Query  2153  EEINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTI  2332
             E+I V+P +  +MGSPSL+IILHK RG DAR+GAK +D EGRL F F SFVSF  A +TI
Sbjct  769   EDIQVMPATLYSMGSPSLLIILHKGRGMDARHGAKQLDNEGRLKFHFQSFVSFNVAHKTI  828

Query  2333  MALWKTRACIPDQKAQIAEEQ-QYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKS  2509
             MALWK R+  P+QK Q+ EE+ + KD  N    E+ S+L +ED  MS+V+S   P +  +
Sbjct  829   MALWKARSLTPEQKVQLVEEESEMKDLQN---NESDSFLGIEDAKMSEVFSSTKPFDVST  885

Query  2510  LMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQR  2689
             LM +F GG LEH+VM K GC+ Y  S WE +  D Y+R++ YK ++ ++    EV STQ+
Sbjct  886   LMSIFEGGPLEHQVMEKIGCMEYSVSPWESVRADAYQRQIHYKFDKRLARHEGEVMSTQQ  945

Query  2690  KSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTK  2869
             KS   +  GW++ E+M + G+P  +++ + +RY++E  S+   +C   V +G+ WLK+ K
Sbjct  946   KSPLPDKNGWLVEEVMTLEGIPVGEYFNLHMRYQLEQISSKPKACNVQVSIGIAWLKSCK  1005

Query  2870  LEDRITKNIVRKFSQRVKEMIEFVGREVF  2956
                +I + ++   S R+K+M   + +E+ 
Sbjct  1006  NRKKIAQEVLSSASSRLKKMFGLLEKELL  1034



>gb|EEC77478.1| hypothetical protein OsI_16308 [Oryza sativa Indica Group]
Length=1023

 Score =   887 bits (2293),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/795 (54%), Positives = 577/795 (73%), Gaps = 28/795 (4%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             SF EA+++++S++   +MPE+L GG++ D TY +  K+ N L+F PDSQF +EL ELQGT
Sbjct  244   SFEEAMEIMKSKSIP-DMPEDLSGGVMFDHTYLVDSKNLNSLVFGPDSQFSKELRELQGT  302

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
              D +E PWTW ++N   LTR   YTKGATK +K+V+  EEQTYLK DGK + ++  V TP
Sbjct  303   TDYEEQPWTWNNNNPPSLTRTCQYTKGATKFMKAVKTIEEQTYLKADGKSYVIMTRVRTP  362

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             +VP+G+ F+V +LY I+  P   SGE  +HL +S+ V+F +STMMK++IEG  + GLK++
Sbjct  363   EVPFGNCFEVVMLYKIIHYPESSSGEGMSHLTVSYNVEFLQSTMMKSMIEGSVRDGLKEN  422

Query  1130  FSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYF  1309
             F  ++  L++H K+  SA  +D   LLA L ++H SD+ LA +YFCNFTV+ST  + LY 
Sbjct  423   FESYAEILSRHVKIADSAG-MDKERLLAPLQTDHQSDIRLAYKYFCNFTVISTVIMALYV  481

Query  1310  SIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDH  1489
              +HI LSR   L GLEF GLDLPD+ GE+I  GILVL LE++  MI+ FVEAR++RGSDH
Sbjct  482   LVHIFLSRPGPLMGLEFKGLDLPDTFGELIISGILVLQLERLLSMISRFVEARVQRGSDH  541

Query  1490  GVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEIL  1669
             G++A+GDGW+LTVAL+E T+L  +  +G  DP+VVF+CNG +RTSSVQLQT DPQWNEI+
Sbjct  542   GIKANGDGWLLTVALLEATSLPPVS-SGSVDPYVVFSCNGITRTSSVQLQTHDPQWNEIM  600

Query  1670  EFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQ  1849
             EF+  EEPP+ LDVEVF+FDGPFD A SLGHAEINFLKHTSAELAD+W+PL GK+AQ+ Q
Sbjct  601   EFDAMEEPPATLDVEVFNFDGPFDLAVSLGHAEINFLKHTSAELADIWVPLEGKLAQTCQ  660

Query  1850  SKLHLRIFLNNNNGVET-IRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
             S+LHLRIFL N  G ET +R+ L+KMEKEVGKKL+++SPHRN+TFQK FGLP EEFLI D
Sbjct  661   SRLHLRIFLENTKGPETSMREYLSKMEKEVGKKLHVQSPHRNATFQKLFGLPHEEFLIAD  720

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             ++CSLKRKLPLQGR+FLS RIVGFYANLFGHKTKFFFLWED+EEI  L PSF+T+G+PSL
Sbjct  721   YACSLKRKLPLQGRLFLSARIVGFYANLFGHKTKFFFLWEDVEEIEELTPSFTTVGTPSL  780

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIA  2386
             + +L   RG DA+NGAKS D+EG                RTI+ LWKT++   +Q+A++ 
Sbjct  781   LFVLKSGRGLDAKNGAKSQDKEG----------------RTIIGLWKTKSSAIEQRAKLE  824

Query  2387  EEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSG  2566
             E+Q+  DEN V   +  S L + DV +SK Y+++LP++   LM +F+GG LE K MS+ G
Sbjct  825   EDQE--DENYVDLNDVQSVLSIGDVPLSKEYTLELPIDADLLMGVFDGGPLEAKAMSRVG  882

Query  2567  CLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIH  2746
             CL+Y  + W+   P V ER  SYK NR +SIFG EV STQ +    +  GW + +++ + 
Sbjct  883   CLDYAATPWQDARPGVLERHASYKFNRYMSIFGGEVVSTQLRLPSDDGDGWTVYDVITLR  942

Query  2747  GVPFSDHYQVQLRYKVESC------SAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKF  2908
              VPF D ++V LR+ + S       +A  +  RC++ VG+ W+K +K + RI +NI  K 
Sbjct  943   NVPFGDFFRVHLRHNIRSVEAASSEAATSSGSRCEILVGIEWVKRSKFQKRIARNICEKL  1002

Query  2909  SQRVKEMIEFVGREV  2953
             + R KE++E   RE+
Sbjct  1003  AHRAKEVLEAAAREI  1017



>ref|XP_006656035.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Oryza brachyantha]
Length=1034

 Score =   886 bits (2290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/803 (52%), Positives = 574/803 (71%), Gaps = 12/803 (1%)
 Frame = +2

Query  545   DYEDNVQETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFA  724
             DYE  V       T SF E +K   S  EG E+PENL GG+L+DQ YA+ P D N LLF+
Sbjct  238   DYETGV-------TMSFDEQLKAFGSFHEGNEIPENLSGGVLIDQVYAVAPSDLNGLLFS  290

Query  725   PDSQFRRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLK  904
             P S F + LAE+QGT  ++   W  ++D +  L RVV+YTK  T LVK+V+ATE+ +YLK
Sbjct  291   PSSDFLQSLAEMQGTTGLEIQQWRLENDGE-VLQRVVSYTKAPTALVKAVKATEDVSYLK  349

Query  905   GDGKEFAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMM  1084
              D   +A L DVSTP+VP+G++F+VE+L  I PGP L   E+S+ LVISW V F +STMM
Sbjct  350   ADEDIYATLADVSTPEVPFGNSFRVEVLTCITPGPELPDDEKSSRLVISWRVNFIQSTMM  409

Query  1085  KTVIEGGTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYF  1264
             K++IE G +QGLKD +++FS  LA++ + + S +      +L+++  E  SD +LA   F
Sbjct  410   KSMIENGAKQGLKDCYNQFSELLARNIRPVDSKDTAAADKVLSSIQPEQESDWKLAFRIF  469

Query  1265  CNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRM  1444
              NFTVVS+    +Y   HI+L+  + +QGLEF GLDLPDS+GE++ CG+LVL  ++V  M
Sbjct  470   GNFTVVSSMLAFIYVFSHIILASPSIIQGLEFPGLDLPDSIGEVVVCGVLVLQGQRVLNM  529

Query  1445  IAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTS  1624
             IA F+ A+ +RGSDHGV+A GDGW+LTVALI+GTNLA+  P+G+ DP+VVFTCNGK++TS
Sbjct  530   IARFIHAKRQRGSDHGVKAQGDGWLLTVALIDGTNLAATKPSGYSDPYVVFTCNGKTKTS  589

Query  1625  SVQLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELA  1804
             S++  TL+P+WNEI EF+  E+PPS++ + V+DFDGPFD+  SLGHAE+NFLK   +ELA
Sbjct  590   SIKFHTLEPRWNEIFEFDAMEDPPSVMKINVYDFDGPFDEVVSLGHAEVNFLKSNFSELA  649

Query  1805  DLWLPLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQ  1984
             D+W+PL GK+AQ  QSKLHLRIFLNN+ G E ++  L KMEKEVGKK+ +RSPH NS FQ
Sbjct  650   DIWIPLKGKLAQPCQSKLHLRIFLNNSRGTEVMKVYLDKMEKEVGKKIAVRSPHTNSAFQ  709

Query  1985  KTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEIN  2164
             K F LPPEEFLINDF+C LKRK+  QGR+FLS RI+GFY NLFGHKTKFFFLWEDIE+I 
Sbjct  710   KIFSLPPEEFLINDFTCHLKRKMLTQGRLFLSPRIIGFYTNLFGHKTKFFFLWEDIEDIQ  769

Query  2165  VLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALW  2344
             VLP + S+MGSPSL+I+LHK RG DAR+GAK +D EGRL F F SFVSF  A +TIMALW
Sbjct  770   VLPATLSSMGSPSLLIVLHKGRGMDARHGAKQLDNEGRLKFHFQSFVSFNVAHKTIMALW  829

Query  2345  KTRACIPDQKAQIAEEQ-QYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEM  2521
             K R+  P+QK Q+ EE  + +D  N   +E+GS+L +ED  MS+V+S   P +  +LM++
Sbjct  830   KARSLSPEQKVQLVEEDSEMEDLQN---DESGSFLGIEDAKMSEVFSSTKPFDVLTLMDI  886

Query  2522  FNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVH  2701
             F GG LE +VM K GC+ Y  S+WE +  DVY+R+V YK ++ ++    EV STQ+KS  
Sbjct  887   FEGGSLERQVMEKIGCMEYSVSAWEPVRADVYQRQVHYKFDKRLARHEGEVMSTQQKSPL  946

Query  2702  ANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDR  2881
              +  GW++ E+M + G+P  +++ + +RY+VE  ++   +C     +G+ WLK+ K + +
Sbjct  947   PDKNGWLVEEVMTLEGIPVGEYFNLHIRYQVEQVASKPRTCNVQASIGISWLKSCKNKKK  1006

Query  2882  ITKNIVRKFSQRVKEMIEFVGRE  2950
             I + +    S R+K++   + +E
Sbjct  1007  IAQEVSSNASSRLKKIFNLLEKE  1029



>ref|XP_010041253.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Eucalyptus grandis]
 gb|KCW44494.1| hypothetical protein EUGRSUZ_L01993 [Eucalyptus grandis]
Length=1020

 Score =   885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/846 (52%), Positives = 597/846 (71%), Gaps = 14/846 (2%)
 Frame = +2

Query  431   KSIAGHLEKLFDkneessksneegskkdnsseLSSIP--SDYEDNVQETTRSQTQSFCEA  604
             K+ AG L ++F+K+ ++S               +S P  SD +D+ Q ++     SF E 
Sbjct  185   KTFAGRLAQMFNKSADTSSVASTKGIDLPELPEASGPESSDSQDDDQFSS----GSFEEL  240

Query  605   IKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQE  784
             IK+++SR +  E P NL GG+LLD    + P + N LLF+ DS F R L++LQGT ++Q 
Sbjct  241   IKIMESREQEGETPSNLPGGVLLDHLCIIAPSELNTLLFSSDSPFFRSLSDLQGTTELQL  300

Query  785   GPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYG  964
             G W ++ +    L RV++Y K ATKL+K+V+ATEEQTYLK DGK +AVL  VSTPDV YG
Sbjct  301   GQWKFE-NGAETLKRVISYIKAATKLIKAVKATEEQTYLKADGKVYAVLASVSTPDVMYG  359

Query  965   STFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFS  1144
             STFKVELLY I PGP L SGE+S+ LVISW + F ++TMMK +IE G +QGLKDSF +++
Sbjct  360   STFKVELLYCITPGPELPSGEQSSRLVISWRMNFLRNTMMKGMIENGVRQGLKDSFEQYA  419

Query  1145  RFLAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
               L Q  K + S +   N   +LA+L +E  SD +LA ++F NFTV+ T  + LY  +H+
Sbjct  420   SLLNQTVKPVHSKDFGSNKEQILASLQAEPQSDWKLAVQHFANFTVLFTFVMGLYVLVHL  479

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
              L+  + + GLEF GLDLPDS+GE+I CGILVL  E+V   I+ F++AR+++GSDHGVRA
Sbjct  480   WLATPSAIHGLEFVGLDLPDSIGEVIVCGILVLQAERVLGFISRFMQARMQKGSDHGVRA  539

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              GDGW+LTVALIEG+++A++D +   DP+VVFTCNGK+RTSS++ Q  DP WNEI EF+ 
Sbjct  540   QGDGWLLTVALIEGSSIAAVDSSALSDPYVVFTCNGKTRTSSIKFQKTDPLWNEIFEFDA  599

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
              E+PPSMLDVEVFDFD    +A+SLGHA++NF++   ++L D+W+PL GK+AQ+ QSKLH
Sbjct  600   MEDPPSMLDVEVFDFD----EAKSLGHAKVNFVRSNISDLGDVWVPLHGKLAQACQSKLH  655

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFL+N  G    ++ ++KMEKEVGKK+N+RSP  NS FQK F LPPEEFLINDF+C L
Sbjct  656   LRIFLDNTRGRNMAKEYISKMEKEVGKKINIRSPQTNSAFQKLFALPPEEFLINDFTCHL  715

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRK+PL GR+FLS RI+GF+ANLFG +TKFFFLWEDIE+I VL  + S+MGSP +V+ L 
Sbjct  716   KRKMPLMGRLFLSARIIGFHANLFGKRTKFFFLWEDIEDIQVLSRTLSSMGSPIVVMTLR  775

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQY  2401
             + RG +AR+GAK+ DEEGRL F F  FVSF  A RTIMALWK R+  P+QK Q+ EE+  
Sbjct  776   RGRGMEARHGAKTQDEEGRLKFQFQYFVSFNVAHRTIMALWKARSLTPEQKVQLIEEES-  834

Query  2402  KDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYV  2581
              +   ++ EE+ S+L ++DVS+S+VY   LP+     ME+F G DLE KVM K+GCLNY 
Sbjct  835   -EARGLVTEESESFLGLDDVSLSEVYCSVLPVPTNFFMEVFGGEDLERKVMEKAGCLNYS  893

Query  2582  TSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFS  2761
              + WE  +PDVYER++ Y+ ++ +S +  EVTSTQ+KS   +  GW++ E+M +H VP  
Sbjct  894   YTPWESEKPDVYERQIYYRFDKRLSRYRGEVTSTQQKSALPDRDGWLIEEVMTLHAVPLG  953

Query  2762  DHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFV  2941
             D++ + LRY++E   +    C   V+ G+ WLK+T+ + RITKNI+     R+K     +
Sbjct  954   DYFNLHLRYQIEDAPSRSKECSVKVFFGIAWLKSTEHQKRITKNILLSLQDRLKVTFGAI  1013

Query  2942  GREVFL  2959
              +E  L
Sbjct  1014  EKEFTL  1019



>ref|XP_004965266.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
isoform X1 [Setaria italica]
 ref|XP_004965267.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
isoform X2 [Setaria italica]
Length=1031

 Score =   884 bits (2284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/797 (52%), Positives = 572/797 (72%), Gaps = 6/797 (1%)
 Frame = +2

Query  563   QETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFR  742
             Q+   S T +F E +K   S+ EG+EMPENL GG+LLDQ YA+ P   N  LF+P S F 
Sbjct  235   QDQEVSATMTFDELLKAFGSQHEGKEMPENLSGGVLLDQVYAVAPSALNAHLFSPSSDFL  294

Query  743   RELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEF  922
             + LAE+QGT  ++   W  ++D +  L RVV+YTK  TKLVK+V+ATE+ TYLK DG+ F
Sbjct  295   QSLAEIQGTTGLEIQQWRLENDGE-ILKRVVSYTKAPTKLVKAVKATEDMTYLKADGEMF  353

Query  923   AVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEG  1102
             AVL DVSTPDVP+G+ F+VE+L  IMPGP L   E+S+ LV+SW + F +STMMK++IE 
Sbjct  354   AVLADVSTPDVPFGNNFRVEVLTCIMPGPQLPDDEQSSRLVVSWRLNFLQSTMMKSMIEN  413

Query  1103  GTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVV  1282
             G +QGLKD++ +FS  L +  + + + +  DN  +L+++  E  SD +LA   F NF ++
Sbjct  414   GARQGLKDNYVQFSELLVRTFRPVDTKDTTDNNEVLSSVQPEQQSDWKLAFRIFGNFALL  473

Query  1283  STAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVE  1462
             S+ F  +Y S HI+L+  + +QGLEF GLDLPDS GE++ CG+LVL  ++V  MI  F++
Sbjct  474   SSVFAFVYVSAHIILASPSIIQGLEFPGLDLPDSAGEVVVCGVLVLQGQRVLNMIGRFIQ  533

Query  1463  ARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQT  1642
             A+ +RG DHGV+A GDGW+LTVALIEGTNLA+   +G+ DP+VVFTCNGK++ SS++  T
Sbjct  534   AKRQRG-DHGVKAQGDGWLLTVALIEGTNLAATKSSGYSDPYVVFTCNGKTKASSIKFHT  592

Query  1643  LDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPL  1822
             L+PQWNEI EF+  E+PPS++++ V+DFDGPFD+   LGHAE+NFLK+  +ELAD+W+PL
Sbjct  593   LEPQWNEIFEFDAMEDPPSVMEINVYDFDGPFDEVACLGHAEVNFLKYNISELADIWIPL  652

Query  1823  GGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLP  2002
              GK+AQ+ QSKLHLRIFLNN  G + ++D L KMEKEVGKK+ +RSPH N  FQK F LP
Sbjct  653   KGKLAQACQSKLHLRIFLNNTRGTQVVKDYLDKMEKEVGKKIAVRSPHANLAFQKIFSLP  712

Query  2003  PEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSF  2182
              EEFLINDF+C LKRK+  QGR+FLS RI GFY NLFGHKTKFFFLWEDIE+I V+P + 
Sbjct  713   AEEFLINDFTCHLKRKMLTQGRLFLSPRIFGFYTNLFGHKTKFFFLWEDIEDILVVPATL  772

Query  2183  STMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACI  2362
             ++MGSPSLVIIL K RG DA++GAK +D EGRL F F SFVSF  A +TIMALWK R+  
Sbjct  773   ASMGSPSLVIILRKGRGLDAKHGAKQLDSEGRLKFHFQSFVSFNVAHKTIMALWKARSLT  832

Query  2363  PDQKAQIAEEQ-QYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDL  2539
             P+QK Q+ EE+ + +D  N   EE GS+L +ED  MS V+S   P +  +LM +F GG L
Sbjct  833   PEQKVQLVEEESETEDFQN---EEGGSFLGIEDAKMSAVFSSTKPFDVSTLMSIFEGGPL  889

Query  2540  EHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGW  2719
             EH+VM + GC++Y  + WE +  DVY+R+V +K ++       E  STQ+KS   N  GW
Sbjct  890   EHRVMERVGCVDYSVTEWEPVRADVYQRQVHHKFDKKSERHEGEAMSTQQKSPLPNKNGW  949

Query  2720  ILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIV  2899
             ++ E+M + G+P  + + + +RY++E+ ++ + SC   V +G++WLK+ K   +IT+++ 
Sbjct  950   LVEEVMTLEGIPIGECFNLHIRYQLENNASKQKSCTVQVSIGIVWLKSCKNRKKITQDVA  1009

Query  2900  RKFSQRVKEMIEFVGRE  2950
                S R+K++   + +E
Sbjct  1010  SSASSRLKKIFSQLEKE  1026



>ref|XP_003528713.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
isoform X1 [Glycine max]
 ref|XP_006584107.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
isoform X2 [Glycine max]
 gb|KHN40230.1| C2 and GRAM domain-containing protein [Glycine soja]
Length=1027

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/802 (54%), Positives = 575/802 (72%), Gaps = 8/802 (1%)
 Frame = +2

Query  566   ETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRR  745
             E  +S  ++F E +K +QS  +G E+P NL GG+L+DQ Y + P+D N+LLF+PDS F +
Sbjct  230   EEDQSSNETFEETMKKIQSADQGSEIPNNLSGGVLIDQLYIVAPEDLNVLLFSPDSNFPK  289

Query  746   ELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFA  925
              L+E QGT ++Q  PW  ++  ++ L R +TY K ATKL+K+V+  E+QTYLK DGK FA
Sbjct  290   SLSEEQGTSELQICPWKLENGGET-LKRSLTYIKAATKLIKAVKGYEDQTYLKADGKNFA  348

Query  926   VLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGG  1105
             VL  VSTPDV YG+TF+VE+LY I PGP L SGE+ + LVISW + F +STMMK +IE G
Sbjct  349   VLGSVSTPDVMYGTTFRVEVLYVITPGPELPSGEQCSRLVISWRMNFLQSTMMKGMIESG  408

Query  1106  TQQGLKDSFSEFSRFLAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYFCNFTVV  1282
              +QG+KDSF +++  L Q  K + S ++  +    LATL  E  S L+LA +Y  NFTV 
Sbjct  409   ARQGMKDSFDQYATLLCQTVKPVVSKDLGSSKEQALATLRPEPQSILKLAMQYLANFTVF  468

Query  1283  STAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVE  1462
             +T  +V Y  +HI L+    +QGLEF G DLPDS+GE + C +LVL  E+V  +I+ F++
Sbjct  469   TTFLMVSYVLVHIYLAAPRTIQGLEFVGFDLPDSIGEFVVCIVLVLQGERVLGLISRFMQ  528

Query  1463  ARLR--RGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQL  1636
             AR R  +GSDHG++A G+GW+LTVALIEG+NLA++D   F DP+VVFTCNGK+RTSS++ 
Sbjct  529   ARARARKGSDHGIKAQGEGWMLTVALIEGSNLATVDSGAFCDPYVVFTCNGKTRTSSIKF  588

Query  1637  QTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWL  1816
             +  DP WNEI EF+  ++PPS+LDVEV+DFDGP D+A SLG  EINFLK   ++LAD+W+
Sbjct  589   KKSDPLWNEIFEFDAMDDPPSVLDVEVYDFDGPCDKAASLGRVEINFLKTNISDLADIWV  648

Query  1817  PLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFG  1996
              L GK+A +  SKLHL++FLNN  G + ++  ++KMEKEVGKK+NLRSP  NS FQK FG
Sbjct  649   SLEGKLALACHSKLHLKVFLNNTRGGDVVKHYISKMEKEVGKKINLRSPQTNSAFQKLFG  708

Query  1997  LPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPP  2176
             LPPEEFLINDF+C LKRK+PLQGR+F+S RI+GF+ANLFGHKTKFF LWEDIE+I ++PP
Sbjct  709   LPPEEFLINDFTCHLKRKMPLQGRLFVSARIIGFHANLFGHKTKFFLLWEDIEDIQIIPP  768

Query  2177  SFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRA  2356
             +FS+MGSP +VI L   RG DAR+GAK+ DEEGRL F F SFVSF  A+RTIMALWK R+
Sbjct  769   TFSSMGSPIIVITLWPGRGVDARHGAKTQDEEGRLKFRFQSFVSFNVANRTIMALWKARS  828

Query  2357  CIPDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGD  2536
               P+QK Q+ EE    +  ++  EE+GS++ + DVSMS+V+S  L +     ME+F+GG+
Sbjct  829   LSPEQKVQLVEEDS--ETKSLRSEESGSFIGLGDVSMSEVHSSALSVPASFFMELFSGGE  886

Query  2537  LEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAG  2716
             L+   M KSGC+NY  + W     DVYER + YK  + IS + VEVTSTQ++S+     G
Sbjct  887   LDRMFMEKSGCVNYSYTPWVSENSDVYERAIYYKFEKRISRYRVEVTSTQQRSL-LEGKG  945

Query  2717  WILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNI  2896
             W+L E+M  HGVP  D + + L Y++E  S   NSC+  V  G  WLK+TK + RITKNI
Sbjct  946   WLLQEVMNFHGVPLGDFFNLHLHYQIEDLSPKANSCKVQVLFGTEWLKSTKHQKRITKNI  1005

Query  2897  VRKFSQRVKEMIEFVGREVFLS  2962
             ++   +R+K     V +E FLS
Sbjct  1006  LKNLQERLKLTFSLVEKE-FLS  1026



>gb|KEH32705.1| C2 and GRAM domain plant-like protein [Medicago truncatula]
Length=1022

 Score =   882 bits (2280),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/798 (52%), Positives = 581/798 (73%), Gaps = 5/798 (1%)
 Frame = +2

Query  560   VQETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQF  739
             V+   +S  ++F E ++ +QS  +G E+P NL GG+L+DQ Y +  +D N LLF+PDS F
Sbjct  225   VKVEDQSSNETFEEIVRKMQSADQGSEIPSNLPGGVLIDQLYVIATEDLNALLFSPDSNF  284

Query  740   RRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKE  919
              + LA++QGT ++Q  PW  +++NKS L R +TY K ATKL+K+++  EEQTYLK DGK 
Sbjct  285   PKSLADIQGTTELQVSPWKLENENKS-LKRSLTYIKAATKLLKAIKGYEEQTYLKADGKN  343

Query  920   FAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIE  1099
             FAVL  VSTPDV YGSTFKVELLY I PGP L S E+ + LVISW + F +STMMK +IE
Sbjct  344   FAVLASVSTPDVMYGSTFKVELLYLITPGPELSSEEQCSRLVISWRMNFLQSTMMKGMIE  403

Query  1100  GGTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYFCNFT  1276
              G +QG+K+SF +++  L+Q  K + S ++      +LA+L +E  SD +LA +YF NFT
Sbjct  404   NGARQGMKESFDQYAILLSQTAKPVDSKDLGSTKEQVLASLKAEPQSDWKLAMQYFANFT  463

Query  1277  VVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHF  1456
              +ST  + LY  IH+ L+    +QGLEF GLDLPDS+ E + C +LVL  +++  +I+ F
Sbjct  464   FISTFLMGLYVLIHMWLAAPIMIQGLEFFGLDLPDSICEFVVCAVLVLQGQRMLGLISRF  523

Query  1457  VEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQL  1636
             + AR R+GSDHG++A GDGW+LTVALIEG+N+A++D  G  +P+VVFTCNGK+R+SS++ 
Sbjct  524   IRARRRKGSDHGIKAQGDGWLLTVALIEGSNIAAVDSGGLCNPYVVFTCNGKTRSSSIKF  583

Query  1637  QTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWL  1816
             Q  +P WNEI EF+  ++PPS+L+VEV+DFDGPFD+  S+GH EINFLK   ++LA+LW+
Sbjct  584   QKSNPSWNEIFEFDAMDDPPSVLEVEVYDFDGPFDEDASVGHIEINFLKTNISDLAELWV  643

Query  1817  PLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFG  1996
              L GK+A + QSKLHL++FL+N  G   ++  ++KMEKEVGKK+NLRSP  NS FQK FG
Sbjct  644   SLEGKLALTCQSKLHLKVFLDNTRGGNVVKHYISKMEKEVGKKINLRSPQTNSAFQKLFG  703

Query  1997  LPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPP  2176
             LPPEEFLINDF+C LKRK+PLQGR+F+S RI+GF+ANLFGHKTKFF LWEDIE+I V+PP
Sbjct  704   LPPEEFLINDFTCHLKRKMPLQGRLFVSARILGFHANLFGHKTKFFLLWEDIEDIQVIPP  763

Query  2177  SFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRA  2356
             +FS+MGSP +VI L + RG DA++GAK  DE+GRL F F SFVS+  A+RTIMALWK R+
Sbjct  764   TFSSMGSPIIVITLRQGRGADAKHGAKKQDEQGRLKFHFQSFVSYNVANRTIMALWKARS  823

Query  2357  CIPDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGD  2536
                +QK ++ E+    +  +V  EE+GS+L  +DVSMS+V+S  LP+     M++F+GG+
Sbjct  824   LSIEQKVRLVEDD--PETRSVASEESGSFLGGDDVSMSEVHSCALPVPVSFFMDLFSGGE  881

Query  2537  LEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAG  2716
             L+ +VM KSGC++Y  + W   +  VYER + YK  + IS + VEVTSTQ+K++  +  G
Sbjct  882   LDCRVMEKSGCVSYSYTPWVSEKKGVYERAIYYKSEKRISRYKVEVTSTQQKTI-LDGNG  940

Query  2717  WILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNI  2896
             W++ E+M  HGVP  D++ + LRY+++        C+  V  G+ WLKNTK + RITKNI
Sbjct  941   WLVEEVMNFHGVPLGDYFNLHLRYQIDDLPPKAKGCKVQVLFGIEWLKNTKHQKRITKNI  1000

Query  2897  VRKFSQRVKEMIEFVGRE  2950
             ++   +R+K ++  V +E
Sbjct  1001  LKNLQERIKLIVSLVEKE  1018



>ref|XP_010686607.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 [Beta 
vulgaris subsp. vulgaris]
Length=990

 Score =   882 bits (2279),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/792 (54%), Positives = 578/792 (73%), Gaps = 14/792 (2%)
 Frame = +2

Query  584   TQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQ  763
             + SF + +K ++ + +G ++P NL GG+LLDQ Y + P + N L+F+PDS+F + LAE Q
Sbjct  205   SASFDDLMKTMEGKDQGIDLPTNLAGGVLLDQLYLVTPAELNALIFSPDSKFPQALAEFQ  264

Query  764   GTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVS  943
             G  D+    W ++++   CL R  TY    +KL KS++A E QTY   +GK FA+L+ VS
Sbjct  265   GKTDLHFAQWEFENE---CLKRQNTYLTPPSKLSKSLKAFETQTYKVANGKSFAILISVS  321

Query  944   TPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLK  1123
             TPDV YGSTF+VE+LY IMPGP L SGE+S+ L+ SW + F +STMMK +IE G +  +K
Sbjct  322   TPDVIYGSTFRVEMLYCIMPGPELESGEQSSRLLASWGMNFVQSTMMKGMIENGARPAVK  381

Query  1124  DSFSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLV  1300
             +SF +FS FL+QH K I   +       +LA+L +E  SD +LA +YF NFTVVST  + 
Sbjct  382   ESFDQFSSFLSQHVKPIDQKDTGSQKDQVLASLQAEPQSDWKLAVQYFANFTVVSTIIIG  441

Query  1301  LYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRG  1480
             +Y  IHI ++  + +QGLEF GLDLPDS+GE+I CG+LVL  ++++ ++A F++ARL++G
Sbjct  442   IYVLIHICITAPSTIQGLEFVGLDLPDSIGEVIVCGVLVLQAKRMFELVARFMQARLQKG  501

Query  1481  SDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWN  1660
             SDHGV+A GDGW+LTVALIEG+NLA++D +GF DP+VVFTCNG+++TSS++ Q LDPQWN
Sbjct  502   SDHGVKAQGDGWLLTVALIEGSNLAAVDSSGFSDPYVVFTCNGRTKTSSIKFQKLDPQWN  561

Query  1661  EILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQ  1840
             EI EF+  +EPPS+L+VEVFDFDGPFD+A SLGHAEINFLK   +ELAD+W+PL GK+AQ
Sbjct  562   EIFEFDAMDEPPSVLEVEVFDFDGPFDEATSLGHAEINFLKANISELADVWVPLQGKLAQ  621

Query  1841  SSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLI  2020
             S QSKL LRIFL++  G   +R+ L KMEKEVGKK+  RSP  NS FQK F LPPEEFLI
Sbjct  622   SWQSKLRLRIFLDDTRGGNAVREYLEKMEKEVGKKIGRRSPQTNSAFQKLFCLPPEEFLI  681

Query  2021  NDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSP  2200
             NDF+C LKRK+PLQGR+FLS R++GF+A LF HKT FF LWED+E+I V  P+ S+MGSP
Sbjct  682   NDFTCHLKRKMPLQGRLFLSPRVIGFHATLFRHKTNFFILWEDVEDIQVASPNLSSMGSP  741

Query  2201  SLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQ  2380
              +VI L K RG DA++GA++ DEEGRL + FHSFVSF  A RTIMALWK R+  P+QK +
Sbjct  742   IIVITLRKGRGLDAKHGARTQDEEGRLKYYFHSFVSFNMAHRTIMALWKARSLSPEQKVK  801

Query  2381  IAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYS--VDLPMNHKSLMEMFNGGDLEHKVM  2554
             I EE    +  ++  EE+G +L  EDVSM++VYS  + +PMN   LME+F+GG+++ +VM
Sbjct  802   IVEEDS--ETTSLHTEESGIFLGDEDVSMTEVYSSAISVPMNF--LMELFSGGEVDRRVM  857

Query  2555  SKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEI  2734
              K+GCL+Y  S WE  + D++ R+V YK ++ IS +  EVTSTQ+KS   +  GW++ E+
Sbjct  858   EKAGCLDYSCSPWE-ADKDLFGRQVCYKFDKRISSYRGEVTSTQQKSPLPDKNGWLIEEV  916

Query  2735  MAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQ  2914
             + +HG+P SDHY + LRY++E  S     C   V  G+ WLK+TK + RI+KN++   + 
Sbjct  917   LTLHGIPLSDHYNLHLRYQLEDRSKG---CHVKVSFGIAWLKSTKHQKRISKNVLSNLAD  973

Query  2915  RVKEMIEFVGRE  2950
             R+  M   V +E
Sbjct  974   RLNVMFATVEKE  985



>ref|XP_004507581.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Cicer arietinum]
Length=1025

 Score =   882 bits (2279),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/798 (53%), Positives = 571/798 (72%), Gaps = 4/798 (1%)
 Frame = +2

Query  560   VQETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQF  739
             ++   +S   +F E ++ +QS  +G E+P NL GG+L+DQ Y +  +D N+LLF+P+S F
Sbjct  225   IKTEDQSSNDTFEETVRKMQSVDQGSEIPSNLPGGVLIDQLYVIATEDLNVLLFSPNSTF  284

Query  740   RRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKE  919
              + LA++QGT ++Q  PW  ++DNKS L R +T+ K A+KL K+V+  EEQTYLK DGK 
Sbjct  285   AKSLADIQGTTELQMSPWKLENDNKS-LKRSLTFVKAASKLFKAVKGYEEQTYLKADGKN  343

Query  920   FAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIE  1099
             FA+L  VSTPDV YGSTFKVE+LY I PGP L SGE+ + LVISW + F +STMMK +IE
Sbjct  344   FALLASVSTPDVMYGSTFKVEVLYVITPGPELSSGEQCSRLVISWRMNFVQSTMMKGMIE  403

Query  1100  GGTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYFCNFT  1276
              G +QG+KD F +++  L+Q  K +   ++  +    LA+L +E  SD +LA +YF NFT
Sbjct  404   NGARQGMKDCFDQYAILLSQTVKPVDLKDLGSSKEQALASLKAEPESDWKLAMQYFANFT  463

Query  1277  VVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHF  1456
              +ST  + LY  IHI L   T +QGLEF GLDLPDS+ E +   +LVL  E++  +I+ F
Sbjct  464   FISTFLMGLYVLIHISLVAPTTIQGLEFFGLDLPDSISEFVVSAVLVLQGERMLGLISRF  523

Query  1457  VEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQL  1636
             ++AR R+GSDHG++A GDGW+LTVALIEG+ LA++D +G  +P+VVFTCNGK+R SS++ 
Sbjct  524   MQARARKGSDHGIKAQGDGWLLTVALIEGSKLAAVDSSGLRNPYVVFTCNGKTRASSIKF  583

Query  1637  QTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWL  1816
             Q  DP WNEI EF+  ++PPSMLDVEV  FDGPF++  SLGH EINFLK   ++LADLW+
Sbjct  584   QKSDPLWNEIFEFDAMDDPPSMLDVEVCAFDGPFNEVVSLGHVEINFLKTNISDLADLWV  643

Query  1817  PLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFG  1996
              L GK+A + QSKLHLRIFL+N  G   +   ++KMEKEVGKK+NLRSP  NS FQK FG
Sbjct  644   SLEGKLALACQSKLHLRIFLDNTRGGNIVEHYISKMEKEVGKKINLRSPQTNSAFQKLFG  703

Query  1997  LPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPP  2176
             LPPEEFLINDF+C LKRK+PLQGR+F+S RI+GF+ANLFGHKT FF LWEDIE+I V+PP
Sbjct  704   LPPEEFLINDFTCHLKRKMPLQGRLFVSARIIGFHANLFGHKTNFFLLWEDIEDIQVVPP  763

Query  2177  SFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRA  2356
             +FS+MGSP  VI L + RG DAR+GAK+ DE+GRL F F SFVSF  A+RTIMALWKTR+
Sbjct  764   TFSSMGSPISVITLRQGRGVDARHGAKTQDEQGRLKFHFQSFVSFNVANRTIMALWKTRS  823

Query  2357  CIPDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGD  2536
                +QK Q+ E+    +  + + EE  S+L ++DVSMS+V+S  LP+     ME+FNGG+
Sbjct  824   LSIEQKVQLVEDD--PETKSFVNEENASFLGLDDVSMSEVHSCALPVPVSFFMELFNGGE  881

Query  2537  LEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAG  2716
             L+ +VM KSGC+ Y  + W     DVYER V YK  + IS + VEVTSTQ+KS+  +  G
Sbjct  882   LDCRVMEKSGCVGYSYTPWVSENNDVYERAVYYKFEKRISRYKVEVTSTQQKSLLEDGKG  941

Query  2717  WILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNI  2896
             W+L E+M  HGVP  D++ + LRY+++   +    C+  V   + WLK+TK + RITKNI
Sbjct  942   WLLEEVMNFHGVPLGDYFNLHLRYQIDDLPSRAKGCKVQVLFDIEWLKSTKHQKRITKNI  1001

Query  2897  VRKFSQRVKEMIEFVGRE  2950
             ++   +R+K     V +E
Sbjct  1002  LKNLQERLKLTFCIVEKE  1019



>ref|XP_006350246.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
isoform X1 [Solanum tuberosum]
Length=1052

 Score =   882 bits (2278),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/823 (51%), Positives = 599/823 (73%), Gaps = 28/823 (3%)
 Frame = +2

Query  554   DNVQETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDS  733
             +N QE  +S + +F E +K +++R +  E+P NL  G+++DQ YA+ P + N+ LF+PDS
Sbjct  224   ENAQEE-QSTSGNFQELLKSIEAREQPSEVP-NL-SGVVVDQLYAIAPHELNLFLFSPDS  280

Query  734   QFRRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDG  913
              F + L ++QG+ +++ GPW  ++  +S L RVV++ K A++L+K+++ TEEQTYLK DG
Sbjct  281   AFFKSLVDIQGSTELRVGPWKLENGGES-LKRVVSFIKAASRLIKALKTTEEQTYLKADG  339

Query  914   KEFAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTV  1093
             K F++L  VSTPD PYGSTFKVE+LY+I PGP L SGE+S+ LV+SW + F +STMMK +
Sbjct  340   KSFSLLCIVSTPDAPYGSTFKVEVLYSITPGPELPSGEQSSRLVVSWRMNFLQSTMMKGM  399

Query  1094  IEGGTQQGLKDSFSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCN  1270
             IE G +QG+K+SF +++  L+Q+ K + + ++  +   +LA++  EH SD +LA +YF N
Sbjct  400   IENGARQGIKESFDQYANLLSQNVKPVDAKDLGSEKEQILASIEVEHQSDWKLAFQYFAN  459

Query  1271  FTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIA  1450
             FT++ST F+ LY  +H+LL+  + +QGLEF GLDLPDS+GE+I CG+LVL  ++V  +I+
Sbjct  460   FTIISTFFIGLYVFVHVLLAMPSTIQGLEFVGLDLPDSIGELIVCGVLVLQGKRVLELIS  519

Query  1451  HFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSV  1630
              F+ AR+++GSDHG++A GDGW+LTVALIEG NLA++D +GF DP+VVFTCNGK+RTSS+
Sbjct  520   RFMRARVQKGSDHGIKAQGDGWLLTVALIEGNNLAAVDTSGFSDPYVVFTCNGKTRTSSI  579

Query  1631  QLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADL  1810
             + Q   P+WNEI EF+  ++PPS+LDVEVFDFDGPF +A SLGHAEINF+K   ++L+D+
Sbjct  580   KFQKSSPKWNEIFEFDAMDDPPSVLDVEVFDFDGPFSEATSLGHAEINFVKTNISDLSDV  639

Query  1811  WLPLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKT  1990
              +PL GK+AQ+ QSKLHLR+FLNN  G   ++D L+KMEKEVGKK+ +RSP  NS FQK 
Sbjct  640   MVPLQGKLAQACQSKLHLRVFLNNTKGSNVVKDYLSKMEKEVGKKIKVRSPQTNSAFQKL  699

Query  1991  FGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVL  2170
             FGLPPEEFLINDF+C LKRK+PLQGR+FLS RI+GF+++LFGHKT FF LWEDIE+I V 
Sbjct  700   FGLPPEEFLINDFACHLKRKMPLQGRLFLSARIIGFHSDLFGHKTNFFLLWEDIEDIQVE  759

Query  2171  PPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKT  2350
              P+ ++MGSP++++ L   RG DAR+GAK+ DEEGRL F FHSFVSF  A RT MALWK 
Sbjct  760   SPTLASMGSPNVIMTLKPGRGFDARHGAKTQDEEGRLKFHFHSFVSFNVAHRTFMALWKA  819

Query  2351  RACIPDQKAQIAEEQ------QYKDENNV----------------LPEETGSYLIVEDVS  2464
             RA  P+QK QI E +      Q  +E+++                  EE GS++ +ED++
Sbjct  820   RALSPEQKVQIVEAEAEAKNLQMAEEDSIGSDFQAADDDSEGKSLQSEEGGSFVGMEDIN  879

Query  2465  MSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIE-PDVYERRVSYKL  2641
             MS VYS  L +  +  ME+F+GG+L+ KVM + GCLNY  S WE  + PDV++R++ YK 
Sbjct  880   MSIVYSSVLSVPTEFFMELFSGGELDRKVMERVGCLNYSCSPWEESDKPDVHQRQLYYKF  939

Query  2642  NRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNS  2821
             ++ IS +  E+TSTQ++S  ++   W++ E+M +HGVP  D++ ++L Y+VE+  +    
Sbjct  940   DKCISRYRGEMTSTQQRSRLSDKNDWLIEEVMTLHGVPLGDYFNLRLGYQVENVPSRSTR  999

Query  2822  CRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGRE  2950
             C   V +G+ WLK ++ + RITKNI+    +R+  M   V +E
Sbjct  1000  CSVQVQLGIAWLKYSRHQKRITKNIISNMQERLLVMCSGVEKE  1042



>gb|EEC80442.1| hypothetical protein OsI_22634 [Oryza sativa Indica Group]
Length=1052

 Score =   881 bits (2276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/824 (51%), Positives = 578/824 (70%), Gaps = 21/824 (3%)
 Frame = +2

Query  533   SIPSDYEDNVQETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNM  712
             S  S+  DN Q+     T SF E +K   S  EG E+PENL GG+L+DQ YA+ P D N 
Sbjct  231   STSSELPDN-QDYETGVTMSFDEQLKAFGSCHEGNEIPENLSGGVLIDQVYAVAPSDLNG  289

Query  713   LLFAPDSQFRRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQ  892
             LLF+P S F + LAE+QGT  ++   W  ++D +  L RVV+YTK  T LVK+V+ATE+ 
Sbjct  290   LLFSPSSDFLQSLAEMQGTTGLEIQQWRLENDGE-VLKRVVSYTKAPTALVKAVKATEDV  348

Query  893   TYLKGDGKEFAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCK  1072
             +YLK DG  +A L DVSTPDVP+G++F+VE+L  IMPGP L   E+S+ LV+SW + F +
Sbjct  349   SYLKADGDIYATLADVSTPDVPFGNSFRVEVLTCIMPGPELPDNEKSSRLVVSWRLNFIQ  408

Query  1073  STMMKTVIEGGTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELA  1252
             STMMK +IE G +QGLKD++ +FS  LA++ + + S +      +L+++  E  SD +LA
Sbjct  409   STMMKGMIENGAKQGLKDNYIQFSELLARNIRPVDSKDAAATDKVLSSVQPEQESDWKLA  468

Query  1253  REYFCNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQ  1432
                F NFTVVS+    +Y   HI+L+  + +QGLEF GLDLPDSVGE++ CG+LVL  ++
Sbjct  469   FRIFGNFTVVSSLVAFIYVFSHIILASPSIIQGLEFPGLDLPDSVGEVVVCGVLVLQGQR  528

Query  1433  VYRMIAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGK  1612
             V  MIA F++A+ +RGSDHGV+A G+GW+LTVALI+GTNLA+   +G+ DP+VVFTCNGK
Sbjct  529   VLNMIARFIQAKRQRGSDHGVKAQGNGWLLTVALIDGTNLAATKSSGYSDPYVVFTCNGK  588

Query  1613  SRTSSVQLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTS  1792
             ++TSS++  TL+P+WNEI EF+  E+PPS++ + V+DFDGPFD+  SLGHAE+NFLK   
Sbjct  589   TKTSSIKFHTLEPRWNEIFEFDAMEDPPSVMKINVYDFDGPFDEVESLGHAEVNFLKSNL  648

Query  1793  AELADLWLPLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRN  1972
             +EL+D+W+PL GK+AQ+ QSKLHLRI LNN+ G E ++D L KMEKEVGKK+ +RSPH N
Sbjct  649   SELSDIWIPLKGKLAQACQSKLHLRIILNNSRGTEVMKDYLDKMEKEVGKKIAVRSPHTN  708

Query  1973  STFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDI  2152
             S FQK F LPPEEFLINDF+C LKRK+  QGR+FLS RI+GFY NLFGHKTKFFFLWEDI
Sbjct  709   SAFQKIFSLPPEEFLINDFTCHLKRKMLTQGRLFLSPRIIGFYTNLFGHKTKFFFLWEDI  768

Query  2153  EEINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTI  2332
             E+I V+P +  +MGSPSL+IILHK RG DAR+GAK +D EGRL F F SFVSF  A +TI
Sbjct  769   EDIQVMPATLYSMGSPSLLIILHKGRGMDARHGAKQLDNEGRLKFHFQSFVSFNVAHKTI  828

Query  2333  MALWKTRACIPDQKAQIAEEQ-QYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKS  2509
             MALWK R+  P+QK Q+ EE+ + KD  N    E+ S+L +ED  MS+V+S   P +  +
Sbjct  829   MALWKARSLTPEQKVQLVEEESEMKDLQN---NESDSFLGIEDAKMSEVFSSTKPFDVST  885

Query  2510  LMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQR  2689
             LM +F GG LEH+VM K GC+ Y  S WE +  D Y+R++ YK ++ ++    EV STQ+
Sbjct  886   LMSIFEGGPLEHQVMEKIGCMEYSVSPWESVRADAYQRQIHYKFDKRLARHEGEVMSTQQ  945

Query  2690  KSVHANDAGWILNEIMAIHGVPFSDHY---------------QVQLRYKVESCSAARNSC  2824
             KS   +  GW++ E+M + G+P  +++               ++ +RY++E  S+   +C
Sbjct  946   KSPLPDKNGWLVEEVMTLEGIPVGEYFNNLHKIILIVSKFPPKLHMRYQLEQISSKPKAC  1005

Query  2825  RCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGREVF  2956
                V +G+ WLK+ K   +I + ++   S R+K+M   + +E+ 
Sbjct  1006  NVQVSIGIAWLKSCKNRKKIAQEVLSSASSRLKKMFGLLEKELL  1049



>gb|EAZ31085.1| hypothetical protein OsJ_15182 [Oryza sativa Japonica Group]
Length=1020

 Score =   880 bits (2274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/795 (54%), Positives = 577/795 (73%), Gaps = 28/795 (4%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             SF EA+++++S++   +MPE+L GG++ D TY +  K+ N L+F PDSQF +EL ELQGT
Sbjct  241   SFEEAMEIMKSKSIP-DMPEDLNGGVMFDHTYLVDSKNLNSLIFGPDSQFSKELRELQGT  299

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
              D +E PWTW ++N   LTR   YTKGATK +K+V+  EEQTYLK DGK + ++  V TP
Sbjct  300   MDYEEQPWTWNNNNPPSLTRTCQYTKGATKFMKAVKTIEEQTYLKADGKSYVIMTRVRTP  359

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             +VP+G+ F+V +LY I+  P L S E  +HL +S+ V+F +STMMK++IEG  + GLK++
Sbjct  360   EVPFGNCFEVVMLYKIIHYPELSSSEGMSHLTVSYNVEFLQSTMMKSMIEGSVRDGLKEN  419

Query  1130  FSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYF  1309
             F  ++  L++H K+  SA  +D   LLA L ++H SD+ LA +YFCNFTV+ST  + LY 
Sbjct  420   FESYAEILSRHVKIADSAG-MDKERLLAPLQTDHQSDIRLAYKYFCNFTVISTVIMALYV  478

Query  1310  SIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDH  1489
              +HI LSR   L GLEF GLDLPD+ GE+I  GILVL LE++  MI+ FVE R++RGSDH
Sbjct  479   LVHIFLSRPGPLMGLEFKGLDLPDTFGELIISGILVLQLERLLSMISRFVEVRVQRGSDH  538

Query  1490  GVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEIL  1669
             G++A+GDGW+LTVAL+E T+L  +  +G  DP+VVF+CNG +RTSSVQLQT DPQWNEI+
Sbjct  539   GIKANGDGWLLTVALLEATSLPPVS-SGSVDPYVVFSCNGITRTSSVQLQTHDPQWNEIM  597

Query  1670  EFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQ  1849
             EF+  EEPP+ LDVEVF+FDGPFD A SLGHAEINFLKHTSAELAD+W+PL GK+AQ+ Q
Sbjct  598   EFDAMEEPPATLDVEVFNFDGPFDLAVSLGHAEINFLKHTSAELADIWVPLEGKLAQTCQ  657

Query  1850  SKLHLRIFLNNNNGVET-IRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
             S+LHLRIFL N  G ET +R+ L+KMEKEVGKKL+++SPHRN+TFQK FGLP EEFLI  
Sbjct  658   SRLHLRIFLENTKGPETSMREYLSKMEKEVGKKLHVQSPHRNATFQKLFGLPHEEFLIAV  717

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             ++CSLKRKLPLQGR+FLS RIVGFYANLFGHKTKFFFLWED+EEI  L PSF+T+G+PSL
Sbjct  718   YACSLKRKLPLQGRLFLSARIVGFYANLFGHKTKFFFLWEDVEEIEELTPSFTTVGTPSL  777

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIA  2386
             + +L   RG DA+NGAKS D+EG                RTI+ LWKT++   +Q+A++ 
Sbjct  778   LFVLKSGRGLDAKNGAKSQDKEG----------------RTIIGLWKTKSSAIEQRAKLE  821

Query  2387  EEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSG  2566
             E+Q+  DEN V   +  S L + DV +SK Y+++LP++   LM +F+GG LE K MS++G
Sbjct  822   EDQE--DENYVDLNDVQSVLSIGDVPLSKEYTLELPIDADLLMGVFDGGPLEAKAMSRAG  879

Query  2567  CLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIH  2746
             CL+Y  + W+   P V ER  SYK NR +SIFG EV STQ +    +  GW + +++ + 
Sbjct  880   CLDYAATPWQDARPGVLERHASYKFNRYMSIFGGEVVSTQLRLPSDDGDGWTVYDVITLR  939

Query  2747  GVPFSDHYQVQLRYKV------ESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKF  2908
              VPF D +++ LR+ +       S +AA +  RC++ VG+ W+K +K + RI +NI  K 
Sbjct  940   NVPFGDFFRLHLRHNIWSVEAASSEAAASSGSRCEILVGIEWVKRSKFQKRIARNICEKL  999

Query  2909  SQRVKEMIEFVGREV  2953
             + R KE++E   RE+
Sbjct  1000  AHRAKEVLEAAAREI  1014



>ref|XP_007147576.1| hypothetical protein PHAVU_006G136200g [Phaseolus vulgaris]
 gb|ESW19570.1| hypothetical protein PHAVU_006G136200g [Phaseolus vulgaris]
Length=1016

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/803 (52%), Positives = 574/803 (71%), Gaps = 7/803 (1%)
 Frame = +2

Query  560   VQETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQF  739
             + +  +S   +F E +K +QS  +G  +P NL  G+ +DQ Y + P+D N LLF+ DS F
Sbjct  219   MNDEDQSSNVTFEETMKKIQSLDQGNGIPNNLPAGLFIDQQYVIAPEDLNELLFSSDSNF  278

Query  740   RRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKE  919
              + LAE+QG+ +++ GPW +++D K    R+V+Y K  +KL+K+V+A EE TYLK DGK 
Sbjct  279   LKSLAEVQGSTELEIGPWKFENDGK-IFKRLVSYVKAPSKLIKAVKAYEEHTYLKADGKN  337

Query  920   FAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIE  1099
             FAVL  VSTPDV YGSTF+VE+LY + PG  L +GE+ + L++SW + F +STMMK +IE
Sbjct  338   FAVLASVSTPDVIYGSTFRVEILYVVTPGLELPTGEQCSRLIVSWRMNFLQSTMMKGMIE  397

Query  1100  GGTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYFCNFT  1276
              G +QG+K+SF +++  L+Q  K    A++  N    LA+L +E  SD  LA +YF NFT
Sbjct  398   NGARQGVKESFDQYATLLSQTVK---PADLSSNKEQALASLHAEPESDWRLAVQYFANFT  454

Query  1277  VVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHF  1456
             V +T F+ LY  +HI L+  + +QGLEF GLDLPDS+GE + C + VL  E++  +I+ F
Sbjct  455   VFTTVFMGLYVLVHIWLAAPSTIQGLEFGGLDLPDSIGEFVFCAVFVLQGERMLGIISRF  514

Query  1457  VEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQL  1636
             ++AR ++GSDHG++A G+GW+LTVALIEG+NLAS+D +G  DP+VVFTCNGK+RTSS++ 
Sbjct  515   IKARAQKGSDHGIKAQGNGWLLTVALIEGSNLASVDSSGLSDPYVVFTCNGKTRTSSIKF  574

Query  1637  QTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWL  1816
             Q  +P WNEI EF+  ++PPS++DV V+DFDGPFD A SLGHAEINFLK   A+LAD+WL
Sbjct  575   QKSNPIWNEIFEFDAMDDPPSVMDVVVYDFDGPFDDAESLGHAEINFLKANIADLADIWL  634

Query  1817  PLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFG  1996
             PL GK++ + QSKLHLRIFL+N  G    ++ L+KMEKEVGKK+NLRSP  NS FQK FG
Sbjct  635   PLEGKLSLACQSKLHLRIFLDNTKGGNVAKEYLSKMEKEVGKKINLRSPQTNSAFQKLFG  694

Query  1997  LPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPP  2176
             LP EEFLINDF+C LKRK+PLQGR+FLS RI+GF+ANLFG KT+FFFLWEDIE+I V+PP
Sbjct  695   LPIEEFLINDFTCHLKRKMPLQGRLFLSARIIGFHANLFGTKTRFFFLWEDIEDIQVIPP  754

Query  2177  SFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRA  2356
             +FS+MGSP +VI L K RG DAR+GAK+ DE GRL F F SFVSF  A RTIMALWK R+
Sbjct  755   TFSSMGSPIIVITLRKGRGVDARHGAKTQDENGRLKFYFQSFVSFNVAHRTIMALWKARS  814

Query  2357  CIPDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGD  2536
               P+QK +  EEQ   D  +++ EE+GS+L ++DVSMS++YS  L +    LME+F+GG+
Sbjct  815   LSPEQKVEFVEEQS--DSKSLISEESGSFLGLDDVSMSEIYSCSLSIPASYLMEIFSGGE  872

Query  2537  LEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAG  2716
             L+ +VM K G LNY  + W      + ER V YK  + IS +  EVTSTQ++S   +  G
Sbjct  873   LDRRVMEKLGYLNYSYTPWVSENSLISERAVYYKFEKRISSYKGEVTSTQQRSPLPDGKG  932

Query  2717  WILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNI  2896
             W++ E+M +HGVP  D++ + LRY++E        CR  V  G+ WLK++K + R+TKNI
Sbjct  933   WLVEELMNLHGVPLGDYFNIHLRYQIEDLPPKAKGCRVQVLFGMEWLKSSKNQKRLTKNI  992

Query  2897  VRKFSQRVKEMIEFVGREVFLSS  2965
             ++   +R+        +E+  +S
Sbjct  993   LQNVQERLNVTFALAEKELHQNS  1015



>ref|XP_002436905.1| hypothetical protein SORBIDRAFT_10g010850 [Sorghum bicolor]
 gb|EER88272.1| hypothetical protein SORBIDRAFT_10g010850 [Sorghum bicolor]
Length=1034

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/798 (52%), Positives = 578/798 (72%), Gaps = 7/798 (1%)
 Frame = +2

Query  563   QETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFR  742
             Q+   S T +F E +K   S+ EG+EMPENL GG++LDQ YA+ P D N LLF+P S F 
Sbjct  237   QDHDASATITFDELLKSFSSQHEGKEMPENLSGGVVLDQVYAVAPSDLNTLLFSPSSDFL  296

Query  743   RELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEF  922
             +  AE+QGT  ++   W  ++D +  L RVV+YTK  TKLVK+V+ATE+ TYLK DG+ F
Sbjct  297   QSFAEMQGTTGLEVQQWRLENDGE-ILRRVVSYTKAPTKLVKAVKATEDMTYLKADGEMF  355

Query  923   AVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEG  1102
             AV  DVSTPDVP+G+TF+VE+L  I+PGP L   E+S+ L++SW + F +STMMK++IE 
Sbjct  356   AVFADVSTPDVPFGNTFRVEVLTCILPGPELPDDEKSSRLMVSWRINFVQSTMMKSMIES  415

Query  1103  GTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVV  1282
             G +QG KD++ +FS  LA++ + + + +   +  +L+++  E  SD +LA   F NF ++
Sbjct  416   GAKQGFKDNYIQFSELLAKYFRPVDAKDTTASNEVLSSVQPEQESDWKLAFRIFGNFALL  475

Query  1283  STAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVE  1462
             S+ F  +Y S HI+L+  + +QGLEF GLDLPDS GE++ CG+LVL  ++V  MIA F++
Sbjct  476   SSVFAFVYVSAHIILASPSIIQGLEFPGLDLPDSAGEVVVCGVLVLQGKRVLNMIARFIQ  535

Query  1463  ARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQT  1642
             A+ +RG DHGV+A G+GW+LTVAL+EGTNLA+   +G+ DP+VVFTCNGK++TSS++  T
Sbjct  536   AKRKRG-DHGVKAQGNGWLLTVALMEGTNLAATKSSGYSDPYVVFTCNGKTKTSSIKFHT  594

Query  1643  LDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTS-AELADLWLP  1819
             L+PQWNEI EF+  E+PPS++++ V+DFDGPFD+  SLGHAE+NFLK+ + +ELAD+W+P
Sbjct  595   LEPQWNEIFEFDAMEDPPSVMEIHVYDFDGPFDEVASLGHAEVNFLKYNNISELADIWIP  654

Query  1820  LGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGL  1999
             L GK+AQ+ QSKLHLRIFLNN  G E ++D L KMEKEVGKK+ +RSPH N  FQK F L
Sbjct  655   LKGKLAQACQSKLHLRIFLNNTRGNEVVKDYLDKMEKEVGKKIAMRSPHTNLAFQKIFSL  714

Query  2000  PPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPS  2179
             PP+EFLINDF+C LKRK+  QGR+FLS RI GFY NLFGHKTKFFFLWEDIE+I ++P +
Sbjct  715   PPDEFLINDFTCHLKRKMLTQGRLFLSPRIFGFYTNLFGHKTKFFFLWEDIEDILLVPAT  774

Query  2180  FSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRAC  2359
              S+MGSPSLVIIL K RG DA++GAK +D EGRL F F SFVSF  A +TIMALWK R+ 
Sbjct  775   LSSMGSPSLVIILRKGRGMDAKHGAKQLDSEGRLKFHFQSFVSFSVAHKTIMALWKARSL  834

Query  2360  IPDQKAQIAEEQ-QYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGD  2536
              P+QK Q+ EE+ + +D  N   EE  S+L +ED  MS V+S   P +  +LM +F GG 
Sbjct  835   TPEQKVQLVEEESETEDFQN---EEGESFLGIEDAKMSGVFSSTKPFDVSTLMGIFEGGP  891

Query  2537  LEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAG  2716
             LE +VM K GC++Y  + WE +  D+Y+R+V YK ++  +  G E  STQ+KS   N  G
Sbjct  892   LECRVMEKVGCMDYSVTEWEPVRADIYQRQVHYKFDKKSARHGGEAMSTQQKSPLPNKNG  951

Query  2717  WILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNI  2896
             W++ E+M + G+P  + + + +RY++E+ ++ + +C   V +G++WLK+ K   +IT+++
Sbjct  952   WLVEEVMTLEGIPVGECFNLHIRYQLENNASKQKTCTIQVSIGIVWLKSCKNRKKITQDV  1011

Query  2897  VRKFSQRVKEMIEFVGRE  2950
                 S R+K++   + +E
Sbjct  1012  ATSASSRLKKIFSQLEKE  1029



>ref|XP_010096488.1| C2 and GRAM domain-containing protein [Morus notabilis]
 gb|EXB64608.1| C2 and GRAM domain-containing protein [Morus notabilis]
Length=988

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/726 (58%), Positives = 548/726 (75%), Gaps = 5/726 (1%)
 Frame = +2

Query  605   IKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQE  784
             +K+++SR +G ++P NL GG+LLDQ YA+ P D N LLF+ DS F + +AELQG+ ++Q 
Sbjct  242   MKIMESRDQGSDIPSNLPGGVLLDQLYAIAPWDLNSLLFSLDSSFPKSIAELQGSTELQL  301

Query  785   GPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYG  964
             G W + +  +S L RV+TY K ATKL+K+V+ATEEQTYL+ DGK FAVL  VSTPDV YG
Sbjct  302   GSWKFDNGGES-LKRVITYIKAATKLIKAVRATEEQTYLRADGKVFAVLSSVSTPDVMYG  360

Query  965   STFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFS  1144
             STFK E+LY I PGP   SGE+++ LVISW   F +STMMK +IE G +QGLK+SF +++
Sbjct  361   STFKTEVLYCITPGPECSSGEQTSRLVISWRTNFLQSTMMKGMIENGARQGLKESFEQYA  420

Query  1145  RFLAQHCKVITSAEVLDNG-HLLATL-PSEHPSDLELAREYFCNFTVVSTAFLVLYFSIH  1318
               L+Q+ K + S EV  N   +LA+L  +E  SD +LA +YF NFTV  T F+ LY  +H
Sbjct  421   SLLSQNVKPVDSKEVGSNKEQVLASLQAAESQSDWKLAVQYFANFTVFFTFFMGLYVLVH  480

Query  1319  ILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVR  1498
             I L+R   +QGLEF GLDLPDS+GE I CG+LVL  E+V  +I+ F++AR ++GSDHGV+
Sbjct  481   IWLARPDAIQGLEFVGLDLPDSIGEFIVCGVLVLQAERVLGLISRFMQARGQKGSDHGVK  540

Query  1499  AHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFE  1678
             A GDGW+LTVALIEG+NLA++D +GF DP+VVFTCNGK+RTSS++ Q  +PQWNEI EF+
Sbjct  541   AQGDGWLLTVALIEGSNLAAVDASGFSDPYVVFTCNGKTRTSSIKFQKSNPQWNEIFEFD  600

Query  1679  PAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKL  1858
               +EPPS+LDVEV DFDGPFD A SLGHAEINF+K   ++LAD+W+PL GK+AQ+ QSKL
Sbjct  601   AMDEPPSVLDVEVCDFDGPFDDATSLGHAEINFVKTNISDLADVWVPLQGKLAQACQSKL  660

Query  1859  HLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCS  2038
             HLRIFL+N  G   + D L+KMEKEVGKK+N+RSP  NS FQK FGLPPEEFLINDF+C 
Sbjct  661   HLRIFLDNTRGGNVVEDYLSKMEKEVGKKINVRSPQTNSAFQKLFGLPPEEFLINDFTCH  720

Query  2039  LKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIIL  2218
             LKRK+PLQGR+FLS RI+GF+ANLFGHKTKFFFLWEDIE+I + PP+ S+MGSP +VI L
Sbjct  721   LKRKMPLQGRLFLSPRIIGFHANLFGHKTKFFFLWEDIEDIQIDPPTLSSMGSPIIVITL  780

Query  2219  HKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQ  2398
              + RG DAR+GAK+ D EGRL F FHSFVSF  A+RTIMALWK R+  P+QK +I EE+ 
Sbjct  781   WQGRGIDARHGAKTRDAEGRLKFHFHSFVSFNAANRTIMALWKARSLSPEQKVRIVEEES  840

Query  2399  YKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNY  2578
               +  ++  +E+GS+L ++DV MS+VYS  L       ME F+GG+LE KVM K+G L+Y
Sbjct  841   --EAKSLQSDESGSFLGLDDVIMSEVYSSVLSAPTSFFMEFFSGGELERKVMEKAGFLDY  898

Query  2579  VTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPF  2758
               + WE  + DVYER+  YK  + IS +G E  STQ++   ++  GW + E+M +HGVP 
Sbjct  899   SQTPWESEKGDVYERQTCYKFAKSISRYGGEARSTQQRIPLSDRNGWTIEEVMTLHGVPL  958

Query  2759  SDHYQV  2776
              DH+ V
Sbjct  959   GDHFNV  964



>ref|XP_007154067.1| hypothetical protein PHAVU_003G088200g [Phaseolus vulgaris]
 gb|ESW26061.1| hypothetical protein PHAVU_003G088200g [Phaseolus vulgaris]
Length=1025

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/789 (53%), Positives = 567/789 (72%), Gaps = 7/789 (1%)
 Frame = +2

Query  587   QSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQG  766
             ++F E +K +QS  +G E+P NL GG+L+DQ Y + P+D N LLF+PDS F + LA+LQG
Sbjct  239   ETFEETMKKIQSAEQGSEIPSNLSGGVLIDQLYIVAPRDLNALLFSPDSNFPKALADLQG  298

Query  767   TKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVST  946
             T ++Q GPW  ++  ++   R ++Y K  TKL+K+V+  E+QTYLK DGK FAV   VST
Sbjct  299   TTELQVGPWKLENGVETS-KRSLSYLKAPTKLIKAVKGYEDQTYLKADGKNFAVFACVST  357

Query  947   PDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKD  1126
             PDV YGSTFKVELLY I PGP L SGE+ + LVISW + F +STMMK +IE G +QG+++
Sbjct  358   PDVMYGSTFKVELLYVITPGPELPSGEQCSRLVISWRMIFVQSTMMKGMIESGARQGMRE  417

Query  1127  SFSEFSRFLAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYFCNFTVVSTAFLVL  1303
             SF +++  L Q  K + S ++  +    LATL  E  SD  LA +Y  NF V  T  +V+
Sbjct  418   SFDQYAILLCQTVKAVVSKDLGSSKEQALATLRPEPQSDWRLALQYLANFKVFLTFLMVM  477

Query  1304  YFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGS  1483
                +H+ L+  + +QGLEF  LDLPDS+GE++ C ILVL  E+V  +I+ F++AR R+GS
Sbjct  478   SVFVHMWLASPSGIQGLEFFWLDLPDSIGELVVCVILVLQGEKVVGLISRFMQARARKGS  537

Query  1484  DHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNE  1663
             DHG++A G+GW+LTVA+IEG+NLA+LD   F DP+VVFTCNGK+RTSSV+ +  +P WNE
Sbjct  538   DHGIKAQGEGWMLTVAIIEGSNLATLDSKTFCDPYVVFTCNGKTRTSSVKFKKSNPLWNE  597

Query  1664  ILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQS  1843
             I EF+  ++PPS+LDV+V+DFDGPFD   +LGH EINFLK   ++LAD+W+ L GK AQ+
Sbjct  598   IFEFDAMDDPPSVLDVDVYDFDGPFDDVTALGHVEINFLKTNISDLADIWVSLEGKWAQA  657

Query  1844  SQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIN  2023
             SQSKLHLRIFLNN    + ++  ++KMEKEVGKK+NLRSP  NS FQK FGLPPEEFLIN
Sbjct  658   SQSKLHLRIFLNNTRRGDVVKHYISKMEKEVGKKINLRSPQTNSAFQKLFGLPPEEFLIN  717

Query  2024  DFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPS  2203
             DF+C LKRK+PLQGR+F+S RI+GF+ANLFGHKTKFF LWEDIE+I ++PP+FS+MGSP 
Sbjct  718   DFTCHLKRKMPLQGRLFVSARIIGFHANLFGHKTKFFLLWEDIEDIQIIPPTFSSMGSPI  777

Query  2204  LVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQI  2383
             +V+ L   RG DAR+GAK+ DE+GRL F F SFVSF  A+RTIMALWK R+  P+QK Q+
Sbjct  778   IVVTLWPGRGVDARHGAKTQDEDGRLKFRFQSFVSFNVANRTIMALWKARSLSPEQKVQL  837

Query  2384  AEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKS  2563
              EE    +  ++  +E+GS++ + DVSMS+V+S  L +    LME+F+GG+L+   M KS
Sbjct  838   VEEDS--ETKSLRSDESGSFIGLGDVSMSEVHSGALSVPASFLMELFSGGELDRMFMEKS  895

Query  2564  GCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAI  2743
             GC+NY  + W      VYER V YK  + IS + VEVTSTQ+KS+     GW+L E+M  
Sbjct  896   GCVNYSYTPWVSENSGVYERAVYYKFEKRISRYRVEVTSTQQKSI-LEGKGWLLQEVMNF  954

Query  2744  HGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVK  2923
             HGVP  D + + +RY++E  +    +C+  V  G  WLK+TK + RITKNI++   +R+K
Sbjct  955   HGVPLGDFFNLHIRYQIEDLTP--KACKVQVLFGTEWLKSTKHQKRITKNILKNLQERLK  1012

Query  2924  EMIEFVGRE  2950
                  V +E
Sbjct  1013  LTFSLVEKE  1021



>ref|XP_008464295.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 isoform 
X2 [Cucumis melo]
Length=876

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/805 (54%), Positives = 579/805 (72%), Gaps = 10/805 (1%)
 Frame = +2

Query  527   LSSIPSDYEDNVQETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDF  706
             +S IP      V+   ++   +F EA+K+L+S+ +  E P N  G I++DQ YA+ P D 
Sbjct  64    ISEIPPSEILEVKSEDQTSMATFEEAVKVLESKDQETETPSNFPG-IMVDQLYAISPSDL  122

Query  707   NMLLFAPDSQFRRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATE  886
             N LLF+  S F + LA+LQGT ++Q G W +++  +S L R V+Y K  TKL+K+V+A E
Sbjct  123   NSLLFSSASSFLQSLADLQGTTELQLGNWKFENGGES-LKRTVSYLKAPTKLIKAVKAFE  181

Query  887   EQTYLKGDGKEFAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKF  1066
             EQ+YLK DG  +AVL  VSTPDV YG+TFKVE+LY I PGP L S E+S+ LVISW + F
Sbjct  182   EQSYLKADGNVYAVLAVVSTPDVMYGNTFKVEILYCITPGPELPSEEKSSRLVISWRMNF  241

Query  1067  CKSTMMKTVIEGGTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNG-HLLATLPSEHP-SD  1240
              +STMMK +IE G +QG+KD+F +++  L+Q    +    +  N    LA+L +  P S 
Sbjct  242   LQSTMMKGMIENGARQGIKDNFDQYASLLSQIVPPVDQKSIGSNKEQALASLEAPPPQST  301

Query  1241  LELAREYFCNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVL  1420
              +LA +YF N TVV T F+ LY  +HI L+  + +QGLEF GLDLPDS+GE I CG+LVL
Sbjct  302   FKLAVQYFANCTVVFTTFMALYVLVHIWLAAPSTIQGLEFVGLDLPDSIGEFIVCGVLVL  361

Query  1421  HLEQVYRMIAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFT  1600
               E+V  +I+ F+ AR + GSDHG++A G+GW+LTVALIEG +LA++D +G  DP+VVFT
Sbjct  362   QGERVLGLISRFMRARQQTGSDHGIKAQGNGWLLTVALIEGCSLAAVDSSGLSDPYVVFT  421

Query  1601  CNGKSRTSSVQLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFL  1780
             CNGK++ SS++ Q  DPQWNEI EF+  +EPPS+L VEV+DFDGPFD+A SLG+AEINFL
Sbjct  422   CNGKTKNSSIKFQKSDPQWNEIFEFDAMDEPPSVLGVEVYDFDGPFDEATSLGYAEINFL  481

Query  1781  KHTSAELADLWLPLGGKIAQSSQSKLHLRIFLNNNNG--VETIRDNLTKMEKEVGKKLNL  1954
             + + ++LAD+W+PL GK+AQ+ QSKLHLRIFL+N  G  V  +++ L+KMEKEVGKK+NL
Sbjct  482   RTSISDLADIWVPLQGKLAQTCQSKLHLRIFLDNTRGSHVNIVKEYLSKMEKEVGKKINL  541

Query  1955  RSPHRNSTFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFF  2134
             RSP  NS FQK FGLP EEFLINDF+C LKRK+P+QGRIFLS R++GF+AN+FGHKTKFF
Sbjct  542   RSPQSNSAFQKLFGLPAEEFLINDFTCHLKRKMPIQGRIFLSARVIGFHANIFGHKTKFF  601

Query  2135  FLWEDIEEINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFG  2314
             FLWEDIE+I V  P+ S+MGSP +VI L   RG DARNGAK++DEEGRL F FHSFVSFG
Sbjct  602   FLWEDIEDIQVAAPTLSSMGSPIIVITLRAGRGLDARNGAKTLDEEGRLKFHFHSFVSFG  661

Query  2315  GASRTIMALWKTRACIPDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLP  2494
              A RTIMALWK R+  P+QK +I EE+  + +  +  EE+GS+L   +VSMS+V S  L 
Sbjct  662   VAHRTIMALWKARSLSPEQKVRIVEEES-EAKGCLQTEESGSFLGPSEVSMSEVLSTTLS  720

Query  2495  MNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEV  2674
             +     ME+FNG DLE KVM K+GCLNY  + WE  + +VYER++ Y  ++ IS + VEV
Sbjct  721   VPTNFAMELFNGADLERKVMEKAGCLNYSFTPWESEKENVYERQIYYVFDKRISHYRVEV  780

Query  2675  TSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYV--GV  2848
             TSTQ++    N  GW++ E++ +HGVP  D++ V LRY++E   +    C C V V  G+
Sbjct  781   TSTQQRHSLPNKNGWLVEEVLTLHGVPLGDYFNVHLRYQIEDLPSKLKGC-CSVLVSFGM  839

Query  2849  MWLKNTKLEDRITKNIVRKFSQRVK  2923
              W K+TK + R+TKNI++    R+K
Sbjct  840   AWQKSTKHQKRMTKNILKNLQDRLK  864



>ref|XP_003637602.1| Protein kinase C beta type [Medicago truncatula]
Length=1038

 Score =   870 bits (2247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/814 (51%), Positives = 582/814 (71%), Gaps = 21/814 (3%)
 Frame = +2

Query  560   VQETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQF  739
             V+   +S  ++F E ++ +QS  +G E+P NL GG+L+DQ Y +  +D N LLF+PDS F
Sbjct  225   VKVEDQSSNETFEEIVRKMQSADQGSEIPSNLPGGVLIDQLYVIATEDLNALLFSPDSNF  284

Query  740   RRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKE  919
              + LA++QGT ++Q  PW  +++NKS L R +TY K ATKL+K+++  EEQTYLK DGK 
Sbjct  285   PKSLADIQGTTELQVSPWKLENENKS-LKRSLTYIKAATKLLKAIKGYEEQTYLKADGKN  343

Query  920   FAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIE  1099
             FAVL  VSTPDV YGSTFKVELLY I PGP L S E+ + LVISW + F +STMMK +IE
Sbjct  344   FAVLASVSTPDVMYGSTFKVELLYLITPGPELSSEEQCSRLVISWRMNFLQSTMMKGMIE  403

Query  1100  GGTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYFCNFT  1276
              G +QG+K+SF +++  L+Q  K + S ++      +LA+L +E  SD +LA +YF NFT
Sbjct  404   NGARQGMKESFDQYAILLSQTAKPVDSKDLGSTKEQVLASLKAEPQSDWKLAMQYFANFT  463

Query  1277  VVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHF  1456
              +ST  + LY  IH+ L+    +QGLEF GLDLPDS+ E + C +LVL  +++  +I+ F
Sbjct  464   FISTFLMGLYVLIHMWLAAPIMIQGLEFFGLDLPDSICEFVVCAVLVLQGQRMLGLISRF  523

Query  1457  VEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQL  1636
             + AR R+GSDHG++A GDGW+LTVALIEG+N+A++D  G  +P+VVFTCNGK+R+SS++ 
Sbjct  524   IRARRRKGSDHGIKAQGDGWLLTVALIEGSNIAAVDSGGLCNPYVVFTCNGKTRSSSIKF  583

Query  1637  QTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWL  1816
             Q  +P WNEI EF+  ++PPS+L+VEV+DFDGPFD+  S+GH EINFLK   ++LA+LW+
Sbjct  584   QKSNPSWNEIFEFDAMDDPPSVLEVEVYDFDGPFDEDASVGHIEINFLKTNISDLAELWV  643

Query  1817  PLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFG  1996
              L GK+A + QSKLHL++FL+N  G   ++  ++KMEKEVGKK+NLRSP  NS FQK FG
Sbjct  644   SLEGKLALTCQSKLHLKVFLDNTRGGNVVKHYISKMEKEVGKKINLRSPQTNSAFQKLFG  703

Query  1997  LPPEEFLINDFSCSLKRKLPLQ-----------GRIFLSTRIVGFYANLFGHKTKFFFLW  2143
             LPPEEFLINDF+C LKRK+PLQ           GR+F+S RI+GF+ANLFGHKTKFF LW
Sbjct  704   LPPEEFLINDFTCHLKRKMPLQVQLLSYVILKAGRLFVSARILGFHANLFGHKTKFFLLW  763

Query  2144  EDIEEINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGAS  2323
             EDIE+I V+PP+FS+MGSP +VI L + RG DA++GAK  DE+GRL F F SFVS+  A+
Sbjct  764   EDIEDIQVIPPTFSSMGSPIIVITLRQGRGADAKHGAKKQDEQGRLKFHFQSFVSYNVAN  823

Query  2324  RTIMALWKTRACIPDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNH  2503
             RTIMALWK R+   +QK ++ E+    +  +V  EE+GS+L  +DVSMS+V+S  LP+  
Sbjct  824   RTIMALWKARSLSIEQKVRLVEDD--PETRSVASEESGSFLGGDDVSMSEVHSCALPVPV  881

Query  2504  KS-----LMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGV  2668
              S      M++F+GG+L+ +VM KSGC++Y  + W   +  VYER + YK  + IS + V
Sbjct  882   ISFSVSFFMDLFSGGELDCRVMEKSGCVSYSYTPWVSEKKGVYERAIYYKSEKRISRYKV  941

Query  2669  EVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGV  2848
             EVTSTQ+K++  +  GW++ E+M  HGVP  D++ + LRY+++        C+  V  G+
Sbjct  942   EVTSTQQKTI-LDGNGWLVEEVMNFHGVPLGDYFNLHLRYQIDDLPPKAKGCKVQVLFGI  1000

Query  2849  MWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGRE  2950
              WLKNTK + RITKNI++   +R+K ++  V +E
Sbjct  1001  EWLKNTKHQKRITKNILKNLQERIKLIVSLVEKE  1034



>ref|XP_002889456.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65715.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=1872

 Score =   895 bits (2314),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/805 (53%), Positives = 585/805 (73%), Gaps = 19/805 (2%)
 Frame = +2

Query  578   SQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAE  757
             S + SF E +K+++S+ +G E P NL GG+++DQ + + P D N+LLFA DS       E
Sbjct  1059  SSSASFEELLKVMESKDQGSEPPSNLPGGVVVDQLFMISPSDLNILLFASDSSLYASFTE  1118

Query  758   LQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVD  937
             LQGT +VQ GPW  ++D +S + RVV+Y K  TKL+K+V+ TEEQTYLK DG+ +AVL  
Sbjct  1119  LQGTTEVQIGPWKGENDGES-VKRVVSYLKAPTKLIKAVKGTEEQTYLKADGEVYAVLAS  1177

Query  938   VSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQG  1117
             V+TPDVP+GSTFKVE+LY I PGP L SGE+ + LV+SW + F +STMMK +IE G +QG
Sbjct  1178  VATPDVPFGSTFKVEVLYCISPGPELPSGEQCSRLVVSWRLNFLQSTMMKGMIENGARQG  1237

Query  1118  LKDSFSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAF  1294
             LKD+F +++  LAQ  K + S ++ ++    L++L +E  SD +LA +YF NFTV ST  
Sbjct  1238  LKDNFEQYANLLAQSVKPVDSKDIGVNKEQALSSLQAEPQSDWKLAVQYFANFTVFSTFL  1297

Query  1295  LVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLR  1474
             + +Y  +HI+ +  + +QGLEF+GLDLPDS+GE +  G+LVL  E+V ++I+ F++AR +
Sbjct  1298  IGIYVFVHIVFAIPSAIQGLEFNGLDLPDSIGEFVVSGVLVLQCERVLQLISRFMQARKQ  1357

Query  1475  RGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQ  1654
             +GSDHG++AHGDGW+LTVALIEG +LA++DP+G  DP++VFT NGK+RTSS++ Q  +PQ
Sbjct  1358  KGSDHGIKAHGDGWLLTVALIEGVDLAAVDPSGHCDPYIVFTSNGKTRTSSIKFQKSNPQ  1417

Query  1655  WNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKI  1834
             WNEI EF+   +PPS+L+VEVFDFDGPFD+A SLG+AEINF++   ++LAD+W+PL GK+
Sbjct  1418  WNEIFEFDAMADPPSVLNVEVFDFDGPFDEAVSLGNAEINFVRSNISDLADVWVPLQGKL  1477

Query  1835  AQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKK-------------LNLRSPHRNS  1975
             AQ+ QSKLHLRIFL++  G + +RD L KMEKEVGKK             +N+RSP  NS
Sbjct  1478  AQACQSKLHLRIFLDHTGGGDVVRDYLNKMEKEVGKKCCYAFLSAESKFQINVRSPQTNS  1537

Query  1976  TFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIE  2155
              FQK FGLP EEFLINDF+C LKRK+PLQGR+FLS RIVGFYA+LFG+KTKFFFLWEDIE
Sbjct  1538  AFQKLFGLPQEEFLINDFTCHLKRKMPLQGRLFLSARIVGFYASLFGNKTKFFFLWEDIE  1597

Query  2156  EINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIM  2335
             +I VLPP+ ++MGSP +V+ L  +RG DAR GAK+ DEEGRL F FHSFVSF  A +TIM
Sbjct  1598  DIQVLPPTLASMGSPIIVMTLRPNRGMDARIGAKTHDEEGRLKFHFHSFVSFNVAQKTIM  1657

Query  2336  ALWKTRACIPDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLM  2515
             ALWK ++  P+QK Q  EE+    E  +  EE+G +L V+DV  S+V+S+ LP+     M
Sbjct  1658  ALWKAKSLTPEQKVQAVEEE---SEQKLQSEESGLFLGVDDVRFSEVFSLTLPVPVSFFM  1714

Query  2516  EMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKS  2695
             E+F GG+++ K M ++GC +Y  S WE  + DVYER+  Y+  R IS +  EVTSTQ+KS
Sbjct  1715  ELFGGGEMDRKAMERAGCQSYSCSPWESEKADVYERQTYYRDKR-ISRYRGEVTSTQQKS  1773

Query  2696  VHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLE  2875
             +     GW++ E+M +HGVP  D++ + LRY++E  ++   +    VY G+ WLK+T+ +
Sbjct  1774  LVPEKNGWLVEEVMTLHGVPLGDYFNLHLRYQMEESASKPKTTYVRVYFGIEWLKSTRHQ  1833

Query  2876  DRITKNIVRKFSQRVKEMIEFVGRE  2950
              R+TKNI+     R+K    F+ +E
Sbjct  1834  KRVTKNILVNLQDRLKMTFGFLEKE  1858



>gb|KHG07899.1| hypothetical protein F383_03817 [Gossypium arboreum]
Length=842

 Score =   859 bits (2219),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/840 (52%), Positives = 576/840 (69%), Gaps = 48/840 (6%)
 Frame = +2

Query  431   KSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETT---RSQTQSFCE  601
             KS+AG + ++F+KN +++ ++           L+ +P +   +V +     +  + SF E
Sbjct  47    KSLAGRIAQIFNKNSDTAVASSTAGID-----LTEMPENSRADVADEKPDDQLSSVSFEE  101

Query  602   AIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
             A+K ++S+ +G E+P NL GG+L+DQ Y + P + N LLF+ DS F + LAE+QG+KD Q
Sbjct  102   AMKTMESKDQGSEIPSNLPGGVLVDQPYVVSPAELNSLLFSSDSSFPKSLAEMQGSKDPQ  161

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
              GPW ++ D  S L RV TY K  TK++K+ +ATEEQTY++ D K FA+LV VSTPDVPY
Sbjct  162   LGPWKFE-DGDSSLKRVYTYIKAPTKMIKATKATEEQTYIRADAKSFAILVVVSTPDVPY  220

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             GSTFK ELLY I PGP L SGE+S HLVISW + F +STMMK +IE G +QGLK+ F +F
Sbjct  221   GSTFKTELLYCITPGPELPSGEQSAHLVISWRMNFLQSTMMKGMIENGARQGLKEGFEQF  280

Query  1142  SRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIH  1318
             +  L Q  K + S ++ L+   +L +L +E  SD +LA +YF NFTVVST F+ LY  +H
Sbjct  281   TTLLTQSVKPVDSKDIGLNKEQILGSLQAEPKSDWKLAFQYFANFTVVSTVFMALYVIVH  340

Query  1319  ILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVR  1498
             I L+  + +QGLEF GLDLPDS+GE I CG+LVL                          
Sbjct  341   IWLAAPSTIQGLEFVGLDLPDSIGEFIVCGVLVLQ-------------------------  375

Query  1499  AHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFE  1678
                      VALIEG+NLA++D +G+ DP+VVFTCNGKSRTSS++ Q   PQWNEI EF+
Sbjct  376   ---------VALIEGSNLATVDSSGYCDPYVVFTCNGKSRTSSIKFQKSSPQWNEIFEFD  426

Query  1679  PAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKL  1858
               EEPPS+LD+EVFDFDG FD+A SLG AEINFLK   ++LAD+W+PL GK AQ+ QSKL
Sbjct  427   AMEEPPSVLDIEVFDFDGLFDEATSLGQAEINFLKSNISDLADVWIPLQGKQAQACQSKL  486

Query  1859  HLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCS  2038
             HLRIFL+N  G   +++ L+KMEKEVGKK+NLRSP  NS FQK FGLPPEEFLINDF+C 
Sbjct  487   HLRIFLDNTRGGHVVKEYLSKMEKEVGKKINLRSPQTNSAFQKLFGLPPEEFLINDFTCH  546

Query  2039  LKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIIL  2218
             LKRK+PLQGR+FLS RI+GF+AN+FGHKTKF+FLWEDIE+I V PP+ ++MGSP +VI L
Sbjct  547   LKRKMPLQGRLFLSARILGFHANIFGHKTKFYFLWEDIEDIQVSPPTLASMGSPIIVITL  606

Query  2219  HKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQ  2398
                RG DAR+GA++ D EGRL F F SFVSF  A RTIMALWK R+  P+QK QI EE+ 
Sbjct  607   RLGRGLDARHGARTQDREGRLKFNFQSFVSFSVAHRTIMALWKARSLSPEQKVQIVEEES  666

Query  2399  YKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNY  2578
                   +  EE+GS+L +EDVSMS++YS  L +   S +E+F GG+++ K M ++GCLNY
Sbjct  667   --KTKCLQTEESGSFLGLEDVSMSEIYSTTLSVPISSFIEIFGGGEMDRKAMERAGCLNY  724

Query  2579  VTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPF  2758
               S W+    DVYER++ ++ ++ +S F  EVTSTQ+KS   +  GW++ E+M +HGVP 
Sbjct  725   SCSPWDSESADVYERQIYFRFDKRVSRFRGEVTSTQQKSPLPDKKGWLIEEVMTLHGVPL  784

Query  2759  SDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEF  2938
              D++ + LRY++E   A    C   V  G+ WLK+TK   RI KNI+     R+KE    
Sbjct  785   GDYFNLHLRYQIEDLKA--KGCSVRVLTGIAWLKSTKHRKRIAKNILSNLEDRLKEFFRL  842



>ref|XP_006373576.1| hypothetical protein POPTR_0016s00550g [Populus trichocarpa]
 gb|ERP51373.1| hypothetical protein POPTR_0016s00550g [Populus trichocarpa]
Length=960

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/740 (56%), Positives = 556/740 (75%), Gaps = 13/740 (2%)
 Frame = +2

Query  575   RSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELA  754
             +S + +F E +K ++SR  G E+P+NL GG+L+DQ+Y +   D N LLF+PDS F R L+
Sbjct  226   QSSSDNFEELMKEMKSRDVGSEVPKNLPGGVLVDQSYLIATPDLNSLLFSPDSSFARSLS  285

Query  755   ELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLV  934
             +  G  + Q GPW +++ + S L RV+TY +  +KLV +V+A+E+Q Y+K DGK FA+L 
Sbjct  286   DFLGNSEQQFGPWKFENGSGS-LKRVITYVRAPSKLVGAVKASEDQIYVKVDGKTFAILN  344

Query  935   DVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQ  1114
              VSTPDV YGSTFKVELLY I PGP L SGEE++HLVISW + F +STM K++IE G + 
Sbjct  345   CVSTPDVMYGSTFKVELLYCITPGPELPSGEETSHLVISWRMNFLQSTMFKSMIENGARA  404

Query  1115  GLKDSFSEFSRFLAQHCKVITSAEVLDNG----HLLATLPSEHPSDLELAREYFCNFTVV  1282
             GLKDSF +FS FL+Q  K +   ++ D G     +LA+L +E  SD +LA +YF NFTVV
Sbjct  405   GLKDSFEQFSTFLSQTVKPV---DLKDMGSSKEQVLASLKAEPQSDRKLAVQYFANFTVV  461

Query  1283  STAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVE  1462
             S  F+ LY  +HI L+  + +QGLEF GLDLPDS+GE++ C +L L  E+V  +++ F++
Sbjct  462   SAFFMGLYVFVHIWLAAPSAIQGLEFLGLDLPDSIGEVLVCSVLALQCERVLGLLSRFMQ  521

Query  1463  ARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQT  1642
             AR ++G+DHGV+A GDGW+LTVALIEG++L ++D +GF DP+VVFTCNGK++TSS++ Q 
Sbjct  522   ARAQKGTDHGVKAQGDGWLLTVALIEGSHLPTVDSSGFCDPYVVFTCNGKTKTSSIKFQK  581

Query  1643  LDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPL  1822
              DP WNEI EF+  ++PPS+LDV+V+DFDGPFD+A SLGH EINF+K   ++LAD+W+PL
Sbjct  582   SDPLWNEIFEFDAMDDPPSVLDVDVYDFDGPFDEAMSLGHTEINFVKSNLSDLADVWVPL  641

Query  1823  GGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLP  2002
              GK+AQ+ QSKLHLRIFLNN  G   +++ L+KMEKEVGKK+N+RSP  NS FQK FGLP
Sbjct  642   QGKLAQACQSKLHLRIFLNNTRGSNVVKEYLSKMEKEVGKKINVRSPQTNSAFQKVFGLP  701

Query  2003  PEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSF  2182
             PEEFLINDF+C LKRK+PLQGR+FLS RI+GFYANLF  KTKFFFLWEDIE+I +  P+ 
Sbjct  702   PEEFLINDFTCHLKRKMPLQGRLFLSARIIGFYANLFRQKTKFFFLWEDIEDIQIYTPTL  761

Query  2183  STMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGA-SRTIMALWKTRAC  2359
             S+MGSP +VI L + +G DAR+GAK+ID+EGRL F F SFVSF  A SRTIMALWK R+ 
Sbjct  762   SSMGSPVIVITLRQGKGMDARHGAKNIDDEGRLKFHFQSFVSFNVAHSRTIMALWKARSL  821

Query  2360  IPDQKAQIAEEQQYKDENNVL-PEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGD  2536
               +QK QI EE     E  +L  EE+GS+L +EDVSMS+VY+    +    +MEMF GG+
Sbjct  822   SLEQKVQIVEEDS---ETKILQTEESGSFLGLEDVSMSEVYAASFSVPTNFVMEMFGGGE  878

Query  2537  LEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAG  2716
             L+ KVM K+GCL+Y  + WE ++ DV+ER++ Y+ ++ IS FG EVTSTQ+K   ++  G
Sbjct  879   LDRKVMEKAGCLSYSYTPWESVKTDVHERQIYYRFDKRISRFGGEVTSTQQKYPLSDRKG  938

Query  2717  WILNEIMAIHGVPFSDHYQV  2776
             W++ E+M +HGVP  D++ +
Sbjct  939   WLVEEVMTLHGVPLGDYFNI  958



>ref|XP_004139509.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Cucumis sativus]
 gb|KGN64978.1| hypothetical protein Csa_1G170510 [Cucumis sativus]
Length=1034

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/814 (54%), Positives = 581/814 (71%), Gaps = 10/814 (1%)
 Frame = +2

Query  527   LSSIPSDYEDNVQETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDF  706
             +S IP      V+   ++   +F EA+K+L+S+ +  E P N  G I++DQ YA+ P D 
Sbjct  221   ISEIPPSEILEVKSEDQTSMATFEEAMKVLESKDQESETPSNFPG-IMVDQLYAIQPSDL  279

Query  707   NMLLFAPDSQFRRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATE  886
             N LLF+ DS F + LA+LQGT ++Q G W ++ D    L R V+Y K  TKL+K+V+A E
Sbjct  280   NSLLFSSDSSFLQSLADLQGTTELQLGNWKFE-DGGESLKRTVSYLKAPTKLIKAVKAFE  338

Query  887   EQTYLKGDGKEFAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKF  1066
             EQ+YLK DG  +AVL  VSTPDV YG+TFKVE+LY I PGP L S E+S+ LVISW + F
Sbjct  339   EQSYLKADGNVYAVLAVVSTPDVMYGNTFKVEILYCITPGPELPSEEKSSRLVISWRMNF  398

Query  1067  CKSTMMKTVIEGGTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNG-HLLATLPSEHP-SD  1240
              +STMMK +IE G +QG+KD+F +++  L+Q    +    +  N    LA+L +  P S 
Sbjct  399   LQSTMMKGMIENGARQGIKDNFDQYTSLLSQTVPPVDQRSIGSNKEQALASLEAPPPQST  458

Query  1241  LELAREYFCNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVL  1420
              +LA +YF N TVV T F+ LY  +HI L+  + +QGLEF GLDLPDS+GE I CG+LVL
Sbjct  459   FKLAIQYFANCTVVFTTFMALYVLVHIWLAAPSTIQGLEFVGLDLPDSIGEFIVCGVLVL  518

Query  1421  HLEQVYRMIAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFT  1600
               E+V  +I+ F+ ARL+ GSDHG++A GDGW+LTVALIEG +LA++D +G  DP+VVFT
Sbjct  519   QGERVLGLISRFMRARLQTGSDHGIKAQGDGWLLTVALIEGCSLAAVDSSGLSDPYVVFT  578

Query  1601  CNGKSRTSSVQLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFL  1780
             CNGK++ SS++ Q  DPQWNEI EF+  +EPPS+L VEV+DFDGPFD+A SLG+AEINFL
Sbjct  579   CNGKTKNSSIKFQKSDPQWNEIFEFDAMDEPPSVLGVEVYDFDGPFDEATSLGYAEINFL  638

Query  1781  KHTSAELADLWLPLGGKIAQSSQSKLHLRIFLNNNNG--VETIRDNLTKMEKEVGKKLNL  1954
             + + ++LAD+W+PL GK+AQ+ QSKLHLRIFL+N  G  V  +++ L+KMEKEVGKK+NL
Sbjct  639   RTSISDLADIWVPLQGKLAQTCQSKLHLRIFLDNTRGSHVNIVKEYLSKMEKEVGKKINL  698

Query  1955  RSPHRNSTFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFF  2134
             RSP  NS FQK FGLP EEFLINDF+C LKRK+P+QGRIFLS R++GF+AN+FGHKTKFF
Sbjct  699   RSPQSNSAFQKLFGLPAEEFLINDFTCHLKRKMPIQGRIFLSARVIGFHANIFGHKTKFF  758

Query  2135  FLWEDIEEINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFG  2314
             FLWEDIE+I V  P+ S+MGSP +VI L   RG DAR+GAK++DEEGRL F FHSFVSFG
Sbjct  759   FLWEDIEDIQVAAPTLSSMGSPIIVITLRAGRGLDARSGAKTLDEEGRLKFHFHSFVSFG  818

Query  2315  GASRTIMALWKTRACIPDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLP  2494
              A RTIMALWK R+  P+QK +I EE+  + +  +  EE+GS+L   +VSMS+V S  L 
Sbjct  819   VAHRTIMALWKARSLSPEQKVRIVEEES-EAKGCLQTEESGSFLGPSEVSMSEVLSTTLS  877

Query  2495  MNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEV  2674
             +     ME+FNG DLE KVM K+GCLNY  + WE  + +VYER++ Y  ++ IS + VEV
Sbjct  878   VPTNFAMELFNGADLERKVMEKAGCLNYSFTPWESEKENVYERQIYYIFDKRISHYRVEV  937

Query  2675  TSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYV--GV  2848
             TSTQ++    N  GW++ E++ +HGVP  D++ V LRY++E   +    C C V V  G+
Sbjct  938   TSTQQRHSLPNKNGWLVEEVLTLHGVPLGDYFNVHLRYQIEDLPSKLKGC-CSVVVSFGM  996

Query  2849  MWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGRE  2950
              W K+TK + R+TKNI++    R+K     V  E
Sbjct  997   AWQKSTKHQKRMTKNILKNLHDRLKATFGLVENE  1030



>ref|XP_008464294.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 isoform 
X1 [Cucumis melo]
Length=1033

 Score =   862 bits (2228),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/805 (54%), Positives = 579/805 (72%), Gaps = 10/805 (1%)
 Frame = +2

Query  527   LSSIPSDYEDNVQETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDF  706
             +S IP      V+   ++   +F EA+K+L+S+ +  E P N  G I++DQ YA+ P D 
Sbjct  221   ISEIPPSEILEVKSEDQTSMATFEEAVKVLESKDQETETPSNFPG-IMVDQLYAISPSDL  279

Query  707   NMLLFAPDSQFRRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATE  886
             N LLF+  S F + LA+LQGT ++Q G W +++  +S L R V+Y K  TKL+K+V+A E
Sbjct  280   NSLLFSSASSFLQSLADLQGTTELQLGNWKFENGGES-LKRTVSYLKAPTKLIKAVKAFE  338

Query  887   EQTYLKGDGKEFAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKF  1066
             EQ+YLK DG  +AVL  VSTPDV YG+TFKVE+LY I PGP L S E+S+ LVISW + F
Sbjct  339   EQSYLKADGNVYAVLAVVSTPDVMYGNTFKVEILYCITPGPELPSEEKSSRLVISWRMNF  398

Query  1067  CKSTMMKTVIEGGTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNG-HLLATLPSEHP-SD  1240
              +STMMK +IE G +QG+KD+F +++  L+Q    +    +  N    LA+L +  P S 
Sbjct  399   LQSTMMKGMIENGARQGIKDNFDQYASLLSQIVPPVDQKSIGSNKEQALASLEAPPPQST  458

Query  1241  LELAREYFCNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVL  1420
              +LA +YF N TVV T F+ LY  +HI L+  + +QGLEF GLDLPDS+GE I CG+LVL
Sbjct  459   FKLAVQYFANCTVVFTTFMALYVLVHIWLAAPSTIQGLEFVGLDLPDSIGEFIVCGVLVL  518

Query  1421  HLEQVYRMIAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFT  1600
               E+V  +I+ F+ AR + GSDHG++A G+GW+LTVALIEG +LA++D +G  DP+VVFT
Sbjct  519   QGERVLGLISRFMRARQQTGSDHGIKAQGNGWLLTVALIEGCSLAAVDSSGLSDPYVVFT  578

Query  1601  CNGKSRTSSVQLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFL  1780
             CNGK++ SS++ Q  DPQWNEI EF+  +EPPS+L VEV+DFDGPFD+A SLG+AEINFL
Sbjct  579   CNGKTKNSSIKFQKSDPQWNEIFEFDAMDEPPSVLGVEVYDFDGPFDEATSLGYAEINFL  638

Query  1781  KHTSAELADLWLPLGGKIAQSSQSKLHLRIFLNNNNG--VETIRDNLTKMEKEVGKKLNL  1954
             + + ++LAD+W+PL GK+AQ+ QSKLHLRIFL+N  G  V  +++ L+KMEKEVGKK+NL
Sbjct  639   RTSISDLADIWVPLQGKLAQTCQSKLHLRIFLDNTRGSHVNIVKEYLSKMEKEVGKKINL  698

Query  1955  RSPHRNSTFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFF  2134
             RSP  NS FQK FGLP EEFLINDF+C LKRK+P+QGRIFLS R++GF+AN+FGHKTKFF
Sbjct  699   RSPQSNSAFQKLFGLPAEEFLINDFTCHLKRKMPIQGRIFLSARVIGFHANIFGHKTKFF  758

Query  2135  FLWEDIEEINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFG  2314
             FLWEDIE+I V  P+ S+MGSP +VI L   RG DARNGAK++DEEGRL F FHSFVSFG
Sbjct  759   FLWEDIEDIQVAAPTLSSMGSPIIVITLRAGRGLDARNGAKTLDEEGRLKFHFHSFVSFG  818

Query  2315  GASRTIMALWKTRACIPDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLP  2494
              A RTIMALWK R+  P+QK +I EE+  + +  +  EE+GS+L   +VSMS+V S  L 
Sbjct  819   VAHRTIMALWKARSLSPEQKVRIVEEES-EAKGCLQTEESGSFLGPSEVSMSEVLSTTLS  877

Query  2495  MNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEV  2674
             +     ME+FNG DLE KVM K+GCLNY  + WE  + +VYER++ Y  ++ IS + VEV
Sbjct  878   VPTNFAMELFNGADLERKVMEKAGCLNYSFTPWESEKENVYERQIYYVFDKRISHYRVEV  937

Query  2675  TSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYV--GV  2848
             TSTQ++    N  GW++ E++ +HGVP  D++ V LRY++E   +    C C V V  G+
Sbjct  938   TSTQQRHSLPNKNGWLVEEVLTLHGVPLGDYFNVHLRYQIEDLPSKLKGC-CSVLVSFGM  996

Query  2849  MWLKNTKLEDRITKNIVRKFSQRVK  2923
              W K+TK + R+TKNI++    R+K
Sbjct  997   AWQKSTKHQKRMTKNILKNLQDRLK  1021



>ref|XP_010059540.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Eucalyptus grandis]
Length=999

 Score =   858 bits (2217),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/846 (50%), Positives = 586/846 (69%), Gaps = 35/846 (4%)
 Frame = +2

Query  431   KSIAGHLEKLFDkneessksneegskkdnsseLSSIP--SDYEDNVQETTRSQTQSFCEA  604
             K+ AG L ++F+K+ ++S               +S P  SD +D+ Q ++     SF E 
Sbjct  185   KTFAGRLAQMFNKSTDTSSVASNKGIDLPELPEASGPESSDSQDDDQFSS----GSFEEL  240

Query  605   IKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQE  784
             IK+++SR +  E P NL GG+LLD    + P + N LLF+ DS F + L++LQGT ++Q 
Sbjct  241   IKIMESREQEGETPSNLPGGVLLDHLCIIAPSELNTLLFSSDSPFFKSLSDLQGTTELQL  300

Query  785   GPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYG  964
             G W ++ +    L RV++Y K ATKL+K+V+ATEEQTYLK DG                 
Sbjct  301   GQWKFE-NGAETLKRVISYIKAATKLIKAVKATEEQTYLKADGS----------------  343

Query  965   STFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFS  1144
                       I  GP L SGE+S+ LVISW + F ++TMMK +IE G +QGLKDSF +++
Sbjct  344   ---------CITHGPELPSGEQSSRLVISWRMNFLQNTMMKGMIESGVRQGLKDSFEQYA  394

Query  1145  RFLAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
               L Q  K + S ++  N   +LA+L +E  SD +LA +YF NFTV+ST  + LY  +H+
Sbjct  395   SLLNQTVKPVDSKDIGSNKEQILASLQAEPQSDWKLAVQYFANFTVLSTFVMGLYVLVHL  454

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
              L+  + + GLEF GLDLPDS+GE+I CG+LVL  E+V   I+ F++AR+++GSDHGV+A
Sbjct  455   WLATPSPIHGLEFVGLDLPDSIGEVIVCGMLVLQAERVLGFISRFMQARMQKGSDHGVKA  514

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              GDGW+LTVALIEG+++A++D +   DP+VVFTCNGK+RTSS++ Q  DP WNEI EF+ 
Sbjct  515   QGDGWLLTVALIEGSSIAAVDSSALSDPYVVFTCNGKTRTSSIKFQKTDPLWNEIFEFDA  574

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
              E+PPSMLDVEVFDFDGPFD+A SLGHAE+NF+++  ++LAD+W+ L GK+AQ+ QSKLH
Sbjct  575   MEDPPSMLDVEVFDFDGPFDEATSLGHAEVNFVRNNISDLADVWVTLHGKLAQACQSKLH  634

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFL+N  G    ++ ++KMEKEVGKK+N+RSP  NS FQK F LPPEEFLINDF+C L
Sbjct  635   LRIFLDNTKGSNVAKEYISKMEKEVGKKINIRSPQTNSAFQKLFALPPEEFLINDFTCHL  694

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRK+PLQGR+FLS RI+GF+ANLFG KTKFFFLWEDIE+I VL P+ ++MGSP +V+ L 
Sbjct  695   KRKMPLQGRLFLSARIIGFHANLFGQKTKFFFLWEDIEDIQVLSPTLASMGSPIVVMTLR  754

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQY  2401
             + RG +AR+GAK+ DEEGRL F F SFVSF  A RTIMALWK R+  P+QK Q+ EE+  
Sbjct  755   RGRGMEARHGAKTQDEEGRLKFQFQSFVSFNVAHRTIMALWKARSLTPEQKVQLIEEE--  812

Query  2402  KDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYV  2581
              +  +++ EE+GS+L +EDVS+S+VY   LP+     +E+F G DLE KVM K+GCLNY 
Sbjct  813   SEARSLVTEESGSFLGLEDVSLSEVYCSVLPVPTNFFLEVFGGEDLERKVMEKAGCLNYS  872

Query  2582  TSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFS  2761
              + WE  +PDVYER++ Y+ ++ IS +  EVTSTQ+KS   +  GW++ E+M +H +P  
Sbjct  873   YTPWESEKPDVYERQLYYRFDKRISRYRGEVTSTQQKSALPDRDGWLIEEVMTLHAIPLG  932

Query  2762  DHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFV  2941
             D++ + LRY++E   +    C   V+ G+ WLK++K + RITKNI+     R+K M   +
Sbjct  933   DYFNLHLRYQIEDAPSRPKECSIKVFFGIAWLKSSKHQKRITKNILVNLQDRLKVMFGAI  992

Query  2942  GREVFL  2959
              +E  L
Sbjct  993   EKEFTL  998



>ref|XP_008659468.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Zea mays]
 gb|AFW86395.1| hypothetical protein ZEAMMB73_728243 [Zea mays]
Length=1034

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/791 (51%), Positives = 569/791 (72%), Gaps = 7/791 (1%)
 Frame = +2

Query  563   QETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFR  742
             Q+   S + SF E +K   SR EG+EMPENL GG++LDQ YA+ P D N LLF+P S F 
Sbjct  237   QDLDASASMSFDELLKAFGSRGEGKEMPENLSGGVVLDQVYAVAPSDLNTLLFSPSSDFL  296

Query  743   RELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEF  922
             + LAE+QGT  ++   W  ++D +  L RVV+YTK  TKLVK+V+ATE+ TYLK D + F
Sbjct  297   QSLAEIQGTTGLEIQQWRLENDGE-ILRRVVSYTKAPTKLVKAVKATEDMTYLKADREMF  355

Query  923   AVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEG  1102
             AVL DVSTPDVP+G+TF+VE+L  I+PGP L   E+S+ L++SW + F +STMMK+++E 
Sbjct  356   AVLADVSTPDVPFGNTFRVEVLTCIIPGPELPDDEKSSRLMVSWRINFVQSTMMKSMVEN  415

Query  1103  GTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVV  1282
             G +QGLKD++ +FS  LA++ + + + +   +  +L+++  E  SD +LA   F NFT+ 
Sbjct  416   GAKQGLKDNYVQFSELLAKNFRPVDAKDTTYSNEVLSSVQPEQESDWKLAFRVFGNFTLF  475

Query  1283  STAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVE  1462
             S+ F  +Y S HI L+  + +QGLEF GLDLPDSVGE++ CG+L+L  ++V  M+A F++
Sbjct  476   SSVFAFVYVSAHIFLTSPSIIQGLEFPGLDLPDSVGEVVVCGVLILQGQRVLNMVARFIQ  535

Query  1463  ARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQT  1642
             A+ +RG DHGV+A GDGW+LTVAL+EGTN+A+   + + DP+VVFTCNGK++TSS++  T
Sbjct  536   AKRQRG-DHGVKAQGDGWLLTVALMEGTNMAATKSSDYSDPYVVFTCNGKTKTSSIKFHT  594

Query  1643  LDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTS-AELADLWLP  1819
             L+PQWNEI EF+  E+PPS++++ V+DFDGPFD+  SLGH E+NFLK+ + ++LAD+W+P
Sbjct  595   LEPQWNEIFEFDAMEDPPSVMEIHVYDFDGPFDKVASLGHTEVNFLKYNNISKLADIWIP  654

Query  1820  LGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGL  1999
             L GK+AQ+ QSKLHLRIFLNN  G E ++D L KMEKEVGKK+ +RSPH N  FQK F L
Sbjct  655   LKGKLAQACQSKLHLRIFLNNTRGTEVVKDYLDKMEKEVGKKIAMRSPHTNLAFQKIFSL  714

Query  2000  PPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPS  2179
             PPEEFLIN F+C LKRK+  QGR+FLS RI GFY N+FGHKTKFF LWEDIE+I ++P +
Sbjct  715   PPEEFLINYFTCHLKRKMLTQGRLFLSPRIFGFYTNIFGHKTKFFLLWEDIEDILLVPAT  774

Query  2180  FSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRAC  2359
              S MGSPSLVIIL K RG DA++GAK +D +GRL+F F SFVSF  A +TI ALWK R+ 
Sbjct  775   LSLMGSPSLVIILRKGRGMDAKHGAKQLDSQGRLNFHFQSFVSFNVAHKTITALWKARSL  834

Query  2360  IPDQKAQIAEEQQYKDE-NNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGD  2536
              P+QK ++ EE+   +E  NV   E  S+L +ED  MS V+S   P +  +LM +F GG 
Sbjct  835   TPEQKVELVEEESETEEFQNV---EGESFLGIEDAQMSGVFSSTKPFDVTTLMGIFEGGP  891

Query  2537  LEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAG  2716
             LE +VM K GC++Y  ++WE +  D+Y+R+V YK ++     G E  STQ+KS   N  G
Sbjct  892   LECRVMEKVGCMDYSVTAWEPVRADIYQRQVHYKFDKKSVRHGGEAMSTQQKSPLPNKNG  951

Query  2717  WILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNI  2896
             W++ E+M + G+P  + + + +RY++E+  + + +C   V +G++WLKN K   +IT +I
Sbjct  952   WLVEEVMTLEGIPVGECFNLHIRYQLENNVSKQKTCTIQVSIGIVWLKNCKNRKKITHDI  1011

Query  2897  VRKFSQRVKEM  2929
                 S R+K++
Sbjct  1012  ATNASSRLKKI  1022



>gb|KDO78670.1| hypothetical protein CISIN_1g001764mg [Citrus sinensis]
Length=971

 Score =   851 bits (2198),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/793 (53%), Positives = 551/793 (69%), Gaps = 50/793 (6%)
 Frame = +2

Query  575   RSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELA  754
             +S + SF EA+K ++ R  G E+P NL GG+L+DQ Y + P+D N LLF+PDS F R  A
Sbjct  224   QSSSASFEEAMKTMEPRDLGSEVPSNLPGGVLVDQMYVIAPQDLNTLLFSPDSNFPRTWA  283

Query  755   ELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLV  934
             E QG  ++Q GPW +++  +S L R VTY K A KL+K+ +  EEQTYLK DGK FA+L 
Sbjct  284   EEQGNTELQIGPWRFENGCES-LKRDVTYIKAANKLIKATKGFEEQTYLKADGKVFAILA  342

Query  935   DVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQ  1114
              VSTP+V YG +FK ELL+ I PGP L SGE+S+HLVISW + F +STMMK +IE G + 
Sbjct  343   SVSTPEVMYGGSFKTELLFCITPGPELSSGEQSSHLVISWRMNFLQSTMMKGMIENGARS  402

Query  1115  GLKDSFSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTA  1291
              L++++ +F+ FL+Q    + S ++ L+   +LA+L  E  SD +LA  YF NFTVVS+ 
Sbjct  403   ALRETYEQFATFLSQTITPVDSNDMGLNKEQILASLQPEPQSDWKLAVHYFANFTVVSSF  462

Query  1292  FLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARL  1471
             F+ +Y  IHI L+ ST +QGLEF GLDLPDS+GE I CG+LVL  E+  ++I+ F++AR 
Sbjct  463   FMGIYVLIHIWLATSTTIQGLEFVGLDLPDSIGEFIVCGVLVLQGERFLQLISRFMQARK  522

Query  1472  RRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDP  1651
             ++GSDHGV+A GDGW+LTVALI+G NLA++D +GF DP+VVFTCNGKSRTSS++ Q  DP
Sbjct  523   QKGSDHGVKAQGDGWLLTVALIKGDNLAAVDSSGFCDPYVVFTCNGKSRTSSIKFQQCDP  582

Query  1652  QWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGK  1831
              WN+                                             LAD+W+PL GK
Sbjct  583   MWND---------------------------------------------LADVWIPLQGK  597

Query  1832  IAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEE  2011
             +AQ+ QSKLHLRIFLNN  G   +++ LTKMEKEVGKK+NLRSP  NS FQK FGLPPEE
Sbjct  598   LAQACQSKLHLRIFLNNTKGSNVVKEYLTKMEKEVGKKINLRSPQTNSAFQKLFGLPPEE  657

Query  2012  FLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTM  2191
             FLINDF+C LKRK+ LQGR+FLS RI+GF+ANLFGHKT FFFLWEDIE+I VLPPS S+M
Sbjct  658   FLINDFTCHLKRKMLLQGRLFLSARIIGFHANLFGHKTNFFFLWEDIEDIQVLPPSLSSM  717

Query  2192  GSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQ  2371
             GSP +V+ L + RG DAR+GAK+ DEEGRL F FHSFVS+  A RTIMALWK R+  P+Q
Sbjct  718   GSPVIVMTLRQGRGMDARHGAKTQDEEGRLKFHFHSFVSYNVAHRTIMALWKARSLSPEQ  777

Query  2372  KAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKV  2551
             K QI EE + K   ++  EE G++L +EDV+MS+VYS  LP+     ME+F GG+LE  V
Sbjct  778   KVQIVEESEAK---SLQSEEGGTFLGLEDVTMSEVYSSVLPVPMSFFMELFGGGELERAV  834

Query  2552  MSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNE  2731
             M K+GC++Y  SSWE  + DVYER++ Y+ ++ IS +  EVTSTQ+KS   N  GW++ E
Sbjct  835   MEKAGCVSYSCSSWESEKLDVYERQIYYRFDKCISRYRGEVTSTQQKSPLPNGNGWLVEE  894

Query  2732  IMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFS  2911
             +M +HGVP  D++ + LRY+VE   +    C   VY+GV WLK+T+ + RITKNIV    
Sbjct  895   VMTLHGVPLGDYFNLHLRYQVEDSPSRPKGCLAQVYLGVAWLKSTRHQKRITKNIVSNLE  954

Query  2912  QRVKEMIEFVGRE  2950
              R++  +  + +E
Sbjct  955   DRLRVKLSVIEKE  967



>gb|EMT18772.1| Protein unc-13-C-like protein [Aegilops tauschii]
Length=1067

 Score =   853 bits (2204),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/793 (52%), Positives = 562/793 (71%), Gaps = 12/793 (2%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             +F E ++  +SR E  EMP NLQG IL++Q+Y   P D N LLF+PDS FR+ L +LQG 
Sbjct  278   TFAELLRSFESRHEEVEMPVNLQG-ILVNQSYFTSPSDLNNLLFSPDSDFRQTLVQLQGC  336

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
              D +  PW   +D +S L RV++YT   +KLVK+V+ATE+Q+YLK DGKE++VL+  STP
Sbjct  337   TDFKTEPWRIDNDGES-LKRVISYTTAPSKLVKAVKATEDQSYLKADGKEYSVLLSASTP  395

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             DVP G+ F+ E+L+ IMPGP L S ++++HLVISW + F +STMMK++IE G +QGL+ +
Sbjct  396   DVPCGTYFRTEVLFRIMPGPELDSEQQTSHLVISWRMNFLQSTMMKSIIENGARQGLEQN  455

Query  1130  FSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLY  1306
             +S+FS  L++  K I   +   D   +LA+L     SD ++A  YFCNF V+S+ F+ LY
Sbjct  456   YSQFSDLLSEKIKPIDVDDAGSDKEQVLASLQGGQESDWKIAFLYFCNFGVLSSLFVALY  515

Query  1307  FSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSD  1486
               +H+ L  S  +QGLEF GLDLPDS+ EI+  G+L L  + +++ I  F +AR ++  D
Sbjct  516   IGVHVSLVNSGAVQGLEFPGLDLPDSISEIVMGGLLFLQAQHIFKKIMCFFQAREQKVGD  575

Query  1487  HGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEI  1666
             HGV+A GDGW+LTVALIEGTNLA +D TGF DP+VVFTCNGK++TSS++ QTL+PQWN+I
Sbjct  576   HGVKAQGDGWLLTVALIEGTNLAPVDATGFSDPYVVFTCNGKTKTSSIKFQTLEPQWNDI  635

Query  1667  LEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSS  1846
              EF+  ++PPS+++V V+DFDGPFD+  SLGHAEINF+K   +ELAD+W+PL G +A+S 
Sbjct  636   FEFDAMDDPPSVMNVHVYDFDGPFDEVTSLGHAEINFVKSNLSELADVWIPLQGNLAKSR  695

Query  1847  QSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
             QSKLHLRIFLNN+ G   + + L+KMEKEVGKK+ LRSP  N+ FQ+ F LP EEFLI+ 
Sbjct  696   QSKLHLRIFLNNSKGTGMVTEYLSKMEKEVGKKMTLRSPRTNTAFQELFSLPAEEFLISS  755

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             F+C LKRKLP QG +FLS RI+GFY+++FG KTKFFFLWEDIE+I  +PPS ST  SPSL
Sbjct  756   FTCYLKRKLPTQGHLFLSPRIIGFYSSMFGRKTKFFFLWEDIEDIQAIPPSLSTW-SPSL  814

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIA  2386
              I LH+ RG DA++GAKS+ E G+L F   SF SF  A+RTIMALWK R+   + K QIA
Sbjct  815   AITLHRGRGMDAKHGAKSV-ESGKLKFSLQSFASFSVANRTIMALWKARSLSSESKVQIA  873

Query  2387  EEQQYKDENNVL-PEETGSYLIVED---VSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVM  2554
             EEQ    +NN L  E++G ++ V+D   + MS+V+S  +  N  SL+E+F GG LE KVM
Sbjct  874   EEQS---QNNTLQSEDSGIFVGVDDSKSLQMSEVFSSTISANMNSLLEVFEGGSLEMKVM  930

Query  2555  SKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEI  2734
              K GCL Y  + WE  +PD Y+R++ YK +R +S  G EVT TQ KS   N  GWI+ E+
Sbjct  931   EKVGCLKYSATQWESDKPDEYQRQIHYKFSRKLSPVGGEVTGTQLKSPMPNKKGWIIEEV  990

Query  2735  MAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQ  2914
             M + GV   D + + ++Y++E  +  + +C   VY+G+ W K T+ + RI KN++   S 
Sbjct  991   MELQGVLLGDFFTLHIKYQIEDLAPKQKACSVQVYLGIEWSKTTRHQKRIEKNVLSSSSA  1050

Query  2915  RVKEMIEFVGREV  2953
             R+KEM     +++
Sbjct  1051  RLKEMFSLASKQL  1063



>gb|EEC83795.1| hypothetical protein OsI_29710 [Oryza sativa Indica Group]
 gb|EEE68912.1| hypothetical protein OsJ_27768 [Oryza sativa Japonica Group]
Length=1071

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/823 (50%), Positives = 571/823 (69%), Gaps = 22/823 (3%)
 Frame = +2

Query  536   IPSDYEDNVQETTR--------SQTQS------FCEAIKLLQSRTEGREMPENLQGGILL  673
             + +D  ++VQE T         SQT S      F E +K  +S+ +  EMP +LQG IL+
Sbjct  250   VTTDKSEDVQEATTGYEAPATGSQTYSASTDTPFDELLKYFESKHQEVEMPVDLQG-ILV  308

Query  674   DQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGA  853
             D++Y   P D N  LF+PDS FR+ + ELQG  DV+   W   SD +S L RV+TYT   
Sbjct  309   DKSYITSPSDLNNFLFSPDSNFRQTVVELQGCSDVKMESWKIDSDGES-LKRVITYTTAP  367

Query  854   TKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEES  1033
             +KLVK+V+ATEEQ+YLK DG  ++VL+ VSTPDVP G+ F+ E+L+ I+PGP L S + +
Sbjct  368   SKLVKAVKATEEQSYLKADGNGYSVLLSVSTPDVPCGTYFRTEILFRILPGPELDSEQLT  427

Query  1034  THLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNGHLLA  1213
             +HLVISW + F +STMMK +IE G +QGL+ ++++FS  L+Q  K I      D G +LA
Sbjct  428   SHLVISWRINFLQSTMMKGMIENGAKQGLQQNYAQFSDLLSQKIKPIDVDAGSDKGQVLA  487

Query  1214  TLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGE  1393
             +L     SD  +A  YFCNF V+ + F+ +Y ++H+ L  S   +GLEF GLDLPDS+ E
Sbjct  488   SLQRGQESDWNIAFLYFCNFGVLCSLFVTIYIAVHVQLRSSGAHKGLEFPGLDLPDSLSE  547

Query  1394  IITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTG  1573
             I+  G+L L L  +Y+ I+ F++AR ++  DHGV+A GDGW+LTVALIEGT LA +D TG
Sbjct  548   IVMGGLLFLQLRHIYKKISCFIQAREQKVGDHGVKAQGDGWLLTVALIEGTKLAPVDATG  607

Query  1574  FPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARS  1753
             F DP+VVFTCNGKS+TSS++ QTL+PQWN+I EF+  ++PPS+++V V+DFDGPFD+  S
Sbjct  608   FSDPYVVFTCNGKSKTSSIKFQTLEPQWNDIFEFDAMDDPPSVMNVHVYDFDGPFDEVTS  667

Query  1754  LGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKE  1933
             LGHAEINF+K   +ELAD+W+PL G +AQS QSKLHLRIFL+N+ G   + + L+KMEKE
Sbjct  668   LGHAEINFVKSNLSELADVWIPLQGNLAQSWQSKLHLRIFLSNSKGSTMVTEYLSKMEKE  727

Query  1934  VGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLF  2113
             VGKK+ LRSP  N+ FQ+ F LP EEFLI+ F+C LKRKL  QG +FLS R +GFY+++F
Sbjct  728   VGKKMTLRSPRTNTAFQELFSLPAEEFLISSFTCCLKRKLHTQGHLFLSPRTIGFYSSMF  787

Query  2114  GHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCF  2293
             G KTKFFFLWEDIEEI  +P S S+  SPSLVI LHK RG DA++GAKS+D  GRL FC 
Sbjct  788   GRKTKFFFLWEDIEEIQAVPQSISSW-SPSLVITLHKGRGMDAKHGAKSVD-NGRLKFCL  845

Query  2294  HSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKDENNVLPEETGSYLIVED---VS  2464
              SF SF  A+RTIMALWK R+   + K QIAEEQ  ++ + +  E++G ++ VED   + 
Sbjct  846   QSFASFSVANRTIMALWKARSLSSEYKMQIAEEQS-QNNDTLQSEDSGIFVGVEDAKNLQ  904

Query  2465  MSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLN  2644
             M++V+S  +  N  SLME+F GG  E K+M+K GCLNY  + WE  +PD Y+R++ YK +
Sbjct  905   MNEVFSSSISANMASLMEVFGGGSFEMKIMNKVGCLNYSATQWESDKPDEYQRQIHYKFS  964

Query  2645  RLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSC  2824
             R +S  G EVT TQ+KS   N AGWI+ E+M + G+ F D + + +RY++E  +  + +C
Sbjct  965   RKLSPIGGEVTGTQQKSPMPNKAGWIIEEVMELQGILFGDFFTIHIRYQIEDLAPKQRAC  1024

Query  2825  RCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGREV  2953
                V++G+ W K T+   RI K+++   S R+KEM     +++
Sbjct  1025  SVQVFLGIEWSKTTRHRKRIEKSVLSGSSARLKEMFILASKQL  1067



>ref|XP_006659530.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Oryza brachyantha]
Length=1072

 Score =   846 bits (2186),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/825 (49%), Positives = 577/825 (70%), Gaps = 23/825 (3%)
 Frame = +2

Query  533   SIPSDYEDNVQETTR--------------SQTQSFCEAIKLLQSRTEGREMPENLQGGIL  670
             ++ +D  +++QE T               S   SF E +K  +S+ +  EMP +LQG IL
Sbjct  249   TVITDKSEDIQEATTGYEAPATASHINGASTDASFDELLKYFESKHQEVEMPVDLQG-IL  307

Query  671   LDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKG  850
             +++ Y   P D N LLF+PDS FR+ + ELQG  D +   W   SD +S L RV+TYT  
Sbjct  308   VNKAYITSPSDLNNLLFSPDSNFRQTVVELQGCSDFKMESWKIDSDGES-LKRVITYTTA  366

Query  851   ATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEE  1030
              +KLVK+V+ATEEQ+YLK DGKE++VL+ VSTPDVPYG+ F+ E+L+ I+PGP L + ++
Sbjct  367   PSKLVKAVKATEEQSYLKADGKEYSVLLSVSTPDVPYGAYFRTEILFRILPGPELDTEQQ  426

Query  1031  STHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRFLAQHCKVITSAEV-LDNGHL  1207
             ++HLVISW + F +STM+K +IE G +QGL+ ++++FS FL++  K I   +   D G +
Sbjct  427   TSHLVISWRINFLQSTMIKGMIENGAKQGLQQNYAQFSDFLSEKIKPIDVEDAGSDKGQV  486

Query  1208  LATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSV  1387
             LA+L     SD ++A  YFCNF V+ + F+V+Y ++H+ L  S   +GLEF GLDLPDS+
Sbjct  487   LASLQGGKESDWKIAFLYFCNFGVLCSLFVVIYITVHVQLRSSGSHKGLEFPGLDLPDSL  546

Query  1388  GEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDP  1567
              EI+  G+L L L+ +++ I+ F++AR ++  DHGV+A GDGW+LTVALIEGT LA +D 
Sbjct  547   SEIVMGGLLFLQLQHIFKKISCFIQAREQKVGDHGVKAQGDGWLLTVALIEGTKLAPVDA  606

Query  1568  TGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQA  1747
             TGF DP+VVFTCNGK++TSS++ QTL+PQWN+I EF+  ++PPS+++V V+DFDGPFD+ 
Sbjct  607   TGFSDPYVVFTCNGKTKTSSIKFQTLEPQWNDIFEFDAMDDPPSVMNVHVYDFDGPFDEV  666

Query  1748  RSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKME  1927
              SLGHAEINF+K   +ELAD+W+PL G +AQS QSKLHLRIFL+N+ G   + + L+KME
Sbjct  667   TSLGHAEINFVKSNLSELADVWIPLQGNLAQSWQSKLHLRIFLSNSKGTSMVTEYLSKME  726

Query  1928  KEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYAN  2107
             KEVGKK+ LRSP  N+ FQ+ F LP EEFLI+ F+C LKRKL  QG +FLS R +GFY++
Sbjct  727   KEVGKKMTLRSPRTNTAFQELFSLPAEEFLISSFTCCLKRKLHTQGHLFLSPRTIGFYSS  786

Query  2108  LFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHF  2287
             +FG KTKFFFLWEDIE+I+ +P S S+  SPSLVI LHK RG DA++GAKS+D  G+L F
Sbjct  787   MFGRKTKFFFLWEDIEQIHAVPQSISSW-SPSLVITLHKGRGMDAKHGAKSMD-NGKLKF  844

Query  2288  CFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKDENNVLPEETGSYLIVED---  2458
             C  SF SF  A+RTIMALWK R+   + K QIAEEQ  +  + +  E++G ++ VED   
Sbjct  845   CLQSFASFNVANRTIMALWKARSLSTEYKMQIAEEQS-RGNDTLQSEDSGIFVGVEDAKS  903

Query  2459  VSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYK  2638
             + M++V+S  +  N  SLME+F GG  E KVM+K GCLNY  + WE  +PD Y+R++ YK
Sbjct  904   LQMNEVFSSSISANMASLMEVFGGGSFEMKVMNKVGCLNYSATQWESDKPDEYQRQIHYK  963

Query  2639  LNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARN  2818
              ++ +S  G EVT TQ+K    N AGWI+ E+M + G+ F D + + +RY++E  +  + 
Sbjct  964   FSKKLSPIGGEVTGTQQKCPMPNKAGWIIEEVMELQGILFGDFFTIHIRYQIEDLAPKQR  1023

Query  2819  SCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGREV  2953
             +C   V++G+ W K T+   RI K+++   S R+KEM     +++
Sbjct  1024  ACSVQVFLGIEWSKTTRHRKRIEKSVLSGSSTRLKEMFVLASKQL  1068



>gb|KCW44495.1| hypothetical protein EUGRSUZ_L01993 [Eucalyptus grandis]
Length=992

 Score =   842 bits (2176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/785 (53%), Positives = 564/785 (72%), Gaps = 14/785 (2%)
 Frame = +2

Query  431   KSIAGHLEKLFDkneessksneegskkdnsseLSSIP--SDYEDNVQETTRSQTQSFCEA  604
             K+ AG L ++F+K+ ++S               +S P  SD +D+ Q ++     SF E 
Sbjct  185   KTFAGRLAQMFNKSADTSSVASTKGIDLPELPEASGPESSDSQDDDQFSS----GSFEEL  240

Query  605   IKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQE  784
             IK+++SR +  E P NL GG+LLD    + P + N LLF+ DS F R L++LQGT ++Q 
Sbjct  241   IKIMESREQEGETPSNLPGGVLLDHLCIIAPSELNTLLFSSDSPFFRSLSDLQGTTELQL  300

Query  785   GPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYG  964
             G W ++ +    L RV++Y K ATKL+K+V+ATEEQTYLK DGK +AVL  VSTPDV YG
Sbjct  301   GQWKFE-NGAETLKRVISYIKAATKLIKAVKATEEQTYLKADGKVYAVLASVSTPDVMYG  359

Query  965   STFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFS  1144
             STFKVELLY I PGP L SGE+S+ LVISW + F ++TMMK +IE G +QGLKDSF +++
Sbjct  360   STFKVELLYCITPGPELPSGEQSSRLVISWRMNFLRNTMMKGMIENGVRQGLKDSFEQYA  419

Query  1145  RFLAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
               L Q  K + S +   N   +LA+L +E  SD +LA ++F NFTV+ T  + LY  +H+
Sbjct  420   SLLNQTVKPVHSKDFGSNKEQILASLQAEPQSDWKLAVQHFANFTVLFTFVMGLYVLVHL  479

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
              L+  + + GLEF GLDLPDS+GE+I CGILVL  E+V   I+ F++AR+++GSDHGVRA
Sbjct  480   WLATPSAIHGLEFVGLDLPDSIGEVIVCGILVLQAERVLGFISRFMQARMQKGSDHGVRA  539

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              GDGW+LTVALIEG+++A++D +   DP+VVFTCNGK+RTSS++ Q  DP WNEI EF+ 
Sbjct  540   QGDGWLLTVALIEGSSIAAVDSSALSDPYVVFTCNGKTRTSSIKFQKTDPLWNEIFEFDA  599

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
              E+PPSMLDVEVFDFD    +A+SLGHA++NF++   ++L D+W+PL GK+AQ+ QSKLH
Sbjct  600   MEDPPSMLDVEVFDFD----EAKSLGHAKVNFVRSNISDLGDVWVPLHGKLAQACQSKLH  655

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFL+N  G    ++ ++KMEKEVGKK+N+RSP  NS FQK F LPPEEFLINDF+C L
Sbjct  656   LRIFLDNTRGRNMAKEYISKMEKEVGKKINIRSPQTNSAFQKLFALPPEEFLINDFTCHL  715

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRK+PL GR+FLS RI+GF+ANLFG +TKFFFLWEDIE+I VL  + S+MGSP +V+ L 
Sbjct  716   KRKMPLMGRLFLSARIIGFHANLFGKRTKFFFLWEDIEDIQVLSRTLSSMGSPIVVMTLR  775

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQY  2401
             + RG +AR+GAK+ DEEGRL F F  FVSF  A RTIMALWK R+  P+QK Q+ EE+  
Sbjct  776   RGRGMEARHGAKTQDEEGRLKFQFQYFVSFNVAHRTIMALWKARSLTPEQKVQLIEEES-  834

Query  2402  KDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYV  2581
              +   ++ EE+ S+L ++DVS+S+VY   LP+     ME+F G DLE KVM K+GCLNY 
Sbjct  835   -EARGLVTEESESFLGLDDVSLSEVYCSVLPVPTNFFMEVFGGEDLERKVMEKAGCLNYS  893

Query  2582  TSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFS  2761
              + WE  +PDVYER++ Y+ ++ +S +  EVTSTQ+KS   +  GW++ E+M +H VP  
Sbjct  894   YTPWESEKPDVYERQIYYRFDKRLSRYRGEVTSTQQKSALPDRDGWLIEEVMTLHAVPLG  953

Query  2762  DHYQV  2776
             D++ V
Sbjct  954   DYFNV  958



>ref|XP_004973782.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Setaria italica]
Length=1068

 Score =   841 bits (2172),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/811 (51%), Positives = 568/811 (70%), Gaps = 13/811 (2%)
 Frame = +2

Query  539   PSDYEDNVQETTRSQTQS-FCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNML  715
             P  YE  V +  ++  ++ F E +K L+SR EG EMP NL G IL++Q+Y   P D N L
Sbjct  261   PRGYEIPVSQDDKTCPEAPFSELLKSLESRHEGVEMPVNLPG-ILVNQSYLASPSDLNNL  319

Query  716   LFAPDSQFRRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQT  895
             LF+PDS F++ + ELQG  D +  PW   +D +S L RVVTYT   +KLVK+V+ATEEQ+
Sbjct  320   LFSPDSDFKQTMIELQGCTDFKTEPWRLDNDGES-LKRVVTYTTAPSKLVKAVRATEEQS  378

Query  896   YLKGDGKEFAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKS  1075
             YLK DGKE+AVL+ VSTPDVP G+ F+ E+L+ IMPGP L S ++++HLVISW + F +S
Sbjct  379   YLKADGKEYAVLLSVSTPDVPCGTYFRTEILFRIMPGPELDSQQQTSHLVISWRMNFLQS  438

Query  1076  TMMKTVIEGGTQQGLKDSFSEFSRFLAQHCKVI-TSAEVLDNGHLLATLPSEHPSDLELA  1252
             TM+K++IE G +QGL+ ++S+FS  L+Q  K I       D   +LA+L     SD ++A
Sbjct  439   TMIKSMIENGARQGLEQNYSQFSDLLSQKIKPIDVEGSGSDKEQVLASLQGGQESDWKIA  498

Query  1253  REYFCNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQ  1432
               YFCNF V+S+ F+ +Y  +H+L   S+ +QGLEF GLDLPDS+ EII  G+L L ++ 
Sbjct  499   FLYFCNFGVLSSLFVSIYIVLHVLRVNSSSVQGLEFPGLDLPDSLSEIIMGGLLFLQVQN  558

Query  1433  VYRMIAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGK  1612
             + + I  FV+AR ++G DHGV+A GDGW+LTVALIEG  LA +D TGF DP+VVFTCNGK
Sbjct  559   ILKKITCFVQARGQKGGDHGVKAQGDGWLLTVALIEGIKLAPVDATGFSDPYVVFTCNGK  618

Query  1613  SRTSSVQLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTS  1792
             ++TSS++ QTL+PQWNEI EF+  ++PPS++ V V+DFDGPFD+  SLGHAEINF+K   
Sbjct  619   TKTSSIKFQTLEPQWNEIFEFDAMDDPPSVMSVHVYDFDGPFDEVTSLGHAEINFVKSNL  678

Query  1793  AELADLWLPLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRN  1972
             + LAD+W+PL G +AQS QSKLHLR+FLNN+ G   + + L+KMEKEVGKK+ LRSP  N
Sbjct  679   SALADVWVPLKGNLAQSWQSKLHLRVFLNNSKGTGMVTEYLSKMEKEVGKKMTLRSPRTN  738

Query  1973  STFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDI  2152
             + FQ+ F LP EEFLI+ F+C L+RKLP QG +FLS R +GFY+++FG KTKF+FLWEDI
Sbjct  739   TAFQELFSLPAEEFLISSFTCYLRRKLPTQGHLFLSPRTIGFYSSMFGRKTKFYFLWEDI  798

Query  2153  EEINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTI  2332
             E+I  +P S S+  SPS+VI LH+ RG DA++GAKS+D  G+L FC  SF SF  A RTI
Sbjct  799   EDIQGIPQSISSW-SPSVVITLHRGRGMDAKHGAKSVD-NGKLKFCLQSFASFSVAHRTI  856

Query  2333  MALWKTRACIPDQKAQIAEEQQYKDENNVL-PEETGSYLIVED---VSMSKVYSVDLPMN  2500
             MALWK R+   + K Q+AEEQ    +NN L  E++G ++ +ED   + M++V+S  +  N
Sbjct  857   MALWKARSLSTELKVQLAEEQ---SQNNTLQSEDSGIFVGIEDAKGLQMTEVFSSTISTN  913

Query  2501  HKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTS  2680
               SLME+F GG LE KVM K GC  Y  + WE  +P+ Y+R++ YK ++ +S  G EVT 
Sbjct  914   MASLMEVFEGGPLEMKVMEKVGCQKYSATQWESDKPNEYQRQIHYKFSKKLSPVGGEVTG  973

Query  2681  TQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLK  2860
             TQ+KS   N  GWI+ E+M + GV   D + + ++Y++E  +  + +    V +G+ W K
Sbjct  974   TQQKSPMPNKKGWIIEEVMELQGVLLGDFFTLHIKYQIEDLAPKQRASSVQVSLGIEWSK  1033

Query  2861  NTKLEDRITKNIVRKFSQRVKEMIEFVGREV  2953
             +T+ + RI KN++   S R+KEM     RE+
Sbjct  1034  STRHQKRIEKNVLSSSSARLKEMFNLASREL  1064



>dbj|BAD10009.1| C2 domain/GRAM domain-containing protein-like [Oryza sativa Japonica 
Group]
Length=1081

 Score =   840 bits (2170),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/833 (50%), Positives = 571/833 (69%), Gaps = 32/833 (4%)
 Frame = +2

Query  536   IPSDYEDNVQETTR--------SQTQS------FCEAIKLLQSRTEGREMPENLQGGILL  673
             + +D  ++VQE T         SQT S      F E +K  +S+ +  EMP +LQG IL+
Sbjct  250   VTTDKSEDVQEATTGYEAPATGSQTYSASTDTPFDELLKYFESKHQEVEMPVDLQG-ILV  308

Query  674   DQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGA  853
             D++Y   P D N  LF+PDS FR+ + ELQG  DV+   W   SD +S L RV+TYT   
Sbjct  309   DKSYITSPSDLNNFLFSPDSNFRQTVVELQGCSDVKMESWKIDSDGES-LKRVITYTTAP  367

Query  854   TKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEES  1033
             +KLVK+V+ATEEQ+YLK DG  ++VL+ VSTPDVP G+ F+ E+L+ I+PGP L S + +
Sbjct  368   SKLVKAVKATEEQSYLKADGNGYSVLLSVSTPDVPCGTYFRTEILFRILPGPELDSEQLT  427

Query  1034  THLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNGHLLA  1213
             +HLVISW + F +STMMK +IE G +QGL+ ++++FS  L+Q  K I      D G +LA
Sbjct  428   SHLVISWRINFLQSTMMKGMIENGAKQGLQQNYAQFSDLLSQKIKPIDVDAGSDKGQVLA  487

Query  1214  TLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGE  1393
             +L     SD  +A  YFCNF V+ + F+ +Y ++H+ L  S   +GLEF GLDLPDS+ E
Sbjct  488   SLQRGQESDWNIAFLYFCNFGVLCSLFVTIYIAVHVQLRSSGAHKGLEFPGLDLPDSLSE  547

Query  1394  IITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTG  1573
             I+  G+L L L  +Y+ I+ F++AR ++  DHGV+A GDGW+LTVALIEGT LA +D TG
Sbjct  548   IVMGGLLFLQLRHIYKKISCFIQAREQKVGDHGVKAQGDGWLLTVALIEGTKLAPVDATG  607

Query  1574  FPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARS  1753
             F DP+VVFTCNGKS+TSS++ QTL+PQWN+I EF+  ++PPS+++V V+DFDGPFD+  S
Sbjct  608   FSDPYVVFTCNGKSKTSSIKFQTLEPQWNDIFEFDAMDDPPSVMNVHVYDFDGPFDEVTS  667

Query  1754  LGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKE  1933
             LGHAEINF+K   +ELAD+W+PL G +AQS QSKLHLRIFL+N+ G   + + L+KMEKE
Sbjct  668   LGHAEINFVKSNLSELADVWIPLQGNLAQSWQSKLHLRIFLSNSKGSTMVTEYLSKMEKE  727

Query  1934  VGKK----------LNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLST  2083
             VGKK          + LRSP  N+ FQ+ F LP EEFLI+ F+C LKRKL  QG +FLS 
Sbjct  728   VGKKVSRFLPVSKEMTLRSPRTNTAFQELFSLPAEEFLISSFTCCLKRKLHTQGHLFLSP  787

Query  2084  RIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSI  2263
             R +GFY+++FG KTKFFFLWEDIEEI  +P S S+  SPSLVI LHK RG DA++GAKS+
Sbjct  788   RTIGFYSSMFGRKTKFFFLWEDIEEIQAVPQSISSW-SPSLVITLHKGRGMDAKHGAKSV  846

Query  2264  DEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKDENNVLPEETGSY  2443
             D  GRL FC  SF SF  A+RTIMALWK R+   + K QIAEEQ  ++ + +  E++G +
Sbjct  847   D-NGRLKFCLQSFASFSVANRTIMALWKARSLSSEYKMQIAEEQS-QNNDTLQSEDSGIF  904

Query  2444  LIVED---VSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDV  2614
             + VED   + M++V+S  +  N  SLME+F GG  E K+M+K GCLNY  + WE  +PD 
Sbjct  905   VGVEDAKNLQMNEVFSSSISANMASLMEVFGGGSFEMKIMNKVGCLNYSATQWESDKPDE  964

Query  2615  YERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKV  2794
             Y+R++ YK +R +S  G EVT TQ+KS   N AGWI+ E+M + G+ F D + + +RY++
Sbjct  965   YQRQIHYKFSRKLSPIGGEVTGTQQKSPMPNKAGWIIEEVMELQGILFGDFFTIHIRYQI  1024

Query  2795  ESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGREV  2953
             E  +  + +C   V++G+ W K T+   RI K+++   S R+KEM     +++
Sbjct  1025  EDLAPKQRACSVQVFLGIEWSKTTRHRKRIEKSVLSGSSARLKEMFILASKQL  1077



>dbj|BAK01942.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1067

 Score =   839 bits (2168),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/793 (51%), Positives = 558/793 (70%), Gaps = 12/793 (2%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             +F E +   +SR E  EMP NLQG IL++Q+Y   P D N LLF+PDS FR+ L +LQ  
Sbjct  278   TFDELLGSFESRHEEVEMPVNLQG-ILVNQSYFTSPSDLNNLLFSPDSDFRQTLVQLQNC  336

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
              D +  PW   +D +S L RV++YT   +KLVK+V+ATEEQ+YLK +GKE++VL+  STP
Sbjct  337   TDFKTEPWRIDNDGES-LKRVISYTTAPSKLVKAVKATEEQSYLKANGKEYSVLLSASTP  395

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             DVP G+ F+ E+L+ IMPGP L S ++++HLVISW + F +STMMK++IE G +QGL+ +
Sbjct  396   DVPCGTYFRTEVLFRIMPGPELDSEQQTSHLVISWRMNFLQSTMMKSLIENGARQGLEQN  455

Query  1130  FSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLY  1306
             +S+FS  L++  K I   +   D   +LA+L     SD ++A  YFCNF V+S+ F+ LY
Sbjct  456   YSQFSDLLSEKIKPIDVDDAGSDKEQVLASLQGGQESDWKIAFLYFCNFGVLSSLFVALY  515

Query  1307  FSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSD  1486
               +H+ L  S  +QGLEF GLDLPDS+ EI+  G+L L ++ +++ I  F +AR ++  D
Sbjct  516   IGVHVSLVNSGAVQGLEFPGLDLPDSLSEIVMGGLLFLQVQHIFKKIICFFQAREQKVGD  575

Query  1487  HGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEI  1666
             HGV+A GDGW+LTVALIEGT LA +D TGF DP+VVFTCNGK++TSS++ QTL+PQWN+I
Sbjct  576   HGVKAQGDGWLLTVALIEGTKLAPVDATGFSDPYVVFTCNGKTKTSSIKFQTLEPQWNDI  635

Query  1667  LEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSS  1846
              EF+  ++PPS+++V V+DFDGPFD+  SLGHAEINF+K   +ELAD+W+PL G +A+S 
Sbjct  636   FEFDAMDDPPSVMNVHVYDFDGPFDEVTSLGHAEINFVKSNLSELADVWIPLEGNLAKSR  695

Query  1847  QSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
             QSKLHLRIFLNN+ G   + + L+KMEKEVGKK+ LRSP  N+ FQ+ F LP EEFLI+ 
Sbjct  696   QSKLHLRIFLNNSKGTGMVTEYLSKMEKEVGKKMTLRSPRTNTAFQELFSLPAEEFLISS  755

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             F+C LKRKLP QG +FLS RI+GFY+++FG KTKFFFLWEDIE+I  +PPS ST  SPSL
Sbjct  756   FTCYLKRKLPTQGHLFLSPRIIGFYSSMFGRKTKFFFLWEDIEDIQAIPPSLSTW-SPSL  814

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIA  2386
              I LH+ RG DA++GAKS+ E G+L F   SF SF  A+RTIMALWK R+   + K QIA
Sbjct  815   SITLHRGRGMDAKHGAKSV-ESGKLKFSLQSFASFSVANRTIMALWKARSLSSESKVQIA  873

Query  2387  EEQQYKDENNVL-PEETGSYLIVED---VSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVM  2554
             EEQ    +NN L  E++G ++ V+D   + MS+V+S  +  N  SL+E+F GG LE KVM
Sbjct  874   EEQS---QNNTLQSEDSGIFVGVDDSKSLQMSEVFSSTISANMNSLLEVFEGGSLEMKVM  930

Query  2555  SKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEI  2734
              K GCL Y  + WE  +PD Y+R++ YK +R +S  G EVT TQ KS   N  GWI+ E+
Sbjct  931   EKVGCLKYSATQWESDKPDEYQRQIHYKFSRKLSPVGGEVTGTQLKSPMPNKKGWIIEEV  990

Query  2735  MAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQ  2914
             M + GV   D + + ++Y+ E  +  +  C   VY+G+ W K T+ + RI KN++   S 
Sbjct  991   MELQGVLLGDFFTLHIKYQFEDLAPKQKVCSVQVYLGIEWSKTTRHQKRIEKNVLSSSSA  1050

Query  2915  RVKEMIEFVGREV  2953
             R+KEM     +++
Sbjct  1051  RLKEMFSLASKQL  1063



>ref|XP_011086285.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Sesamum indicum]
Length=1054

 Score =   838 bits (2165),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/818 (50%), Positives = 562/818 (69%), Gaps = 33/818 (4%)
 Frame = +2

Query  593   FCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTK  772
             F E ++ L+ + +G E+P NL GG++LD+ Y   P + N ++F+PDS F +  A++QG+ 
Sbjct  233   FQELMRSLEMKDQGGELPSNLSGGVVLDKYYGTAPPELNSIIFSPDSNFLKSSADMQGST  292

Query  773   DVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPD  952
             D+Q GPW ++++ +S L RVV+  K  TKLVK+++ATEEQTYLK DGK FAVL  V+TPD
Sbjct  293   DLQIGPWKFENNGES-LKRVVSSIKPPTKLVKALKATEEQTYLKADGKAFAVLATVNTPD  351

Query  953   VPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSF  1132
              PYG TFK E+L+ I PGP   SGE+S+ LV+SW + F +STMMK +IE G +QG+K+SF
Sbjct  352   APYGKTFKAEVLHCISPGPEQPSGEQSSRLVVSWRINFSQSTMMKGMIENGARQGIKESF  411

Query  1133  SEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYF  1309
              +  + LAQ  K +   ++  +   LLA+L  EH SD +LA +YF N  V++   L LY 
Sbjct  412   EQMEKLLAQMVKPLDLKDIGSEKDQLLASLQVEHQSDWKLAVQYFVNVPVIAAILLGLYV  471

Query  1310  SIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDH  1489
               H+ L+  + +QGLEF GLDLPDS  E+I CG+LVL  +++    + F++AR ++GSDH
Sbjct  472   LTHLSLAMPSTVQGLEFVGLDLPDSPSELIVCGVLVLLGQRLLDSASRFMQARAQKGSDH  531

Query  1490  GVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEIL  1669
             G++  GDGW+LTVALIEG+NL  ++     +P+VVFTCNGK RTSS++ Q   P WNEI 
Sbjct  532   GIKGQGDGWLLTVALIEGSNLVKVNSRRSSEPYVVFTCNGKKRTSSIKFQRSKPLWNEIF  591

Query  1670  EFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQ  1849
             EF+  +EPPS L VEVFDFDGPF +A SLG AEINFLK   ++L+D+W+PL GK+ Q+ +
Sbjct  592   EFDATDEPPSTLGVEVFDFDGPFSEATSLGRAEINFLKSNFSDLSDIWIPLQGKLGQAFE  651

Query  1850  SKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDF  2029
             SKLHL+IFLNN  G   ++D + KMEKEVGKK+ LRSP  NS FQK FGLPPEEFLINDF
Sbjct  652   SKLHLKIFLNNTKGKNIVKDYIAKMEKEVGKKIKLRSPQTNSAFQKLFGLPPEEFLINDF  711

Query  2030  SCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLV  2209
             +C+LKR++PLQGR+FLS R++GF+A+LFGHKTKFFFLWEDIE+I V+PP+ S+MGSP +V
Sbjct  712   ACNLKRRMPLQGRLFLSVRMIGFHADLFGHKTKFFFLWEDIEDIQVIPPTLSSMGSPIMV  771

Query  2210  IILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAE  2389
             +IL   RG DAR+GAK  D +GRL F FHSFVSF  A RTIMALWK RA  P+QK QIAE
Sbjct  772   MILKPGRGFDARHGAKKQDSDGRLKFHFHSFVSFDVAQRTIMALWKARALTPEQKVQIAE  831

Query  2390  EQ---------------------------QYKDENN----VLPEETGSYLIVEDVSMSKV  2476
             E+                           Q  DE++    +  E+ GS+   EDV+MS V
Sbjct  832   EESEANGPQTAEEESMAESVQEELESKRHQTADEDSDARSLQNEDNGSFRGPEDVNMSMV  891

Query  2477  YSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLIS  2656
             YS  L +     ME+F   D++ +V  ++GCLNY  + WE  +PDVY+R++ YK ++LIS
Sbjct  892   YSSVLAVPTSFFMELFGECDIDQRVAERAGCLNYTRTPWESEKPDVYQRQLRYKFDKLIS  951

Query  2657  IFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDV  2836
              +  EVTSTQ+KS  +++ G+++ EIM + G    +++ + LRY+VE   +    C   V
Sbjct  952   RYRGEVTSTQQKSGLSSNNGYLVEEIMNLQGFMLGNYFTLHLRYQVEDLPSRSVGCSVQV  1011

Query  2837  YVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGRE  2950
             Y G+ WL++T+ + RI K+I     +R++ M   + +E
Sbjct  1012  YFGIEWLQHTRHQKRIRKSITSNLLKRLRIMFSELEKE  1049



>ref|XP_002445961.1| hypothetical protein SORBIDRAFT_07g028720 [Sorghum bicolor]
 gb|EES15456.1| hypothetical protein SORBIDRAFT_07g028720 [Sorghum bicolor]
Length=1070

 Score =   834 bits (2154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/806 (52%), Positives = 565/806 (70%), Gaps = 16/806 (2%)
 Frame = +2

Query  566   ETTRSQTQSFC------EAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAP  727
             E + SQT + C      E +K L+SR EG EMP NLQG IL++Q+Y   P D N LLF+P
Sbjct  266   ELSVSQTDNVCPETPFSELLKSLESRHEGVEMPVNLQG-ILVNQSYLASPSDLNNLLFSP  324

Query  728   DSQFRRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKG  907
             DS F++ + ELQG  D +  PW+  +D  S L RVVTYT   +KLVK+V+ATEEQTYLK 
Sbjct  325   DSDFKQTMVELQGCTDFKTEPWSLDNDGDS-LKRVVTYTTAPSKLVKAVRATEEQTYLKA  383

Query  908   DGKEFAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMK  1087
             DGKE+AVL+ VSTPDVP G+ F+ E+L+ IMPGP + S ++++HLVISW + F +STMMK
Sbjct  384   DGKEYAVLLSVSTPDVPCGTYFRTEILFRIMPGPEVDSQQQTSHLVISWRMNFLQSTMMK  443

Query  1088  TVIEGGTQQGLKDSFSEFSRFLAQHCKVI-TSAEVLDNGHLLATLPSEHPSDLELAREYF  1264
             ++IE G +QGL+ ++++FS  L+Q  K I       D   +LA+L     SD ++A  YF
Sbjct  444   SMIENGARQGLEQNYAQFSDLLSQKVKPIDVEGSGSDKEQVLASLQGGEESDWKIAFLYF  503

Query  1265  CNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRM  1444
             CNF V+S+ F+ LY  +H+L    + +QGLEF GLDLPDS+ EII  G+L L ++++ + 
Sbjct  504   CNFGVLSSLFVSLYIILHVLRVNPSAVQGLEFPGLDLPDSLSEIIMGGLLFLQVQRILKN  563

Query  1445  IAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTS  1624
             I  FV+AR ++G DHGV+A GDGW+LTVALIEG  LA +D TGF DP+VVFTCNGK+RTS
Sbjct  564   ITCFVQARGQKGGDHGVKAKGDGWLLTVALIEGIKLAPVDATGFSDPYVVFTCNGKTRTS  623

Query  1625  SVQLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELA  1804
             S++ QTL+PQWNEI EF+  ++PPS++ V V+DFDGPFD+  SLGHAEINF+K   +ELA
Sbjct  624   SIKFQTLEPQWNEIFEFDAMDDPPSVMSVHVYDFDGPFDEVTSLGHAEINFVKSNLSELA  683

Query  1805  DLWLPLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQ  1984
             D+W+PL G +AQS QSKLHLRIFLNN+ G   + + L+KMEKEVGKK+ LRSP  N+ FQ
Sbjct  684   DVWIPLKGNLAQSWQSKLHLRIFLNNSKGTGMVTEYLSKMEKEVGKKMTLRSPRTNTAFQ  743

Query  1985  KTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEIN  2164
             + F LP EEFLI+ F+C LKRKLP QG +FLS R +GFY+++FG KTKF+FLWEDIE+I 
Sbjct  744   ELFSLPAEEFLISSFTCYLKRKLPTQGHLFLSPRTIGFYSSMFGRKTKFYFLWEDIEDIQ  803

Query  2165  VLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALW  2344
              +P S S+  SPS++I LHK RG DA++GAKS+D  G+L FC  SF SF  A+RTIMALW
Sbjct  804   GIPQSISSW-SPSIIITLHKGRGMDAKHGAKSMD-NGKLKFCLQSFASFSVANRTIMALW  861

Query  2345  KTRACIPDQKAQIAEEQQYKDENNVLPEETGSYLIVED---VSMSKVYSVDLPMNHKSLM  2515
             K R+   + K Q+AEEQ     N +  E++G ++ +ED   + M++VYS  +  N  SLM
Sbjct  862   KARSLSTELKVQLAEEQ--SQINTLQSEDSGVFVGIEDAKSLQMTEVYSSTISTNMASLM  919

Query  2516  EMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKS  2695
             E+F GG LE KVM K GC  Y  + WE  +P+ Y+R++ YK ++ +S  G EVT TQ+KS
Sbjct  920   EVFAGGSLEMKVMEKVGCQKYSATQWESDKPNEYQRQIHYKFSKKLSPVGGEVTGTQQKS  979

Query  2696  VHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLE  2875
                N  GWI+ E+M + GV   D + + ++Y++E  +  + S    V +G+ W K+T+ +
Sbjct  980   PMPNKKGWIIEEVMELQGVLLGDFFTLHIKYQIEDLAPKQRSSNVQVSLGIEWSKSTRHQ  1039

Query  2876  DRITKNIVRKFSQRVKEMIEFVGREV  2953
              RI KN+    S R+KEM     RE+
Sbjct  1040  KRIEKNVFSSSSARLKEMFNLASREL  1065



>ref|XP_006601389.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Glycine max]
Length=1054

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/750 (54%), Positives = 541/750 (72%), Gaps = 7/750 (1%)
 Frame = +2

Query  566   ETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRR  745
             E  +S  ++F E +K +QS  +G E+P NL GG+L+DQ Y + P+D N+LLF+PDS F +
Sbjct  230   EEDQSSNETFEETMKEIQSADQGSEIPNNLLGGVLIDQLYIVAPEDLNVLLFSPDSNFPK  289

Query  746   ELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFA  925
              L++ QG  ++Q  PW  ++  ++ L R +TY K ATKL+K+V+A E+QTYLK DGK+FA
Sbjct  290   SLSDEQGITELQICPWKLENGGET-LKRSLTYIKAATKLIKAVKAYEDQTYLKADGKKFA  348

Query  926   VLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGG  1105
             VL  VSTPDV YGSTF+VE+LY I PGP L SGE+ + LVISW + F +STMMK +IE G
Sbjct  349   VLASVSTPDVMYGSTFRVEVLYVITPGPELPSGEQCSRLVISWQINFLQSTMMKGMIESG  408

Query  1106  TQQGLKDSFSEFSRFLAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYFCNFTVV  1282
              +QG+KDSF +++  L Q  K + S ++  +    LATL  E  S L+LA +Y  NFTV 
Sbjct  409   ARQGMKDSFDQYASLLCQTVKAVVSKDLGSSKEQALATLRPEPQSILKLAGQYLANFTVF  468

Query  1283  STAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVE  1462
             +T  +V Y  +HI L+    +QGLEF   DLPDS+GE + C  LVL  E+V  +I+ F++
Sbjct  469   TTFLMVSYVLVHIWLAAPGTIQGLEFVWFDLPDSIGEFVVCIALVLQGERVLGLISRFMQ  528

Query  1463  ARLR--RGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQL  1636
             AR R  +GSDHG++A G+GW+LTVALIEG+NLA++D + F DP+VVF+CNGK+RTSS++ 
Sbjct  529   ARARARKGSDHGIKAQGEGWMLTVALIEGSNLATVDSSAFCDPYVVFSCNGKTRTSSIKF  588

Query  1637  QTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWL  1816
             +  D  WNEI EF+  ++PPS+LDVEV+DFDGP D A SLGH EINFLK   ++LAD+W+
Sbjct  589   KKSDALWNEIFEFDAMDDPPSVLDVEVYDFDGPCDGAASLGHVEINFLKTNISDLADIWV  648

Query  1817  PLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFG  1996
              L GK+A +  SKLHL+IFLNN  G + ++  ++KMEKEVG K+NLRSP  NS FQK FG
Sbjct  649   SLEGKLALACHSKLHLKIFLNNTRGGDVVKHYISKMEKEVGTKINLRSPQTNSAFQKLFG  708

Query  1997  LPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPP  2176
             LPPEEFLINDF+C LKRK+PLQGR+F+S RI+GF+ANLFGHKTKFFFLWEDIE++ ++PP
Sbjct  709   LPPEEFLINDFTCHLKRKMPLQGRLFVSARIIGFHANLFGHKTKFFFLWEDIEDVQIIPP  768

Query  2177  SFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRA  2356
             +FS+MGSP +VI L   RG DAR+GAK+ DEEGRL F F SFVSF  A+RTIMALWK R+
Sbjct  769   TFSSMGSPIIVITLWPGRGVDARHGAKTQDEEGRLKFRFQSFVSFNVANRTIMALWKARS  828

Query  2357  CIPDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGD  2536
               P+QK ++ EE    +  ++  EE+GS++ + DVSMS+V+S  L +     ME+F+GG+
Sbjct  829   LSPEQKVKLVEEDS--ETKSLRSEESGSFIGLGDVSMSEVHSCALSVPASFFMELFSGGE  886

Query  2537  LEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAG  2716
             L+   M KSGC+NY  + W     DVYER + YK  + IS + VEVTSTQ++S+     G
Sbjct  887   LDRMFMEKSGCVNYSYTPWVSENSDVYERAIYYKFEKRISRYRVEVTSTQQRSL-LEGKG  945

Query  2717  WILNEIMAIHGVPFSDHYQVQLRYKVESCS  2806
             W+L E+   HGVP  D + + L Y +E  S
Sbjct  946   WLLKEVKNFHGVPLGDFFNLHLHYLIEDLS  975



>gb|KHN03556.1| C2 and GRAM domain-containing protein [Glycine soja]
Length=973

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/740 (54%), Positives = 536/740 (72%), Gaps = 7/740 (1%)
 Frame = +2

Query  566   ETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRR  745
             E  +S  ++F E +K +QS  +G E+P NL GG+L+DQ Y + P+D N+LLF+PDS F +
Sbjct  230   EEDQSSNETFEETMKEIQSADQGSEIPNNLLGGVLIDQLYIVAPEDLNVLLFSPDSNFPK  289

Query  746   ELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFA  925
              L++ QG  ++Q  PW  ++  ++ L R +TY K ATKL+K+V+A E+QTYLK DGK+FA
Sbjct  290   SLSDEQGITELQICPWKLENGGET-LKRSLTYIKAATKLIKAVKAYEDQTYLKADGKKFA  348

Query  926   VLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGG  1105
             VL  VSTPDV YGSTF+VE+LY I PGP L SGE+ + LVISW + F +STMMK +IE G
Sbjct  349   VLASVSTPDVMYGSTFRVEVLYVITPGPELPSGEQCSRLVISWQMNFLQSTMMKGMIESG  408

Query  1106  TQQGLKDSFSEFSRFLAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYFCNFTVV  1282
              +QG+KDSF +++  L Q  K + S ++  +    LATL  E  S L+LA +Y  NFTV 
Sbjct  409   ARQGMKDSFDQYASLLCQTVKAVVSKDLGSSKEQALATLRPEPQSILKLAGQYLANFTVF  468

Query  1283  STAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVE  1462
             +T  +V Y  +HI L+    +QGLEF   DLPDS+GE + C  LVL  E+V  +I+ F++
Sbjct  469   TTFLMVSYVLVHIWLAAPGTIQGLEFVWFDLPDSIGEFVVCIALVLQGERVLGLISRFMQ  528

Query  1463  ARLR--RGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQL  1636
             AR R  +GSDHG++A G+GW+LTVALIEG+NLA++D + F DP+VVF+CNGK+RTSS++ 
Sbjct  529   ARARARKGSDHGIKAQGEGWMLTVALIEGSNLATVDSSAFCDPYVVFSCNGKTRTSSIKF  588

Query  1637  QTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWL  1816
             +  D  WNEI EF+  ++PPS+LDVEV+DFDGP D A SLGH EINFLK   ++LAD+W+
Sbjct  589   KKSDALWNEIFEFDAMDDPPSVLDVEVYDFDGPCDGAASLGHVEINFLKTNISDLADIWV  648

Query  1817  PLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFG  1996
              L GK+A +  SKLHL+IFLNN  G + ++  ++KMEKEVG K+NLRSP  NS FQK FG
Sbjct  649   SLEGKLALACHSKLHLKIFLNNTRGGDVVKHYISKMEKEVGTKINLRSPQTNSAFQKLFG  708

Query  1997  LPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPP  2176
             LPPEEFLINDF+C LKRK+PLQGR+F+S RI+GF+ANLFGHKTKFFFLWEDIE++ ++PP
Sbjct  709   LPPEEFLINDFTCHLKRKMPLQGRLFVSARIIGFHANLFGHKTKFFFLWEDIEDVQIIPP  768

Query  2177  SFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRA  2356
             +FS+MGSP +VI L   RG DAR+GAK+ DEEGRL F F SFVSF  A+RTIMALWK R+
Sbjct  769   TFSSMGSPIIVITLWPGRGVDARHGAKTQDEEGRLKFRFQSFVSFNVANRTIMALWKARS  828

Query  2357  CIPDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGD  2536
               P+QK ++ EE    +  ++  EE+GS++ + DVSMS+V+S  L +     ME+F+GG+
Sbjct  829   LSPEQKVKLVEEDS--ETKSLRSEESGSFIGLGDVSMSEVHSCALSVPASFFMELFSGGE  886

Query  2537  LEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAG  2716
             L+   M KSGC+NY  + W     DVYER + YK  + IS + VEVTSTQ++S+     G
Sbjct  887   LDRMFMEKSGCVNYSYTPWVSENSDVYERAIYYKFEKRISRYRVEVTSTQQRSL-LEGKG  945

Query  2717  WILNEIMAIHGVPFSDHYQV  2776
             W+L E+   HGVP  D + V
Sbjct  946   WLLKEVKNFHGVPLGDFFNV  965



>ref|XP_003574689.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Brachypodium distachyon]
Length=1065

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/810 (51%), Positives = 567/810 (70%), Gaps = 11/810 (1%)
 Frame = +2

Query  539   PSDYEDNVQETTRSQTQS-FCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNML  715
             P+ +E +V ++    +++ F E ++  +SR EG EMP NLQG IL++Q+Y   P D N L
Sbjct  258   PAGFEASVSQSDDMCSEAPFDELLRSFESRHEGVEMPVNLQG-ILINQSYFTSPNDLNNL  316

Query  716   LFAPDSQFRRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQT  895
             LF+PDS FRR L +LQG  D    PW   +  ++ L RV+TYT   +KLVK+V+ATEEQ+
Sbjct  317   LFSPDSDFRRTLVQLQGCTDFTSEPWIIGNGGET-LKRVITYTTAPSKLVKAVRATEEQS  375

Query  896   YLKGDGKEFAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKS  1075
             YLK DGKE++VL+  STPDVP G+ F+ E+L+ IMPGP L S ++++HLVISW + F +S
Sbjct  376   YLKADGKEYSVLLSASTPDVPCGTYFRTEVLFRIMPGPELDSEQQTSHLVISWRMNFLQS  435

Query  1076  TMMKTVIEGGTQQGLKDSFSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELA  1252
             TMMK +IE G +QGL+ ++++F   L++  K I   +   D   +L++L     SD ++A
Sbjct  436   TMMKGIIENGARQGLEQNYAQFLDLLSEKVKPIDVEDAGSDKEQVLSSLQGGQESDWKIA  495

Query  1253  REYFCNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQ  1432
               YFCNF V+S+ F+ LY  +H+ L  S  +QGLEF GLDLPDS+ EI+  G+L L ++ 
Sbjct  496   FLYFCNFGVLSSLFVALYIVVHVSLVNSGAVQGLEFPGLDLPDSLSEIVMGGLLFLQVQN  555

Query  1433  VYRMIAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGK  1612
             +Y+ +  F +AR ++  DHGV+A GDGW+LTVALIEGT LA +D TGF DP+VVFTCNGK
Sbjct  556   MYKKLMCFFQAREQKVGDHGVKAQGDGWLLTVALIEGTKLAPVDATGFSDPYVVFTCNGK  615

Query  1613  SRTSSVQLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTS  1792
             ++TSS++ QTL+PQWN+I EF+  ++PPS+++V V+DFDGPFD+  SLGHAEINF+K   
Sbjct  616   TKTSSIKFQTLEPQWNDIFEFDAMDDPPSVMNVHVYDFDGPFDEVTSLGHAEINFVKSNL  675

Query  1793  AELADLWLPLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRN  1972
             +ELAD+W+PL G +AQS QSKLHLRIFLNN+ G   + + L+KMEKEVGKK+ LRSP  N
Sbjct  676   SELADVWIPLQGNLAQSRQSKLHLRIFLNNSKGTGMVTEYLSKMEKEVGKKMTLRSPRTN  735

Query  1973  STFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDI  2152
             + FQ+ F LP EEFLI+ F+C LKRKL  QG +FLS RI+GFY+++FG KTKFFFLWEDI
Sbjct  736   TAFQELFSLPAEEFLISSFTCYLKRKLHTQGHLFLSPRIIGFYSSMFGRKTKFFFLWEDI  795

Query  2153  EEINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTI  2332
             E+I  +PPS  +  SPSL IILHK RG DA++GAKS+ E G+L F   SF SF  A+RTI
Sbjct  796   EDIQAIPPS-LSSWSPSLAIILHKGRGMDAKHGAKSV-ENGKLKFSLQSFASFSVANRTI  853

Query  2333  MALWKTRACIPDQKAQIAEEQQYKDENNVLPEETGSYLIVED---VSMSKVYSVDLPMNH  2503
             MALWK R+   + K QIAEEQ +   N +  E++G +  VED   + MS+V+S  +  N 
Sbjct  854   MALWKARSLSSETKVQIAEEQSHN--NTLQSEDSGIFAGVEDSKSLQMSEVFSSVISANM  911

Query  2504  KSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTST  2683
              SLME+F GG LE KVM K GCL Y  + WE  +PD Y+R++ YK +R +S  G EVT T
Sbjct  912   ASLMEVFGGGSLEMKVMEKVGCLKYSATQWEPDKPDEYQRQIHYKFSRKLSPVGGEVTGT  971

Query  2684  QRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKN  2863
             Q KS   N+ GWI+ E+M + GV   D + + ++Y+VE  +  + +C   VY+G+ W K 
Sbjct  972   QLKSPMPNNKGWIIEEVMELQGVLLGDFFTLHIKYQVEDLAPKQKACSVQVYLGIEWSKT  1031

Query  2864  TKLEDRITKNIVRKFSQRVKEMIEFVGREV  2953
             T+ + RI KN++   S R+KEM     +++
Sbjct  1032  TRHQKRIEKNVLSSSSARLKEMFSLASKQL  1061



>ref|XP_010227753.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 isoform 
X2 [Brachypodium distachyon]
Length=991

 Score =   820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/802 (49%), Positives = 553/802 (69%), Gaps = 48/802 (6%)
 Frame = +2

Query  563   QETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFR  742
             Q++  S   SF E +K  +SR EG EMP NL GG+L+DQ YA+ P D N LLF+P S F 
Sbjct  237   QDSESSVNMSFDELLKAFESRHEGNEMPANLSGGVLVDQVYAVAPSDLNTLLFSPSSDFL  296

Query  743   RELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEF  922
             R LA++QGT  +    W  ++D  + L RVV+YTK ATKLVK+V+ATE+ TYLK DG  +
Sbjct  297   RSLADMQGTTGLDIQQWRLENDG-AVLKRVVSYTKAATKLVKAVKATEDMTYLKADGDRY  355

Query  923   AVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEG  1102
             AVL DVSTP+VP+G+TF+VE+L  +MPGP L S    + LV+SW + F +STMMK +IE 
Sbjct  356   AVLADVSTPEVPFGNTFRVEILTCLMPGPELNS----SRLVVSWRLNFVQSTMMKGMIEN  411

Query  1103  GTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVV  1282
             G +QGLKD+F++FS  LAQ+ + + + +   N   L+++  E  SD +LA   F NFTVV
Sbjct  412   GAKQGLKDNFNQFSELLAQNVRPVDAKDTTANNQSLSSVQPERESDWKLAFRIFGNFTVV  471

Query  1283  STAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVE  1462
             S+ F  +Y   HI+L+  + +QGLEF GLDLPDS GE++ CG+LVL  ++V  MIA F++
Sbjct  472   SSFFAFIYVFSHIILASPSIIQGLEFPGLDLPDSAGEVVVCGVLVLQGQRVLNMIARFIQ  531

Query  1463  ARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQT  1642
             A+ +RGSDHGV+A GDGW+LTVALI+GTNLA+   +G+ DP+VVFTCNGK++TSS++  T
Sbjct  532   AKRQRGSDHGVKAKGDGWLLTVALIDGTNLAATKSSGYSDPYVVFTCNGKTKTSSIKFHT  591

Query  1643  LDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPL  1822
             L+PQWNEI EF+  E+PPS++++ V+DFDGPFD+  SLGH E+NFL+++ +ELAD+W+PL
Sbjct  592   LEPQWNEIFEFDAMEDPPSVMEINVYDFDGPFDEVASLGHVEVNFLRYSISELADIWIPL  651

Query  1823  GGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLP  2002
              GK+AQ+ Q+KLHLRIFLNN+ G E +++ L +MEKEVG+K                   
Sbjct  652   KGKLAQACQTKLHLRIFLNNSRGTEIVKNYLDRMEKEVGRK-------------------  692

Query  2003  PEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSF  2182
                                 GR+FLS RI+GFY NLFGHKTKFFFLWEDIEEI ++P + 
Sbjct  693   --------------------GRLFLSPRIIGFYTNLFGHKTKFFFLWEDIEEIQLVPATL  732

Query  2183  STMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACI  2362
             S+MGSPSL+I L K RG DAR+GAK +DEEGRL F   SFVSF  A +TIMALWK R+  
Sbjct  733   SSMGSPSLLITLRKGRGMDARHGAKQLDEEGRLKFHLQSFVSFNAAHKTIMALWKARSLT  792

Query  2363  PDQKAQIAEEQ-QYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDL  2539
             P++K Q+ EE+ + KD  N   EE+GS+L +ED  MS+V+S   P +   LM +F GG +
Sbjct  793   PEEKIQLVEEESETKDLQN---EESGSFLGIEDAKMSEVFSSTKPFDVPILMGIFEGGPV  849

Query  2540  EHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGW  2719
             EH+VM K GC++Y  ++WE +   +Y+R+V Y+ +  ++    EV STQ+KS+  +  GW
Sbjct  850   EHRVMEKVGCVDYSVTTWEPVRAGIYQRQVHYRFDMKLARREGEVMSTQQKSLLPDKNGW  909

Query  2720  ILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIV  2899
             ++ E+M + G+P  +++ + +RY++E  ++ + SC   V++G+ WLK+ K + +IT+ + 
Sbjct  910   LVEEVMTLEGIPVGEYFNLHIRYQLEQIASKQKSCSVQVFIGMAWLKSCKNQKKITQEVK  969

Query  2900  RKFSQRVKEMIEFVGREVFLSS  2965
                S R+K++   + +E   +S
Sbjct  970   SNASSRLKKIFSQLEKEFIPAS  991



>gb|EPS70354.1| hypothetical protein M569_04402, partial [Genlisea aurea]
Length=1011

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/809 (50%), Positives = 558/809 (69%), Gaps = 22/809 (3%)
 Frame = +2

Query  551   EDNVQETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPD  730
             E N +E   + +  F E +K+++ R +G E+P  L GG++LDQ Y       N +LF+ D
Sbjct  214   EQNSEE--HASSSDFQELMKIMEMRDQGVEIPAALSGGVILDQLYESESGLLNSVLFSQD  271

Query  731   SQFRRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGD  910
             S F   LAE+Q + D+Q  PW +++D  S L R VTYTK A+KLVK+++  EEQ Y+K D
Sbjct  272   SGFLHSLAEIQRSTDLQVSPWIFENDGGS-LKRTVTYTKAASKLVKALKTIEEQKYIKAD  330

Query  911   GKEFAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKT  1090
             GK FAV    +TPD PYG TFKVE+LY I PG       +S+ L +SW V F +S++MK 
Sbjct  331   GKTFAVFSTATTPDAPYGKTFKVEVLYCITPG---LDQYQSSRLEVSWNVSFSQSSIMKG  387

Query  1091  VIEGGTQQGLKDSFSEFSRFLAQHCKVITSAEVL--DNGHLLATLPSEHPSDLELAREYF  1264
             VIE G +QG+K+SF ++   ++Q+ K +   + +  +   LL +L  E  S  +L  +YF
Sbjct  388   VIENGVKQGIKESFDQYKALVSQNVKPLDIKDAMSSEKDQLLGSLLVEKQSGWKLGVQYF  447

Query  1265  CNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRM  1444
              NFTV+ST  + LY  IH+ L+  + +QGLEF GLDLPD+ GE +  G+LVL   ++  +
Sbjct  448   ANFTVLSTILMFLYVFIHMFLTIPSSVQGLEFPGLDLPDTFGEFMVSGLLVLQGRRMLEL  507

Query  1445  IAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTS  1624
             ++ F++AR ++GSDHGV+A G+GW+LTVALI+GT+LAS+D  GF DP+VVFTCNGK++TS
Sbjct  508   LSRFMKARAQKGSDHGVKAKGNGWLLTVALIQGTSLASVDSNGFSDPYVVFTCNGKTKTS  567

Query  1625  SVQLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELA  1804
             S++ Q  DP WNEI EF+  +EPPS+L  EVFDFDGPFD+A SLG AEINF++   ++L+
Sbjct  568   SIKFQKADPLWNEIFEFDAMDEPPSVLTAEVFDFDGPFDEATSLGSAEINFVRSNISDLS  627

Query  1805  DLWLPLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQ  1984
             D+W+PL GK+A +  SKLHLRIFL+NN G    +D +TKMEKEVGKK+ LRSP  NS FQ
Sbjct  628   DIWIPLKGKLAHACDSKLHLRIFLDNNKGCSAYKDYITKMEKEVGKKIKLRSPQTNSAFQ  687

Query  1985  KTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEIN  2164
             K F LPPEEFLINDFSC LKRK+PLQGR+FLS RI+GF+ +LFGHKT FF LWEDIE I 
Sbjct  688   KIFRLPPEEFLINDFSCHLKRKMPLQGRLFLSARILGFHTDLFGHKTTFFLLWEDIEAIE  747

Query  2165  VLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALW  2344
             V+PP+ S+MGSP +V+ L   RG D+ +GAKS D EGRL + FHSFVSF  A RTIMALW
Sbjct  748   VIPPTLSSMGSPIMVVTLRPGRGLDSVHGAKSQDSEGRLKYHFHSFVSFNVAHRTIMALW  807

Query  2345  KTRACIPDQKAQIAEEQQYKDENNVLPEETGSYL--IVEDVSMSKVYSVDLPMNHKSLME  2518
             ++RA  P+QK +I EE+ +  ++     E+GS+L    ED+ MS VYS  L       ME
Sbjct  808   RSRAMTPEQKVKIVEEESHPTDD-----ESGSFLGAAAEDIKMSVVYSSALRFPASFFME  862

Query  2519  MFNGGDLEHKVMSKSGCLNYVTSSW-----ELIEPDVYERRVSYKLNRLISIFGVEVTST  2683
             +F+GG++E + M  +GCLNY  +SW        E +V+ R++ Y+ ++ +S +G EVTST
Sbjct  863   LFDGGEIELRAMEIAGCLNYSFTSWEVEEKVPPEEEVHRRQIYYRFDKPVSPYGGEVTST  922

Query  2684  QRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKN  2863
             QRKS   +  G+++ E++ +H VP  D++ VQLRY VE    +   CR +V+ GV WLK 
Sbjct  923   QRKSRLRH--GYLVEEVVTLHDVPLGDYFNVQLRYHVEDEEGSGFGCRVEVFFGVGWLKY  980

Query  2864  TKLEDRITKNIVRKFSQRVKEMIEFVGRE  2950
             T+ + RI+KNI+    +R+K M++ + +E
Sbjct  981   TRNQKRISKNIMFNVQRRIKSMVDLLEKE  1009



>ref|XP_008224646.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 isoform 
X2 [Prunus mume]
Length=862

 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/633 (62%), Positives = 486/633 (77%), Gaps = 7/633 (1%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             +F E ++ +QSR +  E P NL GG+LLDQ Y  PP+D N  LF PDS F + LAE+QGT
Sbjct  229   TFEELMRTMQSRDQVSETPSNLPGGVLLDQLYVTPPQDINTFLFLPDSGFPKSLAEVQGT  288

Query  770   KDVQEGPWTWKSDNKS-CLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVST  946
              +++ GPW  K DN S  + RVVTY K ATKL+K+ + TE+Q YLK DGK FAVL  VST
Sbjct  289   TELEVGPW--KLDNSSESVKRVVTYVKAATKLIKACKGTEDQVYLKADGKVFAVLSSVST  346

Query  947   PDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKD  1126
             PDVPYG TF+ ELLY I PGP L SGE+S+ LVISW + F +STMMK +IE G +QGLKD
Sbjct  347   PDVPYGRTFRTELLYCITPGPELPSGEQSSRLVISWRMNFLQSTMMKGMIENGARQGLKD  406

Query  1127  SFSEFSRFLAQHCKVITSAEVLDN-GHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVL  1303
             SF +F+  L+Q+ K + S ++  N   +LA+L +E  SD +LA +YF NFTVVST F+ L
Sbjct  407   SFDQFATLLSQNVKPVDSKDLGSNKDQVLASLQAEPQSDWKLAVQYFGNFTVVSTVFIGL  466

Query  1304  YFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGS  1483
             Y  +HI L+  + +QGLEF GLDLPDS+GE I CG+LVL  E+V  +I+ F++AR ++GS
Sbjct  467   YMLVHIWLATPSTIQGLEFVGLDLPDSIGEFIVCGVLVLQGERVLGLISRFMQARAQKGS  526

Query  1484  DHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNE  1663
             DHGV+A GDGW+LTVALIEG+N+A++D +GF DP+VVFTCNGK+RTSS++ Q  DP WNE
Sbjct  527   DHGVKAQGDGWLLTVALIEGSNIAAVDSSGFSDPYVVFTCNGKTRTSSIKFQKCDPTWNE  586

Query  1664  ILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQS  1843
             I EF+  +EPPS+LDVE++DFDGPFD+A SLGHAEINF+K   ++LADLW+PL GK+AQ+
Sbjct  587   IFEFDAMDEPPSVLDVEIYDFDGPFDEAISLGHAEINFVKTNISDLADLWVPLRGKLAQA  646

Query  1844  SQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIN  2023
              QSKLHLRIFLNN  G       LTKMEKEVGKK+ +RSP  NS FQK FGLPPEEFLIN
Sbjct  647   CQSKLHLRIFLNNTRGGNVANHFLTKMEKEVGKKITVRSPQTNSAFQKLFGLPPEEFLIN  706

Query  2024  DFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPS  2203
             DF+C LKRK+PLQGR+FLS RI+GF+ANLFGHKTKFFFLWEDIEEI V+PPS S+MGSP 
Sbjct  707   DFTCHLKRKMPLQGRLFLSARIIGFHANLFGHKTKFFFLWEDIEEIQVVPPSLSSMGSPI  766

Query  2204  LVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQI  2383
             +V+ L   RG DAR+GAK+ D EGRL F F SFVSF  A RTIMALWK R+  P+QK QI
Sbjct  767   VVMTLRPGRGMDARHGAKTQDGEGRLKFHFQSFVSFNVAHRTIMALWKARSLSPEQKVQI  826

Query  2384  AEEQQYKDENNVLPEETGSYLIVEDVSMSKVYS  2482
              EE+    E  +  EE+GS+L ++DVSMS+VYS
Sbjct  827   VEEES---EVKIQSEESGSFLGLDDVSMSEVYS  856



>ref|XP_008645404.1| PREDICTED: uncharacterized protein LOC100383749 isoform X1 [Zea 
mays]
Length=1069

 Score =   815 bits (2105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/791 (51%), Positives = 557/791 (70%), Gaps = 10/791 (1%)
 Frame = +2

Query  593   FCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTK  772
             F E ++ L+ R EG +MP NLQG IL++Q+Y   P D N LLF+PDS F++ + ELQG  
Sbjct  281   FSELLRSLELRHEGVDMPVNLQG-ILVNQSYLASPSDLNNLLFSPDSDFKQTMVELQGCT  339

Query  773   DVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPD  952
             D +  PW   +  +S L RVVTYT   +KLVK+V ATEEQ+YLK DGKE+AVL+ VSTPD
Sbjct  340   DFKTEPWRLDNGGES-LKRVVTYTTAPSKLVKAVHATEEQSYLKADGKEYAVLLSVSTPD  398

Query  953   VPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSF  1132
             VP G+ F+ E+L+ IMPGP L S ++++HLVISW + F +STM+K++IE G +QGL+ ++
Sbjct  399   VPCGTYFRTEILFRIMPGPELDSQQQTSHLVISWRMNFLQSTMIKSMIENGARQGLEQNY  458

Query  1133  SEFSRFLAQHCKVI-TSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYF  1309
             ++FS  L+Q  K I       D   +LA+L     SD ++A  YFCNF V+S+ F+ LY 
Sbjct  459   AQFSDLLSQKIKPIDVEGSGSDKEQVLASLQGGEESDWKIAFLYFCNFGVLSSFFVSLYI  518

Query  1310  SIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDH  1489
              +H+L    + +QGLEF GLDLPDS+ EII  G+L L ++++ + I  F++AR ++G DH
Sbjct  519   ILHVLRVNPSAVQGLEFPGLDLPDSLSEIIMGGLLFLQVQRILKNITCFLQAREQKGGDH  578

Query  1490  GVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEIL  1669
             G++A GDGW+LTVALI+G  LA +D TG  DP+VVFTCNGK+RTSS++ QTL+PQWNEI 
Sbjct  579   GMKAKGDGWLLTVALIDGIKLAPVDATGLSDPYVVFTCNGKTRTSSIKFQTLEPQWNEIF  638

Query  1670  EFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQ  1849
             EF+  ++PPS++ V V+DFDGPFD+  SLGHAEINF+K   +ELAD+W+PL G +AQS Q
Sbjct  639   EFDAMDDPPSVMSVHVYDFDGPFDEVTSLGHAEINFVKSNLSELADVWIPLKGNLAQSWQ  698

Query  1850  SKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDF  2029
             SKLHLRIFLNN+ G   + + L+KMEKEVGKK+ LRSP  N+ FQ+ F LP EEFLI+ F
Sbjct  699   SKLHLRIFLNNSKGTGMVTEYLSKMEKEVGKKMTLRSPRTNTAFQELFSLPAEEFLISSF  758

Query  2030  SCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLV  2209
             +C LKRKLP QG++FLS R +GFY+++FG KTKF+FLWEDIE+I  +P S S+  SPS++
Sbjct  759   TCYLKRKLPTQGQVFLSPRTIGFYSSMFGRKTKFYFLWEDIEDIQGIPQSISSW-SPSII  817

Query  2210  IILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAE  2389
             I LHK RG D ++GAKS+D  G+L FC  SF SF  A+RTIMALWK R+   + K Q+AE
Sbjct  818   ITLHKGRGMDTKHGAKSMD-NGKLKFCLQSFASFSVANRTIMALWKARSLSTELKVQLAE  876

Query  2390  EQQYKDENNVLPEETGSYLIVED---VSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSK  2560
             EQ     N +  E++G ++ +ED   + M++V+S  +  N  SLME+F GG LE KVM K
Sbjct  877   EQSQI--NTLQSEDSGVFVGIEDAKSLQMTEVFSSTISTNMASLMEVFAGGSLEMKVMDK  934

Query  2561  SGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMA  2740
              GC  Y  + WE  +P+ Y+R++ YK ++ +S  G EVT TQ+KS+  N  GW++ E+M 
Sbjct  935   VGCQKYSATQWESDKPNEYQRQIHYKFSKKLSPVGGEVTGTQQKSLMPNKKGWVIEEVME  994

Query  2741  IHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRV  2920
             + GV   D + + ++Y+VE  +  + +    V +G+ W K+T+ + RI KN++   S R+
Sbjct  995   LQGVLLGDFFTLHIKYQVEDLAPKQRASNVQVSLGIEWSKSTRHQKRIEKNVLSSSSARL  1054

Query  2921  KEMIEFVGREV  2953
             KEM     RE+
Sbjct  1055  KEMFNLASREL  1065



>ref|XP_004152568.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170-like 
[Cucumis sativus]
 ref|XP_004157825.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170-like 
[Cucumis sativus]
 gb|KGN64342.1| hypothetical protein Csa_1G046860 [Cucumis sativus]
Length=818

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/708 (59%), Positives = 532/708 (75%), Gaps = 15/708 (2%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVDAIKV-SSPKKVLEGKQLIKSIAG  445
             GK+LL +SLHGKG+ ++ + A     +      K +D +   SS  K ++ K   K+I  
Sbjct  117   GKVLLIVSLHGKGNVINQSSATNTNTN-----PKPLDLVGAKSSSSKAVKWKPNKKTIVS  171

Query  446   HLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCEAIKLLQSR  625
              LE+LF K++E ++++            SS  SD E+ +         SF EAI+ LQ R
Sbjct  172   RLERLFHKSDEDTRTDNSSES-------SSAMSDTEERI--NGHLSESSFDEAIETLQLR  222

Query  626   TEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEGPWTWKS  805
             + G EMPENL GG+L+DQ Y + P D N LLF+  SQFRRELAE QG  +++EG W+WK 
Sbjct  223   SNGEEMPENLSGGVLVDQVYVVSPGDLNRLLFSTGSQFRRELAEHQGITNLEEGTWSWKR  282

Query  806   DNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGSTFKVEL  985
              +  CL+R+V+Y K ATK+V ++ ATEEQTY+KGDG EFAVLV+V+TP+VP+G+ F VEL
Sbjct  283   GDVPCLSRIVSYRKPATKVVGAINATEEQTYVKGDGWEFAVLVNVNTPEVPFGNAFNVEL  342

Query  986   LYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRFLAQHC  1165
             LY IMPGP L SGEE++H V+SW + F  STMMK +IE G +QGL+++F +F+  LAQH 
Sbjct  343   LYKIMPGPELISGEETSHFVVSWGMNFLHSTMMKGMIEKGARQGLEENFVQFTNLLAQHL  402

Query  1166  KVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHILLSRSTQL  1345
             K   S E+L+ GH+L+   +   S+ ELAR+YF NFTV+ST F+++Y  +HI+LS+    
Sbjct  403   KSPNSTELLNKGHVLSASENNRQSNFELARQYFWNFTVLSTLFVLVYVLVHIILSKPKTT  462

Query  1346  QGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHGDGWVLT  1525
             QGLEF G+DLPDS+GE++T GILVL LE+VY M++HF++ARL+RG DHGV+  GDGW+LT
Sbjct  463   QGLEFIGMDLPDSLGELVTSGILVLQLERVYNMVSHFIQARLKRGGDHGVKGQGDGWILT  522

Query  1526  VALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEEPPSML  1705
             + L+EG N++SLD +G  DP VVFTCNGK RTSSV+LQT +PQWNEILEF+  +EPPS+L
Sbjct  523   IVLLEGVNISSLDSSGSSDPCVVFTCNGKKRTSSVELQTHEPQWNEILEFDAMKEPPSVL  582

Query  1706  DVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRIFLNNN  1885
              VEVFDFDGPFDQA SLGHAEINFLK+ S ELAD+W+PL GK+AQSSQSKLHLRIFL N 
Sbjct  583   YVEVFDFDGPFDQATSLGHAEINFLKYKSTELADIWVPLEGKLAQSSQSKLHLRIFLENT  642

Query  1886  NGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRKLPLQG  2065
             +G+ETIR  L+   KEVGKKL+ RSP+RNSTFQK FGLP EEFL++DF+CSLKRK+ LQG
Sbjct  643   DGIETIRQYLSMKGKEVGKKLHPRSPYRNSTFQKLFGLPAEEFLVSDFTCSLKRKMLLQG  702

Query  2066  RIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDRGTDAR  2245
             R+FLS R++GFYAN FG KTKFFFLWEDIE+I VL PS S++GSPSLVIIL K RG +A 
Sbjct  703   RLFLSARVIGFYANFFGQKTKFFFLWEDIEDIQVLHPSLSSLGSPSLVIILKKGRGLEAS  762

Query  2246  NGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAE  2389
             +GAKS DEEGRL F   SFVSF  ASRTI+ +W+TR    DQKAQ+AE
Sbjct  763   HGAKSQDEEGRLRFYLQSFVSFNVASRTIIGMWRTRTSTLDQKAQVAE  810



>ref|XP_006656227.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Oryza brachyantha]
Length=1097

 Score =   809 bits (2090),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/786 (48%), Positives = 544/786 (69%), Gaps = 6/786 (1%)
 Frame = +2

Query  599   EAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDV  778
             E +K ++S+ +G EMP NL GG+L+D++Y   P + N LLF+ +S F   ++ELQGT   
Sbjct  310   ELLKAMESKDQGSEMPGNLPGGVLVDESYVAAPAELNSLLFSKNSDFWPAVSELQGTSGF  369

Query  779   QEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVP  958
             Q  PW   S N SCL R +TY K A+KLVK+V+ATEEQ YLK  G  FAV   VSTPDVP
Sbjct  370   QIEPWKLDS-NGSCLQRTLTYIKAASKLVKAVKATEEQKYLKAAGNSFAVFSVVSTPDVP  428

Query  959   YGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSE  1138
              G+ FK+E+LY I PGP L S E+++HL +SW V F +STMMK +IE G +QG+ + FS+
Sbjct  429   CGNCFKIEILYCITPGPSLASEEQTSHLTVSWRVNFVQSTMMKGMIESGAKQGMAEGFSQ  488

Query  1139  FSRFLAQHCKVITSAEVLDNGH-LLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSI  1315
             FS  L+Q  KV  + +   N   +L++L ++  S   L   + CNFT + +  +  Y   
Sbjct  489   FSEILSQKMKVAEADDANSNKEKILSSLHAQKESGWRLIVRFLCNFTFIFSVIIASYVIA  548

Query  1316  HILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGV  1495
             H+ LS+   + GLE+ G+DLPDS+GE++ C +L+L  + ++ +   F+ A  ++GSDHGV
Sbjct  549   HLHLSKPNAMHGLEYFGIDLPDSIGEVVVCAVLILQGQNIFNISKRFLNAWKQKGSDHGV  608

Query  1496  RAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEF  1675
             +AHGDGW++TVALIEGT + +   T   D + VFTCN K +TSSV+ QT DP+WNEI EF
Sbjct  609   KAHGDGWLMTVALIEGTGIIAAGSTELFDMYAVFTCNTKRKTSSVKFQTSDPKWNEIYEF  668

Query  1676  EPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSK  1855
             +  ++PPS +DV + D +GPFDQA  +GH E+NFLK   ++L D+WLPL GK  Q++  K
Sbjct  669   DAMDDPPSRMDVAIHDANGPFDQA-PIGHTEVNFLKSNLSDLTDVWLPLDGKCDQTNNPK  727

Query  1856  LHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSC  2035
             +HLRIFLNN+ G E + + L KM KEVGKK+NLRS   N+ F+K F LP EEFLI+DF+C
Sbjct  728   IHLRIFLNNSRGTEVVMNYLAKMGKEVGKKINLRSTQTNAAFRKLFNLPSEEFLIDDFTC  787

Query  2036  SLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVII  2215
              LKRK+PLQGR+F S RI+GFY+N+FGHKTKFFFLW+D+++I V+PP+ S +GSPSL+II
Sbjct  788   HLKRKMPLQGRLFFSPRIIGFYSNIFGHKTKFFFLWDDVDDIQVIPPALS-IGSPSLMII  846

Query  2216  LHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQ  2395
             L K RG++A++GAK  D  GRL + F SFVSF  A R IMA+WK R+  P+QK  + E++
Sbjct  847   LRKGRGSEAKHGAKGTDPHGRLKYYFQSFVSFNDAHRIIMAIWKMRSLGPEQKGDMIEKE  906

Query  2396  QYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLN  2575
                D  ++  +E G+    EDV MS+++S  L ++ +SLMEMF+GG LEH++M K+GCL+
Sbjct  907   --PDVKDLQIDEGGTLFTQEDVKMSEIFSSVLSVDVESLMEMFSGGPLEHRMMQKAGCLD  964

Query  2576  YVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVP  2755
             Y  + WEL+  ++Y+R+VSY+ ++ +S +G E T+ Q+K    N  GW + E+M + GV 
Sbjct  965   YSATEWELVNRNIYQRQVSYRFDKTLSRYGGEATTNQQKYALVNQDGWAIEEVMTLQGVL  1024

Query  2756  FSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIE  2935
               D++ +Q++Y + +  +  N+C   V +G+ WLK+TK + +ITK+++   S R+KE+  
Sbjct  1025  LGDYFSIQMKYNMVNVPSKPNTCSVQVLLGIAWLKSTKQQKKITKSVISNSSIRLKELFA  1084

Query  2936  FVGREV  2953
              V +++
Sbjct  1085  EVEKDL  1090



>ref|NP_001174893.1| Os06g0607900 [Oryza sativa Japonica Group]
 gb|AAU09489.1| no pollen [Oryza sativa Japonica Group]
 dbj|BAH93621.1| Os06g0607900 [Oryza sativa Japonica Group]
Length=1086

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/797 (47%), Positives = 548/797 (69%), Gaps = 6/797 (1%)
 Frame = +2

Query  566   ETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRR  745
             E+  S   S  E +K ++S+ +G EMP NL GG+L+D++Y   P + N LLF+ +S F  
Sbjct  288   ESGTSSESSLDELLKTMESKDQGCEMPANLPGGVLIDESYVAAPTELNSLLFSKNSDFWP  347

Query  746   ELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFA  925
              ++ELQGT   Q  PW    +N++CL R +TYTK A+KLVK+V+ATEEQ YLK  G  FA
Sbjct  348   AVSELQGTSGFQIEPWKL-DNNETCLQRTLTYTKAASKLVKAVKATEEQKYLKAAGNSFA  406

Query  926   VLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGG  1105
             V   VSTPDVP G  FK+E+LY I PGP L S E+++HL +SW V F +STMMK +IE G
Sbjct  407   VHSVVSTPDVPCGGCFKIEILYCITPGPSLSSEEQTSHLTVSWRVNFVQSTMMKGMIESG  466

Query  1106  TQQGLKDSFSEFSRFLAQHCKVITSAEVLDNGH-LLATLPSEHPSDLELAREYFCNFTVV  1282
              +QG+ + F+ FS  L+Q  KV  + +   N   +L++L ++  S   L   +  NFT +
Sbjct  467   AKQGMAEGFAHFSEILSQKIKVAEADDANSNKEKILSSLHAQKESGWRLIVRFLFNFTFI  526

Query  1283  STAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVE  1462
              +  +  Y   H+ LS+   + GLE+ G+DLPDS+GE++ C +L+L  + ++ +I  F+ 
Sbjct  527   FSVIIASYVIAHLHLSKPNAMHGLEYFGIDLPDSIGEVVVCAVLILQGQNIFNIIKRFLN  586

Query  1463  ARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQT  1642
             A  ++GSDHGV+AHGDGW++TVALIEGT + + +     D + VFTCN K +TSSV+ QT
Sbjct  587   AWKQKGSDHGVKAHGDGWLMTVALIEGTGITNSNSKELFDMYAVFTCNAKRKTSSVKFQT  646

Query  1643  LDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPL  1822
              +P+WNEI EF+  ++PPS +DV + D +GPFDQ+  +GHAE+NFLK   ++L D+WLPL
Sbjct  647   SEPKWNEIYEFDAMDDPPSRMDVAIHDANGPFDQS-PIGHAEVNFLKSNLSDLTDVWLPL  705

Query  1823  GGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLP  2002
              GK  Q+S  K+HLRIFLNN+ G E + + L KM KEVGKK+NLRS   N+ F+K F LP
Sbjct  706   EGKCDQTSNPKIHLRIFLNNSRGTEVVMNYLAKMRKEVGKKINLRSAQTNAAFRKLFNLP  765

Query  2003  PEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSF  2182
             PEEFLI+DF+C LKRK+PLQGR+F S RI+GFY+N+FGHKTKFFFLW+D+++I V+PP+ 
Sbjct  766   PEEFLIDDFTCHLKRKMPLQGRLFFSPRIIGFYSNIFGHKTKFFFLWDDVDDIQVIPPTL  825

Query  2183  STMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACI  2362
             S +GSPSL IIL K RG +A++GAK  D  GRL + F SFVSF  A R IMA+WK R+  
Sbjct  826   S-IGSPSLTIILRKGRGLEAKHGAKGTDPNGRLKYYFQSFVSFNDAHRIIMAIWKMRSLS  884

Query  2363  PDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLE  2542
             P+Q+  + E++   D   +  EE G+    EDV MS+++S  L ++ +SLMEMF+GG LE
Sbjct  885   PEQQGDMIEKES--DTKELQLEEGGTLFTHEDVKMSEIFSSALSVDVESLMEMFSGGPLE  942

Query  2543  HKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWI  2722
             H++M K+GC++Y  + WEL+  ++Y+R++SYK ++ +S +G E T+TQ++    N  GW 
Sbjct  943   HRMMQKAGCIDYSPTEWELVSRNIYQRQISYKFDKNLSRYGGEATTTQQRYALVNQEGWA  1002

Query  2723  LNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVR  2902
             + E+M++ GV   D + VQ++Y V +  +  N+C   V +G+ WLK+TK + +ITK+++ 
Sbjct  1003  IEEVMSLQGVLLGDCFNVQMKYTVVNVPSKPNTCSVQVLLGIAWLKSTKQQKKITKSVIS  1062

Query  2903  KFSQRVKEMIEFVGREV  2953
               S R+KE+   V +++
Sbjct  1063  NSSIRLKELFAEVEKDL  1079



>ref|NP_001046217.1| Os02g0199800 [Oryza sativa Japonica Group]
 dbj|BAD15842.1| putative C2 domain-containing protein [Oryza sativa Japonica 
Group]
 dbj|BAD25480.1| putative C2 domain-containing protein [Oryza sativa Japonica 
Group]
 dbj|BAF08131.1| Os02g0199800 [Oryza sativa Japonica Group]
 dbj|BAG93223.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1111

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/789 (49%), Positives = 552/789 (70%), Gaps = 8/789 (1%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             S  E +K L+S+ +G EMPENL+GGIL+DQ+Y L P + N +LF+  S F   +AE+QG 
Sbjct  323   SLNELMKSLESKDKGSEMPENLRGGILVDQSYVLQPTEMNSMLFSAHSDFWPAVAEVQGL  382

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
                Q  PW   S++  CL R ++YTK A+KLVK+V+ TEEQTYLK  G  FAVL  VS+P
Sbjct  383   SGFQTDPWKLVSND--CLKRTLSYTKAASKLVKAVKITEEQTYLKAAGNSFAVLSSVSSP  440

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             +VP G+ FKVE+LY I PGP L S E+++HL ISW + F +STM+K +IE GT+QGL++ 
Sbjct  441   EVPCGNCFKVEILYCITPGPQLPSKEQTSHLTISWRLNFVQSTMLKGMIESGTKQGLREG  500

Query  1130  FSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLY  1306
             +++F+  L+Q  KVI   +  L    +L++L ++  S  +LA  +  NF  + +  + LY
Sbjct  501   YAQFTEVLSQKTKVIAPDDSNLSKDEILSSLQTQEESIWKLAARFLGNFAFIFSLCIALY  560

Query  1307  FSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSD  1486
              + H+ L +   + GLE+ G+DLPDS+ E++ C IL++  + +++    F+ A  +RGSD
Sbjct  561   ATAHLRLVKPNMVHGLEYFGIDLPDSIWEVVFCAILIIQGQNIFKSGRRFLYAWKQRGSD  620

Query  1487  HGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEI  1666
             HGV+AHGDGW+LTVALIEG+ +      G PDP+VVFTCNGK +TSSV+ QT +P+WNEI
Sbjct  621   HGVKAHGDGWLLTVALIEGSGVVGSGTPGLPDPYVVFTCNGKRKTSSVKFQTSEPKWNEI  680

Query  1667  LEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSS  1846
              EF   ++PPS L+V V D +GP ++   +G  E+NFLK+  ++L D+WLPL G+  Q  
Sbjct  681   FEFNAMDDPPSRLEVVVHDSEGPHNKI-PIGQTEVNFLKNNLSDLGDMWLPLDGRFPQGC  739

Query  1847  QSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
             + KLHLRIFLNN+ G E + + L KM KEVGKK++LRS   NS F+K F LPPEEFLI+D
Sbjct  740   EPKLHLRIFLNNSRGTEIVMNYLAKMGKEVGKKIHLRSAQTNSAFRKLFSLPPEEFLIDD  799

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             F+C LKRK+PLQGRIFLS+RI+GFY+N+ G KTKFFFLW+DI++I V PP+ + +GSPSL
Sbjct  800   FTCYLKRKMPLQGRIFLSSRILGFYSNILGRKTKFFFLWDDIDDIQVAPPTLAKVGSPSL  859

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIA  2386
             +IIL KDRG +AR+GAK++D +G+L + F +FVSF  A R IMALWK R+  P+QK ++ 
Sbjct  860   MIILRKDRGLEARHGAKTLDPQGKLKYHFQTFVSFNDAHRIIMALWKMRSVDPEQKGEMI  919

Query  2387  EEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSG  2566
             ++     E   LP E GS L  EDV MS+VYS  L ++  SLM+MF+GG LEHKVM K+G
Sbjct  920   DKN---SELKQLPCEEGSLLANEDVKMSEVYSAVLSVDINSLMDMFSGGPLEHKVMQKAG  976

Query  2567  CLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIH  2746
             C++Y  + WEL+  ++Y+R++S+K ++++S FG E ++TQRK   AN  GW++ E+M + 
Sbjct  977   CVDYSPTEWELLNQNIYQRQISFKFDKILSRFG-EASTTQRKYNLANRDGWVIEEVMTLQ  1035

Query  2747  GVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKE  2926
             GV   D+  +QL+Y++ S S   ++C   V +G+ WLK  K + ++ KN++   + R++E
Sbjct  1036  GVQHEDYSSIQLKYQMTSTSLKPSTCSIQVLLGIAWLKGAKQQKKVVKNVMSNSANRLRE  1095

Query  2927  MIEFVGREV  2953
             +   V +E+
Sbjct  1096  IFSEVEKEL  1104



>ref|XP_006648430.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Oryza brachyantha]
Length=1072

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/789 (49%), Positives = 548/789 (69%), Gaps = 7/789 (1%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             S  E +K L+S+ +G E+PENL+GGIL+DQ+Y +PP + N LLF+  S F   +AE+QG 
Sbjct  278   SLNELMKSLESKDKGTEIPENLRGGILVDQSYVIPPGELNSLLFSAHSDFWPAVAEVQGL  337

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
                Q  PW +  +N  CL R ++YTK A+KLVKSV+ TEEQTYLK  G  FAVL  VS+P
Sbjct  338   SGFQTEPWKY-VNNDICLKRNLSYTKAASKLVKSVKITEEQTYLKAAGNSFAVLSSVSSP  396

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             +VP G+ FKVE+LY I PGP L S E+++HL ISW V F +STM+K +IE GT+QGL++ 
Sbjct  397   EVPCGNCFKVEILYCITPGPQLPSKEQTSHLTISWRVNFVQSTMLKGMIESGTKQGLREG  456

Query  1130  FSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLY  1306
             +++F+  L+Q  KVI   +  L    +L +L ++  S  +LA  +  NF  + +  + LY
Sbjct  457   YAQFAEILSQKTKVIAPDDANLSKDEILGSLQTQEESIWKLAARFLGNFAFIFSFSMALY  516

Query  1307  FSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSD  1486
                H+ L R+  + GLE+ G+DLPDSV E++   IL++  + +++    F  A  + GSD
Sbjct  517   AVAHLRLVRTNMVHGLEYFGIDLPDSVWEVVCGAILIIQGQNIFKAGRRFFYAWKQSGSD  576

Query  1487  HGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEI  1666
             HGV+AHGDGW+LTVALIEG+ +      G PDP+VVFTCNGK +TSSV+ QT +P+WNEI
Sbjct  577   HGVKAHGDGWLLTVALIEGSGVVGAGTPGLPDPYVVFTCNGKRKTSSVKFQTSEPKWNEI  636

Query  1667  LEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSS  1846
              EF+  ++PPS LDV + D DGPF++   +G  E+NFLK+  ++L D+WLPL G+  Q  
Sbjct  637   FEFDAMDDPPSRLDVVIHDSDGPFNE-NPIGQIEVNFLKNNLSDLGDMWLPLDGRFPQGC  695

Query  1847  QSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
             + KLHLRIFLNN+ G E + + L KM KEVGKK+ LRS   NS F+K F LPPEEFLI+D
Sbjct  696   EPKLHLRIFLNNSRGTEIVMNYLAKMGKEVGKKVRLRSAQTNSAFRKLFSLPPEEFLIDD  755

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             F+C LKRK+PLQGRIFLS RI+GFY+N+ G KTKFFFLW+DI++I V PP+ + +GSPSL
Sbjct  756   FTCYLKRKMPLQGRIFLSPRILGFYSNILGRKTKFFFLWDDIDDIQVAPPTLAKVGSPSL  815

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIA  2386
             +IIL KDRG +AR+GAK++D +GRL + F +FVSF  A R IMALWKTR+   +QK ++ 
Sbjct  816   MIILCKDRGLEARHGAKTLDPQGRLKYHFQTFVSFNDAHRIIMALWKTRSVGLEQKGEMI  875

Query  2387  EEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSG  2566
             ++     E   LP E GS L  EDV MS+VYS  L ++  +LM+MF+GG LEHKVM K+G
Sbjct  876   DKNP---EPKQLPCEEGSLLANEDVKMSEVYSAVLSVDVNALMDMFSGGPLEHKVMQKAG  932

Query  2567  CLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIH  2746
             C++Y  + WEL+  ++Y+R++S+K ++++S FG E ++TQRK    N  GW++ E+M + 
Sbjct  933   CIDYSPTEWELLNQNMYQRQISFKFDKILSRFG-EASTTQRKYNLMNRDGWVIEEVMTLQ  991

Query  2747  GVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKE  2926
             GV   D+  +QL+Y + S S   ++C   V +G++WLK  K + ++ KN++   + R++E
Sbjct  992   GVLHEDYSSIQLKYHMTSTSLKPSTCSVQVSLGIVWLKGAKQQKKVVKNVMSNSANRLRE  1051

Query  2927  MIEFVGREV  2953
             +   V +E+
Sbjct  1052  IFSEVEKEL  1060



>ref|XP_004967194.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Setaria italica]
Length=1096

 Score =   804 bits (2076),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/805 (48%), Positives = 552/805 (69%), Gaps = 11/805 (1%)
 Frame = +2

Query  542   SDYEDNVQETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLF  721
             S+  +N ++ T S++ S  E +K+++S+ EG EMP NL GG+L+D++Y   P + N LLF
Sbjct  285   SEDHENPEKGTASES-SLDELLKIMESKDEGSEMPANLPGGVLVDESYVTAPTNLNSLLF  343

Query  722   APDSQFRRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYL  901
             +P+S F   +AELQGT      PW  +S N+SC+ R ++YTK A+KLVK+ +ATEEQ YL
Sbjct  344   SPNSDFWPAVAELQGTSGFHIEPWKLES-NESCVQRTLSYTKAASKLVKACKATEEQKYL  402

Query  902   KGDGKEFAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTM  1081
             K     FAV   VSTPDVP G+ FK+E+LY I PGP L S E+++HL +SW V F +STM
Sbjct  403   KAARNSFAVFSVVSTPDVPCGNCFKIEILYCITPGPQLSSEEQTSHLTVSWRVNFVQSTM  462

Query  1082  MKTVIEGGTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNGH-LLATLPSEHPSDLELARE  1258
             +K +IE G +QG+ + +++FS  L+Q  KV+   +   N   +LA+L ++  +   L   
Sbjct  463   IKGMIESGAKQGMTEGYAQFSEVLSQKLKVVELDDPNSNKEKILASLHAQKETGWRLIVR  522

Query  1259  YFCNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVY  1438
             +  NFT + +  + LY   H+ LS+   + GLE+ GLDLPDS+GE++ C +L+L  + + 
Sbjct  523   FLGNFTFIFSVVIALYVIAHLHLSKPDVMHGLEYFGLDLPDSIGEVVVCAVLILQGQNIV  582

Query  1439  RMIAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSR  1618
             R+I  F+ A  +RGSDHGV+AHGDGW+LTVALIEGT + +   +   D +VVFTCN K +
Sbjct  583   RVIRRFLSAWKQRGSDHGVKAHGDGWLLTVALIEGTGITAAGSSDLFDLYVVFTCNTKRK  642

Query  1619  TSSVQLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAE  1798
             TSS++ QT DP+WNE+ EF+  ++PPS +D+ ++D  G       +GH E+NFLK+  ++
Sbjct  643   TSSIKFQTSDPKWNEVFEFDAMDDPPSRMDIAIYDSSG----LCIIGHTEVNFLKNNLSD  698

Query  1799  LADLWLPLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNST  1978
             L D+WLPL GK  Q+S  KLHLRIFLNN+ G E + + L KM KEVGKK+NLRS   N+ 
Sbjct  699   LTDIWLPLDGKCDQASSPKLHLRIFLNNSRGTEVVMNYLAKMGKEVGKKINLRSAQTNAA  758

Query  1979  FQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEE  2158
             F+K F LPPEEFLI+DF+C LKRK+PLQGR+F S RI+GFY+N+FGHKTKFFFLWED+++
Sbjct  759   FRKLFALPPEEFLIDDFTCHLKRKMPLQGRLFFSPRIIGFYSNIFGHKTKFFFLWEDVDD  818

Query  2159  INVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMA  2338
             I V+P + S +GSPSL++IL KDRG +A++GAK  D  GRL F F SFVSF  A R I A
Sbjct  819   IQVIPATLS-IGSPSLMMILRKDRGLEAKHGAKGTDHHGRLKFHFQSFVSFNDAYRIITA  877

Query  2339  LWKTRACIPDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLME  2518
             +WK RA  P+QK ++ E+ + K+   + PEE GS     DV MS++ S  L ++ +SLME
Sbjct  878   IWKMRALGPEQKGEVIEKDEPKE---LQPEEGGSLFTNADVKMSEILSSVLSVDVESLME  934

Query  2519  MFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSV  2698
             MF+GG LEHKVM K+GC++Y  + WEL+  ++ +R+ SYK ++ +S +G E T+TQ+K  
Sbjct  935   MFSGGPLEHKVMQKAGCIDYSATEWELVGCNIRQRQTSYKFDKNLSRYGGEATTTQQKYT  994

Query  2699  HANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLED  2878
               N  GW + E+M + GV   D++ +QL+Y +    +  N+C   V +G+ WLK+TK + 
Sbjct  995   LVNRVGWAVEEVMTLQGVLLGDYFNLQLKYLMTDVPSKPNTCSVQVLLGIAWLKSTKQQK  1054

Query  2879  RITKNIVRKFSQRVKEMIEFVGREV  2953
             ++TKNI+   S R+KE+   V +E+
Sbjct  1055  KVTKNIISNSSNRLKELFAEVEKEL  1079



>gb|EMT06152.1| hypothetical protein F775_19907 [Aegilops tauschii]
Length=1098

 Score =   798 bits (2060),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/786 (48%), Positives = 538/786 (68%), Gaps = 8/786 (1%)
 Frame = +2

Query  599   EAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDV  778
             E +K+++S+ +G EMP  L  G+L+D++Y + P   N LLF P+S F   +AELQGT   
Sbjct  306   ELLKIMESKDQGCEMPAKLSNGVLVDESYVIAPAGLNSLLFTPNSDFWPAVAELQGTSGF  365

Query  779   QEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVP  958
             Q  PW   S N  CL R ++Y K A+KLVK+ +ATEEQ YLK  G  FAVL  VSTPDVP
Sbjct  366   QIEPWKIDS-NDGCLRRTLSYIKAASKLVKACKATEEQKYLKAAGNSFAVLSIVSTPDVP  424

Query  959   YGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSE  1138
             YGS FK+E+LY I PGP L S E++ HL +SW + F +STMMK +IE G +QG+ + +++
Sbjct  425   YGSCFKIEILYCITPGPQLSSEEQTAHLTVSWRINFLQSTMMKGMIESGAKQGMSEGYAQ  484

Query  1139  FSRFLAQHCKVITSAEVLDN-GHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSI  1315
             FS  L+Q  KV    +   N   +LA+L +       L   +  NFT + +  + +Y  +
Sbjct  485   FSEVLSQRFKVAELDDANSNKAKILASLQAHKEPSWRLIVRFLGNFTFIFSVIIGIYVIV  544

Query  1316  HILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGV  1495
             H+ LSR   + GLE+ G+DLPDS+GE++ C +L+L  + + ++I  F+ A  +RGSDHGV
Sbjct  545   HLHLSRPKVMNGLEYFGIDLPDSIGEVVVCAVLILQGQTILKVIKRFLNAWRQRGSDHGV  604

Query  1496  RAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEF  1675
             +AHGDGW+LTVALIEGT + S   +   D + VFTCN K +TSS++  T DP+WNEI EF
Sbjct  605   KAHGDGWLLTVALIEGTGILSAGSSQPFDLYAVFTCNTKRKTSSIKFHTSDPKWNEIFEF  664

Query  1676  EPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSK  1855
             +  ++PPS +DV + D     D+A  +GHAE+NFLK   ++L D+W+PL G+   +S  K
Sbjct  665   DAMDDPPSRMDVAIHD-SNQLDEA-PIGHAEVNFLKSNLSDLMDIWVPLDGQCDPASNPK  722

Query  1856  LHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSC  2035
             LHLRIFLNN+ G E + + L KM  EVGKK+NLRS   N  F+K F LPPEEFLI+DF+C
Sbjct  723   LHLRIFLNNSRGTEVVLNYLAKMGNEVGKKINLRSAQTNLAFRKLFNLPPEEFLIDDFTC  782

Query  2036  SLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVII  2215
              LKRK+PLQGR+F S RI+GFY+N+FGHKTKFFFLWED+++I V+PP+ S +GSPSL++I
Sbjct  783   HLKRKMPLQGRVFFSPRIIGFYSNIFGHKTKFFFLWEDVDDIQVIPPTLS-IGSPSLMVI  841

Query  2216  LHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQ  2395
             L KDRG++A++GAK+ D  GRL F F SFVSF  A R IM +WK R+   +QK ++ EE 
Sbjct  842   LRKDRGSEAKHGAKATDHHGRLKFHFQSFVSFNDAHRIIMGIWKMRSPGQEQKGEVIEES  901

Query  2396  QYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLN  2575
             + K+   +  EE GS    EDV MS+++S  L ++ +SLMEMF+GG LEHKVM K+GCL+
Sbjct  902   EPKE---LQAEECGSLFTHEDVKMSEIFSSVLSVDVESLMEMFSGGQLEHKVMQKTGCLD  958

Query  2576  YVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVP  2755
             Y ++ WEL+  ++Y+R++SYK ++ +S +G E ++TQ+K    N  GW + E+M + GV 
Sbjct  959   YSSTEWELVGRNIYKRQISYKFDKALSRYGGEASTTQQKYTLVNQDGWAIEEVMTLQGVL  1018

Query  2756  FSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIE  2935
               D++ +QL+Y + +  +  N+C   V +G+ WLK+TK + ++TKNI+   S R+KE+  
Sbjct  1019  LGDYFNLQLKYYMANIPSKPNTCNVQVLLGIAWLKSTKQQKKVTKNIMSNTSNRLKELFS  1078

Query  2936  FVGREV  2953
              V +++
Sbjct  1079  LVEKDL  1084



>tpg|DAA47800.1| TPA: hypothetical protein ZEAMMB73_755076 [Zea mays]
Length=1059

 Score =   795 bits (2053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/791 (50%), Positives = 550/791 (70%), Gaps = 20/791 (3%)
 Frame = +2

Query  593   FCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTK  772
             F E ++ L+ R EG +MP NLQG IL++Q+Y   P D N LLF+PDS F++ + ELQG  
Sbjct  281   FSELLRSLELRHEGVDMPVNLQG-ILVNQSYLASPSDLNNLLFSPDSDFKQTMVELQGCT  339

Query  773   DVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPD  952
             D +  PW   +  +S L RVVTYT   +KLVK+V ATEEQ+YLK DGKE+AVL+ VSTPD
Sbjct  340   DFKTEPWRLDNGGES-LKRVVTYTTAPSKLVKAVHATEEQSYLKADGKEYAVLLSVSTPD  398

Query  953   VPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSF  1132
             VP G+ F+ E+L+ IMPGP L S ++++HL          STM+K++IE G +QGL+ ++
Sbjct  399   VPCGTYFRTEILFRIMPGPELDSQQQTSHL----------STMIKSMIENGARQGLEQNY  448

Query  1133  SEFSRFLAQHCKVI-TSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYF  1309
             ++FS  L+Q  K I       D   +LA+L     SD ++A  YFCNF V+S+ F+ LY 
Sbjct  449   AQFSDLLSQKIKPIDVEGSGSDKEQVLASLQGGEESDWKIAFLYFCNFGVLSSFFVSLYI  508

Query  1310  SIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDH  1489
              +H+L    + +QGLEF GLDLPDS+ EII  G+L L ++++ + I  F++AR ++G DH
Sbjct  509   ILHVLRVNPSAVQGLEFPGLDLPDSLSEIIMGGLLFLQVQRILKNITCFLQAREQKGGDH  568

Query  1490  GVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEIL  1669
             G++A GDGW+LTVALI+G  LA +D TG  DP+VVFTCNGK+RTSS++ QTL+PQWNEI 
Sbjct  569   GMKAKGDGWLLTVALIDGIKLAPVDATGLSDPYVVFTCNGKTRTSSIKFQTLEPQWNEIF  628

Query  1670  EFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQ  1849
             EF+  ++PPS++ V V+DFDGPFD+  SLGHAEINF+K   +ELAD+W+PL G +AQS Q
Sbjct  629   EFDAMDDPPSVMSVHVYDFDGPFDEVTSLGHAEINFVKSNLSELADVWIPLKGNLAQSWQ  688

Query  1850  SKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDF  2029
             SKLHLRIFLNN+ G   + + L+KMEKEVGKK+ LRSP  N+ FQ+ F LP EEFLI+ F
Sbjct  689   SKLHLRIFLNNSKGTGMVTEYLSKMEKEVGKKMTLRSPRTNTAFQELFSLPAEEFLISSF  748

Query  2030  SCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLV  2209
             +C LKRKLP QG++FLS R +GFY+++FG KTKF+FLWEDIE+I  +P S S+  SPS++
Sbjct  749   TCYLKRKLPTQGQVFLSPRTIGFYSSMFGRKTKFYFLWEDIEDIQGIPQSISSW-SPSII  807

Query  2210  IILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAE  2389
             I LHK RG D ++GAKS+D  G+L FC  SF SF  A+RTIMALWK R+   + K Q+AE
Sbjct  808   ITLHKGRGMDTKHGAKSMD-NGKLKFCLQSFASFSVANRTIMALWKARSLSTELKVQLAE  866

Query  2390  EQQYKDENNVLPEETGSYLIVED---VSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSK  2560
             EQ     N +  E++G ++ +ED   + M++V+S  +  N  SLME+F GG LE KVM K
Sbjct  867   EQSQI--NTLQSEDSGVFVGIEDAKSLQMTEVFSSTISTNMASLMEVFAGGSLEMKVMDK  924

Query  2561  SGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMA  2740
              GC  Y  + WE  +P+ Y+R++ YK ++ +S  G EVT TQ+KS+  N  GW++ E+M 
Sbjct  925   VGCQKYSATQWESDKPNEYQRQIHYKFSKKLSPVGGEVTGTQQKSLMPNKKGWVIEEVME  984

Query  2741  IHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRV  2920
             + GV   D + + ++Y+VE  +  + +    V +G+ W K+T+ + RI KN++   S R+
Sbjct  985   LQGVLLGDFFTLHIKYQVEDLAPKQRASNVQVSLGIEWSKSTRHQKRIEKNVLSSSSARL  1044

Query  2921  KEMIEFVGREV  2953
             KEM     RE+
Sbjct  1045  KEMFNLASREL  1055



>ref|XP_010233994.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
isoform X2 [Brachypodium distachyon]
Length=1083

 Score =   793 bits (2048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/790 (48%), Positives = 552/790 (70%), Gaps = 15/790 (2%)
 Frame = +2

Query  599   EAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDV  778
             E ++ ++S+ +G  MP NL GGIL+DQ+YA+ P + N +LF+ +S F   +AE+QG   +
Sbjct  297   ELLRTMESKDQGCGMPGNLPGGILVDQSYAIAPTELNTMLFSANSDFWPAVAEVQGLSGL  356

Query  779   QEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVP  958
             Q  PW  + ++++CL R +TYTK A+KLVKSV+ATEEQTYLK  G  FAVL  VSTPDVP
Sbjct  357   QNDPWKLE-NSENCLKRTLTYTKAASKLVKSVKATEEQTYLKAAGNSFAVLSCVSTPDVP  415

Query  959   YGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSE  1138
              G+ FKVE+LY I+PGP L S E+++ L ISW + F +STM+K +IE G +QGL++ +++
Sbjct  416   CGNCFKVEILYCIIPGPQLPSKEQTSQLTISWRLNFVQSTMLKGMIENGAKQGLREGYAQ  475

Query  1139  FSRFLAQHCKVITSAEVLDNGH-----LLATLPSEHPSDLELAREYFCNFTVVSTAFLVL  1303
             F+  L+Q  KV+     LD+ +     +LA+L +   S+ +L   +  +F  + +  + +
Sbjct  476   FTEVLSQKIKVVE----LDDANSSKDKILASLQTHDQSNWKLVARFLGSFAFIFSFTVAV  531

Query  1304  YFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGS  1483
             Y   H+ L++S  + GLE+ G+DLPDS+GE++ C IL+L  + ++++   F+ A  +RGS
Sbjct  532   YGIAHLRLAKSNNM-GLEYFGIDLPDSIGEVVFCAILILQGQNIFKVGRRFLHAWKQRGS  590

Query  1484  DHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNE  1663
             DHGV+AHGDGW+LTVALIEG+ +      G PDP+VVF CNGK +TSSV+ +T +P+WNE
Sbjct  591   DHGVKAHGDGWLLTVALIEGSGIVGAGTPGLPDPYVVFMCNGKRKTSSVKFRTSEPKWNE  650

Query  1664  ILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQS  1843
             I EF+  ++PPS LDV V D DGP D+  ++G  E+NF+K+   +L D+WLPL G+ AQ 
Sbjct  651   IFEFDAMDDPPSRLDVVVHDSDGPSDET-TIGRTEVNFVKNNLTDLGDMWLPLDGRFAQG  709

Query  1844  SQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIN  2023
             S+ KLH+RIFLNN+ G E + + L KM KEVGKK++LRS   NS+F K F LP EEFLI+
Sbjct  710   SEPKLHVRIFLNNSRGTEVVMNYLEKMGKEVGKKMHLRSAQTNSSFCKLFSLPTEEFLID  769

Query  2024  DFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPS  2203
             DF+C LKRK+PLQGR+FLS RI+GFY+N+FG KTKFFFLWEDI++I V+PPS ST+GSPS
Sbjct  770   DFTCHLKRKMPLQGRLFLSPRIIGFYSNIFGRKTKFFFLWEDIDDIQVVPPSLSTVGSPS  829

Query  2204  LVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQI  2383
             L+IIL KDRG +AR+GAK+ D +GRL F F +FVSF  A R IMALWK R    +QK ++
Sbjct  830   LMIILQKDRGLEARHGAKTQDPQGRLKFHFQTFVSFNDAHRIIMALWKMRLSGLEQKGEV  889

Query  2384  AEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKS  2563
              +++    E   L  + GS L  EDV M++VY+  L ++  +LMEMF+GG LE KVM K+
Sbjct  890   NDKE---PEPKQLASDEGSLLGNEDVKMTEVYTAVLSVDVNALMEMFSGGPLEQKVMQKA  946

Query  2564  GCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAI  2743
             GC +Y  + WE +  ++Y+R++S++ ++  S +G E T+TQ+K    N  GW+L E+M +
Sbjct  947   GCADYSPTEWEPVNRNIYQRQISFRFDKSSSKYGGEATTTQQKYNLQNREGWVLEEVMTL  1006

Query  2744  HGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVK  2923
              GV   D+  +QL+Y + S +   NSC   V +G++WLK T+ + + TKN++   + R+K
Sbjct  1007  QGVLHEDYTSIQLKYHMMSTALKPNSCSIQVMLGIVWLKGTRHQKKATKNVMSNSANRLK  1066

Query  2924  EMIEFVGREV  2953
             EM   V +E+
Sbjct  1067  EMFLEVEKEL  1076



>ref|XP_004954663.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Setaria italica]
Length=1093

 Score =   793 bits (2048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/789 (47%), Positives = 541/789 (69%), Gaps = 6/789 (1%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             S  E +K ++S+ +  EMP NL GG+L+DQ+Y++ P + N LLF+ +S F  E+AELQGT
Sbjct  303   SLDELLKTMESKDQACEMPGNLPGGVLVDQSYSIAPAELNSLLFSANSDFWPEVAELQGT  362

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
                   PW    +N++CL R +TYTK A+KLVKSV+ATE+Q YLK  G  FAVL  VSTP
Sbjct  363   SGFHIEPWK-HENNENCLKRTLTYTKAASKLVKSVKATEDQKYLKAAGNSFAVLCSVSTP  421

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             DVP G+ FKVE+LY I+PGP   S E++T L +SW + F +STM+K +IE G +QGL + 
Sbjct  422   DVPCGNCFKVEILYRIIPGPQFPSEEQTTQLTVSWRLNFVQSTMLKGMIENGAKQGLAEG  481

Query  1130  FSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYF  1309
             +S+FS  L++  KV    +  +   +LA+L  +  S+ +L   +  +F  + +    LY 
Sbjct  482   YSQFSEVLSRKVKVAELDDANNKDKILASLQPQKESNWKLVARFLGSFAFIFSLSTALYI  541

Query  1310  SIHILLSRSTQLQG-LEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSD  1486
               H+ L+R+  + G LE+ G+DLPDS+GE++ C IL++    + ++   F++A  +RGSD
Sbjct  542   ITHLHLARTNMVHGGLEYFGIDLPDSIGEVVFCIILIIQGHNIIKVGRRFLQAWKQRGSD  601

Query  1487  HGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEI  1666
             HG++AHGDGW+LT+ALIEG+ +      G PDP+V+FTCNGK +TSSV+  T +P+WNEI
Sbjct  602   HGIKAHGDGWLLTIALIEGSGVVGAGTPGLPDPYVIFTCNGKRKTSSVKYHTSEPKWNEI  661

Query  1667  LEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSS  1846
              EF+  ++PP+ LDV V D DG  ++   +G  E+NF+K+  ++L D+WLPL G+  Q  
Sbjct  662   FEFDAMDDPPARLDVVVHDSDGASNET-PIGQTEVNFVKNNLSDLGDMWLPLDGRFPQGH  720

Query  1847  QSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
             Q KLHLRIFLNN+ G E + + L KM KEVGKK++LRS   NS F+K F LPPEEFLI+D
Sbjct  721   QPKLHLRIFLNNSQGTEVVLNYLEKMGKEVGKKMHLRSAQTNSAFRKLFSLPPEEFLIDD  780

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             F+C LKRK+PLQGR+FLS RI GFY+N+FG KTKFFFLWEDI++I V+PP  +T+GSPSL
Sbjct  781   FTCHLKRKMPLQGRLFLSPRIAGFYSNIFGRKTKFFFLWEDIDDIQVVPPKLATVGSPSL  840

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIA  2386
             ++IL KDRG +AR+GAK++D +GRL F F +FVSF  A R IMA+WK R+   +QK +I 
Sbjct  841   MLILRKDRGLEARHGAKTLDPQGRLKFHFQTFVSFNDAHRIIMAIWKMRSSGLEQKGEIL  900

Query  2387  EEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSG  2566
             +++    E   LP E GS L  +DV MS+VYS  L +   + MEMF+GG LEHKVM ++G
Sbjct  901   DKESELKE---LPCEEGSLLANDDVKMSEVYSAVLSVGISAFMEMFSGGPLEHKVMERAG  957

Query  2567  CLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIH  2746
             C++Y  + WEL+  D+Y+RR+S++ ++ +S +G E T+TQ+K    N  GW++ E+M + 
Sbjct  958   CVDYSATEWELLNRDIYQRRISFRFDKSLSRYGGEATTTQQKYKLPNQDGWVVEEVMTLQ  1017

Query  2747  GVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKE  2926
             G+   D+  +QL+Y + S     N+C   V +G+ WLK  K + +  KN++   + R++E
Sbjct  1018  GILHEDYSSIQLKYHMTSTPLKPNTCSLKVLLGIAWLKGAKHQKKAAKNVMANSANRLRE  1077

Query  2927  MIEFVGREV  2953
             +   V +E+
Sbjct  1078  IFAEVEKEI  1086



>ref|XP_003571080.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
isoform X1 [Brachypodium distachyon]
Length=1108

 Score =   793 bits (2047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/790 (48%), Positives = 552/790 (70%), Gaps = 15/790 (2%)
 Frame = +2

Query  599   EAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDV  778
             E ++ ++S+ +G  MP NL GGIL+DQ+YA+ P + N +LF+ +S F   +AE+QG   +
Sbjct  297   ELLRTMESKDQGCGMPGNLPGGILVDQSYAIAPTELNTMLFSANSDFWPAVAEVQGLSGL  356

Query  779   QEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVP  958
             Q  PW  + ++++CL R +TYTK A+KLVKSV+ATEEQTYLK  G  FAVL  VSTPDVP
Sbjct  357   QNDPWKLE-NSENCLKRTLTYTKAASKLVKSVKATEEQTYLKAAGNSFAVLSCVSTPDVP  415

Query  959   YGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSE  1138
              G+ FKVE+LY I+PGP L S E+++ L ISW + F +STM+K +IE G +QGL++ +++
Sbjct  416   CGNCFKVEILYCIIPGPQLPSKEQTSQLTISWRLNFVQSTMLKGMIENGAKQGLREGYAQ  475

Query  1139  FSRFLAQHCKVITSAEVLDNGH-----LLATLPSEHPSDLELAREYFCNFTVVSTAFLVL  1303
             F+  L+Q  KV+     LD+ +     +LA+L +   S+ +L   +  +F  + +  + +
Sbjct  476   FTEVLSQKIKVVE----LDDANSSKDKILASLQTHDQSNWKLVARFLGSFAFIFSFTVAV  531

Query  1304  YFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGS  1483
             Y   H+ L++S  + GLE+ G+DLPDS+GE++ C IL+L  + ++++   F+ A  +RGS
Sbjct  532   YGIAHLRLAKSNNM-GLEYFGIDLPDSIGEVVFCAILILQGQNIFKVGRRFLHAWKQRGS  590

Query  1484  DHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNE  1663
             DHGV+AHGDGW+LTVALIEG+ +      G PDP+VVF CNGK +TSSV+ +T +P+WNE
Sbjct  591   DHGVKAHGDGWLLTVALIEGSGIVGAGTPGLPDPYVVFMCNGKRKTSSVKFRTSEPKWNE  650

Query  1664  ILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQS  1843
             I EF+  ++PPS LDV V D DGP D+  ++G  E+NF+K+   +L D+WLPL G+ AQ 
Sbjct  651   IFEFDAMDDPPSRLDVVVHDSDGPSDET-TIGRTEVNFVKNNLTDLGDMWLPLDGRFAQG  709

Query  1844  SQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIN  2023
             S+ KLH+RIFLNN+ G E + + L KM KEVGKK++LRS   NS+F K F LP EEFLI+
Sbjct  710   SEPKLHVRIFLNNSRGTEVVMNYLEKMGKEVGKKMHLRSAQTNSSFCKLFSLPTEEFLID  769

Query  2024  DFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPS  2203
             DF+C LKRK+PLQGR+FLS RI+GFY+N+FG KTKFFFLWEDI++I V+PPS ST+GSPS
Sbjct  770   DFTCHLKRKMPLQGRLFLSPRIIGFYSNIFGRKTKFFFLWEDIDDIQVVPPSLSTVGSPS  829

Query  2204  LVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQI  2383
             L+IIL KDRG +AR+GAK+ D +GRL F F +FVSF  A R IMALWK R    +QK ++
Sbjct  830   LMIILQKDRGLEARHGAKTQDPQGRLKFHFQTFVSFNDAHRIIMALWKMRLSGLEQKGEV  889

Query  2384  AEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKS  2563
              +++    E   L  + GS L  EDV M++VY+  L ++  +LMEMF+GG LE KVM K+
Sbjct  890   NDKE---PEPKQLASDEGSLLGNEDVKMTEVYTAVLSVDVNALMEMFSGGPLEQKVMQKA  946

Query  2564  GCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAI  2743
             GC +Y  + WE +  ++Y+R++S++ ++  S +G E T+TQ+K    N  GW+L E+M +
Sbjct  947   GCADYSPTEWEPVNRNIYQRQISFRFDKSSSKYGGEATTTQQKYNLQNREGWVLEEVMTL  1006

Query  2744  HGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVK  2923
              GV   D+  +QL+Y + S +   NSC   V +G++WLK T+ + + TKN++   + R+K
Sbjct  1007  QGVLHEDYTSIQLKYHMMSTALKPNSCSIQVMLGIVWLKGTRHQKKATKNVMSNSANRLK  1066

Query  2924  EMIEFVGREV  2953
             EM   V +E+
Sbjct  1067  EMFLEVEKEL  1076



>dbj|BAJ99131.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1095

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/786 (48%), Positives = 536/786 (68%), Gaps = 8/786 (1%)
 Frame = +2

Query  599   EAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDV  778
             E +K+++S+ +G EMP  L  G+L+D++Y + P   N LLF+P+S F   +AELQGT   
Sbjct  310   ELLKIMESKDQGCEMPAKLANGVLVDESYVIAPAGLNSLLFSPNSDFWPAVAELQGTSGF  369

Query  779   QEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVP  958
             Q  PW   S N  CL R ++Y K A+KLVK+ +ATEEQ YLK  G  FAV   VSTPDVP
Sbjct  370   QIEPWKIDS-NDGCLRRTLSYIKAASKLVKACKATEEQKYLKAAGNSFAVFSIVSTPDVP  428

Query  959   YGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSE  1138
              G+ FK+E+LY I PGP L S E++ HL +SW + F +STM+K +IE G +QG+ + +++
Sbjct  429   CGTCFKIEILYCITPGPQLSSEEQTAHLTVSWRINFVQSTMIKGMIENGAKQGMSEGYAQ  488

Query  1139  FSRFLAQHCKVITSAEVLDN-GHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSI  1315
             FS  L+Q  KV    +   N   +LA+L +       L   +  NFT + +  + LY   
Sbjct  489   FSEVLSQRFKVAELDDANSNKAKILASLHTHKEPSWRLIVRFLGNFTFIFSVIIGLYVIA  548

Query  1316  HILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGV  1495
             H+ LSR   L GLE+ G+DLPDS+GE++ C +L+L  + + ++I  F+ A  +RGSDHGV
Sbjct  549   HLHLSRPKALNGLEYFGIDLPDSIGEVVVCAVLILQGQTILKVIKRFLNAWKQRGSDHGV  608

Query  1496  RAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEF  1675
             +AHGDGW+LTVALIEGT + S   +   D + VFTCN K +TSS++  T DP+WNEI EF
Sbjct  609   KAHGDGWLLTVALIEGTGIISAGSSQLFDLYAVFTCNTKRKTSSIKFHTSDPKWNEIFEF  668

Query  1676  EPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSK  1855
             +  ++PPS ++V + D     D+A  + HAE+NFLK   ++L D+W+PL GK   +S  K
Sbjct  669   DAMDDPPSRMEVAIHD-SNQLDEA-PICHAELNFLKSNLSDLTDIWVPLDGKCDPASNPK  726

Query  1856  LHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSC  2035
             LHLRIFLNN+ G E + + L+KM  EVGKK+NLRS   N  F+K F LPPEEFLI+DF+C
Sbjct  727   LHLRIFLNNSRGTEVVLNYLSKMGNEVGKKINLRSAQTNLAFRKLFNLPPEEFLIDDFTC  786

Query  2036  SLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVII  2215
              LKRK+PLQGRIF S RI+GFY+N+FGHKTKFFFLW+D+++I V+PP+ S +GSPSL++I
Sbjct  787   HLKRKMPLQGRIFFSPRIIGFYSNIFGHKTKFFFLWDDVDDIQVIPPTLS-IGSPSLMVI  845

Query  2216  LHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQ  2395
             L KDRG++A+NGAK+ D  GRL F F SFVSF  A R IM +WK R+   +QK ++ EE 
Sbjct  846   LRKDRGSEAKNGAKATDHHGRLKFHFQSFVSFNDAHRIIMGIWKMRSPGQEQKGEVIEES  905

Query  2396  QYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLN  2575
             + K+   +L EE GS    EDV MS+++S  L ++ +SLMEMF+GG LEHKVM K+GCL+
Sbjct  906   EPKE---LLAEECGSLFTHEDVKMSEIFSSVLSVDVESLMEMFSGGQLEHKVMQKTGCLD  962

Query  2576  YVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVP  2755
             Y ++ WE +  ++Y+R++SYK ++ +S +G E ++TQ+K    N  GW + E+M + GV 
Sbjct  963   YSSTEWEHVNRNIYKRQISYKFDKALSRYGGEASTTQQKYALVNQEGWTIEELMTLQGVL  1022

Query  2756  FSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIE  2935
               D++ +QL+Y + +  +  N+C   V +G+ WLK+TK + +ITKNI+   S R+KE+  
Sbjct  1023  LGDYFNLQLKYHMANIPSKPNTCSVQVLLGIAWLKSTKQQKKITKNIMSNTSNRLKELFS  1082

Query  2936  FVGREV  2953
              V +++
Sbjct  1083  EVVKDL  1088



>ref|XP_008645391.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
isoform X1 [Zea mays]
Length=1092

 Score =   786 bits (2031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/789 (48%), Positives = 542/789 (69%), Gaps = 7/789 (1%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             S  E +K ++S+ +  E+P NL GG+L+DQ+Y + P + N LLF+  S F  E++ELQGT
Sbjct  301   SLDELLKNMESKDQACELPGNLPGGVLMDQSYIIAPAELNSLLFSGTSDFWPEVSELQGT  360

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
                   PW    +N++CL R +TYTK A+KLVKSV+ATEEQ YLK  G  FAVL  VSTP
Sbjct  361   SGFNIEPWK-HDNNENCLKRTITYTKAASKLVKSVKATEEQKYLKATGSSFAVLSSVSTP  419

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             DVP G+ FKVE+LY I+ G  L   E++T + +SW + F +STM+K +IE G +QGL + 
Sbjct  420   DVPCGNCFKVEILYRIISGSQL-PLEQTTQITVSWRLNFVQSTMLKGMIENGAKQGLAEG  478

Query  1130  FSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYF  1309
             +S FS  L++  KV   A+      +LA+L ++  S+ +L   +  +F  + +    LY 
Sbjct  479   YSHFSEVLSRKVKVAELADANTKDKILASLQTQKESNWKLVARFLGSFAFICSLSTALYI  538

Query  1310  SIHILLSR-STQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSD  1486
             + H+ L++ +  L GLE+ G+DLPDS+GEI+ C IL++    + ++   F++A  +RGSD
Sbjct  539   TTHLHLAKPNVVLGGLEYFGIDLPDSIGEIVFCIILIIQGHNIMKVGRRFLQAWKQRGSD  598

Query  1487  HGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEI  1666
             HGV+AHGDGW+LT+ALIEG+ + S    G PDP+VVFTCNGK +TSSV+ QT +P+WNEI
Sbjct  599   HGVKAHGDGWLLTIALIEGSGVVSAGTPGVPDPYVVFTCNGKRKTSSVKYQTSEPKWNEI  658

Query  1667  LEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSS  1846
              EF+  ++PP+ LDV V D D P ++   +G  E+NF+K+  ++L D+W+PL G+  Q  
Sbjct  659   FEFDAMDDPPARLDVVVHDSDIPNNET-PIGQTEVNFVKNNLSDLGDMWVPLDGRFPQGH  717

Query  1847  QSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
             Q KLHLRIFLNN+ G E + + L KM KEVGKK++LRS   NS F+K F LPPEEFLI+D
Sbjct  718   QPKLHLRIFLNNSRGTEVVMNYLEKMGKEVGKKMHLRSSQTNSAFRKLFSLPPEEFLIDD  777

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             F+C LKRK+PLQGR+FLS RI GFY+N+FG KTKFFFLWEDIE I V+PP  +T+GSPSL
Sbjct  778   FTCHLKRKMPLQGRLFLSPRITGFYSNIFGRKTKFFFLWEDIENIQVVPPKLATVGSPSL  837

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIA  2386
             +IIL KDRG +AR+GAK++D +GRL F F +FVSF  A R IMA+WK R+   +QK ++ 
Sbjct  838   MIILCKDRGLEARHGAKALDPQGRLKFHFQTFVSFNDAHRIIMAIWKLRSSGLEQKGEVI  897

Query  2387  EEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSG  2566
             +++    EN   P E GS L  EDV MS+VYS  L ++  +LMEMF+GG LEHKVM ++G
Sbjct  898   DKEPELKEN---PYEEGSLLANEDVKMSEVYSAVLSVDVSALMEMFSGGPLEHKVMERAG  954

Query  2567  CLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIH  2746
             C++Y+ + WEL+  +VY+R ++++ ++ +S +G E T+TQ+K    N   WI+ E+M + 
Sbjct  955   CVDYLATEWELLNRNVYQRHINFRFDKSLSRYGGEATTTQQKYNLPNQNDWIVEEVMTLQ  1014

Query  2747  GVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKE  2926
             GV   D+  +QL+Y + S     NSCR  V +G+ WLK TK + +  KN++   + R++E
Sbjct  1015  GVQHEDYSSIQLKYHMTSTPLRPNSCRIKVLLGIAWLKGTKHQKKAAKNVMMNSANRLRE  1074

Query  2927  MIEFVGREV  2953
             +   V +EV
Sbjct  1075  IFSEVEKEV  1083



>ref|NP_001053081.2| Os04g0476600 [Oryza sativa Japonica Group]
 dbj|BAF14995.2| Os04g0476600, partial [Oryza sativa Japonica Group]
Length=672

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/668 (56%), Positives = 496/668 (74%), Gaps = 11/668 (2%)
 Frame = +2

Query  971   FKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRF  1150
             F+V +LY I+  P L S E  +HL +S+ V+F +STMMK++IEG  + GLK++F  ++  
Sbjct  3     FEVVMLYKIIHYPELSSSEGMSHLTVSYNVEFLQSTMMKSMIEGSVRDGLKENFESYAEI  62

Query  1151  LAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHILLS  1330
             L++H K+  SA  +D   LLA L ++H SD+ LA +YFCNFTV+ST  + LY  +HI LS
Sbjct  63    LSRHVKIADSAG-MDKERLLAPLQTDHQSDIRLAYKYFCNFTVISTVIMALYVLVHIFLS  121

Query  1331  RSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHGD  1510
             R   L GLEF GLDLPD+ GE+I  GILVL LE++  MI+ FVE R++RGSDHG++A+GD
Sbjct  122   RPGPLMGLEFKGLDLPDTFGELIISGILVLQLERLLSMISRFVEVRVQRGSDHGIKANGD  181

Query  1511  GWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEE  1690
             GW+LTVAL+E T+L  +  +G  DP+VVF+CNG +RTSSVQLQT DPQWNEI+EF+  EE
Sbjct  182   GWLLTVALLEATSLPPVS-SGSVDPYVVFSCNGITRTSSVQLQTHDPQWNEIMEFDAMEE  240

Query  1691  PPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRI  1870
             PP+ LDVEVF+FDGPFD A SLGHAEINFLKHTSAELAD+W+PL GK+AQ+ QS+LHLRI
Sbjct  241   PPATLDVEVFNFDGPFDLAVSLGHAEINFLKHTSAELADIWVPLEGKLAQTCQSRLHLRI  300

Query  1871  FLNNNNGVET-IRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKR  2047
             FL N  G ET +R+ L+KMEKEVGKKL+++SPHRN+TFQK FGLP EEFLI  ++CSLKR
Sbjct  301   FLENTKGPETSMREYLSKMEKEVGKKLHVQSPHRNATFQKLFGLPHEEFLIAVYACSLKR  360

Query  2048  KLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKD  2227
             KLPLQGR+FLS RIVGFYANLFGHKTKFFFLWED+EEI  L PSF+T+G+PSL+ +L   
Sbjct  361   KLPLQGRLFLSARIVGFYANLFGHKTKFFFLWEDVEEIEELTPSFTTVGTPSLLFVLKSG  420

Query  2228  RGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKD  2407
             RG DA+NGAKS D+EGRL F FHSF SF  ASRTI+ LWKT++   +Q+A++ E+Q+  D
Sbjct  421   RGLDAKNGAKSQDKEGRLKFQFHSFASFSKASRTIIGLWKTKSSAIEQRAKLEEDQE--D  478

Query  2408  ENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTS  2587
             EN V   +  S L + DV +SK Y+++LP++   LM +F+GG LE K MS++GCL+Y  +
Sbjct  479   ENYVDLNDVQSVLSIGDVPLSKEYTLELPIDADLLMGVFDGGPLEAKAMSRAGCLDYAAT  538

Query  2588  SWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDH  2767
              W+   P V ER  SYK NR +SIFG EV STQ +    +  GW + +++ +  VPF D 
Sbjct  539   PWQDARPGVLERHASYKFNRYMSIFGGEVVSTQLRLPSDDGDGWTVYDVITLRNVPFGDF  598

Query  2768  YQVQLRYKV------ESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEM  2929
             +++ LR+ +       S +AA +  RC++ VG+ W+K +K + RI +NI  K + R KE+
Sbjct  599   FRLHLRHNIWSVEAASSEAAASSGSRCEILVGIEWVKRSKFQKRIARNICEKLAHRAKEV  658

Query  2930  IEFVGREV  2953
             +E   RE+
Sbjct  659   LEAAAREI  666



>ref|XP_008659765.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
isoform X2 [Zea mays]
Length=971

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/796 (47%), Positives = 537/796 (67%), Gaps = 10/796 (1%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             S  E +K+++S+ +G EMP  L GG L+D++Y   P + N LLF+  S F   +AELQGT
Sbjct  175   SLDELLKVMESKDQGSEMPAALPGGTLVDESYVAAPTELNSLLFSASSDFWPAVAELQGT  234

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
                Q  PW   S ++S + R ++YTK A+KLVK+V+ATEEQ YLK  G  +AV   VSTP
Sbjct  235   SGFQIEPWKLDS-SESFVQRTLSYTKAASKLVKAVKATEEQKYLKAAGNSYAVFSVVSTP  293

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             DVP G+ FKVE+LY + PGP L S E++ HL +SW V F +STM+K +IE G +QG+ + 
Sbjct  294   DVPCGNCFKVEILYCVTPGPQLPSEEQTCHLTVSWRVNFVQSTMIKGMIESGAKQGMAEG  353

Query  1130  FSEFSRFLAQHCKVITSAEVLDNGH-LLATLPSEHPSDLELAREYFCNFTVVSTAFLVLY  1306
             F++FS  L+Q  K     +   N   +LA+L ++  S   L   +  NFT + +  + LY
Sbjct  354   FAQFSEVLSQKLKTAELDDANSNKEKILASLHAQKESCWRLVVRFLGNFTFIFSVAIALY  413

Query  1307  FSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSD  1486
                H+ LS+   + GLE+ GLDLPDS+GE++ C +L+L  + + ++   F+ A  +RGSD
Sbjct  414   VIAHLHLSKPDVMHGLEYFGLDLPDSIGEVVVCAVLILQGQNIVKVTRRFLSAWKQRGSD  473

Query  1487  HGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEI  1666
             HGV+AHGDGW+LTVALIEGT + +   +   D +VVFTCN K +TSS++ QT DP+WNEI
Sbjct  474   HGVKAHGDGWLLTVALIEGTGIIATGSSDLFDIYVVFTCNAKRKTSSIKFQTSDPKWNEI  533

Query  1667  LEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSS  1846
              EF+  ++PPS +DV ++D  G       +GH E+NFLK+  +EL D+WLP+ GK  Q+S
Sbjct  534   FEFDAMDDPPSRMDVAIYDSSGQC----VIGHTEVNFLKNNLSELTDIWLPVSGKCDQAS  589

Query  1847  QSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
               +LHLRIFLNN+ G E + + L KM KEVGKK+NLRS   N  F+K F LP EEFLI+D
Sbjct  590   NPRLHLRIFLNNSRGTEVVMNYLAKMGKEVGKKINLRSAQTNVAFRKLFALPLEEFLIDD  649

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             F+C LKRK+PLQGR+F S RIVGFY+N+FGHKTKFFFLWED+++I V+P + S +GSPSL
Sbjct  650   FTCHLKRKMPLQGRLFFSPRIVGFYSNIFGHKTKFFFLWEDVDDIQVIPATLS-IGSPSL  708

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIA  2386
             +IIL KDRG +A++GAK  D  GRL F F SFVSF  A R I A+WK RA  P+QK +  
Sbjct  709   MIILRKDRGLEAKHGAKGTDHHGRLKFVFQSFVSFNDAYRIITAIWKIRALSPEQKGEAT  768

Query  2387  EEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSG  2566
             E+ + K+   +LPEE G+     DV MS+++S  L ++ +SLMEMF+GG LEHK+M K+G
Sbjct  769   EKDEVKE---LLPEEAGTLFTNADVKMSEIFSSVLSVDVESLMEMFSGGPLEHKMMQKAG  825

Query  2567  CLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIH  2746
             C++Y  + WEL+  ++ +R+ SYKL++ +S  G E  +T++K    N  GW + ++M + 
Sbjct  826   CIDYTATQWELVGCNIQQRQTSYKLDKNLSRHGGEAATTEQKYSLVNQDGWAIEKVMTLQ  885

Query  2747  GVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKE  2926
             GV  +DH+ +Q++Y + +  +  N+C   V +G+ WLK+TK + ++TK+I+   S  +KE
Sbjct  886   GVLLADHFNLQMKYCITNVPSKPNTCSVLVLLGIAWLKSTKQQKKVTKSIISNTSNGLKE  945

Query  2927  MIEFVGREVFLSS*KH  2974
             +   V +E+  SS  H
Sbjct  946   LFAEVEKELTSSSSSH  961



>gb|KCW44492.1| hypothetical protein EUGRSUZ_L01991 [Eucalyptus grandis]
Length=883

 Score =   776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/692 (55%), Positives = 512/692 (74%), Gaps = 10/692 (1%)
 Frame = +2

Query  431   KSIAGHLEKLFDkneessksneegskkdnsseLSSIP--SDYEDNVQETTRSQTQSFCEA  604
             K+ AG L ++F+K+ ++S               +S P  SD +D+ Q ++     SF E 
Sbjct  185   KTFAGRLAQMFNKSTDTSSVASNKGIDLPELPEASGPESSDSQDDDQFSS----GSFEEL  240

Query  605   IKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQE  784
             IK+++SR +  E P NL GG+LLD    + P + N LLF+ DS F + L++LQGT ++Q 
Sbjct  241   IKIMESREQEGETPSNLPGGVLLDHLCIIAPSELNTLLFSSDSPFFKSLSDLQGTTELQL  300

Query  785   GPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYG  964
             G W ++ +    L RV++Y K ATKL+K+V+ATEEQTYLK DGK +AVL  VSTPDV YG
Sbjct  301   GQWKFE-NGAETLKRVISYIKAATKLIKAVKATEEQTYLKADGKVYAVLASVSTPDVMYG  359

Query  965   STFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFS  1144
             STFK+ELLY I  GP L SGE+S+ LVISW + F ++TMMK +IE G +QGLKDSF +++
Sbjct  360   STFKIELLYCITHGPELPSGEQSSRLVISWRMNFLQNTMMKGMIESGVRQGLKDSFEQYA  419

Query  1145  RFLAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
               L Q  K + S ++  N   +LA+L +E  SD +LA +YF NFTV+ST  + LY  +H+
Sbjct  420   SLLNQTVKPVDSKDIGSNKEQILASLQAEPQSDWKLAVQYFANFTVLSTFVMGLYVLVHL  479

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
              L+  + + GLEF GLDLPDS+GE+I CG+LVL  E+V   I+ F++AR+++GSDHGV+A
Sbjct  480   WLATPSPIHGLEFVGLDLPDSIGEVIVCGMLVLQAERVLGFISRFMQARMQKGSDHGVKA  539

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              GDGW+LTVALIEG+++A++D +   DP+VVFTCNGK+RTSS++ Q  DP WNEI EF+ 
Sbjct  540   QGDGWLLTVALIEGSSIAAVDSSALSDPYVVFTCNGKTRTSSIKFQKTDPLWNEIFEFDA  599

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
              E+PPSMLDVEVFDFDGPFD+A SLGHAE+NF+++  ++LAD+W+ L GK+AQ+ QSKLH
Sbjct  600   MEDPPSMLDVEVFDFDGPFDEATSLGHAEVNFVRNNISDLADVWVTLHGKLAQACQSKLH  659

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFL+N  G    ++ ++KMEKEVGKK+N+RSP  NS FQK F LPPEEFLINDF+C L
Sbjct  660   LRIFLDNTKGSNVAKEYISKMEKEVGKKINIRSPQTNSAFQKLFALPPEEFLINDFTCHL  719

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRK+PLQGR+FLS RI+GF+ANLFG KTKFFFLWEDIE+I VL P+ S+MGSP +V+ L 
Sbjct  720   KRKMPLQGRLFLSARIIGFHANLFGQKTKFFFLWEDIEDIQVLSPTLSSMGSPIVVMTLW  779

Query  2222  KDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQY  2401
             + RG +AR+GAK+ DEEGRL F F SFVSF  A RTIMALWK R+  P+QK Q+ EE+  
Sbjct  780   RGRGMEARHGAKTQDEEGRLKFQFQSFVSFNVAHRTIMALWKARSLTPEQKVQLIEEE--  837

Query  2402  KDENNVLPEETGSYLIVEDVSMSKVYSVDLPM  2497
              +  +++ EE+GS+L +EDVS+S+VY   LP+
Sbjct  838   SEARSLVTEESGSFLGLEDVSLSEVYCSVLPV  869



>ref|XP_003563646.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Brachypodium distachyon]
Length=1091

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/783 (48%), Positives = 535/783 (68%), Gaps = 7/783 (1%)
 Frame = +2

Query  608   KLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEG  787
             K+++S+ +G EMP NL  G+L+D+++   P   N LLFAP++ F   +AELQGT   Q  
Sbjct  308   KIMESKDQGCEMPANLANGVLVDESFVTAPAGLNSLLFAPNTDFWPAVAELQGTSGFQIE  367

Query  788   PWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGS  967
             PW    +N  CL R +TY K A+KLVK+V+ATEEQ YLK  G  FAVL  VSTPDVP G+
Sbjct  368   PWKI-DNNDGCLRRTLTYIKAASKLVKAVKATEEQKYLKAAGNSFAVLSIVSTPDVPCGN  426

Query  968   TFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSR  1147
              FK+E+LY I PGP L S +++THL +SW + F +STM+K +IE G +QG+ + +++FS 
Sbjct  427   CFKIEILYCIKPGPQLSSEDQTTHLTVSWRINFIQSTMIKGMIENGAKQGMSEGYAQFSE  486

Query  1148  FLAQHCKVITSAEVLDN-GHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHIL  1324
              L+Q  KV    +   N   +LA+L ++      L   +  NFT + +  + LY   H+ 
Sbjct  487   VLSQRFKVAELDDANSNKDKILASLHTQKEPSWRLVVRFLGNFTFIFSVIIALYIVAHLH  546

Query  1325  LSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAH  1504
             LS+S  + GLE+ G+DLPDS+GE++ C +L+L  + + ++   F+ A  +RGSDHGV+AH
Sbjct  547   LSKSNAMNGLEYFGIDLPDSIGEVVVCTVLILQGQNIKKVTRRFLNAWKQRGSDHGVKAH  606

Query  1505  GDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPA  1684
             GDGW+LTVALIEGT + +   +   D  VVFTCN K +TSS++  T DP+WNEI EF+  
Sbjct  607   GDGWLLTVALIEGTGIIAAGSSDLFDLHVVFTCNTKRKTSSIKFHTSDPKWNEIFEFDAM  666

Query  1685  EEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHL  1864
             ++PPS +DV + D +G FD+A  +GH E+NFLK+  ++L D+WLPL GK   +   K+HL
Sbjct  667   DDPPSRMDVAIHDSNG-FDEA-PIGHTEVNFLKNNLSDLTDIWLPLDGKCDPARNPKIHL  724

Query  1865  RIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLK  2044
             RIFLNN+ G E + + L KM KEVGKK+NLRS   NS F+K F LPPEEFLI+DF+C LK
Sbjct  725   RIFLNNSRGTEVVMNYLAKMGKEVGKKINLRSAQTNSAFRKLFNLPPEEFLIDDFTCHLK  784

Query  2045  RKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHK  2224
             RK+PLQGR+F S RI+GFY+N+FGHKTKFFFLWEDI++I V+P + S +GSPSL++IL K
Sbjct  785   RKMPLQGRLFFSPRIIGFYSNIFGHKTKFFFLWEDIDDIQVIPATLS-IGSPSLMLILRK  843

Query  2225  DRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYK  2404
             DRG++A++ AK  D  GRL F F SFVSF  A R IM +WK R+ + +QK +I E++   
Sbjct  844   DRGSEAKHDAKGTDHLGRLKFHFQSFVSFSDAHRIIMGIWKMRSPVSEQKGEIIEKESEL  903

Query  2405  DENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVT  2584
              E  +  EE+GS    EDV MS+++S  L ++ +SLMEMF+GG LE+KVM K+GC++Y  
Sbjct  904   KE--LQAEESGSLFTHEDVKMSEIFSSVLSVDVESLMEMFSGGQLENKVMQKTGCVDYSP  961

Query  2585  SSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSD  2764
             + WEL+  ++Y+R++SYK ++ +S +G E ++TQ+K    N  GW + E+M +  V   D
Sbjct  962   TEWELVYRNIYQRQISYKFDKALSRYGGEASTTQQKYALVNQDGWAIEEVMTLQSVLPGD  1021

Query  2765  HYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVG  2944
              + +QL+Y + +     N+C   V +GV WLK+TK + + TKNI+   S R+KE+   V 
Sbjct  1022  CFSLQLKYHMANIPPKPNTCNVQVLLGVAWLKSTKQQKKTTKNIMSNTSNRLKELFSEVE  1081

Query  2945  REV  2953
             +++
Sbjct  1082  KDI  1084



>ref|XP_002437261.1| hypothetical protein SORBIDRAFT_10g023780 [Sorghum bicolor]
 gb|EER88628.1| hypothetical protein SORBIDRAFT_10g023780 [Sorghum bicolor]
Length=1101

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/789 (48%), Positives = 539/789 (68%), Gaps = 10/789 (1%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             S  E +K+++S+ +G EMP NL GG+L+D++Y   P + N LLF+P+S F   +AELQGT
Sbjct  305   SLDELLKVMESKDQGSEMPANLPGGVLVDESYVAAPTELNSLLFSPNSDFWPAVAELQGT  364

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
                Q  PW   S N+SC+ R +TYTK A+KLVK+V+ATEEQ YLK     +AV   VSTP
Sbjct  365   SGFQIEPWKLDS-NESCVQRTLTYTKAASKLVKAVKATEEQKYLKAAANSYAVFSVVSTP  423

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             DVP G+ FKVE+LY I PGP L S E+++HL +SW V F +STM+K +IE G +QG+ + 
Sbjct  424   DVPCGNCFKVEILYCITPGPHLSSEEQTSHLTVSWRVNFVQSTMIKGMIENGAKQGMAEG  483

Query  1130  FSEFSRFLAQHCKVITSAEVLDNGH-LLATLPSEHPSDLELAREYFCNFTVVSTAFLVLY  1306
             +++FS  L Q  KV    +   N   +LA+L ++  S   L   +  NFT + +  + LY
Sbjct  484   YAQFSEVLNQKLKVAELDDANSNKEKILASLHAQKESGWRLIVRFLGNFTFIFSVAIALY  543

Query  1307  FSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSD  1486
                H+ LS+     GLE+ GLDLPDS+GE++ C +L+L  + + ++   F+ A  +RGSD
Sbjct  544   VIAHLHLSKPDVTHGLEYFGLDLPDSIGEVVVCAVLILQGQSIVKVTRRFLSAWKQRGSD  603

Query  1487  HGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEI  1666
             HGV+AHGDGW+LTVALIE T + +   +   D +VVFTCN K +TSS++ QT DP+WNEI
Sbjct  604   HGVKAHGDGWLLTVALIEATGITATGSSDLFDLYVVFTCNAKRKTSSIKFQTSDPKWNEI  663

Query  1667  LEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSS  1846
              EF+  ++PPS +DV ++D  G       +GH E+NFLK+  +EL D+WLPL GK  Q+S
Sbjct  664   FEFDAMDDPPSRMDVALYDSSGQC----VIGHTEVNFLKNNLSELTDIWLPLNGKCDQAS  719

Query  1847  QSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
               KLHLRIFLNN+ G E + + L KM KEVGKK+NLRS   N  F+K F LPPEEFLI+D
Sbjct  720   NPKLHLRIFLNNSRGTEVVMNYLAKMGKEVGKKINLRSTQTNVAFRKLFALPPEEFLIDD  779

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             F+C LKRK+PLQGR+F S RIVGFY+N+FGHKTKFFFLWED+++I V+P + S +GSPSL
Sbjct  780   FTCHLKRKMPLQGRLFFSPRIVGFYSNIFGHKTKFFFLWEDVDDIQVIPATLS-IGSPSL  838

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIA  2386
             +I+L KDRG +A++GAK  D  GRL F F SFVSF  A R I A+WK RA  P+QK +  
Sbjct  839   MILLRKDRGLEAKHGAKGTDHHGRLKFIFQSFVSFNDAYRIITAIWKIRALSPEQKGEAI  898

Query  2387  EEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSG  2566
             E+ + K+   +LPEE GS     DV MS+++S  L ++ +SLMEMF+GG LEHK+M K+G
Sbjct  899   EKDEVKE---LLPEECGSLFTNADVKMSEIFSSVLSVDVESLMEMFSGGPLEHKMMQKAG  955

Query  2567  CLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIH  2746
             C++Y  + WEL+  ++ +R+ SYK ++ +S +G E T+T++K    N  GW + ++M + 
Sbjct  956   CVDYTATQWELVGCNIQQRQTSYKFDKNLSRYGGEATTTEQKYSLVNQDGWAIEKVMTLQ  1015

Query  2747  GVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKE  2926
             GV  +D++ +Q++Y + +  +  N+C   V +G+ WLK+TK + ++TK I+   S R+KE
Sbjct  1016  GVLLADYFNLQMKYFITNIPSKPNTCSILVLLGIAWLKSTKQKKKVTKTIISNTSNRLKE  1075

Query  2927  MIEFVGREV  2953
             +   V +E+
Sbjct  1076  LFAEVEKEL  1084



>ref|XP_008659764.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
isoform X1 [Zea mays]
Length=1131

 Score =   782 bits (2019),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/796 (47%), Positives = 537/796 (67%), Gaps = 10/796 (1%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             S  E +K+++S+ +G EMP  L GG L+D++Y   P + N LLF+  S F   +AELQGT
Sbjct  335   SLDELLKVMESKDQGSEMPAALPGGTLVDESYVAAPTELNSLLFSASSDFWPAVAELQGT  394

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
                Q  PW   S ++S + R ++YTK A+KLVK+V+ATEEQ YLK  G  +AV   VSTP
Sbjct  395   SGFQIEPWKLDS-SESFVQRTLSYTKAASKLVKAVKATEEQKYLKAAGNSYAVFSVVSTP  453

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             DVP G+ FKVE+LY + PGP L S E++ HL +SW V F +STM+K +IE G +QG+ + 
Sbjct  454   DVPCGNCFKVEILYCVTPGPQLPSEEQTCHLTVSWRVNFVQSTMIKGMIESGAKQGMAEG  513

Query  1130  FSEFSRFLAQHCKVITSAEVLDNGH-LLATLPSEHPSDLELAREYFCNFTVVSTAFLVLY  1306
             F++FS  L+Q  K     +   N   +LA+L ++  S   L   +  NFT + +  + LY
Sbjct  514   FAQFSEVLSQKLKTAELDDANSNKEKILASLHAQKESCWRLVVRFLGNFTFIFSVAIALY  573

Query  1307  FSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSD  1486
                H+ LS+   + GLE+ GLDLPDS+GE++ C +L+L  + + ++   F+ A  +RGSD
Sbjct  574   VIAHLHLSKPDVMHGLEYFGLDLPDSIGEVVVCAVLILQGQNIVKVTRRFLSAWKQRGSD  633

Query  1487  HGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEI  1666
             HGV+AHGDGW+LTVALIEGT + +   +   D +VVFTCN K +TSS++ QT DP+WNEI
Sbjct  634   HGVKAHGDGWLLTVALIEGTGIIATGSSDLFDIYVVFTCNAKRKTSSIKFQTSDPKWNEI  693

Query  1667  LEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSS  1846
              EF+  ++PPS +DV ++D  G       +GH E+NFLK+  +EL D+WLP+ GK  Q+S
Sbjct  694   FEFDAMDDPPSRMDVAIYDSSGQC----VIGHTEVNFLKNNLSELTDIWLPVSGKCDQAS  749

Query  1847  QSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
               +LHLRIFLNN+ G E + + L KM KEVGKK+NLRS   N  F+K F LP EEFLI+D
Sbjct  750   NPRLHLRIFLNNSRGTEVVMNYLAKMGKEVGKKINLRSAQTNVAFRKLFALPLEEFLIDD  809

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             F+C LKRK+PLQGR+F S RIVGFY+N+FGHKTKFFFLWED+++I V+P + S +GSPSL
Sbjct  810   FTCHLKRKMPLQGRLFFSPRIVGFYSNIFGHKTKFFFLWEDVDDIQVIPATLS-IGSPSL  868

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIA  2386
             +IIL KDRG +A++GAK  D  GRL F F SFVSF  A R I A+WK RA  P+QK +  
Sbjct  869   MIILRKDRGLEAKHGAKGTDHHGRLKFVFQSFVSFNDAYRIITAIWKIRALSPEQKGEAT  928

Query  2387  EEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSG  2566
             E+ + K+   +LPEE G+     DV MS+++S  L ++ +SLMEMF+GG LEHK+M K+G
Sbjct  929   EKDEVKE---LLPEEAGTLFTNADVKMSEIFSSVLSVDVESLMEMFSGGPLEHKMMQKAG  985

Query  2567  CLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIH  2746
             C++Y  + WEL+  ++ +R+ SYKL++ +S  G E  +T++K    N  GW + ++M + 
Sbjct  986   CIDYTATQWELVGCNIQQRQTSYKLDKNLSRHGGEAATTEQKYSLVNQDGWAIEKVMTLQ  1045

Query  2747  GVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKE  2926
             GV  +DH+ +Q++Y + +  +  N+C   V +G+ WLK+TK + ++TK+I+   S  +KE
Sbjct  1046  GVLLADHFNLQMKYCITNVPSKPNTCSVLVLLGIAWLKSTKQQKKVTKSIISNTSNGLKE  1105

Query  2927  MIEFVGREVFLSS*KH  2974
             +   V +E+  SS  H
Sbjct  1106  LFAEVEKELTSSSSSH  1121



>gb|AFW87239.1| hypothetical protein ZEAMMB73_926045 [Zea mays]
Length=1141

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/796 (47%), Positives = 537/796 (67%), Gaps = 10/796 (1%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             S  E +K+++S+ +G EMP  L GG L+D++Y   P + N LLF+  S F   +AELQGT
Sbjct  345   SLDELLKVMESKDQGSEMPAALPGGTLVDESYVAAPTELNSLLFSASSDFWPAVAELQGT  404

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
                Q  PW   S ++S + R ++YTK A+KLVK+V+ATEEQ YLK  G  +AV   VSTP
Sbjct  405   SGFQIEPWKLDS-SESFVQRTLSYTKAASKLVKAVKATEEQKYLKAAGNSYAVFSVVSTP  463

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             DVP G+ FKVE+LY + PGP L S E++ HL +SW V F +STM+K +IE G +QG+ + 
Sbjct  464   DVPCGNCFKVEILYCVTPGPQLPSEEQTCHLTVSWRVNFVQSTMIKGMIESGAKQGMAEG  523

Query  1130  FSEFSRFLAQHCKVITSAEVLDNGH-LLATLPSEHPSDLELAREYFCNFTVVSTAFLVLY  1306
             F++FS  L+Q  K     +   N   +LA+L ++  S   L   +  NFT + +  + LY
Sbjct  524   FAQFSEVLSQKLKTAELDDANSNKEKILASLHAQKESCWRLVVRFLGNFTFIFSVAIALY  583

Query  1307  FSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSD  1486
                H+ LS+   + GLE+ GLDLPDS+GE++ C +L+L  + + ++   F+ A  +RGSD
Sbjct  584   VIAHLHLSKPDVMHGLEYFGLDLPDSIGEVVVCAVLILQGQNIVKVTRRFLSAWKQRGSD  643

Query  1487  HGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEI  1666
             HGV+AHGDGW+LTVALIEGT + +   +   D +VVFTCN K +TSS++ QT DP+WNEI
Sbjct  644   HGVKAHGDGWLLTVALIEGTGIIATGSSDLFDIYVVFTCNAKRKTSSIKFQTSDPKWNEI  703

Query  1667  LEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSS  1846
              EF+  ++PPS +DV ++D  G       +GH E+NFLK+  +EL D+WLP+ GK  Q+S
Sbjct  704   FEFDAMDDPPSRMDVAIYDSSGQC----VIGHTEVNFLKNNLSELTDIWLPVSGKCDQAS  759

Query  1847  QSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
               +LHLRIFLNN+ G E + + L KM KEVGKK+NLRS   N  F+K F LP EEFLI+D
Sbjct  760   NPRLHLRIFLNNSRGTEVVMNYLAKMGKEVGKKINLRSAQTNVAFRKLFALPLEEFLIDD  819

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             F+C LKRK+PLQGR+F S RIVGFY+N+FGHKTKFFFLWED+++I V+P + S +GSPSL
Sbjct  820   FTCHLKRKMPLQGRLFFSPRIVGFYSNIFGHKTKFFFLWEDVDDIQVIPATLS-IGSPSL  878

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIA  2386
             +IIL KDRG +A++GAK  D  GRL F F SFVSF  A R I A+WK RA  P+QK +  
Sbjct  879   MIILRKDRGLEAKHGAKGTDHHGRLKFVFQSFVSFNDAYRIITAIWKIRALSPEQKGEAT  938

Query  2387  EEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSG  2566
             E+ + K+   +LPEE G+     DV MS+++S  L ++ +SLMEMF+GG LEHK+M K+G
Sbjct  939   EKDEVKE---LLPEEAGTLFTNADVKMSEIFSSVLSVDVESLMEMFSGGPLEHKMMQKAG  995

Query  2567  CLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIH  2746
             C++Y  + WEL+  ++ +R+ SYKL++ +S  G E  +T++K    N  GW + ++M + 
Sbjct  996   CIDYTATQWELVGCNIQQRQTSYKLDKNLSRHGGEAATTEQKYSLVNQDGWAIEKVMTLQ  1055

Query  2747  GVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKE  2926
             GV  +DH+ +Q++Y + +  +  N+C   V +G+ WLK+TK + ++TK+I+   S  +KE
Sbjct  1056  GVLLADHFNLQMKYCITNVPSKPNTCSVLVLLGIAWLKSTKQQKKVTKSIISNTSNGLKE  1115

Query  2927  MIEFVGREVFLSS*KH  2974
             +   V +E+  SS  H
Sbjct  1116  LFAEVEKELTSSSSSH  1131



>gb|KCW75057.1| hypothetical protein EUGRSUZ_E038332, partial [Eucalyptus grandis]
Length=649

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/650 (54%), Positives = 483/650 (74%), Gaps = 3/650 (0%)
 Frame = +2

Query  1013  LRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRFLAQHCKVITSAEVL  1192
             L SGE+S+ LVISW + F ++TMMK +IE G +QGLKDSF +++  L Q  K + S ++ 
Sbjct  1     LPSGEQSSRLVISWRMNFLQNTMMKGMIESGVRQGLKDSFEQYASLLNQTVKPVDSKDIG  60

Query  1193  DNG-HLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGL  1369
              N   +LA+L +E  SD +LA +YF NFTV+ST  + LY  +H+ L+  + + GLEF GL
Sbjct  61    SNKEQILASLQAEPQSDWKLAVQYFANFTVLSTFVMGLYVLVHLWLATPSPIHGLEFVGL  120

Query  1370  DLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTN  1549
             DLPDS+GE+I CG+LVL  E+V   I+ F++AR+++GSDHGV+A GDGW+LTVALIEG++
Sbjct  121   DLPDSIGEVIVCGMLVLQAERVLGFISRFMQARMQKGSDHGVKAQGDGWLLTVALIEGSS  180

Query  1550  LASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFD  1729
             +A++D +   DP+VVFTCNGK+RTSS++ Q  DP WNEI EF+  E+PPSMLDVEVFDFD
Sbjct  181   IAAVDSSALSDPYVVFTCNGKTRTSSIKFQKTDPLWNEIFEFDAMEDPPSMLDVEVFDFD  240

Query  1730  GPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRIFLNNNNGVETIRD  1909
             GPFD+A SLGHAE+NF+++  ++LAD+W+ L GK+AQ+ QSKLHLRIFL+N  G    ++
Sbjct  241   GPFDEATSLGHAEVNFVRNNISDLADVWVTLHGKLAQACQSKLHLRIFLDNTKGSNVAKE  300

Query  1910  NLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRI  2089
              ++KMEKEVGKK+N+RSP  NS FQK F LPPEEFLINDF+C LKRK+PLQGR+FLS RI
Sbjct  301   YISKMEKEVGKKINIRSPQTNSAFQKLFALPPEEFLINDFTCHLKRKMPLQGRLFLSARI  360

Query  2090  VGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDE  2269
             +GF+ANLFG KTKFFFLWEDIE+I VL P+ ++MGSP +V+ L + RG +AR+GAK+ DE
Sbjct  361   IGFHANLFGQKTKFFFLWEDIEDIQVLSPTLASMGSPIVVMTLRRGRGMEARHGAKTQDE  420

Query  2270  EGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKDENNVLPEETGSYLI  2449
             EGRL F F SFVSF  A RTIMALWK R+  P+QK Q+ EE+   +  +++ EE+GS+L 
Sbjct  421   EGRLKFQFQSFVSFNVAHRTIMALWKARSLTPEQKVQLIEEE--SEARSLVTEESGSFLG  478

Query  2450  VEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRV  2629
             +EDVS+S+VY   LP+     +E+F G DLE KVM K+GCLNY  + WE  +PDVYER++
Sbjct  479   LEDVSLSEVYCSVLPVPTNFFLEVFGGEDLERKVMEKAGCLNYSYTPWESEKPDVYERQL  538

Query  2630  SYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSA  2809
              Y+ ++ IS +  EVTSTQ+KS   +  GW++ E+M +H +P  D++ + LRY++E   +
Sbjct  539   YYRFDKRISRYRGEVTSTQQKSALPDRDGWLIEEVMTLHAIPLGDYFNLHLRYQIEDAPS  598

Query  2810  ARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGREVFL  2959
                 C   V+ G+ WLK++K + RITKNI+     R+K M   + +E  L
Sbjct  599   RPKECSIKVFFGIAWLKSSKHQKRITKNILVNLQDRLKVMFGAIEKEFTL  648



>gb|KCW75056.1| hypothetical protein EUGRSUZ_E038332, partial [Eucalyptus grandis]
Length=644

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/637 (55%), Positives = 477/637 (75%), Gaps = 3/637 (0%)
 Frame = +2

Query  1013  LRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRFLAQHCKVITSAEVL  1192
             L SGE+S+ LVISW + F ++TMMK +IE G +QGLKDSF +++  L Q  K + S ++ 
Sbjct  1     LPSGEQSSRLVISWRMNFLQNTMMKGMIESGVRQGLKDSFEQYASLLNQTVKPVDSKDIG  60

Query  1193  DNG-HLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGL  1369
              N   +LA+L +E  SD +LA +YF NFTV+ST  + LY  +H+ L+  + + GLEF GL
Sbjct  61    SNKEQILASLQAEPQSDWKLAVQYFANFTVLSTFVMGLYVLVHLWLATPSPIHGLEFVGL  120

Query  1370  DLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTN  1549
             DLPDS+GE+I CG+LVL  E+V   I+ F++AR+++GSDHGV+A GDGW+LTVALIEG++
Sbjct  121   DLPDSIGEVIVCGMLVLQAERVLGFISRFMQARMQKGSDHGVKAQGDGWLLTVALIEGSS  180

Query  1550  LASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFD  1729
             +A++D +   DP+VVFTCNGK+RTSS++ Q  DP WNEI EF+  E+PPSMLDVEVFDFD
Sbjct  181   IAAVDSSALSDPYVVFTCNGKTRTSSIKFQKTDPLWNEIFEFDAMEDPPSMLDVEVFDFD  240

Query  1730  GPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRIFLNNNNGVETIRD  1909
             GPFD+A SLGHAE+NF+++  ++LAD+W+ L GK+AQ+ QSKLHLRIFL+N  G    ++
Sbjct  241   GPFDEATSLGHAEVNFVRNNISDLADVWVTLHGKLAQACQSKLHLRIFLDNTKGSNVAKE  300

Query  1910  NLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRI  2089
              ++KMEKEVGKK+N+RSP  NS FQK F LPPEEFLINDF+C LKRK+PLQGR+FLS RI
Sbjct  301   YISKMEKEVGKKINIRSPQTNSAFQKLFALPPEEFLINDFTCHLKRKMPLQGRLFLSARI  360

Query  2090  VGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDE  2269
             +GF+ANLFG KTKFFFLWEDIE+I VL P+ ++MGSP +V+ L + RG +AR+GAK+ DE
Sbjct  361   IGFHANLFGQKTKFFFLWEDIEDIQVLSPTLASMGSPIVVMTLRRGRGMEARHGAKTQDE  420

Query  2270  EGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKDENNVLPEETGSYLI  2449
             EGRL F F SFVSF  A RTIMALWK R+  P+QK Q+ EE+   +  +++ EE+GS+L 
Sbjct  421   EGRLKFQFQSFVSFNVAHRTIMALWKARSLTPEQKVQLIEEE--SEARSLVTEESGSFLG  478

Query  2450  VEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRV  2629
             +EDVS+S+VY   LP+     +E+F G DLE KVM K+GCLNY  + WE  +PDVYER++
Sbjct  479   LEDVSLSEVYCSVLPVPTNFFLEVFGGEDLERKVMEKAGCLNYSYTPWESEKPDVYERQL  538

Query  2630  SYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSA  2809
              Y+ ++ IS +  EVTSTQ+KS   +  GW++ E+M +H +P  D++ + LRY++E   +
Sbjct  539   YYRFDKRISRYRGEVTSTQQKSALPDRDGWLIEEVMTLHAIPLGDYFNLHLRYQIEDAPS  598

Query  2810  ARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRV  2920
                 C   V+ G+ WLK++K + RITKNI+     R+
Sbjct  599   RPKECSIKVFFGIAWLKSSKHQKRITKNILVNLQDRL  635



>ref|XP_006350247.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
isoform X2 [Solanum tuberosum]
Length=893

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/674 (54%), Positives = 502/674 (74%), Gaps = 27/674 (4%)
 Frame = +2

Query  554   DNVQETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDS  733
             +N QE  +S + +F E +K +++R +  E+P NL  G+++DQ YA+ P + N+ LF+PDS
Sbjct  224   ENAQEE-QSTSGNFQELLKSIEAREQPSEVP-NL-SGVVVDQLYAIAPHELNLFLFSPDS  280

Query  734   QFRRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDG  913
              F + L ++QG+ +++ GPW  ++  +S L RVV++ K A++L+K+++ TEEQTYLK DG
Sbjct  281   AFFKSLVDIQGSTELRVGPWKLENGGES-LKRVVSFIKAASRLIKALKTTEEQTYLKADG  339

Query  914   KEFAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTV  1093
             K F++L  VSTPD PYGSTFKVE+LY+I PGP L SGE+S+ LV+SW + F +STMMK +
Sbjct  340   KSFSLLCIVSTPDAPYGSTFKVEVLYSITPGPELPSGEQSSRLVVSWRMNFLQSTMMKGM  399

Query  1094  IEGGTQQGLKDSFSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCN  1270
             IE G +QG+K+SF +++  L+Q+ K + + ++  +   +LA++  EH SD +LA +YF N
Sbjct  400   IENGARQGIKESFDQYANLLSQNVKPVDAKDLGSEKEQILASIEVEHQSDWKLAFQYFAN  459

Query  1271  FTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIA  1450
             FT++ST F+ LY  +H+LL+  + +QGLEF GLDLPDS+GE+I CG+LVL  ++V  +I+
Sbjct  460   FTIISTFFIGLYVFVHVLLAMPSTIQGLEFVGLDLPDSIGELIVCGVLVLQGKRVLELIS  519

Query  1451  HFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSV  1630
              F+ AR+++GSDHG++A GDGW+LTVALIEG NLA++D +GF DP+VVFTCNGK+RTSS+
Sbjct  520   RFMRARVQKGSDHGIKAQGDGWLLTVALIEGNNLAAVDTSGFSDPYVVFTCNGKTRTSSI  579

Query  1631  QLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADL  1810
             + Q   P+WNEI EF+  ++PPS+LDVEVFDFDGPF +A SLGHAEINF+K   ++L+D+
Sbjct  580   KFQKSSPKWNEIFEFDAMDDPPSVLDVEVFDFDGPFSEATSLGHAEINFVKTNISDLSDV  639

Query  1811  WLPLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKT  1990
              +PL GK+AQ+ QSKLHLR+FLNN  G   ++D L+KMEKEVGKK+ +RSP  NS FQK 
Sbjct  640   MVPLQGKLAQACQSKLHLRVFLNNTKGSNVVKDYLSKMEKEVGKKIKVRSPQTNSAFQKL  699

Query  1991  FGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVL  2170
             FGLPPEEFLINDF+C LKRK+PLQGR+FLS RI+GF+++LFGHKT FF LWEDIE+I V 
Sbjct  700   FGLPPEEFLINDFACHLKRKMPLQGRLFLSARIIGFHSDLFGHKTNFFLLWEDIEDIQVE  759

Query  2171  PPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKT  2350
              P+ ++MGSP++++ L   RG DAR+GAK+ DEEGRL F FHSFVSF  A RT MALWK 
Sbjct  760   SPTLASMGSPNVIMTLKPGRGFDARHGAKTQDEEGRLKFHFHSFVSFNVAHRTFMALWKA  819

Query  2351  RACIPDQKAQIAEEQ------QYKDENNV----------------LPEETGSYLIVEDVS  2464
             RA  P+QK QI E +      Q  +E+++                  EE GS++ +ED++
Sbjct  820   RALSPEQKVQIVEAEAEAKNLQMAEEDSIGSDFQAADDDSEGKSLQSEEGGSFVGMEDIN  879

Query  2465  MSKVYSVDLPMNHK  2506
             MS VYS  L +  K
Sbjct  880   MSIVYSSVLSVPFK  893



>gb|EMT09824.1| hypothetical protein F775_15805 [Aegilops tauschii]
Length=1050

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/792 (48%), Positives = 541/792 (68%), Gaps = 34/792 (4%)
 Frame = +2

Query  599   EAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDV  778
             E +K ++S+ +G  MP NL GG+LL+Q+Y + P + N++LF+ +S F   +AE+QG    
Sbjct  279   ELLKTMESKDQGGGMPGNLPGGVLLEQSYIIKPAELNVMLFSANSDFWPAVAEVQGLSGF  338

Query  779   QEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVP  958
             Q  PW ++ +N++ + R +TYTK A+KLVK+V+ATE+QTYLK  G  FAVL  VSTP+VP
Sbjct  339   QIDPWKYE-NNENSVKRTLTYTKAASKLVKAVKATEKQTYLKAAGNSFAVLSSVSTPEVP  397

Query  959   YGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSE  1138
              G+ FKVE+LY I+PG  L S E+++ L ISW + F +STM+K +IE GT+QGL++ +++
Sbjct  398   CGNCFKVEILYCIIPGTPLPSEEQTSQLTISWRLNFVQSTMLKGMIENGTRQGLREGYAQ  457

Query  1139  FSRFLAQHCKVITSAEVLD----NGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLY  1306
             F+  L++  KV   AE+ D       +LA+L +   S+ +L   +  +F  + +  + +Y
Sbjct  458   FTEVLSKKIKV---AELGDAKSSKDKMLASLQTHEQSNWKLVSRFLGSFAFIFSFTVAVY  514

Query  1307  FSIHILLSRSTQL--QGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRG  1480
                H+ L + +++   GLE+ G+DLPDSVGE++ C +L+L    ++++   F++A  +RG
Sbjct  515   GIAHLGLVKPSKMVHGGLEYFGIDLPDSVGEVVFCALLILQGRNIFKVGQRFLQAWRKRG  574

Query  1481  SDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWN  1660
             SDHGV+AHGDGW+LTVALIEG+ +      G  DP+VVF CNGK +TSSV+ QT +P+WN
Sbjct  575   SDHGVKAHGDGWLLTVALIEGSGIVGAGTPGLADPYVVFMCNGKRKTSSVKFQTSEPKWN  634

Query  1661  EILEFEPAEEPPSMLDVEVFDFDG-PFDQARSLGHAEINFLKHTSAELADLWLPLGGKIA  1837
             EI EF+  ++PPS LDV V D DG P D A  +G  EINF+K+  ++L D WLPL G+ A
Sbjct  635   EIFEFDAMDDPPSRLDVVVHDSDGLPDDNA--IGRTEINFVKNNLSDLDDTWLPLDGRFA  692

Query  1838  QSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFL  2017
             Q S+ KLHLRIFLNN+ G E + + L KM KEVGKK+ LRS   NS+F+K F LPPEEFL
Sbjct  693   QGSEPKLHLRIFLNNSRGTEVVMNYLEKMGKEVGKKMPLRSSQTNSSFRKLFSLPPEEFL  752

Query  2018  INDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGS  2197
             I+DF+C LKRK+PLQGR+FLS RI+GFY+N+FG KTKFFFLWEDI++I V+PPS ST+GS
Sbjct  753   IDDFTCHLKRKMPLQGRLFLSPRIIGFYSNIFGRKTKFFFLWEDIDDIQVVPPSLSTVGS  812

Query  2198  PSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKA  2377
             PSL+IIL KDRG + R+GAK+ D +GRL F F +FVSF  A R IMALWKTR+   +QK 
Sbjct  813   PSLMIILQKDRGLEVRHGAKTQDPQGRLRFHFQTFVSFNDAHRVIMALWKTRSSGLEQKG  872

Query  2378  QIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMS  2557
             +  +++    E   LP E  S L  EDV+              +LMEMF+GG LEHKVM 
Sbjct  873   ETTDKE---PEPKQLPNEEVSLLGNEDVN--------------ALMEMFSGGPLEHKVMQ  915

Query  2558  KSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIM  2737
             K+GC++Y  + WE +  ++Y+R++S++L++     G E T+ Q+K    N  GW+L E+M
Sbjct  916   KAGCVDYSPTEWEPVNRNMYQRQISFRLSK----HGGEATTKQQKYNLQNRDGWVLEEVM  971

Query  2738  AIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQR  2917
              + GV   D+  +QL+Y + S S   NSC   V +G++WLK T+ + + TKN++   + R
Sbjct  972   TLQGVLHEDYSSIQLKYHMMSTSLKPNSCSIQVMLGIVWLKGTRHQKKATKNVMSNSTNR  1031

Query  2918  VKEMIEFVGREV  2953
             +KE+   V +E+
Sbjct  1032  LKEIFSEVEKEL  1043



>ref|XP_006584108.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
isoform X3 [Glycine max]
Length=875

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/645 (56%), Positives = 480/645 (74%), Gaps = 6/645 (1%)
 Frame = +2

Query  566   ETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRR  745
             E  +S  ++F E +K +QS  +G E+P NL GG+L+DQ Y + P+D N+LLF+PDS F +
Sbjct  230   EEDQSSNETFEETMKKIQSADQGSEIPNNLSGGVLIDQLYIVAPEDLNVLLFSPDSNFPK  289

Query  746   ELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFA  925
              L+E QGT ++Q  PW  ++  ++ L R +TY K ATKL+K+V+  E+QTYLK DGK FA
Sbjct  290   SLSEEQGTSELQICPWKLENGGET-LKRSLTYIKAATKLIKAVKGYEDQTYLKADGKNFA  348

Query  926   VLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGG  1105
             VL  VSTPDV YG+TF+VE+LY I PGP L SGE+ + LVISW + F +STMMK +IE G
Sbjct  349   VLGSVSTPDVMYGTTFRVEVLYVITPGPELPSGEQCSRLVISWRMNFLQSTMMKGMIESG  408

Query  1106  TQQGLKDSFSEFSRFLAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYFCNFTVV  1282
              +QG+KDSF +++  L Q  K + S ++  +    LATL  E  S L+LA +Y  NFTV 
Sbjct  409   ARQGMKDSFDQYATLLCQTVKPVVSKDLGSSKEQALATLRPEPQSILKLAMQYLANFTVF  468

Query  1283  STAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVE  1462
             +T  +V Y  +HI L+    +QGLEF G DLPDS+GE + C +LVL  E+V  +I+ F++
Sbjct  469   TTFLMVSYVLVHIYLAAPRTIQGLEFVGFDLPDSIGEFVVCIVLVLQGERVLGLISRFMQ  528

Query  1463  ARLR--RGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQL  1636
             AR R  +GSDHG++A G+GW+LTVALIEG+NLA++D   F DP+VVFTCNGK+RTSS++ 
Sbjct  529   ARARARKGSDHGIKAQGEGWMLTVALIEGSNLATVDSGAFCDPYVVFTCNGKTRTSSIKF  588

Query  1637  QTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWL  1816
             +  DP WNEI EF+  ++PPS+LDVEV+DFDGP D+A SLG  EINFLK   ++LAD+W+
Sbjct  589   KKSDPLWNEIFEFDAMDDPPSVLDVEVYDFDGPCDKAASLGRVEINFLKTNISDLADIWV  648

Query  1817  PLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFG  1996
              L GK+A +  SKLHL++FLNN  G + ++  ++KMEKEVGKK+NLRSP  NS FQK FG
Sbjct  649   SLEGKLALACHSKLHLKVFLNNTRGGDVVKHYISKMEKEVGKKINLRSPQTNSAFQKLFG  708

Query  1997  LPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPP  2176
             LPPEEFLINDF+C LKRK+PLQGR+F+S RI+GF+ANLFGHKTKFF LWEDIE+I ++PP
Sbjct  709   LPPEEFLINDFTCHLKRKMPLQGRLFVSARIIGFHANLFGHKTKFFLLWEDIEDIQIIPP  768

Query  2177  SFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRA  2356
             +FS+MGSP +VI L   RG DAR+GAK+ DEEGRL F F SFVSF  A+RTIMALWK R+
Sbjct  769   TFSSMGSPIIVITLWPGRGVDARHGAKTQDEEGRLKFRFQSFVSFNVANRTIMALWKARS  828

Query  2357  CIPDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDL  2491
               P+QK Q+ EE    +  ++  EE+GS++ + DVSMS+V+S  L
Sbjct  829   LSPEQKVQLVEEDS--ETKSLRSEESGSFIGLGDVSMSEVHSSAL  871



>ref|XP_006584109.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
isoform X4 [Glycine max]
Length=874

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/645 (56%), Positives = 480/645 (74%), Gaps = 6/645 (1%)
 Frame = +2

Query  566   ETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRR  745
             E  +S  ++F E +K +QS  +G E+P NL GG+L+DQ Y + P+D N+LLF+PDS F +
Sbjct  230   EEDQSSNETFEETMKKIQSADQGSEIPNNLSGGVLIDQLYIVAPEDLNVLLFSPDSNFPK  289

Query  746   ELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFA  925
              L+E QGT ++Q  PW  ++  ++ L R +TY K ATKL+K+V+  E+QTYLK DGK FA
Sbjct  290   SLSEEQGTSELQICPWKLENGGET-LKRSLTYIKAATKLIKAVKGYEDQTYLKADGKNFA  348

Query  926   VLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGG  1105
             VL  VSTPDV YG+TF+VE+LY I PGP L SGE+ + LVISW + F +STMMK +IE G
Sbjct  349   VLGSVSTPDVMYGTTFRVEVLYVITPGPELPSGEQCSRLVISWRMNFLQSTMMKGMIESG  408

Query  1106  TQQGLKDSFSEFSRFLAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYFCNFTVV  1282
              +QG+KDSF +++  L Q  K + S ++  +    LATL  E  S L+LA +Y  NFTV 
Sbjct  409   ARQGMKDSFDQYATLLCQTVKPVVSKDLGSSKEQALATLRPEPQSILKLAMQYLANFTVF  468

Query  1283  STAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVE  1462
             +T  +V Y  +HI L+    +QGLEF G DLPDS+GE + C +LVL  E+V  +I+ F++
Sbjct  469   TTFLMVSYVLVHIYLAAPRTIQGLEFVGFDLPDSIGEFVVCIVLVLQGERVLGLISRFMQ  528

Query  1463  ARLR--RGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQL  1636
             AR R  +GSDHG++A G+GW+LTVALIEG+NLA++D   F DP+VVFTCNGK+RTSS++ 
Sbjct  529   ARARARKGSDHGIKAQGEGWMLTVALIEGSNLATVDSGAFCDPYVVFTCNGKTRTSSIKF  588

Query  1637  QTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWL  1816
             +  DP WNEI EF+  ++PPS+LDVEV+DFDGP D+A SLG  EINFLK   ++LAD+W+
Sbjct  589   KKSDPLWNEIFEFDAMDDPPSVLDVEVYDFDGPCDKAASLGRVEINFLKTNISDLADIWV  648

Query  1817  PLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFG  1996
              L GK+A +  SKLHL++FLNN  G + ++  ++KMEKEVGKK+NLRSP  NS FQK FG
Sbjct  649   SLEGKLALACHSKLHLKVFLNNTRGGDVVKHYISKMEKEVGKKINLRSPQTNSAFQKLFG  708

Query  1997  LPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPP  2176
             LPPEEFLINDF+C LKRK+PLQGR+F+S RI+GF+ANLFGHKTKFF LWEDIE+I ++PP
Sbjct  709   LPPEEFLINDFTCHLKRKMPLQGRLFVSARIIGFHANLFGHKTKFFLLWEDIEDIQIIPP  768

Query  2177  SFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRA  2356
             +FS+MGSP +VI L   RG DAR+GAK+ DEEGRL F F SFVSF  A+RTIMALWK R+
Sbjct  769   TFSSMGSPIIVITLWPGRGVDARHGAKTQDEEGRLKFRFQSFVSFNVANRTIMALWKARS  828

Query  2357  CIPDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDL  2491
               P+QK Q+ EE    +  ++  EE+GS++ + DVSMS+V+S  L
Sbjct  829   LSPEQKVQLVEEDS--ETKSLRSEESGSFIGLGDVSMSEVHSSAL  871



>gb|KDO78674.1| hypothetical protein CISIN_1g001764mg [Citrus sinensis]
Length=807

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/585 (60%), Positives = 451/585 (77%), Gaps = 2/585 (0%)
 Frame = +2

Query  575   RSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELA  754
             +S + SF EA+K ++ R  G E+P NL GG+L+DQ Y + P+D N LLF+PDS F R  A
Sbjct  224   QSSSASFEEAMKTMEPRDLGSEVPSNLPGGVLVDQMYVIAPQDLNTLLFSPDSNFPRTWA  283

Query  755   ELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLV  934
             E QG  ++Q GPW +++  +S L R VTY K A KL+K+ +  EEQTYLK DGK FA+L 
Sbjct  284   EEQGNTELQIGPWRFENGCES-LKRDVTYIKAANKLIKATKGFEEQTYLKADGKVFAILA  342

Query  935   DVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQ  1114
              VSTP+V YG +FK ELL+ I PGP L SGE+S+HLVISW + F +STMMK +IE G + 
Sbjct  343   SVSTPEVMYGGSFKTELLFCITPGPELSSGEQSSHLVISWRMNFLQSTMMKGMIENGARS  402

Query  1115  GLKDSFSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTA  1291
              L++++ +F+ FL+Q    + S ++ L+   +LA+L  E  SD +LA  YF NFTVVS+ 
Sbjct  403   ALRETYEQFATFLSQTITPVDSNDMGLNKEQILASLQPEPQSDWKLAVHYFANFTVVSSF  462

Query  1292  FLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARL  1471
             F+ +Y  IHI L+ ST +QGLEF GLDLPDS+GE I CG+LVL  E+  ++I+ F++AR 
Sbjct  463   FMGIYVLIHIWLATSTTIQGLEFVGLDLPDSIGEFIVCGVLVLQGERFLQLISRFMQARK  522

Query  1472  RRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDP  1651
             ++GSDHGV+A GDGW+LTVALI+G NLA++D +GF DP+VVFTCNGKSRTSS++ Q  DP
Sbjct  523   QKGSDHGVKAQGDGWLLTVALIKGDNLAAVDSSGFCDPYVVFTCNGKSRTSSIKFQQCDP  582

Query  1652  QWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGK  1831
              WNEI E++  +EPPSMLDVEV+DFDGPF++A SLGHAEINF+K   ++LAD+W+PL GK
Sbjct  583   MWNEIFEYDAMDEPPSMLDVEVYDFDGPFNEATSLGHAEINFVKSDISDLADVWIPLQGK  642

Query  1832  IAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEE  2011
             +AQ+ QSKLHLRIFLNN  G   +++ LTKMEKEVGKK+NLRSP  NS FQK FGLPPEE
Sbjct  643   LAQACQSKLHLRIFLNNTKGSNVVKEYLTKMEKEVGKKINLRSPQTNSAFQKLFGLPPEE  702

Query  2012  FLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTM  2191
             FLINDF+C LKRK+ LQGR+FLS RI+GF+ANLFGHKT FFFLWEDIE+I VLPPS S+M
Sbjct  703   FLINDFTCHLKRKMLLQGRLFLSARIIGFHANLFGHKTNFFFLWEDIEDIQVLPPSLSSM  762

Query  2192  GSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASR  2326
             GSP +V+ L + RG DAR+GAK+ DEEGRL F FHSFVS+  A R
Sbjct  763   GSPVIVMTLRQGRGMDARHGAKTQDEEGRLKFHFHSFVSYNVAHR  807



>gb|AFW77021.1| hypothetical protein ZEAMMB73_177708 [Zea mays]
Length=824

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/589 (58%), Positives = 449/589 (76%), Gaps = 3/589 (1%)
 Frame = +2

Query  563   QETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFR  742
             Q+   S T +F E +K   S+ EG+EMPENL GG++LDQ YA+ P D N LLF+P S F 
Sbjct  238   QDHDVSATMTFDELLKAFGSQHEGKEMPENLSGGVVLDQVYAVAPSDLNTLLFSPSSDFL  297

Query  743   RELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEF  922
             + LAE+QGT  ++   W  ++D +  L RVV+YTK  TKLVK+V+ATE+ TYLK DG+ F
Sbjct  298   QSLAEIQGTTGLEIQQWRLENDGE-ILRRVVSYTKAPTKLVKAVKATEDMTYLKADGEMF  356

Query  923   AVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEG  1102
             AV  DVSTP+VP+G+TF+VE+L  IMPGP LR  E+S+ L++SW + F +STMMK++IE 
Sbjct  357   AVFADVSTPEVPFGNTFRVEVLTCIMPGPELRGDEKSSRLMVSWHINFVQSTMMKSMIEN  416

Query  1103  GTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVV  1282
             G +QGLKD++ +FS  LA+HC+ + + +   +  +L+++  E  SD +LA   F NF ++
Sbjct  417   GAKQGLKDNYVQFSELLAKHCRPVDTKDTTSSNEVLSSVQPEQESDWKLAFRIFGNFALL  476

Query  1283  STAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVE  1462
             S+ F   Y S HI+L+  + +QGLEF GLDLPDS GE++ CG+LVL  ++V  MIA F++
Sbjct  477   SSVFAFFYVSAHIILASPSIIQGLEFPGLDLPDSAGEVVVCGVLVLQGQRVLNMIARFIQ  536

Query  1463  ARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQT  1642
             A+ +RG DHGV+A GDGW+LTVAL+EGTNLA+   +G+ DP+VVFTCNGK++TSS+   T
Sbjct  537   AKRQRG-DHGVKAQGDGWLLTVALMEGTNLAATKSSGYSDPYVVFTCNGKTKTSSINFHT  595

Query  1643  LDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTS-AELADLWLP  1819
             LDPQWNEI EF+  E+PPS++ + V+DFDGPFD+  SLGHAE+NFLK+ + +ELAD+W+P
Sbjct  596   LDPQWNEIFEFDAMEDPPSVMKIHVYDFDGPFDEVASLGHAEVNFLKYNNISELADIWIP  655

Query  1820  LGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGL  1999
             L GK+AQ+ QSKLHLRIFLNN  G E ++D L K+EKEVGKK+ +RSPH N  FQK F L
Sbjct  656   LKGKLAQACQSKLHLRIFLNNTRGTEVVKDYLDKVEKEVGKKIAMRSPHTNLAFQKIFSL  715

Query  2000  PPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPS  2179
             PPEEFLINDF+C LKRK+  QGRIFLS RI GFY NLFGHKTKFFFLWEDIE+I ++P +
Sbjct  716   PPEEFLINDFTCHLKRKMLTQGRIFLSPRIFGFYTNLFGHKTKFFFLWEDIEDILLVPAT  775

Query  2180  FSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASR  2326
              S+MGSPSLVIIL KDRG DA++GAK +D +GRL F F SFVSF  A +
Sbjct  776   LSSMGSPSLVIILRKDRGMDAKHGAKQLDSQGRLKFHFQSFVSFNVAHK  824



>gb|KDO78673.1| hypothetical protein CISIN_1g001764mg [Citrus sinensis]
Length=800

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/573 (60%), Positives = 441/573 (77%), Gaps = 2/573 (0%)
 Frame = +2

Query  575   RSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELA  754
             +S + SF EA+K ++ R  G E+P NL GG+L+DQ Y + P+D N LLF+PDS F R  A
Sbjct  224   QSSSASFEEAMKTMEPRDLGSEVPSNLPGGVLVDQMYVIAPQDLNTLLFSPDSNFPRTWA  283

Query  755   ELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLV  934
             E QG  ++Q GPW +++  +S L R VTY K A KL+K+ +  EEQTYLK DGK FA+L 
Sbjct  284   EEQGNTELQIGPWRFENGCES-LKRDVTYIKAANKLIKATKGFEEQTYLKADGKVFAILA  342

Query  935   DVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQ  1114
              VSTP+V YG +FK ELL+ I PGP L SGE+S+HLVISW + F +STMMK +IE G + 
Sbjct  343   SVSTPEVMYGGSFKTELLFCITPGPELSSGEQSSHLVISWRMNFLQSTMMKGMIENGARS  402

Query  1115  GLKDSFSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTA  1291
              L++++ +F+ FL+Q    + S ++ L+   +LA+L  E  SD +LA  YF NFTVVS+ 
Sbjct  403   ALRETYEQFATFLSQTITPVDSNDMGLNKEQILASLQPEPQSDWKLAVHYFANFTVVSSF  462

Query  1292  FLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARL  1471
             F+ +Y  IHI L+ ST +QGLEF GLDLPDS+GE I CG+LVL  E+  ++I+ F++AR 
Sbjct  463   FMGIYVLIHIWLATSTTIQGLEFVGLDLPDSIGEFIVCGVLVLQGERFLQLISRFMQARK  522

Query  1472  RRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDP  1651
             ++GSDHGV+A GDGW+LTVALI+G NLA++D +GF DP+VVFTCNGKSRTSS++ Q  DP
Sbjct  523   QKGSDHGVKAQGDGWLLTVALIKGDNLAAVDSSGFCDPYVVFTCNGKSRTSSIKFQQCDP  582

Query  1652  QWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGK  1831
              WNEI E++  +EPPSMLDVEV+DFDGPF++A SLGHAEINF+K   ++LAD+W+PL GK
Sbjct  583   MWNEIFEYDAMDEPPSMLDVEVYDFDGPFNEATSLGHAEINFVKSDISDLADVWIPLQGK  642

Query  1832  IAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEE  2011
             +AQ+ QSKLHLRIFLNN  G   +++ LTKMEKEVGKK+NLRSP  NS FQK FGLPPEE
Sbjct  643   LAQACQSKLHLRIFLNNTKGSNVVKEYLTKMEKEVGKKINLRSPQTNSAFQKLFGLPPEE  702

Query  2012  FLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTM  2191
             FLINDF+C LKRK+ LQGR+FLS RI+GF+ANLFGHKT FFFLWEDIE+I VLPPS S+M
Sbjct  703   FLINDFTCHLKRKMLLQGRLFLSARIIGFHANLFGHKTNFFFLWEDIEDIQVLPPSLSSM  762

Query  2192  GSPSLVIILHKDRGTDARNGAKSIDEEGRLHFC  2290
             GSP +V+ L + RG DAR+GAK+ DEEG+   C
Sbjct  763   GSPVIVMTLRQGRGMDARHGAKTQDEEGQSWHC  795



>gb|EEE56511.1| hypothetical protein OsJ_05785 [Oryza sativa Japonica Group]
Length=1077

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/789 (46%), Positives = 521/789 (66%), Gaps = 42/789 (5%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             S  E +K L+S+ +G EMPENL+GGIL+DQ+Y L P + N +LF+  S F   +AE+QG 
Sbjct  323   SLNELMKSLESKDKGSEMPENLRGGILVDQSYVLQPTEMNSMLFSAHSDFWPAVAEVQGL  382

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
                Q  PW   S++  CL R ++YTK A+KLVK+V+ TEEQTYLK  G  FAVL  VS+P
Sbjct  383   SGFQTDPWKLVSND--CLKRTLSYTKAASKLVKAVKITEEQTYLKAAGNSFAVLSSVSSP  440

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             +VP G+ FKVE+LY I PGP L S E+++HL ISW + F +STM+K +IE GT+QGL++ 
Sbjct  441   EVPCGNCFKVEILYCITPGPQLPSKEQTSHLTISWRLNFVQSTMLKGMIESGTKQGLREG  500

Query  1130  FSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLY  1306
             +++F+  L+Q  KVI   +  L    +L++L ++  S  +LA  +  NF  + +  + LY
Sbjct  501   YAQFTEVLSQKTKVIAPDDSNLSKDEILSSLQTQEESIWKLAARFLGNFAFIFSLCIALY  560

Query  1307  FSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSD  1486
              + H+ L +   + GLE+ G+DLPDS+ E++ C IL++  + +++    F+ A  +RGSD
Sbjct  561   ATAHLRLVKPNMVHGLEYFGIDLPDSIWEVVFCAILIIQGQNIFKSGRRFLYAWKQRGSD  620

Query  1487  HGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEI  1666
             HGV+AHGDGW+LTVALIEG+ +      G PDP+VVFTCNGK +TSSV+ QT +P+WNEI
Sbjct  621   HGVKAHGDGWLLTVALIEGSGVVGSGTPGLPDPYVVFTCNGKRKTSSVKFQTSEPKWNEI  680

Query  1667  LEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSS  1846
              EF   ++PPS L+V V D +GP ++   +G  E+NFLK+  ++L D+WLPL G+  Q  
Sbjct  681   FEFNAMDDPPSRLEVVVHDSEGPHNKI-PIGQTEVNFLKNNLSDLGDMWLPLDGRFPQGC  739

Query  1847  QSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
             + KLHLRIFLNN+ G E + + L KM KEVGKK++LRS   NS F+K F LPPEEFLI+D
Sbjct  740   EPKLHLRIFLNNSRGTEIVMNYLAKMGKEVGKKIHLRSAQTNSAFRKLFSLPPEEFLIDD  799

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             F+C LKRK+PLQ                                  V PP+ + +GSPSL
Sbjct  800   FTCYLKRKMPLQ----------------------------------VAPPTLAKVGSPSL  825

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIA  2386
             +IIL KDRG +AR+GAK++D +G+L + F +FVSF  A R IMALWK R+  P+QK ++ 
Sbjct  826   MIILRKDRGLEARHGAKTLDPQGKLKYHFQTFVSFNDAHRIIMALWKMRSVDPEQKGEMI  885

Query  2387  EEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSG  2566
             ++     E   LP E GS L  EDV MS+VYS  L ++  SLM+MF+GG LEHKVM K+G
Sbjct  886   DKN---SELKQLPCEEGSLLANEDVKMSEVYSAVLSVDINSLMDMFSGGPLEHKVMQKAG  942

Query  2567  CLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIH  2746
             C++Y  + WEL+  ++Y+R++S+K ++++S FG E ++TQRK   AN  GW++ E+M + 
Sbjct  943   CVDYSPTEWELLNQNIYQRQISFKFDKILSRFG-EASTTQRKYNLANRDGWVIEEVMTLQ  1001

Query  2747  GVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKE  2926
             GV   D+  +QL+Y++ S S   ++C   V +G+ WLK  K + ++ KN++   + R++E
Sbjct  1002  GVQHEDYSSIQLKYQMTSTSLKPSTCSIQVLLGIAWLKGAKQQKKVVKNVMSNSANRLRE  1061

Query  2927  MIEFVGREV  2953
             +   V +E+
Sbjct  1062  IFSEVEKEL  1070



>gb|EEC72691.1| hypothetical protein OsI_06266 [Oryza sativa Indica Group]
Length=1094

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/789 (46%), Positives = 521/789 (66%), Gaps = 42/789 (5%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             S  E +K L+S+ +G EMPENL+GGIL+DQ+Y L P + N +LF+  S F   +AE+QG 
Sbjct  323   SLNELMKSLESKDKGSEMPENLRGGILVDQSYVLQPTEMNSMLFSAHSDFWPAVAEVQGL  382

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
                Q  PW   S++  CL R ++YTK A+KLVK+V+ TEEQTYLK  G  FAVL  VS+P
Sbjct  383   SGFQTDPWKLVSND--CLKRTLSYTKAASKLVKAVKITEEQTYLKAAGNSFAVLSSVSSP  440

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             +VP G+ FKVE+LY I PGP L S E+++HL ISW + F +STM+K +IE GT+QGL++ 
Sbjct  441   EVPCGNCFKVEILYCITPGPQLPSKEQTSHLTISWRLNFVQSTMLKGMIESGTKQGLREG  500

Query  1130  FSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLY  1306
             +++F+  L+Q  KVI   +  L    +L++L ++  S  +LA  +  NF  + +  + LY
Sbjct  501   YAQFTEVLSQKTKVIAPDDSNLSKDEILSSLQTQEESIWKLAARFLGNFAFIFSLCIALY  560

Query  1307  FSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSD  1486
                H+ L +   + GLE+ G+DLPDS+ E++ C IL++  + +++    F+ A  +RGSD
Sbjct  561   AIAHLRLVKPNMVHGLEYFGIDLPDSIWEVVFCAILIIQGQNIFKSGRRFLYAWKQRGSD  620

Query  1487  HGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEI  1666
             HGV+AHGDGW+LTVALIEG+ +      G PDP+VVFTCNGK +TSSV+ QT +P+WNEI
Sbjct  621   HGVKAHGDGWLLTVALIEGSGVVGSGTPGLPDPYVVFTCNGKRKTSSVKFQTSEPKWNEI  680

Query  1667  LEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSS  1846
              EF   ++PPS L+V V D +GP ++   +G  E+NFLK+  ++L D+WLPL G+  Q  
Sbjct  681   FEFNAMDDPPSRLEVVVHDSEGPHNKI-PIGQTEVNFLKNNLSDLGDMWLPLDGRFPQGC  739

Query  1847  QSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
             + KLHLRIFLNN+ G E + + L KM KEVGKK++LRS   NS F+K F LPPEEFLI+D
Sbjct  740   EPKLHLRIFLNNSRGTEIVMNYLAKMGKEVGKKIHLRSAQTNSAFRKLFSLPPEEFLIDD  799

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             F+C LKRK+PLQ                                  V PP+ + +GSPSL
Sbjct  800   FTCYLKRKMPLQ----------------------------------VAPPTLAKVGSPSL  825

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIA  2386
             +IIL KDRG +AR+GAK++D +G+L + F +FVSF  A R IMALWK R+  P+QK ++ 
Sbjct  826   MIILRKDRGLEARHGAKTLDPQGKLKYHFQTFVSFNDAHRIIMALWKMRSVDPEQKGEMI  885

Query  2387  EEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSG  2566
             ++     E   LP E GS L  EDV MS+VYSV L ++  SLM+MF+GG LEHKVM K+G
Sbjct  886   DKN---SELKQLPCEEGSLLANEDVKMSEVYSVVLSVDINSLMDMFSGGPLEHKVMQKAG  942

Query  2567  CLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIH  2746
             C++Y  + WEL+  ++Y+R++S+K ++++S FG E ++TQRK   AN  GW++ E+M + 
Sbjct  943   CVDYSPTEWELLNQNIYQRQISFKFDKILSRFG-EASTTQRKYNLANRDGWVIEEVMTLQ  1001

Query  2747  GVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKE  2926
             GV   D+  +QL+Y++ S S   ++C   V +G+ WLK  K + ++ KN++   + R++E
Sbjct  1002  GVQHEDYSSIQLKYQMTSTSLKPSTCSIQVLLGIAWLKGAKQQKKVVKNVMSNSANRLRE  1061

Query  2927  MIEFVGREV  2953
             +   V +E+
Sbjct  1062  IFSEVEKEL  1070



>gb|EEE65992.1| hypothetical protein OsJ_21926 [Oryza sativa Japonica Group]
Length=1041

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/797 (44%), Positives = 516/797 (65%), Gaps = 45/797 (6%)
 Frame = +2

Query  566   ETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRR  745
             E+  S   S  E +K ++S+ +G EMP NL GG+L+D++Y   P + N LLF+ +S F  
Sbjct  267   ESGTSSESSLDELLKTMESKDQGCEMPANLPGGVLIDESYVAAPTELNSLLFSKNSDFWP  326

Query  746   ELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFA  925
              ++ELQGT   Q  PW    +N++CL R +TYTK A+KLVK+V+ATEEQ YLK  G  FA
Sbjct  327   AVSELQGTSGFQIEPWKL-DNNETCLQRTLTYTKAASKLVKAVKATEEQKYLKAAGNSFA  385

Query  926   VLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGG  1105
             V   VSTPDVP G  FK+E+LY I PGP L S E+++HL +SW V F +STMMK +IE G
Sbjct  386   VHSVVSTPDVPCGGCFKIEILYCITPGPSLSSEEQTSHLTVSWRVNFVQSTMMKGMIESG  445

Query  1106  TQQGLKDSFSEFSRFLAQHCKVITSAEVLDNGH-LLATLPSEHPSDLELAREYFCNFTVV  1282
              +QG+ + F+ FS  L+Q  KV  + +   N   +L++L ++  S   L   +  NFT +
Sbjct  446   AKQGMAEGFAHFSEILSQKIKVAEADDANSNKEKILSSLHAQKESGWRLIVRFLFNFTFI  505

Query  1283  STAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVE  1462
              +  +  Y   H+ LS+   + GLE+ G+DLPDS+GE++ C +L+L  + ++ +I  F+ 
Sbjct  506   FSVIIASYVIAHLHLSKPNAMHGLEYFGIDLPDSIGEVVVCAVLILQGQNIFNIIKRFLN  565

Query  1463  ARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQT  1642
             A  ++GSDHGV+AHGDGW++TVALIEGT + + +     D + VFTCN K +TSSV+ QT
Sbjct  566   AWKQKGSDHGVKAHGDGWLMTVALIEGTGITNSNSKELFDMYAVFTCNAKRKTSSVKFQT  625

Query  1643  LDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPL  1822
              +P+WNEI EF+  ++PPS +DV + D +GPFDQ+  +GHAE+NFLK   ++L D+WLPL
Sbjct  626   SEPKWNEIYEFDAMDDPPSRMDVAIHDANGPFDQS-PIGHAEVNFLKSNLSDLTDVWLPL  684

Query  1823  GGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLP  2002
              GK  Q+S  K+HLRIFLNN+ G E + + L KM KEVGKK                   
Sbjct  685   EGKCDQTSNPKIHLRIFLNNSRGTEVVMNYLAKMRKEVGKK-------------------  725

Query  2003  PEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSF  2182
                                 GR+F S RI+GFY+N+FGHKTKFFFLW+D+++I V+PP+ 
Sbjct  726   --------------------GRLFFSPRIIGFYSNIFGHKTKFFFLWDDVDDIQVIPPTL  765

Query  2183  STMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACI  2362
             S +GSPSL IIL K RG +A++GAK  D  GRL + F SFVSF  A R IMA+WK R+  
Sbjct  766   S-IGSPSLTIILRKGRGLEAKHGAKGTDPNGRLKYYFQSFVSFNDAHRIIMAIWKMRSLS  824

Query  2363  PDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLE  2542
             P+Q+  + E++   D   +  EE G+    EDV MS+++S  L ++ +SLMEMF+GG LE
Sbjct  825   PEQQGDMIEKES--DTKELQLEEGGTLFTHEDVKMSEIFSSALSVDVESLMEMFSGGPLE  882

Query  2543  HKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWI  2722
             H++M K+GC++Y  + WEL+  ++Y+R++SYK ++ +S +G E T+TQ++    N  GW 
Sbjct  883   HRMMQKAGCIDYSPTEWELVSRNIYQRQISYKFDKNLSRYGGEATTTQQRYALVNQEGWA  942

Query  2723  LNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVR  2902
             + E+M++ GV   D + VQ++Y V +  +  N+C   V +G+ WLK+TK + +ITK+++ 
Sbjct  943   IEEVMSLQGVLLGDCFNVQMKYTVVNVPSKPNTCSVQVLLGIAWLKSTKQQKKITKSVIS  1002

Query  2903  KFSQRVKEMIEFVGREV  2953
               S R+KE+   V +++
Sbjct  1003  NSSIRLKELFAEVEKDL  1019



>ref|XP_006449998.1| hypothetical protein CICLE_v10014339mg [Citrus clementina]
 ref|XP_006449999.1| hypothetical protein CICLE_v10014339mg [Citrus clementina]
 gb|ESR63238.1| hypothetical protein CICLE_v10014339mg [Citrus clementina]
 gb|ESR63239.1| hypothetical protein CICLE_v10014339mg [Citrus clementina]
Length=567

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/563 (60%), Positives = 434/563 (77%), Gaps = 2/563 (0%)
 Frame = +2

Query  605   IKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQE  784
             +K ++ R  G E+P NL GG+L+DQ Y + P+D N LLF+PDS F R  AE QG  ++Q 
Sbjct  1     MKTMEPRDLGSEVPSNLPGGVLVDQMYVIAPQDLNTLLFSPDSNFPRTWAEEQGNTELQI  60

Query  785   GPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYG  964
             GPW +++  +S L R VTY K A KL+K+ +  EEQTYLK DGK FA+L  VSTP+V YG
Sbjct  61    GPWRFENGCES-LKRDVTYIKAANKLIKATKGFEEQTYLKADGKVFAILASVSTPEVMYG  119

Query  965   STFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFS  1144
              +FK ELL+ I PGP L SGE+S+HLVISW + F +STMMK +IE G +  L++++ +F+
Sbjct  120   GSFKTELLFCITPGPELSSGEQSSHLVISWRMNFLQSTMMKGMIENGARSALRETYEQFA  179

Query  1145  RFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
              FL+Q    + S ++ L+   +LA+L  E  SD +LA  YF NFTVVS+ F+ +Y  +HI
Sbjct  180   TFLSQTITPVDSNDMGLNKEQILASLQPEPQSDWKLAVHYFANFTVVSSFFMGIYVLVHI  239

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
              L+ ST +QGLEF GLDLPDS+GE I CG+LVL  E+  ++I+ F++AR ++GSDHGV+A
Sbjct  240   WLATSTTIQGLEFVGLDLPDSIGEFIVCGVLVLQGERFLQLISRFMQARKQKGSDHGVKA  299

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              GDGW+LTVALI+G NLA++D +GF DP+VVFTCNGKSRTSS++ Q  DP WNEI E++ 
Sbjct  300   QGDGWLLTVALIKGDNLAAVDSSGFCDPYVVFTCNGKSRTSSIKFQQCDPMWNEIFEYDA  359

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
              +EPPSMLDVEV+DFDGPF++A SLGHAEINF+K   ++LAD+W+PL GK+AQ+ QSKLH
Sbjct  360   MDEPPSMLDVEVYDFDGPFNEATSLGHAEINFVKSDISDLADVWIPLQGKLAQACQSKLH  419

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFLNN  G   +++ LTKMEKEVGKK+NLRSP  NS FQK FGLPPEEFLINDF+C L
Sbjct  420   LRIFLNNTKGSNVVKEYLTKMEKEVGKKINLRSPQTNSAFQKLFGLPPEEFLINDFTCHL  479

Query  2042  KRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILH  2221
             KRK+ LQGR+FLS RI+GF+ANLFGHKT FFFLWEDIE+I VLPPS S+MGSP +V+ L 
Sbjct  480   KRKMLLQGRLFLSARIIGFHANLFGHKTNFFFLWEDIEDIQVLPPSLSSMGSPVIVMTLR  539

Query  2222  KDRGTDARNGAKSIDEEGRLHFC  2290
             + RG DAR+GAK+ DEEG+   C
Sbjct  540   QGRGMDARHGAKTQDEEGQSWHC  562



>ref|XP_008669268.1| PREDICTED: LOW QUALITY PROTEIN: C2 and GRAM domain-containing 
protein At5g50170-like [Zea mays]
Length=868

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/639 (56%), Positives = 469/639 (73%), Gaps = 15/639 (2%)
 Frame = +2

Query  593   FCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTK  772
             F EA+++++SR    E+P++L GGI+ +  Y +  K+ N LLF PDSQF +++ ELQGT 
Sbjct  239   FEEAMEIMKSRRSTPELPQDLDGGIIFEHAYLVGSKELNHLLFRPDSQFFKDVRELQGTM  298

Query  773   DVQEGPWTWKSDNKSCLTRVVTYTKGAT-KLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
             D +E PWTWKS +   LTR   YT GA+ K +K+V+ +EEQTYL+ DGK F V   V TP
Sbjct  299   DYEEQPWTWKSADPPSLTRTCRYTTGASNKFMKAVKTSEEQTYLRADGKSFVVTARVRTP  358

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             +VP+G+ F V LLY I+     R+GEE  HL +S+ V F +STMM++VIEG  + GL+++
Sbjct  359   EVPFGNCFAVVLLYKIVH----RTGEEGAHLTVSYNVDFLQSTMMRSVIEGSVRDGLREN  414

Query  1130  FSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEH-PSDLELAREYFCNFTVVSTAFLVLY  1306
             F  F++ L++H   +  +  +    LLA L  EH  SD+ LA  YFCNFT VST    LY
Sbjct  415   FQGFAQVLSRHVVEVAGSVGMSKEQLLAPLQVEHRQSDIRLAYRYFCNFTAVSTVLFALY  474

Query  1307  FSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSD  1486
               +HI LS      GLEF GLDLPDS GE+IT G+LVL L+++  M+ HFVEARL+RGSD
Sbjct  475   VLVHIFLSGPA---GLEFSGLDLPDSFGELITAGVLVLQLQRLLNMVTHFVEARLQRGSD  531

Query  1487  HGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEI  1666
             HGV+A+GDGW+LTVAL+E T+L    P G  DP+VV +CNG +RTSSVQLQTL+PQWNEI
Sbjct  532   HGVKANGDGWLLTVALLEATSL----PPGSVDPYVVLSCNGITRTSSVQLQTLEPQWNEI  587

Query  1667  LEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSS  1846
             +EF   EE P++LDVEVF+F GPF  A S+GHAEINFLKHTS ELAD+W+PL GK+AQ+ 
Sbjct  588   MEFGAMEEAPAVLDVEVFNFVGPFGVAISIGHAEINFLKHTSVELADIWVPLQGKLAQTC  647

Query  1847  QSKLHLRIFLNNNNGVET-IRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIN  2023
             +S+LHLR+FL N  G ET +R+ ++KMEKEVGKKL++RSPHRNSTFQK F LP EEFLI 
Sbjct  648   KSRLHLRVFLENTKGPETTMREYMSKMEKEVGKKLHVRSPHRNSTFQKLFNLPQEEFLIA  707

Query  2024  DFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPS  2203
             D++CSL+RKLPLQGR+F+S RIVGFYANLFGHKTKFFFLWED+EEI VL PSF+T+G+PS
Sbjct  708   DYACSLRRKLPLQGRLFVSARIVGFYANLFGHKTKFFFLWEDVEEIQVLQPSFTTVGTPS  767

Query  2204  LVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQI  2383
             L+ IL   RG DA++GAKS D+EGRL F FHSF SF  ASRTI+ LWK+++   +Q+ + 
Sbjct  768   LLFILKSGRGLDAKSGAKSQDKEGRLKFQFHSFASFSKASRTIIGLWKSKSSAVEQREEH  827

Query  2384  AEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMN  2500
              EE     + +   +   S +I  DV +SK Y+++ P+ 
Sbjct  828   HEEDASSLDLDDDVQAVLS-IINGDVPLSKEYTLEHPIG  865



>tpg|DAA37318.1| TPA: hypothetical protein ZEAMMB73_013076 [Zea mays]
Length=838

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/603 (58%), Positives = 452/603 (75%), Gaps = 14/603 (2%)
 Frame = +2

Query  593   FCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTK  772
             F EA+++++SR    E+P++L GGI+ +  Y +  K+ N LLF PDSQF +++ ELQGT 
Sbjct  239   FEEAMEIMKSRRSTPELPQDLDGGIIFEHAYLVGSKELNHLLFRPDSQFFKDVRELQGTM  298

Query  773   DVQEGPWTWKSDNKSCLTRVVTYTKGAT-KLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
             D +E PWTWKS +   LTR   YT GA+ K +K+V+ +EEQTYL+ DGK F V   V TP
Sbjct  299   DYEEQPWTWKSADPPSLTRTCRYTTGASNKFMKAVKTSEEQTYLRADGKSFVVTARVRTP  358

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             +VP+G+ F V LLY I+     R+GEE  HL +S+ V F +STMM++VIEG  + GL+++
Sbjct  359   EVPFGNCFAVVLLYKIVH----RTGEEGAHLTVSYNVDFLQSTMMRSVIEGSVRDGLREN  414

Query  1130  FSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEH-PSDLELAREYFCNFTVVSTAFLVLY  1306
             F  F++ L++H   +  +  +    LLA L  EH  SD+ LA  YFCNFT VST    LY
Sbjct  415   FQGFAQVLSRHVVEVAGSVGMSKEQLLAPLQVEHRQSDIRLAYRYFCNFTAVSTVLFALY  474

Query  1307  FSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSD  1486
               +HI LS      GLEF GLDLPDS GE+IT G+LVL L+++  M+ HFVEARL+RGSD
Sbjct  475   VLVHIFLSGPA---GLEFSGLDLPDSFGELITAGVLVLQLQRLLNMVTHFVEARLQRGSD  531

Query  1487  HGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEI  1666
             HGV+A+GDGW+LTVAL+E T+L    P G  DP+VV +CNG +RTSSVQLQTL+PQWNEI
Sbjct  532   HGVKANGDGWLLTVALLEATSL----PPGSVDPYVVLSCNGITRTSSVQLQTLEPQWNEI  587

Query  1667  LEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSS  1846
             +EF   EE P++LDVEVF+F GPF  A S+GHAEINFLKHTS ELAD+W+PL GK+AQ+ 
Sbjct  588   MEFGAMEEAPAVLDVEVFNFVGPFGVAISIGHAEINFLKHTSVELADIWVPLQGKLAQTC  647

Query  1847  QSKLHLRIFLNNNNGVET-IRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIN  2023
             +S+LHLR+FL N  G ET +R+ ++KMEKEVGKKL++RSPHRNSTFQK F LP EEFLI 
Sbjct  648   KSRLHLRVFLENTKGPETTMREYMSKMEKEVGKKLHVRSPHRNSTFQKLFNLPQEEFLIA  707

Query  2024  DFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPS  2203
             D++CSL+RKLPLQGR+F+S RIVGFYANLFGHKTKFFFLWED+EEI VL PSF+T+G+PS
Sbjct  708   DYACSLRRKLPLQGRLFVSARIVGFYANLFGHKTKFFFLWEDVEEIQVLQPSFTTVGTPS  767

Query  2204  LVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQI  2383
             L+ IL   RG DA++GAKS D+EGRL F FHSF SF  ASRTI+ LWK+++   +Q+ + 
Sbjct  768   LLFILKSGRGLDAKSGAKSQDKEGRLKFQFHSFASFSKASRTIIGLWKSKSSAVEQREEH  827

Query  2384  AEE  2392
              EE
Sbjct  828   HEE  830



>ref|XP_010534150.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170-like 
[Tarenaya hassleriana]
 ref|XP_010534151.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170-like 
[Tarenaya hassleriana]
Length=689

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/648 (54%), Positives = 464/648 (72%), Gaps = 11/648 (2%)
 Frame = +2

Query  416   GKQLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSF  595
             GK+L+K+I  +L+KL  K E+ +    +    D+     S+ ++ +     +  S    F
Sbjct  12    GKKLMKAIVSNLDKLCHKKEDDASKGNDNDSSDHI----SVSNNKDSPGGFSIPSACTGF  67

Query  596   CEAIKLLQSR-TEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTK  772
              + + L+QSR  E  EMPENL GG+L++Q Y + P++ N+ LF+  SQFRRE AE+QGTK
Sbjct  68    EDGLDLMQSRDRENDEMPENLPGGVLVNQNYLVSPRELNIFLFSSSSQFRREFAEIQGTK  127

Query  773   DVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPD  952
             D+ EGPW  K  +   LTR++TY     K++KSV+ATEEQ YLK  G+ FAV V +STPD
Sbjct  128   DLHEGPWRMKPGDPPALTRILTYMTAPKKIMKSVKATEEQVYLKATGRYFAVHVSISTPD  187

Query  953   VPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSF  1132
             + YG+ FK ELLY I PG  L SGEES+ L++SW ++F +STMMK +IEGG +Q +K+ +
Sbjct  188   LLYGNAFKSELLYKIQPGTKLPSGEESSQLIVSWGIRFHQSTMMKGMIEGGAKQVMKEGY  247

Query  1133  SEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFS  1312
             ++FS FL++  K + S   LD   +LATL SE  SDL+ A  YF  F V+    + LY  
Sbjct  248   TQFSDFLSKKYKTLDSVGFLDKDQILATL-SEQKSDLKSAFRYFWRFHVICPVVMFLYVM  306

Query  1313  IHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLR-RGSDH  1489
              HIL     ++QG EF GLDLPDS+GE+ T  +L L L++VYR   HF++A++  RGSDH
Sbjct  307   AHILQCEPNKVQGFEFCGLDLPDSLGELFTVVVLALLLQRVYRTSLHFIQAKVHDRGSDH  366

Query  1490  GVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEIL  1669
             G +A G GW+LTVALI+  +LAS+      DP+VVFTC GK RTSSV+LQT DP+WNE++
Sbjct  367   GSKATGKGWILTVALIKSMDLASVTRAELSDPYVVFTCRGKRRTSSVKLQTQDPEWNEVI  426

Query  1670  EFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQ  1849
             EF+  EEPPS+LDVEVFDFDGP D   SLGHAE+NFL+H+S ELADLW+PL G +A++S+
Sbjct  427   EFDAMEEPPSVLDVEVFDFDGPLDDGESLGHAEVNFLRHSSDELADLWVPLEGNLAKASK  486

Query  1850  SKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDF  2029
             SKLHLRIFL NNNG+E +++   ++EKEVG KL+++SP +NS FQK FGLP EEFL+ ++
Sbjct  487   SKLHLRIFLENNNGIEAMKNFFIEVEKEVGTKLSIQSPRKNSAFQKLFGLPHEEFLVKEY  546

Query  2030  SCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLV  2209
             +C LKRKLPLQG+IFLS RIV F ++ FGHKTKF+FLWEDI+EI VLP +FS++    L+
Sbjct  547   TCQLKRKLPLQGKIFLSARIVAFCSSFFGHKTKFYFLWEDIDEIRVLPRTFSSL----LL  602

Query  2210  IILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTR  2353
             IIL +DRG DA++GAKS DE+GRL F F SFV+F    R IMALWK R
Sbjct  603   IILKQDRGLDAKHGAKSRDEKGRLCFYFQSFVTFYATCRIIMALWKKR  650



>ref|XP_002453494.1| hypothetical protein SORBIDRAFT_04g006820 [Sorghum bicolor]
 gb|EES06470.1| hypothetical protein SORBIDRAFT_04g006820 [Sorghum bicolor]
Length=1049

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/790 (45%), Positives = 505/790 (64%), Gaps = 52/790 (7%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             S  E +K ++S+ +  EMP NL GG+L+DQ+Y + P + N LLF+  S F  E++ELQGT
Sbjct  303   SLDELLKSMESKDQACEMPANLPGGVLVDQSYIIAPAELNSLLFSGTSDFWPEVSELQGT  362

Query  770   KDVQEGPWTWKSDN-KSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVST  946
                Q  PW  + DN ++CL R ++YTK A+KLVKSV+ATEEQ YLK +G  FAVL  VST
Sbjct  363   SGFQIEPW--RHDNSENCLKRTISYTKAASKLVKSVKATEEQKYLKANGSSFAVLSSVST  420

Query  947   PDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKD  1126
             PDVP G+ FKVE+LY I+ G  L   E++T L +SW + F +STM+K +IE G +QGL +
Sbjct  421   PDVPCGNCFKVEILYRIVSGSQLPLEEQATQLTVSWRLNFVQSTMLKGMIENGAKQGLAE  480

Query  1127  SFSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLY  1306
              +S FS  L++  KV    +      +LA+L ++  S+ +L   +  +F  + +    LY
Sbjct  481   GYSHFSEVLSRKIKVAELDDANSKDKILASLQTQKESNWKLVARFLGSFAFICSLSTALY  540

Query  1307  FSIHILLSRSTQLQ-GLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGS  1483
                H+ L++   +  GLE+ G+DLPDSVGEI+ C IL++    + ++   F++A  +RGS
Sbjct  541   IMTHLHLAKPNVVHGGLEYFGIDLPDSVGEIVFCLILIIQGHNIIKVGRRFLQAWKQRGS  600

Query  1484  DHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNE  1663
             DHGV+AHGDGW+LT+ALIEG+ + S           VF CNGK +TSSV+  T +P+WNE
Sbjct  601   DHGVKAHGDGWLLTIALIEGSGVVS----------AVFMCNGKRKTSSVKYHTSEPKWNE  650

Query  1664  ILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQS  1843
             I EF+  ++PP+ LDV V D DGP ++   +G  E+NF+K+  ++L D+WLPL G+  Q 
Sbjct  651   IFEFDAMDDPPARLDVVVHDSDGPSNET-PIGQTEVNFVKNNLSDLGDMWLPLDGRFPQG  709

Query  1844  SQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIN  2023
              Q KLHLRIFLNN+ G E + D L KM KEVGKK+ LRS   NS F+K F LPPEEFLI+
Sbjct  710   HQPKLHLRIFLNNSRGTEVVMDYLEKMGKEVGKKMQLRSSQTNSAFRKLFSLPPEEFLID  769

Query  2024  DFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPS  2203
             DF+C LKRK+PLQ                                  V+PP  +T+GSPS
Sbjct  770   DFTCHLKRKMPLQ----------------------------------VVPPKLATVGSPS  795

Query  2204  LVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQI  2383
             L+IIL KDRG +AR+GAK++D +GRL F F +FVSF  A R IMA+WK R+   +QK ++
Sbjct  796   LMIILRKDRGLEARHGAKALDPQGRLKFHFQTFVSFNDAHRIIMAIWKMRSPGLEQKGEM  855

Query  2384  AEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKS  2563
              +++    EN   P E GS L  EDV MS+VYS  L ++  +LMEMF+GG LEHKVM ++
Sbjct  856   IDKEPELKEN---PYEEGSLLANEDVKMSEVYSAVLSVDVSALMEMFSGGPLEHKVMERA  912

Query  2564  GCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAI  2743
             GC++Y  + WEL+  +VY+RR+S++ ++ +S +G E T+TQ+K    N   WI+ E+M +
Sbjct  913   GCVDYSATEWELLNRNVYQRRISFRFDKSLSKYGGEATTTQQKYNLTNQNEWIVEEVMTL  972

Query  2744  HGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVK  2923
              GV   D+  +QL+Y + S     NSCR  V +G+ WLK TK + +  KN++   + R++
Sbjct  973   QGVQHEDYSSIQLKYHMTSTPLRPNSCRIKVLLGIAWLKGTKHQKKAAKNVMMNSANRLR  1032

Query  2924  EMIEFVGREV  2953
             E+   V +EV
Sbjct  1033  EIFSEVEKEV  1042



>ref|XP_004172925.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like, 
partial [Cucumis sativus]
Length=870

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/602 (57%), Positives = 448/602 (74%), Gaps = 6/602 (1%)
 Frame = +2

Query  527   LSSIPSDYEDNVQETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDF  706
             +S IP      V+   ++   +F EA+K+L+S+ +  E P N  G I++DQ YA+ P D 
Sbjct  221   ISEIPPSEILEVKSEDQTSMATFEEAMKVLESKDQESETPSNFPG-IMVDQLYAIQPSDL  279

Query  707   NMLLFAPDSQFRRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATE  886
             N LLF+ DS F + LA+LQGT ++Q G W ++ D    L R V+Y K  TKL+K+V+A E
Sbjct  280   NSLLFSSDSSFLQSLADLQGTTELQLGNWKFE-DGGESLKRTVSYLKAPTKLIKAVKAFE  338

Query  887   EQTYLKGDGKEFAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKF  1066
             EQ+YLK DG  +AVL  VSTPDV YG+TFKVE+LY I PGP L S E+S+ LVISW + F
Sbjct  339   EQSYLKADGNVYAVLAVVSTPDVMYGNTFKVEILYCITPGPELPSEEKSSRLVISWRMNF  398

Query  1067  CKSTMMKTVIEGGTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNG-HLLATLPSEHP-SD  1240
              +STMMK +IE G +QG+KD+F +++  L+Q    +    +  N    LA+L +  P S 
Sbjct  399   LQSTMMKGMIENGARQGIKDNFDQYTSLLSQTVPPVDQRSIGSNKEQALASLEAPPPQST  458

Query  1241  LELAREYFCNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVL  1420
              +LA +YF N TVV T F+ LY  +HI L+  + +QGLEF GLDLPDS+GE I CG+LVL
Sbjct  459   FKLAIQYFANCTVVFTTFMALYVLVHIWLAAPSTIQGLEFVGLDLPDSIGEFIVCGVLVL  518

Query  1421  HLEQVYRMIAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFT  1600
               E+V  +I+ F+ ARL+ GSDHG++A GDGW+LTVALIEG +LA++D +G  DP+VVFT
Sbjct  519   QGERVLGLISRFMRARLQTGSDHGIKAQGDGWLLTVALIEGCSLAAVDSSGLSDPYVVFT  578

Query  1601  CNGKSRTSSVQLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFL  1780
             CNGK++ SS++ Q  DPQWNEI EF+  +EPPS+L VEV+DFDGPFD+A SLG+AEINFL
Sbjct  579   CNGKTKNSSIKFQKSDPQWNEIFEFDAMDEPPSVLGVEVYDFDGPFDEATSLGYAEINFL  638

Query  1781  KHTSAELADLWLPLGGKIAQSSQSKLHLRIFLNNNNG--VETIRDNLTKMEKEVGKKLNL  1954
             + + ++LAD+W+PL GK+AQ+ QSKLHLRIFL+N  G  V  +++ L+KMEKEVGKK+NL
Sbjct  639   RTSISDLADIWVPLQGKLAQTCQSKLHLRIFLDNTRGSHVNIVKEYLSKMEKEVGKKINL  698

Query  1955  RSPHRNSTFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFF  2134
             RSP  NS FQK FGLP EEFLINDF+C LKRK+P+QGRIFLS R++GF+AN+FGHKTKFF
Sbjct  699   RSPQSNSAFQKLFGLPAEEFLINDFTCHLKRKMPIQGRIFLSARVIGFHANIFGHKTKFF  758

Query  2135  FLWEDIEEINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFG  2314
             FLWEDIE+I V  P+ S+MGSP +VI L   RG DAR+GAK++DEEGRL F FHSFVSFG
Sbjct  759   FLWEDIEDIQVAAPTLSSMGSPIIVITLRAGRGLDARSGAKTLDEEGRLKFHFHSFVSFG  818

Query  2315  GA  2320
              A
Sbjct  819   VA  820



>gb|AFW70710.1| hypothetical protein ZEAMMB73_250706, partial [Zea mays]
Length=1045

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/789 (44%), Positives = 507/789 (64%), Gaps = 51/789 (6%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             S  E +K ++S+ +  E+P NL GG+L+DQ+Y + P + N LLF+  S F  E++ELQGT
Sbjct  301   SLDELLKNMESKDQACELPGNLPGGVLMDQSYIIAPAELNSLLFSGTSDFWPEVSELQGT  360

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
                   PW    +N++CL R +TYTK A+KLVKSV+ATEEQ YLK  G  FAVL  VSTP
Sbjct  361   SGFNIEPWK-HDNNENCLKRTITYTKAASKLVKSVKATEEQKYLKATGSSFAVLSSVSTP  419

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             DVP G+ FKVE+LY I+ G  L   E++T + +SW + F +STM+K +IE G +QGL + 
Sbjct  420   DVPCGNCFKVEILYRIISGSQL-PLEQTTQITVSWRLNFVQSTMLKGMIENGAKQGLAEG  478

Query  1130  FSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYF  1309
             +S FS  L++  KV   A+      +LA+L ++  S+ +L   +  +F  + +    LY 
Sbjct  479   YSHFSEVLSRKVKVAELADANTKDKILASLQTQKESNWKLVARFLGSFAFICSLSTALYI  538

Query  1310  SIHILLSR-STQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSD  1486
             + H+ L++ +  L GLE+ G+DLPDS+GEI+ C IL++    + ++   F++A  +RGSD
Sbjct  539   TTHLHLAKPNVVLGGLEYFGIDLPDSIGEIVFCIILIIQGHNIMKVGRRFLQAWKQRGSD  598

Query  1487  HGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEI  1666
             HGV+AHGDGW+LT+ALIEG+ + S           VFTCNGK +TSSV+ QT +P+WNEI
Sbjct  599   HGVKAHGDGWLLTIALIEGSGVVS----------AVFTCNGKRKTSSVKYQTSEPKWNEI  648

Query  1667  LEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSS  1846
              EF+  ++PP+ LDV V D D P ++   +G  E+NF+K+  ++L D+W+PL G+  Q  
Sbjct  649   FEFDAMDDPPARLDVVVHDSDIPNNET-PIGQTEVNFVKNNLSDLGDMWVPLDGRFPQGH  707

Query  1847  QSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
             Q KLHLRIFLNN+ G E + + L KM KEVGKK++LRS   NS F+K F LPPEEFLI+D
Sbjct  708   QPKLHLRIFLNNSRGTEVVMNYLEKMGKEVGKKMHLRSSQTNSAFRKLFSLPPEEFLIDD  767

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             F+C LKRK+PLQ                                  V+PP  +T+GSPSL
Sbjct  768   FTCHLKRKMPLQ----------------------------------VVPPKLATVGSPSL  793

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIA  2386
             +IIL KDRG +AR+GAK++D +GRL F F +FVSF  A R IMA+WK R+   +QK ++ 
Sbjct  794   MIILCKDRGLEARHGAKALDPQGRLKFHFQTFVSFNDAHRIIMAIWKLRSSGLEQKGEVI  853

Query  2387  EEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSG  2566
             +++    EN   P E GS L  EDV MS+VYS  L ++  +LMEMF+GG LEHKVM ++G
Sbjct  854   DKEPELKEN---PYEEGSLLANEDVKMSEVYSAVLSVDVSALMEMFSGGPLEHKVMERAG  910

Query  2567  CLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIH  2746
             C++Y+ + WEL+  +VY+R ++++ ++ +S +G E T+TQ+K    N   WI+ E+M + 
Sbjct  911   CVDYLATEWELLNRNVYQRHINFRFDKSLSRYGGEATTTQQKYNLPNQNDWIVEEVMTLQ  970

Query  2747  GVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKE  2926
             GV   D+  +QL+Y + S     NSCR  V +G+ WLK TK + +  KN++   + R++E
Sbjct  971   GVQHEDYSSIQLKYHMTSTPLRPNSCRIKVLLGIAWLKGTKHQKKAAKNVMMNSANRLRE  1030

Query  2927  MIEFVGREV  2953
             +   V +EV
Sbjct  1031  IFSEVEKEV  1039



>ref|XP_006476882.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170-like 
isoform X4 [Citrus sinensis]
Length=955

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/543 (63%), Positives = 420/543 (77%), Gaps = 18/543 (3%)
 Frame = +2

Query  269   GKILLTLSLHGKGHDLSTNHACFVQPSVGSETSKDVD-----AIKVSSPKK----VLEGK  421
             GKILLT+SLHGKGH+LS+NH  +   +V S  SK+++     +  VS  K     V EG 
Sbjct  121   GKILLTISLHGKGHNLSSNHLLYPHSNVSSNESKELEDPCVLSHDVSCSKAPCLDVTEGN  180

Query  422   QLIKSIAGHLEKLFDkneessksneegskkdnsseLSSIPSDYEDNVQETTRSQTQSFCE  601
              L+K++  HLEK+F+KN++  K+ +          LSS PSDYED V+E   S   +F E
Sbjct  181   HLMKAMVSHLEKIFNKNDQGLKTEDSSE-------LSSTPSDYEDCVEEHPPSH--NFEE  231

Query  602   AIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQ  781
             AIK++QSR    +MPENLQGGILLDQ Y + P D N  LFAPDSQFR++LAELQGTKDVQ
Sbjct  232   AIKMMQSRENEGDMPENLQGGILLDQLYQVSPCDLNTFLFAPDSQFRKDLAELQGTKDVQ  291

Query  782   EGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPY  961
             EGPW WKS   +CLTR V+Y K ATKLVK+V+ATE+QTYLK +G+EFA+LV VSTPDVPY
Sbjct  292   EGPWEWKSGEMTCLTRAVSYMKAATKLVKAVKATEQQTYLKANGQEFAILVTVSTPDVPY  351

Query  962   GSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEF  1141
             G+TF V+LLY I+PGP L SGE+S+HL+ISW + F +STMM+ +IEGG +QGLK+SF +F
Sbjct  352   GNTFNVQLLYKIIPGPELSSGEDSSHLIISWGIDFHQSTMMRGMIEGGARQGLKESFEQF  411

Query  1142  SRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
             +  LAQ+ K++ S +  D  H+LATL +E  SD ELA EYF NFTVVS  F++LY  +HI
Sbjct  412   ANLLAQNLKILDSKDASDKDHMLATLQTEQQSDWELASEYFWNFTVVSAGFMILYVIVHI  471

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
             LL   ++ QGLEF+GLDLPDS GE+I+CGILV+ LEQV+ M+ HFV ARLR+GSDHGV+A
Sbjct  472   LLCEPSKRQGLEFYGLDLPDSFGELISCGILVIQLEQVFNMVGHFVRARLRKGSDHGVKA  531

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              GDGWVLTVAL+EG NLAS + TG  DP+VVFTCNGK+RTSSVQLQT DPQW++ILEF+ 
Sbjct  532   QGDGWVLTVALVEGVNLASSEMTGLSDPYVVFTCNGKTRTSSVQLQTCDPQWHDILEFDA  591

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
              EEPPS+LDVEVFDFDGPFDQA SLGHAEINFLKHTS ELAD+W+ L GK+AQS+QSK  
Sbjct  592   MEEPPSVLDVEVFDFDGPFDQATSLGHAEINFLKHTSTELADMWVSLEGKLAQSAQSKGR  651

Query  1862  LRI  1870
             L I
Sbjct  652   LFI  654


 Score =   391 bits (1004),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 186/320 (58%), Positives = 240/320 (75%), Gaps = 5/320 (2%)
 Frame = +2

Query  2018  INDFSCSLKRKLPL----QGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFS  2185
             + D   SL+ KL      +GR+F+S RIVGFYANLFG+KTKFFFLWEDIE+I +LPPS +
Sbjct  631   LADMWVSLEGKLAQSAQSKGRLFISARIVGFYANLFGNKTKFFFLWEDIEDIQILPPSLA  690

Query  2186  TMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIP  2365
             T+GSP LVIIL K RG DAR+GAKS DEEGRL F F SFVSF  ASRTIMALW+TR    
Sbjct  691   TVGSPLLVIILRKGRGLDARHGAKSQDEEGRLRFYFQSFVSFNDASRTIMALWRTRTLTT  750

Query  2366  DQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEH  2545
              QK QIAEEQ+ ++E +   +  GS    ED  MSKVY+ +LP++ K+LMEMF+GG LEH
Sbjct  751   YQKEQIAEEQEVQEEMSTAADR-GSVPNFEDAKMSKVYNAELPISVKALMEMFDGGKLEH  809

Query  2546  KVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWIL  2725
             +VM KSGC NYVT+ W+L++P V ER +SY+ NR +SIFG EVT TQ+KS  A+  GWI+
Sbjct  810   QVMEKSGCHNYVTTPWDLVKPGVCERHLSYRFNRHVSIFGGEVTCTQQKSPLASGEGWIV  869

Query  2726  NEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRK  2905
             NE+M++H VPF DH++V  RY++E    A N+C+C +Y+G+ WLK+TK + RIT+NI  K
Sbjct  870   NEVMSLHDVPFDDHFRVHFRYEIEKSPLAHNACKCAIYIGISWLKSTKFQQRITQNITEK  929

Query  2906  FSQRVKEMIEFVGREVFLSS  2965
             F+ R+KEMIE V RE+  ++
Sbjct  930   FTHRLKEMIELVEREILFAT  949



>ref|XP_002983682.1| hypothetical protein SELMODRAFT_118690 [Selaginella moellendorffii]
 gb|EFJ15178.1| hypothetical protein SELMODRAFT_118690 [Selaginella moellendorffii]
Length=999

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/781 (45%), Positives = 495/781 (63%), Gaps = 19/781 (2%)
 Frame = +2

Query  614   LQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEGPW  793
             LQ  T G  +P  L GG L +QTYA   +  N +LF P S F  EL  +Q T D+ EG  
Sbjct  225   LQLSTSGDSVPPPLSGGFLANQTYATKLQTLNSVLFKPHSPFFEELIAVQKTTDLVEG--  282

Query  794   TWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGSTF  973
              WK        RV+TYTK AT +VKSV+ATEEQTYL+ D + + VL  VSTPDV YGSTF
Sbjct  283   MWKKVGNENPKRVLTYTKAATAVVKSVKATEEQTYLRADDRAYVVLAVVSTPDVLYGSTF  342

Query  974   KVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRFL  1153
             + E+ Y + P       EE  +L ISW + F +STM K +IE G +QGL D+F ++   L
Sbjct  343   RTEVQYCLTP-----VSEERCNLSISWRLNFIQSTMAKRLIESGAKQGLTDNFRQYVEVL  397

Query  1154  AQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCN-FTVVSTAFLVLYFSIHILLS  1330
             +++  V  + E  D     A    E  +D+ L +EYF +   +V +    L   +HI L+
Sbjct  398   SKY--VEEAGEDADPAP--AEEQDEPENDISLTQEYFSSSIFIVVSLLFFLVVLLHIQLA  453

Query  1331  RSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHGD  1510
             + T   GLEF  LDLPD+ GE++T  ++ +H  Q+ +M    + A      DHG +A G+
Sbjct  454   QPTPTVGLEFWQLDLPDTFGELLTSAVITVHFVQLGKMALKKLRAASLTAGDHGKKAKGE  513

Query  1511  GWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEE  1690
             GW+LTV L+EG NL     T   DP+VVFTC+G++RTSSV+LQT +P+W EI EF+  E+
Sbjct  514   GWLLTVTLVEGENLPIRPNTNCLDPYVVFTCSGRTRTSSVKLQTTNPKWGEIFEFDATED  573

Query  1691  PPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRI  1870
             PPS LDVEVF++DGPF +A SLG+AEINFLK +   LADLW+ L G  AQ+S S+LHLRI
Sbjct  574   PPSTLDVEVFNYDGPFPEAVSLGYAEINFLKLSPDNLADLWIRLEGSHAQTSYSRLHLRI  633

Query  1871  FLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRK  2050
             FL N    +T  + + K+EKE G K+ ++S  +N++FQK F LP EEFLINDF+C++KRK
Sbjct  634   FLTNTKEADTFVEYVKKVEKEAGAKV-IKSSRKNASFQKLFSLPQEEFLINDFACAVKRK  692

Query  2051  LPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDR  2230
             +PLQGR+FLS R++GFY+N+FGHKTKF  LWEDI+E+  LPPS + +G PS+V+   K R
Sbjct  693   IPLQGRLFLSPRMLGFYSNIFGHKTKFSLLWEDIDEVQELPPSIANVG-PSIVLFARKGR  751

Query  2231  GTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKDE  2410
               DA  G+K +D +GRL F F SFV  G A RT+M LWK RA  P+Q+ ++ E     D 
Sbjct  752   AHDANQGSKGMDGKGRLKFQFQSFVRAGPAFRTLMVLWKNRALTPEQQLEMVEN---VDT  808

Query  2411  NNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSS  2590
              + L E+ G ++ V DV++S+VYS  LP+   S++ ++   +LE KVM K GC+NY  S 
Sbjct  809   ESKLYED-GEFIGVGDVTLSEVYSTVLPLTAASMVLLYEKENLEEKVMEKLGCMNYTVSP  867

Query  2591  WELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHY  2770
             WE   P    R+V+Y+LNR +  FG  V+  Q+K V +N     ++EI+ +H VPF D++
Sbjct  868   WENEGPG-QRRQVNYRLNRQMCQFGSIVSGVQQKVVSSNHLTASVDEILTLHDVPFGDNF  926

Query  2771  QVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGRE  2950
             Q+ +R +V + S+      C V +G  W K T ++ RIT N+   FS+ + E ++   +E
Sbjct  927   QIHVRNEVRTLSSKPAMSECRVLLGTSWQKGTAMQARITSNVQEHFSKHLIEKVKLAAKE  986

Query  2951  V  2953
             +
Sbjct  987   I  987



>ref|XP_001780685.1| predicted protein [Physcomitrella patens]
 gb|EDQ54469.1| predicted protein [Physcomitrella patens]
Length=1021

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/776 (44%), Positives = 491/776 (63%), Gaps = 12/776 (2%)
 Frame = +2

Query  638   EMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEGPWTWKSDNKS  817
             + P  L GG++LDQ YA+  K  + L+    S F +EL  +Q T +  EGPW  KS+   
Sbjct  236   DFPPPLAGGVVLDQRYAVSSKFLSALILKAGSPFVQELLTVQKTTEYIEGPW--KSEQSG  293

Query  818   CLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGSTFKVELLYNI  997
              + RVVTY K ATK++K+V+ATE QT  + D K F V V  +TPDVPYG  F VEL + I
Sbjct  294   AIQRVVTYMKAATKMIKAVKATETQTCRRQDEKGFVVDVSCATPDVPYGGCFVVELQFCI  353

Query  998   MPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRFLAQHCKVIT  1177
             + GP   S E+S  L ISW + F +STMM+++IE G + G+K+++  + + LA H K + 
Sbjct  354   LAGPDQPSNEKSCRLQISWKLNFLQSTMMRSMIENGARAGIKETYEVYRQVLANHAKSV-  412

Query  1178  SAEVLDNGHLLATLPSEHP-SDLELAREYFCNFTVVSTAFLVLYFSIHILLSRSTQLQGL  1354
             S E  +   L A    E P SD EL R YF    V+     +    +HI  +  T    L
Sbjct  413   SEEPSEGKLLSAPKQEEKPLSDWELVRGYFGKLHVLLALLSLTIVLLHICFASPTLRATL  472

Query  1355  EFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHGDGWVLTVAL  1534
                GLDLPD++ E++   I+VL +E+V +M   FV+AR  +  DHGV+A GDGW++TV L
Sbjct  473   IRWGLDLPDTMSELLFTAIVVLQVERVVKMTQQFVQARFWQSGDHGVKAQGDGWLMTVTL  532

Query  1535  IEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEEPPSMLDVE  1714
             IEG +L+  D     +P+VVFTC+GK RTSSV+L+TL P+W EI EF+  E+PPS +DVE
Sbjct  533   IEGVDLSPND-NKLANPYVVFTCSGKRRTSSVKLRTLKPRWREIFEFDATEDPPSTMDVE  591

Query  1715  VFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRIFLNNNNGV  1894
             VFD+DGPF  A SLGH+EINFLK +  ELAD WLPL GK A++  SKLHLR+FL N    
Sbjct  592   VFDYDGPFSDAESLGHSEINFLKQSPDELADFWLPLSGKNARTHGSKLHLRVFLTNTKQS  651

Query  1895  ETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIF  2074
             + +   L ++EKE+G K+ +RS  +N +FQK F LP EEFLINDF+C++K+K  +QGR+F
Sbjct  652   DALPQYLDRVEKELGTKVVVRSAQKNGSFQKLFALPAEEFLINDFACAIKKKFLVQGRLF  711

Query  2075  LSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDRGTDARNGA  2254
             LS R++GFY+NLFG KTKF F+WEDIEEI   P     + +P +V+ L K RG DA NG 
Sbjct  712   LSPRMLGFYSNLFGIKTKFQFIWEDIEEIVETP----GVMNPYIVMYLRKGRGLDAHNGM  767

Query  2255  KSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQ-IAEEQQYKDENNVLPEE  2431
             + +   GR  F F SFV    A RTI ALWK R   P+Q+ + +A  Q+   E   L ++
Sbjct  768   RGVCPNGRAKFYFCSFVKPVTAFRTISALWKNRKLSPEQQLELVANVQRKHPEIERLGDD  827

Query  2432  TGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELI--E  2605
             T S+  +E+  +  V S D+P+   S+M +F+ G LE  V  + G +NY +SSWE +  +
Sbjct  828   TDSFTGMEEAHLYHVCSFDIPLTTDSVMILFDKGKLEEVVAERMGYVNYESSSWERVDNQ  887

Query  2606  PDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLR  2785
             P V  R +SY+LNR IS FG +++  Q+K+   +   ++++E++ +H VPF DH++VQ++
Sbjct  888   PGVQRREISYQLNRQISQFGSKISCVQQKTSSDSSKVFVIDEVLTLHDVPFGDHFEVQVK  947

Query  2786  YKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGREV  2953
               +E+ S         V VGV W KNT+ + +ITKN++   ++ ++E++    +EV
Sbjct  948   RDIETTSTNPPRSAVKVSVGVAWHKNTEFKKKITKNVLDHMAKEIREVMNISVKEV  1003



>ref|XP_008645392.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
isoform X2 [Zea mays]
Length=966

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/638 (50%), Positives = 444/638 (70%), Gaps = 7/638 (1%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             S  E +K ++S+ +  E+P NL GG+L+DQ+Y + P + N LLF+  S F  E++ELQGT
Sbjct  301   SLDELLKNMESKDQACELPGNLPGGVLMDQSYIIAPAELNSLLFSGTSDFWPEVSELQGT  360

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
                   PW    +N++CL R +TYTK A+KLVKSV+ATEEQ YLK  G  FAVL  VSTP
Sbjct  361   SGFNIEPWK-HDNNENCLKRTITYTKAASKLVKSVKATEEQKYLKATGSSFAVLSSVSTP  419

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             DVP G+ FKVE+LY I+ G  L   E++T + +SW + F +STM+K +IE G +QGL + 
Sbjct  420   DVPCGNCFKVEILYRIISGSQL-PLEQTTQITVSWRLNFVQSTMLKGMIENGAKQGLAEG  478

Query  1130  FSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYF  1309
             +S FS  L++  KV   A+      +LA+L ++  S+ +L   +  +F  + +    LY 
Sbjct  479   YSHFSEVLSRKVKVAELADANTKDKILASLQTQKESNWKLVARFLGSFAFICSLSTALYI  538

Query  1310  SIHILLSR-STQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSD  1486
             + H+ L++ +  L GLE+ G+DLPDS+GEI+ C IL++    + ++   F++A  +RGSD
Sbjct  539   TTHLHLAKPNVVLGGLEYFGIDLPDSIGEIVFCIILIIQGHNIMKVGRRFLQAWKQRGSD  598

Query  1487  HGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEI  1666
             HGV+AHGDGW+LT+ALIEG+ + S    G PDP+VVFTCNGK +TSSV+ QT +P+WNEI
Sbjct  599   HGVKAHGDGWLLTIALIEGSGVVSAGTPGVPDPYVVFTCNGKRKTSSVKYQTSEPKWNEI  658

Query  1667  LEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSS  1846
              EF+  ++PP+ LDV V D D P ++   +G  E+NF+K+  ++L D+W+PL G+  Q  
Sbjct  659   FEFDAMDDPPARLDVVVHDSDIPNNET-PIGQTEVNFVKNNLSDLGDMWVPLDGRFPQGH  717

Query  1847  QSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
             Q KLHLRIFLNN+ G E + + L KM KEVGKK++LRS   NS F+K F LPPEEFLI+D
Sbjct  718   QPKLHLRIFLNNSRGTEVVMNYLEKMGKEVGKKMHLRSSQTNSAFRKLFSLPPEEFLIDD  777

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             F+C LKRK+PLQGR+FLS RI GFY+N+FG KTKFFFLWEDIE I V+PP  +T+GSPSL
Sbjct  778   FTCHLKRKMPLQGRLFLSPRITGFYSNIFGRKTKFFFLWEDIENIQVVPPKLATVGSPSL  837

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIA  2386
             +IIL KDRG +AR+GAK++D +GRL F F +FVSF  A R IMA+WK R+   +QK ++ 
Sbjct  838   MIILCKDRGLEARHGAKALDPQGRLKFHFQTFVSFNDAHRIIMAIWKLRSSGLEQKGEVI  897

Query  2387  EEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMN  2500
             +++    EN   P E GS L  EDV MS+VYS  L ++
Sbjct  898   DKEPELKEN---PYEEGSLLANEDVKMSEVYSAVLSVD  932



>ref|XP_001772096.1| predicted protein [Physcomitrella patens]
 gb|EDQ63177.1| predicted protein [Physcomitrella patens]
Length=801

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/781 (43%), Positives = 495/781 (63%), Gaps = 20/781 (3%)
 Frame = +2

Query  638   EMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEGPWTWKSDNKS  817
             + P  L GG++LDQ YA+  K  N ++F P S+F R+L ++Q T D  E PW  K     
Sbjct  11    DFPPPLPGGVVLDQKYAISAKAMNAIIFKPGSEFVRDLLQIQKTTDYVEEPW--KKVGNE  68

Query  818   CLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGSTFKVELLYNI  997
              + R +TY + A+KLVK+V+A E QTY + D K F +L+  STPDVPYG +F VE+   I
Sbjct  69    PIKRSITYMRAASKLVKAVKAYETQTYQRADDKGFCILISSSTPDVPYGGSFIVEMQAVI  128

Query  998   MPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRFLAQHCKVIT  1177
             +  P   SGE+   L ISW + F  STMMK +IE G + G++DSF  +   L++H   ++
Sbjct  129   VGLPDTASGEKCCQLRISWRLNFLHSTMMKGMIESGARNGIRDSFVVYREVLSRHATPLS  188

Query  1178  SAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHILLSRSTQLQGLE  1357
             S++ L +G     L S    D E+A +YF  + V+     ++   +HI L+   +  GLE
Sbjct  189   SSKELPSGGDDEILIS----DWEIAWDYFKKWHVLFALVSLIIILVHIALAPPKKKCGLE  244

Query  1358  FHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHGDGWVLTVALI  1537
             F  +  PDS+ E+I   ++V+ +E++  MI +FV AR  +  DHGV+A GDGW+ +V L+
Sbjct  245   FWIIHFPDSLMELIMSAVVVIQVERLAIMIYYFVRARYWQSGDHGVKAQGDGWLTSVTLV  304

Query  1538  EGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEEPPSMLDVEV  1717
             EG N+A L  +G P P+V+F CNGKSRTSSV+L+T +P W EI EF  ++ PP+ +D+EV
Sbjct  305   EGVNIA-LPDSGTPSPYVIFRCNGKSRTSSVKLRTSNPAWREIFEFNASDNPPTTMDIEV  363

Query  1718  FDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRIFLNNNNGVE  1897
             FD+DGPF +A SLG+AEINFLK ++ +LAD WLPL G  A+++ +KLHLR+FL+N    +
Sbjct  364   FDYDGPFSEAESLGYAEINFLKQSAGKLADFWLPLEGNSARANGAKLHLRVFLSNTRDTD  423

Query  1898  TIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFL  2077
              + + L ++E+EVG K+  RS  +N++FQK F LP EEFL NDF+C++KRK+P+QGR+FL
Sbjct  424   ALPEYLERVEREVGLKVRKRSAQKNNSFQKLFSLPAEEFLFNDFACAIKRKIPIQGRLFL  483

Query  2078  STRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDRGTDARNGAK  2257
             S R++GFY+NLFGHKTKF  LWE+IEEI  +  S     +PS+V+ L K RG DAR+GA+
Sbjct  484   SPRLLGFYSNLFGHKTKFTLLWEEIEEIKEIAQSI----NPSIVVFLRKGRGFDARHGAR  539

Query  2258  SIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKDENNVLPEETG  2437
              ID  GRL F F SFV  G A R I+ALWK R    +QK  I    +  D    + E   
Sbjct  540   GIDGMGRLKFQFLSFVRSGTAFRAIVALWKNRNLSLEQKMDIIANVEAGDMKYSVAERQA  599

Query  2438  S----YLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIE  2605
                  +L +ED SMS+V  +++P+  +S+  +     ++  +  K G  +Y +S WE+++
Sbjct  600   DDRQPFLGIEDASMSEVVHMEIPITVESVHAVILDEKMDRAISEKLGLSDYESSPWEIVD  659

Query  2606  P----DVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQ  2773
                  ++  R  SYKLNRLI+ FG +++  Q+KS+  N    ++NEI+ +H VPF DH+Q
Sbjct  660   KKAQLEIRRRHRSYKLNRLITQFGSKISCVQQKSLSVNSKKLVINEILTLHDVPFGDHFQ  719

Query  2774  VQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDR-ITKNIVRKFSQRVKEMIEFVGRE  2950
             +Q R + E+ S    +     +VGV W K T+L+ R +TKNI    + + + ++EF+  E
Sbjct  720   IQTRMEFETLSMEPITTHFKAFVGVAWQKATELDQRKMTKNIYEHITNQYQALVEFIVEE  779

Query  2951  V  2953
             V
Sbjct  780   V  780



>gb|KCW75058.1| hypothetical protein EUGRSUZ_E038332, partial [Eucalyptus grandis]
Length=508

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/496 (59%), Positives = 387/496 (78%), Gaps = 3/496 (1%)
 Frame = +2

Query  1013  LRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRFLAQHCKVITSAEVL  1192
             L SGE+S+ LVISW + F ++TMMK +IE G +QGLKDSF +++  L Q  K + S ++ 
Sbjct  1     LPSGEQSSRLVISWRMNFLQNTMMKGMIESGVRQGLKDSFEQYASLLNQTVKPVDSKDIG  60

Query  1193  DNG-HLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGL  1369
              N   +LA+L +E  SD +LA +YF NFTV+ST  + LY  +H+ L+  + + GLEF GL
Sbjct  61    SNKEQILASLQAEPQSDWKLAVQYFANFTVLSTFVMGLYVLVHLWLATPSPIHGLEFVGL  120

Query  1370  DLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTN  1549
             DLPDS+GE+I CG+LVL  E+V   I+ F++AR+++GSDHGV+A GDGW+LTVALIEG++
Sbjct  121   DLPDSIGEVIVCGMLVLQAERVLGFISRFMQARMQKGSDHGVKAQGDGWLLTVALIEGSS  180

Query  1550  LASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFD  1729
             +A++D +   DP+VVFTCNGK+RTSS++ Q  DP WNEI EF+  E+PPSMLDVEVFDFD
Sbjct  181   IAAVDSSALSDPYVVFTCNGKTRTSSIKFQKTDPLWNEIFEFDAMEDPPSMLDVEVFDFD  240

Query  1730  GPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRIFLNNNNGVETIRD  1909
             GPFD+A SLGHAE+NF+++  ++LAD+W+ L GK+AQ+ QSKLHLRIFL+N  G    ++
Sbjct  241   GPFDEATSLGHAEVNFVRNNISDLADVWVTLHGKLAQACQSKLHLRIFLDNTKGSNVAKE  300

Query  1910  NLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRI  2089
              ++KMEKEVGKK+N+RSP  NS FQK F LPPEEFLINDF+C LKRK+PLQGR+FLS RI
Sbjct  301   YISKMEKEVGKKINIRSPQTNSAFQKLFALPPEEFLINDFTCHLKRKMPLQGRLFLSARI  360

Query  2090  VGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDE  2269
             +GF+ANLFG KTKFFFLWEDIE+I VL P+ ++MGSP +V+ L + RG +AR+GAK+ DE
Sbjct  361   IGFHANLFGQKTKFFFLWEDIEDIQVLSPTLASMGSPIVVMTLRRGRGMEARHGAKTQDE  420

Query  2270  EGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKDENNVLPEETGSYLI  2449
             EGRL F F SFVSF  A RTIMALWK R+  P+QK Q+ EE+   +  +++ EE+GS+L 
Sbjct  421   EGRLKFQFQSFVSFNVAHRTIMALWKARSLTPEQKVQLIEEE--SEARSLVTEESGSFLG  478

Query  2450  VEDVSMSKVYSVDLPM  2497
             +EDVS+S+VY   LP+
Sbjct  479   LEDVSLSEVYCSVLPV  494



>ref|XP_001757231.1| predicted protein [Physcomitrella patens]
 gb|EDQ78090.1| predicted protein [Physcomitrella patens]
Length=1007

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/783 (42%), Positives = 480/783 (61%), Gaps = 19/783 (2%)
 Frame = +2

Query  638   EMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEGPWTWKSDNKS  817
             E+P  L GG+LLDQTY +  K  N +LF P S F R+L E Q + +  E PW  +     
Sbjct  216   EIPLPLSGGVLLDQTYGVSSKALNAILFKPGSTFVRDLVEAQKSTEYMEEPW--RKAGNG  273

Query  818   CLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGSTFKVELLYNI  997
              + RV +Y K A+KLVK+++ATE QTY + D   + VL   +TPD PYG TF VE+   I
Sbjct  274   LMKRVTSYIKAASKLVKALKATEVQTYTRADEMCYCVLSTCATPDAPYGGTFVVEVQITI  333

Query  998   MPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRFLAQHCKVIT  1177
                P    G +  HL IS+ V F + +MMK +IEGG + G+K++++ +   LA+H + ++
Sbjct  334   SSRPDFLGGMKCCHLQISYNVNFLQKSMMKGMIEGGVRTGIKETYAIYQDVLAKHVQRVS  393

Query  1178  SAEVLDNGHLL---ATLPSEHP-SDLELAREYFCNFTVVSTAFLVLYFSIHILLSRSTQL  1345
              A+    G+ L   +T   E P S  E A +YF  + V+     + +  +HI LS     
Sbjct  394   VADA--QGYALLGTSTDDEEKPISAWEEAWDYFGKWHVLFAVISLTFILVHIGLSPRKSR  451

Query  1346  QGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHGDGWVLT  1525
              GL+F G+  P S  E+I+  I+ + +E+V   I ++V  R  +  DHG +A GDGW  T
Sbjct  452   TGLDFWGVRFPSSFTELISAAIVAIQVERVAIKIFNYVRVRYWQSGDHGTKARGDGWYTT  511

Query  1526  VALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEEPPSML  1705
             V LIEG N+   D +G  +PFV FTCNGKSRTSSV+L+T  P W E+ EF+  E+PPS +
Sbjct  512   VFLIEGENIVPKD-SGIANPFVAFTCNGKSRTSSVKLRTSQPNWREMFEFDATEDPPSTM  570

Query  1706  DVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRIFLNNN  1885
             D+EVFD+DGPF +   LGHAEINFL+ +  +L+D W+PL GK A+++ SKLHLR+FL+N 
Sbjct  571   DIEVFDYDGPFSEPEILGHAEINFLRKSIGDLSDFWIPLDGKTARANGSKLHLRVFLSNT  630

Query  1886  NGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRKLPLQG  2065
                  + + L ++E+EVG K+  RS HRN TFQ  F LPPEEFL NDF+C+ KR++ +QG
Sbjct  631   GDCNALPNYLERVEREVGLKVGKRSSHRNETFQNLFSLPPEEFLYNDFACAAKRRILIQG  690

Query  2066  RIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDRGTDAR  2245
             R+FLS R++GFY+NLFGHKTKF  LWEDIEEI  +  S     +PS+VI L K RG DAR
Sbjct  691   RLFLSVRLLGFYSNLFGHKTKFTILWEDIEEIKEISQSL----NPSIVIFLRKGRGFDAR  746

Query  2246  NGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKDENNVLP  2425
             +GA+SID  GRL F F SF+  G A +TI+ALWK R   P+Q+  I       D    + 
Sbjct  747   HGARSIDGMGRLKFIFLSFLRSGSAFKTIVALWKNRNLSPEQRMDIVASVVDGDMRYAVA  806

Query  2426  E----ETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSW  2593
             E    ++  +L  E   M +V  +++P+  +S++   N   ++  +  K G   Y  + W
Sbjct  807   ERQADDSQPFLGFEQTIMPEVLVIEIPITAESVLAAVNNTKVDLSISEKLGLAEYRATPW  866

Query  2594  ELIEPDV--YERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDH  2767
             + +E  +  ++R +SYKLNR IS FG  V+  Q++ V  +    ++ E++  H +PF DH
Sbjct  867   DHVEETIGAHQRELSYKLNRQISQFGSRVSCNQQQVVTDDLKKLVIKEVLRYHDMPFGDH  926

Query  2768  YQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGR  2947
             ++V ++ ++E+ S    + +   +VGV+W K+T+ + +ITKNI    + +++E+I+    
Sbjct  927   FEVHVKRELETLSTNPVNTQVKAFVGVVWHKSTEAQKKITKNIYEHMAWQIQELIDITVA  986

Query  2948  EVF  2956
             EVF
Sbjct  987   EVF  989



>ref|XP_002989013.1| hypothetical protein SELMODRAFT_235662 [Selaginella moellendorffii]
 gb|EFJ09807.1| hypothetical protein SELMODRAFT_235662 [Selaginella moellendorffii]
Length=982

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/775 (44%), Positives = 481/775 (62%), Gaps = 28/775 (4%)
 Frame = +2

Query  617   QSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEGPWT  796
             Q  T G  +P  L GG L +QTYA   +  N +LF P S F  EL  +Q T D+ EG   
Sbjct  214   QLSTPGDSVPPPLSGGFLANQTYATKLQTLNSVLFKPHSPFFEELIAVQKTTDLVEG--M  271

Query  797   WKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGSTFK  976
             WK        RV+TYTK AT +VKSV+ATEEQTYL+ D + + VL  VSTPDV YG+TF+
Sbjct  272   WKKVGNENPKRVLTYTKAATAVVKSVKATEEQTYLRADDRAYVVLAVVSTPDVLYGNTFR  331

Query  977   VELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRFLA  1156
              E+ Y + P       EE  +L ISW + F +STM K +IE G +QGL D+F ++   L+
Sbjct  332   TEVQYCLTP-----VSEERCNLSISWRINFIQSTMAKRLIERGAKQGLTDNFRQYVEVLS  386

Query  1157  QHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCN-FTVVSTAFLVLYFSIHILLSR  1333
             ++  V  + E  D     A    E  +D+ L +EYF +   +V +    L   +HI L++
Sbjct  387   KY--VEEAGEDADPAP--AEEQDEPENDISLTQEYFSSSMFIVVSLLFFLVVLLHIQLAQ  442

Query  1334  STQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHGDG  1513
              T   GLEF  LDLPD+ GE++T  ++ +H  Q+ +M    + A      DHG +A G+G
Sbjct  443   PTPTVGLEFWQLDLPDTFGELLTSAVITVHFVQLGKMALKKLRAASLTAGDHGKKAKGEG  502

Query  1514  WVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEEP  1693
             W+LTV L+EG NL     T   DP+VVFTC+G++RTSSV+LQT +P+W EI EF+  E+P
Sbjct  503   WLLTVTLVEGENLPIRPNTNCLDPYVVFTCSGRTRTSSVKLQTTNPKWGEIFEFDATEDP  562

Query  1694  PSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRIF  1873
             PS LDVEVF++DGPF +A SLG+AEINFLK +   LADLW+ L G  AQ+S S+LHLRIF
Sbjct  563   PSTLDVEVFNYDGPFPEAVSLGYAEINFLKLSPDNLADLWIRLEGPHAQTSYSRLHLRIF  622

Query  1874  LNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRKL  2053
             L N    +T  + + K+EKE G K+ ++S  +N++FQK F LP EEFLINDF+       
Sbjct  623   LTNTKEADTFVEYVKKVEKEAGAKV-IKSSRKNASFQKLFSLPAEEFLINDFAF------  675

Query  2054  PLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDRG  2233
                GR+FLS R++GFY+N+FGHKTKF  LWEDI+E+  LPPS + +G PS+V+   K R 
Sbjct  676   ---GRLFLSPRMLGFYSNIFGHKTKFSLLWEDIDEVQELPPSIANVG-PSIVLFSRKGRA  731

Query  2234  TDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKDEN  2413
              DA  G+K +D +GRL F F SFV  G A RT+M LWK RA  P+Q+ ++ E     D  
Sbjct  732   HDANQGSKGMDGKGRLKFQFQSFVRAGPAFRTLMVLWKNRALTPEQQLEMVEN---VDTE  788

Query  2414  NVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSW  2593
             + L E+ G ++ VEDV++S+VYS  LP+   S++ ++   +LE KVM K GC+NY  S W
Sbjct  789   SKLYED-GEFIGVEDVTLSEVYSTVLPLTAASMVLLYEKENLEEKVMEKLGCMNYTVSPW  847

Query  2594  ELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQ  2773
             E   P    R+V+Y+LNR +  FG  V+  Q+K V +N     ++EI+ +H VPF D++Q
Sbjct  848   ENEGPG-QRRQVNYRLNRQMCQFGSIVSGVQQKVVSSNHLTASVDEILTLHDVPFGDNFQ  906

Query  2774  VQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEF  2938
             + +R +V + S+      C V +G  W K T ++ RIT N+   F++ + E +  
Sbjct  907   IHVRNEVRTLSSKPAMSECRVLLGTSWQKGTAMQARITSNVQEHFTKHLIEKMNL  961



>ref|XP_001780836.1| predicted protein [Physcomitrella patens]
 gb|EDQ54315.1| predicted protein [Physcomitrella patens]
Length=1011

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/779 (42%), Positives = 474/779 (61%), Gaps = 14/779 (2%)
 Frame = +2

Query  638   EMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEGPWTWKSDNKS  817
             + P  L  G++LDQ Y    K  + L+    S F +EL     T +  E PW  K  N  
Sbjct  226   DFPPPLASGVVLDQRYGTSAKSLSALICKAGSPFIQELLTCLKTTEYSEEPW--KRANNG  283

Query  818   CLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGSTFKVELLYNI  997
             C+ RVV+Y K ATK++K+V+A+E  T  + D + F + +  STPDVPYGS F V+L + I
Sbjct  284   CIERVVSYMKAATKIIKAVKASESHTCRRLDDRGFILDISCSTPDVPYGSNFMVKLQFCI  343

Query  998   MPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRFLAQHCKVIT  1177
             + G  L S E++  L +SW + F  STMMK +IE G + G+K+++  +   L+++ K I 
Sbjct  344   LAGQDLPSQEKTCRLQVSWTLHFLHSTMMKGMIENGARAGIKETYELYREVLSRYAKPIY  403

Query  1178  SAEVLDNGHLLATLPSEHP-SDLELAREYFCNFTVVSTAFLVLYFSIHILLSRSTQLQGL  1354
                        A    E P SD EL + YF    V+     +    +HI  +       L
Sbjct  404   EGPPGRELVPEAKREEETPLSDWELVKGYFGKLHVLMAILSLTAVFLHIGFASPKASATL  463

Query  1355  EFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHGDGWVLTVAL  1534
                G DLPDS+ E +   I+VL +E+V +M+  F++AR  +  DHGV+A GDGW++TV L
Sbjct  464   IRWGFDLPDSLSEFLFSAIVVLQVEKVVKMVHQFLQARYWQSGDHGVKAQGDGWLMTVTL  523

Query  1535  IEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEEPPSMLDVE  1714
             IEG NL+  +   F +P+ VFTC+GK RTSSV+L+TL+P+W E+ EF+  E+PPS +DVE
Sbjct  524   IEGENLSPTEECSFSNPYAVFTCSGKRRTSSVKLRTLNPRWREVFEFDATEDPPSTMDVE  583

Query  1715  VFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRIFLNNNNGV  1894
             VFD+DGPF  A SLGHAEINFLK +  +LAD W+ L GK A++  S+LHLR+FL N    
Sbjct  584   VFDYDGPFSDAESLGHAEINFLKQSPEDLADFWISLSGKCARTHGSRLHLRVFLTNTKQS  643

Query  1895  ETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIF  2074
             + + + L +++KE G K+  RS  +N +FQK F LP EEFLINDF+C++K+K+ +QGR+F
Sbjct  644   DALPEYLERVQKE-GIKVVKRSAQKNGSFQKLFALPAEEFLINDFACAIKKKILIQGRLF  702

Query  2075  LSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDRGTDARNGA  2254
             LS R++GFY+NLFG KTKF F+WEDI++I   P +     +P +V+ L K RG DARNG 
Sbjct  703   LSPRMLGFYSNLFGIKTKFQFIWEDIDDIVETPVAI----NPCIVMFLRKGRGLDARNGM  758

Query  2255  KSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQK----AQIAEEQQYKDENNVL  2422
             + ID  GR  F F SFV    A RTI ALWK R    +Q+    A +  E Q   ++   
Sbjct  759   RGIDAHGRAKFYFCSFVKPVTAFRTITALWKNRKLSLEQQLELCANVEAEDQTCTDSQRS  818

Query  2423  PEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELI  2602
              ++  ++  +E+ +M  V + D+P+   S M +F  G LE  V  K G +N+V++ WE +
Sbjct  819   ADDADTFTGMEEANMVNVCAFDIPLTMDSAMSLFEKGRLEEVVAEKMGYINFVSTPWERL  878

Query  2603  E--PDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQV  2776
             E   +V  R+VSY LNR IS FG +V+  Q+K++  N   +IL+E++ +H VPF DH+QV
Sbjct  879   EGQNNVQRRQVSYHLNRQISQFGSKVSCIQQKTMLDNMKLYILDEVLTLHDVPFGDHFQV  938

Query  2777  QLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGREV  2953
             Q+R  +E+ S          YVGV W KNT+ + +ITKN+    ++ ++E +    +EV
Sbjct  939   QVRRDIETTSINPPKSSVKAYVGVSWHKNTEFKKKITKNVQDHMAKEIREAMNVSVKEV  997



>ref|XP_008645394.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
isoform X4 [Zea mays]
Length=891

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/590 (51%), Positives = 415/590 (70%), Gaps = 4/590 (1%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             S  E +K ++S+ +  E+P NL GG+L+DQ+Y + P + N LLF+  S F  E++ELQGT
Sbjct  301   SLDELLKNMESKDQACELPGNLPGGVLMDQSYIIAPAELNSLLFSGTSDFWPEVSELQGT  360

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
                   PW    +N++CL R +TYTK A+KLVKSV+ATEEQ YLK  G  FAVL  VSTP
Sbjct  361   SGFNIEPWK-HDNNENCLKRTITYTKAASKLVKSVKATEEQKYLKATGSSFAVLSSVSTP  419

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             DVP G+ FKVE+LY I+ G  L   E++T + +SW + F +STM+K +IE G +QGL + 
Sbjct  420   DVPCGNCFKVEILYRIISGSQL-PLEQTTQITVSWRLNFVQSTMLKGMIENGAKQGLAEG  478

Query  1130  FSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYF  1309
             +S FS  L++  KV   A+      +LA+L ++  S+ +L   +  +F  + +    LY 
Sbjct  479   YSHFSEVLSRKVKVAELADANTKDKILASLQTQKESNWKLVARFLGSFAFICSLSTALYI  538

Query  1310  SIHILLSR-STQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSD  1486
             + H+ L++ +  L GLE+ G+DLPDS+GEI+ C IL++    + ++   F++A  +RGSD
Sbjct  539   TTHLHLAKPNVVLGGLEYFGIDLPDSIGEIVFCIILIIQGHNIMKVGRRFLQAWKQRGSD  598

Query  1487  HGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEI  1666
             HGV+AHGDGW+LT+ALIEG+ + S    G PDP+VVFTCNGK +TSSV+ QT +P+WNEI
Sbjct  599   HGVKAHGDGWLLTIALIEGSGVVSAGTPGVPDPYVVFTCNGKRKTSSVKYQTSEPKWNEI  658

Query  1667  LEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSS  1846
              EF+  ++PP+ LDV V D D P ++   +G  E+NF+K+  ++L D+W+PL G+  Q  
Sbjct  659   FEFDAMDDPPARLDVVVHDSDIPNNET-PIGQTEVNFVKNNLSDLGDMWVPLDGRFPQGH  717

Query  1847  QSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
             Q KLHLRIFLNN+ G E + + L KM KEVGKK++LRS   NS F+K F LPPEEFLI+D
Sbjct  718   QPKLHLRIFLNNSRGTEVVMNYLEKMGKEVGKKMHLRSSQTNSAFRKLFSLPPEEFLIDD  777

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             F+C LKRK+PLQGR+FLS RI GFY+N+FG KTKFFFLWEDIE I V+PP  +T+GSPSL
Sbjct  778   FTCHLKRKMPLQGRLFLSPRITGFYSNIFGRKTKFFFLWEDIENIQVVPPKLATVGSPSL  837

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRA  2356
             +IIL KDRG +AR+GAK++D +GRL F F +FVSF  A R +  L +T++
Sbjct  838   MIILCKDRGLEARHGAKALDPQGRLKFHFQTFVSFNDAHRIVGVLNRTQS  887



>ref|XP_008645393.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
isoform X3 [Zea mays]
Length=902

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/580 (51%), Positives = 409/580 (71%), Gaps = 4/580 (1%)
 Frame = +2

Query  590   SFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGT  769
             S  E +K ++S+ +  E+P NL GG+L+DQ+Y + P + N LLF+  S F  E++ELQGT
Sbjct  301   SLDELLKNMESKDQACELPGNLPGGVLMDQSYIIAPAELNSLLFSGTSDFWPEVSELQGT  360

Query  770   KDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTP  949
                   PW    +N++CL R +TYTK A+KLVKSV+ATEEQ YLK  G  FAVL  VSTP
Sbjct  361   SGFNIEPWK-HDNNENCLKRTITYTKAASKLVKSVKATEEQKYLKATGSSFAVLSSVSTP  419

Query  950   DVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDS  1129
             DVP G+ FKVE+LY I+ G  L   E++T + +SW + F +STM+K +IE G +QGL + 
Sbjct  420   DVPCGNCFKVEILYRIISGSQL-PLEQTTQITVSWRLNFVQSTMLKGMIENGAKQGLAEG  478

Query  1130  FSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYF  1309
             +S FS  L++  KV   A+      +LA+L ++  S+ +L   +  +F  + +    LY 
Sbjct  479   YSHFSEVLSRKVKVAELADANTKDKILASLQTQKESNWKLVARFLGSFAFICSLSTALYI  538

Query  1310  SIHILLSR-STQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSD  1486
             + H+ L++ +  L GLE+ G+DLPDS+GEI+ C IL++    + ++   F++A  +RGSD
Sbjct  539   TTHLHLAKPNVVLGGLEYFGIDLPDSIGEIVFCIILIIQGHNIMKVGRRFLQAWKQRGSD  598

Query  1487  HGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEI  1666
             HGV+AHGDGW+LT+ALIEG+ + S    G PDP+VVFTCNGK +TSSV+ QT +P+WNEI
Sbjct  599   HGVKAHGDGWLLTIALIEGSGVVSAGTPGVPDPYVVFTCNGKRKTSSVKYQTSEPKWNEI  658

Query  1667  LEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSS  1846
              EF+  ++PP+ LDV V D D P ++   +G  E+NF+K+  ++L D+W+PL G+  Q  
Sbjct  659   FEFDAMDDPPARLDVVVHDSDIPNNET-PIGQTEVNFVKNNLSDLGDMWVPLDGRFPQGH  717

Query  1847  QSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
             Q KLHLRIFLNN+ G E + + L KM KEVGKK++LRS   NS F+K F LPPEEFLI+D
Sbjct  718   QPKLHLRIFLNNSRGTEVVMNYLEKMGKEVGKKMHLRSSQTNSAFRKLFSLPPEEFLIDD  777

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             F+C LKRK+PLQGR+FLS RI GFY+N+FG KTKFFFLWEDIE I V+PP  +T+GSPSL
Sbjct  778   FTCHLKRKMPLQGRLFLSPRITGFYSNIFGRKTKFFFLWEDIENIQVVPPKLATVGSPSL  837

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASR  2326
             +IIL KDRG +AR+GAK++D +GRL F F +FVSF  A R
Sbjct  838   MIILCKDRGLEARHGAKALDPQGRLKFHFQTFVSFNDAHR  877



>ref|XP_001764304.1| predicted protein [Physcomitrella patens]
 gb|EDQ70858.1| predicted protein [Physcomitrella patens]
Length=1013

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/776 (42%), Positives = 482/776 (62%), Gaps = 18/776 (2%)
 Frame = +2

Query  638   EMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEGPWTWKSDNKS  817
             + P  L GG++LDQ YA+  K  + L+  P S F +EL  +Q T +  E PW  KS    
Sbjct  234   DFPSPLAGGVVLDQRYAISAKALSSLICKPSSSFFQELLTVQKTTEYSEEPW--KSVKND  291

Query  818   CLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGSTFKVELLYNI  997
              + RVV+Y K ATK++KSV+ATE  T  + D + F + +  +TPDVP G++F VEL + +
Sbjct  292   SIERVVSYMKAATKIIKSVKATETHTCRRLDDRGFVLDISCATPDVPCGTSFLVELQFCV  351

Query  998   MPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRFLAQHCKVIT  1177
             M    L   E++  L+ISW +KF  STM+K +IE G + G+K+++  F   L+++ K I+
Sbjct  352   MAERDLPVKEKTCRLLISWRIKFLHSTMIKGMIESGARAGIKETYEIFKEILSKYAKPIS  411

Query  1178  SAEVLDNGHLL-ATLPSEHP-SDLELAREYFCNFTVVSTAFLVLYFSIHILLSRSTQLQG  1351
               E    G+L+ AT   + P SD EL R YF    V+     ++   +HI  +       
Sbjct  412   --EDSWGGNLVPATQQEDTPLSDWELVRCYFGRLHVLLAFLSLIIVLLHIGFATPKVKVS  469

Query  1352  LEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHGDGWVLTVA  1531
             L   G DLPDS+ E +   I+VL +E+V +M+  F++AR  +  DHGV+A GDGW++TV 
Sbjct  470   LLRCGFDLPDSISEFLCSAIVVLQVERVVKMVHQFLQARFWQSGDHGVKAQGDGWLMTVT  529

Query  1532  LIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEEPPSMLDV  1711
             LIEG NL+    + F +P+VVFTC+GK RTSSV+L+TL+P W EI EF+  E+PPS +DV
Sbjct  530   LIEGENLSPTKESSFANPYVVFTCSGKRRTSSVKLRTLNPCWREIFEFDATEDPPSTMDV  589

Query  1712  EVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRIFLNNNNG  1891
             EVF++DGPF  A SLG AEINFLK +  +L+D W+ L GK A++  S+LHLR+FL N   
Sbjct  590   EVFNYDGPFSDAESLGQAEINFLKQSPDDLSDFWVSLSGKCARTHGSRLHLRVFLTNTKQ  649

Query  1892  VETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRKLPLQGRI  2071
              + + + L +++KE G K+  RS  +N +FQK F LP EEFLINDF+C++K+K+ +QGR+
Sbjct  650   SDALPEYLERVQKE-GIKVVKRSAQKNGSFQKLFSLPAEEFLINDFACAVKKKILIQGRV  708

Query  2072  FLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDRGTDARNG  2251
             FLS R++GFY+NLFG KTKF F+WEDI++I       S   +P +VI L K RG DARNG
Sbjct  709   FLSPRMLGFYSNLFGIKTKFQFIWEDIDDI----VETSVAINPCIVIYLRKGRGLDARNG  764

Query  2252  AKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKDENNVLPEE  2431
              + ID  GR  + F SFV    A RTI ALWK R   P+Q+ ++    +   ++      
Sbjct  765   TRGIDARGRAKYHFCSFVKPITAFRTITALWKNRKLSPEQQLELCANVEANYQSC-----  819

Query  2432  TGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPD  2611
             T S+  +E+ +M++V + ++P+     M +F  G LE  +  K G LNYV++ WE +E  
Sbjct  820   TDSFAGMEEANMAQVCAFEIPLMSDCAMSLFEQGGLEEAMAEKMGYLNYVSTPWERLEGQ  879

Query  2612  --VYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLR  2785
               V  R  SY LNR IS FG +V+  Q++++  +    +L+E++ +H VPF DH+QVQ+R
Sbjct  880   NGVQRRHTSYHLNRQISQFGSKVSCIQQRTMSDSMKSCVLDEVITLHDVPFGDHFQVQVR  939

Query  2786  YKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGREV  2953
              ++E+ S           VGV W KNT+ + +ITKN+    ++ ++E++    +EV
Sbjct  940   REIETTSTNPPQSFVKASVGVSWHKNTEFKKKITKNVHDHMAKEIREVMNVCVKEV  995



>ref|XP_010041254.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Eucalyptus grandis]
Length=761

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/551 (54%), Positives = 401/551 (73%), Gaps = 8/551 (1%)
 Frame = +2

Query  431   KSIAGHLEKLFDkneessksneegskkdnsseLSSIP--SDYEDNVQETTRSQTQSFCEA  604
             K+ AG L ++F+K+ ++S               +S P  SD +D+ Q ++     SF E 
Sbjct  185   KTFAGRLAQMFNKSTDTSSVASNKGIDLPELPEASGPESSDSQDDDQFSS----GSFEEL  240

Query  605   IKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQE  784
             IK+++SR +  E P NL GG+LLD    + P + N LLF+ DS F + L++LQGT ++Q 
Sbjct  241   IKIMESREQEGETPSNLPGGVLLDHLCIIAPSELNTLLFSSDSPFFKSLSDLQGTTELQL  300

Query  785   GPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYG  964
             G W ++ +    L RV++Y K ATKL+K+V+ATEEQTYLK DGK +AVL  VSTPDV YG
Sbjct  301   GQWKFE-NGAETLKRVISYIKAATKLIKAVKATEEQTYLKADGKVYAVLASVSTPDVMYG  359

Query  965   STFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFS  1144
             STFK+ELLY I  GP L SGE+S+ LVISW + F ++TMMK +IE G +QGLKDSF +++
Sbjct  360   STFKIELLYCITHGPELPSGEQSSRLVISWRMNFLQNTMMKGMIESGVRQGLKDSFEQYA  419

Query  1145  RFLAQHCKVITSAEVLDNG-HLLATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHI  1321
               L Q  K + S ++  N   +LA+L +E  SD +LA +YF NFTV+ST  + LY  +H+
Sbjct  420   SLLNQTVKPVDSKDIGSNKEQILASLQAEPQSDWKLAVQYFANFTVLSTFVMGLYVLVHL  479

Query  1322  LLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRA  1501
              L+  + + GLEF GLDLPDS+GE+I CG+LVL  E+V   I+ F++AR+++GSDHGV+A
Sbjct  480   WLATPSPIHGLEFVGLDLPDSIGEVIVCGMLVLQAERVLGFISRFMQARMQKGSDHGVKA  539

Query  1502  HGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEP  1681
              GDGW+LTVALIEG+++A++D +   DP+VVFTCNGK+RTSS++ Q  DP WNEI EF+ 
Sbjct  540   QGDGWLLTVALIEGSSIAAVDSSALSDPYVVFTCNGKTRTSSIKFQKTDPLWNEIFEFDA  599

Query  1682  AEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLH  1861
              E+PPSMLDVEVFDFDGPFD+A SLGHAE+NF+++  ++LAD+W+ L GK+AQ+ QSKLH
Sbjct  600   MEDPPSMLDVEVFDFDGPFDEATSLGHAEVNFVRNNISDLADVWVTLHGKLAQACQSKLH  659

Query  1862  LRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSL  2041
             LRIFL+N  G    ++ ++KMEKEVGKK+N+RSP  NS FQK F LPPEEFLINDF+C L
Sbjct  660   LRIFLDNTKGSNVAKEYISKMEKEVGKKINIRSPQTNSAFQKLFALPPEEFLINDFTCHL  719

Query  2042  KRKLPLQGRIF  2074
             KRK+PLQ  +F
Sbjct  720   KRKMPLQRLLF  730



>gb|EEC80948.1| hypothetical protein OsI_23655 [Oryza sativa Indica Group]
Length=950

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/651 (45%), Positives = 415/651 (64%), Gaps = 49/651 (8%)
 Frame = +2

Query  566   ETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRR  745
             E+  S   S  E +K ++S+ +G EMP NL GG+L+D++Y   P + N LLF+ +S F  
Sbjct  267   ESGTSSESSLDELLKTMESKDQGCEMPANLPGGVLIDESYVAAPTELNSLLFSKNSDFWP  326

Query  746   ELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFA  925
              ++ELQGT   Q  PW    +N++CL R +TYTK A+KLVK+V+ATEEQ YLK  G  FA
Sbjct  327   AVSELQGTSGFQIEPWKL-DNNETCLQRTLTYTKAASKLVKAVKATEEQKYLKAAGNSFA  385

Query  926   VLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGG  1105
             V   VSTPDVP G  FK+E+LY I PGP L S E+++HL +SW V F +STMMK +IE G
Sbjct  386   VHSVVSTPDVPCGGCFKIEILYCITPGPSLSSEEQTSHLTVSWRVNFVQSTMMKGMIESG  445

Query  1106  TQQGLKDSFSEFSRFLAQHCKVITSAEVLDNGH-LLATLPSEHPSDLELAREYFCNFTVV  1282
              +QG+ + F+ FS  L+Q  KV  + +   N   +L++L ++  S   L   +  NFT +
Sbjct  446   AKQGMAEGFAHFSEILSQKIKVAEADDANSNKEKILSSLHAQKESGWRLIVRFLFNFTFI  505

Query  1283  STAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVE  1462
              +  +  Y   H+ LS+   + GLE+ G+DLPDS+GE++ C +L+L  + ++ +I  F+ 
Sbjct  506   FSVIIASYVIAHLHLSKPNAMHGLEYFGIDLPDSIGEVVVCAVLILQGQNIFNIIKRFLN  565

Query  1463  ARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQT  1642
             A  ++GSDHGV+AHGDGW++TVALIEGT + + +     D + VFTCN K +TSSV+ QT
Sbjct  566   AWKQKGSDHGVKAHGDGWLMTVALIEGTGITNSNSKELFDMYAVFTCNAKRKTSSVKFQT  625

Query  1643  LDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPL  1822
              +P+WNEI EF+  ++PPS +DV + D +GPFDQ+  +GHAE+NFLK   ++L D+WLPL
Sbjct  626   SEPKWNEIYEFDAMDDPPSRMDVAIHDANGPFDQS-PIGHAEVNFLKSNLSDLTDVWLPL  684

Query  1823  GGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLP  2002
              GK  Q+S  K+HLRIFLNN+ G E + + L KM KEVGKK                   
Sbjct  685   EGKCDQTSNPKIHLRIFLNNSRGTEVVMNYLAKMRKEVGKK-------------------  725

Query  2003  PEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSF  2182
                                 GR+F S RI+GFY+N+FGHKTKFFFLW+D+++I V+PP+ 
Sbjct  726   --------------------GRLFFSPRIIGFYSNIFGHKTKFFFLWDDVDDIQVIPPTL  765

Query  2183  STMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACI  2362
             S +GSPSL IIL K RG +A++GAK  D  GRL + F SFVSF  A R IMA+WK R+  
Sbjct  766   S-IGSPSLTIILRKGRGLEAKHGAKGTDPNGRLKYYFQSFVSFNDAHRIIMAIWKMRSLS  824

Query  2363  PDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVY----SVDLPMNH  2503
             P+Q+  + E++   D   +  EE G+    EDV MS+++    SVD+ M +
Sbjct  825   PEQQGDMIEKES--DTKELQLEEGGTLFTHEDVKMSEIFSSALSVDVQMKY  873



>dbj|BAK04293.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=530

 Score =   543 bits (1399),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 273/533 (51%), Positives = 371/533 (70%), Gaps = 17/533 (3%)
 Frame = +2

Query  923   AVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEG  1102
             AVL  VSTP+VP G+ FKVE+LY I+PG  L S E+++ L ISW + F +STM+K +IE 
Sbjct  1     AVLSSVSTPEVPCGNCFKVEILYCIIPGTPLPSEEQTSQLTISWRLNFVQSTMLKGMIEN  60

Query  1103  GTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNGH-----LLATLPSEHPSDLELAREYFC  1267
             GT+QGL++ +++F+  L++  KV      LD  +     +LA+L +   S+  L   +  
Sbjct  61    GTRQGLREGYAQFTEVLSKKIKV----SELDGANSSKDKILASLQTHEQSNWSLVARFLG  116

Query  1268  NFTVVSTAFLVLYFSIHILLSRSTQL--QGLEFHGLDLPDSVGEIITCGILVLHLEQVYR  1441
             +F  + +  + +Y   H+ L++ +++   GLE+ G+DLPDSVGE+I C IL+L    +++
Sbjct  117   SFAFIFSFTIAVYGIAHLRLAKPSKMVHGGLEYFGIDLPDSVGEVIFCAILILQGRNIFK  176

Query  1442  MIAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRT  1621
             +   F+ A  +RGSDHGV+AHGDGW+LTVALIEG+ +      G  DP+VVF CNGK +T
Sbjct  177   VGQRFLHAWKKRGSDHGVKAHGDGWLLTVALIEGSGIVGAGTPGLADPYVVFMCNGKRKT  236

Query  1622  SSVQLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAEL  1801
             SSV+ QT +P+WNEI EF+  ++PPS LDV V D DGP D   ++   EINF+K+  ++L
Sbjct  237   SSVKFQTSEPKWNEIFEFDAMDDPPSRLDVVVHDSDGPVDD-NTICRTEINFVKNNLSDL  295

Query  1802  ADLWLPLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTF  1981
              D+WLPL G+ AQ S+ KLHLRIFLNN+ G E + + L KM KEVGKK++LRS   NS+F
Sbjct  296   DDMWLPLDGRFAQGSEPKLHLRIFLNNSRGTEVVMNYLEKMGKEVGKKMHLRSAQTNSSF  355

Query  1982  QKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEI  2161
             +K F LPPEEFLI+DF+C LKRK+PLQGR+FLS RI GFY+N+FG KTKFFFLWEDI++I
Sbjct  356   RKLFSLPPEEFLIDDFTCHLKRKMPLQGRLFLSPRITGFYSNIFGRKTKFFFLWEDIDDI  415

Query  2162  NVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMAL  2341
              V+PPS ST+GSPSL+IIL KDRG +AR+GAK+ D +GRL F F +FVSF  A R IMAL
Sbjct  416   QVVPPSLSTVGSPSLMIILQKDRGLEARHGAKTQDPQGRLKFHFQTFVSFNDAHRVIMAL  475

Query  2342  WKTRACIPDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMN  2500
             WK R+   +QK ++ E      E   LP E    L  EDV M +VYS  L ++
Sbjct  476   WKMRSSGLEQKGEMIEP-----EPKQLPCEEVPLLGNEDVKMIEVYSAVLSVD  523



>gb|KDO78669.1| hypothetical protein CISIN_1g001764mg [Citrus sinensis]
Length=955

 Score =   538 bits (1385),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 263/485 (54%), Positives = 340/485 (70%), Gaps = 12/485 (2%)
 Frame = +2

Query  1514  WVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQW------NEILEF  1675
             W+ T   I+G     LD    PD    F   G       +   L  ++       EI E+
Sbjct  473   WLATSTTIQGLEFVGLD---LPDSIGEFIVCGVLVLQGERFLQLISRFMQARKQKEIFEY  529

Query  1676  EPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSK  1855
             +  +EPPSMLDVEV+DFDGPF++A SLGHAEINF+K   ++LAD+W+PL GK+AQ+ QSK
Sbjct  530   DAMDEPPSMLDVEVYDFDGPFNEATSLGHAEINFVKSDISDLADVWIPLQGKLAQACQSK  589

Query  1856  LHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSC  2035
             LHLRIFLNN  G   +++ LTKMEKEVGKK+NLRSP  NS FQK FGLPPEEFLINDF+C
Sbjct  590   LHLRIFLNNTKGSNVVKEYLTKMEKEVGKKINLRSPQTNSAFQKLFGLPPEEFLINDFTC  649

Query  2036  SLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVII  2215
              LKRK+ LQGR+FLS RI+GF+ANLFGHKT FFFLWEDIE+I VLPPS S+MGSP +V+ 
Sbjct  650   HLKRKMLLQGRLFLSARIIGFHANLFGHKTNFFFLWEDIEDIQVLPPSLSSMGSPVIVMT  709

Query  2216  LHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQ  2395
             L + RG DAR+GAK+ DEEGRL F FHSFVS+  A RTIMALWK R+  P+QK QI EE 
Sbjct  710   LRQGRGMDARHGAKTQDEEGRLKFHFHSFVSYNVAHRTIMALWKARSLSPEQKVQIVEES  769

Query  2396  QYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLN  2575
             + K   ++  EE G++L +EDV+MS+VYS  LP+     ME+F GG+LE  VM K+GC++
Sbjct  770   EAK---SLQSEEGGTFLGLEDVTMSEVYSSVLPVPMSFFMELFGGGELERAVMEKAGCVS  826

Query  2576  YVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVP  2755
             Y  SSWE  + DVYER++ Y+ ++ IS +  EVTSTQ+KS   N  GW++ E+M +HGVP
Sbjct  827   YSCSSWESEKLDVYERQIYYRFDKCISRYRGEVTSTQQKSPLPNGNGWLVEEVMTLHGVP  886

Query  2756  FSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIE  2935
               D++ + LRY+VE   +    C   VY+GV WLK+T+ + RITKNIV     R++  + 
Sbjct  887   LGDYFNLHLRYQVEDSPSRPKGCLAQVYLGVAWLKSTRHQKRITKNIVSNLEDRLRVKLS  946

Query  2936  FVGRE  2950
              + +E
Sbjct  947   VIEKE  951


 Score =   307 bits (787),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 153/302 (51%), Positives = 212/302 (70%), Gaps = 2/302 (1%)
 Frame = +2

Query  575   RSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELA  754
             +S + SF EA+K ++ R  G E+P NL GG+L+DQ Y + P+D N LLF+PDS F R  A
Sbjct  224   QSSSASFEEAMKTMEPRDLGSEVPSNLPGGVLVDQMYVIAPQDLNTLLFSPDSNFPRTWA  283

Query  755   ELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLV  934
             E QG  ++Q GPW +++  +S L R VTY K A KL+K+ +  EEQTYLK DGK FA+L 
Sbjct  284   EEQGNTELQIGPWRFENGCES-LKRDVTYIKAANKLIKATKGFEEQTYLKADGKVFAILA  342

Query  935   DVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQ  1114
              VSTP+V YG +FK ELL+ I PGP L SGE+S+HLVISW + F +STMMK +IE G + 
Sbjct  343   SVSTPEVMYGGSFKTELLFCITPGPELSSGEQSSHLVISWRMNFLQSTMMKGMIENGARS  402

Query  1115  GLKDSFSEFSRFLAQHCKVITSAEV-LDNGHLLATLPSEHPSDLELAREYFCNFTVVSTA  1291
              L++++ +F+ FL+Q    + S ++ L+   +LA+L  E  SD +LA  YF NFTVVS+ 
Sbjct  403   ALRETYEQFATFLSQTITPVDSNDMGLNKEQILASLQPEPQSDWKLAVHYFANFTVVSSF  462

Query  1292  FLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARL  1471
             F+ +Y  IHI L+ ST +QGLEF GLDLPDS+GE I CG+LVL  E+  ++I+ F++AR 
Sbjct  463   FMGIYVLIHIWLATSTTIQGLEFVGLDLPDSIGEFIVCGVLVLQGERFLQLISRFMQARK  522

Query  1472  RR  1477
             ++
Sbjct  523   QK  524



>gb|KHN32056.1| C2 and GRAM domain-containing protein, partial [Glycine soja]
Length=718

 Score =   518 bits (1335),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 239/373 (64%), Positives = 300/373 (80%), Gaps = 0/373 (0%)
 Frame = +2

Query  1208  LATLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSV  1387
             LA+L +E  SD  LA +YF NFTV +T F+ LY  +HI L+  + +QGLEF GLDLPDS+
Sbjct  346   LASLHAEPESDWRLAVQYFGNFTVFATVFMGLYVLVHIWLAAPSTIQGLEFGGLDLPDSI  405

Query  1388  GEIITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDP  1567
             GE + C +LVL  E +  +I+ F++AR ++GSDHG++A GDGW+LTVALIEG++LAS+D 
Sbjct  406   GEFVVCAVLVLQGECMLGIISRFIKARAQKGSDHGIKAQGDGWLLTVALIEGSSLASVDS  465

Query  1568  TGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQA  1747
             +G  DP+VVFTCNGK+RTSS++ Q  +  WNEI EF+  ++PPS+LDV V+DFDGPFD+A
Sbjct  466   SGLSDPYVVFTCNGKTRTSSIKFQKSNLTWNEIFEFDAMDDPPSVLDVVVYDFDGPFDEA  525

Query  1748  RSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKME  1927
              SLGHAEINFLK   A+LAD+W+PL GK+A + QSKLHLRIFL+N  G    +D L++ME
Sbjct  526   ASLGHAEINFLKANIADLADIWVPLEGKLALACQSKLHLRIFLDNTRGGNVAKDYLSRME  585

Query  1928  KEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYAN  2107
             KEVGKK+NLRSP  NS FQK FGLPPEEFLINDF+C LKRK+PLQGR+FLS RI+GF+AN
Sbjct  586   KEVGKKINLRSPQANSAFQKLFGLPPEEFLINDFTCHLKRKMPLQGRLFLSARIIGFHAN  645

Query  2108  LFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHF  2287
             LFG+KTKFFFLWEDIE+I V+PP+FS+MGSP +VI L K RG DAR+GAK+ DE+GRL F
Sbjct  646   LFGNKTKFFFLWEDIEDIQVIPPTFSSMGSPIIVITLRKGRGVDARHGAKTQDEQGRLRF  705

Query  2288  CFHSFVSFGGASR  2326
              F SFVSF  A R
Sbjct  706   HFQSFVSFNVAHR  718


 Score = 89.4 bits (220),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 68/117 (58%), Gaps = 1/117 (1%)
 Frame = +2

Query  575  RSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELA  754
            +S  ++F EA++ LQS  +G E+P NL  G+ +DQ Y + P+D N LLF+ DS F + LA
Sbjct  224  QSSNETFEEAMRKLQSADQGSEIPSNLPAGVFIDQQYVIAPEDLNELLFSSDSNFLKSLA  283

Query  755  ELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFA  925
            E+Q   +++ GPW +++D K    R+VTY K  +K          QT    D K+ +
Sbjct  284  EVQSNTELEIGPWKFENDGK-IFKRLVTYVKAPSKPADLYATLLSQTIKPADLKDLS  339



>gb|EEE65563.1| hypothetical protein OsJ_21055 [Oryza sativa Japonica Group]
Length=1018

 Score =   482 bits (1240),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 224/431 (52%), Positives = 301/431 (70%), Gaps = 19/431 (4%)
 Frame = +2

Query  1661  EILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQ  1840
             EI EF+  E+PPS++ + V+DFDGPFD+  SLGHAE+NFLK   +EL+D+W+PL GK+AQ
Sbjct  514   EIFEFDAMEDPPSVMKINVYDFDGPFDEVESLGHAEVNFLKSNLSELSDIWIPLKGKLAQ  573

Query  1841  SSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLI  2020
             + QSKLHLRI LNN+ G E ++D L KMEKEVGKK+ +RSPH NS FQK F LPPEEFLI
Sbjct  574   ACQSKLHLRIILNNSRGTEVMKDYLDKMEKEVGKKIAVRSPHTNSAFQKIFSLPPEEFLI  633

Query  2021  NDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSP  2200
             NDF+C LKRK+  QGR+FLS RI+GFY NLFGHKTKFFFLWEDIE+I V+P +  +MGSP
Sbjct  634   NDFTCHLKRKMLTQGRLFLSPRIIGFYTNLFGHKTKFFFLWEDIEDIQVMPATLYSMGSP  693

Query  2201  SLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQ  2380
             SL+IILHK RG DAR+GAK +D EGRL F F SFVSF  A +TIMALWK R+  P+QK Q
Sbjct  694   SLLIILHKGRGMDARHGAKQLDNEGRLKFHFQSFVSFNVAHKTIMALWKARSLTPEQKVQ  753

Query  2381  IAEEQ-QYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMS  2557
             + EE+ + KD  N    E+ S+L +ED  MS+V+S   P +  +LM +F GG LEH+VM 
Sbjct  754   LVEEESEMKDLQN---NESDSFLGIEDAKMSEVFSSTKPFDVSTLMSIFEGGPLEHQVME  810

Query  2558  KSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIM  2737
             K GC+ Y  S WE +  D Y+R++ YK ++ ++    EV STQ+KS   +  GW++ E+M
Sbjct  811   KIGCMEYSVSPWESVRADAYQRQIHYKFDKRLARHEGEVMSTQQKSPLPDKNGWLVEEVM  870

Query  2738  AIHGVPFSDHYQV---------------QLRYKVESCSAARNSCRCDVYVGVMWLKNTKL  2872
              + G+P  +++ +                +RY++E  S+   +C   V +G+ WLK+ K 
Sbjct  871   TLEGIPVGEYFNILHKIILIVSKFPPKLHMRYQLEQISSKPKACNVQVSIGIAWLKSCKN  930

Query  2873  EDRITKNIVRK  2905
               +I + ++ K
Sbjct  931   RKKIAQELIEK  941


 Score =   299 bits (766),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 152/315 (48%), Positives = 213/315 (68%), Gaps = 2/315 (1%)
 Frame = +2

Query  533   SIPSDYEDNVQETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNM  712
             S  S+  DN Q+     T SF E +K   S  EG E+PENL GG+L+DQ YA+ P D N 
Sbjct  201   STSSELPDN-QDYETGVTMSFDEQLKAFGSCHEGNEIPENLSGGVLIDQVYAVAPSDLNG  259

Query  713   LLFAPDSQFRRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQ  892
             LLF+P S F + LAE+QGT  ++   W  ++D +  L RVV+YTK  T LVK+V+ATE+ 
Sbjct  260   LLFSPSSDFLQSLAEMQGTTGLEIQQWRLENDGE-VLKRVVSYTKAPTALVKAVKATEDV  318

Query  893   TYLKGDGKEFAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCK  1072
             +YLK DG  +A L DVSTPDVP+G++F+VE+L  IMPGP L   E+S+ LV+SW + F +
Sbjct  319   SYLKADGDIYATLADVSTPDVPFGNSFRVEVLTCIMPGPELPDNEKSSRLVVSWRLNFIQ  378

Query  1073  STMMKTVIEGGTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELA  1252
             STMMK +IE G +QGLKD++ +FS  LA++ + + S +      +L+++  E  SD +LA
Sbjct  379   STMMKGMIENGAKQGLKDNYIQFSELLARNIRPVDSKDAAATDKVLSSVQPEQESDWKLA  438

Query  1253  REYFCNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQ  1432
                F NFTVVS+    +Y   HI+L+  + +QGLEF GLDLPDSVGE++ CG+LVL  ++
Sbjct  439   FRIFGNFTVVSSLVAFIYVFSHIILASPSIIQGLEFPGLDLPDSVGEVVVCGVLVLQGQR  498

Query  1433  VYRMIAHFVEARLRR  1477
             V  MIA F++A+ +R
Sbjct  499   VLNMIARFIQAKRQR  513



>gb|EPS61881.1| hypothetical protein M569_12912 [Genlisea aurea]
Length=604

 Score =   454 bits (1167),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 218/455 (48%), Positives = 308/455 (68%), Gaps = 7/455 (2%)
 Frame = +2

Query  593   FCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTK  772
             F E I+ ++++ +  E+P  L GG +++  Y + PK+ N LLF+P+S F R  A++ G+ 
Sbjct  151   FEELIRCMETKEQEDEIPNPLSGGTVVECLYEISPKELNSLLFSPESDFTRSYADMLGST  210

Query  773   DVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPD  952
             D++   W         L R V+YTK A+KLVK+++A+EEQTYLK DG  + +L  VSTPD
Sbjct  211   DLKMDSWKIGD----ALKRTVSYTKPASKLVKALKASEEQTYLKADGSSYVILSTVSTPD  266

Query  953   VPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSF  1132
              P G TF+ E+LY I  GP   SG  S+ LV+SW + F +STM++++IE G +QG+K+SF
Sbjct  267   APCGKTFRTEILYLITSGPEQLSGAPSSRLVVSWRINFLQSTMLRSMIENGARQGIKESF  326

Query  1133  SEFSRFLAQHCKVIT---SAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVVSTAFLVL  1303
              ++   L+Q  K +    S    D   LL  + +E  S L+LA EYF N T +S   ++L
Sbjct  327   GQYEILLSQRVKPLDHSHSHSTPDANPLLVAVEAESESILKLAVEYFWNITTISALLMLL  386

Query  1304  YFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVEARLRRGS  1483
             Y   H+ L     L GLEF GLDLPDS+ E+I C  LVL  ++V   I+ F+ ARLR+G 
Sbjct  387   YMLTHMWLVAPNTLNGLEFVGLDLPDSISELIVCLALVLQGKRVLEFISRFMRARLRKGC  446

Query  1484  DHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNE  1663
             D+G++A G GW+LTVALIEG+NLA++D  G  +PFV+FTCNGKSRTSSV+    DP WNE
Sbjct  447   DNGIKAQGTGWLLTVALIEGSNLATIDSNGLSNPFVIFTCNGKSRTSSVKFHRSDPLWNE  506

Query  1664  ILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQS  1843
             I EF+  +EPPS+L+++V  FDG F++A S G+AEINFLK   ++L+D+W+PL G++AQ+
Sbjct  507   IFEFDAMDEPPSILEIQVLGFDGRFNEAPSFGNAEINFLKSNISDLSDIWIPLRGQLAQA  566

Query  1844  SQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKL  1948
               SKLH+RIFLNN  G   ++D L K+EKEVGKK+
Sbjct  567   CHSKLHIRIFLNNTKGTNAVKDYLAKVEKEVGKKV  601



>ref|XP_010102692.1| hypothetical protein L484_002066 [Morus notabilis]
 gb|EXB93910.1| hypothetical protein L484_002066 [Morus notabilis]
Length=309

 Score =   404 bits (1038),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 185/303 (61%), Positives = 235/303 (78%), Gaps = 0/303 (0%)
 Frame = +2

Query  2057  LQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDRGT  2236
             +QGR+FLS RIVGFYANLFGHKTKFFFLWEDIE+I VLPP+FS++GSP LVIIL KDRG 
Sbjct  1     MQGRLFLSARIVGFYANLFGHKTKFFFLWEDIEDIQVLPPTFSSVGSPLLVIILKKDRGL  60

Query  2237  DARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKDENN  2416
             DAR  AKS DEEGRL FCF SFVSF  ASRTIMALW+TR    +QK QIAEEQ+ ++E +
Sbjct  61    DARRAAKSQDEEGRLRFCFQSFVSFNVASRTIMALWRTRTLPAEQKPQIAEEQEDQEERS  120

Query  2417  VLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWE  2596
             ++ ++    L  ED  MSKVY  +LP+N  SLMEMF GG LE KVM K GCLNY T++WE
Sbjct  121   IMVDDNEIVLDAEDAKMSKVYGAELPININSLMEMFGGGKLEQKVMVKYGCLNYTTTAWE  180

Query  2597  LIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQV  2776
               + D+ ERR+SYK NR +S+FG EVT TQ+K   AN  GWILNE+MA+H VPFSDH++V
Sbjct  181   AFKDDILERRLSYKFNRHVSVFGGEVTCTQQKFPIANGQGWILNEVMALHDVPFSDHFRV  240

Query  2777  QLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGREVF  2956
              LRY++E  + + N+C+CDVY+G+ WL+++K + +IT+NI  KF+ RV+E+   V RE+ 
Sbjct  241   HLRYQIEKSAFSHNACKCDVYMGITWLRSSKFQQKITQNITDKFTDRVREIFALVEREIL  300

Query  2957  LSS  2965
             L++
Sbjct  301   LAT  303



>gb|AFW77022.1| hypothetical protein ZEAMMB73_177708 [Zea mays]
Length=615

 Score =   414 bits (1064),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 193/366 (53%), Positives = 268/366 (73%), Gaps = 2/366 (1%)
 Frame = +2

Query  563   QETTRSQTQSFCEAIKLLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFR  742
             Q+   S T +F E +K   S+ EG+EMPENL GG++LDQ YA+ P D N LLF+P S F 
Sbjct  238   QDHDVSATMTFDELLKAFGSQHEGKEMPENLSGGVVLDQVYAVAPSDLNTLLFSPSSDFL  297

Query  743   RELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEF  922
             + LAE+QGT  ++   W  ++D +  L RVV+YTK  TKLVK+V+ATE+ TYLK DG+ F
Sbjct  298   QSLAEIQGTTGLEIQQWRLENDGE-ILRRVVSYTKAPTKLVKAVKATEDMTYLKADGEMF  356

Query  923   AVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEG  1102
             AV  DVSTP+VP+G+TF+VE+L  IMPGP LR  E+S+ L++SW + F +STMMK++IE 
Sbjct  357   AVFADVSTPEVPFGNTFRVEVLTCIMPGPELRGDEKSSRLMVSWHINFVQSTMMKSMIEN  416

Query  1103  GTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNGHLLATLPSEHPSDLELAREYFCNFTVV  1282
             G +QGLKD++ +FS  LA+HC+ + + +   +  +L+++  E  SD +LA   F NF ++
Sbjct  417   GAKQGLKDNYVQFSELLAKHCRPVDTKDTTSSNEVLSSVQPEQESDWKLAFRIFGNFALL  476

Query  1283  STAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGEIITCGILVLHLEQVYRMIAHFVE  1462
             S+ F   Y S HI+L+  + +QGLEF GLDLPDS GE++ CG+LVL  ++V  MIA F++
Sbjct  477   SSVFAFFYVSAHIILASPSIIQGLEFPGLDLPDSAGEVVVCGVLVLQGQRVLNMIARFIQ  536

Query  1463  ARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQT  1642
             A+ +RG DHGV+A GDGW+LTVAL+EGTNLA+   +G+ DP+VVFTCNGK++TSS+   T
Sbjct  537   AKRQRG-DHGVKAQGDGWLLTVALMEGTNLAATKSSGYSDPYVVFTCNGKTKTSSINFHT  595

Query  1643  LDPQWN  1660
             LDPQWN
Sbjct  596   LDPQWN  601



>ref|NP_001062120.2| Os08g0492400 [Oryza sativa Japonica Group]
 dbj|BAF24034.2| Os08g0492400, partial [Oryza sativa Japonica Group]
Length=533

 Score =   384 bits (987),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 193/389 (50%), Positives = 265/389 (68%), Gaps = 16/389 (4%)
 Frame = +2

Query  536   IPSDYEDNVQETTR--------SQTQS------FCEAIKLLQSRTEGREMPENLQGGILL  673
             + +D  ++VQE T         SQT S      F E +K  +S+ +  EMP +LQG IL+
Sbjct  134   VTTDKSEDVQEATTGYEAPATGSQTYSASTDTPFDELLKYFESKHQEVEMPVDLQG-ILV  192

Query  674   DQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEGPWTWKSDNKSCLTRVVTYTKGA  853
             D++Y   P D N  LF+PDS FR+ + ELQG  DV+   W   SD +S L RV+TYT   
Sbjct  193   DKSYITSPSDLNNFLFSPDSNFRQTVVELQGCSDVKMESWKIDSDGES-LKRVITYTTAP  251

Query  854   TKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGSTFKVELLYNIMPGPGLRSGEES  1033
             +KLVK+V+ATEEQ+YLK DG  ++VL+ VSTPDVP G+ F+ E+L+ I+PGP L S + +
Sbjct  252   SKLVKAVKATEEQSYLKADGNGYSVLLSVSTPDVPCGTYFRTEILFRILPGPELDSEQLT  311

Query  1034  THLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRFLAQHCKVITSAEVLDNGHLLA  1213
             +HLVISW + F +STMMK +IE G +QGL+ ++++FS  L+Q  K I      D G +LA
Sbjct  312   SHLVISWRINFLQSTMMKGMIENGAKQGLQQNYAQFSDLLSQKIKPIDVDAGSDKGQVLA  371

Query  1214  TLPSEHPSDLELAREYFCNFTVVSTAFLVLYFSIHILLSRSTQLQGLEFHGLDLPDSVGE  1393
             +L     SD  +A  YFCNF V+ + F+ +Y ++H+ L  S   +GLEF GLDLPDS+ E
Sbjct  372   SLQRGQESDWNIAFLYFCNFGVLCSLFVTIYIAVHVQLRSSGAHKGLEFPGLDLPDSLSE  431

Query  1394  IITCGILVLHLEQVYRMIAHFVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTG  1573
             I+  G+L L L  +Y+ I+ F++AR ++  DHGV+A GDGW+LTVALIEGT LA +D TG
Sbjct  432   IVMGGLLFLQLRHIYKKISCFIQAREQKVGDHGVKAQGDGWLLTVALIEGTKLAPVDATG  491

Query  1574  FPDPFVVFTCNGKSRTSSVQLQTLDPQWN  1660
             F DP+VVFTCNGKS+TSS++ QTL+PQWN
Sbjct  492   FSDPYVVFTCNGKSKTSSIKFQTLEPQWN  520



>dbj|BAD35614.1| C2 domain-containing protein-like [Oryza sativa Japonica Group]
 gb|ACN85157.1| C2 domain-containing protein [Oryza nivara]
Length=354

 Score =   368 bits (944),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 168/347 (48%), Positives = 247/347 (71%), Gaps = 3/347 (1%)
 Frame = +2

Query  1913  LTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIV  2092
             L KM KEVGKK+NLRS   N+ F+K F LPPEEFLI+DF+C LKRK+PLQGR+F S RI+
Sbjct  4     LAKMRKEVGKKINLRSAQTNAAFRKLFNLPPEEFLIDDFTCHLKRKMPLQGRLFFSPRII  63

Query  2093  GFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEE  2272
             GFY+N+FGHKTKFFFLW+D+++I V+PP+ S +GSPSL IIL K RG +A++GAK  D  
Sbjct  64    GFYSNIFGHKTKFFFLWDDVDDIQVIPPTLS-IGSPSLTIILRKGRGLEAKHGAKGTDPN  122

Query  2273  GRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKDENNVLPEETGSYLIV  2452
             GRL + F SFVSF  A R IMA+WK R+  P+Q+  + E++   D   +  EE G+    
Sbjct  123   GRLKYYFQSFVSFNDAHRIIMAIWKMRSLSPEQQGDMIEKES--DTKELQLEEGGTLFTH  180

Query  2453  EDVSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVS  2632
             EDV MS+++S  L ++ +SLMEMF+GG LEH++M K+GC++Y  + WEL+  ++Y+R++S
Sbjct  181   EDVKMSEIFSSALSVDVESLMEMFSGGPLEHRMMQKAGCIDYSPTEWELVSRNIYQRQIS  240

Query  2633  YKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAA  2812
             YK ++ +S +G E T+TQ++    N  GW + E+M++ GV   D + VQ++Y V +  + 
Sbjct  241   YKFDKNLSRYGGEATTTQQRYALVNQEGWAIEEVMSLQGVLLGDCFNVQMKYTVVNVPSK  300

Query  2813  RNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGREV  2953
              N+C   V +G+ WLK+TK + +ITK+++   S R+KE+   V +++
Sbjct  301   PNTCSVQVLLGIAWLKSTKQQKKITKSVISNSSIRLKELFAEVEKDL  347



>gb|EPS58216.1| hypothetical protein M569_16599, partial [Genlisea aurea]
Length=357

 Score =   315 bits (806),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 164/355 (46%), Positives = 229/355 (65%), Gaps = 23/355 (6%)
 Frame = +2

Query  1946  LNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKT  2125
             + LRSP  NS FQK FGLPPEEFLIN+F+C LKRK+PLQGR+FLSTRIVGF+A+LFG KT
Sbjct  1     IKLRSPQTNSAFQKLFGLPPEEFLINNFTCHLKRKMPLQGRLFLSTRIVGFHADLFGRKT  60

Query  2126  KFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFV  2305
              FFFLWEDIE+I+  PP+ S+MG P +++IL   RG DAR+GAK  D EGRL+F FHSFV
Sbjct  61    HFFFLWEDIEDIHATPPTLSSMGIPIIIMILRPGRGFDARHGAKKQDAEGRLNFHFHSFV  120

Query  2306  SFGGASRTIMALWKTRACIPDQKAQIAEEQQYKD--------------ENNVLPEETGSY  2443
             SF  A RTIM LWKTRA IP+QK  + EE + +               ++    E T  +
Sbjct  121   SFNVAKRTIMTLWKTRASIPEQKDAVEEEYEVQSGDDDDDESCEDLDAKSIQTDETTTDF  180

Query  2444  LIVEDVSMSKV--YSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVY  2617
             L  +DV+MS +  ++V LPM    LME+FNGGD+E +VM KSGC++Y    W+ I+  ++
Sbjct  181   LGADDVTMSPLCSFTVSLPMTF--LMELFNGGDIEQRVMEKSGCIDYTHGEWQQID-GIH  237

Query  2618  ERRVSYKLNRLI-SIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKV  2794
             +R+V Y  ++L+      +VTS Q+K+  ++   WI+ E  ++  +P S+   V LRY++
Sbjct  238   QRQVHYTFDKLMRKRCQGQVTSIQQKTPISDARSWIIQEASSLRRIPLSECITVHLRYEM  297

Query  2795  E---SCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGRE  2950
             E   S S  R  C   V +G+ W+K+     ++ K I     +R+K M+  + +E
Sbjct  298   EDLASNSVGRCCCSMKVKLGISWVKHLSHYKKMGKRIKSMMKKRIKVMMRLLEKE  352



>ref|NP_001169856.1| uncharacterized protein LOC100383749 [Zea mays]
 gb|ACN35096.1| unknown [Zea mays]
Length=339

 Score =   310 bits (793),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 155/339 (46%), Positives = 224/339 (66%), Gaps = 7/339 (2%)
 Frame = +2

Query  1946  LNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKT  2125
             + LRSP  N+ FQ+ F LP EEFLI+ F+C LKRKLP QG++FLS R +GFY+++FG KT
Sbjct  1     MTLRSPRTNTAFQELFSLPAEEFLISSFTCYLKRKLPTQGQVFLSPRTIGFYSSMFGRKT  60

Query  2126  KFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFV  2305
             KF+FLWEDIE+I  +P S  +  SPS++I LHK RG D ++GAKS+D  G+L FC  SF 
Sbjct  61    KFYFLWEDIEDIQGIPQS-ISSWSPSIIITLHKGRGMDTKHGAKSMDN-GKLKFCLQSFA  118

Query  2306  SFGGASRTIMALWKTRACIPDQKAQIAEEQQYKDENNVLPEETGSYLIVED---VSMSKV  2476
             SF  A+RTIMALWK R+   + K Q+AEEQ     N +  E++G ++ +ED   + M++V
Sbjct  119   SFSVANRTIMALWKARSLSTELKVQLAEEQ--SQINTLQSEDSGVFVGIEDAKSLQMTEV  176

Query  2477  YSVDLPMNHKSLMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLIS  2656
             +S  +  N  SLME+F GG LE KVM K GC  Y  + WE  +P+ Y+R++ YK ++ +S
Sbjct  177   FSSTISTNMASLMEVFAGGSLEMKVMDKVGCQKYSATQWESDKPNEYQRQIHYKFSKKLS  236

Query  2657  IFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDV  2836
               G EVT TQ+KS+  N  GW++ E+M + GV   D + + ++Y+VE  +  + +    V
Sbjct  237   PVGGEVTGTQQKSLMPNKKGWVIEEVMELQGVLLGDFFTLHIKYQVEDLAPKQRASNVQV  296

Query  2837  YVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFVGREV  2953
              +G+ W K+T+ + RI KN++   S R+KEM     RE+
Sbjct  297   SLGIEWSKSTRHQKRIEKNVLSSSSARLKEMFNLASREL  335



>emb|CDP19011.1| unnamed protein product [Coffea canephora]
Length=393

 Score =   263 bits (671),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 153/195 (78%), Gaps = 0/195 (0%)
 Frame = +2

Query  611   LLQSRTEGREMPENLQGGILLDQTYALPPKDFNMLLFAPDSQFRRELAELQGTKDVQEGP  790
             +L+   + +++P+NL+GG LLDQ YA+PPKD NMLLF P SQ  R+LAELQGT DVQEGP
Sbjct  1     MLKLSNDEKDIPKNLEGGNLLDQPYAMPPKDLNMLLFTPKSQLMRDLAELQGTTDVQEGP  60

Query  791   WTWKSDNKSCLTRVVTYTKGATKLVKSVQATEEQTYLKGDGKEFAVLVDVSTPDVPYGST  970
             WT KS +KSCL RV+TYTK  TKLVK+V+ATEEQTY+K +GKEF V VDV+TP+VPYG+T
Sbjct  61    WTRKSADKSCLVRVITYTKAVTKLVKAVKATEEQTYIKANGKEFIVFVDVNTPEVPYGNT  120

Query  971   FKVELLYNIMPGPGLRSGEESTHLVISWAVKFCKSTMMKTVIEGGTQQGLKDSFSEFSRF  1150
             FKV+LLY I PGP L   E+S HLV+SWA+ F ++TMMK +IEGG +QGLK+SF + S  
Sbjct  121   FKVDLLYKITPGPKLSCTEKSAHLVVSWAINFHQNTMMKGMIEGGARQGLKESFEQLSDL  180

Query  1151  LAQHCKVITSAEVLD  1195
             LA+  KVI    V D
Sbjct  181   LAKILKVINPINVSD  195


 Score =   219 bits (558),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 131/179 (73%), Gaps = 8/179 (4%)
 Frame = +2

Query  1871  FLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDFSCSLKRK  2050
             FL+N NG +TIRD L K+EKEVGKKLNL+SPHRNS FQK  GLPP+EFLI+DFS SLKRK
Sbjct  223   FLDNTNGAKTIRDYLNKIEKEVGKKLNLQSPHRNSAFQKISGLPPKEFLISDFSRSLKRK  282

Query  2051  LPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVIILHKDR  2230
             +PLQG++FLS RIVGFYANLFGHK KFF  WE+IE I+ L PS  T+ SPSLVIIL   R
Sbjct  283   MPLQGQLFLSARIVGFYANLFGHKPKFFIPWENIEHIHELFPSLGTVESPSLVIILSMGR  342

Query  2231  GTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIAEEQQYKD  2407
             G D R  A  +       F F  F+    A+RT+M +W  R   PDQ+AQIAEEQQ +D
Sbjct  343   GNDTRRQAAFL-------FSFIHFLQL-NANRTVMVVWTKRKLGPDQRAQIAEEQQDRD  393



>gb|AFW66425.1| hypothetical protein ZEAMMB73_887274 [Zea mays]
Length=563

 Score =   219 bits (559),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 136/372 (37%), Positives = 194/372 (52%), Gaps = 73/372 (20%)
 Frame = +2

Query  1847  QSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIND  2026
             ++KLHLRIFLNN+ G   + + L+KMEKEVGKK+ LRSP  N+ FQ+ F LP EEFLI+ 
Sbjct  258   RTKLHLRIFLNNSKGTGMVTEYLSKMEKEVGKKMTLRSPRTNTAFQELFSLPAEEFLISS  317

Query  2027  FSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSL  2206
             F+C LKRKLP QG                                    P   +  SPS+
Sbjct  318   FTCYLKRKLPTQG-----------------------------------IPQSISSWSPSI  342

Query  2207  VIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQIA  2386
             +I LHK RG DA++GAKS+D  G+L FC  SF SF  A+RTIMALWK R+   + K Q+A
Sbjct  343   IITLHKGRGMDAKHGAKSMDN-GKLKFCLQSFASFSVANRTIMALWKARSLSTELKVQLA  401

Query  2387  EEQQYKDENNVLPEETGSYLIVED---VSMSKVYSVDLPMNHKSLMEMFNGGDLEHKVMS  2557
             +EQ     N +  E++G ++ +ED   + M++V+S  +  N  SLME+F GG LE K   
Sbjct  402   KEQS--QINTLQSEDSGVFVGIEDAKSLQMTEVFSSTISTNMASLMEVFLGGSLEMK---  456

Query  2558  KSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHANDAGWILNEIM  2737
                      S W   + +                          KS+  N  GW++ E+M
Sbjct  457   -----QEAVSRWRRSDRNPV------------------------KSLMPNKKGWVIEEVM  487

Query  2738  AIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQR  2917
              + GV   D + + ++Y+VE  +  + +    V +GV W K ++ + RI KN++   S R
Sbjct  488   ELQGVLLGDFFTLHIKYQVEDLAPKKRASNVQVSLGVEWSKTSRHQKRIEKNVLSNSSAR  547

Query  2918  VKEMIEFVGREV  2953
             +KEM     RE+
Sbjct  548   LKEMFNLALREL  559



>ref|XP_004159121.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Cucumis sativus]
Length=210

 Score =   171 bits (434),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/208 (43%), Positives = 130/208 (63%), Gaps = 4/208 (2%)
 Frame = +2

Query  2333  MALWKTRACIPDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSL  2512
             MALWK R+  P+QK +I EE+  + +  +  EE+GS+L   +VSMS+V S  L +     
Sbjct  1     MALWKARSLSPEQKVRIVEEES-EAKGCLQTEESGSFLGPSEVSMSEVLSTTLSVPTNFA  59

Query  2513  MEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRK  2692
             ME+FNG DLE KVM K+GCLNY  + WE  + +VYER++ Y  ++ IS + VEVTSTQ++
Sbjct  60    MELFNGADLERKVMEKAGCLNYSFTPWESEKENVYERQIYYIFDKRISHYRVEVTSTQQR  119

Query  2693  SVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYV--GVMWLKNT  2866
                 N  GW++ E++ +HGVP  D++ V LRY++E   +    C C V V  G+ W K+T
Sbjct  120   HSLPNKNGWLVEEVLTLHGVPLGDYFNVHLRYQIEDLPSKLKGC-CSVVVSFGMAWQKST  178

Query  2867  KLEDRITKNIVRKFSQRVKEMIEFVGRE  2950
             K + R+TKNI++    R+K     V  E
Sbjct  179   KHQKRMTKNILKNLHDRLKATFGLVENE  206



>gb|EEC83135.1| hypothetical protein OsI_28316 [Oryza sativa Indica Group]
Length=213

 Score =   164 bits (416),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 130/201 (65%), Gaps = 4/201 (2%)
 Frame = +2

Query  2351  RACIPDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNG  2530
             R+  P+QK ++ ++     E   LP E GS L  EDV MS+VYS  L ++  SLM+MF+G
Sbjct  2     RSVDPEQKGEMIDK---NSELKQLPCEEGSLLANEDVKMSEVYSAVLSVDINSLMDMFSG  58

Query  2531  GDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQRKSVHAND  2710
             G LEHKVM K+GC++Y  + WEL+  ++Y+R++S+K ++++S FG E  +TQRK   AN 
Sbjct  59    GPLEHKVMQKAGCVDYSPTEWELLNQNIYQRQISFKFDKILSRFG-EALTTQRKYNLANR  117

Query  2711  AGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRITK  2890
              GW++ E+M + GV   D+  +QL+Y++ S S   ++C   V +G+ WLK  K + ++ K
Sbjct  118   DGWVIEEVMTLQGVQHEDYSSIQLKYQMTSTSLKPSTCSIQVLLGIAWLKGAKQQKKVVK  177

Query  2891  NIVRKFSQRVKEMIEFVGREV  2953
             N++   + R++E+   V +E+
Sbjct  178   NVMSNSANRLREIFSEVEKEL  198



>gb|EEC80958.1| hypothetical protein OsI_23674 [Oryza sativa Indica Group]
Length=913

 Score =   176 bits (445),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 137/208 (66%), Gaps = 2/208 (1%)
 Frame = +2

Query  2330  IMALWKTRACIPDQKAQIAEEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKS  2509
             IMA+WK R+  P+Q+  + E++   D   +  EE G+    EDV MS+++S  L ++ +S
Sbjct  686   IMAIWKMRSLSPEQQGDMIEKES--DTKELQLEEGGTLFTHEDVKMSEIFSSALSVDVES  743

Query  2510  LMEMFNGGDLEHKVMSKSGCLNYVTSSWELIEPDVYERRVSYKLNRLISIFGVEVTSTQR  2689
             LMEMF+GG LEH++M K+GC++Y  + WEL+  ++Y+R++SYK ++ +S +G E T+TQ+
Sbjct  744   LMEMFSGGPLEHRMMQKAGCIDYSPTEWELVSRNIYQRQISYKFDKNLSRYGGEATTTQQ  803

Query  2690  KSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTK  2869
             +    N  GW + E+M++ GV   D + VQ++Y V +  +  N+C   V +G+ WLK+TK
Sbjct  804   RYALVNQEGWAIEEVMSLQGVLLGDCFNVQMKYTVVNVPSKPNTCSVQVLLGIAWLKSTK  863

Query  2870  LEDRITKNIVRKFSQRVKEMIEFVGREV  2953
              + +ITK+++   S R+KE+   V +++
Sbjct  864   QQKKITKSVISNSSIRLKELFAEVEKDL  891



>gb|AFW66424.1| hypothetical protein ZEAMMB73_887274 [Zea mays]
Length=353

 Score =   133 bits (334),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 83/107 (78%), Gaps = 4/107 (4%)
 Frame = +2

Query  1826  GKIAQSS----QSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTF  1993
             G++A++     ++KLHLRIFLNN+ G   + + L+KMEKEVGKK+ LRSP  N+ FQ+ F
Sbjct  247   GELARAQHTNHRTKLHLRIFLNNSKGTGMVTEYLSKMEKEVGKKMTLRSPRTNTAFQELF  306

Query  1994  GLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFF  2134
              LP EEFLI+ F+C LKRKLP QG++FLS R +GFY+++FG KTKF+
Sbjct  307   SLPAEEFLISSFTCYLKRKLPTQGQVFLSPRTIGFYSSMFGRKTKFY  353



>ref|XP_009757623.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Nicotiana sylvestris]
Length=579

 Score =   120 bits (300),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 124/524 (24%), Positives = 230/524 (44%), Gaps = 52/524 (10%)
 Frame = +2

Query  1457  VEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQL  1636
             VE + + G   G       +++ V L+   NL + +  G  DP+V+ TC  + R SS+  
Sbjct  56    VEDKQKMGQLKGDPQTNSAYIIKVELLAAKNLIAANLNGTSDPYVIITCGTQKRFSSMIP  115

Query  1637  QTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWL  1816
              + +P W E   F   +E P+ ++V ++D+D  +  A  LG   +        +   +W 
Sbjct  116   GSRNPMWGEEFNFS-VDELPAEINVTIYDWDIIWKSA-VLGSVTVPV--ENEGQTGAVWY  171

Query  1817  PLGGKIAQSSQSKLHLR-IFLNNN-----NGVETIRDNLTKMEKEVGKKLNLRSPHRNST  1978
              L    + S Q  LH++ + LN N     NG +  R  +  ++KE G  +  + P     
Sbjct  172   TLD---STSGQVCLHIKTVKLNINSSRGLNGCDNTRRRIA-LDKE-GPTVVHQKP---GP  223

Query  1979  FQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEE  2158
              Q  FGLP +E + + +SC+L+R     GR+++S+  + F++N+F  + K      DI+E
Sbjct  224   LQTIFGLPADEVVEHSYSCALERSFLYHGRMYVSSWHICFHSNVFSKQMKVVIPLGDIDE  283

Query  2159  INVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSI-DEEGRLHFCFHSFVSFGGASRTIM  2335
             I     +F    +P++ IIL    G    +G   + + +GR+ + F SF +   A R + 
Sbjct  284   IRRSQHAFI---NPAITIILRTGAGG---HGVPPLGNPDGRVRYMFASFWNRNHAIRALQ  337

Query  2336  -------ALWKTRACIPDQKAQIAEEQQYKD--------ENNVLPEETGSYLIVEDVSMS  2470
                    A+ +      +Q A  A     K         + NV   E     I E+V +S
Sbjct  338   RSATDYHAMLEAEKKEREQSALRAHSSSVKGSKKMDMSRKENVSKTEKSQPFIKEEV-LS  396

Query  2471  KVYSVDLPMNHKSLMEMF--NGGD--LEHKVMSKSGCLNYVTSSWELI-EPDVYERRVSY  2635
              +Y+   P   + + ++   +G +  +E++   K   +N     W    E D   R +++
Sbjct  397   GIYNDIFPCTPQQVFDLLLADGSNYTIEYRTARKDSNIN--IGQWHSADEYDGQVREITF  454

Query  2636  K--LNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSA  2809
             +   N  +      +T  Q   +  +    +   +   H VPF   ++V  R+ +E+ S 
Sbjct  455   RTICNSPMCPPDSAMTEYQHAVLSPDKNMLVFETVQQAHDVPFGSCFEVHCRWSLEASS-  513

Query  2810  ARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFV  2941
               +SC  D+ VG  + K   ++ +I    V ++ + V  MI+  
Sbjct  514   -ESSCVLDIKVGAHFKKWCIMQSKIKAGAVDEYKKEVSTMIQMA  556



>emb|CDP10870.1| unnamed protein product [Coffea canephora]
Length=579

 Score =   119 bits (298),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 117/501 (23%), Positives = 210/501 (42%), Gaps = 48/501 (10%)
 Frame = +2

Query  1511  GWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEE  1690
              +++ V L+   NL   +  G  DP+ + TC  + R SS+   + +P W E   F P +E
Sbjct  72    AYMIKVELLAAKNLIGANLNGTSDPYAIITCGREKRFSSMVPGSRNPMWGEEFNF-PVDE  130

Query  1691  PPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRI  1870
              P+ ++V ++D+D  +  A  LG   I     T  +   LW  L    + S Q  LH++ 
Sbjct  131   LPAEINVTIYDWDIIWKSA-VLGSVTIPV--ETEGQTGALWYSLD---STSGQVCLHIKT  184

Query  1871  F---------LNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLIN  2023
                       LN   G    R  L K    V  +       R    Q  FGL P+E + +
Sbjct  185   IRLLINSPRELNGFAGANARRRTLDKQGPTVVHQ-------RPGPLQTIFGLLPDEVVEH  237

Query  2024  DFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPS  2203
              +SC+L+R     GR+++S   + F++N+F  + K    + DI+EI     S   + +P+
Sbjct  238   SYSCALERSFLYHGRMYVSAWHICFHSNVFSKQIKVIIPFGDIDEIKR---SQHAVINPA  294

Query  2204  LVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKTRACIPDQKAQI  2383
             + I+L    G        S D  GR+ + F SF +   A R +    K    + + + + 
Sbjct  295   ITIVLRMGAGGHGVPPLGSPD--GRVRYKFASFWNRNHALRGLQRSAKNYHTMLESEKKE  352

Query  2384  AEEQQY----------KDENNVLPEETGSY--LIVEDVSMSKVYSVDLPMNHKSLMEMF-  2524
              E+             K ++ V  E    +   I EDV +S +YS   P   +   E+  
Sbjct  353   KEQSALRAHSSSIRGSKRQDKVPKESVAKFQPFIREDV-LSSIYSDTFPCTAEQFFELLL  411

Query  2525  -NGGDLEHKVMSKSGCLNYVTSSWELI-EPDVYERRVSYK--LNRLISIFGVEVTSTQRK  2692
              +G    ++  +     N     W    E D   R ++ +   N  +      +T  Q  
Sbjct  412   NDGSTFTNEYRAVRKDTNLSMGPWHAADEYDGQVREITLRSLCNSPMCPPDTAMTEWQHA  471

Query  2693  SVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKL  2872
              + A+    +   +   H VPF  +++V  R+ +++ S +  SC  D+ VG  + K   +
Sbjct  472   VLSADKKMLVFETVQQAHDVPFGSYFEVHCRWSLDTKSDS--SCIMDIKVGAHFKKWCVM  529

Query  2873  EDRITKNIVRKFSQRVKEMIE  2935
             + +I    + ++ + V  M++
Sbjct  530   QSKIKAGAINEYKKEVDIMLD  550



>ref|XP_004294667.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Fragaria vesca subsp. vesca]
Length=584

 Score =   117 bits (292),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 116/512 (23%), Positives = 217/512 (42%), Gaps = 47/512 (9%)
 Frame = +2

Query  1490  GVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEIL  1669
             G   +   +++ V L+   NL   +  G  DP+ + TC  + R SS+   + +P W E  
Sbjct  67    GDAQNNSAYLIKVELLAAKNLIGANLNGTSDPYAIITCGTEKRFSSMVPGSRNPMWGEEF  126

Query  1670  EFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQ  1849
              F   +E P  ++V ++D+D  +  A  LG   +     +  +   LW  L    + S Q
Sbjct  127   NFS-VDELPVQINVTIYDWDIIWKSA-VLGSVTVPV--ESEGQTGALWYTLN---SPSGQ  179

Query  1850  SKLHLRIF-----------LNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFG  1996
               LH++             +N   G    R  +   +KE G  +  + P      Q  F 
Sbjct  180   VCLHIKTIRLPITSPSGRVVNGYAGANGPRRRIPS-DKE-GPTVVHQKP---GPLQTIFD  234

Query  1997  LPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPP  2176
             L P+E   N +SC+L+R     GR+++S   + F++N+F  + K      DI+EI     
Sbjct  235   LLPDELAENSYSCALERSFLYHGRMYVSAWHICFHSNVFSKQMKVLIPVGDIDEIRRTQH  294

Query  2177  SFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKT-R  2353
             +F    +P++ IIL    G        S D  GR+ + F SF +   A R +    K   
Sbjct  295   AFI---NPAVTIILRMGAGGHGVPPLGSPD--GRVRYKFASFWNRNHAFRALQRARKNYH  349

Query  2354  ACIPDQKAQIAE------EQQYKDENNVLPEE----TGSY-LIVEDVSMSKVYSVDLPMN  2500
             A +  +K + AE          +    ++PE+    TG     ++D +++ +++   P  
Sbjct  350   AMLEAEKKEKAESALRAHSSSIRGSQTMIPEDIIPNTGKLQAFIKDEALNSIFNDAFPCT  409

Query  2501  HKSLMEMF--NGGDLEHKVMSKSGCLNYVTSSWELI-EPDVYERRVSYK--LNRLISIFG  2665
              ++   +   +  +  ++  S     N V   W    E D   R ++++   N  +    
Sbjct  410   AENFFNLLLSDNSNFTNEYRSARKDTNLVIGQWHPADEYDGQVRELTFRGLCNSPMCPPD  469

Query  2666  VEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVG  2845
               +T  Q   +  +    +   +   H VPF  ++++  R+K+E  + A NSC  D+ VG
Sbjct  470   TAMTEWQHAVLSPDKDTLVFETVQQAHDVPFGSYFEIHCRWKLE--TNAENSCIIDIKVG  527

Query  2846  VMWLKNTKLEDRITKNIVRKFSQRVKEMIEFV  2941
               + K   ++ +I  + V ++ + V+ M+E  
Sbjct  528   AHFKKWCVMQSKIKSSAVNEYKKEVENMLEIA  559



>gb|AES90265.2| C2 and GRAM domain plant-like protein [Medicago truncatula]
Length=590

 Score =   115 bits (289),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 109/519 (21%), Positives = 215/519 (41%), Gaps = 51/519 (10%)
 Frame = +2

Query  1466  RLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTL  1645
             +++ G   G    G  +++ + L+   NL + +  G  DP+ + TC  + R SS+   + 
Sbjct  66    KVKIGQSRGDSQAGSAYLIKLELLAAKNLIAANLNGTSDPYTIITCGNEKRFSSMVPGSR  125

Query  1646  DPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLG  1825
             +P W E   F   +E P  ++V ++D+D  +  A  LG   +     +  +   +W  L 
Sbjct  126   NPMWGEEFNFS-VDELPVQINVTIYDWDIIWKSA-VLGSVTVPV--ESEGQTGAVWHTLD  181

Query  1826  GKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSP----------HRNS  1975
                + S Q  LH++         E +  N  ++    G     R P           +  
Sbjct  182   ---SPSGQVCLHIK--------TEKMSANSARINGYGGANTRRRIPLEKQEPTVVHQKPG  230

Query  1976  TFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIE  2155
               Q  F L P+E + + +SC+L+R     GR+++ST  + F++N+F  + K    +EDI+
Sbjct  231   PLQTIFELHPDEVVDHSYSCALERSFLYHGRMYVSTWHICFHSNVFSKQMKVLIPFEDID  290

Query  2156  EINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIM  2335
             EI     +F    +P++ IIL    G        S D  GR+ + F SF +   A R++ 
Sbjct  291   EIRRSQHAFI---NPAITIILRMGAGGHGVPPLGSPD--GRVRYKFASFWNRNHAVRSLQ  345

Query  2336  -ALWKTRACIPDQKAQIAEEQQYKDENNV-------------LPEETGSYLIVEDVSMSK  2473
              A+   R  +  +K + AE +     ++V             +P+       +++ ++  
Sbjct  346   RAVKNFREMLETEKKENAESELRAHSSSVRRSNIMDKVPETSMPKAGKRQTFIKEEALVG  405

Query  2474  VYSVDLPMNHKSLMEMFNGGD--LEHKVMSKSGCLNYVTSSWELIEP-DVYERRVSYK--  2638
             +Y+   P   +    +    D     K  S     N V   W   E  D   R ++++  
Sbjct  406   IYNDVFPCTAEQFFNLLLKDDSKFTSKYRSARKDTNLVMGQWHTAEEYDGQVREITFRSL  465

Query  2639  LNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARN  2818
              N  +      +T  Q   + ++    +   +   H VP    ++V  ++ +E  +   +
Sbjct  466   CNSPMCPPDTAITEWQHVVLSSDKKNLVFETVQQAHDVPLGSCFEVHCKWGLE--TTGES  523

Query  2819  SCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIE  2935
             SC  D+ VG  + K   ++ +I    + ++ + V  M++
Sbjct  524   SCTLDIRVGAHFKKWCVMQSKIKSGAINEYKKEVDVMLD  562



>ref|XP_002273984.2| PREDICTED: C2 and GRAM domain-containing protein At1g03370 [Vitis 
vinifera]
 emb|CBI24674.3| unnamed protein product [Vitis vinifera]
Length=588

 Score =   115 bits (288),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 114/523 (22%), Positives = 219/523 (42%), Gaps = 51/523 (10%)
 Frame = +2

Query  1454  FVEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQ  1633
              ++  ++ G   G       +V+ + L+   NL   +  G  DP+ + TC  + R SS+ 
Sbjct  58    LIDDNVKMGQLKGDPQTNSAYVIKLELLAAKNLIGANLNGMSDPYAIITCGEEKRFSSMV  117

Query  1634  LQTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLW  1813
               + +P W E   F   ++ P  ++V ++D+D  + ++  LG   +     T  +   +W
Sbjct  118   PGSRNPMWGEEFNFS-VDDLPVKINVTIYDWDIIW-KSTILGSVTVPV--ETEGQTGAVW  173

Query  1814  LPLGGKIAQSSQSKLHLRIF---------LNNNNGVETIRDNLTKMEKEVGKKLNLRSPH  1966
               L    + S Q  LH++           LN  +G  T R   +  +   G  L  + P 
Sbjct  174   YSLD---STSGQVCLHIKTIKLPVNSSRVLNGYSGANTRRRMSSDKQ---GPTLVHQKP-  226

Query  1967  RNSTFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWE  2146
                  Q  F L P+E + + +SC+L+R     GR+++S   + F++N+F  + K    ++
Sbjct  227   --GPLQTIFNLHPDEVVEHSYSCALERSFLYHGRMYVSGWHICFHSNVFSKQMKVIIPFQ  284

Query  2147  DIEEINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASR  2326
             DI+EI     +F    +P++ IIL    G        S D  GR+ + F SF +   A R
Sbjct  285   DIDEIKRSQHAFI---NPAITIILRMGAGGHGVPPLGSPD--GRVRYKFASFWNRNHALR  339

Query  2327  TIMALWKT-RACIPDQKAQIAEEQ------------QYKDENNVLPEETGSYLIVEDVSM  2467
             T+    K     +  +K + AE +            Q K   + LP        V++ ++
Sbjct  340   TLQRFAKNFHTMLEAEKKENAESELRAHSSSIKGRSQAKISEDSLPTAIEFQPFVKEEAL  399

Query  2468  SKVYSVDLPMNHKSLMEMFNGGDL----EHKVMSKSGCLNYVTSSWELI-EPDVYERRVS  2632
               +Y+   P   +    +    D     E+++  K    N V   W    E D   R ++
Sbjct  400   ISIYNDAFPCTAEQFFNILLHDDSNYINEYRLARKDA--NLVVGQWHATDEYDGQVREIT  457

Query  2633  YK--LNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCS  2806
             ++      +      +T  Q   V  +    +   +   H VPF  H++V  ++++E+ S
Sbjct  458   FRSLCTSPMCPPDTAMTEYQHAVVSPDKKVLVFETVQQAHDVPFGSHFEVHCKWRLETNS  517

Query  2807  AARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIE  2935
                +SC  ++  G  + K   ++ +I    + ++ + V+ M+E
Sbjct  518   --ESSCTMEIKAGAHFKKWCVMQSKIRSGAINEYKKEVETMLE  558



>ref|XP_003608068.1| GRAM domain-containing protein [Medicago truncatula]
Length=582

 Score =   115 bits (288),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 109/519 (21%), Positives = 215/519 (41%), Gaps = 51/519 (10%)
 Frame = +2

Query  1466  RLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTL  1645
             +++ G   G    G  +++ + L+   NL + +  G  DP+ + TC  + R SS+   + 
Sbjct  58    KVKIGQSRGDSQAGSAYLIKLELLAAKNLIAANLNGTSDPYTIITCGNEKRFSSMVPGSR  117

Query  1646  DPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLG  1825
             +P W E   F   +E P  ++V ++D+D  +  A  LG   +     +  +   +W  L 
Sbjct  118   NPMWGEEFNFS-VDELPVQINVTIYDWDIIWKSA-VLGSVTVPV--ESEGQTGAVWHTLD  173

Query  1826  GKIAQSSQSKLHLRIFLNNNNGVETIRDNLTKMEKEVGKKLNLRSP----------HRNS  1975
                + S Q  LH++         E +  N  ++    G     R P           +  
Sbjct  174   ---SPSGQVCLHIK--------TEKMSANSARINGYGGANTRRRIPLEKQEPTVVHQKPG  222

Query  1976  TFQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIE  2155
               Q  F L P+E + + +SC+L+R     GR+++ST  + F++N+F  + K    +EDI+
Sbjct  223   PLQTIFELHPDEVVDHSYSCALERSFLYHGRMYVSTWHICFHSNVFSKQMKVLIPFEDID  282

Query  2156  EINVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIM  2335
             EI     +F    +P++ IIL    G        S D  GR+ + F SF +   A R++ 
Sbjct  283   EIRRSQHAFI---NPAITIILRMGAGGHGVPPLGSPD--GRVRYKFASFWNRNHAVRSLQ  337

Query  2336  -ALWKTRACIPDQKAQIAEEQQYKDENNV-------------LPEETGSYLIVEDVSMSK  2473
              A+   R  +  +K + AE +     ++V             +P+       +++ ++  
Sbjct  338   RAVKNFREMLETEKKENAESELRAHSSSVRRSNIMDKVPETSMPKAGKRQTFIKEEALVG  397

Query  2474  VYSVDLPMNHKSLMEMFNGGD--LEHKVMSKSGCLNYVTSSWELIEP-DVYERRVSYK--  2638
             +Y+   P   +    +    D     K  S     N V   W   E  D   R ++++  
Sbjct  398   IYNDVFPCTAEQFFNLLLKDDSKFTSKYRSARKDTNLVMGQWHTAEEYDGQVREITFRSL  457

Query  2639  LNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARN  2818
              N  +      +T  Q   + ++    +   +   H VP    ++V  ++ +E  +   +
Sbjct  458   CNSPMCPPDTAITEWQHVVLSSDKKNLVFETVQQAHDVPLGSCFEVHCKWGLE--TTGES  515

Query  2819  SCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIE  2935
             SC  D+ VG  + K   ++ +I    + ++ + V  M++
Sbjct  516   SCTLDIRVGAHFKKWCVMQSKIKSGAINEYKKEVDVMLD  554



>ref|XP_008391883.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 isoform 
X1 [Malus domestica]
Length=588

 Score =   115 bits (288),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 107/499 (21%), Positives = 212/499 (42%), Gaps = 36/499 (7%)
 Frame = +2

Query  1511  GWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEE  1690
              +++ + L+   NL   +  G  DP+ + TC  + R SS+   + +P W E   F   +E
Sbjct  76    AYLIKLELLAAKNLIGANLNGTSDPYAMITCGTEKRFSSMVPGSRNPMWGEEFNFS-VDE  134

Query  1691  PPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLR-  1867
              P  ++V ++D+D  + ++  LG   +     T  +   +W  L    + S Q  LH++ 
Sbjct  135   LPVQINVTIYDWDIIW-KSTVLGSVTVPV--ETEGQTGAVWYTLD---SPSGQVCLHIKT  188

Query  1868  IFLNNNNGVETIRDNLTKMEKEVGKKLNLRSP----HRNSTFQKTFGLPPEEFLINDFSC  2035
             I L  N+      +            L+ + P     +    Q  F L P+E + N +SC
Sbjct  189   IKLPVNSPSGRAMNGYAGANARRRVPLDRQGPTVVHQKPGPLQTIFNLLPDEVVENSYSC  248

Query  2036  SLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVII  2215
             +L+R     GR+++ST  + F++N+F  + K    + DI+EI     +F    +P++ II
Sbjct  249   ALERSFLYHGRMYVSTWHICFHSNVFSKQMKVIIPFGDIDEIRRSQHAFI---NPAITII  305

Query  2216  LHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKT-RACIPDQKAQIAEE  2392
             L    G        S D  GR+ + F SF +     R ++ + K     +  +K + AE 
Sbjct  306   LRMGAGGHGVPPLGSPD--GRVRYKFASFWNRNHVFRGLLRVEKNYHTMLEAEKKEKAES  363

Query  2393  -----------QQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDL  2539
                         Q K   N++P+       +++ +++ +Y+   P   +    +    D 
Sbjct  364   ALRAHSSSVKGSQAKIPENIIPKTGKLQAFIKEEAVTSIYTDVFPCTAEKFFNLLLSDDS  423

Query  2540  EH--KVMSKSGCLNYVTSSWELIEP-DVYERRVSYK--LNRLISIFGVEVTSTQRKSVHA  2704
              +  +  S     N V   W   E  D   R ++++   N  +      +T  Q   +  
Sbjct  424   NYLREYRSARKDTNLVIGQWHPAEEYDGQVREITFRCICNSPMCPPDTAMTEWQHAVLSP  483

Query  2705  NDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRI  2884
             +    +   +   H VPF  +++V +R+ +++     NSC  D+ VGV + K   ++ +I
Sbjct  484   DKITLVFETVQQAHDVPFGSYFEVHVRWSLDTID--ENSCNIDIKVGVHFKKWCVMQSKI  541

Query  2885  TKNIVRKFSQRVKEMIEFV  2941
                 + ++ + +  M++  
Sbjct  542   RAGAINEYKREIDLMLDIA  560



>ref|XP_008391885.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 isoform 
X3 [Malus domestica]
Length=586

 Score =   115 bits (288),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 107/499 (21%), Positives = 212/499 (42%), Gaps = 36/499 (7%)
 Frame = +2

Query  1511  GWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEE  1690
              +++ + L+   NL   +  G  DP+ + TC  + R SS+   + +P W E   F   +E
Sbjct  74    AYLIKLELLAAKNLIGANLNGTSDPYAMITCGTEKRFSSMVPGSRNPMWGEEFNFS-VDE  132

Query  1691  PPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLR-  1867
              P  ++V ++D+D  + ++  LG   +     T  +   +W  L    + S Q  LH++ 
Sbjct  133   LPVQINVTIYDWDIIW-KSTVLGSVTVPV--ETEGQTGAVWYTLD---SPSGQVCLHIKT  186

Query  1868  IFLNNNNGVETIRDNLTKMEKEVGKKLNLRSP----HRNSTFQKTFGLPPEEFLINDFSC  2035
             I L  N+      +            L+ + P     +    Q  F L P+E + N +SC
Sbjct  187   IKLPVNSPSGRAMNGYAGANARRRVPLDRQGPTVVHQKPGPLQTIFNLLPDEVVENSYSC  246

Query  2036  SLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLVII  2215
             +L+R     GR+++ST  + F++N+F  + K    + DI+EI     +F    +P++ II
Sbjct  247   ALERSFLYHGRMYVSTWHICFHSNVFSKQMKVIIPFGDIDEIRRSQHAFI---NPAITII  303

Query  2216  LHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKT-RACIPDQKAQIAEE  2392
             L    G        S D  GR+ + F SF +     R ++ + K     +  +K + AE 
Sbjct  304   LRMGAGGHGVPPLGSPD--GRVRYKFASFWNRNHVFRGLLRVEKNYHTMLEAEKKEKAES  361

Query  2393  -----------QQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMFNGGDL  2539
                         Q K   N++P+       +++ +++ +Y+   P   +    +    D 
Sbjct  362   ALRAHSSSVKGSQAKIPENIIPKTGKLQAFIKEEAVTSIYTDVFPCTAEKFFNLLLSDDS  421

Query  2540  EH--KVMSKSGCLNYVTSSWELIEP-DVYERRVSYK--LNRLISIFGVEVTSTQRKSVHA  2704
              +  +  S     N V   W   E  D   R ++++   N  +      +T  Q   +  
Sbjct  422   NYLREYRSARKDTNLVIGQWHPAEEYDGQVREITFRCICNSPMCPPDTAMTEWQHAVLSP  481

Query  2705  NDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKLEDRI  2884
             +    +   +   H VPF  +++V +R+ +++     NSC  D+ VGV + K   ++ +I
Sbjct  482   DKITLVFETVQQAHDVPFGSYFEVHVRWSLDTID--ENSCNIDIKVGVHFKKWCVMQSKI  539

Query  2885  TKNIVRKFSQRVKEMIEFV  2941
                 + ++ + +  M++  
Sbjct  540   RAGAINEYKREIDLMLDIA  558



>ref|XP_009618040.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Nicotiana tomentosiformis]
Length=586

 Score =   115 bits (288),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 124/524 (24%), Positives = 226/524 (43%), Gaps = 52/524 (10%)
 Frame = +2

Query  1457  VEARLRRGSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQL  1636
             VE + + G   G       +++ V L+   NL + +  G  DP+V+ TC  + R SS+  
Sbjct  56    VEDKQKMGQLKGDPQTNSAYIIKVELLAAKNLIAANLNGTSDPYVIITCGTQKRFSSMIP  115

Query  1637  QTLDPQWNEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWL  1816
              + +P W E   F   +E P+ ++V ++D+D  +  A  LG   +        +   +W 
Sbjct  116   GSRNPMWGEEFNFS-VDELPAEINVTIYDWDIIWKSA-VLGSVTVPV--ENEGQTGAVWY  171

Query  1817  PLGGKIAQSSQSKLHLR-IFLNNN-----NGVETIRDNLTKMEKEVGKKLNLRSPHRNST  1978
              L    + S Q  LH++ + LN N     NG    R  +  ++KE G  +  + P     
Sbjct  172   TLD---STSGQVCLHIKTVKLNINSSRGLNGCGNTRRRIA-LDKE-GPTVVHQKP---GP  223

Query  1979  FQKTFGLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEE  2158
              Q  F LP +E + + +SC+L+R     GR+++S+  + F++N+F  + K      DI+E
Sbjct  224   LQTIFDLPADEVVEHSYSCALERSFLYHGRMYVSSWHICFHSNVFSKQMKVVIPLGDIDE  283

Query  2159  INVLPPSFSTMGSPSLVIILHKDRGTDARNGAKSI-DEEGRLHFCFHSFVSFGGASRTIM  2335
             I     +F    +P++ IIL    G    +G   + + +GR+ + F SF +   A R + 
Sbjct  284   IRRSQHAFI---NPAITIILRTGAGG---HGVPPLGNPDGRVRYMFASFWNRNHAIRALQ  337

Query  2336  -------ALWKTRACIPDQKAQIAEEQQYKD--------ENNVLPEETGSYLIVEDVSMS  2470
                    A+ +      +Q A  A     K         + NV   E     I E+V +S
Sbjct  338   RSATDYHAMLEAEKKEREQSALRAHSSSVKGSKKMDMSRKENVSKTEKSQPFIKEEV-LS  396

Query  2471  KVYSVDLPMNHKSLMEMF--NGGDL--EHKVMSKSGCLNYVTSSWELI-EPDVYERRVSY  2635
              +Y+   P   + + ++   +G +   E++   K   LN     W    E D   R +++
Sbjct  397   GIYNDIFPCTPQQVFDLLLADGSNYTNEYRTARKDSNLN--IGQWHSADEYDGQVREITF  454

Query  2636  K--LNRLISIFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSA  2809
             +   N  +      +T  Q   +       +   +   H VPF   ++V  R+ +E+ S 
Sbjct  455   RTICNSPMCPPDSAMTEYQHAVLSPEKNMLVFETVQQAHDVPFGSCFEVHCRWSLEASS-  513

Query  2810  ARNSCRCDVYVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIEFV  2941
               +SC  D+ VG  + K   ++ +I    V ++ + V  MI+  
Sbjct  514   -ESSCVLDIKVGAHFKKWCIMQSKIKAGAVDEYKKEVSTMIQMA  556



>ref|XP_008391884.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 isoform 
X2 [Malus domestica]
Length=586

 Score =   115 bits (287),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 106/504 (21%), Positives = 211/504 (42%), Gaps = 48/504 (10%)
 Frame = +2

Query  1511  GWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEE  1690
              +++ + L+   NL   +  G  DP+ + TC  + R SS+   + +P W E   F   +E
Sbjct  76    AYLIKLELLAAKNLIGANLNGTSDPYAMITCGTEKRFSSMVPGSRNPMWGEEFNFS-VDE  134

Query  1691  PPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRI  1870
              P  ++V ++D+D  + ++  LG   +     T  +   +W  L    + S Q  LH++ 
Sbjct  135   LPVQINVTIYDWDIIW-KSTVLGSVTVPV--ETEGQTGAVWYTLD---SPSGQVCLHIKT  188

Query  1871  FLNNNNGVETIRDNLTKMEKEVGKKLNLRSP----------HRNSTFQKTFGLPPEEFLI  2020
                    ++   ++   M    G     R P           +    Q  F L P+E + 
Sbjct  189   -------IKLPVNSPRAMNGYAGANARRRVPLDRQGPTVVHQKPGPLQTIFNLLPDEVVE  241

Query  2021  NDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSP  2200
             N +SC+L+R     GR+++ST  + F++N+F  + K    + DI+EI     +F    +P
Sbjct  242   NSYSCALERSFLYHGRMYVSTWHICFHSNVFSKQMKVIIPFGDIDEIRRSQHAFI---NP  298

Query  2201  SLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKT-RACIPDQKA  2377
             ++ IIL    G        S D  GR+ + F SF +     R ++ + K     +  +K 
Sbjct  299   AITIILRMGAGGHGVPPLGSPD--GRVRYKFASFWNRNHVFRGLLRVEKNYHTMLEAEKK  356

Query  2378  QIAEE-----------QQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLMEMF  2524
             + AE             Q K   N++P+       +++ +++ +Y+   P   +    + 
Sbjct  357   EKAESALRAHSSSVKGSQAKIPENIIPKTGKLQAFIKEEAVTSIYTDVFPCTAEKFFNLL  416

Query  2525  NGGDLEH--KVMSKSGCLNYVTSSWELIEP-DVYERRVSYK--LNRLISIFGVEVTSTQR  2689
                D  +  +  S     N V   W   E  D   R ++++   N  +      +T  Q 
Sbjct  417   LSDDSNYLREYRSARKDTNLVIGQWHPAEEYDGQVREITFRCICNSPMCPPDTAMTEWQH  476

Query  2690  KSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTK  2869
               +  +    +   +   H VPF  +++V +R+ +++     NSC  D+ VGV + K   
Sbjct  477   AVLSPDKITLVFETVQQAHDVPFGSYFEVHVRWSLDTID--ENSCNIDIKVGVHFKKWCV  534

Query  2870  LEDRITKNIVRKFSQRVKEMIEFV  2941
             ++ +I    + ++ + +  M++  
Sbjct  535   MQSKIRAGAINEYKREIDLMLDIA  558



>ref|XP_004505156.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like 
[Cicer arietinum]
Length=588

 Score =   114 bits (285),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 113/513 (22%), Positives = 215/513 (42%), Gaps = 47/513 (9%)
 Frame = +2

Query  1478  GSDHGVRAHGDGWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQW  1657
             G   G       +++ + L+   NL + +  G  DP+ + TC  + R SS+   + +P W
Sbjct  68    GQSKGDSQASSAYLIKLELLAAKNLIAANLNGTSDPYAIITCGNEKRFSSMVPGSRNPMW  127

Query  1658  NEILEFEPAEEPPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIA  1837
              E   F   +E P  ++V ++D+D  +   +S G   +     +  +   +W  L    +
Sbjct  128   GEEFNFS-VDELPVQINVTIYDWDIIW---KSAGLGSVTVPVESEGQTGAVWHTLD---S  180

Query  1838  QSSQSKLHLRI--------FLNNNNGVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTF  1993
              S Q  LH++          +N   G  T R     +EK+ G  +  + P      Q  F
Sbjct  181   PSGQVCLHIKTKKLSANSARINGYGGANTRR--RIPLEKQ-GPTVVHQKP---GPLQTIF  234

Query  1994  GLPPEEFLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLP  2173
              L P+E + + +SC+L+R     GR+++ST  + F++N+F  + K    +EDI+EI    
Sbjct  235   DLHPDEVVDHSYSCALERSFLYHGRMYVSTWHICFHSNVFSKQMKVIVPFEDIDEIRRSQ  294

Query  2174  PSFSTMGSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKT-  2350
              +F    +P++ IIL    G        S D  GR+ + F SF +   A R +    K  
Sbjct  295   HAFI---NPAITIILRMGAGGHGVPPLGSPD--GRVRYKFASFWNRNHAFRNLQRAAKNF  349

Query  2351  RACIPDQKAQIAEEQQYKDENNV-------------LPEETGSYLIVEDVSMSKVYSVDL  2491
             R  +  +K + AE +     ++V             LP+       +++ ++  +Y+   
Sbjct  350   REMLETEKKENAESELRAHSSSVRRSNIMDKVPEASLPKAGKLQTFIKEEALVGIYNDIF  409

Query  2492  PMNHKSLMEMFNGGD--LEHKVMSKSGCLNYVTSSWELIEP-DVYERRVSYK--LNRLIS  2656
             P   +    +    D     K  S     N V   W   E  D   R ++++   N  + 
Sbjct  410   PCTAEQFFILLLKDDSKFTSKYRSVRKDTNVVMGQWHSAEEYDGQVREITFRSLCNSPMC  469

Query  2657  IFGVEVTSTQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDV  2836
                  +T  Q   + ++    +   +   H VPF  +++V  ++ +E  +   +SC  D+
Sbjct  470   PPDTAMTEWQHVVLSSDKKNLVFETVQQAHDVPFGSYFEVHCKWSME--TTGESSCTLDI  527

Query  2837  YVGVMWLKNTKLEDRITKNIVRKFSQRVKEMIE  2935
              VG  + K   ++ +I    V ++ + V  M++
Sbjct  528   RVGAHFKKWCVMQSKIKSGAVNEYKKEVDVMLD  560



>ref|XP_006583859.1| PREDICTED: C2 and GRAM domain-containing protein At5g50170-like 
isoform X3 [Glycine max]
Length=523

 Score =   113 bits (282),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 113/501 (23%), Positives = 213/501 (43%), Gaps = 44/501 (9%)
 Frame = +2

Query  1511  GWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEE  1690
              +++ + L+   NL   +  G  DP+ + TC  + R SS+   + +P W E   F   +E
Sbjct  13    AYLIKLELLAAKNLVGANLNGTSDPYAIITCGNEKRFSSMVPGSRNPMWGEEFNFS-VDE  71

Query  1691  PPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRI  1870
              P  ++V ++D+D  +  A  LG   +     +  +   +W  L    + S Q  LH++ 
Sbjct  72    LPVQINVTIYDWDIIWKSA-VLGSVTVPV--ESEGQTGAVWHTLD---SPSGQVCLHIKT  125

Query  1871  FLNNNN-------GVETIRDNLTKMEKEVGKKLNLRSPHRNSTFQKTFGLPPEEFLINDF  2029
                + N       G    R  +  +E + G  +  + P      Q  FGL P+E + + +
Sbjct  126   IKLSGNASRINGYGGANPRRRMPPLESQ-GPTVVHQKP---GPLQTIFGLHPDEVVDHSY  181

Query  2030  SCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTMGSPSLV  2209
             SC+L+R     GR+++S   + F++N+F  + K    +EDI+EI     +F    +P++ 
Sbjct  182   SCALERSFLYHGRMYVSAWHICFHSNVFSKQMKVVIPFEDIDEIRRSQHAFI---NPAIT  238

Query  2210  IILHKDRGTDARNGAKSIDEEGRLHFCFHSFVSFGGASRTIMALWKT-RACIPDQKAQIA  2386
             IIL    G        S D  GR+ + F SF +   A R +    K     +  +K + A
Sbjct  239   IILRMGAGGHGVPPLGSPD--GRVRYMFASFWNRNHALRNLQRAAKNFHEMLEAEKKENA  296

Query  2387  EEQQYKDENNV--------LPEE----TGSYL-IVEDVSMSKVYSVDLPMNHKSLMEMF-  2524
             E +     ++V         PEE    TG     V++ ++  +Y+   P   +    +  
Sbjct  297   ESELRAHSSSVRGNKILDKAPEESMPKTGRLQPFVKEEALVGIYNEVFPCTAEQFFNLLL  356

Query  2525  -NGGDLEHKVMSKSGCLNYVTSSWELI-EPDVYERRVSYK--LNRLISIFGVEVTSTQRK  2692
              +G +   K  S     N V   W    E D   R ++++   N  +      +T  Q  
Sbjct  357   NDGSNFTSKYRSVRKDTNLVMGQWHTADEYDGQVREITFRSLCNSPMCPPDTAMTEWQHH  416

Query  2693  SVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLKNTKL  2872
              +  +    +   +   H VPF  +++V  ++ +E+ +    SC  D+ VG  + K   +
Sbjct  417   VLSLDKKNLVFETVQQAHDVPFGSYFEVHCKWSLETINEI--SCTLDIKVGAHFKKWCVM  474

Query  2873  EDRITKNIVRKFSQRVKEMIE  2935
             + +I    V ++ + V  M++
Sbjct  475   QSKIKSGAVNEYKKEVDVMLD  495



>ref|XP_008222498.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 [Prunus 
mume]
Length=587

 Score =   113 bits (282),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 111/515 (22%), Positives = 217/515 (42%), Gaps = 53/515 (10%)
 Frame = +2

Query  1511  GWVLTVALIEGTNLASLDPTGFPDPFVVFTCNGKSRTSSVQLQTLDPQWNEILEFEPAEE  1690
              +++ + L+   NL   +  G  DP+ + TC  + R SS+   + +P W E   F   +E
Sbjct  75    AYLIKLELLAAKNLIGANLNGTSDPYAMITCGTEKRFSSMVPGSRNPMWGEEFNFS-VDE  133

Query  1691  PPSMLDVEVFDFDGPFDQARSLGHAEINFLKHTSAELADLWLPLGGKIAQSSQSKLHLRI  1870
              P  ++V ++D+D  + ++  LG   +     +  +   +W  L    + S Q  LH++ 
Sbjct  134   LPVKINVTIYDWDIIW-KSTVLGSVTVPV--ESEGQTGAVWYTLD---SPSGQVCLHIKT  187

Query  1871  F---LNNNNGVETIRDNLTKMEKEVGKKLNLRSP----------HRNSTFQKTFGLPPEE  2011
                 +N+++G          M    G     R P           +    Q  F L P+E
Sbjct  188   IKLPVNSSSG--------RAMNGYAGANPRRRVPSDKQGPTVVHQKPGPLQTIFNLLPDE  239

Query  2012  FLINDFSCSLKRKLPLQGRIFLSTRIVGFYANLFGHKTKFFFLWEDIEEINVLPPSFSTM  2191
              + + +SC+L+R     GR+++S   + F++N+F  + K    + DI+EI     +F   
Sbjct  240   VVEHSYSCALERSFLYHGRMYVSAWHICFHSNVFSKQMKVIIPFGDIDEIRRSQHAFI--  297

Query  2192  GSPSLVIILHKDRGTDARNGAKSIDEEGRLHFCFHSFV----SFGGASRTIMALWKTRAC  2359
              +P++ IIL    G        S D  GR+ + F SF     +F G  RT          
Sbjct  298   -NPAITIILRMGAGGHGVPPLGSPD--GRVRYKFASFWNRNHAFRGLHRTEKNYHAMLEA  354

Query  2360  IPDQKAQIA--------EEQQYKDENNVLPEETGSYLIVEDVSMSKVYSVDLPMNHKSLM  2515
                +KA  A        +  Q K   +++P+       +++  ++ +Y+   P   +   
Sbjct  355   EKKEKAASALRAHSSSVKGSQAKIPEDIIPKTGKLPAFIKEEVITSIYNDVFPCTAEKFF  414

Query  2516  EMF--NGGDLEHKVMSKSGCLNYVTSSWELI-EPDVYERRVSYK--LNRLISIFGVEVTS  2680
              +   +G +  H+  S     N V   W    E D   R ++++   N  +      +T 
Sbjct  415   NLLLSDGSNYLHEYRSARKDTNLVIGQWHPADEYDGQLREITFRCICNSPMCPPDTAMTE  474

Query  2681  TQRKSVHANDAGWILNEIMAIHGVPFSDHYQVQLRYKVESCSAARNSCRCDVYVGVMWLK  2860
              Q   +  +    +   +   H VPF  +++V +R++++S     NSC  D+ VGV + K
Sbjct  475   WQHAVLSPDKKTLVFETVQQAHDVPFGSYFEVHVRWRLDSND--ENSCTIDIKVGVHFKK  532

Query  2861  NTKLEDRITKNIVRKFSQRVKEMIEFVGREVFLSS  2965
                ++ +I    + ++ + ++ M+E V R   + +
Sbjct  533   WCVMQSKIRAGAINEYKKEIELMLE-VARSYIIKT  566



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 10369907054052