BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19011_g2_i2 len=2006 path=[5505:0-976 6482:977-1019 6525:1020-1161
6667:1162-1579 3522:1580-1604 3547:1605-2005]

Length=2006
                                                                      Score     E

ref|XP_009796688.1|  PREDICTED: 4-coumarate--CoA ligase-like 6 is...    736   0.0      
ref|XP_009618206.1|  PREDICTED: 4-coumarate--CoA ligase-like 6 is...    728   0.0      
ref|XP_006352919.1|  PREDICTED: 4-coumarate--CoA ligase-like 6-like     724   0.0      
ref|XP_004245937.1|  PREDICTED: 4-coumarate--CoA ligase-like 6          719   0.0      
ref|XP_011092586.1|  PREDICTED: 4-coumarate--CoA ligase-like 6          699   0.0      
ref|XP_007040775.1|  Acyl:coa ligase                                    691   0.0      
ref|XP_002270360.1|  PREDICTED: 4-coumarate--CoA ligase-like 6 is...    684   0.0      Vitis vinifera
ref|XP_009796689.1|  PREDICTED: 4-coumarate--CoA ligase-like 6 is...    680   0.0      
ref|XP_009618207.1|  PREDICTED: 4-coumarate--CoA ligase-like 6 is...    676   0.0      
emb|CDP11727.1|  unnamed protein product                                675   0.0      
ref|XP_004301643.1|  PREDICTED: 4-coumarate--CoA ligase-like 6-like     671   0.0      
ref|XP_010054104.1|  PREDICTED: 4-coumarate--CoA ligase-like 6 is...    664   0.0      
ref|XP_010261634.1|  PREDICTED: 4-coumarate--CoA ligase-like 6          660   0.0      
ref|XP_010054103.1|  PREDICTED: 4-coumarate--CoA ligase-like 6 is...    657   0.0      
gb|KHN40402.1|  4-coumarate--CoA ligase-like 6                          656   0.0      
ref|XP_003517649.2|  PREDICTED: 4-coumarate--CoA ligase-like 6-li...    656   0.0      
gb|KCW78478.1|  hypothetical protein EUGRSUZ_D02624                     652   0.0      
ref|XP_006432648.1|  hypothetical protein CICLE_v10000735mg             652   0.0      
ref|XP_009335868.1|  PREDICTED: 4-coumarate--CoA ligase-like 6          650   0.0      
ref|XP_007158204.1|  hypothetical protein PHAVU_002G132900g             650   0.0      
gb|KDO58807.1|  hypothetical protein CISIN_1g037622mg                   649   0.0      
ref|XP_004144410.1|  PREDICTED: 4-coumarate--CoA ligase-like 6-like     647   0.0      
ref|XP_011028085.1|  PREDICTED: 4-coumarate--CoA ligase-like 6          645   0.0      
ref|XP_010518843.1|  PREDICTED: 4-coumarate--CoA ligase-like 6 is...    645   0.0      
gb|AGO89326.1|  Ca4CL9                                                  645   0.0      
gb|AAP03017.1|  4-coumarate-CoA ligase-like protein                     643   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002304364.1|  4-coumarate--CoA ligase family protein             642   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010110411.1|  4-coumarate--CoA ligase-like 6                     642   0.0      
ref|XP_004512448.1|  PREDICTED: 4-coumarate--CoA ligase-like 6-like     641   0.0      
ref|XP_010518842.1|  PREDICTED: 4-coumarate--CoA ligase-like 6 is...    641   0.0      
ref|XP_008241220.1|  PREDICTED: LOW QUALITY PROTEIN: 4-coumarate-...    641   0.0      
ref|NP_193636.1|  4-coumarate--CoA ligase-like 6                        640   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_003612659.1|  4-coumarate-CoA ligase                             640   0.0      
dbj|BAC42032.1|  putative 4-coumarate-CoA ligase                        640   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008791017.1|  PREDICTED: 4-coumarate--CoA ligase-like 6          639   0.0      
ref|XP_008381603.1|  PREDICTED: 4-coumarate--CoA ligase-like 6          639   0.0      
ref|XP_010087995.1|  4-coumarate--CoA ligase-like 6                     638   0.0      
ref|XP_008236197.1|  PREDICTED: 4-coumarate--CoA ligase-like 6          639   0.0      
ref|XP_006414022.1|  hypothetical protein EUTSA_v10024787mg             638   0.0      
ref|XP_007203932.1|  hypothetical protein PRUPE_ppa017093mg             634   0.0      
ref|XP_002304363.1|  hypothetical protein POPTR_0003s09880g             634   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009382607.1|  PREDICTED: 4-coumarate--CoA ligase-like 6          633   0.0      
ref|XP_002867963.1|  hypothetical protein ARALYDRAFT_492955             632   0.0      
ref|XP_006283429.1|  hypothetical protein CARUB_v10004477mg             632   0.0      
emb|CDX78914.1|  BnaA01g09810D                                          630   0.0      
ref|XP_010449426.1|  PREDICTED: 4-coumarate--CoA ligase-like 6          629   0.0      
ref|XP_010439777.1|  PREDICTED: 4-coumarate--CoA ligase-like 6          628   0.0      
ref|XP_009132447.1|  PREDICTED: 4-coumarate--CoA ligase-like 6 is...    628   0.0      
gb|KHG07976.1|  4-coumarate--CoA ligase-like 6                          619   0.0      
ref|XP_003607426.1|  4-coumarate CoA ligase                             617   0.0      
gb|KCW78479.1|  hypothetical protein EUGRSUZ_D02624                     610   0.0      
ref|XP_003612661.1|  4-coumarate CoA ligase                             612   0.0      
gb|KFK28573.1|  hypothetical protein AALP_AA7G013900                    611   0.0      
ref|XP_007199256.1|  hypothetical protein PRUPE_ppa022562mg             607   0.0      
gb|KCW78480.1|  hypothetical protein EUGRSUZ_D02624                     605   0.0      
gb|AGW27199.1|  4-coumarate:coenzyme A ligase 9                         602   0.0      
ref|XP_008460452.1|  PREDICTED: 4-coumarate--CoA ligase-like 6          595   0.0      
ref|XP_010664596.1|  PREDICTED: 4-coumarate--CoA ligase-like 6 is...    592   0.0      
ref|XP_010677414.1|  PREDICTED: 4-coumarate--CoA ligase-like 6          592   0.0      
gb|KHG01780.1|  4-coumarate--CoA ligase-like 6                          590   0.0      
ref|XP_010111547.1|  4-coumarate--CoA ligase-like 6                     587   0.0      
gb|AES89623.2|  acyl:CoA ligase                                         577   0.0      
gb|EPS72162.1|  hypothetical protein M569_02598                         573   0.0      
ref|XP_002519005.1|  AMP dependent CoA ligase, putative                 564   0.0      Ricinus communis
emb|CDX99401.1|  BnaC01g11510D                                          565   0.0      
dbj|BAJ88016.1|  predicted protein                                      551   0.0      
gb|EYU23282.1|  hypothetical protein MIMGU_mgv1a006528mg                540   0.0      
ref|XP_004983523.1|  PREDICTED: 4-coumarate--CoA ligase-like 3-like     539   0.0      
gb|KHG01779.1|  4-coumarate--CoA ligase-like 6                          535   2e-180   
ref|XP_008658826.1|  PREDICTED: 4-coumarate--CoA ligase-like 3          531   5e-178   
ref|XP_002464864.1|  hypothetical protein SORBIDRAFT_01g027820          523   9e-175   Sorghum bicolor [broomcorn]
ref|XP_003574399.1|  PREDICTED: 4-coumarate--CoA ligase-like 3 is...    521   3e-174   
ref|XP_006662642.1|  PREDICTED: 4-coumarate--CoA ligase-like 2-like     514   4e-172   
ref|XP_009132455.1|  PREDICTED: 4-coumarate--CoA ligase-like 6 is...    508   4e-170   
ref|XP_006659822.1|  PREDICTED: 4-coumarate--CoA ligase-like 3-like     505   1e-168   
gb|KDP46675.1|  hypothetical protein JCGZ_12199                         500   5e-168   
ref|XP_006854104.1|  hypothetical protein AMTR_s00048p00141400          500   1e-166   
gb|EAZ05563.1|  hypothetical protein OsI_27777                          502   2e-166   Oryza sativa Indica Group [Indian rice]
ref|NP_001175376.1|  Os08g0143300                                       501   6e-166   
gb|EMS63832.1|  4-coumarate--CoA ligase-like 3                          481   4e-160   
ref|XP_006828979.1|  hypothetical protein AMTR_s00001p00239750          484   4e-160   
ref|XP_010235057.1|  PREDICTED: 4-coumarate--CoA ligase-like 3 is...    481   5e-159   
ref|XP_010235058.1|  PREDICTED: 4-coumarate--CoA ligase-like 3 is...    478   4e-158   
ref|NP_001176290.1|  Os10g0578950                                       477   4e-157   
ref|XP_006828976.1|  hypothetical protein AMTR_s00001p00238960          489   2e-156   
gb|EAZ17097.1|  hypothetical protein OsJ_32596                          474   5e-156   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006572942.1|  PREDICTED: 4-coumarate--CoA ligase-like 6-li...    466   1e-154   
gb|AGA17922.1|  CCL5                                                    454   2e-148   
ref|XP_010063109.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          454   3e-148   
gb|AHM88424.1|  4CL6                                                    451   3e-147   
ref|XP_010905239.1|  PREDICTED: LOW QUALITY PROTEIN: 4-coumarate-...    444   3e-144   
sp|Q336M7.3|4CLL2_ORYSJ  RecName: Full=4-coumarate--CoA ligase-li...    443   2e-143   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006649341.1|  PREDICTED: 4-coumarate--CoA ligase-like 4-like     440   7e-143   
ref|XP_010536451.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          440   8e-143   
ref|XP_010242836.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          440   8e-143   
gb|AIY34663.1|  4-coumarate:CoA ligase-like protein                     439   9e-143   
ref|XP_008452936.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          439   1e-142   
ref|XP_008777804.1|  PREDICTED: LOW QUALITY PROTEIN: 4-coumarate-...    438   3e-142   
dbj|BAJ95119.1|  predicted protein                                      438   4e-142   
ref|XP_010918637.1|  PREDICTED: 4-coumarate--CoA ligase-like 1 is...    437   8e-142   
ref|NP_001142142.1|  putative AMP-dependent synthetase and ligase...    437   8e-142   Zea mays [maize]
ref|XP_002285920.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          436   2e-141   Vitis vinifera
gb|AGO89325.1|  Ca4CL8                                                  436   3e-141   
ref|XP_004145532.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like     435   5e-141   
ref|XP_004985831.1|  PREDICTED: 4-coumarate--CoA ligase-like 4-like     435   5e-141   
emb|CAN74074.1|  hypothetical protein VITISV_000975                     435   6e-141   Vitis vinifera
ref|XP_010692849.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          435   8e-141   
ref|XP_010094597.1|  4-coumarate--CoA ligase-like 5                     435   8e-141   
ref|NP_001048867.1|  Os03g0132000                                       434   1e-140   Oryza sativa Japonica Group [Japonica rice]
gb|KDP36837.1|  hypothetical protein JCGZ_08128                         434   1e-140   
ref|XP_011099557.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          434   2e-140   
ref|XP_010689117.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          432   3e-140   
gb|AGW27194.1|  4-coumarate:coenzyme A ligase 4                         433   4e-140   
gb|KHG05050.1|  4-coumarate--CoA ligase-like 5                          432   7e-140   
emb|CDP07314.1|  unnamed protein product                                431   2e-139   
ref|XP_008808867.1|  PREDICTED: 4-coumarate--CoA ligase-like 1          431   2e-139   
ref|XP_004499325.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like     430   4e-139   
ref|XP_010229245.1|  PREDICTED: 4-coumarate--CoA ligase-like 4          430   4e-139   
gb|EAY79647.1|  hypothetical protein OsI_34791                          426   5e-139   Oryza sativa Indica Group [Indian rice]
ref|XP_006473755.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like     430   5e-139   
ref|XP_010943943.1|  PREDICTED: 4-coumarate--CoA ligase-like 4          430   5e-139   
ref|XP_010539806.1|  PREDICTED: 4-coumarate--CoA ligase-like 5 is...    430   5e-139   
ref|XP_007160602.1|  hypothetical protein PHAVU_001G001300g             430   6e-139   
ref|XP_011034909.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          430   7e-139   
ref|XP_006435318.1|  hypothetical protein CICLE_v10000764mg             429   8e-139   
ref|XP_007017972.1|  OPC-8:0 CoA ligase1 isoform 1                      429   8e-139   
ref|XP_004308531.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like     429   1e-138   
ref|XP_008221158.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          429   2e-138   
ref|XP_007222465.1|  hypothetical protein PRUPE_ppa003506mg             429   2e-138   
ref|XP_002468571.1|  hypothetical protein SORBIDRAFT_01g048200          428   3e-138   Sorghum bicolor [broomcorn]
ref|XP_007010053.1|  Acyl:coa ligase                                    428   4e-138   
ref|XP_004514911.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like     427   5e-138   
ref|XP_008377088.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          428   5e-138   
gb|AIS92507.1|  4-coumarate:CoA ligase 3                                427   6e-138   
ref|XP_010539807.1|  PREDICTED: 4-coumarate--CoA ligase-like 5 is...    426   2e-137   
ref|XP_002893114.1|  opc-8:0 CoA ligase1                                426   2e-137   
gb|AAP03021.1|  4-coumarate-CoA ligase-like protein                     426   2e-137   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010935869.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          426   3e-137   
ref|NP_564115.1|  OPC-8:0 CoA ligase1                                   425   4e-137   Arabidopsis thaliana [mouse-ear cress]
gb|KEH40252.1|  acyl:CoA ligase                                         425   5e-137   
ref|XP_007017973.1|  OPC-8:0 CoA ligase1 isoform 2                      424   6e-137   
gb|EYU17530.1|  hypothetical protein MIMGU_mgv1a003887mg                425   7e-137   
ref|XP_004253129.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          424   7e-137   
ref|XP_002510640.1|  AMP dependent CoA ligase, putative                 424   7e-137   Ricinus communis
ref|XP_004514323.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like     424   1e-136   
ref|XP_008787558.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          424   2e-136   
ref|XP_010267197.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          423   2e-136   
emb|CDY33631.1|  BnaC08g19310D                                          423   3e-136   
emb|CDX96633.1|  BnaA08g21760D                                          423   3e-136   
ref|XP_008387876.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          422   4e-136   
gb|EYU18792.1|  hypothetical protein MIMGU_mgv1a004091mg                422   5e-136   
ref|XP_009110224.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          422   5e-136   
ref|XP_009774473.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          422   7e-136   
gb|EAY88402.1|  hypothetical protein OsI_09863                          422   1e-135   Oryza sativa Indica Group [Indian rice]
ref|XP_009413046.1|  PREDICTED: 4-coumarate--CoA ligase-like 4          421   2e-135   
gb|EMT13889.1|  4-coumarate--CoA ligase-like protein 3                  413   2e-135   
ref|XP_010422413.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          420   3e-135   
ref|XP_002532625.1|  AMP dependent CoA ligase, putative                 421   3e-135   Ricinus communis
ref|XP_006488032.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like     420   3e-135   
ref|XP_006396627.1|  hypothetical protein EUTSA_v10028562mg             419   5e-135   
gb|KFK32221.1|  hypothetical protein AALP_AA6G213500                    419   5e-135   
ref|XP_006424490.1|  hypothetical protein CICLE_v10028138mg             419   5e-135   
gb|KDP45075.1|  hypothetical protein JCGZ_01575                         421   5e-135   
ref|XP_002307770.1|  4-coumarate--CoA ligase family protein             420   5e-135   Populus trichocarpa [western balsam poplar]
gb|AHL44983.1|  4-coumarate:coenzyme A ligase 4                         419   6e-135   
ref|XP_002271586.3|  PREDICTED: 4-coumarate--CoA ligase-like 5          420   6e-135   Vitis vinifera
ref|XP_011041268.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          419   1e-134   
ref|XP_010498483.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          419   1e-134   
ref|XP_010459734.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          419   1e-134   
ref|XP_002276353.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          419   1e-134   Vitis vinifera
ref|XP_006287440.1|  hypothetical protein CARUB_v10000646mg             418   2e-134   
ref|XP_002315339.1|  hypothetical protein POPTR_0010s23680g             419   2e-134   Populus trichocarpa [western balsam poplar]
ref|XP_010455853.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          417   2e-134   
gb|AGO89324.1|  Ca4CL7                                                  418   3e-134   
ref|XP_006396625.1|  hypothetical protein EUTSA_v10028563mg             417   3e-134   
ref|XP_002285921.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          417   3e-134   Vitis vinifera
ref|XP_006416390.1|  hypothetical protein EUTSA_v10007270mg             417   3e-134   
ref|XP_010477286.1|  PREDICTED: 4-coumarate--CoA ligase-like 5 is...    416   1e-133   
emb|CDY31883.1|  BnaC07g15330D                                          416   1e-133   
emb|CBI18880.3|  unnamed protein product                                415   1e-133   
ref|XP_010431672.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          415   2e-133   
ref|XP_010534096.1|  PREDICTED: 4-coumarate--CoA ligase-like 2          416   3e-133   
ref|XP_003545004.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like     415   4e-133   
ref|XP_006303947.1|  hypothetical protein CARUB_v10008763mg             415   4e-133   
ref|XP_011024331.1|  PREDICTED: 4-coumarate--CoA ligase-like 5 is...    415   7e-133   
ref|XP_009334310.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          415   8e-133   
ref|XP_002523698.1|  AMP dependent CoA ligase, putative                 414   9e-133   Ricinus communis
gb|KFK44167.1|  hypothetical protein AALP_AA1G223400                    414   9e-133   
ref|XP_009613176.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          414   1e-132   
ref|XP_006416394.1|  hypothetical protein EUTSA_v10007272mg             414   1e-132   
gb|KFK44161.1|  hypothetical protein AALP_AA1G222800                    412   3e-132   
gb|KHN37880.1|  4-coumarate--CoA ligase-like 5                          413   3e-132   
ref|XP_002872738.1|  hypothetical protein ARALYDRAFT_490166             412   3e-132   
gb|AGW27195.1|  4-coumarate:coenzyme A ligase 5                         412   5e-132   
gb|ADG46006.1|  4-coumarate coenzyme A ligase                           412   6e-132   
ref|XP_003536288.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like     412   9e-132   
ref|XP_009103339.1|  PREDICTED: 4-coumarate--CoA ligase-like 4          410   1e-131   
ref|XP_007219482.1|  hypothetical protein PRUPE_ppa022057mg             411   2e-131   
ref|XP_008232324.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          410   3e-131   
ref|XP_010111818.1|  4-coumarate--CoA ligase-like 7                     413   4e-131   
ref|XP_006843037.1|  hypothetical protein AMTR_s00076p00189570          409   5e-131   
gb|AGW47873.1|  4-coumarate:coenzyme A ligase 8                         409   5e-131   
ref|XP_008787716.1|  PREDICTED: 4-coumarate--CoA ligase-like 5 is...    409   5e-131   
emb|CDY39155.1|  BnaC09g21890D                                          409   9e-131   
gb|ABR17274.1|  unknown                                                 408   1e-130   Picea sitchensis
ref|XP_007132314.1|  hypothetical protein PHAVU_011G084300g             408   2e-130   
ref|XP_003555474.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like     409   2e-130   
ref|NP_192425.1|  4-coumarate--CoA ligase-like 7                        407   2e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006416393.1|  hypothetical protein EUTSA_v10007280mg             407   2e-130   
gb|AAF79611.1|AC027665_12  F5M15.17                                     409   3e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007017971.1|  OPC-8:0 CoA ligase1                                407   3e-130   
ref|XP_010068871.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          408   3e-130   
ref|XP_001761993.1|  predicted protein                                  407   3e-130   
ref|XP_009603383.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          407   3e-130   
gb|EPS70306.1|  hypothetical protein M569_04447                         407   4e-130   
emb|CDY46375.1|  BnaA09g19890D                                          407   4e-130   
ref|XP_011004441.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          406   5e-130   
gb|KHG20084.1|  4-coumarate--CoA ligase-like 5                          407   5e-130   
ref|XP_009114499.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          406   7e-130   
ref|XP_006340129.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like     406   8e-130   
ref|XP_011089239.1|  PREDICTED: LOW QUALITY PROTEIN: 4-coumarate-...    406   8e-130   
emb|CDY01369.1|  BnaA07g11420D                                          406   9e-130   
ref|XP_009361476.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          407   9e-130   
ref|XP_009350226.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          407   9e-130   
ref|NP_173472.1|  AMP-dependent synthetase and ligase family protein    407   9e-130   Arabidopsis thaliana [mouse-ear cress]
gb|KDP43987.1|  hypothetical protein JCGZ_05454                         405   1e-129   
ref|XP_010041733.1|  PREDICTED: 4-coumarate--CoA ligase 1-like          405   1e-129   
ref|XP_008347063.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          406   1e-129   
gb|AAP03016.1|  4-coumarate-CoA ligase-like protein                     406   2e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002982252.1|  hypothetical protein SELMODRAFT_179406             405   2e-129   
ref|XP_010045319.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          405   2e-129   
gb|AIR95612.1|  4-coumarate:CoA ligase-like protein                     404   3e-129   
ref|XP_011021220.1|  PREDICTED: 4-coumarate--CoA ligase-like 7 is...    404   3e-129   
ref|XP_006485343.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like     405   4e-129   
gb|AGO89328.1|  Ca4CL11                                                 404   4e-129   
ref|XP_009346102.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          405   4e-129   
ref|XP_002966178.1|  hypothetical protein SELMODRAFT_143817             404   4e-129   
ref|XP_010090435.1|  4-coumarate--CoA ligase-like 5                     405   5e-129   
ref|XP_010477287.1|  PREDICTED: 4-coumarate--CoA ligase-like 5 is...    404   5e-129   
ref|XP_009346655.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          405   5e-129   
ref|XP_002311981.1|  hypothetical protein POPTR_0008s03140g             404   5e-129   Populus trichocarpa [western balsam poplar]
ref|XP_007208457.1|  hypothetical protein PRUPE_ppa003893mg             404   6e-129   
ref|XP_011031616.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          404   8e-129   
ref|XP_010477284.1|  PREDICTED: 4-coumarate--CoA ligase-like 2 is...    404   8e-129   
ref|XP_010538202.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          404   9e-129   
ref|XP_006342547.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like     404   9e-129   
ref|XP_011021221.1|  PREDICTED: 4-coumarate--CoA ligase-like 7 is...    403   1e-128   
ref|XP_009335967.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          403   1e-128   
ref|XP_002985111.1|  hypothetical protein SELMODRAFT_157069             402   2e-128   
ref|XP_006590186.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like     403   3e-128   
gb|KCW87479.1|  hypothetical protein EUGRSUZ_B03943                     406   3e-128   
ref|XP_010926601.1|  PREDICTED: 4-coumarate--CoA ligase-like 5 is...    402   3e-128   
ref|XP_006373451.1|  4-coumarate--CoA ligase family protein             402   4e-128   
gb|AFD33347.1|  acyl-activating enzyme 3                                402   4e-128   
ref|XP_009786809.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          401   5e-128   
ref|XP_006436540.1|  hypothetical protein CICLE_v10033676mg             402   6e-128   
ref|XP_003627898.1|  4-coumarate-CoA ligase-like protein                402   6e-128   
gb|KEH29989.1|  4-coumarate:CoA ligase-like protein                     401   7e-128   
ref|XP_002519487.1|  AMP dependent CoA ligase, putative                 400   9e-128   Ricinus communis
gb|ABR18186.1|  unknown                                                 400   1e-127   Picea sitchensis
ref|XP_006361720.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like     401   1e-127   
ref|XP_004147290.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like     400   1e-127   
ref|XP_009766303.1|  PREDICTED: 4-coumarate--CoA ligase-like 4          401   2e-127   
gb|KFK44162.1|  hypothetical protein AALP_AA1G222900                    400   2e-127   
ref|XP_010068841.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          399   2e-127   
ref|XP_008357494.1|  PREDICTED: LOW QUALITY PROTEIN: 4-coumarate-...    397   3e-127   
ref|XP_008375641.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          400   3e-127   
emb|CDY46376.1|  BnaA09g19900D                                          399   3e-127   
gb|AGA17924.1|  CCL7                                                    399   5e-127   
ref|XP_004251107.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          399   5e-127   
ref|XP_002979110.1|  hypothetical protein SELMODRAFT_177466             399   6e-127   
ref|XP_006591122.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-li...    399   7e-127   
ref|XP_009110225.1|  PREDICTED: 4-coumarate--CoA ligase-like 8          402   8e-127   
ref|XP_002866551.1|  hypothetical protein ARALYDRAFT_919627             399   8e-127   
ref|XP_009149529.1|  PREDICTED: 4-coumarate--CoA ligase-like 4          398   9e-127   
gb|KEH39397.1|  4-coumarate:CoA ligase-like protein                     398   1e-126   
ref|XP_011087155.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          398   1e-126   
emb|CDY39153.1|  BnaC09g21910D                                          397   1e-126   
ref|XP_002986342.1|  hypothetical protein SELMODRAFT_182368             397   1e-126   
ref|XP_004291645.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like     397   3e-126   
ref|XP_001752801.1|  predicted protein                                  397   3e-126   
ref|XP_007144251.1|  hypothetical protein PHAVU_007G140700g             397   3e-126   
gb|AGA17927.1|  CCL10                                                   396   4e-126   
ref|XP_004250495.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          397   4e-126   
ref|XP_010459729.1|  PREDICTED: 4-coumarate--CoA ligase-like 2          397   5e-126   
ref|XP_002305282.1|  4-coumarate--CoA ligase family protein             395   9e-126   
ref|XP_006591121.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-li...    396   9e-126   
ref|XP_006488030.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like     395   1e-125   
ref|XP_009356915.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          395   1e-125   
ref|XP_010501535.1|  PREDICTED: 4-coumarate--CoA ligase-like 2          395   1e-125   
gb|KHG23973.1|  4-coumarate--CoA ligase-like 7                          396   1e-125   
gb|AGO89327.1|  Ca4CL10                                                 395   2e-125   
ref|XP_002979037.1|  hypothetical protein SELMODRAFT_268211             394   2e-125   
ref|XP_007150153.1|  hypothetical protein PHAVU_005G131400g             394   2e-125   
ref|XP_006851309.1|  hypothetical protein AMTR_s00050p00171700          394   2e-125   
gb|AGW47869.1|  4-coumarate:coenzyme A ligase 4                         394   2e-125   
dbj|BAJ88705.1|  predicted protein                                      395   2e-125   
ref|NP_001243292.1|  4-coumarate--CoA ligase-like 7-like                394   4e-125   
ref|XP_006307145.1|  hypothetical protein CARUB_v10008735mg             394   5e-125   
ref|XP_009402705.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          393   9e-125   
ref|XP_010484070.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          394   1e-124   
emb|CDY33628.1|  BnaC08g19280D                                          393   1e-124   
ref|XP_010918638.1|  PREDICTED: 4-coumarate--CoA ligase-like 1 is...    391   1e-124   
ref|XP_006416396.1|  hypothetical protein EUTSA_v10007285mg             392   2e-124   
ref|XP_009110228.1|  PREDICTED: 4-coumarate--CoA ligase-like 2          392   2e-124   
ref|XP_010460206.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          392   2e-124   
ref|XP_008463063.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          392   3e-124   
ref|XP_006280253.1|  hypothetical protein CARUB_v10026169mg             392   3e-124   
ref|XP_010943942.1|  PREDICTED: LOW QUALITY PROTEIN: 4-coumarate-...    392   4e-124   
ref|XP_010477290.1|  PREDICTED: 4-coumarate--CoA ligase-like 4 is...    392   4e-124   
ref|XP_001759551.1|  predicted protein                                  391   4e-124   
ref|XP_009130250.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          392   4e-124   
ref|XP_009114500.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          391   5e-124   
ref|XP_006351482.1|  PREDICTED: 4-coumarate--CoA ligase-like 9-like     391   5e-124   
ref|XP_004496136.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like     393   7e-124   
ref|XP_009598765.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          391   7e-124   
gb|ABR17473.1|  unknown                                                 391   7e-124   
ref|XP_007016849.1|  AMP-dependent synthetase and ligase family p...    390   7e-124   
ref|XP_004497538.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like     391   8e-124   
ref|XP_010459732.1|  PREDICTED: 4-coumarate--CoA ligase-like 4          390   9e-124   
ref|XP_009359465.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          391   9e-124   
ref|XP_004236342.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          390   9e-124   
ref|XP_008226338.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          390   9e-124   
gb|EPS60018.1|  hypothetical protein M569_14786                         390   9e-124   
ref|XP_002991507.1|  hypothetical protein SELMODRAFT_133629             390   1e-123   
ref|XP_008787715.1|  PREDICTED: 4-coumarate--CoA ligase-like 5 is...    392   1e-123   
ref|XP_002970786.1|  hypothetical protein SELMODRAFT_231716             389   1e-123   
ref|XP_008359628.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          390   1e-123   
ref|XP_009103340.1|  PREDICTED: 4-coumarate--CoA ligase-like 4          390   2e-123   
ref|XP_004487067.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like     389   2e-123   
ref|XP_010498481.1|  PREDICTED: 4-coumarate--CoA ligase-like 8 is...    392   2e-123   
ref|XP_004304462.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like     389   2e-123   
ref|XP_010529378.1|  PREDICTED: LOW QUALITY PROTEIN: 4-coumarate-...    389   3e-123   
ref|XP_009413145.1|  PREDICTED: 4-coumarate--CoA ligase-like 1          389   4e-123   
gb|AIA24410.1|  4-coumarate-CoA ligase                                  388   4e-123   
ref|XP_002456793.1|  hypothetical protein SORBIDRAFT_03g042910          388   7e-123   
gb|AAP03018.1|  4-coumarate-CoA ligase-like protein                     389   8e-123   
ref|NP_173474.5|  4-coumarate--CoA ligase-like 4                        388   9e-123   
gb|KFK44164.1|  hypothetical protein AALP_AA1G223100                    388   1e-122   
emb|CDX96638.1|  BnaA08g21810D                                          387   1e-122   
ref|XP_008384715.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          387   1e-122   
ref|XP_001754050.1|  predicted protein                                  386   2e-122   
ref|XP_010477292.1|  PREDICTED: 4-coumarate--CoA ligase-like 4          387   2e-122   
gb|KFK28050.1|  hypothetical protein AALP_AA8G465100                    387   3e-122   
ref|NP_201143.1|  4-coumarate--CoA ligase-like 9                        387   3e-122   
gb|KEH43325.1|  long-chain acyl-CoA synthetase                          387   3e-122   
gb|KFK44163.1|  hypothetical protein AALP_AA1G223000                    386   3e-122   
emb|CDY01370.1|  BnaA07g11430D                                          385   9e-122   
gb|ACL54157.1|  unknown                                                 382   1e-121   
ref|XP_010534034.1|  PREDICTED: 4-coumarate--CoA ligase-like 4 is...    385   2e-121   
ref|XP_008442710.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          384   3e-121   
ref|XP_007209086.1|  hypothetical protein PRUPE_ppa003658mg             384   4e-121   
ref|XP_010250796.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          384   4e-121   
ref|XP_006488029.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like     384   4e-121   
ref|XP_009110226.1|  PREDICTED: 4-coumarate--CoA ligase-like 8 is...    384   5e-121   
gb|EYU34787.1|  hypothetical protein MIMGU_mgv1a025620mg                383   5e-121   
ref|XP_006307164.1|  hypothetical protein CARUB_v10008755mg             384   6e-121   
emb|CDY31474.1|  BnaC05g15830D                                          384   7e-121   
ref|XP_006440064.1|  hypothetical protein CICLE_v10019547mg             383   9e-121   
ref|XP_010037648.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          383   9e-121   
ref|XP_011087272.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          382   1e-120   
ref|XP_002870867.1|  hypothetical protein ARALYDRAFT_494165             382   1e-120   
gb|KHN21493.1|  4-coumarate--CoA ligase-like 7                          382   2e-120   
ref|XP_008446808.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          382   2e-120   
gb|AAP03015.1|  4-coumarate-CoA ligase-like protein                     382   2e-120   
ref|XP_008239369.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          382   2e-120   
ref|XP_004161266.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like     381   3e-120   
emb|CAN70560.1|  hypothetical protein VITISV_031619                     385   3e-120   
ref|NP_198628.2|  4-coumarate--CoA ligase-like 8                        381   3e-120   
ref|XP_010026707.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          382   3e-120   
ref|XP_003558787.1|  PREDICTED: 4-coumarate--CoA ligase-like 1          381   4e-120   
gb|KGN58984.1|  hypothetical protein Csa_3G740270                       381   4e-120   
ref|XP_004982543.1|  PREDICTED: 4-coumarate--CoA ligase-like 1-like     381   5e-120   
ref|XP_003523137.1|  PREDICTED: 4-coumarate--CoA ligase-like 9-li...    382   5e-120   
emb|CDX96637.1|  BnaA08g21800D                                          381   6e-120   
dbj|BAJ86776.1|  predicted protein                                      381   6e-120   
dbj|BAJ84877.1|  predicted protein                                      382   7e-120   
ref|XP_010037647.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          380   8e-120   
ref|XP_003564855.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          380   2e-119   
gb|ADE77047.1|  unknown                                                 373   2e-119   
ref|XP_007203616.1|  hypothetical protein PRUPE_ppa003871mg             379   2e-119   
ref|XP_008241410.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          380   2e-119   
ref|XP_008672616.1|  PREDICTED: uncharacterized protein LOC100191...    379   2e-119   
ref|XP_006290853.1|  hypothetical protein CARUB_v10016963mg             379   3e-119   
gb|AHL44977.1|  4-coumarate:coenzyme A ligase 4                         379   3e-119   
ref|XP_004169593.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like     379   4e-119   
ref|XP_006304883.1|  hypothetical protein CARUB_v10012648mg             378   1e-118   
ref|XP_004985665.1|  PREDICTED: 4-coumarate--CoA ligase-like 1-li...    377   1e-118   
ref|XP_010498479.1|  PREDICTED: 4-coumarate--CoA ligase-like 8 is...    380   1e-118   
ref|XP_004985664.1|  PREDICTED: 4-coumarate--CoA ligase-like 1-like     378   1e-118   
gb|KDP46323.1|  hypothetical protein JCGZ_10163                         377   1e-118   
ref|XP_010498480.1|  PREDICTED: 4-coumarate--CoA ligase-like 8 is...    380   2e-118   
ref|XP_004982544.1|  PREDICTED: 4-coumarate--CoA ligase-like 1-like     376   3e-118   
ref|XP_010534028.1|  PREDICTED: 4-coumarate--CoA ligase-like 4 is...    377   3e-118   
ref|XP_009401821.1|  PREDICTED: 4-coumarate--CoA ligase-like 1          376   3e-118   
sp|Q3E6Y4.2|4CLL3_ARATH  RecName: Full=4-coumarate--CoA ligase-li...    376   3e-118   
ref|XP_010663724.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          375   6e-118   
ref|XP_004297550.1|  PREDICTED: 4-coumarate--CoA ligase-like 9-like     375   1e-117   
ref|XP_002265545.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          374   2e-117   
ref|XP_007209087.1|  hypothetical protein PRUPE_ppa003674mg             375   2e-117   
ref|XP_008222054.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          374   2e-117   
tpg|DAA50089.1|  TPA: putative AMP-dependent synthetase and ligas...    374   2e-117   
gb|EYU32443.1|  hypothetical protein MIMGU_mgv1a019706mg                374   2e-117   
ref|XP_010536450.1|  PREDICTED: 4-coumarate--CoA ligase-like 4          374   3e-117   
ref|XP_011076955.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          374   4e-117   
ref|XP_002300662.2|  4-coumarate--CoA ligase family protein             372   5e-117   
ref|XP_006476995.1|  PREDICTED: 4-coumarate--CoA ligase-like 9-like     374   5e-117   
emb|CDM84903.1|  unnamed protein product                                373   6e-117   
dbj|BAD82768.1|  putative 4-coumarate:coenzyme A ligase                 373   6e-117   
ref|XP_009149527.1|  PREDICTED: 4-coumarate--CoA ligase-like 2          372   7e-117   
ref|XP_003602078.1|  4-coumarate-coa ligase                             373   9e-117   
ref|XP_011044186.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          372   9e-117   
ref|XP_007027423.1|  AMP-dependent synthetase and ligase family p...    374   1e-116   
gb|AHL44987.1|  4-coumarate:coenzyme A ligase 4                         372   1e-116   
ref|XP_009790448.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          372   1e-116   
emb|CDY29527.1|  BnaA06g14430D                                          371   1e-116   
ref|XP_003638169.1|  4-coumarate-CoA ligase-like protein                380   2e-116   
ref|XP_007223071.1|  hypothetical protein PRUPE_ppa003742mg             372   2e-116   
ref|XP_008392841.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          372   2e-116   
dbj|BAB11279.1|  AMP-binding protein-like                               370   4e-116   
gb|KCW87478.1|  hypothetical protein EUGRSUZ_B03942                     373   5e-116   
ref|XP_006372917.1|  hypothetical protein POPTR_0017s06220g             370   6e-116   
ref|XP_011037054.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          370   6e-116   
ref|XP_004970939.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like     370   1e-115   
ref|XP_011097313.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          369   2e-115   
ref|XP_008346706.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          369   2e-115   
emb|CDY33627.1|  BnaC08g19270D                                          369   2e-115   
emb|CDP06777.1|  unnamed protein product                                368   2e-115   
ref|XP_003602077.1|  4-coumarate-coa ligase                             369   2e-115   
emb|CDY45730.1|  BnaC02g42520D                                          365   3e-115   
ref|XP_010440913.1|  PREDICTED: 4-coumarate--CoA ligase-like 8          369   3e-115   
emb|CDY31472.1|  BnaC05g15810D                                          367   4e-115   
ref|XP_003528115.1|  PREDICTED: 4-coumarate--CoA ligase-like 9-like     370   4e-115   
gb|EYU43067.1|  hypothetical protein MIMGU_mgv1a004025mg                368   5e-115   
gb|KHG15506.1|  4-coumarate--CoA ligase-like 9                          368   5e-115   
ref|XP_008239435.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          368   6e-115   
ref|XP_009595630.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          367   6e-115   
ref|XP_002511221.1|  AMP dependent CoA ligase, putative                 367   7e-115   
ref|XP_002270592.1|  PREDICTED: 4-coumarate--CoA ligase-like 9 is...    367   8e-115   
gb|AID56317.1|  4-coumarate coenzyme A ligase 4                         367   9e-115   
ref|XP_002893113.1|  F5M15.18                                           388   1e-114   
ref|XP_011024332.1|  PREDICTED: 4-coumarate--CoA ligase-like 5 is...    367   1e-114   
ref|XP_004500662.1|  PREDICTED: 4-coumarate--CoA ligase-like 9-li...    366   2e-114   
ref|XP_002270555.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          366   2e-114   
ref|XP_002318708.2|  hypothetical protein POPTR_0012s09650g             365   4e-114   
ref|XP_010101621.1|  4-coumarate--CoA ligase-like 7                     365   4e-114   
ref|XP_011021222.1|  PREDICTED: 4-coumarate--CoA ligase-like 7 is...    364   5e-114   
ref|XP_002509558.1|  AMP dependent CoA ligase, putative                 365   7e-114   
ref|XP_006852174.1|  hypothetical protein AMTR_s00049p00100040          364   1e-113   
ref|XP_009336558.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          364   2e-113   
gb|KGN64389.1|  hypothetical protein Csa_1G050280                       363   3e-113   
gb|KEH42183.1|  4-coumarate:CoA ligase-like protein                     363   3e-113   
gb|KEH42182.1|  4-coumarate:CoA ligase-like protein                     363   3e-113   
ref|XP_011086752.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          363   3e-113   
ref|XP_002985866.1|  hypothetical protein SELMODRAFT_446445             363   4e-113   
ref|XP_007137935.1|  hypothetical protein PHAVU_009G167800g             363   4e-113   
ref|XP_006416397.1|  hypothetical protein EUTSA_v10007257mg             363   4e-113   
ref|XP_010912839.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          362   6e-113   
emb|CDY71478.1|  BnaAnng37600D                                          359   7e-113   
ref|XP_002984802.1|  hypothetical protein SELMODRAFT_181279             361   1e-112   
ref|XP_006476993.1|  PREDICTED: 4-coumarate--CoA ligase-like 9-li...    361   2e-112   
ref|XP_008787718.1|  PREDICTED: 4-coumarate--CoA ligase-like 5 is...    360   2e-112   
gb|AAF79612.1|AC027665_13  F5M15.18                                     380   3e-112   
emb|CAN65888.1|  hypothetical protein VITISV_009068                     361   4e-112   
gb|AGO89329.1|  Ca4CL12                                                 359   5e-112   
gb|ACG28731.1|  4-coumarate--CoA ligase 2                               359   6e-112   
sp|Q0DV32.2|4CLL1_ORYSJ  RecName: Full=4-coumarate--CoA ligase-li...    360   8e-112   
ref|XP_004310199.1|  PREDICTED: 4-coumarate--CoA ligase-like 9-like     358   2e-111   
emb|CDY29526.1|  BnaA06g14440D                                          374   2e-111   
ref|XP_009110227.1|  PREDICTED: 4-coumarate--CoA ligase-like 8 is...    358   3e-111   
ref|XP_008389826.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          357   6e-111   
ref|XP_007031778.1|  AMP-dependent synthetase and ligase family p...    357   8e-111   
ref|XP_009792274.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          355   3e-110   
ref|XP_010045504.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          353   3e-110   
ref|XP_009627505.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          355   4e-110   
gb|KDO45190.1|  hypothetical protein CISIN_1g0410551mg                  354   4e-110   
ref|XP_010037440.1|  PREDICTED: 4-coumarate--CoA ligase-like 9 is...    354   6e-110   
gb|KGN64390.1|  hypothetical protein Csa_1G050290                       355   6e-110   
ref|XP_002514964.1|  AMP dependent CoA ligase, putative                 354   7e-110   
ref|XP_008807546.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          354   9e-110   
ref|XP_010262467.1|  PREDICTED: putative 4-coumarate--CoA ligase-...    353   1e-109   
ref|XP_008361839.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          353   2e-109   
ref|NP_973872.1|  OPC-8:0 CoA ligase1                                   351   2e-109   
ref|XP_008446209.1|  PREDICTED: uncharacterized protein LOC103489008    368   2e-109   
ref|XP_002466906.1|  hypothetical protein SORBIDRAFT_01g016420          353   2e-109   
ref|XP_010926600.1|  PREDICTED: 4-coumarate--CoA ligase-like 5 is...    353   3e-109   
gb|KDP30952.1|  hypothetical protein JCGZ_11328                         353   3e-109   
ref|XP_002988726.1|  hypothetical protein SELMODRAFT_128539             354   4e-109   
ref|XP_002986325.1|  hypothetical protein SELMODRAFT_123905             353   4e-109   
emb|CBI15627.3|  unnamed protein product                                351   5e-109   
gb|EAZ41489.1|  hypothetical protein OsJ_26013                          344   6e-109   
ref|XP_002982349.1|  hypothetical protein SELMODRAFT_116209             351   6e-109   
gb|EYU23108.1|  hypothetical protein MIMGU_mgv1a003608mg                353   6e-109   
ref|XP_007031780.1|  AMP-dependent synthetase and ligase family p...    352   6e-109   
ref|XP_010037442.1|  PREDICTED: 4-coumarate--CoA ligase-like 9 is...    351   2e-108   
gb|AGE10595.1|  4-coumarate CoA ligase                                  350   2e-108   
ref|XP_006651051.1|  PREDICTED: 4-coumarate--CoA ligase-like 1-like     348   6e-108   
ref|XP_011044188.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          349   8e-108   
ref|XP_007037922.1|  AMP-dependent synthetase and ligase family p...    359   8e-108   
ref|XP_002966508.1|  hypothetical protein SELMODRAFT_85691              348   8e-108   



>ref|XP_009796688.1| PREDICTED: 4-coumarate--CoA ligase-like 6 isoform X1 [Nicotiana 
sylvestris]
Length=565

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/545 (69%), Positives = 441/545 (81%), Gaps = 14/545 (3%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             +Y +ETG+Y SKHP + LP DPFLDVVSFI S  H G SAL+DS SG SI Y EL S+V 
Sbjct  28    WYCAETGVYNSKHPFIKLPEDPFLDVVSFIFSHKHAGFSALIDSTSGISIPYSELFSMVK  87

Query  1663  SMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             SMA+ L + GVSQGDV LILLPNSIYFPVI LG+LS+GA+  TMNP S+L EIKKQ+ DC
Sbjct  88    SMASSLRQRGVSQGDVVLILLPNSIYFPVILLGVLSLGAIVTTMNPFSSLLEIKKQALDC  147

Query  1483  NVRLAFATPDRVQNLGSTLGIPVIGLPESL------NLDSPFRKLISSDPKLAPTPRIRQ  1322
              V LAF T D+V  L + LGIPVIG+PESL      +  S F +LIS DP    +P+I Q
Sbjct  148   GVTLAFTTDDKVDKLAA-LGIPVIGVPESLVSNSNSSQSSGFYELISCDPNWDSSPKISQ  206

Query  1321  QDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVY  1142
             QDTAA+L+SSGTTG  K V LTHANFIAMV+LFVRFEASQYEY +T NVYL V+PM+HVY
Sbjct  207   QDTAAILYSSGTTGTGKGVVLTHANFIAMVQLFVRFEASQYEYLSTENVYLAVIPMFHVY  266

Query  1141  GLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK-ADKCG  965
             GLSLFVMGLLSLGSTVVV+RK++ +E+V+AI+RYGVTHFP  PPLL+ALTR+AK      
Sbjct  267   GLSLFVMGLLSLGSTVVVMRKFDANEMVKAIERYGVTHFPTVPPLLMALTRRAKDGASSS  326

Query  964   LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVG  785
             +KSLKQVS GAAP++   I+ FVRT P +D IQGYGMTESTA+GTRG+NT KL NY+SVG
Sbjct  327   MKSLKQVSCGAAPLNTKSIEEFVRTLPDVDLIQGYGMTESTAIGTRGYNTEKLHNYSSVG  386

Query  784   LLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHT  605
             LLAPNM+A+VVD  +G     LPP  MGELWL GP +MKGYLNN EA+K+ +D +GWLHT
Sbjct  387   LLAPNMQAKVVDWITGSP---LPPNCMGELWLCGPGVMKGYLNNSEATKSTIDGNGWLHT  443

Query  604   GDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEI  425
             GDI +FDE+GYLYV DRLKE+IKYKGFQIAPADLEAVL+SHPDIVDAAVT A+ EE GEI
Sbjct  444   GDIAYFDEEGYLYVIDRLKEIIKYKGFQIAPADLEAVLVSHPDIVDAAVTGARDEEAGEI  503

Query  424   PVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNLL  245
             PVAFVVK+ G   +LSQ +VIDFV KQVAPYKK+RRVYF  SIP+SA+GKILRKELRNLL
Sbjct  504   PVAFVVKRDG--CALSQTDVIDFVCKQVAPYKKIRRVYFKASIPRSAAGKILRKELRNLL  561

Query  244   ITSKI  230
              TSK+
Sbjct  562   -TSKL  565



>ref|XP_009618206.1| PREDICTED: 4-coumarate--CoA ligase-like 6 isoform X1 [Nicotiana 
tomentosiformis]
Length=565

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/545 (69%), Positives = 438/545 (80%), Gaps = 14/545 (3%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             +Y +ETG+Y SK+P + LP DPFLDVVSFI S  H G SALVDS SG S+ Y    S+V 
Sbjct  28    WYCAETGVYNSKYPFIKLPEDPFLDVVSFIFSHKHAGFSALVDSTSGISLPYSVFYSMVK  87

Query  1663  SMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             SMA+ LH+ GVS GDV LILLPNSIYFPVI LG+LS+GA+  TMNP S+L EIKKQ+ DC
Sbjct  88    SMASSLHQRGVSPGDVVLILLPNSIYFPVILLGVLSLGAIVTTMNPFSSLLEIKKQALDC  147

Query  1483  NVRLAFATPDRVQNLGSTLGIPVIGLPESL------NLDSPFRKLISSDPKLAPTPRIRQ  1322
              V LAF T DRV    + LGIPVIG+PESL      +  S F +LIS DP    +P+I Q
Sbjct  148   GVTLAFTTDDRVDKCAA-LGIPVIGVPESLVSNSNGSQSSGFYELISCDPNWDSSPKISQ  206

Query  1321  QDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVY  1142
             QDTAA+L+SSGTTG  K V LTHANFIAMV+LFVRFEASQYEY +T NVYL V+PM+HVY
Sbjct  207   QDTAAILYSSGTTGTGKGVVLTHANFIAMVQLFVRFEASQYEYLSTENVYLAVVPMFHVY  266

Query  1141  GLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK-ADKCG  965
             GLSLFVMGLLSLGSTVVV+RK++ DE+V+AI+RYGVTHFP  PPL +ALTR+AK      
Sbjct  267   GLSLFVMGLLSLGSTVVVMRKFDADEMVKAIERYGVTHFPTVPPLFMALTRRAKDGTSSS  326

Query  964   LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVG  785
             +KSLKQVS GAAP++   I+ FVRT P +D IQGYGMTESTA+GTRG+N+ KLRNY+SVG
Sbjct  327   MKSLKQVSCGAAPLNTKSIEEFVRTLPDVDLIQGYGMTESTAIGTRGYNSEKLRNYSSVG  386

Query  784   LLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHT  605
             LLAPNM+A+VVD  +G     LPP  MGELWL GP +MKGYLNN EA+K+ +D +GWLHT
Sbjct  387   LLAPNMQAKVVDWITGSP---LPPNCMGELWLCGPGVMKGYLNNSEATKSTIDGNGWLHT  443

Query  604   GDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEI  425
             GDI +FDE+GYLYV DRLKE+IKYKGFQIAPADLEAVL+SHPDIVDAAVT A+ EE GEI
Sbjct  444   GDITYFDEEGYLYVIDRLKEIIKYKGFQIAPADLEAVLVSHPDIVDAAVTGARDEEAGEI  503

Query  424   PVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNLL  245
             PVAFVVK+ G   +LSQ +VIDFV KQVAPYKK+RRVYF  SIP+SA+GKILRKELRNLL
Sbjct  504   PVAFVVKRDG--CALSQTDVIDFVCKQVAPYKKIRRVYFKASIPRSAAGKILRKELRNLL  561

Query  244   ITSKI  230
              TSK+
Sbjct  562   -TSKL  565



>ref|XP_006352919.1| PREDICTED: 4-coumarate--CoA ligase-like 6-like [Solanum tuberosum]
Length=574

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/545 (69%), Positives = 442/545 (81%), Gaps = 14/545 (3%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             +Y +ETGIY SK+PS+ LP DPFLDVVSFI S  +GG+SALVDS SG SISY EL  +V 
Sbjct  37    WYCAETGIYSSKYPSIKLPEDPFLDVVSFIFSHKNGGVSALVDSTSGISISYSELYPMVK  96

Query  1663  SMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             SMA+GLH+ GVSQGDV LILLPNSIYFPVI LG+L++GA+A TMNPLS L EIKKQ+ DC
Sbjct  97    SMASGLHQRGVSQGDVVLILLPNSIYFPVILLGVLALGAIATTMNPLSNLLEIKKQALDC  156

Query  1483  NVRLAFATPDRVQNLGSTLGIPVIGLPESL------NLDSPFRKLISSDPKLAPTPRIRQ  1322
              V LAF+T D+V  L STL IPVIG+PE L      +  S F +LIS DP     P+I Q
Sbjct  157   CVTLAFSTCDKVDKL-STLDIPVIGVPEILVSGSNCSESSVFYELISCDPNWDSRPKISQ  215

Query  1321  QDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVY  1142
             QDTAA+L+SSGTTG  K V LTH NFIAMVE FVRFEASQYEY ++ NVYLDV PM+HVY
Sbjct  216   QDTAAILYSSGTTGVGKGVILTHGNFIAMVETFVRFEASQYEYSSSENVYLDVTPMFHVY  275

Query  1141  GLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADK-CG  965
             GLSLFVMGLLSLG+T+VV+ K++ DE+V+AI+RY VTHFP+ PPLL+ALTR+AK      
Sbjct  276   GLSLFVMGLLSLGTTIVVMSKFDADEMVKAIERYKVTHFPLVPPLLMALTRRAKDGALSS  335

Query  964   LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVG  785
             +KSLKQVS GAAP++   I++FV T P +DFIQGYGMTESTA+GTRG+NT KL NY+SVG
Sbjct  336   MKSLKQVSCGAAPVNPKSIEDFVHTLPDVDFIQGYGMTESTAIGTRGYNTEKLHNYSSVG  395

Query  784   LLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHT  605
             LLAPNM+A+VVD      GS+L P  MGELWL GP +MKGYLNN EA+K+ +DD+G+LHT
Sbjct  396   LLAPNMQAKVVDW---ITGSTLAPDCMGELWLCGPGVMKGYLNNLEATKSTIDDNGYLHT  452

Query  604   GDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEI  425
             GDI +FDE+GYLYV DRLKE IKYKGFQIAPADLEAVL+SHPDI+DAAV  A+ EE GEI
Sbjct  453   GDIAYFDEEGYLYVIDRLKETIKYKGFQIAPADLEAVLVSHPDIIDAAVIGARDEEAGEI  512

Query  424   PVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNLL  245
             PVAFVVK+ G  V  SQ +VI+FV KQVAP+KK+R+VYF  SIP+SA+GKILRKELRNLL
Sbjct  513   PVAFVVKRDGCAV--SQTDVINFVTKQVAPFKKIRKVYFRASIPRSAAGKILRKELRNLL  570

Query  244   ITSKI  230
              TSK+
Sbjct  571   -TSKL  574



>ref|XP_004245937.1| PREDICTED: 4-coumarate--CoA ligase-like 6 [Solanum lycopersicum]
Length=574

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/545 (68%), Positives = 440/545 (81%), Gaps = 14/545 (3%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             +Y +ETGIY SK+PS+ LP DP LDVVSFI S  +GG+SALVDS SG SISY EL  LV 
Sbjct  37    WYCAETGIYSSKYPSIKLPEDPLLDVVSFIFSHKNGGVSALVDSASGISISYSELYPLVK  96

Query  1663  SMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             SMA+GL + GVSQGDV LILLPNSIYFPVI LG+L++GA+A TMNP S L EIKKQ+ DC
Sbjct  97    SMASGLQQRGVSQGDVVLILLPNSIYFPVILLGVLALGAIATTMNPFSNLLEIKKQALDC  156

Query  1483  NVRLAFATPDRVQNLGSTLGIPVIGLPESL------NLDSPFRKLISSDPKLAPTPRIRQ  1322
             +V LAF + D+V  L STL IPVIG+PE L      +  S F +LIS DP     P+I Q
Sbjct  157   SVTLAFTSSDKVDQL-STLDIPVIGVPEILVSGSNCSESSVFYELISCDPNWDSRPKISQ  215

Query  1321  QDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVY  1142
             QDTAA+L+SSGTTG  K V LTH NFIAMVE FVRFEASQYEY ++ NVYLDV PM+HVY
Sbjct  216   QDTAAILYSSGTTGVGKGVILTHGNFIAMVETFVRFEASQYEYSSSENVYLDVTPMFHVY  275

Query  1141  GLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK-ADKCG  965
             GLSLFVMGLLSLG+T+VV+ K++ DE+V+AI+RY VTHFP+ PPLL+ALTR+AK      
Sbjct  276   GLSLFVMGLLSLGTTIVVMSKFDADEMVKAIERYNVTHFPLVPPLLMALTRRAKDGASSS  335

Query  964   LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVG  785
             +KSLKQVS GAAP++   I++FV T P +DFIQGYGMTESTA GTRG+NT KL NY+SVG
Sbjct  336   MKSLKQVSCGAAPVNPKSIEDFVHTLPDVDFIQGYGMTESTATGTRGYNTEKLHNYSSVG  395

Query  784   LLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHT  605
             LLAPNM+A+VVD      GS+L P  MGELWL GP +MKGYLNN EA+K+ +DD+G+LHT
Sbjct  396   LLAPNMQAKVVDW---ITGSTLAPNCMGELWLCGPGVMKGYLNNLEATKSTIDDNGYLHT  452

Query  604   GDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEI  425
             GDI +FDE+GYLYV DRLKE IKYKGFQIAPADLE+VL+SHPDI+DAAVT A+ EE GEI
Sbjct  453   GDIAYFDEEGYLYVIDRLKETIKYKGFQIAPADLESVLVSHPDIIDAAVTGARDEEAGEI  512

Query  424   PVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNLL  245
             PVAFVVK+ G  V  SQ +VIDFV+KQVAP+K++R+VYF  SIP+SA+GKILRKELRN+L
Sbjct  513   PVAFVVKRDGCAV--SQTDVIDFVSKQVAPFKRIRKVYFRASIPRSAAGKILRKELRNIL  570

Query  244   ITSKI  230
              TSK+
Sbjct  571   -TSKL  574



>ref|XP_011092586.1| PREDICTED: 4-coumarate--CoA ligase-like 6 [Sesamum indicum]
Length=578

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/544 (67%), Positives = 439/544 (81%), Gaps = 13/544 (2%)
 Frame = -2

Query  1846  CFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLV  1667
             C+YS ETG+Y+SK+P V+LP +PFLDVVSFI S+ H G+ AL+DS SGFS+SY +L +LV
Sbjct  38    CWYSPETGVYQSKYPPVNLPCEPFLDVVSFIFSQKHAGVHALIDSSSGFSVSYSQLFTLV  97

Query  1666  NSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFD  1487
              S+A+GLH MGV QGDV L LLPNS+ FP++FLG LSVGA+   MNPLS+LSEIK+Q  D
Sbjct  98    KSVASGLHHMGVKQGDVILFLLPNSVCFPIVFLGALSVGAIVTPMNPLSSLSEIKRQVLD  157

Query  1486  CNVRLAFATPDRVQNL-GSTLGIPVIGLPESLNLD------SPFRKLISSDPKLAPTPRI  1328
              N  L F+  DRV  L G+  G  VIG+PE L+ D      S F KL+SSDP++APTP I
Sbjct  158   SNASLVFSVLDRVHELFGALRGCSVIGVPEILSFDSLPDDYSVFHKLVSSDPRMAPTPEI  217

Query  1327  RQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYH  1148
              QQDTAA+L+SSGTTG  K V LTH NFIAM+ELFVRFEAS Y+YP+T +VYL V+PM+H
Sbjct  218   MQQDTAAILYSSGTTGRAKGVMLTHGNFIAMMELFVRFEASLYDYPSTGHVYLAVVPMFH  277

Query  1147  VYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK-ADK  971
             VYGLSLFVMGLLSLG TVV ++K++ DE+VRAIDRYGVTH    PPLL ALTRKAK AD 
Sbjct  278   VYGLSLFVMGLLSLGITVVAMKKFDADEMVRAIDRYGVTHLHAVPPLLTALTRKAKRADG  337

Query  970   CGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTS  791
                +SLKQVS GAAP+S   I  F+   PH+DFIQGYGMTESTAVGTRG+NTAK++ YTS
Sbjct  338   NSFRSLKQVSCGAAPLSEKSINEFIEALPHVDFIQGYGMTESTAVGTRGYNTAKVQKYTS  397

Query  790   VGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWL  611
             VGLL+PN++A+VVD      GS LPP S+GELWLR P  MKGYLNN EA+  A+D DGWL
Sbjct  398   VGLLSPNVQAKVVDW---VTGSHLPPGSVGELWLRTPGTMKGYLNNIEATTAAIDKDGWL  454

Query  610   HTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVG  431
             HTGDIV+FD++GYLY+ DRLKEMIKYKGFQIAPADLEAVL+SHP+++DAAVT A+ EE G
Sbjct  455   HTGDIVYFDQEGYLYIIDRLKEMIKYKGFQIAPADLEAVLISHPEVLDAAVTGAKDEEAG  514

Query  430   EIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRN  251
             EIPVAFVV K GS  S+S A ++D+VAKQVAPYKKVR+VYF  SIP+SA+GKILR+ELR+
Sbjct  515   EIPVAFVVLKDGS--SVSGAALLDYVAKQVAPYKKVRKVYFRTSIPRSAAGKILRRELRS  572

Query  250   LLIT  239
             LL++
Sbjct  573   LLVS  576



>ref|XP_007040775.1| Acyl:coa ligase [Theobroma cacao]
 gb|EOY25276.1| Acyl:coa ligase [Theobroma cacao]
Length=561

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/552 (64%), Positives = 431/552 (78%), Gaps = 13/552 (2%)
 Frame = -2

Query  1879  RNSAAEKGRRSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGF  1700
             + S ++  R   +YS ETGIY SKH S+ LP+D FLD+VSFI S  H G++AL+DS SG+
Sbjct  12    QRSESKTTRFPDWYSPETGIYSSKHSSISLPTDHFLDIVSFIFSHQHDGVTALIDSSSGY  71

Query  1699  SISYPELRSLVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLS  1520
             S SY +L  L+ SMA+GLH +GVSQGDV L+LLPNS++FP+IFL +L +GA+  TMNPL+
Sbjct  72    STSYAKLLPLIQSMASGLHHLGVSQGDVVLLLLPNSVHFPIIFLSVLYLGAIVTTMNPLT  131

Query  1519  TLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSP------FRKLISS  1358
             ++ EIKKQ  D +VR AF   D+V  L   LG+  IG+PE+LNLDS       F KLI  
Sbjct  132   SMLEIKKQIADSSVRFAFTLLDKVDKL-KNLGVHAIGVPENLNLDSEKTDFLLFHKLIGG  190

Query  1357  DPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATAN  1178
                 AP P IRQQDTAA+++SSGTTG  K V LTH NFIAMVELFVRFEASQYEY ++ N
Sbjct  191   QFDKAPRPVIRQQDTAAIMYSSGTTGVSKGVVLTHGNFIAMVELFVRFEASQYEYSSSKN  250

Query  1177  VYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVA  998
             VYL VLPM+H+YGLSLFV+GLLSLG+++VV+R++   E+VR ID+YGVTHFPV PP+L  
Sbjct  251   VYLAVLPMFHIYGLSLFVVGLLSLGTSIVVMRRFNATEMVRVIDKYGVTHFPVVPPILRT  310

Query  997   LTRKAKA-DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGF  821
             L  +AK   +  LKSLKQVS GAAP+S   I++FV+  PH+DFIQGYGMTESTAVG RGF
Sbjct  311   LAMRAKGVCENSLKSLKQVSCGAAPLSRKAIEDFVQALPHVDFIQGYGMTESTAVGNRGF  370

Query  820   NTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEAS  641
             N  K   Y+SVGLLAPNM+A+VVD +SG     LPP S GELWLRGP +M+GYLNN EA+
Sbjct  371   NNEKHHKYSSVGLLAPNMQAKVVDWNSGSS---LPPDSHGELWLRGPGLMQGYLNNVEAT  427

Query  640   KNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAA  461
             +  +D DGWL TGDIV FDEDGY+YV DRLKE+IKYKG+QIAPADLEA+L+SHP+I+DAA
Sbjct  428   RMTIDKDGWLRTGDIVCFDEDGYMYVSDRLKEIIKYKGYQIAPADLEAILISHPEILDAA  487

Query  460   VTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSAS  281
             V  A  EE GEIPVAFVV+++GS  +L+Q  V+DFVAKQVAPYKKVR+V FTKSIPKSA+
Sbjct  488   VIPAIDEEAGEIPVAFVVRRQGS--TLTQGAVMDFVAKQVAPYKKVRKVVFTKSIPKSAA  545

Query  280   GKILRKELRNLL  245
             GK LR+ELRN L
Sbjct  546   GKTLRRELRNFL  557



>ref|XP_002270360.1| PREDICTED: 4-coumarate--CoA ligase-like 6 isoform X1 [Vitis vinifera]
 emb|CBI23270.3| unnamed protein product [Vitis vinifera]
Length=571

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/545 (63%), Positives = 428/545 (79%), Gaps = 13/545 (2%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             ++S ETGIY S +PS+ +PSDP LD+VSFI S+NH G+SAL D  SGFSISY +L  LV 
Sbjct  33    WFSPETGIYSSTYPSLPIPSDPHLDIVSFIFSKNHNGVSALTDYSSGFSISYSQLHPLVK  92

Query  1663  SMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             SMA+GLH+MG SQGDV L+LLPNSIYFPVIFL +LS+G +A TMNPLS+L+EI+KQ+  C
Sbjct  93    SMASGLHQMGFSQGDVILLLLPNSIYFPVIFLAVLSLGGIATTMNPLSSLTEIRKQTVGC  152

Query  1483  NVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSP------FRKLISSDPKLAPTPRIRQ  1322
             ++ LAF  P+  + LG+ LG+PVIG+PE+ + +S       F  LIS DP   P P I Q
Sbjct  153   SLSLAFTVPETSEKLGA-LGVPVIGVPENGSFNSKSKEFSTFHWLISGDPDCCPRPVINQ  211

Query  1321  QDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVY  1142
              D AA+++SSGTTG  KAV LTH NFIAMVE FVRFEAS YE   + NVYL VLPM+H+Y
Sbjct  212   HDVAAIMYSSGTTGSTKAVVLTHGNFIAMVETFVRFEASLYENSGSENVYLAVLPMFHIY  271

Query  1141  GLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCG-  965
             GLSLFV GL+SLGS +VV+RK++ +E+V+AIDRY VTHFPV PP+L+AL + A+A   G 
Sbjct  272   GLSLFVTGLISLGSAIVVMRKFDANEMVKAIDRYRVTHFPVVPPVLMALIKSARAAGAGC  331

Query  964   LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVG  785
               SLKQV  GAAP++   IQ FV+T  H+D IQGYGMTESTAVGTRGFNT KLRNY+S+G
Sbjct  332   FGSLKQVCCGAAPLTQKSIQEFVQTLSHVDLIQGYGMTESTAVGTRGFNTKKLRNYSSIG  391

Query  784   LLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHT  605
             LLAPNM A+VVDL     GS LPP + GELWL+GP IMKGYLN+ EA+ + +D +GWLHT
Sbjct  392   LLAPNMRAKVVDL---SSGSLLPPGNCGELWLQGPGIMKGYLNDEEATISTIDKEGWLHT  448

Query  604   GDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEI  425
             GDIV FD+DGYLY+  R+KE+IKYKGFQIAP DLE++L+SHP+I DAAV     EE GE+
Sbjct  449   GDIVSFDQDGYLYMFSRIKEIIKYKGFQIAPVDLESILISHPEISDAAVAGVGDEEAGEV  508

Query  424   PVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNLL  245
             PVAFVVK+ GS  +LSQA +I++V KQVAPYKKVR+V FT  IPKSA+GKILR+EL++L 
Sbjct  509   PVAFVVKRPGS--ALSQAAIINYVEKQVAPYKKVRKVIFTHPIPKSAAGKILRRELKHLF  566

Query  244   ITSKI  230
             + S+I
Sbjct  567   MISRI  571



>ref|XP_009796689.1| PREDICTED: 4-coumarate--CoA ligase-like 6 isoform X2 [Nicotiana 
sylvestris]
Length=536

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/517 (68%), Positives = 414/517 (80%), Gaps = 14/517 (3%)
 Frame = -2

Query  1759  FILSRNHGGLSALVDSQSGFSISYPELRSLVNSMAAGLHRMGVSQGDVALILLPNSIYFP  1580
             F      G  + L+DS SG SI Y EL S+V SMA+ L + GVSQGDV LILLPNSIYFP
Sbjct  27    FWYCAETGVYNTLIDSTSGISIPYSELFSMVKSMASSLRQRGVSQGDVVLILLPNSIYFP  86

Query  1579  VIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPE  1400
             VI LG+LS+GA+  TMNP S+L EIKKQ+ DC V LAF T D+V  L + LGIPVIG+PE
Sbjct  87    VILLGVLSLGAIVTTMNPFSSLLEIKKQALDCGVTLAFTTDDKVDKLAA-LGIPVIGVPE  145

Query  1399  SL------NLDSPFRKLISSDPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIA  1238
             SL      +  S F +LIS DP    +P+I QQDTAA+L+SSGTTG  K V LTHANFIA
Sbjct  146   SLVSNSNSSQSSGFYELISCDPNWDSSPKISQQDTAAILYSSGTTGTGKGVVLTHANFIA  205

Query  1237  MVELFVRFEASQYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevv  1058
             MV+LFVRFEASQYEY +T NVYL V+PM+HVYGLSLFVMGLLSLGSTVVV+RK++ +E+V
Sbjct  206   MVQLFVRFEASQYEYLSTENVYLAVIPMFHVYGLSLFVMGLLSLGSTVVVMRKFDANEMV  265

Query  1057  RAIDRYGVTHFPVAPPLLVALTRKAK-ADKCGLKSLKQVSSGAAPISITCIQNFVRTFPH  881
             +AI+RYGVTHFP  PPLL+ALTR+AK      +KSLKQVS GAAP++   I+ FVRT P 
Sbjct  266   KAIERYGVTHFPTVPPLLMALTRRAKDGASSSMKSLKQVSCGAAPLNTKSIEEFVRTLPD  325

Query  880   IDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMG  701
             +D IQGYGMTESTA+GTRG+NT KL NY+SVGLLAPNM+A+VVD  +G     LPP  MG
Sbjct  326   VDLIQGYGMTESTAIGTRGYNTEKLHNYSSVGLLAPNMQAKVVDWITGSP---LPPNCMG  382

Query  700   ELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQ  521
             ELWL GP +MKGYLNN EA+K+ +D +GWLHTGDI +FDE+GYLYV DRLKE+IKYKGFQ
Sbjct  383   ELWLCGPGVMKGYLNNSEATKSTIDGNGWLHTGDIAYFDEEGYLYVIDRLKEIIKYKGFQ  442

Query  520   IAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQV  341
             IAPADLEAVL+SHPDIVDAAVT A+ EE GEIPVAFVVK+ G   +LSQ +VIDFV KQV
Sbjct  443   IAPADLEAVLVSHPDIVDAAVTGARDEEAGEIPVAFVVKRDG--CALSQTDVIDFVCKQV  500

Query  340   APYKKVRRVYFTKSIPKSASGKILRKELRNLLITSKI  230
             APYKK+RRVYF  SIP+SA+GKILRKELRNLL TSK+
Sbjct  501   APYKKIRRVYFKASIPRSAAGKILRKELRNLL-TSKL  536



>ref|XP_009618207.1| PREDICTED: 4-coumarate--CoA ligase-like 6 isoform X2 [Nicotiana 
tomentosiformis]
Length=536

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/517 (68%), Positives = 411/517 (79%), Gaps = 14/517 (3%)
 Frame = -2

Query  1759  FILSRNHGGLSALVDSQSGFSISYPELRSLVNSMAAGLHRMGVSQGDVALILLPNSIYFP  1580
             F      G  + LVDS SG S+ Y    S+V SMA+ LH+ GVS GDV LILLPNSIYFP
Sbjct  27    FWYCAETGVYNTLVDSTSGISLPYSVFYSMVKSMASSLHQRGVSPGDVVLILLPNSIYFP  86

Query  1579  VIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPE  1400
             VI LG+LS+GA+  TMNP S+L EIKKQ+ DC V LAF T DRV    + LGIPVIG+PE
Sbjct  87    VILLGVLSLGAIVTTMNPFSSLLEIKKQALDCGVTLAFTTDDRVDKCAA-LGIPVIGVPE  145

Query  1399  SL------NLDSPFRKLISSDPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIA  1238
             SL      +  S F +LIS DP    +P+I QQDTAA+L+SSGTTG  K V LTHANFIA
Sbjct  146   SLVSNSNGSQSSGFYELISCDPNWDSSPKISQQDTAAILYSSGTTGTGKGVVLTHANFIA  205

Query  1237  MVELFVRFEASQYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevv  1058
             MV+LFVRFEASQYEY +T NVYL V+PM+HVYGLSLFVMGLLSLGSTVVV+RK++ DE+V
Sbjct  206   MVQLFVRFEASQYEYLSTENVYLAVVPMFHVYGLSLFVMGLLSLGSTVVVMRKFDADEMV  265

Query  1057  RAIDRYGVTHFPVAPPLLVALTRKAK-ADKCGLKSLKQVSSGAAPISITCIQNFVRTFPH  881
             +AI+RYGVTHFP  PPL +ALTR+AK      +KSLKQVS GAAP++   I+ FVRT P 
Sbjct  266   KAIERYGVTHFPTVPPLFMALTRRAKDGTSSSMKSLKQVSCGAAPLNTKSIEEFVRTLPD  325

Query  880   IDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMG  701
             +D IQGYGMTESTA+GTRG+N+ KLRNY+SVGLLAPNM+A+VVD  +G     LPP  MG
Sbjct  326   VDLIQGYGMTESTAIGTRGYNSEKLRNYSSVGLLAPNMQAKVVDWITGSP---LPPNCMG  382

Query  700   ELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQ  521
             ELWL GP +MKGYLNN EA+K+ +D +GWLHTGDI +FDE+GYLYV DRLKE+IKYKGFQ
Sbjct  383   ELWLCGPGVMKGYLNNSEATKSTIDGNGWLHTGDITYFDEEGYLYVIDRLKEIIKYKGFQ  442

Query  520   IAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQV  341
             IAPADLEAVL+SHPDIVDAAVT A+ EE GEIPVAFVVK+ G   +LSQ +VIDFV KQV
Sbjct  443   IAPADLEAVLVSHPDIVDAAVTGARDEEAGEIPVAFVVKRDG--CALSQTDVIDFVCKQV  500

Query  340   APYKKVRRVYFTKSIPKSASGKILRKELRNLLITSKI  230
             APYKK+RRVYF  SIP+SA+GKILRKELRNLL TSK+
Sbjct  501   APYKKIRRVYFKASIPRSAAGKILRKELRNLL-TSKL  536



>emb|CDP11727.1| unnamed protein product [Coffea canephora]
Length=573

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/533 (66%), Positives = 424/533 (80%), Gaps = 15/533 (3%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             +YS ETGIY SKHPSV LPSDPFLDVVSFI S  H G +AL+DS SGFS+SY ++  LVN
Sbjct  34    WYSPETGIYHSKHPSVTLPSDPFLDVVSFIFSHEHSGQTALIDSSSGFSLSYSKIFPLVN  93

Query  1663  SMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             S+A+GLH+MGVSQGDV LI LPNSI+FP++FLG+LS+GA+   +NPLS+LSE+KKQ  DC
Sbjct  94    SVASGLHQMGVSQGDVVLISLPNSIHFPIVFLGILSLGAIVTAINPLSSLSEVKKQVIDC  153

Query  1483  NVRLAFATPDRVQNLGSTLGIPVIGLPESLNL--------DSPFRKLISSDPKLAPTPRI  1328
                     P++V  L S  G PVIG+P + +L        +S F KLISSDPKLAP P+I
Sbjct  154   KPSFGLCLPEKVDEL-SAFGFPVIGVPHTESLMPNSKVCRNSDFYKLISSDPKLAPRPKI  212

Query  1327  RQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYH  1148
              QQDTAA+L+SSGTTG CK   LTH NFIAMV LFVRFEAS Y    + NVYL   PM+H
Sbjct  213   NQQDTAAILYSSGTTGTCKGTMLTHGNFIAMVVLFVRFEASTYCDLPSENVYLATSPMFH  272

Query  1147  VYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK-ADK  971
             +YGLSLFVMGLLSLG+T+VV+R ++ D++VR ID+YGVTHFP  PP+L+ LT +AK A  
Sbjct  273   IYGLSLFVMGLLSLGTTIVVMRNFDADQLVRVIDKYGVTHFPTVPPVLMKLTSRAKDASD  332

Query  970   CGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTS  791
               LKSL+QVS GAAP+   CI++FV+T PH+DFIQGYGMTESTAVG+RG+NT     Y+S
Sbjct  333   GSLKSLRQVSCGAAPVIAKCIEDFVQTLPHVDFIQGYGMTESTAVGSRGYNTENFYKYSS  392

Query  790   VGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWL  611
             VGLLAPN++ARVV+ ++G     LPP S GELWLR P  MKGYLNN EA+K+ ++ DGWL
Sbjct  393   VGLLAPNVQARVVNWTTGCS---LPPGSTGELWLRSPGTMKGYLNNDEATKSTIEKDGWL  449

Query  610   HTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVG  431
             HTGDIV+FDEDGYLYV DRLKE+IKYKGFQIAPADLE+VLMSHP+IVDAAVT A+ EE G
Sbjct  450   HTGDIVYFDEDGYLYVVDRLKEVIKYKGFQIAPADLESVLMSHPEIVDAAVTGARDEEAG  509

Query  430   EIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKI  272
             EIPVAFVV+K+GS  +LS+A VI+FVAKQV PYKK+R+V F  S+P+SA+GKI
Sbjct  510   EIPVAFVVRKEGS--TLSEAAVIEFVAKQVTPYKKIRKVNFIASVPRSAAGKI  560



>ref|XP_004301643.1| PREDICTED: 4-coumarate--CoA ligase-like 6-like [Fragaria vesca 
subsp. vesca]
Length=567

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/540 (64%), Positives = 431/540 (80%), Gaps = 13/540 (2%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             ++S ETGIY SKHP+V+LPSDPFLDVVSFI S  H G+SAL+DS SGFSISY +L SLV 
Sbjct  30    WFSPETGIYSSKHPNVNLPSDPFLDVVSFIFSHKHSGVSALIDSSSGFSISYSKLYSLVE  89

Query  1663  SMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             SMA+GL +MGVSQGDV L+LLPNS+Y+P++FLG+L +GAV  TMNPLS++ EIKKQ  DC
Sbjct  90    SMASGLIKMGVSQGDVVLLLLPNSVYYPIVFLGVLYIGAVVTTMNPLSSVVEIKKQIKDC  149

Query  1483  NVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSP------FRKLISSDPKLAPTPRIRQ  1322
             N    F   + V  L   L IP I +P ++ LDS       F +L+ S+  LA  P I+Q
Sbjct  150   NACFGFTGYENVDKL-QALSIPAIAVPGNVVLDSKKEMFSVFYQLVDSEVDLALRPVIKQ  208

Query  1321  QDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVY  1142
             QDTAA+L+SSGTTG  K V +TH N IA VELFVRFEASQYEY +  NVYL VLP++H+Y
Sbjct  209   QDTAAILYSSGTTGVSKGVLITHGNLIATVELFVRFEASQYEYSSLKNVYLSVLPLFHIY  268

Query  1141  GLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK-ADKCG  965
             GL+L V+GLLSLGS++V+++K++V+EVV AIDRY VTHFPV PP+L ALT+ A+      
Sbjct  269   GLALMVVGLLSLGSSIVIMKKFDVNEVVSAIDRYKVTHFPVVPPILTALTKIAQDVGAQS  328

Query  964   LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVG  785
             L+SLKQVS GAAP S+  I+  V+T PH+DFIQGYGMTE+TAVGTRGFNT K+R Y+S+G
Sbjct  329   LQSLKQVSCGAAPTSMKLIEELVQTLPHVDFIQGYGMTETTAVGTRGFNTEKIRKYSSIG  388

Query  784   LLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHT  605
             LLAPNM+A+VVD      GS LPP S+GELWLRGP+IM+GYLNN  A+ + +D+DGWLHT
Sbjct  389   LLAPNMQAKVVDW---NTGSFLPPASIGELWLRGPSIMRGYLNNARATMSTIDNDGWLHT  445

Query  604   GDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEI  425
             GDI +FDEDGYLY+ DR+KE+IKYKGFQIAPADLEAVL+SHP+I+D  VT A  EE GE+
Sbjct  446   GDISYFDEDGYLYICDRIKEIIKYKGFQIAPADLEAVLISHPEILDVGVTGATDEECGEV  505

Query  424   PVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNLL  245
             PVAFVV+K  SE  LSQ +++D+VA+QV+P+KKVR+V FT SIP+SA+GKILR+ELRNLL
Sbjct  506   PVAFVVRKHDSE--LSQEDIMDYVARQVSPHKKVRKVVFTHSIPRSAAGKILRRELRNLL  563



>ref|XP_010054104.1| PREDICTED: 4-coumarate--CoA ligase-like 6 isoform X2 [Eucalyptus 
grandis]
Length=552

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/545 (64%), Positives = 431/545 (79%), Gaps = 14/545 (3%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             +YS  TGIY SKHP+V LPSDP  D VS + SR HGG +ALVDS SG SISY ELRSLV 
Sbjct  15    WYSPVTGIYCSKHPAVDLPSDPLNDAVSHLFSRAHGGSTALVDSPSGSSISYSELRSLVR  74

Query  1663  SMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
              +A+G+  MGVS+GDV L+ LPNS+Y+PV+FLG+L  G V  TMNPLS+ SE ++Q  DC
Sbjct  75    CIASGIRSMGVSRGDVVLLQLPNSVYYPVVFLGVLFSGGVVTTMNPLSSASETRRQVSDC  134

Query  1483  NVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDS------PFRKLISSDPKLAPTPRIRQ  1322
             NVRLAFA+ D+ + L   LG+P + +PE +   S       FR L+S   +    P ++Q
Sbjct  135   NVRLAFASSDKCEML-KALGVPAVAVPEDVRSASRDREFVEFRTLLSRKFESFERPIVKQ  193

Query  1321  QDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVY  1142
             QDTAA+++SSGTTG  K V LTH NFIA+ ELFVRFEASQYEYP + NVYL VLPM+H+Y
Sbjct  194   QDTAAIVYSSGTTGVSKGVMLTHGNFIAVCELFVRFEASQYEYPTSENVYLAVLPMFHIY  253

Query  1141  GLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK-ADKCG  965
             G+SLFV+GLLSLGSTVVV+R+++ +EVV+AIDRYGVTHFPV PP+L ALTR  K A+  G
Sbjct  254   GMSLFVLGLLSLGSTVVVMRRFDPNEVVKAIDRYGVTHFPVVPPILTALTRTLKVANGSG  313

Query  964   LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVG  785
             L+SLKQVS GAA +S   I++FV+TFPH+DFIQGYGMTESTAVGTRGFNT K R Y+S+G
Sbjct  314   LRSLKQVSCGAAALSRKSIEDFVQTFPHVDFIQGYGMTESTAVGTRGFNTEKCRRYSSIG  373

Query  784   LLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHT  605
             LLAPNM+A+V+D  +G     LPP S GEL LRGPAIMKGYLNN +A++  +D+DGWLHT
Sbjct  374   LLAPNMQAKVLDWKTGSF---LPPGSSGELLLRGPAIMKGYLNNVDATRLMIDEDGWLHT  430

Query  604   GDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEI  425
             GDIVHFD+DG+L++ DR+KE+IKYKGFQIAPADLE VL++HPDIVD AVT A  EE GEI
Sbjct  431   GDIVHFDQDGFLHILDRVKEIIKYKGFQIAPADLEGVLITHPDIVDVAVTGALDEESGEI  490

Query  424   PVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNLL  245
             PVAFVV++ GS +  S+  V+D++A QVAPYKKVR+V FT SIPKSA+GKILR+EL+  L
Sbjct  491   PVAFVVRRIGSNI--SEEAVMDYLAAQVAPYKKVRKVVFTSSIPKSAAGKILRRELKKSL  548

Query  244   ITSKI  230
              TS++
Sbjct  549   -TSRL  552



>ref|XP_010261634.1| PREDICTED: 4-coumarate--CoA ligase-like 6 [Nelumbo nucifera]
Length=564

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/540 (65%), Positives = 425/540 (79%), Gaps = 13/540 (2%)
 Frame = -2

Query  1849  SC-FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             SC ++S ETGIY SKH S  LPS+PFLDVVSFI S +H G+SAL+DS SGFSISY +L+ 
Sbjct  22    SCNWFSPETGIYISKHRSRQLPSNPFLDVVSFIFSHSHKGVSALIDSSSGFSISYSKLQQ  81

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
             +V SM +GLH +GVSQG+V LILLPN+IY+PV+FLG+LS+GA+A +MNPLS+ +EIKK+ 
Sbjct  82    MVKSMGSGLHEIGVSQGEVVLILLPNTIYYPVVFLGVLSIGAIATSMNPLSSPAEIKKRI  141

Query  1492  FDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSP------FRKLISSDPKLAPTPR  1331
              DCNV LAFAT  RV  +   +G+ V+ + E+   DS       F KL+ SDP  +    
Sbjct  142   SDCNVVLAFATSGRVGEI-EKMGVHVVEVRENAASDSSWSEFSCFNKLLLSDPNSSHRAI  200

Query  1330  IRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMY  1151
             I Q+DTAA+L+SSGT+G  K V LTH NFIAMVELFVRFEASQYE  A+ NVYL  +PM+
Sbjct  201   INQKDTAAILYSSGTSGVSKGVVLTHMNFIAMVELFVRFEASQYESLASDNVYLATVPMF  260

Query  1150  HVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADK  971
             HVYGLSLF MGLLSLGS +VV+RK++VDE+VRAIDRY +TH PV  P+L+AL R   +  
Sbjct  261   HVYGLSLFAMGLLSLGSAIVVMRKFDVDEMVRAIDRYKITHLPVVSPILMALARVKSSSD  320

Query  970   CGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTS  791
             C L+SLKQVS GAAP S   I +F++ FP +D IQGYGMTE+ AVGTRGFNT K+R YTS
Sbjct  321   CSLRSLKQVSFGAAPTSKKIILDFLQRFPQVDLIQGYGMTETAAVGTRGFNTEKIRKYTS  380

Query  790   VGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWL  611
             +GLLAPNM+A+VV+      GS LPP   GELWLRGPAIMKGYLNN EA+ + +D DGWL
Sbjct  381   IGLLAPNMQAKVVNW---ITGSCLPPGETGELWLRGPAIMKGYLNNAEATSSTIDRDGWL  437

Query  610   HTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVG  431
             HTGDI HFD+DGYLY+ DRLKEMIKYKG+QIAPADLEAVL SHP+I+D AV +   EE G
Sbjct  438   HTGDIAHFDQDGYLYILDRLKEMIKYKGYQIAPADLEAVLFSHPEILDVAVAAVIDEEAG  497

Query  430   EIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRN  251
             E+PVAFVVK+ GS  +LSQA+VID+VA+QVAPYKKVR+V FT SIPKSA+GKILR+ L N
Sbjct  498   ELPVAFVVKRPGS--ALSQADVIDYVAQQVAPYKKVRKVVFTSSIPKSAAGKILRRRLSN  555



>ref|XP_010054103.1| PREDICTED: 4-coumarate--CoA ligase-like 6 isoform X1 [Eucalyptus 
grandis]
Length=558

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/551 (64%), Positives = 431/551 (78%), Gaps = 20/551 (4%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             +YS  TGIY SKHP+V LPSDP  D VS + SR HGG +ALVDS SG SISY ELRSLV 
Sbjct  15    WYSPVTGIYCSKHPAVDLPSDPLNDAVSHLFSRAHGGSTALVDSPSGSSISYSELRSLVR  74

Query  1663  SMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
              +A+G+  MGVS+GDV L+ LPNS+Y+PV+FLG+L  G V  TMNPLS+ SE ++Q  DC
Sbjct  75    CIASGIRSMGVSRGDVVLLQLPNSVYYPVVFLGVLFSGGVVTTMNPLSSASETRRQVSDC  134

Query  1483  NVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDS------PFRKLISSDPKLAPTPRIRQ  1322
             NVRLAFA+ D+ + L   LG+P + +PE +   S       FR L+S   +    P ++Q
Sbjct  135   NVRLAFASSDKCEML-KALGVPAVAVPEDVRSASRDREFVEFRTLLSRKFESFERPIVKQ  193

Query  1321  QDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVY  1142
             QDTAA+++SSGTTG  K V LTH NFIA+ ELFVRFEASQYEYP + NVYL VLPM+H+Y
Sbjct  194   QDTAAIVYSSGTTGVSKGVMLTHGNFIAVCELFVRFEASQYEYPTSENVYLAVLPMFHIY  253

Query  1141  GLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK-ADKCG  965
             G+SLFV+GLLSLGSTVVV+R+++ +EVV+AIDRYGVTHFPV PP+L ALTR  K A+  G
Sbjct  254   GMSLFVLGLLSLGSTVVVMRRFDPNEVVKAIDRYGVTHFPVVPPILTALTRTLKVANGSG  313

Query  964   LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVG  785
             L+SLKQVS GAA +S   I++FV+TFPH+DFIQGYGMTESTAVGTRGFNT K R Y+S+G
Sbjct  314   LRSLKQVSCGAAALSRKSIEDFVQTFPHVDFIQGYGMTESTAVGTRGFNTEKCRRYSSIG  373

Query  784   LLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMK------GYLNNGEASKNAVDD  623
             LLAPNM+A+V+D      GS LPP S GEL LRGPAIMK      GYLNN +A++  +D+
Sbjct  374   LLAPNMQAKVLDW---KTGSFLPPGSSGELLLRGPAIMKAACNFSGYLNNVDATRLMIDE  430

Query  622   DGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQS  443
             DGWLHTGDIVHFD+DG+L++ DR+KE+IKYKGFQIAPADLE VL++HPDIVD AVT A  
Sbjct  431   DGWLHTGDIVHFDQDGFLHILDRVKEIIKYKGFQIAPADLEGVLITHPDIVDVAVTGALD  490

Query  442   EEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRK  263
             EE GEIPVAFVV++ GS +  S+  V+D++A QVAPYKKVR+V FT SIPKSA+GKILR+
Sbjct  491   EESGEIPVAFVVRRIGSNI--SEEAVMDYLAAQVAPYKKVRKVVFTSSIPKSAAGKILRR  548

Query  262   ELRNLLITSKI  230
             EL+  L TS++
Sbjct  549   ELKKSL-TSRL  558



>gb|KHN40402.1| 4-coumarate--CoA ligase-like 6 [Glycine soja]
Length=553

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/542 (63%), Positives = 419/542 (77%), Gaps = 12/542 (2%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             ++S ++GIY SKH  V LP+DPFLD+VSFI S  H G+SALVDS SG SISYP+L  LV 
Sbjct  17    WFSPKSGIYHSKHAPVDLPNDPFLDLVSFIFSHRHNGVSALVDSSSGCSISYPKLLPLVK  76

Query  1663  SMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             S+A+GLHRMGVSQGDV L+LLPNSIY+P++FL +L +GA+   +NPLS++ EI++Q  +C
Sbjct  77    SVASGLHRMGVSQGDVVLLLLPNSIYYPIVFLAVLYIGAIVTPLNPLSSVYEIRRQVSEC  136

Query  1483  NVRLAFATPDRVQNLGSTLGIPVIGLPESLN-----LDSPFRKLISSDPKLAPTPRIRQQ  1319
              V LAF  P+  + L   LGI VI +PE+         S F  LIS D  L   P I+Q 
Sbjct  137   GVSLAFTVPENEKKL-EPLGISVIAVPENEKGLKDGCFSCFCDLISCDFDLPKRPVIKQD  195

Query  1318  DTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVYG  1139
             DTA +L+SSGTTG  K V L+H N +AMVELFVRFEASQYE     NVYL VLPM+HVYG
Sbjct  196   DTAGILYSSGTTGVSKGVVLSHKNLVAMVELFVRFEASQYEGSCLRNVYLAVLPMFHVYG  255

Query  1138  LSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCG-L  962
             LSLF +GLLSLGSTVVV+RK+++DEVVR ID Y VTHFPV PP+L AL ++AK    G  
Sbjct  256   LSLFAVGLLSLGSTVVVMRKFDIDEVVRVIDEYKVTHFPVVPPMLTALIKRAKGVNGGEF  315

Query  961   KSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGL  782
             +SL QVSSGAAP+S+  I  F+R FP++DFIQGYGMTESTAVGTRGFNT K RNY+S+GL
Sbjct  316   QSLVQVSSGAAPLSMGVINEFIRAFPNVDFIQGYGMTESTAVGTRGFNTEKFRNYSSIGL  375

Query  781   LAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTG  602
             LAPNMEA+VVD      G+ LPP S GEL LRGP+IM GYLNN E + + +D DGWLHTG
Sbjct  376   LAPNMEAKVVDW---NTGAFLPPGSSGELRLRGPSIMTGYLNNEEVTMSTIDKDGWLHTG  432

Query  601   DIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIP  422
             D+V+FD DGYL++ DRLK++IKYKGFQIAPADLEAVL+ HP+IVD AVT A  EE GEIP
Sbjct  433   DVVYFDHDGYLHISDRLKDIIKYKGFQIAPADLEAVLILHPEIVDVAVTRAMDEETGEIP  492

Query  421   VAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNLLI  242
             VAFVV+K GS   LS  +++DFVA+QVAPYKKVR+V+FT  IP+SA+GKILRK+LRN L 
Sbjct  493   VAFVVRKVGS--VLSPKHIMDFVAEQVAPYKKVRKVFFTDKIPRSATGKILRKQLRNYLT  550

Query  241   TS  236
             ++
Sbjct  551   SN  552



>ref|XP_003517649.2| PREDICTED: 4-coumarate--CoA ligase-like 6-like isoform X1 [Glycine 
max]
Length=553

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/542 (63%), Positives = 419/542 (77%), Gaps = 12/542 (2%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             ++S ++GIY SKH  V LP+DPFLD+VSFI S  H G+SALVDS SG SISYP+L  LV 
Sbjct  17    WFSPKSGIYHSKHAPVDLPNDPFLDLVSFIFSHRHNGVSALVDSSSGCSISYPKLLPLVK  76

Query  1663  SMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             S+A+GLHRMGVSQGDV L+LLPNSIY+P++FL +L +GA+   +NPLS++ EI++Q  +C
Sbjct  77    SVASGLHRMGVSQGDVVLLLLPNSIYYPIVFLAVLYIGAIVTPLNPLSSVYEIRRQVSEC  136

Query  1483  NVRLAFATPDRVQNLGSTLGIPVIGLPESLN-----LDSPFRKLISSDPKLAPTPRIRQQ  1319
              V LAF  P+  + L   LGI VI +PE+         S F  LIS D  L   P I+Q 
Sbjct  137   GVSLAFTVPENEKKL-EPLGISVIAVPENEKGLKDGCFSCFCDLISCDFDLPKRPVIKQD  195

Query  1318  DTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVYG  1139
             DTA +L+SSGTTG  K V L+H N +AMVELFVRFEASQYE     NVYL VLPM+HVYG
Sbjct  196   DTAGILYSSGTTGVSKGVVLSHKNLVAMVELFVRFEASQYEGSCLRNVYLAVLPMFHVYG  255

Query  1138  LSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCG-L  962
             LSLF +GLLSLGSTVVV+RK+++DEVVR ID Y VTHFPV PP+L AL ++AK    G  
Sbjct  256   LSLFAVGLLSLGSTVVVMRKFDIDEVVRVIDEYKVTHFPVVPPMLTALIKRAKGVNGGEF  315

Query  961   KSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGL  782
             +SL QVSSGAAP+S+  I  F+R FP++DFIQGYGMTESTAVGTRGFNT K RNY+S+GL
Sbjct  316   QSLVQVSSGAAPLSMGVINEFIRAFPNVDFIQGYGMTESTAVGTRGFNTEKFRNYSSIGL  375

Query  781   LAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTG  602
             LAPNMEA+VVD      G+ LPP S GEL LRGP+IM GYLNN E + + +D DGWLHTG
Sbjct  376   LAPNMEAKVVDW---NTGAFLPPGSSGELRLRGPSIMTGYLNNEEVTMSTIDKDGWLHTG  432

Query  601   DIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIP  422
             D+V+FD DGYL++ DRLK++IKYKGFQIAPADLEAVL+ HP++VD AVT A  EE GEIP
Sbjct  433   DVVYFDHDGYLHISDRLKDIIKYKGFQIAPADLEAVLILHPEVVDVAVTRAMDEETGEIP  492

Query  421   VAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNLLI  242
             VAFVV+K GS   LS  +++DFVA+QVAPYKKVR+V+FT  IP+SA+GKILRK+LRN L 
Sbjct  493   VAFVVRKVGS--VLSPKHIMDFVAEQVAPYKKVRKVFFTDKIPRSATGKILRKQLRNYLT  550

Query  241   TS  236
             ++
Sbjct  551   SN  552



>gb|KCW78478.1| hypothetical protein EUGRSUZ_D02624 [Eucalyptus grandis]
Length=542

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/534 (64%), Positives = 423/534 (79%), Gaps = 14/534 (3%)
 Frame = -2

Query  1810  KHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVNSMAAGLHRMGV  1631
             KHP+V LPSDP  D VS + SR HGG +ALVDS SG SISY ELRSLV  +A+G+  MGV
Sbjct  16    KHPAVDLPSDPLNDAVSHLFSRAHGGSTALVDSPSGSSISYSELRSLVRCIASGIRSMGV  75

Query  1630  SQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRLAFATPDR  1451
             S+GDV L+ LPNS+Y+PV+FLG+L  G V  TMNPLS+ SE ++Q  DCNVRLAFA+ D+
Sbjct  76    SRGDVVLLQLPNSVYYPVVFLGVLFSGGVVTTMNPLSSASETRRQVSDCNVRLAFASSDK  135

Query  1450  VQNLGSTLGIPVIGLPESLNLDS------PFRKLISSDPKLAPTPRIRQQDTAAVLFSSG  1289
              + L   LG+P + +PE +   S       FR L+S   +    P ++QQDTAA+++SSG
Sbjct  136   CEML-KALGVPAVAVPEDVRSASRDREFVEFRTLLSRKFESFERPIVKQQDTAAIVYSSG  194

Query  1288  TTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVYGLSLFVMGLLS  1109
             TTG  K V LTH NFIA+ ELFVRFEASQYEYP + NVYL VLPM+H+YG+SLFV+GLLS
Sbjct  195   TTGVSKGVMLTHGNFIAVCELFVRFEASQYEYPTSENVYLAVLPMFHIYGMSLFVLGLLS  254

Query  1108  LGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK-ADKCGLKSLKQVSSGA  932
             LGSTVVV+R+++ +EVV+AIDRYGVTHFPV PP+L ALTR  K A+  GL+SLKQVS GA
Sbjct  255   LGSTVVVMRRFDPNEVVKAIDRYGVTHFPVVPPILTALTRTLKVANGSGLRSLKQVSCGA  314

Query  931   APISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVV  752
             A +S   I++FV+TFPH+DFIQGYGMTESTAVGTRGFNT K R Y+S+GLLAPNM+A+V+
Sbjct  315   AALSRKSIEDFVQTFPHVDFIQGYGMTESTAVGTRGFNTEKCRRYSSIGLLAPNMQAKVL  374

Query  751   DLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGY  572
             D  +G     LPP S GEL LRGPAIMKGYLNN +A++  +D+DGWLHTGDIVHFD+DG+
Sbjct  375   DWKTGSF---LPPGSSGELLLRGPAIMKGYLNNVDATRLMIDEDGWLHTGDIVHFDQDGF  431

Query  571   LYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGS  392
             L++ DR+KE+IKYKGFQIAPADLE VL++HPDIVD AVT A  EE GEIPVAFVV++ GS
Sbjct  432   LHILDRVKEIIKYKGFQIAPADLEGVLITHPDIVDVAVTGALDEESGEIPVAFVVRRIGS  491

Query  391   EVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNLLITSKI  230
              +  S+  V+D++A QVAPYKKVR+V FT SIPKSA+GKILR+EL+  L TS++
Sbjct  492   NI--SEEAVMDYLAAQVAPYKKVRKVVFTSSIPKSAAGKILRRELKKSL-TSRL  542



>ref|XP_006432648.1| hypothetical protein CICLE_v10000735mg [Citrus clementina]
 ref|XP_006471457.1| PREDICTED: 4-coumarate--CoA ligase-like 6-like [Citrus sinensis]
 gb|ESR45888.1| hypothetical protein CICLE_v10000735mg [Citrus clementina]
Length=561

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/563 (62%), Positives = 425/563 (75%), Gaps = 19/563 (3%)
 Frame = -2

Query  1882  IRNSAAEKGRRSCFYSSETGIYRSKHPSVHLPS-DPFLDVVSFILSRNHGGLSALVDSQS  1706
             ++ S++E+   S +Y  ETGIY SKHPSV+LP+ D  LDVVSFI S  H G +ALVDS S
Sbjct  6     LQTSSSERINTSQWYLPETGIYHSKHPSVNLPANDSLLDVVSFIFSHKHNGRTALVDSLS  65

Query  1705  GFSISYPELRSLVNSMAAGL-HRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMN  1529
             G+SISYP+L  LV S+A+GL H  G+SQGD  L+LLPNSIY PVIFL LL +GA+   MN
Sbjct  66    GYSISYPQLFPLVQSVASGLRHHFGISQGDAVLLLLPNSIYLPVIFLALLYLGAIVIPMN  125

Query  1528  PLSTLSEIKKQSFDCNVR--LAFATPDRVQNLGSTLGIPVIGLPESLNLD------SPFR  1373
             PL ++SEIKKQ   C  +  LAF   + V  L S    PVI +PE+L  D      S F 
Sbjct  126   PLLSVSEIKKQVTLCKTKISLAFTIYENVDKLRSWGTTPVIAVPENLINDFKEGRFSDFH  185

Query  1372  KLISSDPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEY  1193
             KLI+    L   P IRQQDTAA+L SSGTTG  K   LTH NFIA VELFVRFEASQYEY
Sbjct  186   KLITGKFDLVERPVIRQQDTAAILNSSGTTGASKGAVLTHGNFIAAVELFVRFEASQYEY  245

Query  1192  PATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAP  1013
              ++  V+L VLPM+H+YGLSLF +GLLSLG++VVV+R++E  E+++ ID+YGVTHFPV P
Sbjct  246   LSSEAVFLAVLPMFHIYGLSLFTLGLLSLGASVVVMRRFEASEMLKVIDKYGVTHFPVVP  305

Query  1012  PLLVALTRKAKADKCG--LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTA  839
             P+L+ALT+ AK   CG  LKSLKQVSSGAAP +   I++FV  FPH+DFIQGYGMTESTA
Sbjct  306   PILMALTKAAKG-LCGNSLKSLKQVSSGAAPANSKIIEDFVGAFPHVDFIQGYGMTESTA  364

Query  838   VGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYL  659
             VGTRGFNT K   Y SVGLLAPNM+A+VVD  +G     LPP S GELWLRGP  MK Y+
Sbjct  365   VGTRGFNTKKFSKYFSVGLLAPNMQAKVVDWVNGCF---LPPGSTGELWLRGPGTMKEYI  421

Query  658   NNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHP  479
             NN +A+ + +D +GWLHTGDI +FDEDGYLY+ DRLKE+IKY G+QI+PADLE VL+ HP
Sbjct  422   NNADATMSTIDKEGWLHTGDIAYFDEDGYLYIVDRLKEVIKYNGYQISPADLETVLICHP  481

Query  478   DIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKS  299
             +I+D AVT A    +GEIPVAFVV++ GS  +L++A VID++A++VAPYKKVRRV FTKS
Sbjct  482   EILDVAVTGAMDRVLGEIPVAFVVRRDGS--TLTEAAVIDYIAQRVAPYKKVRRVVFTKS  539

Query  298   IPKSASGKILRKELRNLLITSKI  230
             IPKSA+GK+LR+ELR  L TSK+
Sbjct  540   IPKSAAGKVLRRELRKFL-TSKL  561



>ref|XP_009335868.1| PREDICTED: 4-coumarate--CoA ligase-like 6 [Pyrus x bretschneideri]
Length=567

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/559 (62%), Positives = 430/559 (77%), Gaps = 16/559 (3%)
 Frame = -2

Query  1879  RNSAAEKGRRSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLS-ALVDSQSG  1703
             +  + +  +   ++S ETGIY SKHP + LP+DPFLDVV+FI S  H G+S AL+DS SG
Sbjct  16    QKQSTQDYKYPWWFSPETGIYCSKHPEITLPTDPFLDVVTFIFSHQHTGVSPALIDSSSG  75

Query  1702  FSISYPELRSLVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPL  1523
              S+SYP+L S V S A+GL +MG+SQGDV L+LLPNSIY+P++FLG+L  GA+  TMNPL
Sbjct  76    SSLSYPQLYSCVKSFASGLRQMGISQGDVVLLLLPNSIYYPIVFLGVLYAGAIVTTMNPL  135

Query  1522  STLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSP------FRKLIS  1361
             S++ EIKKQ  D   R AF   + V  L   LG+P + +P++  LDS       F KL++
Sbjct  136   SSVGEIKKQVGDSKARRAFTGLEYVGKL-QALGVPAVLVPDNAALDSKEEAFSVFYKLVN  194

Query  1360  SDPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATA  1181
              +  LAP P IRQQDTAA+++SSGTTG  K V +TH NFIA VELFVRFEASQYE  + +
Sbjct  195   GNVGLAPRPVIRQQDTAAIMYSSGTTGASKGVVITHRNFIAAVELFVRFEASQYEGSSLS  254

Query  1180  NVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLV  1001
             NVYL+VLP++H+YGL LF MGLLSLGS +VV++K++V+EVV+AI++Y VTHFPV PP+L 
Sbjct  255   NVYLNVLPLFHIYGLVLFGMGLLSLGSRIVVMKKFDVNEVVKAIEKYKVTHFPVVPPILT  314

Query  1000  ALTRKAKAD--KCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTR  827
             ALT KAK    K  LKS+KQVSSGAA +S   I++FVRT PH+D IQGYGMTE+TAVGTR
Sbjct  315   ALTAKAKDGLVKQSLKSVKQVSSGAALLSAKSIEDFVRTLPHVDLIQGYGMTETTAVGTR  374

Query  826   GFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGE  647
             GFNT  L+   S+GLLAPNM+A+VVD  +G     LPPTS GELWLRGP I+ GYLNN E
Sbjct  375   GFNTESLKKPFSLGLLAPNMQAKVVDWKTGSP---LPPTSSGELWLRGPGIVNGYLNNAE  431

Query  646   ASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVD  467
             A+ + +D++GWLHTGDIV+FDE GYL + DRLK++IKYKGFQIAPADLEAVL++HP+I+D
Sbjct  432   ATMSTIDEEGWLHTGDIVYFDEHGYLNLQDRLKDVIKYKGFQIAPADLEAVLINHPEILD  491

Query  466   AAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKS  287
              AV     EE GEIPVAFVV+K GS V  S  NV+DFVA QVAPYKKVR+V FT SIPKS
Sbjct  492   VAVAGVLDEESGEIPVAFVVRKHGSRV--SGENVMDFVAAQVAPYKKVRKVVFTDSIPKS  549

Query  286   ASGKILRKELRNLLITSKI  230
             A+GKILR+ELR +L TSK+
Sbjct  550   AAGKILRRELRKVL-TSKL  567



>ref|XP_007158204.1| hypothetical protein PHAVU_002G132900g [Phaseolus vulgaris]
 gb|ESW30198.1| hypothetical protein PHAVU_002G132900g [Phaseolus vulgaris]
Length=552

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/544 (63%), Positives = 419/544 (77%), Gaps = 13/544 (2%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             ++S ++GIY SKH  V LPSDPFLDVVSFI S  H G+SALVD  SG SISY +L  LV 
Sbjct  16    WFSPKSGIYHSKHAPVDLPSDPFLDVVSFIFSHRHDGVSALVDFSSGCSISYSKLLPLVK  75

Query  1663  SMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             S+A+GLH+MGVSQGDV LILLPNSIY+P++FLG+L +GA+   +NPLS++ EI++Q  +C
Sbjct  76    SVASGLHKMGVSQGDVVLILLPNSIYYPIVFLGVLYLGAIVTPLNPLSSVYEIRRQVAEC  135

Query  1483  NVRLAFATPDRVQNLGSTLGIPVIGLPES-----LNLDSPFRKLISSDPKLAPTPRIRQQ  1319
              V +AF  P+  + L   LGI VI +PE+         S F  LIS D  L   P I+Q 
Sbjct  136   GVSVAFTVPENFKKL-EPLGISVIAVPENEKGLRYGCFSCFCDLISCDFDLPQRPVIKQD  194

Query  1318  DTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVYG  1139
             D A +L+SSGTTG  K V L+H N IAMVELFVRFEASQYE     NVYL VLPM+HVYG
Sbjct  195   DAAGILYSSGTTGVSKGVVLSHKNLIAMVELFVRFEASQYEGSCLRNVYLAVLPMFHVYG  254

Query  1138  LSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKA-DKCGL  962
             LSLF +GLLSLGSTVVV+RK+++DEVVR ID Y VTHFPV PP+L AL  +A   +   L
Sbjct  255   LSLFALGLLSLGSTVVVMRKFDIDEVVRVIDEYKVTHFPVVPPMLTALIMRANGVNDSKL  314

Query  961   KSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGL  782
             +SL QVSSGAA +S   +  F+RTFP++DFIQGYGMTESTAVGTRGFNT K RNY+S+GL
Sbjct  315   QSLIQVSSGAALLSSGVVNEFLRTFPNVDFIQGYGMTESTAVGTRGFNTEKFRNYSSIGL  374

Query  781   LAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTG  602
             LAPNMEA+VVD ++G     LPP S GELWLRG ++M GYLNN EA+ + +D DGWLHTG
Sbjct  375   LAPNMEAKVVDWNTGAF---LPPGSSGELWLRGSSVMTGYLNNEEATMSTIDRDGWLHTG  431

Query  601   DIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIP  422
             D+V+FD+DGY+Y+ DRLK++IKYKGFQIAPADLEAVL+ HP+IVD AV  A  EE GE+P
Sbjct  432   DVVYFDDDGYVYIADRLKDIIKYKGFQIAPADLEAVLILHPEIVDVAVIGAMDEETGEMP  491

Query  421   VAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNLLI  242
             VAFVVKK GS   LS  +V+D+VA+QVAPYKK+R+V+FT  IP+SA+GKILRK+LRN L 
Sbjct  492   VAFVVKKVGS--VLSPKHVMDYVAEQVAPYKKIRKVFFTNHIPRSATGKILRKQLRNCL-  548

Query  241   TSKI  230
             TSK+
Sbjct  549   TSKL  552



>gb|KDO58807.1| hypothetical protein CISIN_1g037622mg [Citrus sinensis]
Length=560

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/563 (61%), Positives = 426/563 (76%), Gaps = 19/563 (3%)
 Frame = -2

Query  1882  IRNSAAEKGRRSCFYSSETGIYRSKHPSVHLPS-DPFLDVVSFILSRNHGGLSALVDSQS  1706
             ++  ++E+   S +YS ETGIY SKHPSV+LP+ D  LDV SFI S  H G +ALVDS S
Sbjct  5     LQTFSSERINTSQWYSPETGIYHSKHPSVNLPANDSLLDVDSFIFSHKHNGRTALVDSLS  64

Query  1705  GFSISYPELRSLVNSMAAGL-HRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMN  1529
             G+SISYP+L  LV S+A+GL H  G+SQGD  L+LLPNSIYFPVIFL LL +GA+   MN
Sbjct  65    GYSISYPQLFPLVQSVASGLRHHFGISQGDAVLLLLPNSIYFPVIFLALLYLGAIVIPMN  124

Query  1528  PLSTLSEIKKQSFDCNVR--LAFATPDRVQNLGSTLGIPVIGLPESLNLD------SPFR  1373
             PL ++SEIKKQ   C  +  LAF   + V  L S    PV+ +PE+L  D      S F 
Sbjct  125   PLLSVSEIKKQVTLCKTKISLAFTIYENVDKLRSWGTTPVVAVPENLVNDFKEGRFSDFH  184

Query  1372  KLISSDPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEY  1193
             KLI+    L   P IRQQDTAA+L+SSGTTG  K   LTH NFIA VELFVRFEASQYEY
Sbjct  185   KLIAGKFDLVERPVIRQQDTAAILYSSGTTGASKGAELTHGNFIAAVELFVRFEASQYEY  244

Query  1192  PATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAP  1013
              ++  V+L VLPM+H+YGLSLF +GLLSLG +VVV+R++E  E+++ ID+YGVTHFPV P
Sbjct  245   LSSEAVFLAVLPMFHIYGLSLFALGLLSLGPSVVVMRRFEASEMLKVIDKYGVTHFPVVP  304

Query  1012  PLLVALTRKAKADKCG--LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTA  839
             P+L+ALT+ AK   CG  LKSLKQVSSGAAP +   I++FV  FPH+DFIQGYGMTESTA
Sbjct  305   PILMALTKAAKG-LCGNSLKSLKQVSSGAAPANSKIIEDFVGAFPHVDFIQGYGMTESTA  363

Query  838   VGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYL  659
             VGTRGFNT K   Y SVGLLAPN++A+VVD  +G     LPP S GELWLRGP  MK Y+
Sbjct  364   VGTRGFNTKKFSKYFSVGLLAPNIQAKVVDWVNGCF---LPPGSTGELWLRGPGTMKEYI  420

Query  658   NNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHP  479
             NN +A+ + +D +GWLHTGDI +FDEDGYLY+ DRLKE+IKY G+QI+PADLE VL+ HP
Sbjct  421   NNADATMSTIDKEGWLHTGDIAYFDEDGYLYIVDRLKEVIKYNGYQISPADLETVLICHP  480

Query  478   DIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKS  299
             +I+D AVT A  + +GEIPVAFVV++ GS  +L++A VID++A++VAPYKKVRRV FTKS
Sbjct  481   EILDVAVTGAMDKVLGEIPVAFVVRRDGS--TLTEAAVIDYLAQRVAPYKKVRRVVFTKS  538

Query  298   IPKSASGKILRKELRNLLITSKI  230
             IPKSA+GK+LR+ELR  L TSK+
Sbjct  539   IPKSAAGKVLRRELRKFL-TSKL  560



>ref|XP_004144410.1| PREDICTED: 4-coumarate--CoA ligase-like 6-like [Cucumis sativus]
 ref|XP_004160997.1| PREDICTED: 4-coumarate--CoA ligase-like 6-like [Cucumis sativus]
 gb|KGN58405.1| hypothetical protein Csa_3G638510 [Cucumis sativus]
Length=577

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/550 (62%), Positives = 415/550 (75%), Gaps = 20/550 (4%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRN--HGGLSALVDSQSGFSISYPELRSL  1670
             +YS +TGI RS H    LPSDPFLDVVSFI S    H G SAL+DS +G SISY EL  +
Sbjct  36    WYSPDTGICRSVHGYRKLPSDPFLDVVSFIFSFQFQHNGHSALIDSSTGNSISYKELFPM  95

Query  1669  VNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSF  1490
             V SMA+GLH +G+SQGDV L++LPNSI+FP+I LG L +GAV  TM P S+ SEIKK+  
Sbjct  96    VKSMASGLHNLGISQGDVVLLMLPNSIFFPIIILGALYLGAVVTTMFPQSSSSEIKKRIT  155

Query  1489  DCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLD-------SPFRKLISSDPKLAPTPR  1331
             DCNVRLAFA   +++N    LGI  IG+PE+ N +       S F +LIS    L   P 
Sbjct  156   DCNVRLAFAITQKIKNF-EALGIKTIGVPENTNFNLMRSMGFSSFYELISGGSDLIKKPV  214

Query  1330  IRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMY  1151
             IRQ+DTAA+LFSSGTTG  K V L+H NFI+ +ELFVRFEASQYEY  T NVYL  +PM+
Sbjct  215   IRQEDTAAILFSSGTTGVSKGVMLSHRNFISTIELFVRFEASQYEYLPTKNVYLAAVPMF  274

Query  1150  HVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADK  971
             H+YGLS+FVMGL+SLGS+VVV+ K++V +VV+AIDR+ VTHFPV PP+L AL R A  +K
Sbjct  275   HIYGLSIFVMGLMSLGSSVVVMSKFDVKDVVKAIDRFKVTHFPVVPPILTALARTA--EK  332

Query  970   CGL---KSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRN  800
              G+   +SLKQVS GAA  S   I NFV   PH+DFIQGYGMTESTAVGTRGFNT   RN
Sbjct  333   IGVHRFRSLKQVSCGAAASSKKTIDNFVHALPHVDFIQGYGMTESTAVGTRGFNTKNARN  392

Query  799   YTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDD  620
             Y SVGLLAPN EA+VVD  +G     +PP   GEL LRGP  MKGYLNN EA+   +D +
Sbjct  393   YLSVGLLAPNTEAKVVDWVTGSS---MPPGKTGELLLRGPGSMKGYLNNPEATTFTMDQE  449

Query  619   GWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSE  440
              WLHTGDIV+FD DGYLYV DRLKE+IKYKGFQIAP DLEAV+++HP+++D AV +A+ E
Sbjct  450   NWLHTGDIVYFDRDGYLYVVDRLKEVIKYKGFQIAPTDLEAVVITHPEVLDTAVAAAKDE  509

Query  439   EVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKE  260
             E GEIPVAFVVKK GS  +L+Q +V+D+VA+QVAPYKKVR+V FT+SIPKSA+GK+LR+E
Sbjct  510   ECGEIPVAFVVKKPGS--ALTQKDVVDYVAQQVAPYKKVRKVIFTESIPKSAAGKVLRRE  567

Query  259   LRNLLITSKI  230
             L+     SK+
Sbjct  568   LQKHFPASKL  577



>ref|XP_011028085.1| PREDICTED: 4-coumarate--CoA ligase-like 6 [Populus euphratica]
Length=554

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/558 (62%), Positives = 428/558 (77%), Gaps = 17/558 (3%)
 Frame = -2

Query  1876  NSAAEKGRRSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSR-NHGGLSALVDSQSGF  1700
              + A K +   +YS ETGIY SKHP + LP+DPFLDVVSFI S  NH GL+AL+DS SGF
Sbjct  5     TATASKTKLPEWYSPETGIYSSKHPPIPLPADPFLDVVSFIFSHHNHNGLTALIDSSSGF  64

Query  1699  SISYPELRSLVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLS  1520
             SISY ++  LV S+A+GL  MG+ QGDV L+LLPNSI+FP++FLG+L +G + +TMNPLS
Sbjct  65    SISYSKILPLVKSVASGLSNMGIKQGDVVLLLLPNSIHFPIVFLGVLYLGGIVSTMNPLS  124

Query  1519  TLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSP------FRKLISS  1358
             +  E+K++  DCN  +AF   ++V      LGIPVIG+PE++NLD        F  L+ S
Sbjct  125   SELEVKQRIIDCNACIAFVELEKVGKF-QPLGIPVIGVPENVNLDEKSNDFEAFYTLVYS  183

Query  1357  DPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATAN  1178
                +   P IRQQDTAA+++SSGTT   K V LTH NFI+MVE FV+FEASQYEY +T N
Sbjct  184   KGDVGVKPVIRQQDTAAIMYSSGTTAASKGVVLTHRNFISMVEHFVKFEASQYEYSSTDN  243

Query  1177  VYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVA  998
             VYL VLPM+H+YGLSLFV GLL LGS++VV+RK++V E+V+ IDRYGVTHFPV PP+L A
Sbjct  244   VYLAVLPMFHIYGLSLFVAGLLCLGSSIVVMRKFDVSEMVKVIDRYGVTHFPVVPPILTA  303

Query  997   LTRKAKADKCG--LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRG  824
             LTR AK   CG  LK LK VS GAAP+    IQ+FV   PH+DFIQGYG+TESTAVGTRG
Sbjct  304   LTRTAKG-VCGNSLKCLKLVSCGAAPLFGKTIQDFVEVLPHVDFIQGYGLTESTAVGTRG  362

Query  823   FNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEA  644
              NT K + Y+S+GLLAPN+EA+VVD S+G     LPP   GELW+RGP +MK YLN+GEA
Sbjct  363   LNTEKFQKYSSIGLLAPNIEAKVVDWSTGAL---LPPGGCGELWIRGPGVMKEYLNDGEA  419

Query  643   SKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDA  464
             +   +D DGWLHTGD+V+ D DGYLYV DRLKE+IKYKGFQIAPADLEAVL+SH +I+DA
Sbjct  420   TALTIDKDGWLHTGDVVYADHDGYLYVVDRLKEIIKYKGFQIAPADLEAVLISHCEILDA  479

Query  463   AVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSA  284
             AV     +E GEIPVAFVVK++GS   L+Q  +I++VA+QVAPYKKVR+V FT+SIPKSA
Sbjct  480   AVIPVVDKECGEIPVAFVVKRQGS--MLTQEAIINYVAEQVAPYKKVRKVIFTRSIPKSA  537

Query  283   SGKILRKELRNLLITSKI  230
             +GKILR+ELR  L TSK+
Sbjct  538   AGKILRRELRRSL-TSKL  554



>ref|XP_010518843.1| PREDICTED: 4-coumarate--CoA ligase-like 6 isoform X2 [Tarenaya 
hassleriana]
Length=565

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/566 (60%), Positives = 427/566 (75%), Gaps = 18/566 (3%)
 Frame = -2

Query  1906  NIHENISKIRNSAAEKGRRSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLS  1727
             ++H+N   +  +  E+     ++  ETGIY SK  SV LP DPFLD VS I S  H G  
Sbjct  4     DLHDNPDAMNPTKLEQ--PPYWFCPETGIYSSKFTSVQLPLDPFLDAVSAIFSHRHDGDV  61

Query  1726  ALVDSQSGFSISYPELRSLVNSMAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLSVG  1550
             ALVDS SGFSISY EL+ LV SMAAGLH  MGV QGDV L++L NS+YFPVIF  +L +G
Sbjct  62    ALVDSSSGFSISYAELQPLVKSMAAGLHHLMGVKQGDVVLLVLRNSVYFPVIFFSVLYLG  121

Query  1549  AVAATMNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNL------  1388
             A+  TMNP S+L EIKKQ  DCN  LAFA+PD V+ LG TLGI VI +PES +L      
Sbjct  122   AIVTTMNPSSSLEEIKKQVVDCNAGLAFASPDIVEKLG-TLGITVIRVPESCDLGSIQIK  180

Query  1387  DSPFRKLISSDPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEA  1208
             +S F  +I+ +  + P P I+Q D AA+++SSGTTG  K V LTH N IA +ELFVRF A
Sbjct  181   NSKFYDIINGNFGIVPKPLIKQDDAAAIMYSSGTTGASKGVLLTHGNLIAAMELFVRFGA  240

Query  1207  SQYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTH  1028
             SQYEY +++ VYL VLPM H+YGLSLF +GLLSLGST+VV+RK+++ EVVR I+R+ +TH
Sbjct  241   SQYEYSSSSCVYLAVLPMCHIYGLSLFAVGLLSLGSTIVVMRKFDIAEVVRVIERFKITH  300

Query  1027  FPVAPPLLVALTRKAKADKCG--LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGM  854
             FPV PP+LVALT++A+   CG   KSLKQV SGAAP+S   I++F++TFP +D IQGYGM
Sbjct  301   FPVVPPMLVALTKRAQG-VCGKSFKSLKQVFSGAAPLSWKFIEDFIQTFPSVDLIQGYGM  359

Query  853   TESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAI  674
             TESTAVG+RGFNT K + Y+SVGLLAPNM+A+V D SSG     LPP S GELW+RGP I
Sbjct  360   TESTAVGSRGFNTQKFKKYSSVGLLAPNMQAKVADWSSGSF---LPPGSQGELWIRGPGI  416

Query  673   MKGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAV  494
             MKGYLNN EA++  + +D WL TGDI +FD+DGYL++ DR+KE+IKYKGFQI+PADLEAV
Sbjct  417   MKGYLNNPEATQMVIIEDSWLRTGDIAYFDQDGYLFIIDRIKEIIKYKGFQISPADLEAV  476

Query  493   LMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRV  314
             L+SHP I+DAAVT+   EE GEIPVAFVV++   E ++S+ +VI++V  QVAPYKKVR+V
Sbjct  477   LVSHPGILDAAVTAVSHEECGEIPVAFVVRRP--ETTVSEQDVINYVGAQVAPYKKVRKV  534

Query  313   YFTKSIPKSASGKILRKELRNLLITS  236
             +   SIPKS SGKILR+ELR +L  S
Sbjct  535   FMVNSIPKSPSGKILRRELRRILSNS  560



>gb|AGO89326.1| Ca4CL9 [Salix arbutifolia]
Length=554

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/558 (62%), Positives = 427/558 (77%), Gaps = 17/558 (3%)
 Frame = -2

Query  1876  NSAAEKGRRSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSR-NHGGLSALVDSQSGF  1700
              + A K     +YS ETGIY SKHP++ LP+DPFLDVVSFI S  NH GL+AL+DS SGF
Sbjct  5     TATASKTTFPDWYSPETGIYSSKHPTIPLPADPFLDVVSFIFSHHNHNGLTALIDSSSGF  64

Query  1699  SISYPELRSLVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLS  1520
             SISY ++  LV S+A+GL  MG+ QGDV L+LLPNSI+FP++FLG+L +G + +TMNPLS
Sbjct  65    SISYSKILPLVKSVASGLRNMGIKQGDVVLLLLPNSIHFPIVFLGVLYLGGIVSTMNPLS  124

Query  1519  TLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSP------FRKLISS  1358
             +  E+KK+  DCN R+AF    +V      LGI VIG+ E++NLD        F   + S
Sbjct  125   SEPEVKKRIADCNARIAFVELKKVGKF-QPLGILVIGVQENVNLDEKSNDFEAFYMRLYS  183

Query  1357  DPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATAN  1178
                +   P IRQQDTAA+++SSGTT   K V LTH NFI+MVELFV+FEASQYEY +T N
Sbjct  184   KGDVGVKPVIRQQDTAAIMYSSGTTAASKGVVLTHRNFISMVELFVKFEASQYEYSSTDN  243

Query  1177  VYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVA  998
             VYL VLPM+H+YGLSLFV+GLLSLGS++VV+RK++V E V+ IDRYGVTHFPV PP+L A
Sbjct  244   VYLAVLPMFHIYGLSLFVVGLLSLGSSIVVMRKFDVSETVKVIDRYGVTHFPVVPPILTA  303

Query  997   LTRKAKADKCG--LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRG  824
             LTR AK   CG  LK LK VS GAAP+    IQ+FV   PH+DFIQGYG+TESTAVGTRG
Sbjct  304   LTRTAKG-VCGNSLKCLKVVSCGAAPLFAKTIQDFVEVLPHVDFIQGYGLTESTAVGTRG  362

Query  823   FNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEA  644
              NT K + Y+S+GLLAPN+EA+VVD  +G     LPP   GELW+RGP +MK YLN+GEA
Sbjct  363   LNTEKFKKYSSIGLLAPNIEAKVVDWITGTL---LPPGGSGELWIRGPGVMKEYLNDGEA  419

Query  643   SKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDA  464
             +   +D DGWLHTGD+V+ D DGYLYV DRLKE+IKYKGFQIAPADLEAVL+SH +I+DA
Sbjct  420   TALTIDKDGWLHTGDVVYTDHDGYLYVVDRLKEIIKYKGFQIAPADLEAVLISHCEILDA  479

Query  463   AVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSA  284
             AV  A  +E GEIPVAFVVK+KGS V  ++  +I++VA QVAPYKKVR+V FT+SIPKSA
Sbjct  480   AVIPAIDKECGEIPVAFVVKRKGSMV--TKEAIINYVADQVAPYKKVRKVIFTQSIPKSA  537

Query  283   SGKILRKELRNLLITSKI  230
             +GKILR+EL+N L TSK+
Sbjct  538   AGKILRRELKNSL-TSKL  554



>gb|AAP03017.1| 4-coumarate-CoA ligase-like protein [Arabidopsis thaliana]
Length=566

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/545 (60%), Positives = 424/545 (78%), Gaps = 16/545 (3%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             ++SS+TGIY SK PS+HLP DP LD VS + S  H G +AL+DS +GFSIS+ EL+ +V 
Sbjct  24    WFSSKTGIYTSKFPSLHLPVDPNLDAVSALFSHKHHGDTALIDSLTGFSISHTELQIMVQ  83

Query  1663  SMAAGL-HRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFD  1487
             SMAAG+ H +GV QGDV  ++LPNS+YFP+IFL L+S+GA+  TMNP S+L EIKKQ  +
Sbjct  84    SMAAGIYHVLGVRQGDVVSLVLPNSVYFPMIFLSLISLGAIVTTMNPSSSLGEIKKQVSE  143

Query  1486  CNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDS------PFRKLISSDPKLAPTPRIR  1325
             C+V LAF + + V+ L S+LG+ VI +PES + DS       F  ++       P P I+
Sbjct  144   CSVGLAFTSTENVEKL-SSLGVSVISVPESYDFDSIRIENPKFYSIMKESFGFVPKPLIK  202

Query  1324  QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHV  1145
             Q D AA+++SSGTTG  K V LTH N IA +ELFVRFEASQYEYP ++NVYL  LP+ H+
Sbjct  203   QDDVAAIMYSSGTTGASKGVLLTHRNLIASMELFVRFEASQYEYPGSSNVYLAALPLCHI  262

Query  1144  YGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCG  965
             YGLSLFVMGLLSLGST+VV+++++  +VV  I+R+ +THFPV PP+L+ALT+KAK   CG
Sbjct  263   YGLSLFVMGLLSLGSTIVVMKRFDASDVVNVIERFKITHFPVVPPMLMALTKKAKG-VCG  321

Query  964   --LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTS  791
                KSLKQVSSGAAP+S   I++F++T PH+D IQGYGMTESTAVGTRGFN+ KL  Y+S
Sbjct  322   EVFKSLKQVSSGAAPLSRKFIEDFLQTLPHVDLIQGYGMTESTAVGTRGFNSEKLSRYSS  381

Query  790   VGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWL  611
             VGLLAPNM+A+VVD SSG     LPP + GELW++GP +MKGYLNN +A++ ++ +D WL
Sbjct  382   VGLLAPNMQAKVVDWSSGSF---LPPGNRGELWIQGPGVMKGYLNNPKATQMSIVEDSWL  438

Query  610   HTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVG  431
              TGDI +FDEDGYL++ DR+KE+IKYKGFQIAPADLEAVL+SHP I+DAAVT+A +EE G
Sbjct  439   RTGDIAYFDEDGYLFIVDRIKEIIKYKGFQIAPADLEAVLVSHPLIIDAAVTAAPNEECG  498

Query  430   EIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRN  251
             EIPVAFVV+++  E +LS+ +VI +VA QVAPY+KVR+V    SIPKS +GKILRKEL+ 
Sbjct  499   EIPVAFVVRRQ--ETTLSEEDVISYVASQVAPYRKVRKVVMVNSIPKSPTGKILRKELKR  556

Query  250   LLITS  236
             +L  S
Sbjct  557   ILTNS  561



>ref|XP_002304364.1| 4-coumarate--CoA ligase family protein [Populus trichocarpa]
 gb|EEE79343.1| 4-coumarate--CoA ligase family protein [Populus trichocarpa]
Length=544

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/552 (62%), Positives = 425/552 (77%), Gaps = 15/552 (3%)
 Frame = -2

Query  1876  NSAAEKGRRSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSR-NHGGLSALVDSQSGF  1700
              + A K     +YS ETGIY SKHP + LP+DPFLDVVSFI S  NH GL+AL+DS SGF
Sbjct  5     TATASKTTLPEWYSPETGIYSSKHPPIPLPADPFLDVVSFIFSHHNHNGLTALIDSSSGF  64

Query  1699  SISYPELRSLVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLS  1520
             SISY ++  LV S+A+GL  MG+ QGDV L+LLPNSI+FP++FLG+L +G + +TMNPLS
Sbjct  65    SISYSKILPLVKSVASGLSNMGIKQGDVVLLLLPNSIHFPIVFLGVLYLGGIVSTMNPLS  124

Query  1519  TLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPFRKLISSDPKLAP  1340
             +  E+K++  DCN  +AF   ++V      LGIPVIG+PE++N D      I S   +  
Sbjct  125   SELEVKQRIVDCNACIAFVELEKVCKF-QPLGIPVIGVPENVNFDEK----IYSKGDVGV  179

Query  1339  TPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVL  1160
              P IRQQDTAA+++SSGTT   K V LTH NFI+MVELFV+FEASQYEY +T NVYL VL
Sbjct  180   KPVIRQQDTAAIMYSSGTTAASKGVVLTHRNFISMVELFVKFEASQYEYSSTDNVYLAVL  239

Query  1159  PMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK  980
             PM+H+YGLSLFV+GLLSLGS++VV+RK++V E+V+ IDRYGVTHFPV PP+L ALTR AK
Sbjct  240   PMFHIYGLSLFVVGLLSLGSSIVVMRKFDVSEMVKVIDRYGVTHFPVVPPILTALTRTAK  299

Query  979   ADKCG--LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKL  806
                CG  LK LK VS GAAP+    IQ+FV   PH+DFIQGYG+TESTAVGTRG NT K 
Sbjct  300   G-VCGNSLKCLKLVSCGAAPLFGKTIQDFVEVLPHVDFIQGYGLTESTAVGTRGLNTEKF  358

Query  805   RNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVD  626
             + Y+S+GLLAPN+EA+VVD  +G     LPP   GELW+RGP +MK YLN GEA+   +D
Sbjct  359   QKYSSIGLLAPNIEAKVVDWITGAL---LPPGGSGELWIRGPGVMKEYLNGGEATALTID  415

Query  625   DDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQ  446
              DGWLHTGD+V+ D DGYLYV DRLKE+IKYKGFQIAPADLEAVL+SH +I+DAAV    
Sbjct  416   KDGWLHTGDVVYADHDGYLYVVDRLKEIIKYKGFQIAPADLEAVLISHCEILDAAVIPVV  475

Query  445   SEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILR  266
              +E GEIPVAFVVK++GS   L+Q  +I++VA+QVAPYKKVR+V FT+SIPKSA+GKILR
Sbjct  476   DKECGEIPVAFVVKRQGS--MLTQEAIINYVAEQVAPYKKVRKVIFTQSIPKSAAGKILR  533

Query  265   KELRNLLITSKI  230
             +EL+  L TSK+
Sbjct  534   RELKCSL-TSKL  544



>ref|XP_010110411.1| 4-coumarate--CoA ligase-like 6 [Morus notabilis]
 gb|EXC26243.1| 4-coumarate--CoA ligase-like 6 [Morus notabilis]
Length=555

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/542 (64%), Positives = 423/542 (78%), Gaps = 15/542 (3%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYP-ELRSLV  1667
             +YS ETGI  S +  +  PSDPFLDVVSFI S+ H G+SALVDS SG S     EL  LV
Sbjct  16    WYSPETGICHSTNRPITFPSDPFLDVVSFIFSKQHNGVSALVDSSSGSSSISYSELHRLV  75

Query  1666  NSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFD  1487
              SMA+GLH MGVS+ DV L+LLPNS+YFPVI LG++ +GA+  TMNPLST++E+KKQ  D
Sbjct  76    KSMASGLHSMGVSKNDVVLLLLPNSVYFPVILLGVVYLGAIVTTMNPLSTVTEVKKQVAD  135

Query  1486  CNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLD----SPFR---KLISSDPKLAPTPRI  1328
                 LAF  P++V+ L     +  I +PE+ N      S FR   KL+S +   AP P I
Sbjct  136   SKACLAFTLPEKVELL-RAFRVGAIAVPENFNSSQKPMSSFREFYKLVSCEFDFAPRPLI  194

Query  1327  RQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYH  1148
             RQQDTAA+++SSGTTG  K V LTH NFIAMV+LFVRFEASQYEYP + NVYL VLPM+H
Sbjct  195   RQQDTAAIMYSSGTTGASKGVVLTHGNFIAMVDLFVRFEASQYEYPRSENVYLAVLPMFH  254

Query  1147  VYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKA-DK  971
             +YGL+LFVMGLLSLGST+VV+RK++V+++V+ I+ Y VTHFPV PP+L+ALT+ AK    
Sbjct  255   IYGLALFVMGLLSLGSTIVVMRKFDVNDMVKTIETYKVTHFPVVPPMLIALTKCAKVVGG  314

Query  970   CGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTS  791
              G +SLKQVSSGAAPIS   I++F+ T PH+DFIQGYGMTESTAVGTRGFNT K R ++S
Sbjct  315   KGFRSLKQVSSGAAPISGKIIEDFLHTLPHVDFIQGYGMTESTAVGTRGFNTKKCRKFSS  374

Query  790   VGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWL  611
             VGLL PNMEA+V+DL++G     LPP S GELWLRGPA+MKGYLNN  A+ +A+D DGWL
Sbjct  375   VGLLGPNMEAKVMDLNTGSF---LPPGSCGELWLRGPAVMKGYLNNAVATMSAIDKDGWL  431

Query  610   HTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVG  431
              TGDIV+FD+DGYL+V DRLKE+IKYKG+QIAPADLEAVL SHP+I D AV +A+  + G
Sbjct  432   RTGDIVYFDQDGYLHVVDRLKEIIKYKGYQIAPADLEAVLASHPEIRDVAVAAAEDADSG  491

Query  430   EIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRN  251
             E+PVAFVV+K GS  SLSQ  V+D+VA+QVAPYKK+R+V FT SIPKSA+GKILR+EL+ 
Sbjct  492   EVPVAFVVRKHGS--SLSQEAVMDYVARQVAPYKKIRKVVFTHSIPKSAAGKILRRELQK  549

Query  250   LL  245
              L
Sbjct  550   SL  551



>ref|XP_004512448.1| PREDICTED: 4-coumarate--CoA ligase-like 6-like [Cicer arietinum]
Length=555

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/544 (63%), Positives = 427/544 (78%), Gaps = 13/544 (2%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             +YSS+TGIY S H  ++LP+DPFLD+VSFI S  H G+ AL+DS SG SISY +L  L+ 
Sbjct  19    WYSSKTGIYNSTHSRLNLPTDPFLDIVSFIFSHPHDGVLALIDSSSGSSISYSKLLPLIK  78

Query  1663  SMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             SMA+GLH+MGVSQGDV L+LLPNSIY+P++ L +L +GAV   +NPLS++ EI+KQ  +C
Sbjct  79    SMASGLHKMGVSQGDVVLLLLPNSIYYPIVLLSVLYLGAVITPLNPLSSVREIRKQVSEC  138

Query  1483  NVRLAFATPDRVQNLGSTLGIPVIGLPES---LNLD--SPFRKLISSDPKLAPTPRIRQQ  1319
             +V LAF  P+ V+ L  T+ IP+I +PE+   L  D  S F  LI  +  L   P I+Q+
Sbjct  139   SVSLAFTVPENVKKL-ETISIPIIAVPENEKDLKNDCFSCFFNLIYGNFDLPQKPVIKQE  197

Query  1318  DTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVYG  1139
             DTA +L+SSGTTG  K V LTH N IAMVELFVRFEASQYEY +  NVYL  LPM+HVYG
Sbjct  198   DTAGILYSSGTTGVSKGVVLTHKNLIAMVELFVRFEASQYEYSSLNNVYLAALPMFHVYG  257

Query  1138  LSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK-ADKCGL  962
             LSLF  GLLSLGST++V+RK+++D+V+R ID+Y VTHF V PP++ ALT KAK  +   L
Sbjct  258   LSLFAAGLLSLGSTIIVMRKFDIDKVIRVIDKYNVTHFAVVPPMVSALTAKAKDVNGSKL  317

Query  961   KSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGL  782
             +SL+QVS GAA +S   I +FV+ FP++DFIQGYGMTESTAVGTRGFNT K RN +S+GL
Sbjct  318   QSLRQVSCGAASLSAGIINDFVQAFPNVDFIQGYGMTESTAVGTRGFNTEKFRNCSSIGL  377

Query  781   LAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTG  602
             LAPNMEA+VVD +SG     LPP S GELWLRGP+IM+GYLNN EA+ + +D+DGWLHTG
Sbjct  378   LAPNMEAKVVDFNSGEF---LPPGSSGELWLRGPSIMRGYLNNEEATMSTIDEDGWLHTG  434

Query  601   DIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIP  422
             DIV+FD++GYLY+ DRLK++IK+KGFQIAPADLEA+L+ HP+IVD AVT A+ EE GEIP
Sbjct  435   DIVYFDQNGYLYLSDRLKDIIKFKGFQIAPADLEALLILHPEIVDVAVTGAKDEETGEIP  494

Query  421   VAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNLLI  242
             VAFVVKK GS   LS  +VID++A+QVAPYKKVR+V FT  IP++ +GKILRK LRN L 
Sbjct  495   VAFVVKKAGS--VLSSKHVIDYIAEQVAPYKKVRKVVFTDKIPRTPAGKILRKNLRNCL-  551

Query  241   TSKI  230
             TSK+
Sbjct  552   TSKL  555



>ref|XP_010518842.1| PREDICTED: 4-coumarate--CoA ligase-like 6 isoform X1 [Tarenaya 
hassleriana]
Length=567

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/568 (60%), Positives = 426/568 (75%), Gaps = 20/568 (4%)
 Frame = -2

Query  1906  NIHENISKIRNSAAEKGRRSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLS  1727
             ++H+N   +  +  E+     ++  ETGIY SK  SV LP DPFLD VS I S  H G  
Sbjct  4     DLHDNPDAMNPTKLEQ--PPYWFCPETGIYSSKFTSVQLPLDPFLDAVSAIFSHRHDGDV  61

Query  1726  ALVDSQSGFSISYPELRSLVNSMAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLSVG  1550
             ALVDS SGFSISY EL+ LV SMAAGLH  MGV QGDV L++L NS+YFPVIF  +L +G
Sbjct  62    ALVDSSSGFSISYAELQPLVKSMAAGLHHLMGVKQGDVVLLVLRNSVYFPVIFFSVLYLG  121

Query  1549  AVAATMNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNL------  1388
             A+  TMNP S+L EIKKQ  DCN  LAFA+PD V+ LG TLGI VI +PES +L      
Sbjct  122   AIVTTMNPSSSLEEIKKQVVDCNAGLAFASPDIVEKLG-TLGITVIRVPESCDLGSIQIK  180

Query  1387  DSPFRKLISSDPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEA  1208
             +S F  +I+ +  + P P I+Q D AA+++SSGTTG  K V LTH N IA +ELFVRF A
Sbjct  181   NSKFYDIINGNFGIVPKPLIKQDDAAAIMYSSGTTGASKGVLLTHGNLIAAMELFVRFGA  240

Query  1207  SQYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTH  1028
             SQYEY +++ VYL VLPM H+YGLSLF +GLLSLGST+VV+RK+++ EVVR I+R+ +TH
Sbjct  241   SQYEYSSSSCVYLAVLPMCHIYGLSLFAVGLLSLGSTIVVMRKFDIAEVVRVIERFKITH  300

Query  1027  FPVAPPLLVALTRKAKADKCG--LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGM  854
             FPV PP+LVALT++A+   CG   KSLKQV SGAAP+S   I++F++TFP +D IQGYGM
Sbjct  301   FPVVPPMLVALTKRAQG-VCGKSFKSLKQVFSGAAPLSWKFIEDFIQTFPSVDLIQGYGM  359

Query  853   TESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAI  674
             TESTAVG+RGFNT K + Y+SVGLLAPNM+A+V D      GS LPP S GELW+RGP I
Sbjct  360   TESTAVGSRGFNTQKFKKYSSVGLLAPNMQAKVADW---SSGSFLPPGSQGELWIRGPGI  416

Query  673   MKGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAV  494
             MKGYLNN EA++  + +D WL TGDI +FD+DGYL++ DR+KE+IKYKGFQI+PADLEAV
Sbjct  417   MKGYLNNPEATQMVIIEDSWLRTGDIAYFDQDGYLFIIDRIKEIIKYKGFQISPADLEAV  476

Query  493   LMSHPDIVDAAVT--SAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVR  320
             L+SHP I+DAAVT  S   EE GEIPVAFVV++   E ++S+ +VI++V  QVAPYKKVR
Sbjct  477   LVSHPGILDAAVTAFSVSHEECGEIPVAFVVRRP--ETTVSEQDVINYVGAQVAPYKKVR  534

Query  319   RVYFTKSIPKSASGKILRKELRNLLITS  236
             +V+   SIPKS SGKILR+ELR +L  S
Sbjct  535   KVFMVNSIPKSPSGKILRRELRRILSNS  562



>ref|XP_008241220.1| PREDICTED: LOW QUALITY PROTEIN: 4-coumarate--CoA ligase-like 
6 [Prunus mume]
Length=573

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/572 (60%), Positives = 424/572 (74%), Gaps = 20/572 (3%)
 Frame = -2

Query  1918  PEPINIHENIS---KIRNSAAEKGRR-SCFYSSETGIYRSKHPSVHLPSDPFLDVVSFIL  1751
             P   N + +IS    I+N  A    +   ++S ETGIY+SKH S+ LPSDPFLDVVSFI 
Sbjct  4     PSNTNFNSHISGKQSIQNQKALAAEQFPWWFSPETGIYQSKHLSIDLPSDPFLDVVSFIF  63

Query  1750  SRNHGGLS-ALVDSQSGFSISYPELRSLVNSMAAGLHRMGVSQGDVALILLPNSIYFPVI  1574
             S  H G+S AL+ S  G +ISY +L S V SMA+ L +MG+SQGDV L+LLPNSIY+P++
Sbjct  64    SYQHDGVSSALIGSSCGSAISYSQLYSSVKSMASSLQQMGISQGDVLLLLLPNSIYYPIV  123

Query  1573  FLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESL  1394
             FLG+L +GA+  TMNPLS+++EIKKQ  +     AF  P+    L   LG+P I +PE  
Sbjct  124   FLGVLYLGAIVTTMNPLSSVAEIKKQIAETKACHAFTGPENADKL-QALGLPAIMVPEHA  182

Query  1393  NLD-------SPFRKLISSDPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAM  1235
              L        S F KLI S   LAP P I+QQDTAA+++SSGTTG  K V LTH NFIA 
Sbjct  183   FLSGLKEDIFSVFYKLIYSRFDLAPRPVIKQQDTAAIMYSSGTTGASKGVMLTHRNFIAT  242

Query  1234  VELFVRFEASQYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvR  1055
             V  FVRFEASQYE  +  NVYL VLPM+H+YGLSLFVMGLLSLGS VVV+++++V+E +R
Sbjct  243   VAHFVRFEASQYEGSSLDNVYLAVLPMFHIYGLSLFVMGLLSLGSRVVVMKRFDVNEAIR  302

Query  1054  AIDRYGVTHFPVAPPLLVALTRKAKADKC--GLKSLKQVSSGAAPISITCIQNFVRTFPH  881
             AIDRY VTHFPV PP+L ALT +AK       LKSLKQVS GAA +S+  I++FV+T P 
Sbjct  303   AIDRYKVTHFPVVPPILTALTTRAKDGLAPHTLKSLKQVSCGAALLSMKTIEDFVQTLPR  362

Query  880   IDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMG  701
             ID IQGYGMTE+TAVGTRGFNT KLR  +S+GLLAPNM+A+VVD ++G     LPPTS+G
Sbjct  363   IDLIQGYGMTETTAVGTRGFNTEKLRKPSSIGLLAPNMQAKVVDWNTGSP---LPPTSIG  419

Query  700   ELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQ  521
             ELWL GP IMKGYLNN +A+ + +D++GWLHTGDIV FDEDGYL++ DRLK+ IKYKGFQ
Sbjct  420   ELWLHGPGIMKGYLNNAKATLSTIDEEGWLHTGDIVFFDEDGYLHLQDRLKDAIKYKGFQ  479

Query  520   IAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQV  341
             IAPADLE VL++HP+I+D AV  A  EE GE+PVAFVV+K  SE  L+   V+DFVA QV
Sbjct  480   IAPADLEGVLINHPEILDVAVAGAIDEESGEVPVAFVVRKHRSE--LNHEAVMDFVAAQV  537

Query  340   APYKKVRRVYFTKSIPKSASGKILRKELRNLL  245
             APYKKVR+V F  SIPKS +GKILR+ELR  L
Sbjct  538   APYKKVRKVVFVDSIPKSLAGKILRRELRKFL  569



>ref|NP_193636.1| 4-coumarate--CoA ligase-like 6 [Arabidopsis thaliana]
 sp|Q84P24.2|4CLL6_ARATH RecName: Full=4-coumarate--CoA ligase-like 6; AltName: Full=4-coumarate--CoA 
ligase isoform 7; Short=At4CL7 [Arabidopsis 
thaliana]
 emb|CAA16758.1| 4-coumarate-CoA ligase-like [Arabidopsis thaliana]
 emb|CAB78903.1| 4-coumarate-CoA ligase-like [Arabidopsis thaliana]
 gb|AAQ86592.1| 4-coumarate CoA ligase isoform 7 [Arabidopsis thaliana]
 gb|AEE84125.1| 4-coumarate--CoA ligase-like 6 [Arabidopsis thaliana]
Length=566

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/545 (60%), Positives = 423/545 (78%), Gaps = 16/545 (3%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             ++SS+TGIY SK PS+HLP DP LD VS + S  H G +AL+DS +GFSIS+ EL+ +V 
Sbjct  24    WFSSKTGIYTSKFPSLHLPVDPNLDAVSALFSHKHHGDTALIDSLTGFSISHTELQIMVQ  83

Query  1663  SMAAGL-HRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFD  1487
             SMAAG+ H +GV QGDV  ++LPNS+YFP+IFL L+S+GA+  TMNP S+L EIKKQ  +
Sbjct  84    SMAAGIYHVLGVRQGDVVSLVLPNSVYFPMIFLSLISLGAIVTTMNPSSSLGEIKKQVSE  143

Query  1486  CNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDS------PFRKLISSDPKLAPTPRIR  1325
             C+V LAF + + V+ L S+LG+ VI + ES + DS       F  ++       P P I+
Sbjct  144   CSVGLAFTSTENVEKL-SSLGVSVISVSESYDFDSIRIENPKFYSIMKESFGFVPKPLIK  202

Query  1324  QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHV  1145
             Q D AA+++SSGTTG  K V LTH N IA +ELFVRFEASQYEYP ++NVYL  LP+ H+
Sbjct  203   QDDVAAIMYSSGTTGASKGVLLTHRNLIASMELFVRFEASQYEYPGSSNVYLAALPLCHI  262

Query  1144  YGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCG  965
             YGLSLFVMGLLSLGST+VV+++++  +VV  I+R+ +THFPV PP+L+ALT+KAK   CG
Sbjct  263   YGLSLFVMGLLSLGSTIVVMKRFDASDVVNVIERFKITHFPVVPPMLMALTKKAKG-VCG  321

Query  964   --LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTS  791
                KSLKQVSSGAAP+S   I++F++T PH+D IQGYGMTESTAVGTRGFN+ KL  Y+S
Sbjct  322   EVFKSLKQVSSGAAPLSRKFIEDFLQTLPHVDLIQGYGMTESTAVGTRGFNSEKLSRYSS  381

Query  790   VGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWL  611
             VGLLAPNM+A+VVD SSG     LPP + GELW++GP +MKGYLNN +A++ ++ +D WL
Sbjct  382   VGLLAPNMQAKVVDWSSGSF---LPPGNRGELWIQGPGVMKGYLNNPKATQMSIVEDSWL  438

Query  610   HTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVG  431
              TGDI +FDEDGYL++ DR+KE+IKYKGFQIAPADLEAVL+SHP I+DAAVT+A +EE G
Sbjct  439   RTGDIAYFDEDGYLFIVDRIKEIIKYKGFQIAPADLEAVLVSHPLIIDAAVTAAPNEECG  498

Query  430   EIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRN  251
             EIPVAFVV+++  E +LS+ +VI +VA QVAPY+KVR+V    SIPKS +GKILRKEL+ 
Sbjct  499   EIPVAFVVRRQ--ETTLSEEDVISYVASQVAPYRKVRKVVMVNSIPKSPTGKILRKELKR  556

Query  250   LLITS  236
             +L  S
Sbjct  557   ILTNS  561



>ref|XP_003612659.1| 4-coumarate-CoA ligase [Medicago truncatula]
 gb|AES95617.1| acyl:CoA ligase [Medicago truncatula]
Length=555

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/539 (63%), Positives = 407/539 (76%), Gaps = 12/539 (2%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             +YS +TGIY S H    LP+DPFLDVV FI S  H G+ AL+DS SG SISY  L +LV 
Sbjct  19    WYSPKTGIYNSIHSPRSLPTDPFLDVVCFIFSHPHDGVLALIDSLSGTSISYSNLLTLVK  78

Query  1663  SMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             S+A+GLH+MGVSQGDV L+LLPNSIY+P+  L ++ +GAV   +NPLS++ EI+K+  DC
Sbjct  79    SLASGLHKMGVSQGDVVLLLLPNSIYYPIALLSVMYLGAVVTPLNPLSSVDEIRKRVNDC  138

Query  1483  NVRLAFATPDRVQNLGSTLGIPVIGLPESLN-----LDSPFRKLISSDPKLAPTPRIRQQ  1319
              V  AF  P+ V+ L   LGIP+I +PE+         S F  LIS +  L     I+Q+
Sbjct  139   GVSFAFTIPENVKKL-EPLGIPIISVPENEKDLKHACFSCFFNLISGNFVLPQKSVIKQE  197

Query  1318  DTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVYG  1139
             DTAA+LFSSGTTG  K V LTH N IAMVEL  RFEAS+YEY ++ NVYLDVLPM+H+YG
Sbjct  198   DTAAILFSSGTTGVSKGVVLTHRNLIAMVELSARFEASKYEYSSSKNVYLDVLPMFHLYG  257

Query  1138  LSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKA-DKCGL  962
             LSLF  GLLSLGST+VV+RK+++DE +R ID+Y VTHF V PP+L ALT KAK  +   L
Sbjct  258   LSLFATGLLSLGSTIVVMRKFDIDETIRVIDKYNVTHFHVVPPILTALTAKAKGVNGSKL  317

Query  961   KSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGL  782
             +SL+QV S AAP++   I +FV+ FPH+DFIQGYGMTES  VG  GFNT K RNY+S+GL
Sbjct  318   QSLRQVGSSAAPLTTKAINDFVQAFPHVDFIQGYGMTESGTVGACGFNTEKFRNYSSLGL  377

Query  781   LAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTG  602
             LAPNMEA+VVD +SG     LPP   GELWLRGP+ MKGYLNN EA+ + VD DGWLHTG
Sbjct  378   LAPNMEAKVVDWNSGAF---LPPGRSGELWLRGPSTMKGYLNNEEATMSTVDKDGWLHTG  434

Query  601   DIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIP  422
             DIV+FD+DGYLY+ DRLKE IKYKGFQI PADLEAVL+ HP+I D AVT A+ EE GEIP
Sbjct  435   DIVYFDQDGYLYLSDRLKEFIKYKGFQIPPADLEAVLILHPEIADVAVTGAKDEEAGEIP  494

Query  421   VAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNLL  245
             VAFVVKK GS   LS  +VIDFVAKQVAP+KKVR+V FT  IP+S +GKILRK+LRN L
Sbjct  495   VAFVVKKVGS--VLSPKDVIDFVAKQVAPFKKVRKVVFTDKIPRSVTGKILRKQLRNCL  551



>dbj|BAC42032.1| putative 4-coumarate-CoA ligase [Arabidopsis thaliana]
 gb|AAO64847.1| At4g19010 [Arabidopsis thaliana]
Length=566

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/545 (60%), Positives = 422/545 (77%), Gaps = 16/545 (3%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             ++SS+TGIY SK PS+HLP DP LD VS + S  H G +AL+DS +GFSIS+ EL+ +V 
Sbjct  24    WFSSKTGIYTSKFPSLHLPVDPNLDAVSALFSHKHHGDTALIDSLTGFSISHTELQIMVQ  83

Query  1663  SMAAG-LHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFD  1487
             SMAAG  H +GV QGDV  ++LPNS+YFP+IFL L+S+GA+  TMNP S+L EIKKQ  +
Sbjct  84    SMAAGTYHVLGVRQGDVVSLVLPNSVYFPMIFLSLISLGAIVTTMNPSSSLGEIKKQVSE  143

Query  1486  CNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDS------PFRKLISSDPKLAPTPRIR  1325
             C+V LAF + + V+ L S+LG+ VI + ES + DS       F  ++       P P I+
Sbjct  144   CSVGLAFTSTENVEKL-SSLGVSVISVSESYDFDSIRIENPKFYSIMKESFGFVPKPLIK  202

Query  1324  QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHV  1145
             Q D AA+++SSGTTG  K V LTH N IA +ELFVRFEASQYEYP ++NVYL  LP+ H+
Sbjct  203   QDDVAAIMYSSGTTGASKGVLLTHRNLIASMELFVRFEASQYEYPGSSNVYLAALPLCHI  262

Query  1144  YGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCG  965
             YGLSLFVMGLLSLGST+VV+++++  +VV  I+R+ +THFPV PP+L+ALT+KAK   CG
Sbjct  263   YGLSLFVMGLLSLGSTIVVMKRFDASDVVNVIERFKITHFPVVPPMLMALTKKAKG-VCG  321

Query  964   --LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTS  791
                KSLKQVSSGAAP+S   I++F++T PH+D IQGYGMTESTAVGTRGFN+ KL  Y+S
Sbjct  322   EVFKSLKQVSSGAAPLSRKFIEDFLQTLPHVDLIQGYGMTESTAVGTRGFNSEKLSRYSS  381

Query  790   VGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWL  611
             VGLLAPNM+A+VVD SSG     LPP + GELW++GP +MKGYLNN +A++ ++ +D WL
Sbjct  382   VGLLAPNMQAKVVDWSSGSF---LPPGNRGELWIQGPGVMKGYLNNPKATQMSIVEDSWL  438

Query  610   HTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVG  431
              TGDI +FDEDGYL++ DR+KE+IKYKGFQIAPADLEAVL+SHP I+DAAVT+A +EE G
Sbjct  439   RTGDIAYFDEDGYLFIVDRIKEIIKYKGFQIAPADLEAVLVSHPLIIDAAVTAAPNEECG  498

Query  430   EIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRN  251
             EIPVAFVV+++  E +LS+ +VI +VA QVAPY+KVR+V    SIPKS +GKILRKEL+ 
Sbjct  499   EIPVAFVVRRQ--ETTLSEEDVISYVASQVAPYRKVRKVVMVNSIPKSPTGKILRKELKR  556

Query  250   LLITS  236
             +L  S
Sbjct  557   ILTNS  561



>ref|XP_008791017.1| PREDICTED: 4-coumarate--CoA ligase-like 6 [Phoenix dactylifera]
Length=556

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/536 (62%), Positives = 402/536 (75%), Gaps = 11/536 (2%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             F+S ET +Y SKHP   LP +PF D+VSF+ S  H G++ALVDS SGFSISY +LR +V 
Sbjct  20    FFSPETSVYTSKHPPRDLPENPFQDLVSFLFSHGHQGVTALVDSVSGFSISYRKLRDMVE  79

Query  1663  SMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             SMA+GL  +G+S G V LILLPN+I FPVI LG++SVGA+  TMNPLS   EIKKQ+   
Sbjct  80    SMASGLDHIGISSGHVVLILLPNTILFPVILLGVMSVGAIVTTMNPLSKPGEIKKQTSIS  139

Query  1483  NVRLAFATPDRVQNLGSTLGIPVIGLPESLNLD----SPFRKLISSDPKLAPTPRIRQQD  1316
              V L F   + V      LG+ V+ +PE L+ D    S F +L+S DPK AP P IRQ D
Sbjct  140   KVGLVFTFSENVGKFDG-LGVRVVTVPERLDFDAAQFSGFSQLLSRDPKQAPKPLIRQTD  198

Query  1315  TAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVYGL  1136
              AA+LFSSGT+G  K V +THANFIAMVELFVRFEASQY   +  NVYL  +PM+HVYGL
Sbjct  199   AAAILFSSGTSGLSKGVVITHANFIAMVELFVRFEASQYHTESWKNVYLAAVPMFHVYGL  258

Query  1135  SLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK-ADKCGLK  959
             SLF MGLLSLGSTVVV+R++  +E +R ID Y VTHFPV PP+L AL ++ K +  C L+
Sbjct  259   SLFTMGLLSLGSTVVVMRRFTAEEALRVIDGYKVTHFPVVPPMLAALLKRVKDSSGCDLR  318

Query  958   SLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGLL  779
             SL QVS GAAP+S   IQ+F+  FPH+D IQGYGMTESTAV TRGFNTA  + YTSVGLL
Sbjct  319   SLTQVSCGAAPLSEKLIQDFLEVFPHVDLIQGYGMTESTAVATRGFNTADCKQYTSVGLL  378

Query  778   APNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTGD  599
             APNMEA+++DL +G     LPP  MGELWLRGPAIMKGYLN  EA+ + + D GWL TGD
Sbjct  379   APNMEAKIIDLKTGSA---LPPGIMGELWLRGPAIMKGYLNGEEAASSTIADGGWLRTGD  435

Query  598   IVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIPV  419
             I HFD+DGYLYV DRLK+ IKYKG+QIAPADLEA+L+ HP+I+D AVT A  EE GEIPV
Sbjct  436   IAHFDQDGYLYVLDRLKDTIKYKGYQIAPADLEALLIHHPEILDVAVTFAADEEAGEIPV  495

Query  418   AFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRN  251
             AFVV++ GS   LS + VI+++++ VAP KKVR+V F  SIPKSA+GK+LR+ LR+
Sbjct  496   AFVVRRPGS--VLSSSEVIEYISQLVAPCKKVRKVVFVNSIPKSAAGKVLRRLLRD  549



>ref|XP_008381603.1| PREDICTED: 4-coumarate--CoA ligase-like 6 [Malus domestica]
Length=571

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/548 (62%), Positives = 423/548 (77%), Gaps = 16/548 (3%)
 Frame = -2

Query  1846  CFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLS-ALVDSQSGFSISYPELRSL  1670
              ++S ETGIY SKHP + LP++ FLDVV+FI S  H G+S AL+DS SG S+SY +L S 
Sbjct  31    WWFSPETGIYCSKHPEITLPTNHFLDVVTFIFSHQHTGVSPALIDSSSGSSLSYSQLYSF  90

Query  1669  VNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSF  1490
             V S A+GL +MG+SQGDV L LLPNSIY+P++FLG+L  GA+  TMNPLS++ EIKKQ  
Sbjct  91    VKSFASGLRQMGISQGDVVLFLLPNSIYYPIVFLGVLYAGAIVTTMNPLSSVEEIKKQVG  150

Query  1489  DCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSP------FRKLISSDPKLAPTPRI  1328
             D     AF   + V  L   LG+P + +PE+  LDS       F KL++ +  LAP P I
Sbjct  151   DSKACHAFTGLEYVGKL-QALGVPAVLVPENAVLDSKNEAFSVFYKLVNGNVGLAPRPVI  209

Query  1327  RQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYH  1148
             RQQDTAA+++SSGTTG  K V +TH NFIA VELFVRFEASQYE  + ++VYLDVLP++H
Sbjct  210   RQQDTAAIMYSSGTTGASKGVVITHRNFIAAVELFVRFEASQYEGSSLSDVYLDVLPLFH  269

Query  1147  VYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKAD--  974
             +YGL LFVMGL SLGS +VV++K++V EVV+AI++Y VTHFPV PP+L ALT KAK    
Sbjct  270   IYGLLLFVMGLFSLGSRIVVMKKFDVSEVVKAIEKYKVTHFPVVPPILTALTAKAKDGLA  329

Query  973   KCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYT  794
             K  LKSLKQVSSGAAP+S   I++FVRT PH+D IQGYGMTE+TAVGTRGFNT  L+  +
Sbjct  330   KQSLKSLKQVSSGAAPLSAKSIEDFVRTLPHVDLIQGYGMTETTAVGTRGFNTESLKKPS  389

Query  793   SVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGW  614
             S+GLLAPNM+A+VVD  +G     LPPTS GELWLRGP IM GYLNN +A+ + +D++GW
Sbjct  390   SIGLLAPNMQAKVVDWKTGSP---LPPTSSGELWLRGPGIMNGYLNNADATMSTIDEEGW  446

Query  613   LHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEV  434
             LHTGDIV+FDEDGYLY+ DRLK+ IKYKGFQIAPADLE VL++HP+I+D AV     EE 
Sbjct  447   LHTGDIVYFDEDGYLYLQDRLKDAIKYKGFQIAPADLEGVLINHPEILDVAVAGVVDEES  506

Query  433   GEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELR  254
             GEIPVAFVV+K GS +   + NV+DFVA QVAPYKKVR+V FT SIPKSA+GKILR+ELR
Sbjct  507   GEIPVAFVVRKHGSRI--LEDNVMDFVAAQVAPYKKVRKVVFTDSIPKSAAGKILRRELR  564

Query  253   NLLITSKI  230
              +L TS++
Sbjct  565   KVL-TSRL  571



>ref|XP_010087995.1| 4-coumarate--CoA ligase-like 6 [Morus notabilis]
 gb|EXB31005.1| 4-coumarate--CoA ligase-like 6 [Morus notabilis]
Length=554

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/542 (61%), Positives = 414/542 (76%), Gaps = 11/542 (2%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             +YS ETGIY S HP  +LPSD FLDVVSF+ S  H G+SAL+D+ SG SI Y EL S V 
Sbjct  20    WYSPETGIYNSTHPPRNLPSDTFLDVVSFLFSCQHKGVSALIDASSGVSIPYSELYSSVK  79

Query  1663  SMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             SMA+GLH  GV++GDV L++LPNSIYFPV+ LG+L  GA+   MNPLS+++EI+K+  DC
Sbjct  80    SMASGLHSTGVTKGDVVLVMLPNSIYFPVVLLGVLHSGAIFTPMNPLSSVTEIEKRVADC  139

Query  1483  NVRLAFATPDRVQNLGSTLGIPVIGLPE---SLNLDSPFRKLISSDPKLAPTPRIRQQDT  1313
                LAF  P++V ++   LG+  IG+P+   SL     F KLISSD  LA  P I Q+DT
Sbjct  140   KPCLAFTVPEKV-DIFRKLGVAAIGVPDQNVSLGDFLDFSKLISSDYNLASRPLIMQEDT  198

Query  1312  AAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVYGLS  1133
             AA+++SSGTTG  K V L+H NFIAM+ELFVRFEASQY+YP++  VYL VLPM+HVYGL+
Sbjct  199   AAIMYSSGTTGLSKGVVLSHGNFIAMIELFVRFEASQYDYPSSEIVYLAVLPMFHVYGLA  258

Query  1132  LFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKC-GLKS  956
              F MGL SLGSTVVV+RK++++EV RA+++Y VTH    PP+L ALT+ AK +     +S
Sbjct  259   YFAMGLFSLGSTVVVMRKFDMNEVARAVEKYRVTHIAAVPPILTALTKAAKNNGGKSFRS  318

Query  955   LKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGLLA  776
             LKQVSSGAAP S   I+  V+ FPH+DFIQGYGMTESTA+GTRGFNT   R+Y+S GLLA
Sbjct  319   LKQVSSGAAPPSRKMIEELVQVFPHVDFIQGYGMTESTAIGTRGFNTKNCRDYSSAGLLA  378

Query  775   PNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTGDI  596
             PN +A+VVD  +G     LPP + GELWLRGP +MKGYLNN   + +++D DGWL TGDI
Sbjct  379   PNTQAKVVDWKTGSL---LPPGNSGELWLRGPGVMKGYLNNDSTTMSSIDKDGWLRTGDI  435

Query  595   VHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIPVA  416
              +FD++GYLY+ DRLKEMIKYKGFQIAPADLEAVL SHP+I+D  VT+   E+ GEIPVA
Sbjct  436   AYFDQNGYLYIVDRLKEMIKYKGFQIAPADLEAVLASHPEILDVGVTAVMDEDCGEIPVA  495

Query  415   FVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNLLITS  236
             FVV+K+GS  SL   +VI+ VA+QVAPYKK+R+V FT SIPKS +GKILR+ELR  L TS
Sbjct  496   FVVRKQGS--SLCHEDVINHVARQVAPYKKIRKVVFTNSIPKSPAGKILRRELRESL-TS  552

Query  235   KI  230
             K+
Sbjct  553   KL  554



>ref|XP_008236197.1| PREDICTED: 4-coumarate--CoA ligase-like 6 [Prunus mume]
Length=574

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/573 (60%), Positives = 424/573 (74%), Gaps = 21/573 (4%)
 Frame = -2

Query  1918  PEPINIHENIS---KIRNSAAEKGRRSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILS  1748
             P   N + +IS    I   A    +   ++S ETGIY+SKH S+ LPSDPFLD+VSFI S
Sbjct  4     PSNTNFNSHISGKQSINQKALAAEQFPWWFSPETGIYQSKHLSIDLPSDPFLDIVSFIFS  63

Query  1747  RNHGGLS-ALVDSQSGFSISYPELRSLVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIF  1571
               H G+S AL+ S  G +ISY +L S V SMA+GL +MG+SQGDV L+LLPNSIY+P+ F
Sbjct  64    HQHDGVSSALIGSSCGSAISYSQLYSSVKSMASGLQQMGISQGDVVLLLLPNSIYYPIAF  123

Query  1570  LGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLP----  1403
             LG+L +GA+  TMNPLS L+EIKKQ  D     AF  P+    L   LGI VI +P    
Sbjct  124   LGVLYLGAIVTTMNPLSNLAEIKKQIADTKACHAFTGPENADKL-QALGIHVILVPANAI  182

Query  1402  -----ESLNLDSPFRKLISSDPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIA  1238
                   S ++ S F KLI S   LA  P I+QQDTAA+++SSGTTG  K V +TH NFIA
Sbjct  183   SGLKGSSKDIFSVFYKLIYSRCYLALRPVIKQQDTAAIMYSSGTTGVSKGVMITHRNFIA  242

Query  1237  MVELFVRFEASQYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevv  1058
              V  FVRFEASQYE  +  NVYL VLP++H+YGLSLFVMGLLSLGS +VV+++++V+EV+
Sbjct  243   TVAHFVRFEASQYEASSLDNVYLAVLPLFHIYGLSLFVMGLLSLGSRIVVMKRFDVNEVI  302

Query  1057  RAIDRYGVTHFPVAPPLLVALTRKAKADKC--GLKSLKQVSSGAAPISITCIQNFVRTFP  884
             RAIDRY VTHFPV PP+L ALT++AK       LKSLKQ+S GAA +S+  I++FV+TFP
Sbjct  303   RAIDRYKVTHFPVVPPVLTALTKRAKDGLAPHSLKSLKQISCGAALLSMKTIEDFVQTFP  362

Query  883   HIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSM  704
             HID IQGYGMTE+TAVGTRGFNT KLR  +S+G+LAPNM+A+VVD ++G     +PPTS 
Sbjct  363   HIDLIQGYGMTETTAVGTRGFNTEKLRKPSSIGVLAPNMQAKVVDWNTGSP---MPPTST  419

Query  703   GELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGF  524
             GELWL GP IMKGYLNN +A+ + +D++GWLHTGDIV FDEDGYL++ DRLK+ IKYKGF
Sbjct  420   GELWLHGPGIMKGYLNNAKATLSTIDEEGWLHTGDIVFFDEDGYLHLQDRLKDAIKYKGF  479

Query  523   QIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQ  344
             QIAPADLE VL++HP+I+D AV  A  EE GE+PVAFVV+K  SE  L+   V+DFVA Q
Sbjct  480   QIAPADLEGVLINHPEILDVAVAGAMDEESGEVPVAFVVRKHRSE--LNHDAVMDFVAAQ  537

Query  343   VAPYKKVRRVYFTKSIPKSASGKILRKELRNLL  245
             VAPYKKVR+V F  SIPKS +GKILR+ELR  L
Sbjct  538   VAPYKKVRKVVFVDSIPKSPAGKILRRELRKFL  570



>ref|XP_006414022.1| hypothetical protein EUTSA_v10024787mg [Eutrema salsugineum]
 gb|ESQ55475.1| hypothetical protein EUTSA_v10024787mg [Eutrema salsugineum]
Length=570

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/565 (59%), Positives = 422/565 (75%), Gaps = 20/565 (4%)
 Frame = -2

Query  1900  HENISKIRNSAAEKGRRSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGG----  1733
             H +IS    +         ++S ETG+Y SK PS+HLP DP LD VS + S  H G    
Sbjct  5     HLHISSNSKTPTSLQNPPLWFSPETGMYTSKFPSLHLPVDPNLDAVSALFSHIHDGDDAA  64

Query  1732  LSALVDSQSGFSISYPELRSLVNSMAAGL-HRMGVSQGDVALILLPNSIYFPVIFLGLLS  1556
              +A VDS +GFSISY ELR +V SMAAG+ H +GV QGDV  ++LPNS+YFPVIFL L+S
Sbjct  65    SAAFVDSSTGFSISYTELRVMVKSMAAGIYHDLGVRQGDVVSLVLPNSVYFPVIFLSLIS  124

Query  1555  VGAVAATMNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDS--  1382
             +GA+  T+NP S+L EIKKQ  +CNV LAF + +  + L S+LGI VI +PES + DS  
Sbjct  125   LGAIVTTVNPSSSLGEIKKQVSECNVGLAFTSHENFEKL-SSLGIVVIRVPESYDFDSFR  183

Query  1381  ----PFRKLISSDPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRF  1214
                  F  +I  D    P P I Q D AA+++SSGTTG  K V LTH N IA +ELFVRF
Sbjct  184   IENPKFYAIIKRDFGFVPKPLINQDDVAAIMYSSGTTGASKGVLLTHRNLIATMELFVRF  243

Query  1213  EASQYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGV  1034
             EASQYEYP ++NVYL  LP+ H+YGLSLFV+GLLSLGST+VV+R+++  +V+  I+R+ +
Sbjct  244   EASQYEYPGSSNVYLAALPLCHIYGLSLFVLGLLSLGSTIVVMRRFDASDVINVIERFKI  303

Query  1033  THFPVAPPLLVALTRKAKADKCG--LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGY  860
             THFPV PP+L+ALT+KAK   CG   KSLKQVS GAAP+S   I++F+ T PH+D IQGY
Sbjct  304   THFPVVPPMLMALTKKAKG-VCGEVFKSLKQVSCGAAPLSRKFIEDFLGTLPHVDLIQGY  362

Query  859   GMTESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGP  680
             GMTESTAVGTRGFN+ KLR Y+SVGLLAPNM+A+VVD SSG     LPP + GELW++GP
Sbjct  363   GMTESTAVGTRGFNSQKLRKYSSVGLLAPNMQAKVVDWSSGSF---LPPGNRGELWIQGP  419

Query  679   AIMKGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLE  500
              +MKGYLNN EA++  + +D WL TGDI +FDEDGYL++ DR+KE+IKYKGFQIAPADLE
Sbjct  420   GVMKGYLNNPEATQMTISEDSWLRTGDIAYFDEDGYLFIVDRIKEIIKYKGFQIAPADLE  479

Query  499   AVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVR  320
             AVL+SHP I+DAAVT+A  EE GEIPVAFVV+++  E +LS+ +VI +VA QVAPY+KVR
Sbjct  480   AVLVSHPLIIDAAVTAAPDEECGEIPVAFVVRRQ--ETTLSEQDVISYVAAQVAPYRKVR  537

Query  319   RVYFTKSIPKSASGKILRKELRNLL  245
             +V    SIPKS +GKILRKEL+ +L
Sbjct  538   KVVMVSSIPKSPTGKILRKELKRIL  562



>ref|XP_007203932.1| hypothetical protein PRUPE_ppa017093mg [Prunus persica]
 gb|EMJ05131.1| hypothetical protein PRUPE_ppa017093mg [Prunus persica]
Length=565

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/546 (62%), Positives = 413/546 (76%), Gaps = 15/546 (3%)
 Frame = -2

Query  1855  RRSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLS-ALVDSQSGFSISYPEL  1679
             R   ++S ETGIY+SKH S+ LPSDPFLDVVSFI S  H G+S AL+ S  G +ISY +L
Sbjct  22    RFPWWFSPETGIYQSKHLSIDLPSDPFLDVVSFIFSYQHDGVSSALIGSSCGSAISYSQL  81

Query  1678  RSLVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKK  1499
              S V SMA+GL +MG+SQGDV L+LLPNSIY+P+ FLG+L +GA+  TMNPLS+++EIKK
Sbjct  82    YSSVKSMASGLQQMGISQGDVILLLLPNSIYYPIAFLGVLYLGAIVTTMNPLSSVAEIKK  141

Query  1498  QSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESL------NLDSPFRKLISSDPKLAPT  1337
             Q  D     AF  P+    L   LGIP I +PE+       ++ S F KLI S   LAP 
Sbjct  142   QIADTKACHAFTGPENADKL-QALGIPAILVPENALSGLKEDIFSVFYKLIYSRFDLAPR  200

Query  1336  PRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLP  1157
             P I+QQDTAA+++SSGTTG  K V LTH N IA +  FVRFEASQYE  +  NVYL VLP
Sbjct  201   PVIKQQDTAAIMYSSGTTGVSKGVMLTHRNCIATIAHFVRFEASQYEGSSLDNVYLAVLP  260

Query  1156  MYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKA  977
             ++H+YGLSLFVMGLLSLGS VVV+++++V+EV+RAIDRY VTHFPV PP+L ALT +AK 
Sbjct  261   LFHIYGLSLFVMGLLSLGSIVVVMKRFDVNEVIRAIDRYKVTHFPVVPPVLTALTTRAKD  320

Query  976   DKC--GLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLR  803
                   LKSLKQVS GAA +S+  I++FV+T P ID IQGYGMTE+TAVGTRGFNT KLR
Sbjct  321   GLAPHSLKSLKQVSCGAAQLSMKTIEDFVQTLPDIDLIQGYGMTETTAVGTRGFNTEKLR  380

Query  802   NYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDD  623
               +S+GLLAPNM+A+VVD  +G     LPPTS GELWL GP IMKGYLNN  A+ + +D+
Sbjct  381   KPSSIGLLAPNMQAKVVDWDTGSP---LPPTSTGELWLHGPGIMKGYLNNANATLSTIDE  437

Query  622   DGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQS  443
             +GWLHTGDIV FDEDGYL++ DRLK+ IKYKGFQIAPADLE VL++HP+I+D AV  A  
Sbjct  438   EGWLHTGDIVFFDEDGYLHLQDRLKDAIKYKGFQIAPADLEGVLINHPEILDVAVAGAMD  497

Query  442   EEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRK  263
             EE GE+PVAFVV+K  SE  L+   V+DFVA QVAPYKKVR+V F  SIPKS +GKILR+
Sbjct  498   EESGEVPVAFVVRKHISE--LNHDAVMDFVAAQVAPYKKVRKVVFVDSIPKSPAGKILRR  555

Query  262   ELRNLL  245
             ELR  L
Sbjct  556   ELRKSL  561



>ref|XP_002304363.1| hypothetical protein POPTR_0003s09880g [Populus trichocarpa]
 gb|EEE79342.1| hypothetical protein POPTR_0003s09880g [Populus trichocarpa]
Length=557

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/565 (61%), Positives = 425/565 (75%), Gaps = 28/565 (5%)
 Frame = -2

Query  1876  NSAAEKGRRSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSR-NHGGLSALVDSQSGF  1700
              + A K     +YS ETGIY SKHP + LP+DPFLDVVSFI S  NH GL+AL+DS SGF
Sbjct  5     TATASKTTLPEWYSPETGIYSSKHPPIPLPADPFLDVVSFIFSHHNHNGLTALIDSSSGF  64

Query  1699  SISYPELRSLVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLS  1520
             SISY ++  LV S+A+GL  MG+ QGDV L+LLPNSI+FP++FLG+L +G + +TMNPLS
Sbjct  65    SISYSKILPLVKSVASGLSNMGIKQGDVVLLLLPNSIHFPIVFLGVLYLGGIVSTMNPLS  124

Query  1519  TLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPFRKLISSDPKLAP  1340
             +  E+K++  DCN  +AF   ++V      LGIPVIG+PE++N D      I S   +  
Sbjct  125   SELEVKQRIVDCNACIAFVELEKVCKF-QPLGIPVIGVPENVNFDEK----IYSKGDVGV  179

Query  1339  TPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVL  1160
              P IRQQDTAA+++SSGTT   K V LTH NFI+MVELFV+FEASQYEY +T NVYL VL
Sbjct  180   KPVIRQQDTAAIMYSSGTTAASKGVVLTHRNFISMVELFVKFEASQYEYSSTDNVYLAVL  239

Query  1159  PMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK  980
             PM+H+YGLSLFV+GLLSLGS++VV+RK++V E+V+ IDRYGVTHFPV PP+L ALTR AK
Sbjct  240   PMFHIYGLSLFVVGLLSLGSSIVVMRKFDVSEMVKVIDRYGVTHFPVVPPILTALTRTAK  299

Query  979   ADKCG--LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKL  806
                CG  LK LK VS GAAP+    IQ+FV   PH+DFIQGYG+TESTAVGTRG NT K 
Sbjct  300   G-VCGNSLKCLKLVSCGAAPLFGKTIQDFVEVLPHVDFIQGYGLTESTAVGTRGLNTEKF  358

Query  805   RNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVD  626
             + Y+S+GLLAPN+EA+VVD      G+ LPP   GELW+RGP +MK YLN GEA+   +D
Sbjct  359   QKYSSIGLLAPNIEAKVVDW---ITGALLPPGGSGELWIRGPGVMKEYLNGGEATALTID  415

Query  625   DDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGF-------------QIAPADLEAVLMS  485
              DGWLHTGD+V+ D DGYLYV DRLKE+IKYKGF             QIAPADLEAVL+S
Sbjct  416   KDGWLHTGDVVYADHDGYLYVVDRLKEIIKYKGFQFVDLYVTILSLLQIAPADLEAVLIS  475

Query  484   HPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFT  305
             H +I+DAAV     +E GEIPVAFVVK++GS   L+Q  +I++VA+QVAPYKKVR+V FT
Sbjct  476   HCEILDAAVIPVVDKECGEIPVAFVVKRQGS--MLTQEAIINYVAEQVAPYKKVRKVIFT  533

Query  304   KSIPKSASGKILRKELRNLLITSKI  230
             +SIPKSA+GKILR+EL+  L TSK+
Sbjct  534   QSIPKSAAGKILRRELKCSL-TSKL  557



>ref|XP_009382607.1| PREDICTED: 4-coumarate--CoA ligase-like 6 [Musa acuminata subsp. 
malaccensis]
Length=548

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/544 (61%), Positives = 403/544 (74%), Gaps = 10/544 (2%)
 Frame = -2

Query  1849  SCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSL  1670
             S F+S ETGIYRSKH    LP DPF+D+VS++ S  H G++ALVDS+SG SI+Y ELR +
Sbjct  11    SGFFSPETGIYRSKHRPAALPQDPFVDLVSYVFSFPHQGVTALVDSRSGASIAYAELRGM  70

Query  1669  VNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSF  1490
             V S+AAGL R G++  DV L+++PNSI FPV+FLG+LSVGAV +TMNPLS+  EIKKQ  
Sbjct  71    VRSLAAGLSRDGITSKDVVLVMIPNSILFPVVFLGVLSVGAVFSTMNPLSSAEEIKKQMS  130

Query  1489  DCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSP----FRKLISSDPKLAPTPRIRQ  1322
              C     F  P  V  LG  LG+ ++ +PE    D+     F  LISSDP  AP P IRQ
Sbjct  131   LCRFTFIFTVPSNVAKLGG-LGVKIVTVPEEPEFDAHKFVLFNSLISSDPNDAPRPVIRQ  189

Query  1321  QDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVY  1142
              D AA+LFSSGTTG  K V LTH N IA VELFVR EAS Y   +  NVYL  +PM+HVY
Sbjct  190   TDAAAILFSSGTTGASKGVVLTHRNLIATVELFVRSEASLYGSESWRNVYLTAIPMFHVY  249

Query  1141  GLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCGL  962
             GLSLF MGLLSLGST+VV+RK++V+E VRAID + VTHFP  PP++ AL R   A  C L
Sbjct  250   GLSLFSMGLLSLGSTIVVMRKFDVEETVRAIDAFKVTHFPAVPPIMTALIRAKGATGCRL  309

Query  961   KSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGL  782
             +SL QVS GAAPI+   I +F++ FPH+DFIQGYG+TES AVGTRGFNT   R + SVGL
Sbjct  310   QSLVQVSCGAAPIAPKTIHDFLKAFPHVDFIQGYGLTESAAVGTRGFNTINCRRHISVGL  369

Query  781   LAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTG  602
             LAPNM+A+++DL     GS LPP + GEL L G AIMKGYLN+  A+ +A+  DGWL TG
Sbjct  370   LAPNMQAKIIDL---ETGSCLPPGTSGELLLHGAAIMKGYLNDDNATSSAIIKDGWLKTG  426

Query  601   DIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIP  422
             DI +FD DGYLY+ DRLKE IKYKGFQIAPADLEA+L +HPDIVDAAVT+A++EE GEIP
Sbjct  427   DIAYFDGDGYLYISDRLKETIKYKGFQIAPADLEALLNAHPDIVDAAVTAAKNEEAGEIP  486

Query  421   VAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNLLI  242
             VAFVV + GS+  LS  +VI+FVAKQV PYKKVR V F  SIP+S +GK LR+ELR+ L 
Sbjct  487   VAFVVTRSGSK--LSSTDVIEFVAKQVTPYKKVREVIFVNSIPRSPAGKTLRRELRDTLA  544

Query  241   TSKI  230
              S++
Sbjct  545   ASRM  548



>ref|XP_002867963.1| hypothetical protein ARALYDRAFT_492955 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44222.1| hypothetical protein ARALYDRAFT_492955 [Arabidopsis lyrata subsp. 
lyrata]
Length=566

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/563 (59%), Positives = 424/563 (75%), Gaps = 14/563 (2%)
 Frame = -2

Query  1900  HENISKIRNSAAEKGRRSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSAL  1721
             H +IS    +         ++S +TGIY SK PSVHLP DP LD VS + S  HGG +AL
Sbjct  5     HLHISPNDKTQTSHQNPPFWFSPKTGIYSSKFPSVHLPVDPNLDAVSALFSHRHGGDAAL  64

Query  1720  VDSQSGFSISYPELRSLVNSMAAGL-HRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAV  1544
             VDS +GFSIS+ EL+ +V SMAAG+ H +GV QGDV  ++LPNS+YFP+IFL L+S+GA+
Sbjct  65    VDSLTGFSISHTELQIMVQSMAAGIYHVLGVRQGDVVSLVLPNSVYFPMIFLSLISLGAI  124

Query  1543  AATMNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDS------  1382
               TMNP S+L EIKKQ  +C+V LAF + + V  L S+L + VI +PES + DS      
Sbjct  125   VTTMNPSSSLGEIKKQVSECSVGLAFTSAENVDKL-SSLEVRVIIVPESYDFDSIRIENP  183

Query  1381  PFRKLISSDPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQ  1202
              F  ++       P P I+Q D AA+++SSGTTG  K V LTH N I  +ELFVRFEASQ
Sbjct  184   KFYVIMKESFGFVPKPLIKQDDVAAIMYSSGTTGATKGVLLTHRNLIVSMELFVRFEASQ  243

Query  1201  YEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFP  1022
             YEYP  +NVYL  LP+ H+YGLSLFVMGLLSLGST+VV+R+++  +V+  I+R+ +THFP
Sbjct  244   YEYPGLSNVYLAALPLCHIYGLSLFVMGLLSLGSTIVVMRRFDASDVINVIERFKITHFP  303

Query  1021  VAPPLLVALTRKAKADKCGL-KSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTES  845
             V PP+L+ALT+KAK     + KSLKQVSSGAAP+S   I++F++T PH+D IQGYGMTES
Sbjct  304   VVPPMLMALTKKAKGVSGEVFKSLKQVSSGAAPLSRKFIEDFLQTLPHVDLIQGYGMTES  363

Query  844   TAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKG  665
             TAVGTRGFN+ KL  Y+SVGLLAPNM+A+VVD SSG     LPP + GELW++GP +MKG
Sbjct  364   TAVGTRGFNSEKLSRYSSVGLLAPNMQAKVVDWSSGCF---LPPGNRGELWIQGPGVMKG  420

Query  664   YLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMS  485
             YLNN +A++ ++ +D WL TGDI +FDEDGYL++ DR+KE+IKYKGFQIAPADLEAVL+S
Sbjct  421   YLNNPKATQMSIVEDSWLRTGDIAYFDEDGYLFIVDRIKEIIKYKGFQIAPADLEAVLVS  480

Query  484   HPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFT  305
             HP I+DAAVT+A +EE GEIPVAFVV+++  E +LS+ +VI +VA QVAPY+KVR+V   
Sbjct  481   HPLIIDAAVTAAPNEECGEIPVAFVVRRQ--ETTLSEQDVISYVAAQVAPYRKVRKVVMV  538

Query  304   KSIPKSASGKILRKELRNLLITS  236
              SIPKS +GKILRKEL+ +L  S
Sbjct  539   SSIPKSPTGKILRKELKRILTNS  561



>ref|XP_006283429.1| hypothetical protein CARUB_v10004477mg [Capsella rubella]
 gb|EOA16327.1| hypothetical protein CARUB_v10004477mg [Capsella rubella]
Length=566

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/545 (60%), Positives = 419/545 (77%), Gaps = 16/545 (3%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             ++S +TGIY SK PSVHLP DP LD VS + S  H G  ALVDS +GFSIS+ EL+ +V 
Sbjct  24    WFSPKTGIYTSKFPSVHLPVDPNLDAVSALFSHCHHGDVALVDSLTGFSISHVELQIMVQ  83

Query  1663  SMAAGL-HRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFD  1487
             SMAAG+ H +GV QGDV  ++LPNS+YFP+IFL L+S+GA+  TMNP S+L EIKKQ  +
Sbjct  84    SMAAGIYHHLGVRQGDVVSLVLPNSVYFPLIFLSLVSIGAIVTTMNPSSSLGEIKKQVSE  143

Query  1486  CNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLD------SPFRKLISSDPKLAPTPRIR  1325
             CNV LAF + +  + L ++LG+ VI +PES + D        F ++I       P P I+
Sbjct  144   CNVGLAFTSTENAEKL-TSLGVMVIRVPESYDFDLIRIENPEFYRIIKGSFGFVPKPLIK  202

Query  1324  QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHV  1145
             Q D AAV++SSGTTG  K V LTH N IA +ELFVRFEASQYEYP ++NVYL  LPM H+
Sbjct  203   QDDVAAVMYSSGTTGASKGVLLTHRNLIASMELFVRFEASQYEYPGSSNVYLAALPMCHI  262

Query  1144  YGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCG  965
             YGLSLFVMGLLSLGST+VV+R++ V +V+  I+R+ +THFPV PP+L+ALT+KAK   CG
Sbjct  263   YGLSLFVMGLLSLGSTIVVMRRFSVSDVINVIERFKITHFPVVPPMLMALTKKAKG-VCG  321

Query  964   --LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTS  791
                KSLKQVSSGAAP+S   I++F+ T PH+D IQGYGMTESTAVGTRGFN+  L  ++S
Sbjct  322   EVFKSLKQVSSGAAPLSRKFIEDFLGTLPHVDLIQGYGMTESTAVGTRGFNSKNLSRHSS  381

Query  790   VGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWL  611
             VGLLAPNM+A+VVD SSG     LPP + GELW++GP +MKGYLNN +A++  + +D WL
Sbjct  382   VGLLAPNMQAKVVDWSSGSF---LPPGNRGELWIQGPGVMKGYLNNPKATQMTIVEDSWL  438

Query  610   HTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVG  431
              TGDI +F+EDGYL++ DR+KE+IKYKGFQIAPADLEAVL+SHP I+DAAVT+A +EE G
Sbjct  439   RTGDIAYFNEDGYLFIVDRIKEIIKYKGFQIAPADLEAVLVSHPLILDAAVTAAPNEECG  498

Query  430   EIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRN  251
             EIPVAFVV+++  E +LS+ +VI++VA QVAPY+KVR+V    SIPKS +GKILRKEL+ 
Sbjct  499   EIPVAFVVRRQ--ETTLSEQDVINYVAAQVAPYRKVRKVVMVSSIPKSPTGKILRKELKR  556

Query  250   LLITS  236
             +L  +
Sbjct  557   ILTNT  561



>emb|CDX78914.1| BnaA01g09810D [Brassica napus]
Length=574

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/548 (61%), Positives = 418/548 (76%), Gaps = 22/548 (4%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHG----GLSALVDSQSGFSISYPELR  1676
             ++S +TGIY SKHPSVHLP DP LD  S + S  H       +A VDS +GFSISY EL+
Sbjct  26    WFSPDTGIYTSKHPSVHLPVDPHLDAASALFSHLHTVDDPSSAAFVDSLTGFSISYSELQ  85

Query  1675  SLVNSMAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKK  1499
              +V S+AA +HR +GV QGDV  ++LPNS+YFP++FL L+S+G V  TMNP S+L EIKK
Sbjct  86    VMVESIAAAIHRDLGVRQGDVVSLVLPNSLYFPLLFLSLISLGTVVTTMNPSSSLGEIKK  145

Query  1498  QSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDS------PFRKLISS--DPKLA  1343
             Q  +CNV LAF + + V  L S LG+ VI + ES +LDS       F  +I    D    
Sbjct  146   QVRECNVALAFTSRESVDKLAS-LGVVVIRVSESYDLDSVRVENPKFYSIIRGGFDFGSV  204

Query  1342  PTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDV  1163
             P P ++Q D AA+++SSGTTGG K V LTH N IA +ELFVRFEASQYEYP ++NVYL  
Sbjct  205   PKPLVKQDDVAAIMYSSGTTGGTKGVMLTHRNLIASMELFVRFEASQYEYPGSSNVYLAA  264

Query  1162  LPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKA  983
             LP+ H+YGLSLFVMGLLS+GST+VV+R+++V +VV  I+R+ VTHFPV PP+L+ALT+KA
Sbjct  265   LPLCHIYGLSLFVMGLLSVGSTIVVMRRFDVSDVVDVIERFKVTHFPVVPPMLMALTKKA  324

Query  982   KADKCG--LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAK  809
             K   CG   +SLKQVSSGAAP+S   I++FV T PH+D IQGYGMTESTAVGTRGFNT K
Sbjct  325   KG-VCGEAFRSLKQVSSGAAPLSRKFIEDFVGTLPHVDLIQGYGMTESTAVGTRGFNTQK  383

Query  808   LRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAV  629
             LR Y+SVGL+APNM+ARVVD SSG     LPP + GELW++GP +MKGYLNN EA++  +
Sbjct  384   LRKYSSVGLIAPNMQARVVDWSSGSF---LPPGNRGELWIQGPGVMKGYLNNPEATEMTI  440

Query  628   DDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSA  449
              +  WL TGDI +FDEDGYL++ DR+KE+IKYKGFQIAPADLEAVL+SHP I+DAAVT+A
Sbjct  441   VEKSWLRTGDIAYFDEDGYLFIVDRMKEIIKYKGFQIAPADLEAVLVSHPLIIDAAVTAA  500

Query  448   QSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKIL  269
              +EE GEIPVAFVV+++  E +LS+ +VI +VA QVAPY+KVR+V    SIPKS +GKIL
Sbjct  501   PNEECGEIPVAFVVRRQ--ETTLSEQDVISYVAAQVAPYRKVRKVVMVSSIPKSPTGKIL  558

Query  268   RKELRNLL  245
             RKEL+ +L
Sbjct  559   RKELKTIL  566



>ref|XP_010449426.1| PREDICTED: 4-coumarate--CoA ligase-like 6 [Camelina sativa]
Length=567

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/545 (60%), Positives = 416/545 (76%), Gaps = 16/545 (3%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             ++S +TGIY SK PSVHLP DP LD VS + S +H G  ALVDS +G SIS+ ELR +V 
Sbjct  25    WFSPKTGIYTSKFPSVHLPVDPNLDAVSALFSHSHHGDVALVDSLTGCSISHIELRVMVQ  84

Query  1663  SMAAGL-HRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFD  1487
             SMAAG+ H +GV QGDV  ++LPNS+YFP+IFL L+S+GAV  TMNP S+L EIKKQ  +
Sbjct  85    SMAAGIYHGLGVRQGDVVSLVLPNSVYFPIIFLSLVSLGAVVTTMNPSSSLGEIKKQVSE  144

Query  1486  CNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLD------SPFRKLISSDPKLAPTPRIR  1325
             CNV LAF + D  + L S LG+ VI +PES + D        F  ++       P P I+
Sbjct  145   CNVGLAFTSTDNAEKLKS-LGVMVIRVPESYDFDLIRIENPKFYAIVRGRFGFVPKPLIK  203

Query  1324  QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHV  1145
             Q D AA+++SSGTTG  K V LTH N IA +ELFVRFEASQYE P ++NVYL  LP  H+
Sbjct  204   QDDVAAIMYSSGTTGATKGVLLTHRNLIASMELFVRFEASQYECPGSSNVYLAALPFCHI  263

Query  1144  YGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCG  965
             YGLSLFVMGLLSLGST+V++R++ V++V+  I+R+ +THFPV PP+L+ALT+KAK   CG
Sbjct  264   YGLSLFVMGLLSLGSTIVIMRRFSVNDVINVIERFKITHFPVVPPMLMALTKKAKG-VCG  322

Query  964   --LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTS  791
                KSLKQVSSGAAP+S+  I++F+ T PH+D IQGYGMTESTAVGTRGFN+ KL  Y+S
Sbjct  323   EVFKSLKQVSSGAAPLSMKFIEDFLGTLPHVDLIQGYGMTESTAVGTRGFNSEKLSRYSS  382

Query  790   VGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWL  611
             VGLLAPNM+A+VVD SSG     LPP + GELW++GP +MKGYLNN + ++  + +D WL
Sbjct  383   VGLLAPNMQAKVVDWSSGSF---LPPGNRGELWIQGPGVMKGYLNNPKETQMTIVEDSWL  439

Query  610   HTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVG  431
              TGDI +FDEDGYL++ DR+KE+IKYKGFQIAPADLEAVL+SHP I+DAAVT+A +EE G
Sbjct  440   RTGDIAYFDEDGYLFIVDRIKEIIKYKGFQIAPADLEAVLVSHPLILDAAVTAAPNEECG  499

Query  430   EIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRN  251
             EIPVAFVV++K  E +LS+ +VI +VA QV+PY+KVR+V    SIPKS +GKILRKEL+ 
Sbjct  500   EIPVAFVVRRK--EAALSEQDVISYVAAQVSPYRKVRKVVMVSSIPKSPTGKILRKELKK  557

Query  250   LLITS  236
             +L  +
Sbjct  558   ILTNT  562



>ref|XP_010439777.1| PREDICTED: 4-coumarate--CoA ligase-like 6 [Camelina sativa]
Length=567

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/545 (60%), Positives = 417/545 (77%), Gaps = 16/545 (3%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             ++S +TGIY SK PSVHLP DP LD VS + S +H G  ALVDS +GFSIS+ ELR +V 
Sbjct  25    WFSPKTGIYTSKFPSVHLPVDPNLDAVSALFSHSHHGDVALVDSLTGFSISHVELRVMVQ  84

Query  1663  SMAAGL-HRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFD  1487
             SMAAG+ H +GV QGDV  ++LPNSIYFP+IFL L+S+GAV  TMNP S+L EIKKQ  +
Sbjct  85    SMAAGIYHDLGVRQGDVVSLVLPNSIYFPMIFLSLVSLGAVVTTMNPSSSLGEIKKQVSE  144

Query  1486  CNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLD------SPFRKLISSDPKLAPTPRIR  1325
             CNV LAF + +  + L S LG+ VI +PES + D        F  +        P P I+
Sbjct  145   CNVGLAFTSSENAEKLKS-LGVMVIRVPESYDFDLIRIENPEFYAITKGSFGFVPKPLIK  203

Query  1324  QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHV  1145
             Q D AA+++SSGTTG  K V LTH N IA +ELFVRFEASQYE P ++N+YL  LP+ H+
Sbjct  204   QDDVAAIMYSSGTTGATKGVLLTHRNLIASMELFVRFEASQYECPGSSNIYLAALPLCHI  263

Query  1144  YGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCG  965
             YGLSLFVMGLLSLGST+VV+R++ V++V+  I+RY +THFPV PP+L+ALT+KAK   CG
Sbjct  264   YGLSLFVMGLLSLGSTIVVMRRFSVNDVINVIERYKITHFPVVPPMLMALTKKAKG-VCG  322

Query  964   --LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTS  791
                KSLKQVSSGAAP+S   I++F+ T PH+D IQGYGMTESTAVGTRGFN+ KL  Y+S
Sbjct  323   QVFKSLKQVSSGAAPLSRKFIEDFLGTLPHVDLIQGYGMTESTAVGTRGFNSEKLSRYSS  382

Query  790   VGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWL  611
             VGLLAPNM+A+VVD SSG     LPP + GELW++GP +MKGYLN+ +A++  + +  WL
Sbjct  383   VGLLAPNMQAKVVDWSSGSF---LPPGNRGELWIQGPGVMKGYLNDPKATQMTIVEYSWL  439

Query  610   HTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVG  431
              TGDI +FDEDGYL++ DR+KE+IKYKGFQIAPADLEAVL+SHP I+DAAVT+A +EE G
Sbjct  440   RTGDIAYFDEDGYLFIVDRIKEIIKYKGFQIAPADLEAVLVSHPLILDAAVTAAPNEECG  499

Query  430   EIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRN  251
             EIPVAFVV+++  E +LS+ +VI +VA QVAPY+KVR+V    SIPKS +GKILRKEL+ 
Sbjct  500   EIPVAFVVRRR--EAALSEQDVISYVAAQVAPYRKVRKVVMVSSIPKSPTGKILRKELKR  557

Query  250   LLITS  236
             +L ++
Sbjct  558   ILTST  562



>ref|XP_009132447.1| PREDICTED: 4-coumarate--CoA ligase-like 6 isoform X1 [Brassica 
rapa]
Length=573

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/547 (61%), Positives = 415/547 (76%), Gaps = 21/547 (4%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHG----GLSALVDSQSGFSISYPELR  1676
             ++S +TGIY SKHPSVHLP DP LD  S + S  H       +A VDS +GFSISY EL+
Sbjct  26    WFSPDTGIYTSKHPSVHLPVDPHLDAASALFSHLHTVDDPSSAAFVDSLTGFSISYSELQ  85

Query  1675  SLVNSMAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKK  1499
              +V S+AA +HR  GV QGDV  ++LPNS+YFP++FL L+S+G V  TMNP S+L EIKK
Sbjct  86    VMVESIAAAIHRDFGVRQGDVVSLVLPNSLYFPLLFLSLISLGTVVTTMNPSSSLGEIKK  145

Query  1498  QSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDS------PFRKLISSDPKLAPT  1337
             Q  +CNV LAF + + V  L S LG+ VI +PES +LDS       F  +I       P 
Sbjct  146   QVRECNVALAFTSRESVDKLAS-LGVVVIRVPESYDLDSVRVENPTFYSIIKGGLGSVPK  204

Query  1336  -PRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVL  1160
              P ++Q D AA+++SSGTTG  K V LTH N IA +ELFVRFEASQYEYP  +NVYL  L
Sbjct  205   KPLVKQDDVAAIMYSSGTTGASKGVMLTHRNLIASMELFVRFEASQYEYPGASNVYLAAL  264

Query  1159  PMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK  980
             P+ H+YGLSLFVMGLLS+GST+VV+R+++V +VV  I+R+ VTHFPV PP+L+ALT+KAK
Sbjct  265   PLCHIYGLSLFVMGLLSVGSTIVVMRRFDVSDVVDVIERFKVTHFPVVPPMLMALTKKAK  324

Query  979   ADKCG--LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKL  806
                CG   +SLKQVSSGAAP+S   I++FV T PH+D IQGYGMTESTAVGTRGFNT KL
Sbjct  325   G-VCGEAFRSLKQVSSGAAPLSRKFIEDFVGTLPHVDLIQGYGMTESTAVGTRGFNTQKL  383

Query  805   RNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVD  626
             R Y+SVGLLAPNM+ARVVD SSG     LPP + GELW++GP +MKGYLNN EA++  + 
Sbjct  384   RKYSSVGLLAPNMQARVVDWSSGSF---LPPGNRGELWIQGPGVMKGYLNNPEATEMTIV  440

Query  625   DDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQ  446
             +  WL TGDI +FDEDGYL++ DR+KE+IKYKGFQIAPADLEAVL+SHP I+DAAVT+A 
Sbjct  441   EKSWLRTGDIAYFDEDGYLFIVDRMKEIIKYKGFQIAPADLEAVLVSHPLIIDAAVTAAP  500

Query  445   SEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILR  266
             +EE GEIPVAFVV+++  E +LS+ +VI +VA QVAPY+KVR+V    SIPKS +GKILR
Sbjct  501   NEECGEIPVAFVVRRQ--ETTLSEQDVISYVAAQVAPYRKVRKVVMVSSIPKSPTGKILR  558

Query  265   KELRNLL  245
             KEL+ +L
Sbjct  559   KELKRIL  565



>gb|KHG07976.1| 4-coumarate--CoA ligase-like 6 [Gossypium arboreum]
Length=550

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/545 (59%), Positives = 403/545 (74%), Gaps = 30/545 (6%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             +YS ETGIY SKHPS+ LP+DPFLD+VSF+ S  H G++AL+DS SG+SI Y +L  L+ 
Sbjct  24    WYSPETGIYSSKHPSISLPTDPFLDIVSFVFSHKHDGVTALIDSSSGYSIPYSKLLPLIQ  83

Query  1663  SMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             SMA+GLHR+GVSQGDV L+LLPNS +FP+IF  +L +GA+ + MNPLS+  EIKKQ  DC
Sbjct  84    SMASGLHRLGVSQGDVVLLLLPNSSHFPIIFFSILYLGAIVSAMNPLSSTIEIKKQVSDC  143

Query  1483  NVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSP------FRKLISSDPKLAPTPRIRQ  1322
             +VR AF + +++  L + LG+  IG+P++++ DS       F +LI      AP P IRQ
Sbjct  144   SVRFAFTSLEKIDQL-NNLGVHAIGVPQNIDFDSENIGFSAFHELIGGRFGKAPRPVIRQ  202

Query  1321  QDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVY  1142
             QDTA +++SSGTTG  K V LTH N IAMVELFV+FEASQYEY ++ NVYL V+PM+H+Y
Sbjct  203   QDTAVIMYSSGTTGVSKGVVLTHGNLIAMVELFVKFEASQYEYSSSKNVYLAVVPMFHIY  262

Query  1141  GLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKA---DK  971
             GLSLFV+GLLSLGST+V++R+++ +E V+ ID YGVTHFP+ PP+L  L   AK     +
Sbjct  263   GLSLFVVGLLSLGSTIVLMRRFDGNEAVKLIDYYGVTHFPLVPPILTTLVMIAKGATNTE  322

Query  970   CGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTS  791
                KSLKQVS GAAP S   I++F +  PH+DFIQGYGMTE+TAVGTRGFNT +   Y S
Sbjct  323   NSFKSLKQVSCGAAPTSRKIIEDFFQVLPHVDFIQGYGMTETTAVGTRGFNTQQCHKYCS  382

Query  790   VGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWL  611
             +GLLAPNM+A+V+D      GS L P   GELWL+GPAIM+ YLNN  A+K A+D DGWL
Sbjct  383   IGLLAPNMQAKVMDW---NSGSPLRPEYYGELWLKGPAIMQRYLNNDVATKMAIDKDGWL  439

Query  610   HTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVG  431
              TGDIV FDEDGYLY               IAPADLEA+L+SHP I+DAAV     E  G
Sbjct  440   RTGDIVCFDEDGYLY---------------IAPADLEAILISHPHILDAAVIGEMDEVYG  484

Query  430   EIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRN  251
             EIPVAFVV + GS  +L+Q +V+ FVA QVAPYKK+R+V FTKSIPKSA+GKILR+EL+ 
Sbjct  485   EIPVAFVVTRHGS--TLNQEDVMGFVAMQVAPYKKIRKVVFTKSIPKSATGKILRRELKK  542

Query  250   LLITS  236
             LL +S
Sbjct  543   LLSSS  547



>ref|XP_003607426.1| 4-coumarate CoA ligase [Medicago truncatula]
Length=542

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/545 (61%), Positives = 414/545 (76%), Gaps = 32/545 (6%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             +YSS+TGIY S H   +LP+DPFLD+VSFI S +H G         GF          + 
Sbjct  23    WYSSKTGIYNSIHTPRNLPTDPFLDIVSFIFSHSHDG---------GF----------IK  63

Query  1663  SMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             SMA+ LH+MGVSQGDV L+LLPNSIY+PVI L +L +GAV   +NPLS++ EI+KQ  +C
Sbjct  64    SMASALHKMGVSQGDVVLLLLPNSIYYPVILLAVLYLGAVFTPLNPLSSVGEIRKQVQEC  123

Query  1483  NVRLAFATPDRVQNLGSTLGI-PVIGLPES---LNLD--SPFRKLISSDPKLAPTPRIRQ  1322
              V  AF  P+ V+ L    GI P+I +PE+   L  D  S F  L+     L     I+Q
Sbjct  124   GVSFAFTIPENVKKLELLGGINPIIAVPENEKDLRNDGFSSFFNLLYGKFDLPQRVVIKQ  183

Query  1321  QDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVY  1142
             +DTA +L+SSGTTG  K V LTH N I+MVELFVRFEASQY+Y  + +V+L VLPM+HVY
Sbjct  184   EDTAGILYSSGTTGVSKGVVLTHRNLISMVELFVRFEASQYDYSCSKSVFLAVLPMFHVY  243

Query  1141  GLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKA-DKCG  965
             GLSLF  GLLSLGSTV+V+RK+++DEV+R ID+Y VTHFPV PP+L ALT KAK  +   
Sbjct  244   GLSLFAAGLLSLGSTVIVMRKFDIDEVIRVIDKYNVTHFPVVPPMLSALTMKAKGVNGIK  303

Query  964   LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVG  785
             L+SL+QVS GAAP+SI  I +FV  FP++DFIQGYGMTESTAVGTRGFNT K  NY+S+G
Sbjct  304   LQSLRQVSCGAAPLSIGVISSFVHAFPNVDFIQGYGMTESTAVGTRGFNTEKFHNYSSIG  363

Query  784   LLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHT  605
             LLAPN EA+VVD ++G     LPP S GELWLRGP+IM+GYLNN EA+ + +D DGWLHT
Sbjct  364   LLAPNTEAKVVDWNNGTF---LPPGSCGELWLRGPSIMRGYLNNEEATISTIDKDGWLHT  420

Query  604   GDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEI  425
             GDIV+FD+DGYL++ DRLK++IKYKGFQIAPADLEAVL+ HP+I+DAAVT+A+ EE+GEI
Sbjct  421   GDIVYFDQDGYLHLADRLKDIIKYKGFQIAPADLEAVLILHPEIIDAAVTAAEDEEIGEI  480

Query  424   PVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNLL  245
             PVAFVVKK GS   LS  +V+++VA+QVAPYKKVR+V+FT  IP+S +GKILRK+LR+ L
Sbjct  481   PVAFVVKKVGS--VLSPKDVVNYVAEQVAPYKKVRKVFFTDKIPRSPTGKILRKQLRHCL  538

Query  244   ITSKI  230
              TSK+
Sbjct  539   -TSKL  542



>gb|KCW78479.1| hypothetical protein EUGRSUZ_D02624 [Eucalyptus grandis]
Length=524

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/533 (62%), Positives = 408/533 (77%), Gaps = 30/533 (6%)
 Frame = -2

Query  1810  KHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVNSMAAGLHRMGV  1631
             KHP+V LPSDP  D VS + SR HGG +ALVDS SG SISY ELRSLV  +A+G+  MGV
Sbjct  16    KHPAVDLPSDPLNDAVSHLFSRAHGGSTALVDSPSGSSISYSELRSLVRCIASGIRSMGV  75

Query  1630  SQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRLAFATPDR  1451
             S+GDV L+ LPNS+Y+PV+FLG+L  G V  TMNPLS+ SE ++Q  DCNVRLAFA+ D+
Sbjct  76    SRGDVVLLQLPNSVYYPVVFLGVLFSGGVVTTMNPLSSASETRRQVSDCNVRLAFASSDK  135

Query  1450  VQNLGSTLGIPVIGLPESLNLDS------PFRKLISSDPKLAPTPRIRQQDTAAVLFSSG  1289
              + L   LG+P + +PE +   S       FR L+S   +    P ++QQDTAA+++SSG
Sbjct  136   CEML-KALGVPAVAVPEDVRSASRDREFVEFRTLLSRKFESFERPIVKQQDTAAIVYSSG  194

Query  1288  TTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVYGLSLFVMGLLS  1109
             TTG  K V LTH NFIA+ ELFVRFEASQYEYP + NVYL VLPM+H+YG+SLFV+GLLS
Sbjct  195   TTGVSKGVMLTHGNFIAVCELFVRFEASQYEYPTSENVYLAVLPMFHIYGMSLFVLGLLS  254

Query  1108  LGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCGLKSLKQVSSGAA  929
             LGSTVVV+R+++ +EVV+AIDR                T K  A+  GL+SLKQVS GAA
Sbjct  255   LGSTVVVMRRFDPNEVVKAIDR----------------TLKV-ANGSGLRSLKQVSCGAA  297

Query  928   PISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVVD  749
              +S   I++FV+TFPH+DFIQGYGMTESTAVGTRGFNT K R Y+S+GLLAPNM+A+V+D
Sbjct  298   ALSRKSIEDFVQTFPHVDFIQGYGMTESTAVGTRGFNTEKCRRYSSIGLLAPNMQAKVLD  357

Query  748   LssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYL  569
               +G     LPP S GEL LRGPAIMKGYLNN +A++  +D+DGWLHTGDIVHFD+DG+L
Sbjct  358   WKTGSF---LPPGSSGELLLRGPAIMKGYLNNVDATRLMIDEDGWLHTGDIVHFDQDGFL  414

Query  568   YVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSE  389
             ++ DR+KE+IKYKGFQIAPADLE VL++HPDIVD AVT A  EE GEIPVAFVV++ GS 
Sbjct  415   HILDRVKEIIKYKGFQIAPADLEGVLITHPDIVDVAVTGALDEESGEIPVAFVVRRIGSN  474

Query  388   VSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNLLITSKI  230
             +  S+  V+D++A QVAPYKKVR+V FT SIPKSA+GKILR+EL+  L TS++
Sbjct  475   I--SEEAVMDYLAAQVAPYKKVRKVVFTSSIPKSAAGKILRRELKKSL-TSRL  524



>ref|XP_003612661.1| 4-coumarate CoA ligase [Medicago truncatula]
 gb|AES95619.1| acyl:CoA ligase [Medicago truncatula]
Length=568

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/556 (61%), Positives = 419/556 (75%), Gaps = 25/556 (4%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             +YS + GIY S     +LP+DPFLDVVSFI S  H G+ AL+DS SG SISY  L +LV 
Sbjct  20    WYSPKPGIYSSLQSPRNLPTDPFLDVVSFIFSHPHDGVLALIDSSSGTSISYSNLLTLVK  79

Query  1663  SMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             S+A+GLH+MGVSQGDV L+LLPNSIY+P++ L ++ +GAV   +NP S++ EI+KQ  +C
Sbjct  80    SLASGLHKMGVSQGDVVLLLLPNSIYYPIVLLSVMYLGAVVTPLNPFSSVGEIRKQVKEC  139

Query  1483  NVRLAFATPDRVQNLGSTLGIPVIGLPES------------LNLD-----SPFRKLISSD  1355
              V  +F  P+ ++ L S LGIPVI +PE+             NL      S  + LI  D
Sbjct  140   RVSFSFTIPENIKKLES-LGIPVIAVPENEMDLKHDCFSCFYNLTYGKFYSIKKNLIYGD  198

Query  1354  PKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANV  1175
               L   P I+Q+DTA +L+SSGTTG  K V LTH N IAMVELFVRFEASQY+Y ++  V
Sbjct  199   FDLPQRPVIKQEDTAGILYSSGTTGVSKGVVLTHRNLIAMVELFVRFEASQYDYSSSKTV  258

Query  1174  YLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVAL  995
             +L VLPM+H+YGL+LF  GLLSLGST+VV+RKY++DE +RAID+Y VTHF V P +L AL
Sbjct  259   HLAVLPMFHLYGLALFATGLLSLGSTIVVIRKYDIDEAIRAIDKYKVTHFHVVPMMLSAL  318

Query  994   TRKAK-ADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFN  818
             T KAK  +   L+SL+ VS GA P+S   I++FV+ FP++DFIQGYGMTES AVGTRGFN
Sbjct  319   TAKAKDGNGSKLQSLRHVSCGAEPLSKGAIKDFVQAFPNVDFIQGYGMTESGAVGTRGFN  378

Query  817   TAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASK  638
             T K  NY+S+GLLAPN+EA+VVD  SG     LPP   GELWLRGP+IMKGYLNN EA+ 
Sbjct  379   TDKFHNYSSLGLLAPNIEAKVVDWKSGTF---LPPGLSGELWLRGPSIMKGYLNNEEATM  435

Query  637   NAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAV  458
             + +D DGW+HTGDIV+FD+DGYLY+  RLK++IKYKGFQIAPADLEA+L+SHP+IVDAAV
Sbjct  436   STIDKDGWIHTGDIVYFDQDGYLYMSGRLKDIIKYKGFQIAPADLEALLISHPEIVDAAV  495

Query  457   TSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASG  278
             T+ + +  GEIPVAFVVKK GS   LS  +VID+VAKQVAPYKKVR+V FT  IP+SA+G
Sbjct  496   TAGKVDVAGEIPVAFVVKKVGS--VLSSQHVIDYVAKQVAPYKKVRKVVFTDKIPRSATG  553

Query  277   KILRKELRNLLITSKI  230
             KILRKELRN L TSK+
Sbjct  554   KILRKELRNCL-TSKL  568



>gb|KFK28573.1| hypothetical protein AALP_AA7G013900 [Arabis alpina]
Length=569

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/572 (57%), Positives = 430/572 (75%), Gaps = 22/572 (4%)
 Frame = -2

Query  1900  HENISKIRNSAAEKGRRSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSAL  1721
             H ++  I  +A  +     ++S +TGIY SK  S++LP D  LD V+ + S  H G +A+
Sbjct  5     HHHLLHISTNAKTQTPSPLWFSPQTGIYTSKFTSINLPIDSNLDAVTALFSHRHNGDTAI  64

Query  1720  VDSQSGFSISYPELRSLVNSMAAGL-HRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAV  1544
             +DS +GFSIS+ +L+ LV S+A+ + H +G+ QG V  ++LPNS+YFPVIFL L+S+GA+
Sbjct  65    IDSLTGFSISHIDLKVLVKSIASRVYHDLGIRQGHVVSLVLPNSVYFPVIFLSLISLGAI  124

Query  1543  AATMNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLD-----SP  1379
               TMNP S+LSEIKKQ  +C+V L F   + V+ L S+LGI V+ +PES + D     +P
Sbjct  125   VTTMNPSSSLSEIKKQVSECSVGLVFTCSENVEKL-SSLGIVVVKVPESYDFDLIRVENP  183

Query  1378  -FRKLISS--DPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEA  1208
              F  +     D      P I+Q D AA+++SSGTTGG K V LTH N IA +ELFVRFEA
Sbjct  184   RFYSIFKGGLDYGFVAKPVIKQDDVAAIMYSSGTTGGSKGVLLTHRNLIASMELFVRFEA  243

Query  1207  SQYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTH  1028
             SQYEY  ++NVYL  LP+ H+YGLSLFVMGLLS+GST+VV+R+++V +VV  I+R+ VTH
Sbjct  244   SQYEYSGSSNVYLAALPLCHIYGLSLFVMGLLSVGSTIVVMRRFDVSDVVDVIERFKVTH  303

Query  1027  FPVAPPLLVALTRKAKADKCG--LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGM  854
             FPV PP+L+ALT+KAK   CG   +SLKQVSSGAAP+S   I++F++T PH+D IQGYGM
Sbjct  304   FPVVPPMLMALTKKAKG-VCGDVFRSLKQVSSGAAPLSRKFIEDFLQTLPHVDLIQGYGM  362

Query  853   TESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAI  674
             TESTAVGTRGFN+ K+R Y+SVGLLAPNM+A+VVD SSG     LPP + GELW++GP +
Sbjct  363   TESTAVGTRGFNSQKVRKYSSVGLLAPNMQAKVVDWSSGSF---LPPGNRGELWIQGPGV  419

Query  673   MKGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAV  494
             MKGYLNN +A++  + +D WL TGDI +FD+DGYL++ DR+KE+IKYKGFQIAPADLEAV
Sbjct  420   MKGYLNNPKATQMTIVEDSWLRTGDIAYFDDDGYLFIVDRIKEIIKYKGFQIAPADLEAV  479

Query  493   LMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRV  314
             L+SHP I+DAAVT+A +EE GEIPVAFVV+K+G+  +LS+ +VI +VA QV+PY+KVR+V
Sbjct  480   LVSHPLIIDAAVTAAPNEECGEIPVAFVVRKQGT--TLSEQDVISYVAAQVSPYRKVRKV  537

Query  313   YFTKSIPKSASGKILRKELR----NLLITSKI  230
                 SIPKS +GKILRKEL+    N + TSK+
Sbjct  538   VMVNSIPKSPAGKILRKELKRRLTNCVTTSKL  569



>ref|XP_007199256.1| hypothetical protein PRUPE_ppa022562mg [Prunus persica]
 gb|EMJ00455.1| hypothetical protein PRUPE_ppa022562mg [Prunus persica]
Length=530

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/542 (60%), Positives = 401/542 (74%), Gaps = 29/542 (5%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLS-ALVDSQSGFSISYPELRSLV  1667
             ++S ETGIY+SKH S+ LPSDPFLD+VSFI S  H G+S AL+ S  G +ISY +L S V
Sbjct  5     WFSPETGIYQSKHLSIDLPSDPFLDIVSFIFSHQHDGVSSALIGSSCGSAISYSQLYSSV  64

Query  1666  NSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFD  1487
              SMA+GL +MG+SQGDV L+LLPNSIY+P+ FLG++ +GA+  TMNPLS+++EIKKQ  D
Sbjct  65    KSMASGLQQMGISQGDVVLLLLPNSIYYPIAFLGVMYLGAIVTTMNPLSSVAEIKKQIAD  124

Query  1486  CNVRLAFATPDRVQNLGSTLGIPVIGLPE------SLNLDSPFRKLISSDPKLAPTPRIR  1325
                  AF  P+    L   LGIP I +PE      S ++ S F KLI S   LA  P I+
Sbjct  125   TKACHAFTGPENADKL-QALGIPAILVPENALPGSSKDIFSVFYKLIYSRCYLALRPVIK  183

Query  1324  QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHV  1145
             QQDTAA+++SSGTTG  K V +TH NFIA V  FVRFEASQYE  +  NVYL VLP++H+
Sbjct  184   QQDTAAIMYSSGTTGVSKGVMITHRNFIATVAHFVRFEASQYEGSSLDNVYLAVLPLFHI  243

Query  1144  YGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKC-  968
             YGLSLF+MGLLSLGS VVV+++++V+EV+RAIDRY VTHFPV PP+L ALT++A      
Sbjct  244   YGLSLFMMGLLSLGSRVVVMKRFDVNEVIRAIDRYKVTHFPVVPPVLTALTKRANDGLAP  303

Query  967   -GLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTS  791
               LKSLKQVS GAA +S+  I+NFV+TFPHID IQGYGMTE+TAVGTRGFNT KLR  +S
Sbjct  304   HSLKSLKQVSCGAALLSMKTIENFVQTFPHIDLIQGYGMTETTAVGTRGFNTQKLRKPSS  363

Query  790   VGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWL  611
             +GLLAPNM+A+VVD ++      LPPTS GELWL GP IMKGYLNN +A+ + +D+ GWL
Sbjct  364   IGLLAPNMQAKVVDWNTRSP---LPPTSTGELWLHGPGIMKGYLNNAKATLSTIDEGGWL  420

Query  610   HTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVG  431
             HTGDIV FDEDGYL++ DRLK+ IKYKGFQIAPADLE VL++H +I+D AV  A  EE G
Sbjct  421   HTGDIVFFDEDGYLHLQDRLKDAIKYKGFQIAPADLECVLINHAEILDVAVAGAMDEESG  480

Query  430   EIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRN  251
             E+PVAFVV+K  SE++                +  VR+V F  SIPKS +GKILR+ELR 
Sbjct  481   EVPVAFVVRKHRSELN----------------HDAVRKVVFVDSIPKSPAGKILRRELRK  524

Query  250   LL  245
              L
Sbjct  525   FL  526



>gb|KCW78480.1| hypothetical protein EUGRSUZ_D02624 [Eucalyptus grandis]
Length=516

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/533 (61%), Positives = 403/533 (76%), Gaps = 38/533 (7%)
 Frame = -2

Query  1810  KHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVNSMAAGLHRMGV  1631
             KHP+V LPSDP  D VS + SR HGG +ALVDS SG SISY ELRSLV  +A+G+  MGV
Sbjct  16    KHPAVDLPSDPLNDAVSHLFSRAHGGSTALVDSPSGSSISYSELRSLVRCIASGIRSMGV  75

Query  1630  SQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRLAFATPDR  1451
             S+GDV L+ LPNS+Y+PV+FLG+L  G V  TMNPLS+ SE ++Q  DCNVRLAFA+ D+
Sbjct  76    SRGDVVLLQLPNSVYYPVVFLGVLFSGGVVTTMNPLSSASETRRQVSDCNVRLAFASSDK  135

Query  1450  VQNLGSTLGIPVIGLPESLNLDS------PFRKLISSDPKLAPTPRIRQQDTAAVLFSSG  1289
              + L   LG+P + +PE +   S       FR L+S   +    P ++QQDTAA+++SSG
Sbjct  136   CEML-KALGVPAVAVPEDVRSASRDREFVEFRTLLSRKFESFERPIVKQQDTAAIVYSSG  194

Query  1288  TTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVYGLSLFVMGLLS  1109
             TTG  K V LTH NFIA+ ELFVRFEASQYEYP + NVYL VLPM+H+YG+SLFV+GLLS
Sbjct  195   TTGVSKGVMLTHGNFIAVCELFVRFEASQYEYPTSENVYLAVLPMFHIYGMSLFVLGLLS  254

Query  1108  LGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCGLKSLKQVSSGAA  929
             LGSTVVV+R+++ +EVV+AID                          GL+SLKQVS GAA
Sbjct  255   LGSTVVVMRRFDPNEVVKAID-------------------------SGLRSLKQVSCGAA  289

Query  928   PISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVVD  749
              +S   I++FV+TFPH+DFIQGYGMTESTAVGTRGFNT K R Y+S+GLLAPNM+A+V+D
Sbjct  290   ALSRKSIEDFVQTFPHVDFIQGYGMTESTAVGTRGFNTEKCRRYSSIGLLAPNMQAKVLD  349

Query  748   LssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYL  569
                   GS LPP S GEL LRGPAIMKGYLNN +A++  +D+DGWLHTGDIVHFD+DG+L
Sbjct  350   W---KTGSFLPPGSSGELLLRGPAIMKGYLNNVDATRLMIDEDGWLHTGDIVHFDQDGFL  406

Query  568   YVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSE  389
             ++ DR+KE+IKYKGFQIAPADLE VL++HPDIVD AVT A  EE GEIPVAFVV++ GS 
Sbjct  407   HILDRVKEIIKYKGFQIAPADLEGVLITHPDIVDVAVTGALDEESGEIPVAFVVRRIGSN  466

Query  388   VSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNLLITSKI  230
             +  S+  V+D++A QVAPYKKVR+V FT SIPKSA+GKILR+EL+  L TS++
Sbjct  467   I--SEEAVMDYLAAQVAPYKKVRKVVFTSSIPKSAAGKILRRELKKSL-TSRL  516



>gb|AGW27199.1| 4-coumarate:coenzyme A ligase 9, partial [Salvia miltiorrhiza]
Length=480

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/483 (64%), Positives = 379/483 (78%), Gaps = 14/483 (3%)
 Frame = -2

Query  1660  MAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             MAAGLH   GV QGDV LILLPNS+ FP+IFLG LS+GAV   MNPLS + EIKKQ  DC
Sbjct  1     MAAGLHHHFGVKQGDVILILLPNSVCFPLIFLGALSLGAVVTPMNPLSNMLEIKKQVLDC  60

Query  1483  NVRLAFATPDRVQNLGSTL-GIPVIGLPESLNLDS------PFRKLISSDPKLAPTPRIR  1325
             NV LAFA   +V  L S L G  V+G+PE+L ++S       F KLISSDP +AP PRI 
Sbjct  61    NVTLAFAATGKVDELVSALRGCHVVGVPEALGMNSLSSDGSVFHKLISSDPAMAPMPRIA  120

Query  1324  QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHV  1145
             QQDTAA+L+SSGTTG  K V L+H NFIAM+ELFVRFEAS Y+YP++ NVYL V+PM+HV
Sbjct  121   QQDTAAILYSSGTTGRSKGVMLSHGNFIAMIELFVRFEASLYDYPSSENVYLAVVPMFHV  180

Query  1144  YGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK-ADKC  968
             YGLSLFV+GLLSLGSTVV +++++ DE+VRAIDRY VTH    PP+LVALT++AK     
Sbjct  181   YGLSLFVLGLLSLGSTVVTMKRFDADEMVRAIDRYAVTHLHSVPPILVALTKRAKRGGGA  240

Query  967   GLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSV  788
               +SLKQVS GAAP+S   I   +   PH+DFIQGYGMTESTA+ TRG+NT     Y+SV
Sbjct  241   SFRSLKQVSCGAAPLSKKSITELIEALPHVDFIQGYGMTESTALATRGYNTVGSHKYSSV  300

Query  787   GLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLH  608
             G+L+PN+EA+VVD      G+ LPP S+GELWLR P  M GYLNN +A+  A+D DGWLH
Sbjct  301   GVLSPNVEAKVVDW---VTGAHLPPGSVGELWLRSPGNMNGYLNNIDATMVALDKDGWLH  357

Query  607   TGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGE  428
             TGDIV+FD++GYLYV DRLKE+IKYKGFQIAPADLEAVLMSHP+++DAAVT  + EE GE
Sbjct  358   TGDIVYFDQEGYLYVIDRLKEVIKYKGFQIAPADLEAVLMSHPEVLDAAVTGYRDEEAGE  417

Query  427   IPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNL  248
             IPVAFVV+++GS   LS+  ++ +VAKQVAPYKKVR+VYF+ SIP+S +GKILR+ELRNL
Sbjct  418   IPVAFVVRREGS--YLSETALMSYVAKQVAPYKKVRKVYFSSSIPRSPAGKILRRELRNL  475

Query  247   LIT  239
             L++
Sbjct  476   LVS  478



>ref|XP_008460452.1| PREDICTED: 4-coumarate--CoA ligase-like 6 [Cucumis melo]
Length=554

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/514 (61%), Positives = 387/514 (75%), Gaps = 20/514 (4%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRN--HGGLSALVDSQSGFSISYPELRSL  1670
             +YS +TGI  S H    LPSDPFLDVVSFI S    H G SAL+DS +G SISY EL  +
Sbjct  37    WYSPDTGICHSVHGYRKLPSDPFLDVVSFIFSVQFQHNGHSALIDSLTGNSISYKELFPM  96

Query  1669  VNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSF  1490
             V SMA+GLH +G+SQGDV L++LPNSI++P+I LG L +GAV  TM P S+ SEIKK+  
Sbjct  97    VKSMASGLHNLGISQGDVVLLMLPNSIFYPIIILGALYLGAVITTMFPQSSSSEIKKRIT  156

Query  1489  DCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLD-------SPFRKLISSDPKLAPTPR  1331
             DCNVRLAF    +++N    LGI  IG+PE+ N D       S F +LISS   L   P 
Sbjct  157   DCNVRLAFTITQKIKNF-EALGIKTIGVPENTNFDLMRPMGFSSFYELISSGSDLIKRPV  215

Query  1330  IRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMY  1151
             IRQ+DTAA+LFSSGTTG  K V L+H NFI+ +ELFVRFEASQYEY  T NVYL  +PM+
Sbjct  216   IRQEDTAAILFSSGTTGVSKGVMLSHRNFISTIELFVRFEASQYEYLPTKNVYLAAIPMF  275

Query  1150  HVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADK  971
             H+YGLS+FVMGL+SLGS+VVV+ K++V +VV+AIDR+ VTHFPV PP+L+AL+R A  +K
Sbjct  276   HIYGLSIFVMGLMSLGSSVVVMSKFDVKDVVKAIDRFKVTHFPVVPPILIALSRTA--EK  333

Query  970   CGLK---SLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRN  800
              G++   SLKQVS GAA  S   I +FV+   H+DFIQGYGMTESTA+GTRGFN  K RN
Sbjct  334   IGVRRFRSLKQVSCGAAASSKKTIDDFVQALSHVDFIQGYGMTESTAIGTRGFNNKKTRN  393

Query  799   YTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDD  620
             Y SVGLLAPN EA+VVD  +G     +PP   GEL LRGP  MKGYLNN EA+ + +D +
Sbjct  394   YLSVGLLAPNTEAKVVDWVTGSS---MPPGKTGELLLRGPGSMKGYLNNPEATMSTIDQE  450

Query  619   GWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSE  440
              WLHTGDIV+FD DGYLYV DRLKE+IKYKGFQIAP DLEAV+++HP+++D AV +A+ E
Sbjct  451   NWLHTGDIVYFDRDGYLYVVDRLKEVIKYKGFQIAPTDLEAVVIAHPEVLDTAVAAAKDE  510

Query  439   EVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVA  338
             E GEIPVAFVVKK GS  +LSQ +V+D+VA+QV+
Sbjct  511   ECGEIPVAFVVKKPGS--ALSQKDVVDYVAQQVS  542



>ref|XP_010664596.1| PREDICTED: 4-coumarate--CoA ligase-like 6 isoform X2 [Vitis vinifera]
Length=513

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/469 (64%), Positives = 368/469 (78%), Gaps = 11/469 (2%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             ++S ETGIY S +PS+ +PSDP LD+VSFI S+NH G+SAL D  SGFSISY +L  LV 
Sbjct  33    WFSPETGIYSSTYPSLPIPSDPHLDIVSFIFSKNHNGVSALTDYSSGFSISYSQLHPLVK  92

Query  1663  SMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             SMA+GLH+MG SQGDV L+LLPNSIYFPVIFL +LS+G +A TMNPLS+L+EI+KQ+  C
Sbjct  93    SMASGLHQMGFSQGDVILLLLPNSIYFPVIFLAVLSLGGIATTMNPLSSLTEIRKQTVGC  152

Query  1483  NVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSP------FRKLISSDPKLAPTPRIRQ  1322
             ++ LAF  P+  + LG+ LG+PVIG+PE+ + +S       F  LIS DP   P P I Q
Sbjct  153   SLSLAFTVPETSEKLGA-LGVPVIGVPENGSFNSKSKEFSTFHWLISGDPDCCPRPVINQ  211

Query  1321  QDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVY  1142
              D AA+++SSGTTG  KAV LTH NFIAMVE FVRFEAS YE   + NVYL VLPM+H+Y
Sbjct  212   HDVAAIMYSSGTTGSTKAVVLTHGNFIAMVETFVRFEASLYENSGSENVYLAVLPMFHIY  271

Query  1141  GLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCG-  965
             GLSLFV GL+SLGS +VV+RK++ +E+V+AIDRY VTHFPV PP+L+AL + A+A   G 
Sbjct  272   GLSLFVTGLISLGSAIVVMRKFDANEMVKAIDRYRVTHFPVVPPVLMALIKSARAAGAGC  331

Query  964   LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVG  785
               SLKQV  GAAP++   IQ FV+T  H+D IQGYGMTESTAVGTRGFNT KLRNY+S+G
Sbjct  332   FGSLKQVCCGAAPLTQKSIQEFVQTLSHVDLIQGYGMTESTAVGTRGFNTKKLRNYSSIG  391

Query  784   LLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHT  605
             LLAPNM A+VVDL     GS LPP + GELWL+GP IMKGYLN+ EA+ + +D +GWLHT
Sbjct  392   LLAPNMRAKVVDL---SSGSLLPPGNCGELWLQGPGIMKGYLNDEEATISTIDKEGWLHT  448

Query  604   GDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAV  458
             GDIV FD+DGYLY+  R+KE+IKYKGFQIAP DLE++L+SHP+I DAAV
Sbjct  449   GDIVSFDQDGYLYMFSRIKEIIKYKGFQIAPVDLESILISHPEISDAAV  497



>ref|XP_010677414.1| PREDICTED: 4-coumarate--CoA ligase-like 6 [Beta vulgaris subsp. 
vulgaris]
Length=568

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/550 (58%), Positives = 406/550 (74%), Gaps = 22/550 (4%)
 Frame = -2

Query  1849  SCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSL  1670
             SC Y+ ETGIY SK+P + LP +PFLDVV+ I S  + G S L+DS SG+SI +  L SL
Sbjct  22    SC-YNPETGIYSSKNPKIQLPENPFLDVVTHIFSYTNNGTSVLIDSSSGYSIPFSHLFSL  80

Query  1669  VNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSF  1490
             V S++ GLH MG SQGDVALILLPNSIY P+IFLG+L +G +   MNPLS+ SE+KKQ+ 
Sbjct  81    VKSISFGLHEMGFSQGDVALILLPNSIYLPLIFLGVLYLGGIVTPMNPLSSFSEVKKQTL  140

Query  1489  DCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSP-----FRKLISSDPKLA---PTP  1334
              C+  +AF   + V+ L S+LG+ +I +PE++  +       F +LI      +   P P
Sbjct  141   GCHATMAFTIGENVEKL-SSLGLNIIQVPENVIGEETQKYPDFSRLIFGKKVRSYSFPRP  199

Query  1333  RIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQY-EYPATANVYLDVLP  1157
             +I Q DTAA+++SSGT+G  K V LTH NFIAMVELFVRFEASQY E  +  NVYL VLP
Sbjct  200   KINQDDTAAIMYSSGTSGASKGVMLTHRNFIAMVELFVRFEASQYKEMMSHKNVYLAVLP  259

Query  1156  MYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKA  977
             M+H+YGL+LF  GLLSLG++VVV++KY+++EVV+ I++Y VTHFPV PPLL ALT KAK+
Sbjct  260   MFHIYGLALFGFGLLSLGTSVVVMKKYDINEVVKVIEKYKVTHFPVVPPLLAALTTKAKS  319

Query  976   -----DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTA  812
                  +  GL SLKQVS GAAPI+   I +F+   P +DFIQGYG+TES AVGTRGFN  
Sbjct  320   LDSVGNVSGLCSLKQVSCGAAPITSKVIADFLEIVPSVDFIQGYGLTESAAVGTRGFNVV  379

Query  811   KLR-NYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKN  635
                  YTSVGLLAPN EA+VV+ S+G     +PP   GEL LRGP +MKGY N+ EA++ 
Sbjct  380   GHNPKYTSVGLLAPNTEAKVVNCSTGSC---MPPGKAGELLLRGPGVMKGYHNSQEATRL  436

Query  634   AVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVT  455
              +++DGWLHTGDI +FD DGYLY+ DRLK++IKYKGFQIAPADLEA+L+SHP+I+D AV 
Sbjct  437   TIEEDGWLHTGDIAYFDHDGYLYIIDRLKDIIKYKGFQIAPADLEALLISHPEILDVAVI  496

Query  454   SAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGK  275
              +  EE GE+PVAFVV++ GS   LS+  +I +VA  VAP+KKVR V F KSIPKSA+GK
Sbjct  497   GSADEEAGEVPVAFVVRRPGS--LLSRDEIIKYVADTVAPHKKVREVVFMKSIPKSATGK  554

Query  274   ILRKELRNLL  245
             +LRK+L NLL
Sbjct  555   MLRKQLANLL  564



>gb|KHG01780.1| 4-coumarate--CoA ligase-like 6 [Gossypium arboreum]
Length=534

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/540 (60%), Positives = 398/540 (74%), Gaps = 38/540 (7%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             +YS ET IY S + S+ LP+DPFLDVVSFI S  H G++AL+DS SG+SISY +L  LV 
Sbjct  22    WYSPETRIYSSTYSSISLPTDPFLDVVSFIFSHQHDGVTALIDSSSGYSISYSKLLPLVQ  81

Query  1663  SMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             SMA+GLH +GVSQGDV L+LLPNS++FP+IF  +L +GA+  TMNPLS + E+KKQ  DC
Sbjct  82    SMASGLHHLGVSQGDVVLLLLPNSVHFPIIFFSVLYLGAIVTTMNPLSNMMEVKKQIVDC  141

Query  1483  NVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSP------FRKLISSDPKLAPTPRIRQ  1322
              VR AF   + V  L   LG+  IG+PE+++LDS       FRKLI      AP P IRQ
Sbjct  142   GVRFAFTLLENVDKL-QKLGVHAIGVPENMDLDSEKTGFLSFRKLIGGQFGKAPRPVIRQ  200

Query  1321  QDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVY  1142
             QDTAA+++SSGTTG  K V LTH NFIAM ELFVRFEASQYEY ++ NVYL VLPM+H+Y
Sbjct  201   QDTAAIMYSSGTTGVSKGVVLTHGNFIAMTELFVRFEASQYEYSSSKNVYLAVLPMFHIY  260

Query  1141  GLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK-ADKCG  965
             GLSLFV+GLLSLGS++V++R+++  E+V+ ID YGVTHFPV PP+L  LT +AK   +  
Sbjct  261   GLSLFVVGLLSLGSSIVIMRRFDASELVKVIDDYGVTHFPVVPPILTTLTMRAKHVCENS  320

Query  964   LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVG  785
             L+SLKQVS GAAP+S   I +FV+  PH+DF+QGYGMTESTAVGTRGFN  K  NY+S+G
Sbjct  321   LQSLKQVSCGAAPLSRKTILDFVQALPHVDFVQGYGMTESTAVGTRGFNNEKHHNYSSIG  380

Query  784   LLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHT  605
             LLAPNM+A+VVD       SSLPP   GELWLRGPAIM+ Y+NN EA+   +D DGWL T
Sbjct  381   LLAPNMQAKVVDW---NSDSSLPPGFHGELWLRGPAIMQRYINNVEATNMTIDKDGWLRT  437

Query  604   GDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEI  425
             GDI                         IAPADLEAVL+SHP+I+DAAVTSA  E  GEI
Sbjct  438   GDI-------------------------IAPADLEAVLISHPEILDAAVTSAADEVCGEI  472

Query  424   PVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNLL  245
             PVAFVV++ G   +L++  VIDFVA QVAPYKKVRRV FT+SIPKSA+GKILRKEL++ +
Sbjct  473   PVAFVVRRHGC--TLTKGAVIDFVANQVAPYKKVRRVVFTESIPKSAAGKILRKELKSFI  530



>ref|XP_010111547.1| 4-coumarate--CoA ligase-like 6 [Morus notabilis]
 gb|EXC31205.1| 4-coumarate--CoA ligase-like 6 [Morus notabilis]
Length=619

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/607 (54%), Positives = 410/607 (68%), Gaps = 76/607 (13%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             +YS ETGIY S +P ++LPSDPFLD VSF+ SR H G++AL+D+ SG SI Y EL  LV 
Sbjct  20    WYSPETGIYNSTYPPINLPSDPFLDAVSFLFSRQHEGVTALIDAPSGISIPYSELYPLVK  79

Query  1663  SMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             S A+GLH  GVS+GDV L+LLPNS+YFPVI +G++ +GA+   MNPLS+++EIKK+  DC
Sbjct  80    SFASGLHSKGVSKGDVVLVLLPNSVYFPVIIMGVMYLGAIFTPMNPLSSVTEIKKRVTDC  139

Query  1483  NVRLAFATPDRVQNLGSTLGIPVIGLPESLN-LD---------SPFRKLISSD--PKLAP  1340
                LAF  P++ + +   LG+  I +PE +  LD         S F KLIS      +AP
Sbjct  140   KPCLAFTAPEK-EEVFQKLGVGAIRVPEGVTYLDKRSPKTGNFSDFSKLISCHDFDNMAP  198

Query  1339  TPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYE--YPATANVYLD  1166
              P IRQQDTAA+++SSGTTG  K   ++H NFIAM+ELFVRFE SQY+  Y  +  VYL 
Sbjct  199   RPLIRQQDTAAIMYSSGTTGVSKGAVISHGNFIAMMELFVRFEVSQYKEFYSPSEIVYLV  258

Query  1165  VLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRK  986
              LPM+H+YGL  F +G+LSLGSTVVV+ KY+V EVV+AI++Y +TH P+ PP+L ALT+ 
Sbjct  259   FLPMFHIYGLCHFAIGMLSLGSTVVVMSKYDVKEVVKAIEKYKITHLPLVPPILAALTKV  318

Query  985   AKADKCG----------------------------------LKSLKQVSSGAAPISITCI  908
             AK D  G                                   +SLKQ+S GAAP S   I
Sbjct  319   AKDDIEGNGGKTFQSLKQISWGAAPSRKVAKDDIEGNGGKTFQSLKQISWGAAPSSRKMI  378

Query  907   QNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssgggg  728
             ++ V+T PHID IQGYGMTESTA+G RG NT KLRNY SVGLLAPN  A+VVD      G
Sbjct  379   EDLVQTLPHIDLIQGYGMTESTAIGARGLNTKKLRNYFSVGLLAPNTHAKVVDC---STG  435

Query  727   sSLPPTSMGELWLRGPAIMK---------------------GYLNNGEASKNAVDDDGWL  611
             S LPP   GELWL+GP IMK                     GYLN+ E + +A+D DGWL
Sbjct  436   SLLPPGKSGELWLKGPGIMKGYLNDPETTMSAIDKDGWLRTGYLNDPETTMSAIDKDGWL  495

Query  610   HTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVG  431
              TGDIV+ +++GYL++ DRLKEMIKYKGFQIAPADLE VL SHP+I++  VT    EE G
Sbjct  496   RTGDIVYINQNGYLHIIDRLKEMIKYKGFQIAPADLETVLTSHPEILEVGVTGIPDEECG  555

Query  430   EIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRN  251
             EIPVAFVV+K+GS+  LS  +V+D+VA QVAPYKK+R+V FT SIPKS +GKILR+EL+ 
Sbjct  556   EIPVAFVVRKQGSK--LSHKDVMDYVASQVAPYKKIRKVIFTNSIPKSPAGKILRRELKE  613

Query  250   LLITSKI  230
              L TSK+
Sbjct  614   SL-TSKL  619



>gb|AES89623.2| acyl:CoA ligase [Medicago truncatula]
Length=478

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/484 (63%), Positives = 381/484 (79%), Gaps = 13/484 (3%)
 Frame = -2

Query  1660  MAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCN  1481
             MA+ LH+MGVSQGDV L+LLPNSIY+PVI L +L +GAV   +NPLS++ EI+KQ  +C 
Sbjct  1     MASALHKMGVSQGDVVLLLLPNSIYYPVILLAVLYLGAVFTPLNPLSSVGEIRKQVQECG  60

Query  1480  VRLAFATPDRVQNLGSTLGI-PVIGLPES---LNLD--SPFRKLISSDPKLAPTPRIRQQ  1319
             V  AF  P+ V+ L    GI P+I +PE+   L  D  S F  L+     L     I+Q+
Sbjct  61    VSFAFTIPENVKKLELLGGINPIIAVPENEKDLRNDGFSSFFNLLYGKFDLPQRVVIKQE  120

Query  1318  DTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVYG  1139
             DTA +L+SSGTTG  K V LTH N I+MVELFVRFEASQY+Y  + +V+L VLPM+HVYG
Sbjct  121   DTAGILYSSGTTGVSKGVVLTHRNLISMVELFVRFEASQYDYSCSKSVFLAVLPMFHVYG  180

Query  1138  LSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKA-DKCGL  962
             LSLF  GLLSLGSTV+V+RK+++DEV+R ID+Y VTHFPV PP+L ALT KAK  +   L
Sbjct  181   LSLFAAGLLSLGSTVIVMRKFDIDEVIRVIDKYNVTHFPVVPPMLSALTMKAKGVNGIKL  240

Query  961   KSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGL  782
             +SL+QVS GAAP+SI  I +FV  FP++DFIQGYGMTESTAVGTRGFNT K  NY+S+GL
Sbjct  241   QSLRQVSCGAAPLSIGVISSFVHAFPNVDFIQGYGMTESTAVGTRGFNTEKFHNYSSIGL  300

Query  781   LAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTG  602
             LAPN EA+VVD ++G     LPP S GELWLRGP+IM+GYLNN EA+ + +D DGWLHTG
Sbjct  301   LAPNTEAKVVDWNNGTF---LPPGSCGELWLRGPSIMRGYLNNEEATISTIDKDGWLHTG  357

Query  601   DIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIP  422
             DIV+FD+DGYL++ DRLK++IKYKGFQIAPADLEAVL+ HP+I+DAAVT+A+ EE+GEIP
Sbjct  358   DIVYFDQDGYLHLADRLKDIIKYKGFQIAPADLEAVLILHPEIIDAAVTAAEDEEIGEIP  417

Query  421   VAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNLLI  242
             VAFVVKK GS   LS  +V+++VA+QVAPYKKVR+V+FT  IP+S +GKILRK+LR+ L 
Sbjct  418   VAFVVKKVGS--VLSPKDVVNYVAEQVAPYKKVRKVFFTDKIPRSPTGKILRKQLRHCL-  474

Query  241   TSKI  230
             TSK+
Sbjct  475   TSKL  478



>gb|EPS72162.1| hypothetical protein M569_02598, partial [Genlisea aurea]
Length=546

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/551 (56%), Positives = 394/551 (72%), Gaps = 26/551 (5%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGG----LSALVDSQSGFSISYPELR  1676
             FYS ETGIY SK+PSV+LPS P LDVVS+I S  HGG      A++DS SG SI++  LR
Sbjct  1     FYSPETGIYTSKYPSVNLPSSPNLDVVSYIFSHRHGGGGDDAPAVIDSSSGISITHSTLR  60

Query  1675  SLVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQ  1496
             SLV ++A+G+H +GV +GD  +ILLPNS +FPV+FL  LS+GAVAA  NPL +L EI KQ
Sbjct  61    SLVKTVASGMHSIGVQKGDAVMILLPNSPFFPVVFLAALSLGAVAAPANPLCSLPEIGKQ  120

Query  1495  SFDCNVRLAFATPDRVQNLGSTL-GIPVIGLPESLNLD-------------SPFRKLIS-  1361
             + DC   + F   +R   L   L G  +IG+   L+LD             S FRKLI  
Sbjct  121   AVDCMPAVVFTVQNRAPELADALPGCRIIGVDIDLDLDRDGRSGIDRGTPESDFRKLIRR  180

Query  1360  SDPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATA  1181
             SDP+ +P P IRQ+D AA+L+SSGTTG  K   LTH NFIA  E+FVRFEAS Y +    
Sbjct  181   SDPRASPNPEIRQRDVAAILYSSGTTGRPKGTLLTHGNFIAAAEVFVRFEASNYRHHHRG  240

Query  1180  --NVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPL  1007
                V+L V+PM+H+YGLSLFV+GL SLGSTVV +R+++ +E+ +A+ RYGVTH    PP+
Sbjct  241   FRAVHLAVMPMFHIYGLSLFVVGLPSLGSTVVAMRRFDGEEMAKAVYRYGVTHIHTVPPM  300

Query  1006  LVALTRKAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTR  827
             L A+T+ AK       +LKQV  GA  IS   I  F++ FPH+DFIQGYGMTE+TA+GTR
Sbjct  301   LSAMTKLAKRFTSYGGNLKQVICGATLISKKIIHEFLQAFPHVDFIQGYGMTETTAIGTR  360

Query  826   GFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGE  647
             G+N  K R Y S GLLAPN++A+VVD+ +G     LPP S+GELWL  P  MKGYLN+ E
Sbjct  361   GYNNGKFRKYLSAGLLAPNIKAKVVDVITGSC---LPPGSIGELWLDTPGNMKGYLNSPE  417

Query  646   ASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVD  467
              +   +  DGWL TGDIV+ DEDGYL+V DRLK++IKYKG+QI+PA+LEAVLM+HP++V+
Sbjct  418   ETSAVLGKDGWLRTGDIVYLDEDGYLFVIDRLKDVIKYKGYQISPAELEAVLMAHPEVVE  477

Query  466   AAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKS  287
             AAVT     E GEIPVAFVV KKGS  S+S+A ++++V+K VAP+KKVRR++F  SIPKS
Sbjct  478   AAVTGITDNEAGEIPVAFVVLKKGS--SISEAALVEYVSKYVAPHKKVRRIHFRDSIPKS  535

Query  286   ASGKILRKELR  254
              +GKIL++ELR
Sbjct  536   PAGKILKRELR  546



>ref|XP_002519005.1| AMP dependent CoA ligase, putative [Ricinus communis]
 gb|EEF43538.1| AMP dependent CoA ligase, putative [Ricinus communis]
Length=517

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/538 (56%), Positives = 382/538 (71%), Gaps = 53/538 (10%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             +Y  +TGIY SKHP+V LP+DPFLDVVSFI S  H G++A +DS SGFSI Y +L  LVN
Sbjct  20    WYCPQTGIYTSKHPTVSLPTDPFLDVVSFIFSHKHNGVTAFIDSFSGFSIPYSDLFPLVN  79

Query  1663  SMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             SMA+GL  MG+ QG                        AV  TMNPLST  EI+KQ  +C
Sbjct  80    SMASGLQNMGLKQG------------------------AVVTTMNPLSTSLEIEKQISNC  115

Query  1483  NVRLAFATPDRVQNLGSTLGIPVIGLPESLN-------LDSPFRKLISSDPKLAPTPRIR  1325
             N  +AF+  ++   L S LGIPV+ +PE++         D+ F  L+  +  L   P IR
Sbjct  116   NACIAFSVLEKAAKLQS-LGIPVVSVPENVTSLKANKAFDA-FYMLLYGNVDLCLRPIIR  173

Query  1324  QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHV  1145
             Q+DTAA+L+SSGTTG  K V LTH NFI+MVELFVRFEASQY+Y ++ NV+L VLPM+HV
Sbjct  174   QEDTAAILYSSGTTGSSKGVVLTHRNFISMVELFVRFEASQYDYSSSKNVFLAVLPMFHV  233

Query  1144  YGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCG  965
             YGLSLFVMGLLSLGS++VV+R           D   ++   +   LL++L       +C 
Sbjct  234   YGLSLFVMGLLSLGSSIVVMR---------KFDANEMSRQLICMKLLISLLFH----RCS  280

Query  964   LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVG  785
               +LKQVS GAAP+    IQ+FV T P++DFIQGYGMTESTAVGTRGFNT   + Y+S+G
Sbjct  281   --NLKQVSCGAAPLFGKTIQDFVETLPYVDFIQGYGMTESTAVGTRGFNTKNFQKYSSIG  338

Query  784   LLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHT  605
             LLAPN+EA+V+D  +G     LPP + GEL +RGPA+MK YLNNGEA+ + +D DGWLHT
Sbjct  339   LLAPNIEAKVMDWVTGCF---LPPGNSGELLIRGPAVMKEYLNNGEATASTIDKDGWLHT  395

Query  604   GDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEI  425
             GDIV+ D DGYL++ DRLKE+IKYKGFQIAPADLEAVL+ HPDI+DAAVT+A  +E GEI
Sbjct  396   GDIVYIDHDGYLHIVDRLKEIIKYKGFQIAPADLEAVLVCHPDILDAAVTAAIDKECGEI  455

Query  424   PVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRN  251
             PVAFVVK+   E  L+Q ++I++VA QVAP+KKVR+V F +SIPKSA+GKILR+ELR+
Sbjct  456   PVAFVVKRL--ESMLTQEDIINYVAVQVAPHKKVRKVIFVQSIPKSAAGKILRRELRH  511



>emb|CDX99401.1| BnaC01g11510D [Brassica napus]
Length=668

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/487 (61%), Positives = 377/487 (77%), Gaps = 18/487 (4%)
 Frame = -2

Query  1672  LVNSMAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQ  1496
             +V S+AA +HR +GV QGDV  ++LPNS+YFP++FL L+S+G V  TMNP S+L EIKKQ
Sbjct  1     MVESIAAAIHRDLGVRQGDVVSLVLPNSLYFPLLFLSLISLGTVVTTMNPSSSLGEIKKQ  60

Query  1495  SFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDS------PFRKLISS--DPKLAP  1340
               +CNV LAF + + V  L S LG+ VI +PES +LDS       F  +I    D     
Sbjct  61    VSECNVALAFTSRESVAKLAS-LGVVVIRVPESYDLDSVRVENPKFYSIIKGGFDFGSVT  119

Query  1339  TPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVL  1160
              P ++Q D AA+++SSGTTG  K V LTH N IA +ELFVRFEASQYE+P ++NVYL  L
Sbjct  120   KPLVKQDDVAAIMYSSGTTGASKGVMLTHRNLIASMELFVRFEASQYEHPGSSNVYLAAL  179

Query  1159  PMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK  980
             P+ H+YGLSLFVMGLLS+GST+VV+R+++V +VV  I+R+ +THFPV PP+L+ALT+KAK
Sbjct  180   PLCHIYGLSLFVMGLLSVGSTIVVMRRFDVSDVVDVIERFKITHFPVVPPMLMALTKKAK  239

Query  979   ADKCG--LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKL  806
                CG   +SLKQVSSGAAP+S   I++FV T PH+D IQGYGMTESTAVGTRGFNT KL
Sbjct  240   G-VCGEAFRSLKQVSSGAAPLSRKFIEDFVGTLPHVDLIQGYGMTESTAVGTRGFNTQKL  298

Query  805   RNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVD  626
             R Y+SVGLLAPNM+ARVVD SSG     LPP + GELW++GP +MKGYLNN EA++  + 
Sbjct  299   RKYSSVGLLAPNMQARVVDWSSGSF---LPPGNRGELWIQGPGVMKGYLNNPEATEMTIV  355

Query  625   DDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQ  446
             +  WL TGDI +F EDGYL++ DR+KE+IKYKGFQIAPADLEAVL+SHP I+DAAVT+A 
Sbjct  356   EKSWLRTGDIAYFGEDGYLFIVDRMKEIIKYKGFQIAPADLEAVLVSHPLIIDAAVTAAP  415

Query  445   SEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILR  266
             +EE GEIPVAFVV+++  E +LS+ +VI++VA QVAPY+KVR+V    SIPKS +GKILR
Sbjct  416   NEECGEIPVAFVVRRQ--ETALSEQDVINYVAAQVAPYRKVRKVVMVSSIPKSPTGKILR  473

Query  265   KELRNLL  245
             KEL+ +L
Sbjct  474   KELKRIL  480



>dbj|BAJ88016.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=570

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/541 (56%), Positives = 378/541 (70%), Gaps = 22/541 (4%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFILSRNHGG-----LSALVDSQSGFSISYPELRSLVNS  1661
             G+Y S HP V LP DP L +V  I SR   G        L+D+ +  S+S  +LR LV S
Sbjct  20    GLYASTHPPVPLPVDPGLSLVPHIFSRLPLGPPPHSRPCLLDAATAASLSRADLRRLVAS  79

Query  1660  MAAGLHRM-GVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             +A GL R  GV  G V L++LPNS+ FPV FL +L+ G VA TMNP S+ +EI  +  D 
Sbjct  80    LARGLRRAHGVRAGAVVLLVLPNSVAFPVAFLAVLAAGGVATTMNPSSSRAEIAGRLRDT  139

Query  1483  NVRLAFATPDRVQNLGSTLGIPVIGLPESL-------NLDSPFRKLISSDPKLA-PTPRI  1328
                L  A+PD    +  +   PV+ +PE+        N  +PFR L+ SD     P+  +
Sbjct  140   APSLVLASPDNAAKVPPSAAAPVVLVPETFHPSPSAGNEFAPFRALLDSDADDGLPSAEV  199

Query  1327  RQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYH  1148
              Q D AAVL+SSGT+G  K V LTH N IAMVELFVRFEASQY  PA  NVYL  LPM+H
Sbjct  200   GQDDAAAVLYSSGTSGRSKGVVLTHRNLIAMVELFVRFEASQYARPACDNVYLAALPMFH  259

Query  1147  VYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKC  968
             VYGLSLF  GLLSLGSTVVV+R+++V + VRAI +Y VTH P+ PP++ AL R       
Sbjct  260   VYGLSLFAAGLLSLGSTVVVMRRFDVGDAVRAIHKYKVTHLPLVPPIMAALLRARATGAS  319

Query  967   GLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSV  788
              L+SL QVSSGAAP+S   +Q+F++ FPH+DFIQGYGMTESTAVGTRGFNT+K + Y SV
Sbjct  320   SLESLVQVSSGAAPLSGKLVQDFLKAFPHVDFIQGYGMTESTAVGTRGFNTSKHKKYASV  379

Query  787   GLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLH  608
             GLLAPNM A++VDL     G  LPP S GELWL GPAIMKGYLN+ +     + +DGW  
Sbjct  380   GLLAPNMHAKIVDL---ETGLCLPPGSCGELWLHGPAIMKGYLNDED---TCMRNDGWFQ  433

Query  607   TGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGE  428
             TGD+ +FD DGYLY+  RLK+ IKYKGFQIAPADLEAVL+ HP+IVD AVTSA+ EE GE
Sbjct  434   TGDLAYFDSDGYLYIVGRLKDTIKYKGFQIAPADLEAVLVQHPEIVDVAVTSAEDEEAGE  493

Query  427   IPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNL  248
             IPVAFVV++ GS ++  Q  V+++VAKQV+PYKKVR+V F ++IPKSA+GK+LR+ L++ 
Sbjct  494   IPVAFVVRRSGSHLTCVQ--VMEYVAKQVSPYKKVRKVIFVEAIPKSAAGKVLRRLLKDS  551

Query  247   L  245
             L
Sbjct  552   L  552



>gb|EYU23282.1| hypothetical protein MIMGU_mgv1a006528mg [Erythranthe guttata]
Length=440

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/441 (64%), Positives = 338/441 (77%), Gaps = 16/441 (4%)
 Frame = -2

Query  1534  MNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLG--IPVIGLPE------SLNLD-S  1382
             MNPLS+LSEIKKQ  D +  LAF    +V  L  +LG    VIG+PE      SL  D S
Sbjct  1     MNPLSSLSEIKKQVLDSSASLAFTLVGKVDELVGSLGGGCRVIGVPEDMFDFDSLRSDGS  60

Query  1381  PFRKLISSDPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQ  1202
              F +L+SSDP LAP PRI Q DTAA+L+SSGTTG  K V LTH NFIAM+ LFVRFEAS 
Sbjct  61    VFGELVSSDPSLAPRPRIAQNDTAAILYSSGTTGRAKGVMLTHGNFIAMMVLFVRFEASM  120

Query  1201  YEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFP  1022
             Y+YP+T NVYL V+PM+HVYGLSLFVMGLLSLG T+V ++K+  +E+  A++RYGVTH  
Sbjct  121   YDYPSTENVYLAVVPMFHVYGLSLFVMGLLSLGCTIVTMKKFGANEMATAVERYGVTHLH  180

Query  1021  VAPPLLVALTRKAKAD-KCG-LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTE  848
               PPL+  L R+AK D  C   +SLKQVS GAAP+S   I  F  TFP +DFIQGYGMTE
Sbjct  181   AVPPLVAELVRRAKRDGSCNSFRSLKQVSCGAAPLSENSINEFKETFPRVDFIQGYGMTE  240

Query  847   STAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMK  668
             +TAVGTRG+NT + R Y+SVGLL+PN E +VV+  +G     LPP S+GELWL  P  MK
Sbjct  241   TTAVGTRGYNTIEARKYSSVGLLSPNAEGKVVNWVTGAH---LPPGSVGELWLHTPGNMK  297

Query  667   GYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLM  488
             GYLNN EA+   +D DGWLHTGDIV+FD +GYLYV DRLKE+IKYKGFQ+APADLEAVLM
Sbjct  298   GYLNNIEATMATIDKDGWLHTGDIVYFDNEGYLYVIDRLKEIIKYKGFQVAPADLEAVLM  357

Query  487   SHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYF  308
             SHP+++DAAV  A+ EE GEIPVAFVV K+GS  S+SQA ++DFVAKQVAPYKKVR+V+F
Sbjct  358   SHPEVLDAAVIGARDEEAGEIPVAFVVPKEGS--SISQAALLDFVAKQVAPYKKVRKVHF  415

Query  307   TKSIPKSASGKILRKELRNLL  245
               SIP+SA+GKILR+ELRNLL
Sbjct  416   RASIPRSAAGKILRRELRNLL  436



>ref|XP_004983523.1| PREDICTED: 4-coumarate--CoA ligase-like 3-like [Setaria italica]
Length=579

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/545 (55%), Positives = 379/545 (70%), Gaps = 23/545 (4%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSAL----VDSQSGFSISYPELR  1676
             FYS+ +G+Y S HP+V LP+DP L +   +L+      +      VD+ +G ++S   LR
Sbjct  23    FYSAASGVYASTHPAVRLPADPCLSLAPHVLALLPAAAAPDAPALVDAATGEAVSRAGLR  82

Query  1675  SLVNSMAAGL-HRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKK  1499
              LV+++AAGL  R G+  GDV LI LPNS+ FPV FL +L+ G VA TMNP S  +EI  
Sbjct  83    RLVSALAAGLLRRHGLHAGDVVLIALPNSVAFPVAFLAVLAAGGVATTMNPYSAPAEIAD  142

Query  1498  QSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLD-------SPFRKLISSDPKLAP  1340
             +  +    L  A  D    L   L +PV+ +P +           +PFR L+  D  L P
Sbjct  143   RVRETRPALVLAAADNAGRL-PPLRVPVVLVPGTFRPADAGAPGFAPFRSLLLLDSDLPP  201

Query  1339  TPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVL  1160
              P + Q D AA+L+SSGT G  K V LTH N IA  ELFVRFEASQY  PA  NVYL  L
Sbjct  202   APPVGQDDAAAILYSSGTGGRSKGVVLTHRNLIATAELFVRFEASQYAAPACDNVYLAAL  261

Query  1159  PMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK  980
             PM+HVYGLSLF +GLL+LGSTVVV+++++V E V+AIDR+GVTHFP+ PP++ A+     
Sbjct  262   PMFHVYGLSLFAVGLLTLGSTVVVMKRFDVGEAVKAIDRFGVTHFPLVPPIMAAMVH--A  319

Query  979   ADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRN  800
             A+   L SL QVS+GAAP S+  I +FV+ FPH+D IQGYGMTES AVGTRGFNT+K + 
Sbjct  320   AEPPALSSLVQVSTGAAPASVRLINDFVKAFPHVDLIQGYGMTESAAVGTRGFNTSKQKK  379

Query  799   YTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDD  620
             Y SVGLLAPNM AR+VDL     G  LPP S GELWL GPAIM+GYLN+ +A      ++
Sbjct  380   YASVGLLAPNMHARIVDL---ETGCYLPPGSCGELWLHGPAIMRGYLNDEDAHAM---NN  433

Query  619   GWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSE  440
             GWL TGD  +FD DGYLY+  RLKE+IKYKG+QIAPADLEAVL+ HP+IVD AVTSA+ E
Sbjct  434   GWLRTGDAAYFDSDGYLYIVGRLKEVIKYKGYQIAPADLEAVLVEHPEIVDVAVTSAEDE  493

Query  439   EVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKE  260
             E GE+PVAFVV+K GS  SLS   V+++VAKQV+PYKKVR+V F ++IP+S +GK+LR+ 
Sbjct  494   EAGEVPVAFVVRKSGS--SLSCTEVMEYVAKQVSPYKKVRKVVFVEAIPRSPAGKVLRRL  551

Query  259   LRNLL  245
             L+N L
Sbjct  552   LKNSL  556



>gb|KHG01779.1| 4-coumarate--CoA ligase-like 6 [Gossypium arboreum]
Length=527

 Score =   535 bits (1379),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 299/507 (59%), Positives = 367/507 (72%), Gaps = 38/507 (7%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             +YS ET IY S + S+ LP+DPFLDVVSFI S  H G++AL+DS SG+SISY +L  LV 
Sbjct  22    WYSPETRIYSSTYSSISLPTDPFLDVVSFIFSHQHDGVTALIDSSSGYSISYSKLLPLVQ  81

Query  1663  SMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             SMA+GLH +GVSQGDV L+LLPNS++FP+IF  +L +GA+  TMNPLS + E+KKQ  DC
Sbjct  82    SMASGLHHLGVSQGDVVLLLLPNSVHFPIIFFSVLYLGAIVTTMNPLSNMMEVKKQIVDC  141

Query  1483  NVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSP------FRKLISSDPKLAPTPRIRQ  1322
              VR AF   + V  L   LG+  IG+PE+++LDS       FRKLI      AP P IRQ
Sbjct  142   GVRFAFTLLENVDKL-QKLGVHAIGVPENMDLDSEKTGFLSFRKLIGGQFGKAPRPVIRQ  200

Query  1321  QDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVY  1142
             QDTAA+++SSGTTG  K V LTH NFIAM ELFVRFEASQYEY ++ NVYL VLPM+H+Y
Sbjct  201   QDTAAIMYSSGTTGVSKGVVLTHGNFIAMTELFVRFEASQYEYSSSKNVYLAVLPMFHIY  260

Query  1141  GLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK-ADKCG  965
             GLSLFV+GLLSLGS++V++R+++  E+V+ ID YGVTHFPV PP+L  LT +AK   +  
Sbjct  261   GLSLFVVGLLSLGSSIVIMRRFDASELVKVIDDYGVTHFPVVPPILTTLTMRAKHVCENS  320

Query  964   LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVG  785
             L+SLKQVS GAAP+S   I +FV+  PH+DF+QGYGMTESTAVGTRGFN  K  NY+S+G
Sbjct  321   LQSLKQVSCGAAPLSRKTILDFVQALPHVDFVQGYGMTESTAVGTRGFNNEKHHNYSSIG  380

Query  784   LLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHT  605
             LLAPNM+A+VVD       SSLPP   GELWLRGPAIM+ Y+NN EA+   +D DGWL T
Sbjct  381   LLAPNMQAKVVDW---NSDSSLPPGFHGELWLRGPAIMQRYINNVEATNMTIDKDGWLRT  437

Query  604   GDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEI  425
             GDI                         IAPADLEAVL+SHP+I+DAAVTSA  E  GEI
Sbjct  438   GDI-------------------------IAPADLEAVLISHPEILDAAVTSAADEVCGEI  472

Query  424   PVAFVVKKKGSEVSLSQANVIDFVAKQ  344
             PVAFVV++ G   +L++  VIDFVA Q
Sbjct  473   PVAFVVRRHGC--TLTKGAVIDFVANQ  497



>ref|XP_008658826.1| PREDICTED: 4-coumarate--CoA ligase-like 3 [Zea mays]
 tpg|DAA46521.1| TPA: putative AMP-dependent synthetase and ligase superfamily 
protein [Zea mays]
Length=575

 Score =   531 bits (1368),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 301/551 (55%), Positives = 379/551 (69%), Gaps = 20/551 (4%)
 Frame = -2

Query  1849  SCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSR---NHGGLSALVDSQSGFSISYPEL  1679
             + FY +  G+Y S HP V LPSDP L +V  I +R         ALVD+ +  ++S  +L
Sbjct  17    ATFYCAAAGVYASTHPPVALPSDPSLSLVPHIFARLPAARPDAPALVDAATAEALSRADL  76

Query  1678  RSLVNSMAAGLHRMGVSQG-DVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIK  1502
             R LV+++AAGL R    +  DV L+ LPNSI FPV FL +L+ G++A TM+P S  +EI 
Sbjct  77    RRLVSALAAGLRRRRGLREGDVVLLALPNSIAFPVAFLAVLAAGSIATTMSPFSAPAEIA  136

Query  1501  KQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLD-------SPFRKLISSDPKLA  1343
              +  D +  L FAT D V  L   L +PV+ +P++ +L        +PFR+L+  D +  
Sbjct  137   ARVRDTSPALVFATLDNVGKL-PPLRVPVVLVPDAFHLADEGAPEFAPFRELLLLDSEPL  195

Query  1342  PTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDV  1163
             P P + Q D AA+L+SSGT G  K V LTH N IA VELFV FEASQY  PA  NVYL  
Sbjct  196   PGPSVGQDDAAAILYSSGTGGRSKGVVLTHRNLIATVELFVHFEASQYAAPACDNVYLAA  255

Query  1162  LPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKA  983
             LPM+HVYGLSLF +GLLSLGSTVVV+++++  E V+ I R+ VTHFPV PP++ AL    
Sbjct  256   LPMFHVYGLSLFAVGLLSLGSTVVVMKRFDAGEAVKTIRRFKVTHFPVVPPIMAALVHTT  315

Query  982   KADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLR  803
             K     L+ L QVS+GAAP S   I +FV+ FPH+D IQGYGMTES AVGTRGFNT+K +
Sbjct  316   KPAAMPLECLVQVSTGAAPSSRRLIDDFVKAFPHVDLIQGYGMTESAAVGTRGFNTSKHK  375

Query  802   NYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDD  623
              Y SVGLLAPNM AR+V +     G SLPP S GELWL GPAIMKGYLN+ +       +
Sbjct  376   KYGSVGLLAPNMHARIVHV---ETGCSLPPGSCGELWLHGPAIMKGYLNHVDPCAI---N  429

Query  622   DGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQS  443
              GWL TGDI +FD DGYLY+  RLKE+IKYKGFQIAPADLEAVL+ HP IVD AVTS + 
Sbjct  430   GGWLRTGDIAYFDFDGYLYIVGRLKEVIKYKGFQIAPADLEAVLIEHPGIVDVAVTSTED  489

Query  442   EEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRK  263
             EE GE+PVAFVV+K GS +S +Q  V+++VAKQV+PYKKVR+V F +SIPKS +GK+LR+
Sbjct  490   EEAGEVPVAFVVRKSGSGLSCTQ--VMEYVAKQVSPYKKVRKVVFVESIPKSPAGKVLRR  547

Query  262   ELRNLLITSKI  230
              LR  L  S +
Sbjct  548   LLRESLAASAV  558



>ref|XP_002464864.1| hypothetical protein SORBIDRAFT_01g027820 [Sorghum bicolor]
 gb|EER91862.1| hypothetical protein SORBIDRAFT_01g027820 [Sorghum bicolor]
Length=579

 Score =   523 bits (1347),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 302/553 (55%), Positives = 382/553 (69%), Gaps = 22/553 (4%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSR---NHGGLSALVDSQSGFSISYPELRS  1673
             FYS+ TG+Y S HP V LPSDP L +V  I +R         AL+D+ +  ++S  +LR 
Sbjct  17    FYSAATGVYASTHPPVALPSDPSLSLVPHIFARLPAARPDAPALLDAATAEALSRADLRR  76

Query  1672  LVNSMAAGLHRMGVSQG-DVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQ  1496
             LV+++AAGL R G  +G DV L+ LPNS+ FPV FL +L+ G+VA TM+P S  +EI  +
Sbjct  77    LVSALAAGLRRRGGLRGGDVVLLALPNSVAFPVAFLAVLAAGSVATTMSPSSAPAEIAAR  136

Query  1495  SFDCNVRLAFATPDRVQNLGSTLGIPVIGLPES---LNLD-----SPFRKLISSDPKLAP  1340
               D +  L FA PD V  L   L +PV+ +P++   L  D     +PFR+L+  D +   
Sbjct  137   VRDTSPALVFAAPDNVGKL-PPLRVPVVLVPDAFHHLGDDGAPEFAPFRELLLFDSEPLM  195

Query  1339  TPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVL  1160
              P + Q D AA+L+SSGT G  K V LTH N IA VELFVRFEASQY  PA  NVYL  L
Sbjct  196   APPVGQDDAAAILYSSGTGGRSKGVVLTHRNLIATVELFVRFEASQYAAPACDNVYLAAL  255

Query  1159  PMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK  980
             PM+HVYGL+LF +GLLSLGSTVVV+++++  + V+AI R+ VTHFPV PP++ AL    K
Sbjct  256   PMFHVYGLALFAVGLLSLGSTVVVMKRFDAGDAVKAIHRFKVTHFPVVPPIMAALVHATK  315

Query  979   ADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRN  800
                  L+SL QVS+GAAP S   I +FV+ FPH+DFIQGYGMTES AVGTRGFNT K + 
Sbjct  316   PAAMPLESLVQVSTGAAPSSGRLIDDFVKAFPHVDFIQGYGMTESAAVGTRGFNT-KQKK  374

Query  799   YTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASK---NAV  629
             Y SVGLLAPNM AR+V +        LPP S GELWL GPAIMK +      SK   +  
Sbjct  375   YASVGLLAPNMHARIVHM---ETACCLPPGSCGELWLHGPAIMKAFRCLVVLSKIMDSRA  431

Query  628   DDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSA  449
              +DGWL TGDI +FD DGYLY+  RLKE+IKYKGFQIAPADLEA+L+ HP IVD AVTS 
Sbjct  432   INDGWLRTGDIAYFDFDGYLYIVGRLKEVIKYKGFQIAPADLEAILIEHPGIVDVAVTST  491

Query  448   QSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKIL  269
             + +E GEIPVAFVV+K GS +S +Q  V+D+VAKQV+PYKKVR+V F +SIPKS +GK+L
Sbjct  492   EDKEAGEIPVAFVVRKSGSGLSCTQ--VMDYVAKQVSPYKKVRKVVFVESIPKSPAGKVL  549

Query  268   RKELRNLLITSKI  230
             R+ L++ L  S +
Sbjct  550   RRLLKDSLAASAV  562



>ref|XP_003574399.1| PREDICTED: 4-coumarate--CoA ligase-like 3 isoform X1 [Brachypodium 
distachyon]
Length=569

 Score =   521 bits (1342),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 303/565 (54%), Positives = 384/565 (68%), Gaps = 32/565 (6%)
 Frame = -2

Query  1882  IRNSAAEKGRRSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSR------NHGGLSAL  1721
             ++++AA    R+ FYS+  G+Y S H  V LP+DP L +V  + SR       H  L  L
Sbjct  1     MQDAAAHDPSRT-FYSAAAGVYSSTHAPVPLPADPGLSLVPHLFSRLPLDAAPHSLL--L  57

Query  1720  VDSQSGFSISYPELRSLVNSMAAGL---HRMGVSQGDVALILLPNSIYFPVIFLGLLSVG  1550
              D+ +G S++  +LR LV+S+A GL   HR  V  G V L++LPNSI FP+ FL +L+ G
Sbjct  58    RDAATGASLTRADLRRLVSSLAHGLRQTHR--VRAGAVVLLVLPNSIAFPIAFLAVLAAG  115

Query  1549  AVAATMNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLD-----  1385
             AVA TMNP S+ +EI  +  +    L  A+ D V  L    G PV+ +P  L        
Sbjct  116   AVATTMNPYSSSAEIADRVRETRPCLVLASRDNVSKLPPFAGAPVVLVPHLLTAAPADEQ  175

Query  1384  -SPFRKLISSDP-KLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFE  1211
              +PF  L+ S      P+  + Q D AAVL+SSGT+G  K V LTH N I MVELFVRFE
Sbjct  176   FAPFHALLGSGAGDEFPSAEVGQDDAAAVLYSSGTSGRSKGVVLTHRNLITMVELFVRFE  235

Query  1210  ASQYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVT  1031
              SQY  PA  NVYL  LPM+HVYGLSLF +GLLSLGSTVVV+ +++V E V AI RY VT
Sbjct  236   VSQYARPACDNVYLAALPMFHVYGLSLFAVGLLSLGSTVVVMNRFDVGEAVSAIHRYKVT  295

Query  1030  HFPVAPPLLVALTR---KAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGY  860
             H P+ PP++ AL R    A A    L SL QVSSGAAP+S   IQ+F++ FPH+DFIQGY
Sbjct  296   HLPLVPPIMTALLRAKATAGAGALPLGSLVQVSSGAAPLSGRLIQDFIKAFPHVDFIQGY  355

Query  859   GMTESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGP  680
             GMTESTAVGTRGFN++K +NY SVGLLAPNM A++V+L     G  LPP S GELWL GP
Sbjct  356   GMTESTAVGTRGFNSSKHKNYASVGLLAPNMHAKIVEL---ETGFCLPPGSCGELWLHGP  412

Query  679   AIMKGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLE  500
             A+MKGYL + +        DGWL TGD+ +FD DGYLY+  RLK+ IKYKGFQIAPADLE
Sbjct  413   AVMKGYLTDEDVCTR---KDGWLRTGDLAYFDSDGYLYIAGRLKDTIKYKGFQIAPADLE  469

Query  499   AVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVR  320
              VL+ HP++VD AVTSA+ EE GEIP+AFVV+K GS ++  Q  V+++VAKQV+P+KKVR
Sbjct  470   EVLVQHPEVVDVAVTSAEDEEAGEIPIAFVVRKSGSTLTCVQ--VMEYVAKQVSPHKKVR  527

Query  319   RVYFTKSIPKSASGKILRKELRNLL  245
             RV F  +IPKSA+GK+LR+ L++ L
Sbjct  528   RVIFVNAIPKSAAGKVLRRLLKDSL  552



>ref|XP_006662642.1| PREDICTED: 4-coumarate--CoA ligase-like 2-like, partial [Oryza 
brachyantha]
Length=526

 Score =   514 bits (1324),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 302/526 (57%), Positives = 366/526 (70%), Gaps = 36/526 (7%)
 Frame = -2

Query  1792  LPSDPFLDVVSFILSRNHGGLS----ALVDSQSGFSISYPELRSLVNSMAAGL-HRMGVS  1628
             LPSDP L +V  + SR    L+    AL+D+ +  S+S   LR LV S+AAGL HR+ V+
Sbjct  4     LPSDPSLSLVPHLFSRLPFHLTNPSPALLDASTSSSLSCAHLRRLVYSLAAGLRHRLRVA  63

Query  1627  QGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRLAFATPDRV  1448
             +G   L LLPNSI FPV    LL+ GAVA TMNP S  +EI  +  D    L FA+P   
Sbjct  64    RGSTVLFLLPNSITFPV---ALLATGAVATTMNPSSAPAEITARLRDTAPSLVFASPQNA  120

Query  1447  QNLGSTLGIPVIGLPESLNLDSP--------FRKLISSDPK----LAPTPRIRQQDTAAV  1304
               L   L  P++ +P++ +L SP        F  L+  DP     LAP P + Q+D A V
Sbjct  121   SKL-PPLSAPLVLVPDTFHL-SPDQHHRFALFHALL--DPAGADALAP-PEVGQEDAAVV  175

Query  1303  LFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVYGLSLFV  1124
             L+SSGTTGG K V LTH N IAMVELFVRFE SQY  PA  N+YL  LPM+HVYGL LF 
Sbjct  176   LYSSGTTGGSKGVVLTHRNLIAMVELFVRFEVSQYTRPACENIYLAALPMFHVYGLGLFA  235

Query  1123  MGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCGLKSLKQV  944
             +GLLSLGSTVVV+++++V E VRAIDRY VTH P+ PP++ AL R     K  L+SL QV
Sbjct  236   VGLLSLGSTVVVMKRFDVGEAVRAIDRYKVTHLPLVPPIVAALVRA----KAPLQSLVQV  291

Query  943   SSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGLLAPNME  764
             SSGAAPI+   I +F+  FPH+DFIQGYGMTESTAVGTRGFNT K + Y SVGLLAPNM 
Sbjct  292   SSGAAPINANLIHDFLTAFPHVDFIQGYGMTESTAVGTRGFNTCKHKKYASVGLLAPNMH  351

Query  763   ARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTGDIVHFD  584
             A++V L     GS LPP S GELWL GPAIMKGYLN+G+ S      DGWL TGDI +FD
Sbjct  352   AKIVHL---ESGSCLPPGSCGELWLDGPAIMKGYLNDGDGSFT--RKDGWLRTGDIAYFD  406

Query  583   EDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVK  404
              DGYL++  RLK+ IKYKGFQIA ADLEAVL+ HP+IVD AVTS + E+ GEIPVAFVV+
Sbjct  407   SDGYLFIVGRLKDTIKYKGFQIALADLEAVLIRHPEIVDVAVTSDEDEDAGEIPVAFVVR  466

Query  403   KKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILR  266
             K GS   LS  +V+++VAK VA YK+VR+V F ++IPKSA+GKILR
Sbjct  467   KSGS--ILSCTDVMEYVAKLVASYKRVRKVVFVEAIPKSAAGKILR  510



>ref|XP_009132455.1| PREDICTED: 4-coumarate--CoA ligase-like 6 isoform X2 [Brassica 
rapa]
Length=488

 Score =   508 bits (1307),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 271/455 (60%), Positives = 337/455 (74%), Gaps = 19/455 (4%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHG----GLSALVDSQSGFSISYPELR  1676
             ++S +TGIY SKHPSVHLP DP LD  S + S  H       +A VDS +GFSISY EL+
Sbjct  26    WFSPDTGIYTSKHPSVHLPVDPHLDAASALFSHLHTVDDPSSAAFVDSLTGFSISYSELQ  85

Query  1675  SLVNSMAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKK  1499
              +V S+AA +HR  GV QGDV  ++LPNS+YFP++FL L+S+G V  TMNP S+L EIKK
Sbjct  86    VMVESIAAAIHRDFGVRQGDVVSLVLPNSLYFPLLFLSLISLGTVVTTMNPSSSLGEIKK  145

Query  1498  QSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDS------PFRKLISSDPKLAPT  1337
             Q  +CNV LAF + + V  L S LG+ VI +PES +LDS       F  +I       P 
Sbjct  146   QVRECNVALAFTSRESVDKLAS-LGVVVIRVPESYDLDSVRVENPTFYSIIKGGLGSVPK  204

Query  1336  -PRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVL  1160
              P ++Q D AA+++SSGTTG  K V LTH N IA +ELFVRFEASQYEYP  +NVYL  L
Sbjct  205   KPLVKQDDVAAIMYSSGTTGASKGVMLTHRNLIASMELFVRFEASQYEYPGASNVYLAAL  264

Query  1159  PMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK  980
             P+ H+YGLSLFVMGLLS+GST+VV+R+++V +VV  I+R+ VTHFPV PP+L+ALT+KAK
Sbjct  265   PLCHIYGLSLFVMGLLSVGSTIVVMRRFDVSDVVDVIERFKVTHFPVVPPMLMALTKKAK  324

Query  979   ADKCG--LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKL  806
                CG   +SLKQVSSGAAP+S   I++FV T PH+D IQGYGMTESTAVGTRGFNT KL
Sbjct  325   G-VCGEAFRSLKQVSSGAAPLSRKFIEDFVGTLPHVDLIQGYGMTESTAVGTRGFNTQKL  383

Query  805   RNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVD  626
             R Y+SVGLLAPNM+ARVVD      GS LPP + GELW++GP +MKGYLNN EA++  + 
Sbjct  384   RKYSSVGLLAPNMQARVVDW---SSGSFLPPGNRGELWIQGPGVMKGYLNNPEATEMTIV  440

Query  625   DDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQ  521
             +  WL TGDI +FDEDGYL++ DR+KE+IKYKGFQ
Sbjct  441   EKSWLRTGDIAYFDEDGYLFIVDRMKEIIKYKGFQ  475



>ref|XP_006659822.1| PREDICTED: 4-coumarate--CoA ligase-like 3-like, partial [Oryza 
brachyantha]
Length=522

 Score =   505 bits (1301),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 293/540 (54%), Positives = 362/540 (67%), Gaps = 36/540 (7%)
 Frame = -2

Query  1726  ALVDSQSGFSISYPELRSLVNSMAAGLHRM-GVSQGDVALILLPNSIYFPVIFLGLLSVG  1550
             ALVD+ +  S+S   LR LV S+AAGL R  GV  G V ++LLPNS+ FPV FL +L+ G
Sbjct  1     ALVDAATASSVSRAGLRRLVPSLAAGLRRRHGVRSGSVVMLLLPNSVVFPVSFLAVLAAG  60

Query  1549  AVAATMNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLD-----  1385
              VA T+NP S+  EI  Q+      L  A+ D  + L S L  PV+ +PE L+L      
Sbjct  61    GVATTVNPSSSPKEIAAQARATGASLVLASRDGARKLLSPLAAPVVLVPEILDLSVGAAA  120

Query  1384  --------SPFRKLISSDPKLAPTPRI-RQQDTAAVLFSSGTTGGCKAVALTHANFIAMV  1232
                     + FR L+  D + A    +  Q D AA+LFSSGTTG  K V LTH N IAMV
Sbjct  121   EDEDQRAFAEFRALLDDDSESAEIATVVGQDDAAAILFSSGTTGRSKGVVLTHRNLIAMV  180

Query  1231  ELFVRFEASQYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRA  1052
             ELFVRFEASQY   A  NVYL  LPM+HVYGLSLF +GLLSLG+TVVV+R+++V E VRA
Sbjct  181   ELFVRFEASQYARGARENVYLAALPMFHVYGLSLFAVGLLSLGTTVVVMRRFDVREAVRA  240

Query  1051  IDRYGVTHFPVAPPLLVALTRKAKADK---CGLKSLKQVSSGAAPISITCIQNFVRTFPH  881
             I RY VTH P+ PP++ A+ R A A +     + SL QVS GAAP   T I  F++ FP 
Sbjct  241   IGRYRVTHLPLVPPIMAAMVRAAAAGRVPPAEVASLVQVSCGAAPTRATLIHEFLQAFPR  300

Query  880   IDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMG  701
             +DFIQGYGMTESTAVGTRGFNT K +NYTSVGLLAPNM A+++ L     G+ LPP S G
Sbjct  301   LDFIQGYGMTESTAVGTRGFNTNKHKNYTSVGLLAPNMHAKIIHL---ESGTCLPPGSSG  357

Query  700   ELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQ  521
             ELWL GP IMKGYLN  + +      DGWL TGDI +FD DGYLY+  RLK+ IKYKGFQ
Sbjct  358   ELWLHGPGIMKGYLNGDDDAST--RKDGWLRTGDIAYFDSDGYLYIVGRLKDTIKYKGFQ  415

Query  520   IAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQV  341
             IAP DLE VL+ HP+I+D AV SA+ EE GEIPVAFVV+K  SE SLS   V+++VAKQV
Sbjct  416   IAPGDLEEVLIHHPEILDVAVASAEDEEAGEIPVAFVVRK--SESSLSCMQVMEYVAKQV  473

Query  340   APYKKVRRVYFTKSIPKSASGKILRKELRNLLITSKI*LCTQIHL*SFSRTHPTSLISSL  161
             A YK+VR+V F ++IPKSA+GK+LR+ L+N L  + +           + T P+S+ S L
Sbjct  474   ASYKRVRKVIFVEAIPKSAAGKVLRRLLKNSLDAAAV-----------AATSPSSIASKL  522



>gb|KDP46675.1| hypothetical protein JCGZ_12199 [Jatropha curcas]
Length=439

 Score =   500 bits (1288),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 267/441 (61%), Positives = 332/441 (75%), Gaps = 17/441 (4%)
 Frame = -2

Query  1534  MNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNL---DSPFRKL-  1367
             MNPLST+ EI+KQ   C   +AF+  ++   L S LGIP++ +PE   L    S F+   
Sbjct  1     MNPLSTILEIQKQIVHCKACIAFSLFEKSSKLHS-LGIPIVSVPEHPTLIKEKSEFQVFY  59

Query  1366  ------ISSDPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEAS  1205
                   ++ +  L+    IRQ+D AA+L+SSGTTG  K V LTH NFI+++E FVRFEAS
Sbjct  60    NLVYGNVNVNFDLSVRSVIRQEDPAAILYSSGTTGASKGVVLTHRNFISVIEHFVRFEAS  119

Query  1204  QYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHF  1025
             QYEY A+ NVYL  LPM+HVYGLSLFVMGL SLGS +VV+RK++ +E+V+AIDRYGVTHF
Sbjct  120   QYEYSASDNVYLAALPMFHVYGLSLFVMGLFSLGSGIVVMRKFDANEMVKAIDRYGVTHF  179

Query  1024  PVAPPLLVALTRKAKA-DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTE  848
             PV PP+L  L +KAK+    G +SLKQVS GAAP+    IQ+FV TFP +DFIQGYGMTE
Sbjct  180   PVVPPILQTLIKKAKSVSANGFRSLKQVSCGAAPLYQKTIQDFVETFPFVDFIQGYGMTE  239

Query  847   STAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMK  668
             STAVGTRGFNT   + Y+S+GLLAPN EA+++D  +G     LPP   GEL +RGPAIMK
Sbjct  240   STAVGTRGFNTKHCQKYSSIGLLAPNTEAKLMDWITGYY---LPPGCSGELLIRGPAIMK  296

Query  667   GYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLM  488
              YLN+ +A+ + +D DGWLHTGDIV+ D DGYL++ DRLKE+IKYKGFQIAPADLEAVL+
Sbjct  297   EYLNDRKATASTIDKDGWLHTGDIVYIDCDGYLHIIDRLKEIIKYKGFQIAPADLEAVLI  356

Query  487   SHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYF  308
             SHPDI+DAAVT A  +E GEIPVAFVVK++GS   L++  + D VA QVAPYKKVR+V F
Sbjct  357   SHPDILDAAVTGAIDKECGEIPVAFVVKRQGS--MLTERAIFDCVADQVAPYKKVRKVIF  414

Query  307   TKSIPKSASGKILRKELRNLL  245
              +SIPKSA+GKILR+ELR  L
Sbjct  415   VQSIPKSAAGKILRRELRRYL  435



>ref|XP_006854104.1| hypothetical protein AMTR_s00048p00141400 [Amborella trichopoda]
 gb|ERN15571.1| hypothetical protein AMTR_s00048p00141400 [Amborella trichopoda]
Length=529

 Score =   500 bits (1288),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 280/521 (54%), Positives = 354/521 (68%), Gaps = 27/521 (5%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             +YS E G+Y+S    V LP DPF+D  SF+LS  H G +AL+DS +GFSISY +L  +V 
Sbjct  7     WYSDENGVYKSTFSPVDLPKDPFVDATSFLLSHKHHGTTALIDSSTGFSISYTQLPHMVK  66

Query  1663  SMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             S+A+GLH +GVSQG V L+LLPN  YFPVIFL ++S GA+A  MNPLST +EI KQ   C
Sbjct  67    SIASGLHEIGVSQGQVVLMLLPNMAYFPVIFLSIISAGAIATPMNPLSTFNEIMKQIKYC  126

Query  1483  NVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPFRK-------------------LIS  1361
             NV LAF   + +  L    GIPV+ + E     S F +                   ++S
Sbjct  127   NVVLAFTVSEYLGKL-EKAGIPVVLVREHEEKSSHFVRGKEEKISCSGSSKVVSFDWVLS  185

Query  1360  SDPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEAS--QYEYPA  1187
              DP  A  PRI Q D A +L SSGT+G  K VA+TH N I+ VELFVRFEAS  + EY  
Sbjct  186   CDPIHATRPRINQNDIAVLLNSSGTSGPSKVVAITHRNLISTVELFVRFEASLCENEYMG  245

Query  1186  TANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPL  1007
                VYLDV+PM+H+YGL L   GLLSLGS +V++ K++  E+ R I  YGVTH P  P L
Sbjct  246   WETVYLDVIPMFHIYGLVLLASGLLSLGSKIVIMHKFDEREMARCISGYGVTHIPAVPSL  305

Query  1006  LVALTRKAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTR  827
             +V+LT+  K D    +SLKQV SGAAP+S   I  F++ FPH++  QGYGMTE+TAVG R
Sbjct  306   VVSLTKIGKMDNYSFRSLKQVVSGAAPLSKKSIDEFLKVFPHVELGQGYGMTETTAVGFR  365

Query  826   GFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGE  647
             G   AK++ Y+SVGLLAPNMEA+VVD      GS LPP   GELWLRGP IMK Y N+  
Sbjct  366   GTTNAKVKKYSSVGLLAPNMEAKVVD---SAQGSCLPPGETGELWLRGPGIMKEYFNSHT  422

Query  646   ASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVD  467
             A+ + +D +GWLHTGDIV+FD+DGYLY+ DRLK++IK  GFQ+APADL+A+L+ HP I+D
Sbjct  423   ATLSTIDKEGWLHTGDIVYFDKDGYLYIVDRLKDIIKCNGFQVAPADLDAILILHPQILD  482

Query  466   AAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQ  344
             AAV    +E+ GEIPVAFV +  GS  +LS+A+VIDFVA Q
Sbjct  483   AAVAGIPNEQTGEIPVAFVKRSIGS--NLSEADVIDFVAAQ  521



>gb|EAZ05563.1| hypothetical protein OsI_27777 [Oryza sativa Indica Group]
Length=591

 Score =   502 bits (1293),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 300/578 (52%), Positives = 380/578 (66%), Gaps = 37/578 (6%)
 Frame = -2

Query  1897  ENISKIRNSAAEKGRRSC-----FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSR---N  1742
             + I+  RN+    GR S      FYS+ TGIY S HP V LP+DP L +V+ + +R    
Sbjct  4     DAIAAARNAGCSSGRISQPPPPPFYSAATGIYSSIHPPVALPTDPSLTLVAHLFARLPLT  63

Query  1741  HGGLSALVDSQSGFSISYPELRSLVNSMAAGLHRM-GVSQGDVALILLPNSIYFPVIFLG  1565
               G  +LVD+ +  ++S  +LR LV S+AAGL R  GV +G V L+LLPNS+ FPV FL 
Sbjct  64    DPGAPSLVDAATASAVSRADLRRLVASLAAGLRRRHGVRKGSVVLLLLPNSVAFPVSFLA  123

Query  1564  LLSVGAVAATMNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLN--  1391
             +L+ GAVA TMNP S+ +EI  Q+      L  A+ D    L   L  PV+ +PE L+  
Sbjct  124   VLAAGAVATTMNPSSSPAEIAAQARATGACLVLASRDGAARL-PPLAAPVVLVPEILDHS  182

Query  1390  -----------LDSPFRKLISSDPKL---APTPRIRQQDTAAVLFSSGTTGGCKAVALTH  1253
                        + + FR ++            P + Q D A +L+SSGT+G  K V LTH
Sbjct  183   AAADDGDDDQRVFAAFRAMLDGGGGDGTETAVPVVGQDDAAVILYSSGTSGRSKGVVLTH  242

Query  1252  ANFIAMVELFVRFEASQYE-YPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrky  1076
              N IAM ELFVRFEASQY    A  NVY+  LPM HVYGLSLF +GLLSLG+TVVV+R++
Sbjct  243   RNLIAMTELFVRFEASQYHARGARENVYMAALPMSHVYGLSLFAVGLLSLGATVVVMRRF  302

Query  1075  evdevvRAIDRYGVTHFPVAPPLLVALTRKAKAD---KCGLKSLKQVSSGAAPISITCIQ  905
             +  + V AI RY VTH P+ PP++ A+ R A A       + SL QVS GAAPI+   I 
Sbjct  303   DAGDAVAAIGRYKVTHMPLVPPIMAAMVRAAAAGGVPPSQVASLVQVSCGAAPITAALIH  362

Query  904   NFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggs  725
              F++ FPH+DFIQGYGMTESTAVGTRGFNT+K + YTSVGLLAPNM A++V L S     
Sbjct  363   EFLQAFPHVDFIQGYGMTESTAVGTRGFNTSKHKKYTSVGLLAPNMHAKIVHLESSSC--  420

Query  724   SLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKE  545
              LPP   GELWL GP IMKGYL++ +        DGWL TGDI +FD DGYLY+  RLK+
Sbjct  421   -LPPGFSGELWLSGPGIMKGYLSDDD--DACTRKDGWLRTGDIAYFDLDGYLYIVGRLKD  477

Query  544   MIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANV  365
              IKYKGFQIAP DLE VL+ HP+I+D AVTSA+ EE GEIPVAFVV++ GS +S  Q  V
Sbjct  478   TIKYKGFQIAPGDLEEVLIHHPEILDVAVTSAEDEEAGEIPVAFVVRRSGSNLSCKQ--V  535

Query  364   IDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRN  251
             +++VAKQVAPYK+VR+V F ++IPKS +GK+LR+ LRN
Sbjct  536   MEYVAKQVAPYKRVRKVVFVEAIPKSPAGKVLRRLLRN  573



>ref|NP_001175376.1| Os08g0143300 [Oryza sativa Japonica Group]
 sp|Q6YYZ2.1|4CLL3_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 3 [Oryza sativa Japonica 
Group]
 dbj|BAD13196.1| putative 4-coumarate--CoA ligase 4CL2 [Oryza sativa Japonica 
Group]
 dbj|BAD17022.1| putative 4-coumarate--CoA ligase 4CL2 [Oryza sativa Japonica 
Group]
 dbj|BAH94104.1| Os08g0143300 [Oryza sativa Japonica Group]
Length=591

 Score =   501 bits (1289),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 299/578 (52%), Positives = 380/578 (66%), Gaps = 37/578 (6%)
 Frame = -2

Query  1897  ENISKIRNSAAEKGRRSC-----FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSR---N  1742
             + I+  RN+    GR S      FYS+ TGIY S HP V LP+DP L +V+ + +R    
Sbjct  4     DAIAAARNAGCSSGRISQPPPPPFYSAATGIYSSIHPPVALPTDPSLTLVAHLFARLPLA  63

Query  1741  HGGLSALVDSQSGFSISYPELRSLVNSMAAGLHRM-GVSQGDVALILLPNSIYFPVIFLG  1565
               G   LVD+ +  ++S  +LR LV S+AAGL R  GV +G V L+LLPNS+ FPV FL 
Sbjct  64    DPGAPTLVDAATASAVSRADLRRLVASLAAGLRRRHGVRKGSVVLLLLPNSVAFPVSFLA  123

Query  1564  LLSVGAVAATMNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLN--  1391
             +L+ GAVA TMNP S+ +EI  Q+      L  A+ D    L   L  PV+ +PE L+  
Sbjct  124   VLAAGAVATTMNPSSSPAEIAAQARATGACLVLASRDGAARL-PPLAAPVVLVPEILDHS  182

Query  1390  -----------LDSPFRKLISSDPKL---APTPRIRQQDTAAVLFSSGTTGGCKAVALTH  1253
                        + + FR ++            P + Q D  A+L+SSGT+G  K V LTH
Sbjct  183   AAADDGDDDQRVFAAFRAMLDGGGGDGTETAVPVVGQDDAVAILYSSGTSGRSKGVVLTH  242

Query  1252  ANFIAMVELFVRFEASQYE-YPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrky  1076
              N IAM ELFVRFEASQY    A  NVY+  LPM HVYGLSLF +GLLS+G+TVVV+R++
Sbjct  243   RNLIAMTELFVRFEASQYHARGARENVYMAALPMSHVYGLSLFAVGLLSIGATVVVMRRF  302

Query  1075  evdevvRAIDRYGVTHFPVAPPLLVALTRKAKAD---KCGLKSLKQVSSGAAPISITCIQ  905
             +  + V AI RY VTH P+ PP++ A+ R A A       + SL QVS GAAPI+   I 
Sbjct  303   DAGDAVAAIGRYKVTHMPLVPPIMAAMVRAAAAGGVPPSQVASLVQVSCGAAPITAALIH  362

Query  904   NFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggs  725
              F++ FPH+DFIQGYGMTESTAVGTRGFNT+K + YTSVGLLAPNM A++V L S     
Sbjct  363   EFLQAFPHVDFIQGYGMTESTAVGTRGFNTSKHKKYTSVGLLAPNMHAKIVHLESSSC--  420

Query  724   SLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKE  545
              LPP   GELWL GP IMKGYL++ + +      DGWL TGDI +FD DGYLY+  RLK+
Sbjct  421   -LPPGFSGELWLHGPGIMKGYLSDDDDA--CTRKDGWLRTGDIAYFDLDGYLYIVGRLKD  477

Query  544   MIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANV  365
              IKYKGFQIAP DLE VL+ HP+I+D AVTSA+ EE GEIPVAFVV++ GS +S  Q  V
Sbjct  478   TIKYKGFQIAPGDLEEVLIHHPEILDVAVTSAEDEEAGEIPVAFVVRRSGSNLSCKQ--V  535

Query  364   IDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRN  251
             +++VAKQVAPYK+VR+V F ++IPKS +GK+LR+ LRN
Sbjct  536   MEYVAKQVAPYKRVRKVVFVEAIPKSPAGKVLRRLLRN  573



>gb|EMS63832.1| 4-coumarate--CoA ligase-like 3 [Triticum urartu]
Length=446

 Score =   481 bits (1237),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 255/437 (58%), Positives = 316/437 (72%), Gaps = 16/437 (4%)
 Frame = -2

Query  1534  MNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLD-------SPF  1376
             MNP S+ +EI  +  D    L  A+PD    L  +   PV+ +PE+ +         +PF
Sbjct  1     MNPSSSRAEIADRLRDTAPSLVLASPDNAAKLPPS-AAPVVLVPETFHPTPSAGHEFAPF  59

Query  1375  RKLISSDPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYE  1196
             R L+ SD    P+  + Q D AAVL+SSGT+G  K V LTH N IAMVELFVRFEASQY 
Sbjct  60    RSLLDSDADDLPSAEVGQDDAAAVLYSSGTSGRSKGVVLTHRNLIAMVELFVRFEASQYA  119

Query  1195  YPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVA  1016
              PA  NVYL  LPM+HVYGLSLF  GLLSLGSTVVV+R+++V E VRA+ RY VTH P+ 
Sbjct  120   RPACDNVYLAALPMFHVYGLSLFAAGLLSLGSTVVVMRRFDVGEAVRAVHRYKVTHLPLV  179

Query  1015  PPLLVALTRKAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAV  836
             PP++ AL R        L SL QVSSGAAP++   +Q+F++ FPH+DFIQGYGMTESTAV
Sbjct  180   PPIMAALLRAKATGASSLDSLVQVSSGAAPLNGKLVQDFIKAFPHVDFIQGYGMTESTAV  239

Query  835   GTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLN  656
             GTRGFNT+K + Y SVGLLAPNM A++VDL     G  LPP S GELWL GPAIMKGYLN
Sbjct  240   GTRGFNTSKHKKYASVGLLAPNMHAKIVDL---ETGLCLPPGSCGELWLHGPAIMKGYLN  296

Query  655   NGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPD  476
             + +       +DGWL TGD+ +FD DGYLY+  RLK+ IKYKGFQIAPADLEAVL+ HP+
Sbjct  297   DEDTCTR---NDGWLQTGDLAYFDSDGYLYIVGRLKDTIKYKGFQIAPADLEAVLVQHPE  353

Query  475   IVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSI  296
             IVD AVTSA+ EE GEIPVAFVV++ GS ++  Q  V+++VAKQV+PYKKVR+V F ++I
Sbjct  354   IVDVAVTSAEDEEAGEIPVAFVVRRSGSHLTCVQ--VMEYVAKQVSPYKKVRKVIFVEAI  411

Query  295   PKSASGKILRKELRNLL  245
             PKSA+GK+LR+ L++ L
Sbjct  412   PKSAAGKVLRRLLKDSL  428



>ref|XP_006828979.1| hypothetical protein AMTR_s00001p00239750 [Amborella trichopoda]
 gb|ERM96395.1| hypothetical protein AMTR_s00001p00239750 [Amborella trichopoda]
Length=544

 Score =   484 bits (1246),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 260/540 (48%), Positives = 357/540 (66%), Gaps = 14/540 (3%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             R C +    G++ SK  S+ LPSD FLD  +FI S+ H G  A +++ +G +++Y +L  
Sbjct  8     RRCGFCKSNGVFYSKRKSIPLPSDEFLDAFTFISSQPHKGNIAFIEAATGRTLAYIDLWR  67

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              VNS+AAGL  +GV QGDV L+L PNSI FP+I L ++S+GA+  T NPL+T  EI KQ+
Sbjct  68    SVNSVAAGLSELGVRQGDVILLLSPNSIQFPIICLAVMSIGAIITTTNPLNTPGEIHKQA  127

Query  1492  FDCNVRLAFATPDRVQNLGST-LGIPVIGL-PESLNLDSPFRKLISSDPKLAPTPRIRQQ  1319
              D N  LAF  P  +  L  T L I +IG   E  +  +   +L+ ++P+  P  RI+Q 
Sbjct  128   ADSNATLAFTIPALIPKLSLTNLPIVLIGSDTEPRSCITTLDRLMRTNPERRPLVRIKQD  187

Query  1318  DTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEY-PATANVYLDVLPMYHVY  1142
             DTA +LFSSGTTG  K VA +H N IAMV +       Q  Y P     +L  +PM+H+Y
Sbjct  188   DTATLLFSSGTTGVSKGVASSHRNVIAMVSVL------QKRYSPGERLTFLCTVPMFHIY  241

Query  1141  GLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCGL  962
             GL  F  GLL+ G+T VV+ K+E+ E+++A++ Y VTH P+ PP+LVAL     + +  L
Sbjct  242   GLCCFATGLLAAGTTTVVISKFELSEMLQAVETYRVTHLPIVPPILVALGGSEVSQRFNL  301

Query  961   KSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGL  782
              SLK V  G AP+S    + F+R FP +   QGYGMTE+  +G       + + Y S GL
Sbjct  302   GSLKNVVCGGAPVSREVTEAFLRRFPGVVLTQGYGMTETAGIGASTETPEEGKRYGSAGL  361

Query  781   LAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTG  602
             L P+MEA++VD      G S+PP   GELWLRGP++MKGY +N EA+   ++ +GWL TG
Sbjct  362   LIPDMEAKIVD---PETGESMPPNRRGELWLRGPSVMKGYFSNAEATAGTLNSEGWLRTG  418

Query  601   DIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIP  422
             D+ +FDEDG+L+V DRLKE+IKYKG+Q+APA+LEA+L++HP++ DAAV     +E G+IP
Sbjct  419   DLCYFDEDGFLFVVDRLKELIKYKGYQVAPAELEALLLTHPNVEDAAVVPFPDKEAGQIP  478

Query  421   VAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNLLI  242
             VAFVVKK   E  LS A ++ FVA +VAPYKK+RRV F +SIPK++SGKILRK+L NL I
Sbjct  479   VAFVVKK--VESHLSNATLLSFVADRVAPYKKIRRVMFVRSIPKTSSGKILRKDLINLAI  536



>ref|XP_010235057.1| PREDICTED: 4-coumarate--CoA ligase-like 3 isoform X2 [Brachypodium 
distachyon]
Length=532

 Score =   481 bits (1237),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 285/543 (52%), Positives = 361/543 (66%), Gaps = 32/543 (6%)
 Frame = -2

Query  1882  IRNSAAEKGRRSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSR------NHGGLSAL  1721
             ++++AA    R+ FYS+  G+Y S H  V LP+DP L +V  + SR       H  L  L
Sbjct  1     MQDAAAHDPSRT-FYSAAAGVYSSTHAPVPLPADPGLSLVPHLFSRLPLDAAPHSLL--L  57

Query  1720  VDSQSGFSISYPELRSLVNSMAAGL---HRMGVSQGDVALILLPNSIYFPVIFLGLLSVG  1550
              D+ +G S++  +LR LV+S+A GL   HR  V  G V L++LPNSI FP+ FL +L+ G
Sbjct  58    RDAATGASLTRADLRRLVSSLAHGLRQTHR--VRAGAVVLLVLPNSIAFPIAFLAVLAAG  115

Query  1549  AVAATMNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLD-----  1385
             AVA TMNP S+ +EI  +  +    L  A+ D V  L    G PV+ +P  L        
Sbjct  116   AVATTMNPYSSSAEIADRVRETRPCLVLASRDNVSKLPPFAGAPVVLVPHLLTAAPADEQ  175

Query  1384  -SPFRKLISSDP-KLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFE  1211
              +PF  L+ S      P+  + Q D AAVL+SSGT+G  K V LTH N I MVELFVRFE
Sbjct  176   FAPFHALLGSGAGDEFPSAEVGQDDAAAVLYSSGTSGRSKGVVLTHRNLITMVELFVRFE  235

Query  1210  ASQYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVT  1031
              SQY  PA  NVYL  LPM+HVYGLSLF +GLLSLGSTVVV+ +++V E V AI RY VT
Sbjct  236   VSQYARPACDNVYLAALPMFHVYGLSLFAVGLLSLGSTVVVMNRFDVGEAVSAIHRYKVT  295

Query  1030  HFPVAPPLLVALTR---KAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGY  860
             H P+ PP++ AL R    A A    L SL QVSSGAAP+S   IQ+F++ FPH+DFIQGY
Sbjct  296   HLPLVPPIMTALLRAKATAGAGALPLGSLVQVSSGAAPLSGRLIQDFIKAFPHVDFIQGY  355

Query  859   GMTESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGP  680
             GMTESTAVGTRGFN++K +NY SVGLLAPNM A++V+L     G  LPP S GELWL GP
Sbjct  356   GMTESTAVGTRGFNSSKHKNYASVGLLAPNMHAKIVEL---ETGFCLPPGSCGELWLHGP  412

Query  679   AIMKGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLE  500
             A+MKGYL + +        DGWL TGD+ +FD DGYLY+  RLK+ IKYKGFQIAPADLE
Sbjct  413   AVMKGYLTDEDVCTR---KDGWLRTGDLAYFDSDGYLYIAGRLKDTIKYKGFQIAPADLE  469

Query  499   AVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVR  320
              VL+ HP++VD AVTSA+ EE GEIP+AFVV+K GS ++  Q  V+++VAKQV  + +  
Sbjct  470   EVLVQHPEVVDVAVTSAEDEEAGEIPIAFVVRKSGSTLTCVQ--VMEYVAKQVKRWCRRT  527

Query  319   RVY  311
             R +
Sbjct  528   RKF  530



>ref|XP_010235058.1| PREDICTED: 4-coumarate--CoA ligase-like 3 isoform X3 [Brachypodium 
distachyon]
Length=523

 Score =   478 bits (1231),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 283/532 (53%), Positives = 356/532 (67%), Gaps = 32/532 (6%)
 Frame = -2

Query  1882  IRNSAAEKGRRSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSR------NHGGLSAL  1721
             ++++AA    R+ FYS+  G+Y S H  V LP+DP L +V  + SR       H  L  L
Sbjct  1     MQDAAAHDPSRT-FYSAAAGVYSSTHAPVPLPADPGLSLVPHLFSRLPLDAAPHSLL--L  57

Query  1720  VDSQSGFSISYPELRSLVNSMAAGL---HRMGVSQGDVALILLPNSIYFPVIFLGLLSVG  1550
              D+ +G S++  +LR LV+S+A GL   HR  V  G V L++LPNSI FP+ FL +L+ G
Sbjct  58    RDAATGASLTRADLRRLVSSLAHGLRQTHR--VRAGAVVLLVLPNSIAFPIAFLAVLAAG  115

Query  1549  AVAATMNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLD-----  1385
             AVA TMNP S+ +EI  +  +    L  A+ D V  L    G PV+ +P  L        
Sbjct  116   AVATTMNPYSSSAEIADRVRETRPCLVLASRDNVSKLPPFAGAPVVLVPHLLTAAPADEQ  175

Query  1384  -SPFRKLISSDP-KLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFE  1211
              +PF  L+ S      P+  + Q D AAVL+SSGT+G  K V LTH N I MVELFVRFE
Sbjct  176   FAPFHALLGSGAGDEFPSAEVGQDDAAAVLYSSGTSGRSKGVVLTHRNLITMVELFVRFE  235

Query  1210  ASQYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVT  1031
              SQY  PA  NVYL  LPM+HVYGLSLF +GLLSLGSTVVV+ +++V E V AI RY VT
Sbjct  236   VSQYARPACDNVYLAALPMFHVYGLSLFAVGLLSLGSTVVVMNRFDVGEAVSAIHRYKVT  295

Query  1030  HFPVAPPLLVALTR---KAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGY  860
             H P+ PP++ AL R    A A    L SL QVSSGAAP+S   IQ+F++ FPH+DFIQGY
Sbjct  296   HLPLVPPIMTALLRAKATAGAGALPLGSLVQVSSGAAPLSGRLIQDFIKAFPHVDFIQGY  355

Query  859   GMTESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGP  680
             GMTESTAVGTRGFN++K +NY SVGLLAPNM A++V+L     G  LPP S GELWL GP
Sbjct  356   GMTESTAVGTRGFNSSKHKNYASVGLLAPNMHAKIVEL---ETGFCLPPGSCGELWLHGP  412

Query  679   AIMKGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLE  500
             A+MKGYL + +        DGWL TGD+ +FD DGYLY+  RLK+ IKYKGFQIAPADLE
Sbjct  413   AVMKGYLTDEDVCTR---KDGWLRTGDLAYFDSDGYLYIAGRLKDTIKYKGFQIAPADLE  469

Query  499   AVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQ  344
              VL+ HP++VD AVTSA+ EE GEIP+AFVV+K GS ++  Q  V+++VAKQ
Sbjct  470   EVLVQHPEVVDVAVTSAEDEEAGEIPIAFVVRKSGSTLTCVQ--VMEYVAKQ  519



>ref|NP_001176290.1| Os10g0578950 [Oryza sativa Japonica Group]
 gb|AAG46175.1|AC018727_27 putative 4-coumarate CoA ligase [Oryza sativa Japonica Group]
 gb|ABB48038.2| AMP-binding enzyme family protein [Oryza sativa Japonica Group]
 dbj|BAH95018.1| Os10g0578950 [Oryza sativa Japonica Group]
Length=564

 Score =   477 bits (1228),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 277/512 (54%), Positives = 354/512 (69%), Gaps = 32/512 (6%)
 Frame = -2

Query  1720  VDSQSGFSISYPELRSLVNSMAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLSVGAV  1544
             VD+ +  ++S  + R LV+S+AAGL R + +++G + L+LLPNS+ FPV FL +L+ GAV
Sbjct  57    VDAPTAATLSCADFRRLVSSLAAGLRRRLHIARGSLVLLLLPNSLTFPVAFLAVLATGAV  116

Query  1543  AATMNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPFR---  1373
             A TMNP S  +EI  +  D    L  A+      L   L  P++ +P++           
Sbjct  117   ATTMNPSSAPAEIAARLRDTAPSLVLASTHNAAKL-PPLAAPLVLVPDTFQQQHDDDQFD  175

Query  1372  ----KLISSDPKLAPTP-----RIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV  1220
                  L+ +DP+   TP      + Q D AAVL+SSGT+G  K V +TH N IAMVELFV
Sbjct  176   FFFHALLETDPE---TPVEMGVGVGQDDAAAVLYSSGTSGRSKGVVVTHRNLIAMVELFV  232

Query  1219  RFEASQYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRY  1040
             RFEASQY  PA  NVYL  LPM+HVYGLSLF +GLLSLG TVVV+R++ VD+ V+AI +Y
Sbjct  233   RFEASQYTRPARDNVYLAALPMFHVYGLSLFAVGLLSLGCTVVVMRRFNVDDAVKAIRKY  292

Query  1039  GVTHFPVAPPLLVALTRKAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGY  860
              VTH P+ PP++ AL R        L SL QVSSGAAP++ T I +F+  FPH+DFIQGY
Sbjct  293   KVTHLPLVPPIMSALLRANP--PLELDSLLQVSSGAAPLNHTLIHHFLHAFPHVDFIQGY  350

Query  859   GMTESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGP  680
             GMTESTAVGTRGFNT K + Y SVGLLAPNM A++V L     GS LPP S GELWL GP
Sbjct  351   GMTESTAVGTRGFNTCKHKKYASVGLLAPNMHAKIVHL---ESGSCLPPGSYGELWLHGP  407

Query  679   AIMK------GYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQI  518
             AIMK      GYLN+ + +      DGWL TGDI +FD DGYL++  RLK+ IKYKGFQI
Sbjct  408   AIMKEFCFVTGYLNDDDDAFT--RKDGWLRTGDIAYFDSDGYLFIVGRLKDTIKYKGFQI  465

Query  517   APADLEAVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVA  338
             APADLEAVL+ HP+I+D AVTS + EE GEIPVAFVV+K GS  +LS  +V+++VAKQVA
Sbjct  466   APADLEAVLIRHPEIIDVAVTSDEDEEAGEIPVAFVVRKSGS--TLSCTHVMEYVAKQVA  523

Query  337   PYKKVRRVYFTKSIPKSASGKILRKELRNLLI  242
              YK+VR+V F ++IPKSA+GK+LR+ L++ L+
Sbjct  524   SYKRVRKVIFVEAIPKSAAGKVLRRLLKDSLV  555



>ref|XP_006828976.1| hypothetical protein AMTR_s00001p00238960 [Amborella trichopoda]
 gb|ERM96392.1| hypothetical protein AMTR_s00001p00238960 [Amborella trichopoda]
Length=1002

 Score =   489 bits (1260),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 267/538 (50%), Positives = 358/538 (67%), Gaps = 15/538 (3%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  S    Y  + P  H PSD FLDV ++I S +H G  AL+D+ +  +++YP+L  
Sbjct  11    RSGFCRSNRVFYSKRKPIPH-PSDGFLDVFTYISSHHHRGRIALIDAATAQALTYPDLWG  69

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              VNS+AAGL  +G+ QGDV L+L PNSIYFP+I L ++S+GA+  T NPL+T  EI KQ+
Sbjct  70    AVNSVAAGLSDLGIKQGDVVLLLSPNSIYFPIICLAIMSIGAIITTTNPLNTPREIHKQA  129

Query  1492  FDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDS---PFRKLISSDPKLAPTPRIRQ  1322
              D   +LA  TP  V  LG T  +PV+ +       S       L+ SDP+  P  RIRQ
Sbjct  130   ADSKAKLAVTTPALVAKLGLT-KLPVVLIGSDTKAQSCVCSLDDLMRSDPEKRPVVRIRQ  188

Query  1321  QDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVY  1142
             +DTA +LFSSGTTG  K VA TH N IAM+ +  R  +S          +L  +PM+H+Y
Sbjct  189   EDTATLLFSSGTTGASKGVATTHRNIIAMISVVQRRFSS-----GDLLTFLCTVPMFHIY  243

Query  1141  GLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCGL  962
             GL  F  GLLS GST+VV+ K+E+ E++RA+ RY VTH PV PP+L+AL     A    L
Sbjct  244   GLCAFATGLLSTGSTIVVLSKFEIGEMLRAVQRYRVTHLPVVPPILMALGATEMAKGFDL  303

Query  961   KSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGL  782
              S+K V  G AP+S    + F   FP +  +QGYG+TE++ +G       + R Y + GL
Sbjct  304   GSVKTVVCGGAPLSKEATEAFTARFPKVAIMQGYGLTETSGIGASADTPEESRRYGTAGL  363

Query  781   LAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTG  602
             L+PNMEA+VVD      G +L P   G+LWLRGP+IMKGY +N EA+  A+D +GWL TG
Sbjct  364   LSPNMEAKVVD---PDTGEALLPNQRGDLWLRGPSIMKGYFSNAEATAGALDAEGWLKTG  420

Query  601   DIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIP  422
             D+ +FDEDG+L+V DRLKE+IKYKG+Q+APA+LEA+L++HP+I DAAV     +E G+IP
Sbjct  421   DLCYFDEDGFLFVVDRLKELIKYKGYQVAPAELEALLLTHPNIEDAAVVPFPDKEAGQIP  480

Query  421   VAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNL  248
             +AFVV+K GS  SLS+A +++FVA QVAPYKK+RRV F  +IPK+ASGK LRK+L +L
Sbjct  481   MAFVVRKAGS--SLSEATLMEFVAAQVAPYKKIRRVAFVSAIPKNASGKTLRKDLISL  536



>gb|EAZ17097.1| hypothetical protein OsJ_32596 [Oryza sativa Japonica Group]
Length=564

 Score =   474 bits (1220),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 276/512 (54%), Positives = 354/512 (69%), Gaps = 32/512 (6%)
 Frame = -2

Query  1720  VDSQSGFSISYPELRSLVNSMAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLSVGAV  1544
             VD+ +  ++S  + R LV+S+AAGL R + +++G + L+LLPNS+ FPV FL +L+ GAV
Sbjct  57    VDAPTAATLSCADFRRLVSSLAAGLRRRLHIARGSLVLLLLPNSLTFPVAFLAVLATGAV  116

Query  1543  AATMNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPFR---  1373
             A TMNP S  +EI  +  D    L  A+      L   L  P++ +P++           
Sbjct  117   ATTMNPSSAPAEIAARLRDTAPSLVLASTHNAAKL-PPLAAPLVLVPDTFQQQHDDDQFD  175

Query  1372  ----KLISSDPKLAPTP-----RIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV  1220
                  L+ +DP+   TP      + Q D AAVL+SSGT+G  K V +TH N IAMVELFV
Sbjct  176   FFFHALLETDPE---TPVEMGVGVGQDDAAAVLYSSGTSGRSKGVVVTHRNLIAMVELFV  232

Query  1219  RFEASQYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRY  1040
             RFEASQY  PA  NVYL  LPM+HVYGLSLF +GLLSLG TVVV+R++ VD+ V+AI +Y
Sbjct  233   RFEASQYTRPARDNVYLAALPMFHVYGLSLFAVGLLSLGCTVVVMRRFNVDDAVKAIRKY  292

Query  1039  GVTHFPVAPPLLVALTRKAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGY  860
              VTH P+ PP++ AL R        L SL QVSSGAAP++ T I +F+  FP++DFIQGY
Sbjct  293   KVTHLPLVPPIMSALLRANP--PLELDSLLQVSSGAAPLNHTLIHHFLHAFPNVDFIQGY  350

Query  859   GMTESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGP  680
             GMTESTAVGTRGFNT K + Y SVGLLAPNM A++V L     GS LPP S GELWL GP
Sbjct  351   GMTESTAVGTRGFNTCKHKKYASVGLLAPNMHAKIVHL---ESGSCLPPGSYGELWLHGP  407

Query  679   AIMK------GYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQI  518
             AIMK      GYLN+ + +      DGWL TGDI +FD DGYL++  RLK+ IKYKGFQI
Sbjct  408   AIMKEFCFVTGYLNDDDDAFT--RKDGWLRTGDIAYFDSDGYLFIVGRLKDTIKYKGFQI  465

Query  517   APADLEAVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVA  338
             APADLEAVL+ HP+I+D AVTS + EE GEIPVAFVV+K GS  +LS  +V+++VAKQVA
Sbjct  466   APADLEAVLIRHPEIIDVAVTSDEDEEAGEIPVAFVVRKSGS--TLSCTHVMEYVAKQVA  523

Query  337   PYKKVRRVYFTKSIPKSASGKILRKELRNLLI  242
              YK+VR+V F ++IPKSA+GK+LR+ L++ L+
Sbjct  524   SYKRVRKVIFVEAIPKSAAGKVLRRLLKDSLV  555



>ref|XP_006572942.1| PREDICTED: 4-coumarate--CoA ligase-like 6-like isoform X2 [Glycine 
max]
Length=438

 Score =   466 bits (1199),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 246/376 (65%), Positives = 295/376 (78%), Gaps = 6/376 (2%)
 Frame = -2

Query  1360  SDPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATA  1181
             S PKL P  +        +  S GTTG  K V L+H N +AMVELFVRFEASQYE     
Sbjct  67    SYPKLLPLVKSVASGLHRMGVSQGTTGVSKGVVLSHKNLVAMVELFVRFEASQYEGSCLR  126

Query  1180  NVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLV  1001
             NVYL VLPM+HVYGLSLF +GLLSLGSTVVV+RK+++DEVVR ID Y VTHFPV PP+L 
Sbjct  127   NVYLAVLPMFHVYGLSLFAVGLLSLGSTVVVMRKFDIDEVVRVIDEYKVTHFPVVPPMLT  186

Query  1000  ALTRKAKADKCG-LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRG  824
             AL ++AK    G  +SL QVSSGAAP+S+  I  F+R FP++DFIQGYGMTESTAVGTRG
Sbjct  187   ALIKRAKGVNGGEFQSLVQVSSGAAPLSMGVINEFIRAFPNVDFIQGYGMTESTAVGTRG  246

Query  823   FNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEA  644
             FNT K RNY+S+GLLAPNMEA+VVD ++G     LPP S GEL LRGP+IM GYLNN E 
Sbjct  247   FNTEKFRNYSSIGLLAPNMEAKVVDWNTGAF---LPPGSSGELRLRGPSIMTGYLNNEEV  303

Query  643   SKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDA  464
             + + +D DGWLHTGD+V+FD DGYL++ DRLK++IKYKGFQIAPADLEAVL+ HP++VD 
Sbjct  304   TMSTIDKDGWLHTGDVVYFDHDGYLHISDRLKDIIKYKGFQIAPADLEAVLILHPEVVDV  363

Query  463   AVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSA  284
             AVT A  EE GEIPVAFVV+K GS   LS  +++DFVA+QVAPYKKVR+V+FT  IP+SA
Sbjct  364   AVTRAMDEETGEIPVAFVVRKVGS--VLSPKHIMDFVAEQVAPYKKVRKVFFTDKIPRSA  421

Query  283   SGKILRKELRNLLITS  236
             +GKILRK+LRN L ++
Sbjct  422   TGKILRKQLRNYLTSN  437


 Score =   103 bits (258),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  1843  FYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVN  1664
             ++S ++GIY SKH  V LP+DPFLD+VSFI S  H G+SALVDS SG SISYP+L  LV 
Sbjct  17    WFSPKSGIYHSKHAPVDLPNDPFLDLVSFIFSHRHNGVSALVDSSSGCSISYPKLLPLVK  76

Query  1663  SMAAGLHRMGVSQG  1622
             S+A+GLHRMGVSQG
Sbjct  77    SVASGLHRMGVSQG  90



>gb|AGA17922.1| CCL5 [Humulus lupulus]
Length=551

 Score =   454 bits (1169),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 250/550 (45%), Positives = 360/550 (65%), Gaps = 26/550 (5%)
 Frame = -2

Query  1840  YSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVNS  1661
             Y     I+ SK   V LP +  +DV +FI SR H G  A +D+ +G  +++P+L   V+S
Sbjct  15    YCKSNSIFYSKREPVQLPQNHSVDVTTFISSRAHHGKIAFIDAATGRHLTFPQLWRAVDS  74

Query  1660  MAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCN  1481
             +A  L  MG+ +GDV L+L PNSIYFPV+ L ++S+GA+  T NPL+T  EI KQ  D  
Sbjct  75    VATCLSAMGIRKGDVILLLSPNSIYFPVVCLAVMSLGAIITTTNPLNTPREIAKQITDSK  134

Query  1480  VRLAFATPDRVQNL-GSTLGIPVI------GLPESLNLDSPFRKLISSDPKLAPTP---R  1331
               LAF  P  V  + GS L I +I       L ++LN+ S   +++  +P  +P     R
Sbjct  135   PVLAFTIPQLVSKIAGSNLPIVIIDDEVKSSLEKTLNIVSSLGEMMRKEP--SPNRIGYR  192

Query  1330  IRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVE-LFVRFEASQYEYPATANVYLDVLPM  1154
             + Q+DTA +L+SSGTTG  K V  +H N IAMV+ +  RF     E+      ++  +PM
Sbjct  193   VNQEDTATLLYSSGTTGASKGVVSSHKNLIAMVQTILSRFGTEDGEH-----TFICTVPM  247

Query  1153  YHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK--  980
             +H+YGL+ F MGLLS GST+V++ K+E+ E++ AI++Y  T+ P+ PP+L+AL + A   
Sbjct  248   FHIYGLAAFAMGLLSSGSTIVILSKFEIHEMLSAIEKYRATYLPLVPPILMALLKNANHI  307

Query  979   ADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRN  800
               K  L SL+ V SG AP+S   I+ FV  +P +  +QGYG+TEST +G       + R 
Sbjct  308   RAKYDLSSLQSVLSGGAPLSKEVIEGFVENYPTVSILQGYGLTESTGIGASTDCLQESRR  367

Query  799   YTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDD  620
             Y + G+L+P+MEA++V+      G +L     GELWLRGP IMKGY +N EA+ + +D +
Sbjct  368   YGTAGMLSPSMEAKIVN---PETGEALSVNRTGELWLRGPTIMKGYFSNEEATSSTIDSE  424

Query  619   GWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSE  440
             GWL TGD+ + DEDG+++V DRLKE+IKYKG+Q+APA+LEA+L+SHP+I DAAV     +
Sbjct  425   GWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVAPAELEALLLSHPEISDAAVIPYPDK  484

Query  439   EVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKE  260
             E G+ P+A+VV+K GS  +LS++ V+DF+AK VAPYK++R+V F  SIPK+ SGKILRK+
Sbjct  485   EAGQFPMAYVVRKGGS--NLSESTVMDFIAKLVAPYKRIRKVAFVASIPKNPSGKILRKD  542

Query  259   LRNLLITSKI  230
             L   L TSK+
Sbjct  543   LIK-LATSKL  551



>ref|XP_010063109.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Eucalyptus grandis]
 gb|KCW70300.1| hypothetical protein EUGRSUZ_F03543 [Eucalyptus grandis]
Length=564

 Score =   454 bits (1169),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 257/569 (45%), Positives = 362/569 (64%), Gaps = 35/569 (6%)
 Frame = -2

Query  1864  EKGRRSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYP  1685
             E  RRS F    +  Y  + P + LP +P LDV +FI S +H G +A VD+ SG  IS+P
Sbjct  7     EIDRRSGFCRPNSTFYSKRKP-IPLPPNPSLDVTTFISSHSHRGSTAFVDASSGLHISFP  65

Query  1684  ELRSLVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEI  1505
             EL   V S+A+ L   G+ +GDV L+L PNSI FPV+ L ++S+GAV  T NPL+T SEI
Sbjct  66    ELWRSVESLASRLSATGIRKGDVVLLLSPNSISFPVVCLAVMSLGAVITTTNPLNTASEI  125

Query  1504  KKQSFDCNVRLAFATPDRVQNLGSTL-GIPVIGL-----PESLNLD------------SP  1379
              KQ  D    LAF TPD    L S   G+P++ +     P S   D            + 
Sbjct  126   AKQIADSKPVLAFTTPDLAPKLASAASGLPLVLIEDAASPSSSRADGNNRSAPKAKIITT  185

Query  1378  FRKLISSDPKLAPT---PRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFE  1211
              R++I++ P+ + +    R+ Q DTA +L+SSGTTG  K V  +H N IAMV+  + RF 
Sbjct  186   LREMIANGPEASGSRVRQRVDQNDTATLLYSSGTTGASKGVVSSHRNLIAMVQTVLNRFN  245

Query  1210  ASQYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVT  1031
               +       + +L  +PM+H+YGL+ F  GLL+ G+T+VV+ K+++ E+  +I +Y  T
Sbjct  246   LDE----EGGHRFLCTVPMFHIYGLAAFATGLLAAGATIVVLSKFDLHEMFASIAKYRAT  301

Query  1030  HFPVAPPLLVALTRKAKADKC--GLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYG  857
             + P+ PP+LVA+   A   +    L SL  V SG AP+S   I+ FV  +P +  +QGYG
Sbjct  302   YLPLVPPILVAMVNNADQIRARYDLSSLHSVLSGGAPLSREVIEGFVERYPAVRILQGYG  361

Query  856   MTESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPA  677
             +TEST VG    +  + R Y + GLL+P+MEAR+VD      G++L     GELWLRGP 
Sbjct  362   LTESTGVGASTDSLEESRRYGTAGLLSPSMEARIVD---PDSGAALGVNRTGELWLRGPT  418

Query  676   IMKGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEA  497
             IMKGY +N EA+ + +D +GWL TGD+ +FD+DG+++V DRLKE+IKYKG+Q+ PA+LEA
Sbjct  419   IMKGYFSNAEATASTLDSEGWLRTGDLCYFDDDGFIFVVDRLKELIKYKGYQVPPAELEA  478

Query  496   VLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRR  317
             +L++HPD+ DAAV     +EVG+ P+A+V +K G E  LS+  V+DFVA+QVAPYK++RR
Sbjct  479   LLLTHPDVADAAVIPFPDKEVGQFPMAYVARKAGRE--LSETAVMDFVARQVAPYKRIRR  536

Query  316   VYFTKSIPKSASGKILRKELRNLLITSKI  230
             V F  SIPK+ SGKILRK+L   L TSK+
Sbjct  537   VAFIASIPKNPSGKILRKDLIK-LATSKL  564



>gb|AHM88424.1| 4CL6 [Fraxinus mandshurica]
Length=552

 Score =   451 bits (1161),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 244/548 (45%), Positives = 364/548 (66%), Gaps = 21/548 (4%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  + +  Y SK   + LPS+  LDV +FI SR+H G +A +D+ +G  +S+ ++  
Sbjct  14    RSGFCKANSTFY-SKRKQIPLPSNDSLDVTTFISSRSHRGKTAFIDASTGRKLSFSDVWI  72

Query  1672  LVNSMAAGLH-RMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQ  1496
              V ++A  L   M + + DV L+L PNSIYFP++ L ++S+GA+  T NPL+T  EI KQ
Sbjct  73    AVEAVATCLSIDMNIRKNDVVLLLSPNSIYFPIVCLAVMSLGAIITTTNPLNTSREIAKQ  132

Query  1495  SFDCNVRLAFATPDRVQNLGSTLGIPVIGL------PESLNLDSPFRKLISSDPKLAPT-  1337
               D    LAF  P  +  LG +  +P++ L      P  L + +   +++  +P  +   
Sbjct  133   IADSKPVLAFTIPQLLPKLGDS-KLPIVLLDSANSYPSKLKIVNNIVEMMKREPSQSRVK  191

Query  1336  PRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLP  1157
              R+ Q D A++L+SSGTTG  K V  +H N IAMV+  V    S+++     + ++  +P
Sbjct  192   ERVSQDDIASLLYSSGTTGVSKGVVSSHRNLIAMVQTIV----SRFKLDEENHTFICTVP  247

Query  1156  MYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKA  977
             M+H+YGL+ F  GLL+ GST+V++ K+E+DE++ AI +Y  T+ P+ PP+LVAL   A A
Sbjct  248   MFHIYGLAAFATGLLAAGSTIVILSKFEMDEMLMAIQKYTATYLPLVPPILVALVNNAAA  307

Query  976   --DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLR  803
                K  L+SLK V SG AP+S   I+ FV  +P++  +QGYG+TESTA+G    +  + R
Sbjct  308   IKKKYDLRSLKSVLSGGAPLSREVIEGFVEKYPNVTILQGYGLTESTAIGASTDSLEESR  367

Query  802   NYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDD  623
              Y + G+L+P+MEA++VD      G +LP    GELWLRGP+IMKGY +N EA+ + +D 
Sbjct  368   RYGTAGMLSPSMEAKIVD---PESGEALPVNCTGELWLRGPSIMKGYFSNEEATASTLDS  424

Query  622   DGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQS  443
             +GWL TGD+ + DEDG+++V DRLKE+IKYKG+Q+ PA+LEA+L++HP+I DAAV     
Sbjct  425   EGWLRTGDLCYVDEDGFIFVVDRLKELIKYKGYQVPPAELEALLLTHPEIADAAVIPFPD  484

Query  442   EEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRK  263
             E+VG+ P+A+VV+K GS  S+S++ V+DF+AKQVAPYK++RRV FT S+PK+ SGKILRK
Sbjct  485   EKVGQFPMAYVVRKTGS--SISESAVMDFIAKQVAPYKRIRRVAFTASVPKNPSGKILRK  542

Query  262   ELRNLLIT  239
             +L  L ++
Sbjct  543   DLIKLAVS  550



>ref|XP_010905239.1| PREDICTED: LOW QUALITY PROTEIN: 4-coumarate--CoA ligase-like 
4 [Elaeis guineensis]
Length=551

 Score =   444 bits (1141),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 254/550 (46%), Positives = 352/550 (64%), Gaps = 20/550 (4%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  S + I+ SK   + LPSDP LDV +F+ SR H G +AL+D+ SG  +S+P L  
Sbjct  13    RSGFCPSNS-IFYSKRKPIPLPSDPHLDVTTFLSSRRHSGTTALIDAASGRRVSFPTLWR  71

Query  1672  LVNSMAAGLH-RMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQ  1496
              V ++A+ L  R+ V +G V L+L PNSI+FPV+ L ++S+GAV  T NPL+T  EI KQ
Sbjct  72    SVAALASALSSRLSVRKGQVVLLLSPNSIHFPVVSLAVMSLGAVLTTTNPLNTPQEIAKQ  131

Query  1495  SFDCNVRLAFATPDRVQNLGSTLGIPVIGLPES--LNLDSPFRKLISSDPKLAPTPRIR-  1325
               D +  LAFA P  V  L      P++ L +      D+  R  I     + P  R R 
Sbjct  132   ISDSDPILAFAXPPLVGKLPRDRDFPIVLLEDRRIAGDDARIRYTIEELTAMEPDLRRRR  191

Query  1324  ----QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLDVL  1160
                 Q DTA +L+SSGTTG  K V  TH N I+MV++ + RF+    E       ++  +
Sbjct  192   EPVSQDDTATLLYSSGTTGASKGVVATHRNLISMVQIILNRFKLE--EGGGEPETFICTV  249

Query  1159  PMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK  980
             PM+HVYGL+ F  GLL  GSTVV++ K+E+ E++RAI  YG T+ P+ PP+LVA+  + K
Sbjct  250   PMFHVYGLAAFATGLLGSGSTVVILSKFEMGEMIRAIREYGATYLPLVPPILVAMLNQPK  309

Query  979   ADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRN  800
                 G   L++V SG AP+    I+ F   +P ++ +QGYG+TEST +G    +  + R 
Sbjct  310   PLPLG--RLRRVLSGGAPLGREVIEGFREKYPAVEILQGYGLTESTGIGASTDSAEESRR  367

Query  799   YTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDD  620
             Y + GLL+PN EAR+VD      G SLP    GELW+RGP +MKGY  N +A+ + +D +
Sbjct  368   YGTAGLLSPNTEARIVD---PDTGVSLPVNRTGELWIRGPYVMKGYFKNPQATSSTLDSE  424

Query  619   GWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSE  440
             GWL TGDI + DEDGYL+V DRLKE+IKYKG+Q+ PA+LEA+L++HP+I DAAV      
Sbjct  425   GWLRTGDICYVDEDGYLFVVDRLKELIKYKGYQVPPAELEALLLTHPEIADAAVIPFPDR  484

Query  439   EVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKE  260
              VG+ P+A++V+K GS   LS+  V++FVAKQVAPYK++R+V F  +IPK+ SGKILRK+
Sbjct  485   AVGQYPMAYIVRKAGSR--LSETGVMEFVAKQVAPYKRIRKVAFVSAIPKNPSGKILRKD  542

Query  259   LRNLLITSKI  230
             L   L TSK+
Sbjct  543   LIK-LATSKL  551



>sp|Q336M7.3|4CLL2_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 2 [Oryza sativa Japonica 
Group]
Length=583

 Score =   443 bits (1139),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 264/495 (53%), Positives = 333/495 (67%), Gaps = 36/495 (7%)
 Frame = -2

Query  1720  VDSQSGFSISYPELRSLVNSMAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLSVGAV  1544
             VD+ +  ++S  + R LV+S+AAGL R + +++G + L+LLPNS+ FPV FL +L+ GAV
Sbjct  57    VDAPTAATLSCADFRRLVSSLAAGLRRRLHIARGSLVLLLLPNSLTFPVAFLAVLATGAV  116

Query  1543  AATMNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPFR---  1373
             A TMNP S  +EI  +  D    L  A+      L   L  P++ +P++           
Sbjct  117   ATTMNPSSAPAEIAARLRDTAPSLVLASTHNAAKL-PPLAAPLVLVPDTFQQQHDDDQFD  175

Query  1372  ----KLISSDPKLAPTP-----RIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV  1220
                  L+ +DP+   TP      + Q D AAVL+SSGT+G  K V +TH N IAMVELFV
Sbjct  176   FFFHALLETDPE---TPVEMGVGVGQDDAAAVLYSSGTSGRSKGVVVTHRNLIAMVELFV  232

Query  1219  RFEASQYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRY  1040
             RFEASQY  PA  NVYL  LPM+HVYGLSLF +GLLSLG TVVV+R++ VD+ V+AI +Y
Sbjct  233   RFEASQYTRPARDNVYLAALPMFHVYGLSLFAVGLLSLGCTVVVMRRFNVDDAVKAIRKY  292

Query  1039  GVTHFPVAPPLLVALTRKAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGY  860
              VTH P+ PP++ AL R        L SL QVSSGAAP++ T I +F+  FPH+DFIQGY
Sbjct  293   KVTHLPLVPPIMSALLRANP--PLELDSLLQVSSGAAPLNHTLIHHFLHAFPHVDFIQGY  350

Query  859   GMTESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGP  680
             GMTESTAVGTRGFNT K + Y SVGLLAPNM A++V L     GS LPP S GELWL GP
Sbjct  351   GMTESTAVGTRGFNTCKHKKYASVGLLAPNMHAKIVHL---ESGSCLPPGSYGELWLHGP  407

Query  679   AIMK------GYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQI  518
             AIMK      GYLN+ + +      DGWL TGDI +FD DGYL++  RLK+ IKYKGFQI
Sbjct  408   AIMKEFCFVTGYLNDDDDAFT--RKDGWLRTGDIAYFDSDGYLFIVGRLKDTIKYKGFQI  465

Query  517   APADLEAVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVA  338
             APADLEAVL+ HP+I+D AVTS + EE GEIPVAFVV+K GS  +LS  +V+++VAKQV 
Sbjct  466   APADLEAVLIRHPEIIDVAVTSDEDEEAGEIPVAFVVRKSGS--TLSCTHVMEYVAKQV-  522

Query  337   PYKKVRRVYFTKSIP  293
                + RR Y T+  P
Sbjct  523   ---RTRRSYTTQHSP  534



>ref|XP_006649341.1| PREDICTED: 4-coumarate--CoA ligase-like 4-like [Oryza brachyantha]
Length=551

 Score =   440 bits (1131),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 261/555 (47%), Positives = 354/555 (64%), Gaps = 35/555 (6%)
 Frame = -2

Query  1840  YSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVNS  1661
             Y + T  +RSK   V LP+DP +DVVSF+ SR H G+ AL+D+ SG  I++ EL   V  
Sbjct  14    YCAATRTFRSKRADVPLPADPEIDVVSFLASRRHSGVVALIDAASGRRITFTELWRAVAG  73

Query  1660  MAAGLHRMGVS--QGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFD  1487
             +A+ L    VS  +G VALIL PNS++FPV  L  +S+GAV  T NPL+T +EI KQ  D
Sbjct  74    VASALAAPPVSLRKGHVALILSPNSVHFPVAALAAMSLGAVITTANPLNTPAEIAKQVAD  133

Query  1486  CNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPFRKLISSDPKL--------APTP-  1334
                 LAF T + +  L     + V+ L ES  L        SSDP++        A TP 
Sbjct  134   ARPVLAFTTRELLPKLPRAHDLRVVLL-ESTRLPGD-----SSDPRIVATIEEISATTPD  187

Query  1333  ------RIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVEL-FVRFEASQYEYPATANV  1175
                   R+ Q D A +L+SSGTTG  K V  TH + I+MV++   RF   + E       
Sbjct  188   PGRRKDRVTQDDPATLLYSSGTTGPSKGVVATHRSLISMVQIVMTRF---RLEDSDKTET  244

Query  1174  YLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVAL  995
             +L  +PM+HVYGL  F  GLL  G+TVVV+ KYE+ E++R+I+ YGVT+ P+ PP+LVA+
Sbjct  245   FLCTVPMFHVYGLVAFATGLLGCGATVVVLSKYELPEMLRSINAYGVTYLPLVPPILVAM  304

Query  994   TRKAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNT  815
                 K    G   L++V SG AP+    I+ F   +P ++ +QGYG+TESTA+G    + 
Sbjct  305   VAHPKPLPLG--QLRKVLSGGAPLGKELIEGFREKYPQVEILQGYGLTESTAIGASTDSA  362

Query  814   AKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKN  635
              + R Y + GLL+PN EA++VD      G +LP    GELW+RGP +MKGY  N EA+++
Sbjct  363   EESRRYGTAGLLSPNTEAKIVD---PDSGEALPVNRTGELWIRGPYVMKGYFKNTEATQS  419

Query  634   AVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVT  455
              +  DGWL TGD+ + DEDGYL+V DRLKE+IKYKG+Q+ PA+LEA+L++H +I D AV 
Sbjct  420   TLTPDGWLKTGDLCYIDEDGYLFVVDRLKELIKYKGYQVPPAELEALLLTHQEITDVAVI  479

Query  454   SAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGK  275
                  EVG+ P+A+VV+KKGS  +LS+  V++FVAKQVAPYKKVR+V F K IPK+ASGK
Sbjct  480   PFPDREVGQFPMAYVVRKKGS--NLSEREVMEFVAKQVAPYKKVRKVAFVKDIPKNASGK  537

Query  274   ILRKELRNLLITSKI  230
             ILRK+L   L TSK+
Sbjct  538   ILRKDLIK-LATSKL  551



>ref|XP_010536451.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Tarenaya hassleriana]
Length=548

 Score =   440 bits (1131),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 249/554 (45%), Positives = 359/554 (65%), Gaps = 25/554 (5%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  S +  Y  + P + LP +P LDV +FI S+ H G +AL+D+ +G ++S+ EL  
Sbjct  7     RSGFCKSNSTFYSKRTP-IPLPPNPSLDVTTFISSQAHRGKTALIDAATGRNLSFSELWR  65

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V S+A+ L  MG+ +GDV L+L PNSI FPV+ L ++S+GAV  T NPL+T  EI KQ 
Sbjct  66    SVESVASCLSDMGIRKGDVVLLLSPNSILFPVVCLSVMSLGAVITTTNPLNTSGEISKQI  125

Query  1492  FDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPFR------KLISSDPKLAPTPR  1331
              D N  +AF T D +  + + L I ++   E +    P R      +L+    K     R
Sbjct  126   SDSNPVIAFTTVDLLPKIAADLPIVIMDEEERVG---PMRGARIAGRLVEMMEKRPNERR  182

Query  1330  IR----QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLD  1166
             +R    Q DTA++L+SSGTTG  K V  +H N I+MV+  V RF +    +      ++ 
Sbjct  183   VRERVDQDDTASLLYSSGTTGASKGVVSSHRNLISMVQTVVQRFGSDSGGH--GEQRFIC  240

Query  1165  VLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRK  986
              +PM+H+YGL+ F  GLL+ GST++V+ K+++ E++ AI +Y  T+ P+ PP+LVA+   
Sbjct  241   TVPMFHIYGLAAFATGLLAYGSTIIVLSKFDMHEMMSAIGKYRATYLPLVPPILVAMING  300

Query  985   AKA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTA  812
             A     K  L SL  +  G AP+S   I+ FV  +P +  +QGYG+TESTA+G       
Sbjct  301   ADQIKRKYDLSSLHSILCGGAPLSKEVIEGFVEKYPTVKILQGYGLTESTAIGASTDTLD  360

Query  811   KLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNA  632
             + R Y + GLL+P+MEA++VD    G G  L     GELWL+GP+IMKGY  N EA+ + 
Sbjct  361   ESRRYGTAGLLSPSMEAKIVD---PGSGRVLGLNQTGELWLKGPSIMKGYFRNEEATSST  417

Query  631   VDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTS  452
             +D +GWL TGD+ +FDEDG+++V DRLKE+IKYKG+Q+ PA+LEA+L++HP+IVDAAV  
Sbjct  418   LDSEGWLRTGDLCYFDEDGFIFVVDRLKELIKYKGYQVPPAELEALLLTHPEIVDAAVIP  477

Query  451   AQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKI  272
                EEVG+ P+A+VV+K GS  +LS  N+++FV+KQVAPYK++R+V F  S+PK+ SGKI
Sbjct  478   FPDEEVGQFPMAYVVRKPGS--NLSGNNLMEFVSKQVAPYKRIRKVAFVSSVPKNPSGKI  535

Query  271   LRKELRNLLITSKI  230
             LRK+L   L TSK+
Sbjct  536   LRKDLIK-LATSKL  548



>ref|XP_010242836.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Nelumbo nucifera]
Length=560

 Score =   440 bits (1132),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 238/558 (43%), Positives = 357/558 (64%), Gaps = 25/558 (4%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  S +  Y  + P + LPS+  LD+ +FI SR H G  A VD+ +G  +++ E+  
Sbjct  11    RSGFSRSNSVFYSKRQP-IALPSNESLDITTFISSRAHHGKIAFVDASTGRHLTFSEVWR  69

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V+S+A  L  +G+ +G V L+L PNSI+FPVI L ++S+GA+  T NPL+T  EI+KQ 
Sbjct  70    AVDSVATCLSDLGIRKGHVVLLLSPNSIFFPVICLSVMSLGAIITTTNPLNTTQEIRKQI  129

Query  1492  FDCNVRLAFATPDRVQNLGSTLGIPVIGLPES-------------LNLDSPFRKLISSDP  1352
              D    LAF T   +      + +P++ + E              + + S    ++  +P
Sbjct  130   ADSKPVLAFTTHSLLPKFAG-MDLPIVLIGEGHDSETGRGANVSRIKIVSSLENMMKKEP  188

Query  1351  KLAPTP-RIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATAN  1178
               +    R+ Q DTA +L+SSGTTG  K V  +H N IAMV+  + RF+  + +     +
Sbjct  189   NDSRVKDRVCQDDTATLLYSSGTTGASKGVVSSHRNLIAMVQTILGRFKLEEADSRGGPH  248

Query  1177  VYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVA  998
              ++  +PM+H+YGL+ F  GLL+ GST+VV+ K+++ E++ AI RY VT+ P+ PP+LVA
Sbjct  249   TFVCTVPMFHIYGLAAFATGLLASGSTIVVLSKFDMHEMLSAISRYRVTYLPLVPPILVA  308

Query  997   LTRKAKA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRG  824
             L   A     K  + +L+ V SG AP+S   I+ F+  +P +  +QGYG+TE+  +G   
Sbjct  309   LINNADVIRAKYDIGTLQSVLSGGAPLSKEVIEGFLEKYPTVKILQGYGLTETAGIGAST  368

Query  823   FNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEA  644
                 + R Y + GLL+PNMEA+++D      G +LP    GELWLRGP++MKGY +N EA
Sbjct  369   DTVEESRRYGTAGLLSPNMEAKIID---PETGEALPVNRTGELWLRGPSVMKGYFSNPEA  425

Query  643   SKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDA  464
             + + ++ +GWL TGD+ + DEDGY+++ DRLKE+IKYKG+Q+ PA+LEA+L+ HP++ D 
Sbjct  426   TTSTLNSEGWLRTGDVCYIDEDGYIFIVDRLKELIKYKGYQVPPAELEALLLCHPEVADV  485

Query  463   AVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSA  284
             AV     +EVG+IP+A+VV+K GS+  LS +NV+DFVA+QVAPYK++RRV F  +IPK+ 
Sbjct  486   AVIPFPDKEVGQIPMAYVVRKAGSD--LSDSNVMDFVARQVAPYKRIRRVAFVNAIPKNP  543

Query  283   SGKILRKELRNLLITSKI  230
             SGKILRK+L   L TSK+
Sbjct  544   SGKILRKDLIK-LATSKL  560



>gb|AIY34663.1| 4-coumarate:CoA ligase-like protein [Galtonia saundersiae]
Length=547

 Score =   439 bits (1130),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 245/543 (45%), Positives = 348/543 (64%), Gaps = 24/543 (4%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRN---HGGLSALVDSQSGFSISYPE  1682
             +SC Y   TGIY S  P +  PSDP L ++SF+  RN   +    ALVD++SG S ++ E
Sbjct  4     KSC-YDPITGIYTSPRPPLSFPSDPDLSMISFLF-RNVDLYPNRLALVDAESGRSFTFAE  61

Query  1681  LRSLVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIK  1502
             LRS V+S A GL R+G+ +GDV LI  PNS+ FP+ FL ++S+GAVA T+NPL T+ E+ 
Sbjct  62    LRSTVSSFAVGLSRLGIEKGDVVLIFSPNSVLFPISFLSIVSLGAVATTVNPLYTVPELS  121

Query  1501  KQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSP---FRKLIS---SDP--KL  1346
             KQ+ D   +L   +P+ V      L +P++ L +  N  +    F  +I    S P  ++
Sbjct  122   KQALDSRAKLVLTSPELVAK-ARALNLPIVLLSDKENASASMPTFYDVIERFGSAPAARI  180

Query  1345  APTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLD  1166
              P PRI Q+DTAA+L+SSGTTG  K V LTH NFI+   +     A Q E     N +L 
Sbjct  181   DP-PRITQEDTAALLYSSGTTGTSKGVVLTHRNFISAAMMLT---ADQDEEGDPPNTFLC  236

Query  1165  VLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRK  986
              LP++HV+GLS+     L  G+TVVV+ +++++ ++ AIDR+ V+H  V PP++V L + 
Sbjct  237   FLPIFHVFGLSVVNFAQLRRGNTVVVMERFDMERMLAAIDRFAVSHLFVVPPVMVGLAKM  296

Query  985   AKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKL  806
              K  K  L SL+ + SGAAP+    ++   R F  +D +QGYG+TE+T++ +      K 
Sbjct  297   GKVTKYNLDSLRWICSGAAPVGGDVMEEVARAFDGVDVVQGYGLTETTSIISLERCKEKG  356

Query  805   RNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVD  626
             R   S G L   +EA+V+ + +      +PP   GEL  RGP +M+GY NN EA++  +D
Sbjct  357   RKIGSTGYLMAGIEAKVITVDTLQP---VPPRMNGELLFRGPNMMQGYFNNPEATRLTLD  413

Query  625   DDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQ  446
             D+GWLHTGD+ +FDE G LYV DR+KE+IK KGFQ+APA+LEAVL+SHP I+DAAV   +
Sbjct  414   DEGWLHTGDLGYFDEKGRLYVEDRIKELIKCKGFQVAPAELEAVLISHPQILDAAVVPME  473

Query  445   SEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILR  266
               E G++P+AFVV     + SL++ +V  FVA +VAPYK++RRV F   IPK+ASGKILR
Sbjct  474   DAEAGQVPIAFVV---CPDSSLTETDVQKFVANEVAPYKRLRRVVFVNGIPKTASGKILR  530

Query  265   KEL  257
             +EL
Sbjct  531   REL  533



>ref|XP_008452936.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Cucumis melo]
Length=550

 Score =   439 bits (1130),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 251/552 (45%), Positives = 357/552 (65%), Gaps = 26/552 (5%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  S T I+ SK   + LP +  LD  +FI SR H G  AL+D+ +G  I+Y +L +
Sbjct  14    RSGFCKS-TKIFHSKRRPIPLPPNESLDATTFISSRPHNGKIALIDAATGHHITYSDLWN  72

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V+S+A+ L  MG+ +G V L+L PNSI+FP+I L ++S+GA+  T NPL+T  EI KQ 
Sbjct  73    AVHSVASSLSDMGIRKGHVILLLSPNSIHFPIICLAVMSIGAIITTTNPLNTPQEIAKQI  132

Query  1492  FDCNVRLAFATPDRVQNLGSTLGIPVI----GLPES----LNLDSPFRKLISSDPKLAPT  1337
              D    LAF T + +  + ST  +P++     +P+S    +   S   K  +S  ++   
Sbjct  133   ADSRPILAFTTQELIPKI-STSKLPIVIIDGQIPKSQDKIVTTLSEMMKKKASGSQIKE-  190

Query  1336  PRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLDVL  1160
              R+ Q DTA +L+SSGTTG  K V  +H N IAMV++ V RF+ S+ E       ++  +
Sbjct  191   -RVEQNDTATLLYSSGTTGASKGVVSSHKNLIAMVQVVVTRFKLSEGE-----GTFICTV  244

Query  1159  PMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK  980
             PM+H+YGL  F  GLLS GST+VV+ K+E+ E++ AI++Y  T+ P+ PP+LVAL   A+
Sbjct  245   PMFHIYGLVAFATGLLSSGSTIVVLSKFEIHEMLSAIEKYKATYLPLVPPILVALVNAAE  304

Query  979   A--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKL  806
                 K  L SL    SG AP+    I+ FV  FPH+  +QGYG+TEST +G    +  + 
Sbjct  305   QIKGKYDLGSLHTALSGGAPLGKEVIEGFVEKFPHVAILQGYGLTESTGIGASTDSLEES  364

Query  805   RNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVD  626
             R Y + GLL+P+ E  +VD      G +LP    GELWLRGP +MKGY  N EA+ + +D
Sbjct  365   RRYGTAGLLSPSTEGMIVD---PETGEALPVNRTGELWLRGPTVMKGYFGNVEATNSTLD  421

Query  625   DDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQ  446
              +GWL TGD+ + DEDG+++V DRLKE+IKYKG+Q+ PA+LEA+L++HP+I DAAV    
Sbjct  422   SEGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVPPAELEALLLTHPNISDAAVIPYP  481

Query  445   SEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILR  266
              ++VG+ P+A+VV+K GS+  LS  +++ FVAKQVAPYK++RRV F  SIPK+ SGKILR
Sbjct  482   DKDVGQFPMAYVVRKAGSD--LSHDDIMQFVAKQVAPYKRIRRVAFVDSIPKNPSGKILR  539

Query  265   KELRNLLITSKI  230
             K+L  L  TSK+
Sbjct  540   KDLIKLA-TSKL  550



>ref|XP_008777804.1| PREDICTED: LOW QUALITY PROTEIN: 4-coumarate--CoA ligase-like 
4 [Phoenix dactylifera]
Length=551

 Score =   438 bits (1127),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 253/550 (46%), Positives = 351/550 (64%), Gaps = 20/550 (4%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  S + I+ SK   V  PSDP LDV +F+ SR H G +AL+D+ +G  +S+P L  
Sbjct  13    RSGFCPSNS-IFYSKRKPVPXPSDPHLDVTTFLSSRRHSGTTALIDAATGRRVSFPALWR  71

Query  1672  LVNSMAAGLH-RMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQ  1496
              V ++A+ L  R+ V +GDV L+L PNS++FPV+ L ++S+GAV  T NPL+T  EI KQ
Sbjct  72    SVAALASALSSRLSVRKGDVVLLLSPNSLHFPVVSLAVMSLGAVLTTTNPLNTPQEIAKQ  131

Query  1495  SFDCNVRLAFATPDRVQNLGSTLGIPVIGLPES--LNLDSPFRKLISSDPKLAPTPRIR-  1325
               D +  LAF     V  L      P++ L +      D+  R  I     + P  R R 
Sbjct  132   ISDSDPILAFVIRPLVGKLPRDRDFPIVLLEDCRIAGDDARIRYTIEELTAMEPDLRRRR  191

Query  1324  ----QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLDVL  1160
                 Q DTA +L+SSGTTG  K V  TH N I+MV++ + RF+    E       ++  +
Sbjct  192   EPVSQDDTATLLYSSGTTGTSKGVVATHRNLISMVQIILNRFKLE--EGGGEPETFICTV  249

Query  1159  PMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK  980
             PM+HVYGL+ F  GLL  GSTVV++ K+E+ E++RAI  YG T+ P+ PP+LVA+  +A 
Sbjct  250   PMFHVYGLAAFATGLLGSGSTVVILSKFEMGEMIRAIREYGATYLPLVPPILVAMLNQAA  309

Query  979   ADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRN  800
                 G   L++V SG AP+    I+ F   +P ++ +QGYG+TEST +G    +  + R 
Sbjct  310   PLPLG--RLRRVLSGGAPLGREVIEGFREKYPAVEILQGYGLTESTGIGASTDSAEESRR  367

Query  799   YTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDD  620
             + + GLL+PN EAR+VD      G SLP    GELW+RGP +MKGY  N EA+ + +D +
Sbjct  368   FGTAGLLSPNTEARIVD---PDTGVSLPVKRTGELWIRGPYVMKGYFKNPEATSSTLDSE  424

Query  619   GWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSE  440
             GWL TGDI + DEDG+L+V DRLKE+IKYKG+Q+ PA+LEA+L+SHP+I DAAV      
Sbjct  425   GWLRTGDICYIDEDGFLFVVDRLKELIKYKGYQVPPAELEALLLSHPEITDAAVIPFPDR  484

Query  439   EVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKE  260
             EVG+ P+A+VV+K GS   LS+  V++FVAKQVAPYK++R+V F  +IPK+ SGKILRK+
Sbjct  485   EVGQFPMAYVVRKAGSH--LSETGVMEFVAKQVAPYKRIRKVAFVSAIPKNPSGKILRKD  542

Query  259   LRNLLITSKI  230
             L   L TSK+
Sbjct  543   LIK-LATSKL  551



>dbj|BAJ95119.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=544

 Score =   438 bits (1126),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 257/547 (47%), Positives = 350/547 (64%), Gaps = 24/547 (4%)
 Frame = -2

Query  1840  YSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVNS  1661
             Y + TG +RSK   V LP+D  LDVV+F+ SR H G+ ALVD+ +G   ++ +L   V  
Sbjct  12    YCAATGAFRSKRAEVQLPADRDLDVVTFLASRRHSGVVALVDASTGRRTTFADLWRAVAG  71

Query  1660  MAAGLHR--MGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFD  1487
              A  L     G+ +G VALIL PNS++FPV  L  +S+GAV  T NPL+T +E+ KQ  D
Sbjct  72    AATALAAPPFGLRKGHVALILSPNSVHFPVAALAAMSLGAVVTTANPLNTAAEVAKQVAD  131

Query  1486  CNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPFRKLISSDPKLAPTP-------RI  1328
                 LAF T D +  L    G+ V+ L      D P R + + D   A TP       R+
Sbjct  132   ARPVLAFTTRDLLPKLPR--GLRVVLLEPPSPADDP-RIVATIDEISATTPDPARRRDRV  188

Query  1327  RQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLDVLPMY  1151
              Q D A +L+SSGTTG  K V  TH N I+MV++ + RF   + E   T   +L  +PM+
Sbjct  189   TQDDQATLLYSSGTTGPSKGVVATHRNLISMVQIVMNRF---RLEDSDTTETFLCTVPMF  245

Query  1150  HVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADK  971
             HVYGL  F  GLL  G+T+VV+ K+E+ E++R I  YGVT+ P+ PP+LVA+    K   
Sbjct  246   HVYGLVAFATGLLGCGATIVVLSKFELPEMLRCITAYGVTYLPLVPPILVAMVAHPKPLP  305

Query  970   CGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTS  791
              G  +L++V SG AP+S   I+ F   +P ++ +QGYG+TESTA+G    +  + R Y +
Sbjct  306   LG--NLRKVLSGGAPLSKELIEGFRDKYPQVEILQGYGLTESTAIGASTDSAEESRRYGT  363

Query  790   VGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWL  611
              GLL+PN EA++VD      G +LP    GELW+RGP +MKGY  N EA+++ V  DGWL
Sbjct  364   AGLLSPNTEAKIVD---PETGEALPVNRTGELWIRGPYVMKGYFKNTEATQSTVTPDGWL  420

Query  610   HTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVG  431
              TGD+ + DEDGYL+V DRLKE+IKYKG+Q+ PA+LEA+L++HP++ D AV      EVG
Sbjct  421   KTGDLCYIDEDGYLFVVDRLKELIKYKGYQVPPAELEALLLTHPEVSDVAVIPFPDREVG  480

Query  430   EIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRN  251
             + P+A+VV+KKGS  +LS   V++FVAKQVAPYKKVR+V F   IPK+ASGKILRK+L  
Sbjct  481   QFPMAYVVRKKGS--NLSAQEVMEFVAKQVAPYKKVRKVAFVTDIPKNASGKILRKDLIK  538

Query  250   LLITSKI  230
              L TSK+
Sbjct  539   -LATSKL  544



>ref|XP_010918637.1| PREDICTED: 4-coumarate--CoA ligase-like 1 isoform X1 [Elaeis 
guineensis]
Length=544

 Score =   437 bits (1124),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 243/536 (45%), Positives = 348/536 (65%), Gaps = 23/536 (4%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFILSRNHG--GLSALVDSQSGFSISYPELRSLVNSMAA  1652
             G+YRS  P +  PSDP L ++ F+  R        AL D+ SG S+++ +LRS ++S AA
Sbjct  11    GVYRSLSPPIAFPSDPDLSMLPFLFRRTAAFPDRLALADADSGRSLTFLQLRSAISSAAA  70

Query  1651  GLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRL  1472
             GL  +G+S+GDV LI  PNS++FPV FL +LS+GA+A T+NPL T++EI KQ+ D N +L
Sbjct  71    GLASLGISKGDVVLIFSPNSLHFPVCFLAILSLGAIATTVNPLYTVAEISKQAKDSNPKL  130

Query  1471  AFATPDRVQNLGSTLGIPVIGL-----PESLNLDSP---FRKLIS--SDPKLAPTPRIRQ  1322
                 PD    + + LG+P + L     P S +   P   F +LIS  ++P   P P +RQ
Sbjct  131   VITVPDLWPKV-APLGLPAVILGPKDSPLSPSTHVPITYFSELISRHTNPDFKPPP-VRQ  188

Query  1321  QDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVY  1142
              D AA+L+SSGTTG  K V LTH NFI    +    +    E PAT   +L  LPM+H++
Sbjct  189   TDVAALLYSSGTTGESKGVILTHRNFICAALMVTADQELNGEPPAT---FLCFLPMFHIF  245

Query  1141  GLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCGL  962
             GLS+     L+ G+TVV + K++ + V++++++Y V+H    PP+++AL ++ K  K  L
Sbjct  246   GLSVITYAQLTRGNTVVSMGKFDFEMVLKSVEKYRVSHLFCVPPVMIALAKQGKTGKFDL  305

Query  961   KSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAV-GTRGFNTAKLRNYTSVG  785
              SL+ + SGAAP+    + +  + FP  D IQGYGMTE+  +        A+ R + S G
Sbjct  306   SSLRLIGSGAAPLGKDVMADVSKNFPDADVIQGYGMTETCGIISLENPPKAEARWFGSTG  365

Query  784   LLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHT  605
             +LA  +E +VV +++      LPP  +GEL  RGP IM+GYLNN +A+K  +D+ GWLHT
Sbjct  366   ILASGVEGKVVSINTLKS---LPPNQLGELCFRGPNIMQGYLNNPQATKLTLDEQGWLHT  422

Query  604   GDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEI  425
             GD+ +FDE G LYV DR+KE+IKYKGFQ+APA+LE +L+SH +I+DA V      E GE+
Sbjct  423   GDLGYFDEKGQLYVVDRIKELIKYKGFQVAPAELEGLLLSHSEILDAVVIPFPDAEAGEV  482

Query  424   PVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             P+AFVV+   S  SL++ NV  F+A+QVAP+K++RRV F  S+PKSASGKILR+EL
Sbjct  483   PIAFVVRSPNS--SLTEENVQKFIAEQVAPFKRLRRVTFVNSVPKSASGKILRREL  536



>ref|NP_001142142.1| putative AMP-dependent synthetase and ligase superfamily protein 
[Zea mays]
 gb|ACF87751.1| unknown [Zea mays]
 tpg|DAA43192.1| TPA: putative AMP-dependent synthetase and ligase superfamily 
protein [Zea mays]
Length=551

 Score =   437 bits (1124),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 259/551 (47%), Positives = 352/551 (64%), Gaps = 28/551 (5%)
 Frame = -2

Query  1840  YSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVNS  1661
             Y + T  +RSK   V LP+D  LDVV F+ SR H G+ ALVD+ +G  +++ EL   V  
Sbjct  11    YCAATRTFRSKRADVPLPADADLDVVRFLASRRHAGVVALVDAATGHRVTFQELWRAVEG  70

Query  1660  MAAGLHRMGVS--QGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFD  1487
              A  L    +S  +G VALIL PNS++FPV  L  +S+GAV  T NPL+T +EI KQ  D
Sbjct  71    AATALAAPPLSLRKGQVALILSPNSVHFPVAALAAMSLGAVLTTANPLNTPAEIAKQVAD  130

Query  1486  CNVRLAFATPDRVQNL---GSTLGIPVIGL-PESLNLD-SPFRKLISSDPKLAPTP----  1334
                 +AF T D +  L   G+  GI V+ L P+ L  D SP    I       P P    
Sbjct  131   ARPVVAFTTRDLLPKLPRAGAGAGIRVVLLEPDRLPSDPSPVVATIGEISATPPDPTRRR  190

Query  1333  -RIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV---RFEASQYEYPATANVYLD  1166
              R+ Q D A +L+SSGTTG  K V  TH + I+MV++ +   R EAS          +L 
Sbjct  191   DRVTQDDPATLLYSSGTTGPSKGVVATHRSLISMVQIIMSRFRLEASN-----RTETFLC  245

Query  1165  VLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRK  986
              +PM+HVYGL  F  GLL  G+T+VV+ KYE+ E++RAI+ YGVT+ P+ PP+LVA+   
Sbjct  246   TVPMFHVYGLVAFATGLLGCGATIVVLSKYELPEMLRAINEYGVTYLPLVPPILVAML--  303

Query  985   AKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKL  806
             A  ++  L  L++V SG AP+S   I+ F   +P ++ +QGYG+TESTA+G    +  + 
Sbjct  304   AHPNRLPLGGLRKVLSGGAPLSKELIEGFKEKYPQVEILQGYGLTESTAIGASTDSAEES  363

Query  805   RNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVD  626
               Y + GLL+P+ EA++VD      G +LP    GELW+RGP +MKGY  N EA+++ + 
Sbjct  364   SRYGTAGLLSPSTEAKIVD---PETGEALPVNRTGELWIRGPYVMKGYFKNAEATQSTLT  420

Query  625   DDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQ  446
              DGWL TGD+ + DEDGYL+V DRLKE+IKYKG+Q+ PA+LEA+L++HP+I D AV    
Sbjct  421   PDGWLKTGDLCYIDEDGYLFVVDRLKELIKYKGYQVPPAELEALLLTHPEIEDVAVIPFP  480

Query  445   SEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILR  266
               EVG+ P+A+VV+KKGS  +LS+  V++FVAKQVAPYKKVR+V F   IPK+ASGKILR
Sbjct  481   DREVGQFPMAYVVRKKGS--NLSEREVMEFVAKQVAPYKKVRKVAFVAEIPKNASGKILR  538

Query  265   KELRNLLITSK  233
             K+L   L TSK
Sbjct  539   KDLIK-LATSK  548



>ref|XP_002285920.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Vitis vinifera]
Length=549

 Score =   436 bits (1121),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 246/550 (45%), Positives = 354/550 (64%), Gaps = 21/550 (4%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  S +  Y  ++P V LP   F+DV +FI SR H G +A +D+ SG  +S+ E+  
Sbjct  12    RSGFCRSNSVFYSKRNP-VSLPQKEFIDVTTFISSRPHPGKTAFIDAASGHRLSFYEVWR  70

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V+++++ L  MG+ +G V L+L PNSI FP++ L ++S+GAV  T NPL+T  EI KQ 
Sbjct  71    AVDAVSSCLADMGIRKGHVILLLSPNSILFPIVCLSVMSLGAVITTTNPLNTAREIGKQI  130

Query  1492  FDCNVRLAFATPDRVQNL-GSTLGIPVIG----LPESLNLDSPFRKLISSDPKLAPT-PR  1331
              D    LAF  P  V  L GS L I ++G     P    +     +++  +P       R
Sbjct  131   ADSKPVLAFTIPSLVPKLAGSNLPIVLMGGEGNTPAPAGVVGSLEEMMRREPSGKRVGER  190

Query  1330  IRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLDVLPM  1154
             + Q+DTA +L+SSGTTG  K V  +H N IAMV+  V RF +   E       ++  +PM
Sbjct  191   VNQEDTATLLYSSGTTGASKGVVSSHRNLIAMVQTIVSRFSSEDGE-----QTFICTVPM  245

Query  1153  YHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKAD  974
             +H+YGL+ F MG+L+ GSTVVV+ ++E+DE++ +I +Y  T  P+ PP+LVAL   A   
Sbjct  246   FHIYGLAAFAMGMLASGSTVVVLSRFEMDEMLSSISKYRATCLPLVPPILVALVHSADKI  305

Query  973   KC--GLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRN  800
             K    L SL+   SG AP+S   I+ F   +P +  +QGYG+TEST +G    +  + R 
Sbjct  306   KAKYDLNSLQSTLSGGAPLSKEVIEGFAEKYPSVKILQGYGLTESTGIGASTDSLEESRR  365

Query  799   YTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDD  620
             Y + GLL+P+MEA++VD    G G +L     GELWLRGP IMKGY +N E + + +D  
Sbjct  366   YGTAGLLSPSMEAKIVD---PGSGKALTVNQTGELWLRGPTIMKGYFSNPEVTTSTLDSS  422

Query  619   GWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSE  440
             GWL TGD+ + D+DG++++ DRLKE+IKYKG+Q+ PA+LEA+L++HP+I DAAV     +
Sbjct  423   GWLRTGDLCYIDDDGFIFIVDRLKELIKYKGYQVPPAELEALLLTHPEIADAAVIPFPDK  482

Query  439   EVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKE  260
             EVG+ P+A++ +K GS  +LS++ V+DF+AKQVAPYK++RRV F  SIPK+ASGKILRK+
Sbjct  483   EVGQYPMAYINRKAGS--NLSESAVMDFIAKQVAPYKRIRRVAFVDSIPKNASGKILRKD  540

Query  259   LRNLLITSKI  230
             L   L TSK+
Sbjct  541   LIQ-LATSKL  549



>gb|AGO89325.1| Ca4CL8 [Salix arbutifolia]
Length=554

 Score =   436 bits (1121),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 237/554 (43%), Positives = 357/554 (64%), Gaps = 25/554 (5%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  S +  Y  + P + LP   FLDV +FI SR H G +A +D+ +G  +S+ +L  
Sbjct  13    RSGFCKSNSVFYSKRKP-IPLPQTDFLDVTTFIFSRPHHGKTAFIDAATGRQLSFKDLWR  71

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V+S++  LH MG+ +G V L+L PNSI+FP++ L ++ +GA+  T NPL+T  EI KQ 
Sbjct  72    AVDSVSMCLHDMGIRKGQVILLLSPNSIFFPIVCLSVMWLGAIITTTNPLNTPREIAKQI  131

Query  1492  FDCNVRLAFATPDRVQNLG-STLGIPVIGLPESL--------NLDSPFRKLISSDPKLAP  1340
              D    LAF TP+ V  L  S+  +P++ + + +         + +   +++  +P+ + 
Sbjct  132   ADSKPSLAFTTPELVSKLTESSSSLPIVLIDDEIGTSIKTKAKIVTTLSEMVKREPRESR  191

Query  1339  T-PRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLD  1166
                R+ Q DTA +L+SSGTTG  K VA +H N IAMV+  V RF  ++  +      ++ 
Sbjct  192   VRERVNQNDTATLLYSSGTTGESKGVASSHKNLIAMVQTIVERFRLNEGSHK-----FVC  246

Query  1165  VLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRK  986
              +PM+H+YGL+ F  G+L+ GST++V+ K+E+ E++  I++Y  T+ P+ PP+LVA+   
Sbjct  247   TVPMFHIYGLAAFATGILASGSTIIVLSKFEMGEMLSTIEKYQATYLPLVPPILVAMING  306

Query  985   AKA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTA  812
             A     K  L SL+ V SG AP+S   I+ F   +P +  +QGYG+TESTA+G       
Sbjct  307   ADQIRAKYDLSSLQSVLSGGAPLSKEVIEGFSNKYPGVTILQGYGLTESTAIGASTDTLE  366

Query  811   KLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNA  632
             + R Y + GLL+PN EA++VD      G +L     GELWLR P++MKGY +N EA+ +A
Sbjct  367   ESRRYGTAGLLSPNTEAKIVD---PESGKALSVNQTGELWLRAPSVMKGYFSNAEATSSA  423

Query  631   VDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTS  452
             +D +GWL TGD+ + D+DG+++V DRLKE+IKYKG+Q+ PA+LEA+L++HP+I DAAV  
Sbjct  424   IDSEGWLRTGDLCYIDDDGFIFVVDRLKELIKYKGYQVPPAELEALLLAHPEISDAAVIP  483

Query  451   AQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKI  272
                + VG+ P+A+VV+K GS  +LS+  V DF+A QVAPYK++RRV F  ++PK+ SGKI
Sbjct  484   FPDKNVGQFPMAYVVRKAGS--NLSEKAVQDFIAGQVAPYKRIRRVAFIAAVPKNPSGKI  541

Query  271   LRKELRNLLITSKI  230
             LRK+L   L TSK+
Sbjct  542   LRKDLIK-LATSKL  554



>ref|XP_004145532.1| PREDICTED: 4-coumarate--CoA ligase-like 5-like [Cucumis sativus]
 ref|XP_004157077.1| PREDICTED: 4-coumarate--CoA ligase-like 5-like [Cucumis sativus]
 gb|KGN55484.1| hypothetical protein Csa_4G653450 [Cucumis sativus]
Length=550

 Score =   435 bits (1119),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 249/550 (45%), Positives = 355/550 (65%), Gaps = 22/550 (4%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  S T I+ SK   + LP +  LD  +FI SR H G  AL+D+ +G  I+Y +L +
Sbjct  14    RSGFCKS-TKIFNSKRRPIPLPPNQSLDATTFISSRPHNGKIALIDASTGHHITYSDLWN  72

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V+S+A+ L  MG+ +G V L+L PNSI+FP+I L ++S+GA+  T NPL+T  EI KQ 
Sbjct  73    AVHSVASSLSDMGIRKGHVILLLSPNSIHFPIICLAVMSIGAIITTTNPLNTPQEISKQI  132

Query  1492  FDCNVRLAFATPDRVQNLGSTLGIPVI----GLPES-LNLDSPFRKLISSDPKLAP-TPR  1331
              D    LAF T   +  + +T  +PV+     +P+S   + S   +++   P  +    R
Sbjct  133   SDSKPILAFTTQALIPKI-ATSKLPVVVIDGQIPKSQAKIVSTLSEMMRKKPSGSQIKER  191

Query  1330  IRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLDVLPM  1154
             + Q DTA +L+SSGTTG  K V  +H N IAMV++ V RF+ S+ E       ++  +PM
Sbjct  192   VEQNDTATLLYSSGTTGASKGVVSSHKNLIAMVQVVVTRFKLSEGE-----GTFICTVPM  246

Query  1153  YHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKA-  977
             +H+YGL  F  GLLS GST+VV+ K+E+ E++ AI++Y  T+ P+ PP+LVAL   A+  
Sbjct  247   FHIYGLVAFATGLLSSGSTIVVLSKFEIHEMLSAIEKYKATYLPLVPPILVALVNAAEQI  306

Query  976   -DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRN  800
               K  L SL    SG AP+    I+ FV  FP++  +QGYG+TEST +G    +  + R 
Sbjct  307   KGKYDLGSLHTALSGGAPLGKEVIEGFVEKFPNVAILQGYGLTESTGIGASTDSLEESRR  366

Query  799   YTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDD  620
             Y + GLL+P+ E  +VD      G +LP    GELWLRGP +MKGY  N EA+ + +D  
Sbjct  367   YGTAGLLSPSTEGMIVD---PETGEALPVNRTGELWLRGPTVMKGYFGNVEATSSTLDSA  423

Query  619   GWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSE  440
             GWL TGD+ + DEDG+++V DRLKE+IKYKG+Q+ PA+LEA+L++HP+I DAAV     +
Sbjct  424   GWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVPPAELEALLLTHPNISDAAVIPYPDK  483

Query  439   EVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKE  260
             +VG+ P+A+VV+K GS++  S  +V+ FVAKQVAPYK++RRV F  SIPK+ SGKILRK+
Sbjct  484   DVGQFPMAYVVRKVGSDI--SHNDVMQFVAKQVAPYKRIRRVAFVDSIPKNPSGKILRKD  541

Query  259   LRNLLITSKI  230
             L   L TSK+
Sbjct  542   LIK-LATSKL  550



>ref|XP_004985831.1| PREDICTED: 4-coumarate--CoA ligase-like 4-like [Setaria italica]
Length=548

 Score =   435 bits (1119),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 257/550 (47%), Positives = 357/550 (65%), Gaps = 26/550 (5%)
 Frame = -2

Query  1840  YSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVNS  1661
             Y + T  +RSK   V LP+D  LDVV+F+ SR H G  ALVD+ +G  +++PEL   V S
Sbjct  12    YCAATRSFRSKRAPVPLPADRDLDVVAFLASRRHAGTVALVDAATGRRVTFPELWRAVAS  71

Query  1660  MAAGLHR--MGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFD  1487
              A  L    + + +G VALIL PNS++FPV  L  +S+GAV  T NPL+T +EI KQ  D
Sbjct  72    AATALAAPPLSLRKGHVALILSPNSVHFPVAALAAMSLGAVITTANPLNTPAEIAKQVAD  131

Query  1486  CNVRLAFATPDRVQNL-GSTLGIPVIGL-PESLNLDSPFRKLISSDPKLAPTP-------  1334
                 +AF T D +  L  +  G+ V+ L PE L  D     ++++  +++ TP       
Sbjct  132   ARPVVAFTTRDLLPKLPAAGDGLRVVLLEPERLPSDP--AAVVATIEEISATPPDPARRR  189

Query  1333  -RIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLDVL  1160
              R+ Q D A +L+SSGTTG  K V  TH + I+MV++ + RF   + E       +L  +
Sbjct  190   DRVTQDDPATLLYSSGTTGPSKGVVATHRSLISMVQIIMTRF---RLEGADRTEAFLCTV  246

Query  1159  PMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK  980
             PM+HVYGL  F  GLL  G+T+VV+ KYE+ E++RAI+ YGVT+ P+ PP+LVA+    K
Sbjct  247   PMFHVYGLVAFATGLLGCGATIVVLSKYELPEMLRAINEYGVTYLPLVPPILVAMVAHPK  306

Query  979   ADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRN  800
                 G   L++V SG AP+S   I+ F   +P ++ +QGYG+TESTA+G    +  + R 
Sbjct  307   PLPLG--QLRKVLSGGAPLSKELIEGFREKYPQVEILQGYGLTESTAIGASTDSAEESRR  364

Query  799   YTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDD  620
             Y + GLL+PN EA++VD      G +LP    GELW+RGP +MKGY  N EA+++ V  D
Sbjct  365   YGTAGLLSPNTEAKIVD---PETGEALPVNRTGELWIRGPYVMKGYFKNPEATQSTVTPD  421

Query  619   GWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSE  440
             GWL TGD+ + DEDGYL+V DRLKE+IKYKG+Q+ PA+LEA+L++HP+I D AV      
Sbjct  422   GWLKTGDLCYIDEDGYLFVVDRLKELIKYKGYQVPPAELEALLLTHPEIADVAVIPFPDR  481

Query  439   EVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKE  260
             EVG+ P+A+VV+KKGS+  LS+  +++FVAKQVAPYKKVR+V F   IPK+ASGKILRK+
Sbjct  482   EVGQFPMAYVVRKKGSK--LSEREIMEFVAKQVAPYKKVRKVAFVAEIPKNASGKILRKD  539

Query  259   LRNLLITSKI  230
             L   L TSK+
Sbjct  540   LIK-LATSKL  548



>emb|CAN74074.1| hypothetical protein VITISV_000975 [Vitis vinifera]
Length=546

 Score =   435 bits (1118),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 247/550 (45%), Positives = 353/550 (64%), Gaps = 21/550 (4%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  S +  Y  ++P V LP   F+DV +FI SR H G +A +D+ SG  +S  E+  
Sbjct  9     RSGFCRSNSVFYSKRNP-VSLPQKEFIDVTTFISSRPHHGKTAFIDAASGHRLSXYEVWR  67

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V+++++ L  MG+ +G V L+L PNSI FP + L ++S+GAV  T NPL+T  EI KQ 
Sbjct  68    AVDAVSSCLADMGIRKGHVILLLSPNSILFPXVCLSVMSLGAVITTTNPLNTAREIGKQI  127

Query  1492  FDCNVRLAFATPDRVQNL-GSTLGIPVIG----LPESLNLDSPFRKLISSDPKLAPT-PR  1331
              D    LAF  P  V  L GS L I ++G     P    +     +++  +P       R
Sbjct  128   ADSKPVLAFTIPSLVPKLAGSNLPIVLMGGEGNTPAPAGVVGSLEEMMRREPSGKRVGER  187

Query  1330  IRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLDVLPM  1154
             + Q+DTA +L+SSGTTG  K V  +H N IAMV+  V RF +   E       ++  +PM
Sbjct  188   VNQEDTATLLYSSGTTGASKGVVSSHRNLIAMVQTIVSRFSSEDGE-----QTFICTVPM  242

Query  1153  YHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKAD  974
             +H+YGL+ F MG+L+ GSTVVV+ ++E+DE++ +I +Y  T  P+ PP+LVAL   A   
Sbjct  243   FHIYGLAAFAMGMLASGSTVVVLSRFEMDEMLSSISKYRATCLPLVPPILVALVHSADKI  302

Query  973   KC--GLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRN  800
             K    L SL+   SG AP+S   I+ F   +P +  +QGYG+TEST +G    +  + R 
Sbjct  303   KAKYDLNSLQSTLSGGAPLSKEVIEGFAEKYPSVKILQGYGLTESTGIGASTDSLEESRR  362

Query  799   YTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDD  620
             Y + GLL+P+MEA++VD    G G +L     GELWLRGP IMKGY +N EA+ + +D  
Sbjct  363   YGTAGLLSPSMEAKIVD---PGSGKALTVNQTGELWLRGPTIMKGYFSNPEATTSTLDSS  419

Query  619   GWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSE  440
             GWL TGD+ + D+DG++++ DRLKE+IKYKG+Q+ PA+LEA+L++HP+I DAAV     +
Sbjct  420   GWLRTGDLCYIDDDGFIFIVDRLKELIKYKGYQVPPAELEALLLTHPEIADAAVIPFPDK  479

Query  439   EVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKE  260
             EVG+ P+A++ +K GS  +LS++ V+DF+AKQVAPYK++RRV F  SIPK+ASGKILRK+
Sbjct  480   EVGQYPMAYINRKAGS--NLSESAVMDFIAKQVAPYKRIRRVAFVDSIPKNASGKILRKD  537

Query  259   LRNLLITSKI  230
             L   L TSK+
Sbjct  538   LIQ-LATSKL  546



>ref|XP_010692849.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Beta vulgaris subsp. 
vulgaris]
Length=561

 Score =   435 bits (1119),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 242/546 (44%), Positives = 353/546 (65%), Gaps = 22/546 (4%)
 Frame = -2

Query  1840  YSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVNS  1661
             YSS    + SK PS+ LP +  LD+ +FI SR H   +A +D+ +G  +SY +L S V+S
Sbjct  16    YSSINSTFYSKRPSIPLPPNTSLDITTFISSRPHKSTTAFIDASNGRHLSYSDLWSSVDS  75

Query  1660  MAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             ++  L     + +G V LIL PNS+ FP++ L ++S+GAV  T NPL+T  EI+KQ  + 
Sbjct  76    LSHSLSSTWNIRKGHVILILSPNSLSFPIVCLSVMSLGAVITTANPLNTTREIRKQVSNS  135

Query  1483  NVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPFRKLISSDPKLAPTP-------RIR  1325
             + +LAFATP+    L  + G+ V+ L E     +   +++    +            R+ 
Sbjct  136   DPKLAFATPELAHKLTGS-GVRVVLLGEGDGKTTTLEEMVKEGGERKEKEGMRVMRDRVD  194

Query  1324  QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATA----NVYLDVL  1160
             Q D AA+L+SSGTTG  K V  +H N IAMV++ + RF     EY  +     NV++  +
Sbjct  195   QNDAAALLYSSGTTGESKGVISSHRNMIAMVQVIIGRFRLDD-EYQRSGGSLNNVFICTV  253

Query  1159  PMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK  980
             PM+H+YGL  F  GLL+ G+TVV++ K+E+ +++ AI +Y V++FP+ PP+LVA+   A 
Sbjct  254   PMFHIYGLVAFATGLLAAGATVVILPKFEMHDLLLAISKYKVSYFPLVPPILVAMVHNAD  313

Query  979   ADKCG--LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKL  806
               K    L SL+ V SG AP+    I+ F+  FP++  +QGYG+TESTA+G       + 
Sbjct  314   QIKKNYDLSSLRHVLSGGAPLGKEVIEGFMEKFPNVVIMQGYGLTESTAIGASTDCLEES  373

Query  805   RNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVD  626
             R Y + GLL+P+ EA++VD      G SL     GELWLRGP +MKGY NN EA+ + + 
Sbjct  374   RKYGTAGLLSPSTEAKIVD---PVSGKSLGVNQTGELWLRGPTVMKGYFNNDEATASTLT  430

Query  625   DDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQ  446
              DGWL TGD+ + D+DG+L+V DRLKE+IKYKG+Q+ PA+LEA+L++HP+I DAAV    
Sbjct  431   SDGWLKTGDVCYIDDDGFLFVIDRLKELIKYKGYQVPPAELEALLLTHPEIADAAVIPFP  490

Query  445   SEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILR  266
              E+VG+ P+A+VV+K G   +LS+  V++FVAK+VAPYKK+RRV F +S+PK+ASGKILR
Sbjct  491   DEKVGQFPMAYVVRKAG--CTLSENEVMNFVAKEVAPYKKIRRVAFIESVPKNASGKILR  548

Query  265   KELRNL  248
             K+L  L
Sbjct  549   KDLIKL  554



>ref|XP_010094597.1| 4-coumarate--CoA ligase-like 5 [Morus notabilis]
 gb|EXB56351.1| 4-coumarate--CoA ligase-like 5 [Morus notabilis]
Length=554

 Score =   435 bits (1118),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 256/570 (45%), Positives = 361/570 (63%), Gaps = 32/570 (6%)
 Frame = -2

Query  1891  ISKIRNSAAEKGRRSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDS  1712
             + KI N   +K  RS F  S + I+ SK   V LP +  +D+ +FI SR H G  A VD+
Sbjct  1     MEKISNPTVDK--RSGFCKSNS-IFYSKRTPVALPQNQSVDIATFISSRAHNGKIAFVDA  57

Query  1711  QSGFSISYPELRSLVNSMAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAAT  1535
              +G  +++P+L   V S+A  L   MG+ +GDV L+L PNSI FPV+ L ++S+GAV  T
Sbjct  58    ATGRHLTFPQLWRAVYSVATCLSTDMGIRKGDVILLLSPNSIVFPVVCLAVMSLGAVITT  117

Query  1534  MNPLSTLSEIKKQSFDCNVRLAFATPDRVQNL-GSTLGIPVIGLPESLNLDS----PFRK  1370
              NPL+T  EI KQ  D    LAF T   +  + GS L  P++ + + +   S      R 
Sbjct  118   TNPLNTSREIAKQIADSKPVLAFTTLQLIPKIVGSNL--PIVLIDDDVGKQSLSNKNLRI  175

Query  1369  LISSDPKLAPTP-------RIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RF  1214
             + S    +   P       R+ Q DTA +L+SSGTTG  K V  +H N IAMV+  + RF
Sbjct  176   VFSLGEMMKKEPSAKRVGYRVDQDDTATLLYSSGTTGESKGVVSSHRNLIAMVQTILGRF  235

Query  1213  EASQYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGV  1034
              A + E       ++  +PM+H+YGL+ F MGLLS GST+VV+ K+E+ +++ AI++Y  
Sbjct  236   GADEGE-----QTFICTVPMFHIYGLAAFAMGLLSSGSTIVVLSKFEIHDMLSAIEKYRA  290

Query  1033  THFPVAPPLLVALTRKAKADKC--GLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGY  860
             T+ P+ PP+L+AL   A+  K    L++L  V SG AP+S    + FV  FP +  +QGY
Sbjct  291   TYLPLVPPILMALLNSAEKIKAKYDLRTLHSVLSGGAPLSKEVTEGFVEKFPSVKILQGY  350

Query  859   GMTESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGP  680
             G+TEST +G    +  + R Y + GLL+P+MEA++VD      G +LP    GELWLRGP
Sbjct  351   GLTESTGIGASTDSLEESRRYGTAGLLSPSMEAKIVD---PETGEALPVNRTGELWLRGP  407

Query  679   AIMKGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLE  500
              IMKGY +N EA+ + +  +GWL TGD+ + D+DG+L+V DRLKE+IKYKG+Q+ PA+LE
Sbjct  408   TIMKGYFSNEEATSSTLHSEGWLRTGDLCYIDDDGFLFVVDRLKELIKYKGYQVPPAELE  467

Query  499   AVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVR  320
             A+L+SHP+I D+AV     +EVG+ PVA+VV+K GS+  LS+  VIDF+ K VAPYK++R
Sbjct  468   ALLLSHPEISDSAVIPYPDKEVGQYPVAYVVRKGGSK--LSETEVIDFIGKLVAPYKRIR  525

Query  319   RVYFTKSIPKSASGKILRKELRNLLITSKI  230
             RV F  SI K+ASGKILRK+L   L TSK+
Sbjct  526   RVTFVSSILKNASGKILRKDLIK-LATSKL  554



>ref|NP_001048867.1| Os03g0132000 [Oryza sativa Japonica Group]
 sp|Q10S72.1|4CLL4_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 4 [Oryza sativa Japonica 
Group]
 gb|ABF93822.1| AMP-binding enzyme family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10781.1| Os03g0132000 [Oryza sativa Japonica Group]
 dbj|BAG97355.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00460.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58280.1| hypothetical protein OsJ_09299 [Oryza sativa Japonica Group]
Length=552

 Score =   434 bits (1116),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 254/557 (46%), Positives = 352/557 (63%), Gaps = 39/557 (7%)
 Frame = -2

Query  1840  YSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPEL--RSLV  1667
             Y + T  +RS+   V LP+DP +DVVSF+ SR H G+ ALVD+ +G  I++ EL      
Sbjct  15    YCAATRTFRSRRADVPLPADPEVDVVSFLASRRHSGVVALVDAATGRRITFTELWRAVAG  74

Query  1666  NSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFD  1487
              + A   H + + +G VALIL PNS++FPV  L  +S+GAV  T NPL+T +EI KQ  D
Sbjct  75    AASALAAHPVSLRKGHVALILSPNSVHFPVAALAAMSLGAVLTTANPLNTPAEIAKQVAD  134

Query  1486  CNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPFRKLISSDPKL--------APTP-  1334
                 LAF T + +  L     + V+ L ES  L        SSDP++        A TP 
Sbjct  135   ARPVLAFTTRELLPKLPRAHDLRVVLL-ESARLPGD-----SSDPRIVATIEEISATTPD  188

Query  1333  ------RIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV---RFEASQYEYPATA  1181
                   R+ Q D A +L+SSGTTG  K V  TH + I+MV++ +   R E S        
Sbjct  189   PARRKDRVTQDDPATLLYSSGTTGPSKGVVATHRSLISMVQIIMTRFRLEGSD-----KT  243

Query  1180  NVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLV  1001
               +L  +PM+HVYGL  F  GLL  G+TVVV+ KYE+ E++R+I+ YGVT+ P+ PP+LV
Sbjct  244   ETFLCTVPMFHVYGLVAFATGLLGCGATVVVLSKYELPEMLRSINAYGVTYLPLVPPILV  303

Query  1000  ALTRKAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGF  821
             A+    K    G   +++V SG AP+    I+ F   +P ++ +QGYG+TESTA+G    
Sbjct  304   AMVAHPKPLPLG--QMRKVLSGGAPLGKELIEGFREKYPQVEILQGYGLTESTAIGASTD  361

Query  820   NTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEAS  641
             +  + R Y + GLL+PN EA++VD      G +LP    GELW+RGP +MKGY  N EA+
Sbjct  362   SAEESRRYGTAGLLSPNTEAKIVD---PDSGEALPVNRTGELWIRGPYVMKGYFKNAEAT  418

Query  640   KNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAA  461
             ++ +  DGWL TGD+ + DEDGYL+V DRLKE+IKYKG+Q+ PA+LEA+L++HP++ D A
Sbjct  419   QSTLTPDGWLKTGDLCYIDEDGYLFVVDRLKELIKYKGYQVPPAELEALLLTHPEVTDVA  478

Query  460   VTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSAS  281
             V      EVG+ P+A++V+KKGS  +LS+  V++FVAKQVAPYKKVR+V F   IPK+AS
Sbjct  479   VIPFPDREVGQFPMAYIVRKKGS--NLSEREVMEFVAKQVAPYKKVRKVAFVTDIPKNAS  536

Query  280   GKILRKELRNLLITSKI  230
             GKILRK+L   L TSK+
Sbjct  537   GKILRKDLIK-LATSKL  552



>gb|KDP36837.1| hypothetical protein JCGZ_08128 [Jatropha curcas]
Length=550

 Score =   434 bits (1116),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 249/560 (44%), Positives = 353/560 (63%), Gaps = 24/560 (4%)
 Frame = -2

Query  1876  NSAAEKGRRSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFS  1697
              S+ E   RS F  S +  Y SK  S+ LP + ++DV +FI S+ H G +A +D+ +G  
Sbjct  4     KSSFEIDPRSGFCRSNSTFY-SKRKSIPLPPNQYIDVTTFISSQAHRGKTAFIDATTGRH  62

Query  1696  ISYPELRSLVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLST  1517
             +S+ EL   V+S+A  L  +GV +G V L+L PNSI+FP++ L ++S+GA+  T NPL+T
Sbjct  63    LSFLELWRAVDSVATSLFELGVRKGHVILLLSPNSIFFPIVCLSVMSLGAIITTTNPLNT  122

Query  1516  LSEIKKQSFDCNVRLAFATPDRVQNLG---STLGIPVIGLPESLNLDSPFRKLISSDPKL  1346
               E+ KQ  D     AF TP  V  L    S+L I +I    S  LD+     +S     
Sbjct  123   PREMAKQIADSKPSFAFTTPQLVPKLAESDSSLPIILIEDQNSTKLDAKIVTTLSQMMTK  182

Query  1345  APT-----PRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPAT  1184
              P+      R+   DTA +L+SSGTTG  K V  +H N IAMV+  V RF   +      
Sbjct  183   EPSGSRIKERVNIDDTATLLYSSGTTGASKGVVSSHRNLIAMVQTIVGRFNEDR------  236

Query  1183  ANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLL  1004
              + ++  +PM+H+YGL+ F  GLL+ GST++V+ K+E+ E++  I+ Y  T  P+ PP+L
Sbjct  237   EHRFICTVPMFHIYGLAAFATGLLASGSTIIVLSKFEIHEMLSTIEGYRATDLPLVPPIL  296

Query  1003  VALTRKAKA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGT  830
             VAL   +     K  L SL+ V SG AP+    I+ F   +P +  +QGYG+TESTA+G 
Sbjct  297   VALINGSDQIRSKYDLSSLETVLSGGAPLGKEVIEGFAEKYPTVRILQGYGLTESTAIGA  356

Query  829   RGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNG  650
                   + R Y + GLL+P+MEA++VD      G  LP    GELWLRGP+IMKGY  N 
Sbjct  357   STDTPEESRRYGTAGLLSPSMEAKIVD---PESGKPLPVNQTGELWLRGPSIMKGYFGNV  413

Query  649   EASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIV  470
             EA+ + +D +GWL TGD+ + D+DG+++V DRLKE+IKYKG+Q+ PA+LEA+L++H DI 
Sbjct  414   EATSSTLDSEGWLRTGDLCYIDDDGFIFVVDRLKELIKYKGYQVPPAELEALLLTHVDIS  473

Query  469   DAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPK  290
             DAAV     +E G+IP+A+VV+K GS  SLS+  V+DFVA+QVAPYK++RRV F  +IPK
Sbjct  474   DAAVIPLPDKEAGQIPMAYVVRKAGS--SLSETAVMDFVARQVAPYKRIRRVAFISAIPK  531

Query  289   SASGKILRKELRNLLITSKI  230
             +ASGKILRK+L   L TSK+
Sbjct  532   NASGKILRKDLIQ-LATSKL  550



>ref|XP_011099557.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Sesamum indicum]
Length=554

 Score =   434 bits (1116),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 241/551 (44%), Positives = 355/551 (64%), Gaps = 25/551 (5%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  + +  Y  + P V LPS+  LDV +FI SR H G  A +D+ +G  +++ ++  
Sbjct  14    RSGFCKANSTFYSKRKP-VPLPSNDSLDVTTFISSRAHNGKIAFIDAATGRQLTFADVWR  72

Query  1672  LVNSMAAGLH-RMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQ  1496
              V+++A+ L    G+ +G V L+L PNSIYFP++ L ++S+GA+  T NPL+T  EI KQ
Sbjct  73    AVDAVASSLSADFGIRKGHVVLLLTPNSIYFPIVCLAVMSLGAIITTTNPLNTSREIAKQ  132

Query  1495  SFDCNVRLAFATPDRVQNLGSTLGIPVI------GLPES--LNLDSPFRKLISSDPKLAP  1340
               D    LAF  P  +  L  +  +PV+      G P S  L + +   +L+  +P+ + 
Sbjct  133   IADSKPVLAFTIPQLLPKLADS-NLPVVLLGSECGTPNSSKLRIVASIEELMRREPRQSR  191

Query  1339  T-PRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLD  1166
                R+ Q DTA +L+SSGTTG  K V  +H N IAMV+  V RF+  + E       ++ 
Sbjct  192   VKERVHQNDTATLLYSSGTTGASKGVVSSHRNLIAMVQTVVNRFKLDEEE-----QTFIC  246

Query  1165  VLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRK  986
              +PM+H+YGL  F  GL++ GSTVV++ K+E+DE++ AI ++  T+ P+ PP+LVAL   
Sbjct  247   TVPMFHIYGLVAFATGLIASGSTVVILSKFEMDEMLMAIQKFSATYLPLVPPILVALVNH  306

Query  985   AKA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTA  812
             A+    K  L SL  V SG AP+S   I+ F   +P++  +QGYG+TEST VG    +  
Sbjct  307   AEIIRKKYDLSSLHSVLSGGAPLSKEVIEGFSEKYPNVTILQGYGLTESTGVGASTDSLE  366

Query  811   KLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNA  632
             + R Y + GLL+P+MEA++VD      G +L     GELWL+GP IMKGY +N EA+ + 
Sbjct  367   ESRKYGTAGLLSPSMEAKIVD---PESGVALSVNQTGELWLKGPTIMKGYFSNEEATAST  423

Query  631   VDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTS  452
             +D +GWL TGD+ + DEDG+++V DRLKE+IKYKG+Q+ PA+LEA+L++HP+I DAAV  
Sbjct  424   LDSEGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVPPAELEALLLTHPEIADAAVIP  483

Query  451   AQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKI  272
                +EVG+ P+A+VV+K  S  ++S+  V+DF+AKQVAPYK++RRV F  SIPK+ SGKI
Sbjct  484   FPDKEVGQFPMAYVVRKTAS--TISENGVMDFIAKQVAPYKRIRRVAFVASIPKNPSGKI  541

Query  271   LRKELRNLLIT  239
             LRK+L  L ++
Sbjct  542   LRKDLIKLAVS  552



>ref|XP_010689117.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Beta vulgaris subsp. 
vulgaris]
Length=540

 Score =   432 bits (1112),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 237/534 (44%), Positives = 353/534 (66%), Gaps = 22/534 (4%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFILSRN---HGGLSALVDSQSGFSISYPELRSLVNSMA  1655
             GIYRS  PS+  P++P L++VSF+  RN   +    AL+DS SG  +++ +L S+V++++
Sbjct  10    GIYRSLRPSLITPTNPNLNMVSFLF-RNISSYPEKPALIDSDSGEILNFSKLNSMVSNLS  68

Query  1654  AGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVR  1475
              GL ++G+ +G V LIL PNSI +PV FLG+++ GA+A T+NP+ T++EIKKQ  DC  +
Sbjct  69    YGLTQLGIQKGHVVLILAPNSIQYPVTFLGVIATGAIATTVNPIYTVTEIKKQVDDCKPK  128

Query  1474  LAFATP---DRVQNLGSTLGIPVIGLPESLNLDSP-----FRKLISSDPKLAPTPRIRQQ  1319
             L    P   D+V NL   L + ++G   + NL S      F  L++      P   I+Q 
Sbjct  129   LIVTVPELWDKVSNL--NLPVLILGSKGNGNLKSNSKVVYFNDLVNGSAVDFPKVEIKQS  186

Query  1318  DTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVYG  1139
             DTAA+L+SSGTTG  K V LTH NFIA   +    + SQ E     +VYL V+PM+HV+G
Sbjct  187   DTAALLYSSGTTGVSKGVVLTHRNFIAASLMVTSDQESQGE---MDDVYLCVIPMFHVFG  243

Query  1138  LSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCGLK  959
             LS+ +   L  G+TVV + K++ + +++AI+++ VT   + PP+++AL +     K  L 
Sbjct  244   LSVILYSQLQKGNTVVSMSKFDFEMMLKAIEKFRVTKLWIVPPVMLALAKHNAVKKYDLS  303

Query  958   SLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGLL  779
             SLK++ SGAAP+    ++   +  P    IQGYGMTE++ V +        R+  S G+L
Sbjct  304   SLKEIGSGAAPLGKELMKECSKVVPQARIIQGYGMTETSGVISLEHPRLGGRHSGSTGML  363

Query  778   APNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTGD  599
             A  +E++++ + +      LPP  +GE+W+RGP +MKGY NN +A+K+ +D+ GW+HTGD
Sbjct  364   AAGVESQIIKVDTLKP---LPPKQLGEIWVRGPNMMKGYFNNQQATKSTIDNQGWVHTGD  420

Query  598   IVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIPV  419
             + +FDE+G LYV DRLKE+IKYKGFQ+APA+LEAVL+SHP+I+DAAV     +E GE+PV
Sbjct  421   LGYFDEEGQLYVVDRLKELIKYKGFQVAPAELEAVLISHPEILDAAVIPFPDDEAGEVPV  480

Query  418   AFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             A+VV    S  S+ + +V  FVA QVAP+K++R+V F  +IPKSA+GK+LR+EL
Sbjct  481   AYVVSSPKS--SVKEEDVKKFVADQVAPFKRLRKVIFINAIPKSAAGKLLRREL  532



>gb|AGW27194.1| 4-coumarate:coenzyme A ligase 4 [Salvia miltiorrhiza]
Length=552

 Score =   433 bits (1113),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 238/548 (43%), Positives = 354/548 (65%), Gaps = 21/548 (4%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F S+ +  Y  + P + LP++  LDV +FI SR H G  A +D+ SG S+++ EL  
Sbjct  14    RSGFCSANSTFYSKRKP-IPLPANQSLDVTTFISSRAHHGEVAFIDAASGRSLTFAELWR  72

Query  1672  LVNSMAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQ  1496
              V++++  L    G+ +G V L+L PNSIYFP++ L ++S+GA+  T NPL+T  EI KQ
Sbjct  73    AVDAVSTSLSSDFGIRKGHVILLLTPNSIYFPIVCLAVMSLGAIITTTNPLNTAREIAKQ  132

Query  1495  SFDCNVRLAFATPDRVQNLGSTLGIPVI----GLPES--LNLDSPFRKLISSDPKLAPT-  1337
               D    LAF  P  +  L  +  +P++    G P S  L + +   +++  +P  +   
Sbjct  133   IADSKPSLAFTVPQLLPKLADS-NLPIVLLGGGAPSSSKLRIITTIEEMMRREPSASRVR  191

Query  1336  PRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLP  1157
              R+ Q DTA +L+SSGTTG  K V  +H N IAMV+  V    S+++       ++  +P
Sbjct  192   ERVNQDDTATLLYSSGTTGASKGVVSSHKNLIAMVQTVV----SRFKLEDGKQTFICTVP  247

Query  1156  MYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKA  977
             M+H+YGL  F  GL++ GSTVV++ K+E+DE++ AI ++  T+ P+ PP+LVAL   A +
Sbjct  248   MFHIYGLVAFATGLIASGSTVVILSKFEMDEMLMAIQKFSATYLPLVPPILVALMNHADS  307

Query  976   --DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLR  803
                K  L SL  V SG AP+S   I+ F   +P +  +QGYG+TEST +G    +  +  
Sbjct  308   IKRKYDLSSLHTVLSGGAPLSKEVIEGFTDKYPGVGVLQGYGLTESTGIGASTDSQEESS  367

Query  802   NYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDD  623
              Y + GLL+P+MEA++V+      G+ LP    GELWLRGP+IMKGY +N EA+ + +D 
Sbjct  368   RYGTAGLLSPSMEAKIVN---PETGAPLPVNRTGELWLRGPSIMKGYFSNEEATASTLDS  424

Query  622   DGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQS  443
              GWL TGD+ + DEDG+++V DRLKE+IKYKG+Q+ PA+LEA+L++HP I D+AV     
Sbjct  425   QGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVPPAELEALLLTHPQIDDSAVIPFPD  484

Query  442   EEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRK  263
             +E G+IP+A+VV+KKGS ++ SQ  V+DF+A+QVAPYK++RRV F  S+PK+ SGKILRK
Sbjct  485   KEAGQIPMAYVVRKKGSTITESQ--VMDFIAQQVAPYKRIRRVAFVASVPKNPSGKILRK  542

Query  262   ELRNLLIT  239
             +L  L ++
Sbjct  543   DLIKLAVS  550



>gb|KHG05050.1| 4-coumarate--CoA ligase-like 5 [Gossypium arboreum]
Length=549

 Score =   432 bits (1111),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 242/553 (44%), Positives = 359/553 (65%), Gaps = 27/553 (5%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F+ S +  Y  + P + LP +  LDV +FI +R H G  A +D+ +G  +++ EL  
Sbjct  12    RSGFFRSNSTFYSKRKP-IPLPKNDSLDVTTFISARAHHGKVAFIDAATGRHLTFSELWR  70

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V+S+A  L  MG+ +G V L+L PNSI+FP++ L ++S+GA+  T NPL+T +EI KQ 
Sbjct  71    AVDSVATCLSDMGIRKGHVVLLLSPNSIFFPIVCLSVMSLGAIITTTNPLNTANEIGKQV  130

Query  1492  FDCNVRLAFATPDRVQNL-GSTLGIPVIGLPESLNLDSPFRKLISSDPKL---APT-PRI  1328
              D    LAF  P  +  L GST  IP++ L + ++  +   K++++  ++    P+  R+
Sbjct  131   ADSKPVLAFTIPQLLPKLAGST--IPIVLLEDHVSSQAGEAKIVTTLHQMMKREPSGSRV  188

Query  1327  RQQ----DTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLDV  1163
             R Q    DTA +L+SSGTTG  K V  +H N IAMV+  + RF     E       ++  
Sbjct  189   RDQVNQDDTATLLYSSGTTGASKGVVSSHRNLIAMVQTVINRFSIEVGEK------FICT  242

Query  1162  LPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKA  983
             +PM+H+YGL  F  GLL+ GSTV+V+ K+E+ +++  I++Y  T+ P+ PP+LVA+   A
Sbjct  243   VPMFHIYGLVAFATGLLASGSTVIVLSKFEMHDMLSTIEKYRATYLPLVPPILVAMVNAA  302

Query  982   KA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAK  809
                  K  L SL    SG AP+S   I+ F+  +P++  +QGYG+TEST +G    +  +
Sbjct  303   DQIRKKYDLSSLHSALSGGAPLSKEVIEGFLEKYPNVKILQGYGLTESTGIGASTDSLEE  362

Query  808   LRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAV  629
              R Y + G+L+P+MEA+VVD      G +L     GELWLRGP++MKGY +N EA+ + +
Sbjct  363   SRKYGTAGMLSPSMEAKVVD---PDSGKALNVNQTGELWLRGPSVMKGYFSNPEATTSTL  419

Query  628   DDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSA  449
             D DGWL TGD+ + DEDG++++ DRLKE+IK+KG+Q+ PA+LEA+L+SHPDI+DAAV   
Sbjct  420   DSDGWLRTGDLCYIDEDGFIFIVDRLKELIKFKGYQVPPAELEALLLSHPDILDAAVIPF  479

Query  448   QSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKIL  269
                EVG+ P+A+VV+K GS  +LS+  V+DFV +QVAPYK++R+V F  SIPK+ SGKIL
Sbjct  480   PDREVGQFPMAYVVRKPGS--NLSETGVMDFVGRQVAPYKRIRKVAFVASIPKNPSGKIL  537

Query  268   RKELRNLLITSKI  230
             RK+L   L TSK+
Sbjct  538   RKDLIK-LATSKL  549



>emb|CDP07314.1| unnamed protein product [Coffea canephora]
Length=554

 Score =   431 bits (1109),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 241/555 (43%), Positives = 346/555 (62%), Gaps = 30/555 (5%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  + +  Y  + P +  P++  LD+ +FI SR H G  A +D+ +G  +++P+   
Sbjct  5     RSGFCKANSTFYSKRKP-IPFPANHALDLTTFISSRPHHGKVAFIDATTGGQLTFPDFWK  63

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V S++  L  MG+ +G V L+L PNSI+FPV+ L ++S+GAV  T NPL+T  EI K  
Sbjct  64    AVESVSTCLSEMGIRKGHVVLLLSPNSIFFPVVSLSVISLGAVITTTNPLNTAREIAKHI  123

Query  1492  FDCNVRLAFATPDRVQNLGST-----LGIPVIG-----LPESLNLDSPFRKLISSDPKL-  1346
              D    LAF  P  +  L        L + ++G      P   N  +    +I S  ++ 
Sbjct  124   SDTKPALAFTVPQLLPKLADASNDNHLKVVLVGERERETPCENNFSTSSCTVIGSLEEMM  183

Query  1345  ---APTPRIRQQ----DTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPA  1187
                A   R++ +    DTA +L+SSGTTG  K VA +H NFIA++E  VR    ++   A
Sbjct  184   KREASQARVKDRVTLDDTATLLYSSGTTGVSKGVASSHKNFIALIETLVR----RFGTNA  239

Query  1186  TANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPL  1007
                +Y+  +PM+H+YGL+ F MG L++GSTVVV+ K++++E++ A+ +Y  T+ P+ PP+
Sbjct  240   QEEIYIATVPMFHIYGLAAFTMGHLAMGSTVVVLSKFDLEEMLWAVQKYRATYLPLVPPI  299

Query  1006  LVALTRKAKADK--CGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVG  833
             LV +  KA   K    L SL+ V  G AP+S   I+ FV  FP +  +QGY +TEST  G
Sbjct  300   LVGIVNKADEIKKTYDLSSLRTVLCGGAPLSKEMIEGFVDKFPKVTIMQGYALTESTGGG  359

Query  832   TRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNN  653
                    + R Y + GLL+P++E R+VD      G +LP    GELWLRGP IMKGY NN
Sbjct  360   ASTDTMEESRRYGTAGLLSPSVEGRIVD---SDSGRALPVNRTGELWLRGPTIMKGYFNN  416

Query  652   GEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDI  473
              EA+ + +  DGWL TGD+ + DEDG+L++ DRLKE+IKYKG+Q+APA+LEA+L+ HP++
Sbjct  417   EEATASTLYSDGWLRTGDLCYIDEDGFLFIVDRLKELIKYKGYQVAPAELEALLLCHPEV  476

Query  472   VDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIP  293
              DAAV     EEVG+ P+A+VV+K GS  ++S   VIDF+AKQVAPYK++RRV F  SIP
Sbjct  477   ADAAVIPFPDEEVGQFPMAYVVRKAGS--TISGVAVIDFIAKQVAPYKRIRRVAFIASIP  534

Query  292   KSASGKILRKELRNL  248
             K+ SGKILRK+L  L
Sbjct  535   KNPSGKILRKDLIQL  549



>ref|XP_008808867.1| PREDICTED: 4-coumarate--CoA ligase-like 1 [Phoenix dactylifera]
Length=544

 Score =   431 bits (1108),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 240/536 (45%), Positives = 347/536 (65%), Gaps = 23/536 (4%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFILSRNHG--GLSALVDSQSGFSISYPELRSLVNSMAA  1652
             G++RS  P +  PSDP L +V F+  R        AL D+ SG S+++ +LRS V+S A 
Sbjct  11    GVHRSLRPPIAFPSDPDLSMVPFLFRRTAAFPDRLALADADSGRSLTFLQLRSAVSSTAV  70

Query  1651  GLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRL  1472
             GL  +G+S+GDV LI  PNS++FPV FL +LS+GA+A T+NPL T++E+ KQ+ D N +L
Sbjct  71    GLASLGISKGDVVLIFSPNSLHFPVCFLAVLSLGAIATTVNPLYTVAELSKQAKDSNPKL  130

Query  1471  AFATPDRVQNLGSTLGIPVIGL-----PESLNLDSP---FRKLIS--SDPKLAPTPRIRQ  1322
                 P+    + + LG+P + L     P S +   P   F +LI+  ++P  AP P +RQ
Sbjct  131   VITVPELWHKV-APLGLPAVILGPKDSPLSPSTHLPITYFSELIAGHTNPDFAPPP-VRQ  188

Query  1321  QDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVY  1142
              D AA+L+SSGT+G  K V LTH NFI    +    +    E PAT   +L  LPM+H++
Sbjct  189   TDVAALLYSSGTSGASKGVILTHRNFICTALMVTADQEQNGEPPAT---FLCFLPMFHIF  245

Query  1141  GLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCGL  962
             GLS+     L+ G+TVV + K++ + V+R+I++Y V+H    PP+++AL ++ K  K  L
Sbjct  246   GLSVITYAQLTRGNTVVSMGKFDFEMVLRSIEKYRVSHLFCVPPVMIALAKQGKMGKFDL  305

Query  961   KSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFN-TAKLRNYTSVG  785
              SL+ + SGAAP+    +    + FP  + IQGYGMTE+  + +R F   A+ R + S G
Sbjct  306   SSLRFICSGAAPLGKDVMTEVSKNFPDREVIQGYGMTETCGIISREFPLKAEARQFGSTG  365

Query  784   LLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHT  605
             +L P +E +VV + +      LPP  +GEL  RGP IM+GYLNN +A+K  +D+ GWLHT
Sbjct  366   MLVPGVEGKVVSVDTLKS---LPPNQLGELCFRGPNIMQGYLNNPQATKLTLDEQGWLHT  422

Query  604   GDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEI  425
             GDI + DE G +YV DR+KE+IKYKG Q+APA+LE +L+SH +I+DAAV      E GE+
Sbjct  423   GDIGYIDEKGQVYVVDRIKELIKYKGLQVAPAELEGLLLSHSEILDAAVIPFPDAEAGEV  482

Query  424   PVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             P+AFVV+   S  SL++ +V  F+A+QVAP+K++RRV F  S+PKSASGKILR+ L
Sbjct  483   PIAFVVRSPNS--SLTEEDVQKFIAEQVAPFKRLRRVTFVNSVPKSASGKILRRVL  536



>ref|XP_004499325.1| PREDICTED: 4-coumarate--CoA ligase-like 5-like [Cicer arietinum]
Length=539

 Score =   430 bits (1105),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 237/546 (43%), Positives = 353/546 (65%), Gaps = 15/546 (3%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             +S F SS + I+ SK   + LP   ++D  +FI SR+H G  AL+D+ +G   +Y +L S
Sbjct  4     KSGFCSSNS-IFYSKRKPLPLPPSHYIDATTFISSRSHHGRVALIDASTGRQFTYQQLWS  62

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V ++ + L  MG+ +GDV LIL PNSIYFPV+ L ++S+GA+  T NPL+T  EI KQ 
Sbjct  63    AVEAVTSSLSNMGIRKGDVILILSPNSIYFPVVCLAVMSLGAIITTTNPLNTTREIAKQI  122

Query  1492  FDCNVRLAFAT-PDRVQNLGSTLGIPVIGLPESLNLDSPFRKLISSDPKLAPT-PRIRQQ  1319
              D    LAF T P   +  G++  + +I +    +  +   +++  +P+L+    R+ Q 
Sbjct  123   ADSKPVLAFTTSPLAPKIRGASPTLAIILMESEGDSSNTLEEMMKKEPELSRVRERVNQD  182

Query  1318  DTAAVLFSSGTTGGCKAVALTHANFIAMVEL-FVRFEASQYEYPATANVYLDVLPMYHVY  1142
             DTA +L+SSGTTG  K V  +H N IAMV++   RF   Q E   T   ++  +PM+H+Y
Sbjct  183   DTATLLYSSGTTGPSKGVVSSHKNLIAMVQIVLARFGKEQEERGQT---FICTVPMFHIY  239

Query  1141  GLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKA--DKC  968
             GL++F  GLLSLGST+VV+ K+E+ +++ +I+++  +  P+ PP+LVA+   A A   K 
Sbjct  240   GLAVFATGLLSLGSTIVVLSKFEMHDMLSSIEKFRASILPLVPPILVAMLNNADAIKSKY  299

Query  967   GLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSV  788
              L SL  V SG AP+S    + FV  +P++  +QGYG+TES+ VG    +  + R Y + 
Sbjct  300   DLSSLHTVLSGGAPLSKEVTEGFVEKYPNVAILQGYGLTESSGVGASTDSLEESRKYGTA  359

Query  787   GLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLH  608
             GLL+ + EA +VD         LP    GELWLRGP IMKGY +N EA+ + +  DGWL 
Sbjct  360   GLLSSSTEAMIVD---TETAKPLPVNRTGELWLRGPTIMKGYFSNEEATTSTLTSDGWLK  416

Query  607   TGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGE  428
             TGD+ + D DG++++ DRLKE+IKYKG+Q+ PA+LEA+L++HP I+DAAV     +E G+
Sbjct  417   TGDVCYIDSDGFVFIVDRLKELIKYKGYQVPPAELEALLLTHPAILDAAVIPYPHKEAGQ  476

Query  427   IPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNL  248
             IP+A+VV+K  +E ++++  V+DF+A QVA YK++R+V F  SIPK+ SGKILRK+L   
Sbjct  477   IPMAYVVRK--AESNIAEKQVMDFIAGQVASYKRIRKVAFISSIPKNPSGKILRKDLVK-  533

Query  247   LITSKI  230
             L TSK+
Sbjct  534   LATSKL  539



>ref|XP_010229245.1| PREDICTED: 4-coumarate--CoA ligase-like 4 [Brachypodium distachyon]
Length=551

 Score =   430 bits (1106),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 252/553 (46%), Positives = 347/553 (63%), Gaps = 30/553 (5%)
 Frame = -2

Query  1840  YSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVNS  1661
             Y + TG +RSK  +V LP D  +DVV+F+ SR H G+ AL+D+ +G   ++ EL   V  
Sbjct  13    YCAATGSFRSKRAAVPLPVDRDVDVVTFLASRRHSGVVALIDAATGRRTTFGELWRAVAG  72

Query  1660  MAAGLHRMGVS--QGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFD  1487
              A  L     S  +G VALIL PNS++FPV  L  +S+GAV  T NPL+T +EI KQ  D
Sbjct  73    AATALASAPFSLRKGHVALILSPNSVHFPVAALAAMSLGAVVTTANPLNTAAEIAKQVAD  132

Query  1486  CNVRLAFAT-----------PDRVQNLGSTLGIPVIGLPESLNLDSPFRKLISS--DPKL  1346
                 LAF T           P RV  L S  G P   LP    + +   ++ ++  DP  
Sbjct  133   ARPVLAFTTRELLPKLPRDHPLRVVLLESAAGDP---LPADPRIAATIEEISATPPDPAR  189

Query  1345  APTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVEL-FVRFEASQYEYPATANVYL  1169
                 R+ Q D A +L+SSGTTG  K V  TH N I+MV++   RF   + +   +   +L
Sbjct  190   RRGDRVTQDDQATLLYSSGTTGPSKGVVSTHRNLISMVQIVMTRFRLEESD---STETFL  246

Query  1168  DVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTR  989
               +PM+HVYGL  F  GLL  G+T+VV+ K+E+ E++R I+ YGVT+ P+ PP+LVA+  
Sbjct  247   CTVPMFHVYGLVAFATGLLGCGATIVVLSKFELPEMLRCINAYGVTYLPLVPPILVAMVA  306

Query  988   KAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAK  809
               K    G   L++V SG AP+S   I+ F   +P ++ +QGYG+TESTA+G    +  +
Sbjct  307   HPKPLPLG--QLRKVLSGGAPLSKELIEGFKEKYPQVEILQGYGLTESTAIGASTDSAEE  364

Query  808   LRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAV  629
              R Y + GLL+PN EA++VD        +LP    GELW++GP +MKGY  N EA+K  V
Sbjct  365   SRQYGTAGLLSPNTEAKIVD---PETAEALPVNRTGELWIKGPYVMKGYFKNTEATKATV  421

Query  628   DDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSA  449
               +GWL TGD+ + DEDGYL+V DRLKE+IKYKG+Q+ PA+LEA+L++HP+I DAAV   
Sbjct  422   TPEGWLKTGDLCYIDEDGYLFVVDRLKELIKYKGYQVPPAELEALLLTHPEITDAAVIPF  481

Query  448   QSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKIL  269
               +EVG+ P+A++V+K GS  +LS   V++FVAKQVAPYKKVR+V F   IPK+ASGKIL
Sbjct  482   PDKEVGQFPMAYIVRKNGS--NLSAHEVMEFVAKQVAPYKKVRKVAFVTDIPKNASGKIL  539

Query  268   RKELRNLLITSKI  230
             RK+L   L TSK+
Sbjct  540   RKDLIK-LATSKL  551



>gb|EAY79647.1| hypothetical protein OsI_34791 [Oryza sativa Indica Group]
Length=445

 Score =   426 bits (1096),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 247/451 (55%), Positives = 309/451 (69%), Gaps = 31/451 (7%)
 Frame = -2

Query  1534  MNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPFR------  1373
             MNP S  +EI  +  D    L  A+      L   L  P++ +P++              
Sbjct  1     MNPSSAPAEIAARLRDTAPSLVLASTHNAAKL-PPLAAPLVLVPDTFQQQHDDDQFDFFF  59

Query  1372  -KLISSDPKLAPTP-----RIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFE  1211
               L+ +DP+   TP      + Q D AAVL+SSGT+G  K V +TH N IAMVELFVRFE
Sbjct  60    HALLETDPE---TPVEMGVGVGQDDAAAVLYSSGTSGRSKGVVVTHRNLIAMVELFVRFE  116

Query  1210  ASQYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVT  1031
             ASQY  PA  NVYL  LPM+HVYGLSLF +GLLSLG TVVV+R++ VD+ V+AI +Y VT
Sbjct  117   ASQYTRPARDNVYLAALPMFHVYGLSLFAVGLLSLGCTVVVMRRFNVDDAVKAIRKYKVT  176

Query  1030  HFPVAPPLLVALTRKAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMT  851
             H P+ PP++ AL R        L SL QVSSGAAP++ T I +F+  FP++DFIQGYGMT
Sbjct  177   HLPLVPPIMSALLRANP--PLELDSLLQVSSGAAPLNHTLIHHFLHAFPNVDFIQGYGMT  234

Query  850   ESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIM  671
             ESTAVGTRGFNT K + Y SVGLLAPNM A++V L     GS LPP S GELWL GPAIM
Sbjct  235   ESTAVGTRGFNTCKHKKYASVGLLAPNMHAKIVHL---ESGSCLPPGSYGELWLHGPAIM  291

Query  670   K------GYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPA  509
             K      GYLN+ + +      DGWL TGDI +FD DGYL++  RLK+ IKYKGFQIAPA
Sbjct  292   KEFCFVTGYLNDDDDAFT--RKDGWLRTGDIAYFDSDGYLFIVGRLKDTIKYKGFQIAPA  349

Query  508   DLEAVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYK  329
             DLEAVL+ HP+IVD AVTS + EE GEIPVAFVV+K GS  +LS  +V+++VAKQVA YK
Sbjct  350   DLEAVLIRHPEIVDVAVTSDEDEEAGEIPVAFVVRKSGS--TLSCTHVMEYVAKQVASYK  407

Query  328   KVRRVYFTKSIPKSASGKILRKELRNLLITS  236
             +VR+V F ++IPKSA+GK+LR+ L++ L+ +
Sbjct  408   RVRKVIFVEAIPKSAAGKVLRRLLKDSLVDA  438



>ref|XP_006473755.1| PREDICTED: 4-coumarate--CoA ligase-like 5-like [Citrus sinensis]
 gb|KDO85040.1| hypothetical protein CISIN_1g008946mg [Citrus sinensis]
Length=548

 Score =   430 bits (1105),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 245/553 (44%), Positives = 356/553 (64%), Gaps = 26/553 (5%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  S + I+ SK   V LP +  LDV +FI SR H G +A +D+ +G  +++ EL  
Sbjct  10    RSGFCKSNS-IFYSKRKPVSLPPNESLDVTTFISSRAHHGRTAFIDAATGRHLTFSELWR  68

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V+S++  L  MG+ +G V L+L PNSI+FPV+ L ++S+GA+  T NPL+T  EI KQ 
Sbjct  69    AVDSVSTCLSDMGIRKGHVILLLSPNSIFFPVVCLAVMSLGAIITTTNPLNTKQEIAKQI  128

Query  1492  FDCNVRLAFATPDRVQNL-GSTLGIPVIGLPESLNLDSPFRKLISSDPKL---APT----  1337
              D    LAF     V  L GSTL  P++ L +     +   K +++ P++    P+    
Sbjct  129   ADSKPVLAFTISQLVPKLAGSTL--PIVLLDDEKTTSTEGIKTVTTLPQMMRKEPSGTLV  186

Query  1336  -PRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLDV  1163
               RI Q D A +L+SSGTTG  K V  +H N IAMV+  + RF+    E       ++  
Sbjct  187   RDRINQDDVATLLYSSGTTGASKGVVSSHRNLIAMVQTVLGRFKLEDGE-----QTFICT  241

Query  1162  LPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKA  983
             +PM+H+YGL+ F  GLL+ GST+VV+ K+++ E++ +I +Y  T+ P+ PP+LVAL   A
Sbjct  242   VPMFHIYGLAAFATGLLASGSTIVVLSKFDMHEMLSSISKYRATYLPLVPPILVALISGA  301

Query  982   KA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAK  809
                  K  L SL+ V SG AP+S   I+ FV+ +P +  +QGYG+TEST +G    +  +
Sbjct  302   DQIRSKYDLSSLQSVLSGGAPLSREVIEGFVQKYPKVRILQGYGLTESTGIGASTDSLEE  361

Query  808   LRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAV  629
              R Y + G+L+P+MEA++VD      G +L     GELWL+GP+IMKGY +N EA+ + +
Sbjct  362   SRKYGTAGMLSPSMEAKIVD---PDSGKALLVNQTGELWLKGPSIMKGYFSNPEATTSTL  418

Query  628   DDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSA  449
             D +GWL TGD+ + D+DG++++ DRLKE+IKYKG+Q+ PA+LEA+L++HP I DAAV   
Sbjct  419   DSEGWLRTGDLCYIDDDGFIFIVDRLKELIKYKGYQVPPAELEALLLTHPKISDAAVVPF  478

Query  448   QSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKIL  269
               +E G+ P+A+VV++ GS   LS+  V+DFVA+QVAPYK+VRRV F  SIPK+ SGKIL
Sbjct  479   PDKEAGQYPMAYVVREAGSR--LSENEVMDFVARQVAPYKRVRRVAFVASIPKNPSGKIL  536

Query  268   RKELRNLLITSKI  230
             RK+L   L TSK+
Sbjct  537   RKDLIK-LATSKL  548



>ref|XP_010943943.1| PREDICTED: 4-coumarate--CoA ligase-like 4 [Elaeis guineensis]
Length=552

 Score =   430 bits (1106),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 247/546 (45%), Positives = 344/546 (63%), Gaps = 18/546 (3%)
 Frame = -2

Query  1840  YSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVNS  1661
             +     I+ SK   V LPSDP LDV +F+ SR H G +AL+D+ SG  +S+P L   V++
Sbjct  16    FCPSNSIFYSKRKPVPLPSDPHLDVTTFLSSRRHSGTTALIDAASGRRVSFPTLWRSVSA  75

Query  1660  MAAGLH-RMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             +A+ L  R+ V +G V L+L PNSI+FPV+ L ++S+GAV  T NPL+T  EI KQ  D 
Sbjct  76    LASALSSRLSVRKGQVVLLLSPNSIHFPVVSLAVMSLGAVLTTTNPLNTPQEIAKQISDS  135

Query  1483  NVRLAFATPDRVQNLGSTLGIPVIGLPESL--NLDSPFRKLISSDPKLAPTPRIR-----  1325
             +  LAFAT   V  L      P++ L +      D   R  I     + P  R R     
Sbjct  136   DPILAFATRPFVGKLPRDRDFPIVLLEDCRISGDDGRIRYTIEELTAMEPDLRRRRELVS  195

Query  1324  QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHV  1145
             Q DTA +L+SSGTTG  K V  TH N I+MV++ +       E       ++  +PM+H+
Sbjct  196   QDDTATLLYSSGTTGTSKGVVATHRNMISMVQMILN-RLKLEEGGGALETFICTVPMFHI  254

Query  1144  YGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCG  965
             YGL+ F  GLL  GSTVV++ ++E+ E++R+I  YG T+ P+ PP+LVA+  +A     G
Sbjct  255   YGLAAFATGLLGAGSTVVILSRFELGEMIRSIGEYGATYLPLVPPILVAMLNQAAPLPLG  314

Query  964   LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVG  785
                L++V SG AP+    I+ F   +P ++ +Q YG+TEST +G    +  + R Y + G
Sbjct  315   --RLRRVLSGGAPLGREVIEGFREKYPAVEILQSYGLTESTGMGASTDSAEESRRYGTAG  372

Query  784   LLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDD-DGWLH  608
             LL+PN EAR+VD      G SLP    GELW+RGP +MKGY  N EA+   +D  +GWL 
Sbjct  373   LLSPNTEARIVD---PDTGMSLPVNRTGELWIRGPFVMKGYFKNPEATSTMLDSKEGWLR  429

Query  607   TGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGE  428
             TGD+ + DEDGYL+V DRLKE+IKYKG+Q+APA+LEA+L++HP I DAAV     +EVG+
Sbjct  430   TGDLCYIDEDGYLFVVDRLKELIKYKGYQVAPAELEALLLTHPAITDAAVIPFPDKEVGQ  489

Query  427   IPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNL  248
              P+A+VV+K G    LS+  V++FVAKQVAPYK++R+V F  +IPK+ SGKILRK+L   
Sbjct  490   YPMAYVVRKAGRH--LSKTGVMEFVAKQVAPYKRIRKVAFVSAIPKNPSGKILRKDLIK-  546

Query  247   LITSKI  230
             L TSK+
Sbjct  547   LATSKL  552



>ref|XP_010539806.1| PREDICTED: 4-coumarate--CoA ligase-like 5 isoform X1 [Tarenaya 
hassleriana]
Length=549

 Score =   430 bits (1105),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 240/554 (43%), Positives = 357/554 (64%), Gaps = 24/554 (4%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  S +  Y SK P V LP++P LD+ +FI S+ H G  A +D+ +G ++S+ EL  
Sbjct  7     RSGFCKSNSTFY-SKRPPVSLPANPSLDIKTFISSQAHRGKIAFIDAVTGKNLSFSELWR  65

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V+S+A+ L  MG+ +G V L+L PNSI+FPV+ L ++S+GA+  T NPL+T  EI KQ 
Sbjct  66    SVDSVASCLSDMGIRKGHVVLLLSPNSIFFPVVCLAVMSLGAIITTTNPLNTSGEISKQI  125

Query  1492  FDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPFRKLISS------DPKLAPTPR  1331
              D    LAF T   +  + + L  P++ + E   +DS     I+       + K     R
Sbjct  126   SDSKPVLAFTTAGLLPKIAADL--PMVLMDEEERVDSTCGARIAGILVEMMEKKRPSESR  183

Query  1330  IR----QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLD  1166
             +R    Q DTA +L+SSGTTG  K V  +H N I+MV+  V RF +   +     + ++ 
Sbjct  184   VRERVDQDDTATLLYSSGTTGASKGVVSSHKNLISMVQTVVNRFRSENGD--QGEHRFIC  241

Query  1165  VLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRK  986
              +PM+H+YGL+ F  GLL+ GST++++ K+++ E++ AI +Y  ++ P+ PP+LVA+   
Sbjct  242   TVPMFHIYGLAAFATGLLACGSTIIILSKFDMHEMMSAIGQYRASYLPLVPPILVAMVNG  301

Query  985   AKA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTA  812
             A     K  L SL+ +  G AP+S   I+ FV  +P++  +QGYG+TEST +G       
Sbjct  302   ADQIKRKYDLSSLQSILCGGAPLSKEVIEGFVEKYPNVRILQGYGLTESTGMGASTDTLE  361

Query  811   KLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNA  632
             + R Y + GLL+P+ME ++VD      G +L     GELWL+GPAIMKGY +N EA+ + 
Sbjct  362   ESRRYGTAGLLSPSMEGKIVD---PDSGRALGLNQTGELWLKGPAIMKGYFSNEEATSST  418

Query  631   VDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTS  452
             +D +GWL TGD+ +FDEDG+++V DRLKE+IKYKG+Q+ PA+LEA+L+ H +IVDAAV  
Sbjct  419   LDSEGWLRTGDLCYFDEDGFIFVVDRLKELIKYKGYQVPPAELEALLLVHQEIVDAAVIP  478

Query  451   AQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKI  272
                 E G+ P+A++V+K GS+  LS+ +V+DFV++QVAPYK++R+V F  SIPK+ SGKI
Sbjct  479   FPDREAGQFPMAYIVRKPGSK--LSEKSVMDFVSEQVAPYKRIRKVAFVASIPKNPSGKI  536

Query  271   LRKELRNLLITSKI  230
             LRK+L   L TSK+
Sbjct  537   LRKDLIK-LATSKL  549



>ref|XP_007160602.1| hypothetical protein PHAVU_001G001300g [Phaseolus vulgaris]
 gb|ESW32596.1| hypothetical protein PHAVU_001G001300g [Phaseolus vulgaris]
Length=547

 Score =   430 bits (1105),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 247/555 (45%), Positives = 350/555 (63%), Gaps = 29/555 (5%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDP--FLDVVSFILSRNHGGLSALVDSQSGFSISYPEL  1679
             RS F  S +  Y  + P   LP  P   LDV +FI SR H G +A +D+ +G  +SY +L
Sbjct  8     RSGFCPSNSVFYSKRKP---LPLSPNNALDVTTFISSRAHRGTTAFIDAATGRHLSYSQL  64

Query  1678  RSLVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKK  1499
                V  +A  L  MG+ +G+V L+L PNSI FPV+ L ++S+GAV  T NPL+T  EI K
Sbjct  65    WRAVEGVAGSLWDMGIRKGNVVLLLSPNSIDFPVVCLAIMSLGAVITTTNPLNTTQEIAK  124

Query  1498  QSFDCNVRLAFATPDRVQNLGSTL-GIPVIGLPESLNLDSPFRKLISSDPKLAPTP----  1334
             Q  D    LAF TP  +  L      +P+I +  + +   P  K++++  ++A       
Sbjct  125   QIADSKPLLAFTTPLLLPKLTKAAPSLPIILMDTTAHPPLPHPKIVATLHEMAKKEPRAE  184

Query  1333  ----RIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYL  1169
                 R+ Q DTA +L+SSGTTG  K V  +H N IAMV++ + RF     E       ++
Sbjct  185   RVRERVEQDDTATLLYSSGTTGPSKGVLSSHRNLIAMVQIVLGRFHVEDNE------TFI  238

Query  1168  DVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTR  989
               +PM+H+YGL  F  GLL+ GST+VV+ K+E+ +++ +I R+  T+ P+ PP+LVA+  
Sbjct  239   CTVPMFHIYGLVAFATGLLASGSTIVVLSKFEMHDMLSSIQRFRATYLPLVPPILVAMLN  298

Query  988   KAKA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNT  815
              A A   K  ++SL  V SG AP+S   I+ FV  +P++  +QGYG+TEST VG    + 
Sbjct  299   NADAIKGKYDIRSLHSVLSGGAPLSKEVIEGFVDKYPNVTILQGYGLTESTGVGASTDSL  358

Query  814   AKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKN  635
              + R Y + GLL+P  +A +VD      G SLP  S GELWLRGP IMKGY NN EA+ +
Sbjct  359   EESRRYGTAGLLSPATQAMIVD---PDSGRSLPVNSTGELWLRGPTIMKGYFNNEEATTS  415

Query  634   AVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVT  455
              +D  GWL TGD+ + D DG++++ DRLKE+IKYKG+Q+ PA+LEA+L++HP I DAAV 
Sbjct  416   TLDSKGWLRTGDVCYIDNDGFIFIVDRLKELIKYKGYQVPPAELEALLLTHPAISDAAVI  475

Query  454   SAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGK  275
                 +EVG+ P+A+VV+K GS  SLS++ V+DFVA QVAPYK++R+V F  S+PK+ SGK
Sbjct  476   PYPDKEVGQFPMAYVVRKDGS--SLSESQVMDFVAGQVAPYKRIRKVAFISSVPKNPSGK  533

Query  274   ILRKELRNLLITSKI  230
             ILRK+L   L TSK+
Sbjct  534   ILRKDLIK-LATSKL  547



>ref|XP_011034909.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Populus euphratica]
Length=554

 Score =   430 bits (1105),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 232/544 (43%), Positives = 349/544 (64%), Gaps = 24/544 (4%)
 Frame = -2

Query  1822  IYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVNSMAAGLH  1643
             ++ SK   + LP   FLD  +FI SR H G +A +D+ +G  +S+ +L   V+S+A+ L 
Sbjct  22    VFYSKRKPITLPQTDFLDTTTFIFSRPHHGKTAFIDAATGRQLSFKDLWRAVDSVASCLQ  81

Query  1642  RMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRLAFA  1463
              MG+ +G V L+L PNSI+FP++ L ++ +GA+  T NPL+T  EI KQ  +    LAF 
Sbjct  82    DMGIRKGQVILLLSPNSIFFPIVCLSVMWLGAIITTTNPLNTPREIAKQIANSKPSLAFT  141

Query  1462  TPDRVQNLG-STLGIPVI--------GLPESLNLDSPFRKLISSDPKLAPT-PRIRQQDT  1313
             TP+ V  L  S+  +P++         +    N+ +   +++  +P+ +    R+ Q D 
Sbjct  142   TPELVSKLTESSSNLPIVLIDDETGTSIKTKANILTTLSEMVKREPRESRVRERVNQDDP  201

Query  1312  AAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLDVLPMYHVYGL  1136
             A +L+SSGTTG  K V  +H N IAMV+  V RF  ++  +      ++  +PM+H+YGL
Sbjct  202   ATLLYSSGTTGESKGVVSSHKNLIAMVQTIVERFRLNEGRH-----TFVCTVPMFHIYGL  256

Query  1135  SLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKC--GL  962
             + F  G+L+ GST++V+ K+E+ E++  I++Y  T+ P+ PP+LVA+   A   K    L
Sbjct  257   AAFATGILASGSTIIVLSKFEMGEMLSTIEKYRATYLPLVPPILVAMINGADQIKMKYDL  316

Query  961   KSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGL  782
              SL+ V SG AP+S   I+ F   +P I  +QGYG+TESTA+G       + R Y + GL
Sbjct  317   SSLQSVLSGGAPLSKEVIEGFSNKYPGITILQGYGLTESTAIGASTDTLEESRRYGTAGL  376

Query  781   LAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTG  602
             L+PN EA++VD      G +LP    GELWLR P++MKGY  N EA+ + +D +GWL TG
Sbjct  377   LSPNTEAKIVD---PESGKALPVNQTGELWLRAPSVMKGYFGNAEATSSTIDSEGWLRTG  433

Query  601   DIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIP  422
             D+ + D+DG+++V DRLKE+IKYKG+Q+ PA+LEA+L++HP+I DAAV     ++VG+ P
Sbjct  434   DLCYIDDDGFIFVVDRLKELIKYKGYQVPPAELEALLLAHPEISDAAVIPFPDKDVGQFP  493

Query  421   VAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNLLI  242
             +A+VV+K GS  +LS+  V DF+A QVAPYK++RRV F  +IPK+ SGKILRK+L   L 
Sbjct  494   MAYVVRKAGS--NLSEKAVQDFIAGQVAPYKRIRRVAFIAAIPKNPSGKILRKDLIK-LA  550

Query  241   TSKI  230
             TSK+
Sbjct  551   TSKL  554



>ref|XP_006435318.1| hypothetical protein CICLE_v10000764mg [Citrus clementina]
 gb|ESR48558.1| hypothetical protein CICLE_v10000764mg [Citrus clementina]
Length=548

 Score =   429 bits (1104),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 244/553 (44%), Positives = 356/553 (64%), Gaps = 26/553 (5%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  S + I+ SK   V LP +  LDV +FI SR H G +A +D+ +G  +++ EL  
Sbjct  10    RSGFCKSNS-IFYSKRKPVSLPPNESLDVTTFISSRAHHGRTAFIDAATGRHLTFSELWR  68

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V+S++  L  MG+ +G V L+L PNSI+FPV+ L ++S+GA+  T NPL+T  EI KQ 
Sbjct  69    AVDSVSTCLSDMGIRKGHVILLLSPNSIFFPVVCLAVMSLGAIITTTNPLNTKQEIAKQI  128

Query  1492  FDCNVRLAFATPDRVQNL-GSTLGIPVIGLPESLNLDSPFRKLISSDPKL---APT----  1337
              D    LAF     V  L GSTL  P++ L +     +   K +++ P++    P+    
Sbjct  129   ADSKPVLAFTISQLVPKLAGSTL--PIVLLDDEKTTSTEGIKTVTTLPQMMRKEPSGTLV  186

Query  1336  -PRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLDV  1163
               RI Q D A +L+SSGTTG  K V  +H N IAMV+  + RF+    E       ++  
Sbjct  187   RDRINQDDVATLLYSSGTTGASKGVVSSHRNLIAMVQTVLGRFKLEDGE-----QTFICT  241

Query  1162  LPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKA  983
             +PM+H+YGL+ F  GLL+ GST+VV+ K+++ E++ +I +Y  T+ P+ PP+LVAL   A
Sbjct  242   VPMFHIYGLAAFATGLLASGSTIVVLSKFDMHEMLSSISKYRATYLPLVPPILVALISGA  301

Query  982   KA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAK  809
                  K  L SL+ V SG AP+S   I+ FV+ +P +  +QGYG+TEST +G    +  +
Sbjct  302   DQIRSKYDLSSLQSVLSGGAPLSREVIEGFVQKYPKVRILQGYGLTESTGIGASTDSLEE  361

Query  808   LRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAV  629
              R Y + G+L+P+MEA++VD      G +L     GELWL+GP+IMKGY +N EA+ + +
Sbjct  362   SRKYGTAGMLSPSMEAKIVD---PDSGKALLVNQTGELWLKGPSIMKGYFSNPEATTSTL  418

Query  628   DDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSA  449
             D +GWL TGD+ + D+DG++++ DRLKE+IKYKG+Q+ PA+LEA+L++HP + DAAV   
Sbjct  419   DSEGWLRTGDLCYIDDDGFIFIVDRLKELIKYKGYQVPPAELEALLLTHPKVSDAAVVPF  478

Query  448   QSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKIL  269
               +E G+ P+A+VV++ GS   LS+  V+DFVA+QVAPYK+VRRV F  SIPK+ SGKIL
Sbjct  479   PDKEAGQYPMAYVVREAGSR--LSENEVMDFVARQVAPYKRVRRVAFVASIPKNPSGKIL  536

Query  268   RKELRNLLITSKI  230
             RK+L   L TSK+
Sbjct  537   RKDLIK-LATSKL  548



>ref|XP_007017972.1| OPC-8:0 CoA ligase1 isoform 1 [Theobroma cacao]
 gb|EOY15197.1| OPC-8:0 CoA ligase1 isoform 1 [Theobroma cacao]
Length=549

 Score =   429 bits (1104),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 242/553 (44%), Positives = 354/553 (64%), Gaps = 27/553 (5%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  S +  Y  + P + L  +  LDV +FI SR H G  A +D+ +G  +++ EL  
Sbjct  12    RSGFCRSNSTFYSKRKP-IPLAKNDSLDVTTFISSRAHHGKVAFIDAGTGRQLTFSELWR  70

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V+S+A  L  MG+ +G V L+L PNSIYFPV+ L ++S+GA+  T NPL+T +EI KQ 
Sbjct  71    AVDSVATCLSDMGIRKGHVVLLLSPNSIYFPVVCLSVMSLGAIITTTNPLNTAAEIGKQI  130

Query  1492  FDCNVRLAFATPDRVQNL-GSTLGIPVIGLPESLNLDSPFRKLISSDPKLAPTP------  1334
              D    LAF  P  +  L GST  IP++ L +    ++   K++++  ++  T       
Sbjct  131   SDSKPVLAFTIPQLLPKLAGST--IPIVLLDDHAISNASQAKIVTTLHQMMKTEPSGSRV  188

Query  1333  --RIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLDV  1163
               R+ Q DTA +L+SSGTTG  K V  +H N IAMV+  + RF   + E       ++  
Sbjct  189   RDRVNQDDTATLLYSSGTTGASKGVVSSHRNLIAMVQTVLNRFSLQEEER------FICT  242

Query  1162  LPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKA  983
             +PM+H+YGL  F  GLL+ GSTV+V+ K+E+ +++  I++Y  T+ P+ PP+LVA+   A
Sbjct  243   VPMFHIYGLVAFATGLLASGSTVIVLSKFEMHDMLSTIEKYRATYLPLVPPILVAMVNAA  302

Query  982   KA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAK  809
                  K  L SL    SG AP+S   I+ F+  +P +  +QGYG+TEST +G    +  +
Sbjct  303   DQIRKKYDLSSLHSALSGGAPLSKEVIEGFLDKYPTVKILQGYGLTESTGIGASTDSLEE  362

Query  808   LRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAV  629
              R Y + G+L+P+MEA++VD      G +L     GELWLRGP+IMKGY +N EA+ + +
Sbjct  363   SRKYGTAGMLSPSMEAKIVD---PDSGKALTVNQTGELWLRGPSIMKGYFSNPEATASTL  419

Query  628   DDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSA  449
             D +GWL TGDI + D+DG+++V DRLKE+IKYKG+Q+ PA+LEA+L++HP+I DAAV   
Sbjct  420   DSEGWLKTGDICYIDDDGFIFVVDRLKELIKYKGYQVPPAELEALLLTHPEIFDAAVIPF  479

Query  448   QSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKIL  269
               +EVG+ P+A+VV+K G   +LS+  V+DFVA+QVAPYK++R+V F  SIPK+ SGKIL
Sbjct  480   PDKEVGQFPMAYVVRKTG--CNLSETAVMDFVARQVAPYKRIRKVAFVSSIPKNPSGKIL  537

Query  268   RKELRNLLITSKI  230
             RK+L   L TSK+
Sbjct  538   RKDLIK-LATSKL  549



>ref|XP_004308531.1| PREDICTED: 4-coumarate--CoA ligase-like 5-like [Fragaria vesca 
subsp. vesca]
Length=562

 Score =   429 bits (1104),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 244/561 (43%), Positives = 355/561 (63%), Gaps = 40/561 (7%)
 Frame = -2

Query  1858  GRRSCFYSSETGIYRS------KHPSVHLPSDPFLDVVSFILSR-NHGGLS----ALVDS  1712
             G  +  +  +TG+Y S      +H    +P+ P LD  +F+LS+  H  L+    AL+DS
Sbjct  8     GEHTGGFDPQTGVYHSIFNLGDRH---KIPTTPNLDTATFVLSQFPHPHLAESRVALIDS  64

Query  1711  QSGFSISYPELRSLVNSMAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAAT  1535
              +   ++Y +L   + S+A+GLH+ +GV +GDV  +L PNS+ +P I L + SVGA+  T
Sbjct  65    ATNQRVTYAQLHRSIQSLASGLHQALGVQKGDVVFVLSPNSLLYPTICLAVFSVGAILTT  124

Query  1534  MNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVI-------GLPESLNLDSPF  1376
              NPL+T SEI KQ  D   +LA A+P+ V  L  T G+P I       G   SL+++   
Sbjct  125   ANPLNTESEIGKQVRDSGAKLAIASPEEVHKLVPT-GVPTIVTSRPSNGTDNSLSIEELI  183

Query  1375  RKLISSDPKLAPTP----RIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEA  1208
                 S DP   PT     R  Q DTAA+L+SSGTTG  K V LTHANFIA++ L    + 
Sbjct  184   E---SCDP--IPTELALARPTQSDTAAILYSSGTTGTSKGVVLTHANFIAIMTLL---KW  235

Query  1207  SQYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTH  1028
             S  E  A  +V+L  +PM+H+YGL+ F +G+   GST V+++++E   ++ AI  + V++
Sbjct  236   SVDETSAQDDVFLCFIPMFHIYGLAFFALGMFCSGSTTVLMQRFEFKAMLDAIQTHKVSN  295

Query  1027  FPVAPPLLVALTRKAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTE  848
              P  PP+++AL + AK  +C L SL+++SSGAAP+S   +  F + FP ++   GYG+TE
Sbjct  296   IPAVPPVILALVKYAKQARCDLSSLRRISSGAAPLSKEVVDEFRQKFPWVELRPGYGLTE  355

Query  847   STAVGTRGFNTAKLRNYT-SVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIM  671
             S    T   +  + + +T S G L P   A+VVD+ +G     L P   GELWL+ P IM
Sbjct  356   SCGATTFFISDEQAKKHTGSCGHLVPKFAAKVVDIETGQA---LGPYKEGELWLKSPTIM  412

Query  670   KGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVL  491
             K YL N EA+   +D++GWL TGD+ +FDEDG LY+ DR+KE+IK+ G+Q+APA+LEA+L
Sbjct  413   KEYLGNVEATIATIDEEGWLKTGDLCYFDEDGLLYIVDRIKELIKHNGYQVAPAELEAIL  472

Query  490   MSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVY  311
             +SHP I+DAAV   + EE G+IP+A+VV+   +E+ +++  VI FVA QVAPYKKVR+V 
Sbjct  473   LSHPQILDAAVIPVEDEEAGQIPMAYVVRATSTEL-ITEDQVIQFVAGQVAPYKKVRKVG  531

Query  310   FTKSIPKSASGKILRKELRNL  248
             F  +IP+SA+ KILRKEL +L
Sbjct  532   FISAIPRSAASKILRKELVSL  552



>ref|XP_008221158.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Prunus mume]
Length=568

 Score =   429 bits (1103),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 246/567 (43%), Positives = 349/567 (62%), Gaps = 32/567 (6%)
 Frame = -2

Query  1888  SKIRNSAAEKGRRS-CFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDS  1712
             + +  SA   GR   C YSS    + SK   + LP + FLD+ +FI S+ H G  A +D 
Sbjct  4     TAVMGSAKADGRSGFCNYSS---TFYSKRKPIPLPHNDFLDITTFISSQAHRGTVAFIDG  60

Query  1711  QSGFSISYPELRSLVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATM  1532
              +G  ++Y +L   V S+A+ L  MG+ +G V L+L PNSI+FPV+ L ++S+GA+  T 
Sbjct  61    STGRQLTYAQLWRAVRSVASSLSDMGIRKGHVVLLLSPNSIFFPVVCLAVMSLGAIITTT  120

Query  1531  NPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPFR---KLIS  1361
             NPL+T  EI KQ  D    LAF T   +  LG +     I L +   + +P     K++S
Sbjct  121   NPLNTTGEIAKQIADSKPVLAFTTRQLISKLGGSTTNLSIVLIDDDEIKAPNHGNGKIVS  180

Query  1360  --------------SDPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELF  1223
                           S+  L     I Q DTA +L+SSGTTG  K V  +H N IAMV   
Sbjct  181   TLGEMMVKKERHGSSNGGLNLKEEINQDDTATLLYSSGTTGASKGVVSSHKNLIAMV---  237

Query  1222  VRFEASQYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDR  1043
              R   S++        +L  +PM+H+YGL+ F  GLL+ GST+VV+ K+E+ +++ AI +
Sbjct  238   -RVVLSRFNLDDGVERFLCTVPMFHIYGLAAFATGLLASGSTIVVLSKFEMHDMLWAIQK  296

Query  1042  YGVTHFPVAPPLLVALTRKAKADKC--GLKSLKQVSSGAAPISITCIQNFVRTFPHIDFI  869
             + V++ P+ PP+LVAL   A   K    L SL++V SG AP+S   I+ FV  +P +  +
Sbjct  297   HRVSYLPLVPPILVALINAADQIKAKYDLSSLRRVLSGGAPLSREVIEGFVEKYPSVTIL  356

Query  868   QGYGMTESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWL  689
             QGYG+TEST VG    N  + R Y + GLL+ +MEA++VD      G +L     GELWL
Sbjct  357   QGYGLTESTGVGASTDNLEESRRYGTAGLLSASMEAKIVD---PDSGKALAVNQTGELWL  413

Query  688   RGPAIMKGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPA  509
             +GP IMK Y +N EA+   +D  GWL TGD+ + DEDG+++V DRLKE+IKYKG+Q+ PA
Sbjct  414   KGPTIMKEYFSNAEATAATLDAQGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVPPA  473

Query  508   DLEAVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYK  329
             +LEA+L++HP IVDAAV     ++VG+ P+A+VV+K GS  +LS+ +V++FV KQVAPYK
Sbjct  474   ELEALLLTHPQIVDAAVIPFPDDKVGQYPMAYVVRKAGS--NLSEKDVMEFVGKQVAPYK  531

Query  328   KVRRVYFTKSIPKSASGKILRKELRNL  248
             K+RRV F  S+PK+ SGKILRK+L  L
Sbjct  532   KIRRVAFIASVPKNPSGKILRKDLIQL  558



>ref|XP_007222465.1| hypothetical protein PRUPE_ppa003506mg [Prunus persica]
 gb|EMJ23664.1| hypothetical protein PRUPE_ppa003506mg [Prunus persica]
Length=569

 Score =   429 bits (1103),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 244/560 (44%), Positives = 349/560 (62%), Gaps = 31/560 (6%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F +S +  Y  + P + LP +  LD+ +FI S+ H G  A +D  +G  ++Y +L  
Sbjct  15    RSGFCNSSSTFYSKRKP-IPLPHNDSLDITTFISSQAHRGTVAFIDGSTGRQLTYAQLWR  73

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V S+A+ L  MG+ +G V L+L PNSI+FPV+ L ++S+GA+  T NPL+T +EI KQ 
Sbjct  74    AVRSVASSLSDMGIRKGHVVLLLSPNSIFFPVVCLAVMSLGAIITTTNPLNTTAEIAKQI  133

Query  1492  FDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPFR-----KLIS-----------  1361
              D    LAF T   +  LG +     I L +   + +P       K++S           
Sbjct  134   ADSKPVLAFTTRQLISKLGGSTTDLSIVLIDDDEIRAPNHGTGNGKIVSTLGQMMVTKER  193

Query  1360  ---SDPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYP  1190
                S+  L     I Q DTA +L+SSGTTG  K V  +H N IAMV    R   S++   
Sbjct  194   HGSSNGGLNLKEEINQDDTATLLYSSGTTGASKGVVSSHKNLIAMV----RVVLSRFNLD  249

Query  1189  ATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPP  1010
                + +L  +PM+H+YGL++F  GLL+ GST+VV+ K+E+ +++RAI ++ VT+ P+ PP
Sbjct  250   DGEDTFLCTVPMFHIYGLAVFATGLLASGSTIVVLSKFEMHDMLRAIQKHRVTYLPLVPP  309

Query  1009  LLVALTRKAKADKC--GLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAV  836
             +LVAL   A   K    L SL++V SG AP+S   I+ FV  +P +  +QGYG+TEST V
Sbjct  310   ILVALINAADQIKAKYNLSSLRRVLSGGAPLSREVIEGFVEKYPTVTILQGYGLTESTGV  369

Query  835   GTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLN  656
             G    N  + R Y + GLL+ +M A++VD      G +L     GELWL+GP IMK Y +
Sbjct  370   GASTDNLEESRRYGTAGLLSASMAAKIVD---PDSGKALAVNQTGELWLKGPTIMKEYFS  426

Query  655   NGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPD  476
             N EA+   +D  GWL TGD+ + DEDG+++V DRLKE+IKYKG+Q+ PA+LEA+L++HP 
Sbjct  427   NAEATAATLDAQGWLRTGDLCYVDEDGFIFVVDRLKELIKYKGYQVPPAELEALLLTHPQ  486

Query  475   IVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSI  296
             IVDAAV     E+VG+ P+A+VV+K GS  +LS+ +V++FV KQVAPYKK+RRV F  S+
Sbjct  487   IVDAAVIPFPDEKVGQYPMAYVVRKAGS--NLSEKDVMEFVGKQVAPYKKIRRVAFIASV  544

Query  295   PKSASGKILRKELRNLLITS  236
             PK+ SGKILRK+L  L  +S
Sbjct  545   PKNPSGKILRKDLIQLATSS  564



>ref|XP_002468571.1| hypothetical protein SORBIDRAFT_01g048200 [Sorghum bicolor]
 gb|EER95569.1| hypothetical protein SORBIDRAFT_01g048200 [Sorghum bicolor]
Length=553

 Score =   428 bits (1101),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 252/550 (46%), Positives = 351/550 (64%), Gaps = 28/550 (5%)
 Frame = -2

Query  1840  YSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVNS  1661
             Y + T  +RSK   V LP+D  LDVV F+ SR H G+ AL+D+ +G  +++ +L   V  
Sbjct  15    YCAATRTFRSKRADVPLPADADLDVVRFLASRRHAGVVALIDAATGRRVTFRDLWRAVEG  74

Query  1660  MAAGLHRMGVS--QGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFD  1487
              A  L    +S  +G VALIL PNSI+FPV  L  +S+GAV  T NPL+T +EI KQ  D
Sbjct  75    AATALAAPPLSLRKGQVALILSPNSIHFPVAALAAMSLGAVLTTANPLNTPAEIAKQVAD  134

Query  1486  CNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPFRKLISSDPKLAPTP---------  1334
                 +AF T D +  L    G+ V+ L E   L S    ++++  +++ TP         
Sbjct  135   ARPVVAFTTRDLLPKLPLGAGLRVVLL-EPDRLASDPSSVVATIGEISATPPDPARRGDR  193

Query  1333  RIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV---RFEASQYEYPATANVYLDV  1163
             R+ Q D A +L+SSGTTG  K V  TH + I+MV++ +   R E S          +L  
Sbjct  194   RVTQDDPATLLYSSGTTGPSKGVVATHRSLISMVQIIMTRFRLEGSD-----KTETFLCT  248

Query  1162  LPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKA  983
             +PM+HVYGL  F  GLL  G+T+VV+ KYE+ E++R+I+ YGVT+ P+ PP+LVA+    
Sbjct  249   VPMFHVYGLVAFATGLLGCGATIVVLSKYELPEMLRSINEYGVTYLPLVPPILVAMLAHP  308

Query  982   KADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLR  803
             K    G  +L++V SG AP+S   I+ F   +P ++ +QGYG+TESTA+G    +  + R
Sbjct  309   KPLPLG--NLRKVLSGGAPLSKELIEGFKEKYPQVEILQGYGLTESTAIGASTDSAEESR  366

Query  802   NYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDD  623
              Y + GLL+PN EA++VD      G +LP    GELW+RGP +MKGY  N EA+++ +  
Sbjct  367   RYGTAGLLSPNTEAKIVD---PETGEALPVNRTGELWIRGPYVMKGYFKNTEATQSTLTP  423

Query  622   DGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQS  443
             DGWL TGD+ + DEDGYL+V DRLKE+IKYKG+Q+ PA+LEA+L++H +I D AV     
Sbjct  424   DGWLKTGDLCYIDEDGYLFVVDRLKELIKYKGYQVPPAELEALLLTHSEIQDVAVIPFPD  483

Query  442   EEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRK  263
              EVG+ P+A+VV+KKGS  +LS+  V++FVAKQVAPYKKVR+V F   IPK+ASGKILRK
Sbjct  484   REVGQFPMAYVVRKKGS--NLSEREVMEFVAKQVAPYKKVRKVAFVTEIPKNASGKILRK  541

Query  262   ELRNLLITSK  233
             +L   L TSK
Sbjct  542   DLIK-LATSK  550



>ref|XP_007010053.1| Acyl:coa ligase [Theobroma cacao]
 gb|EOY18863.1| Acyl:coa ligase [Theobroma cacao]
Length=567

 Score =   428 bits (1101),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 245/540 (45%), Positives = 343/540 (64%), Gaps = 23/540 (4%)
 Frame = -2

Query  1840  YSSETGIYRSKHP-SVHL--PSDPFLDVVSFILSR---NHGGLS--ALVDSQSGFSISYP  1685
             + S TGIY S  P S HL  PSDP L + SF+LS+      G S  AL+DS +   ++Y 
Sbjct  27    FDSHTGIYSSLFPLSDHLKFPSDPDLGIASFVLSQFPHPQVGESKVALIDSATNQQLTYA  86

Query  1684  ELRSLVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEI  1505
             +L   + S+A GL+ +GV +GDV  +L PNS+ +P I L +LS+GA+ +  NP++T SEI
Sbjct  87    QLHRSIQSLACGLYHLGVRKGDVVFLLSPNSLLYPTICLAILSLGAILSPTNPINTPSEI  146

Query  1504  KKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDS-PFRKLISS-DPKLAPTPR  1331
              KQ  D   +LA + P+ +  L  T G+P I      + DS    +LI   DP+  P  +
Sbjct  147   AKQVLDSGAKLAISAPEELHKLLQT-GVPTIITSRQSDEDSLSIEELIECCDPRELPETK  205

Query  1330  IRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMY  1151
             ++Q DTAA+L+SSGTTG  K V LTH+NFI    L VR+ A      +  +++L  +P++
Sbjct  206   VKQSDTAAILYSSGTTGTSKGVILTHSNFITTTRL-VRWYAEATS--SQNDIFLGFIPIF  262

Query  1150  HVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADK  971
             H+YGL+ F +GLL+ G T V++ ++++  ++ AI  + V + P  PP+++ L +  K + 
Sbjct  263   HIYGLAFFGVGLLTAGITTVLMPRFDLQAMLDAIQTHKVNNIPAVPPVILGLVKYCKGNS  322

Query  970   CGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGF--NTAKLRNY  797
               L +L++V SGAAP+S      F   FP ++  QGYG+TE T   T GF  +     + 
Sbjct  323   -KLSTLRRVGSGAAPLSKELTDAFREQFPWVELRQGYGLTE-TCGATSGFVSHEEAKAHP  380

Query  796   TSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDG  617
              S G+L P   A+VVD      G +LPP   GELWL GP  MKGYL N EA+   +  DG
Sbjct  381   GSCGMLLPTCCAKVVD---TETGLALPPYRKGELWLNGPTTMKGYLGNEEATAATIAKDG  437

Query  616   WLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEE  437
             WL TGD+ +FDEDG+LY+ DR+KE+IK+ G+Q+APA+LEAVL+ HPDIVDAAV   + EE
Sbjct  438   WLKTGDLGYFDEDGFLYIVDRIKELIKHNGYQVAPAELEAVLLGHPDIVDAAVIPVEDEE  497

Query  436   VGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
              G+IP+A+VVK   S+  L++  VI FVA QVAPYKKVRRV F  +IPKSA+GKILRKEL
Sbjct  498   SGQIPMAYVVKAAASQ--LTEEQVIKFVATQVAPYKKVRRVEFINAIPKSAAGKILRKEL  555



>ref|XP_004514911.1| PREDICTED: 4-coumarate--CoA ligase-like 5-like [Cicer arietinum]
Length=552

 Score =   427 bits (1099),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 237/539 (44%), Positives = 343/539 (64%), Gaps = 12/539 (2%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F SS +  Y  + P   LP +  LDV +FI S +H G  A +D+ +G  I+Y +L  
Sbjct  17    RSGFCSSNSIFYSKRKPH-SLPPNHSLDVTTFISSCSHHGRIAFIDASTGRHITYQQLWR  75

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V ++   L   G+ +GDV LIL PNSIYF V+ L +LS+GA+  T NPL+T+ EI KQ 
Sbjct  76    SVEAVTCSLSNTGIRKGDVILILSPNSIYFAVVCLSVLSLGAIITTTNPLNTIHEITKQI  135

Query  1492  FDCNVRLAFAT-PDRVQNLGSTLGIPVIGLPESLNLDSPFRKLISSDPKLAPT-PRIRQQ  1319
              D    LAF T P   +  G++  +P+I +    N  +   K++  +P+L+    R+ Q 
Sbjct  136   ADSKPVLAFTTTPLAPKITGASPTLPIILMESEDNSSNTVEKMMKKEPELSKVRERVNQD  195

Query  1318  DTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVYG  1139
             D A +L+SSGTTG  K V  +H N I MV+  +     + E       ++  +PM+H+YG
Sbjct  196   DIATLLYSSGTTGASKGVISSHKNLIGMVQNKMAMFGKEQE--KRGQTFICTVPMFHIYG  253

Query  1138  LSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKA--DKCG  965
             L++F  GLL+LGST+VV+ K+E+ +++ +I+++  +  PV PP+LVA+   A A   K  
Sbjct  254   LAVFATGLLALGSTIVVISKFEMHDMLSSIEKFRASFLPVVPPILVAMLNNADAIKSKYD  313

Query  964   LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVG  785
             L SL  + SG AP+S   I+ F+  FP++  +QGYG+TE++ VG       + R Y + G
Sbjct  314   LSSLHSMFSGGAPLSKEVIEGFIEKFPNVTILQGYGLTETSGVGASTNCFEESRKYGTAG  373

Query  784   LLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHT  605
             LL+ + EA +VD+ +      L     GELWLRGP IMKGYL+N EA+K+ +  +GWL T
Sbjct  374   LLSSSTEAMIVDIDTAQP---LAINQTGELWLRGPTIMKGYLSNEEATKSTLTSEGWLKT  430

Query  604   GDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEI  425
             GDI + D DGYL+V DRLKE+IKYKG+Q+ PA+LEA+L++H  I+DAAV    ++E G+I
Sbjct  431   GDICYIDSDGYLFVVDRLKELIKYKGYQVPPAELEALLLTHHAILDAAVIPYPNKEAGQI  490

Query  424   PVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNL  248
             P+A+VV+K GS +S  Q  V+DFVA QVAPYK++R+V F  SIPK+ SGKILRK+L  L
Sbjct  491   PMAYVVRKAGSNISEKQ--VMDFVAGQVAPYKRIRKVTFISSIPKNPSGKILRKDLIKL  547



>ref|XP_008377088.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Malus domestica]
Length=575

 Score =   428 bits (1101),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 238/551 (43%), Positives = 354/551 (64%), Gaps = 23/551 (4%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F SS + ++ SK  ++ LP   +LD+ +FI S+ H G  A +D  +G  ++Y +L +
Sbjct  33    RSGFCSSNS-VFYSKRKAITLPPSDYLDITTFISSQAHRGNVAFIDGSTGQQLTYVQLWT  91

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V+S+A+ L  MG+ +G V L+L PNSI+FPV+ L ++S+GA+  T NPL+T  EI KQ 
Sbjct  92    AVDSVASSLSDMGIRKGHVILLLSPNSIFFPVVCLAVMSLGAIITTTNPLNTTREITKQM  151

Query  1492  FDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLN-------LDSPFRKLISSDPKLAPTP  1334
              D    LAF T   +  L     +P++ +   +N       + S   K+++++ +     
Sbjct  152   ADSKPVLAFTTRQLIPKLAGPKPLPIVLIDGEINTPVSNKNIASTLGKMMANEKRDGLKS  211

Query  1333  R--IRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEY-PATANVYLDV  1163
             R  I Q DTA +L+SSGTTG  K V  +H N IAMV+         + Y   T   +L  
Sbjct  212   REVINQDDTATLLYSSGTTGASKGVVSSHRNLIAMVQ-----SVKGWLYLDDTHQTFLCT  266

Query  1162  LPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKA  983
             +PM+H++GL++F  GLLSLGST+VV+ K+E+ +++ AI +  V++ PV PP+LVAL   A
Sbjct  267   IPMFHIFGLAVFAAGLLSLGSTIVVLSKFEMHDMLLAIQKNRVSYVPVVPPILVALINAA  326

Query  982   KADKC--GLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAK  809
                K    L SL+ V SG AP+S    + F+  +P +  +QGYG+TES  VG    +  +
Sbjct  327   DQVKAKYDLSSLRWVLSGGAPLSKEVTEGFLDKYPMVTILQGYGLTESAGVGASTESLEE  386

Query  808   LRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAV  629
              R Y + GLL+ +MEA +VD      G+ LP    GEL+L+GP+IMKGY NN +A+ + +
Sbjct  387   SRKYGTAGLLSASMEAMIVD---RDSGNPLPANKTGELYLKGPSIMKGYFNNAKATASTL  443

Query  628   DDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSA  449
             D  GWL TGD+ + DEDG+++V DRLKE+IKY G+Q+APA+LEA+L++HP+IVDAAV   
Sbjct  444   DSKGWLRTGDLCYIDEDGFIFVVDRLKELIKYNGYQVAPAELEALLLTHPEIVDAAVIPF  503

Query  448   QSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKIL  269
               E+VG+ P+A+VV+K GS  SL+++ V++FV KQVAPYK++RRV F  S+PK+ SGKIL
Sbjct  504   PDEKVGQHPMAYVVRKAGS--SLTESGVMEFVGKQVAPYKRIRRVAFIDSVPKNPSGKIL  561

Query  268   RKELRNLLITS  236
             RK+L  +  +S
Sbjct  562   RKDLIQIATSS  572



>gb|AIS92507.1| 4-coumarate:CoA ligase 3 [Epimedium sagittatum]
Length=550

 Score =   427 bits (1098),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 238/549 (43%), Positives = 360/549 (66%), Gaps = 19/549 (3%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             +S F  S +  Y  + P + L S+  LD+ +FI +R H G  A VD+ +G  +++ ++  
Sbjct  13    KSGFCKSNSVFYSKRKP-ILLSSNGSLDITTFISARAHNGKIAYVDAATGRHLTFTQVWQ  71

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V+S+++ L  +G+ +G V L+L PNSIYFP+I L ++S+GA+  T NPL+T  EI KQ 
Sbjct  72    AVDSLSSCLSDLGIRKGHVVLLLSPNSIYFPIICLSVMSLGAIITTTNPLNTPREIGKQI  131

Query  1492  FDCNVRLAFATPDRVQNLG-STLGIPVIGLPES----LNLDSPFRKLISSDP-KLAPTPR  1331
              +    LAF     +  L  S L + +IG  +S    L + S   +++  +P +     R
Sbjct  132   ANSKPVLAFTIHSLLPKLADSKLPVVLIGGGDSRSSNLKIVSTLEEMLKKEPSQTRVKDR  191

Query  1330  IRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMY  1151
             + Q DTA +L+SSGTTG  K V  +H N IAMV+  +    S++        +L  +PM+
Sbjct  192   VTQDDTATLLYSSGTTGESKGVVSSHGNLIAMVQTVL----SRFRLEDGEQCFLCTVPMF  247

Query  1150  HVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK--A  977
             H+YGL++F  GLL+ GSTVVV+ K+E+DE++ +I++Y VT+ P+ PP+L+A+   A    
Sbjct  248   HIYGLAVFASGLLASGSTVVVLSKFEMDEMLSSIEKYRVTYLPLVPPILIAMINNANNIK  307

Query  976   DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNY  797
              K  L+SL+ V SG AP+S   I+ F+  +P +  +QGYG+TE+  VG    +  + R Y
Sbjct  308   RKYNLESLESVLSGGAPLSKEVIEGFIEKYPTVKILQGYGLTETAGVGASTDSLVESRRY  367

Query  796   TSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDG  617
              + GL++P+MEA+VVD      G +L     GELWLRGP++MKGY +N EA+ + +D +G
Sbjct  368   GTAGLMSPSMEAKVVD---PVTGEALGVNRTGELWLRGPSVMKGYFSNPEATTSTLDSEG  424

Query  616   WLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEE  437
             WL TGD+ +FDEDGY++V DRLKE+IKYKG+Q+APA+LEA+L++H ++ DAAV     ++
Sbjct  425   WLRTGDLCYFDEDGYIFVVDRLKELIKYKGYQVAPAELEALLLTHSEVTDAAVIPFPDKD  484

Query  436   VGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             VG+ P+A+VV+K GS  +LS+  V++F+AKQVAPYK++RRV F  +IPK+ SGKILRK+L
Sbjct  485   VGQFPMAYVVRKAGS--NLSETAVMEFIAKQVAPYKRIRRVSFVSAIPKNPSGKILRKDL  542

Query  256   RNLLITSKI  230
                L TSKI
Sbjct  543   IK-LATSKI  550



>ref|XP_010539807.1| PREDICTED: 4-coumarate--CoA ligase-like 5 isoform X2 [Tarenaya 
hassleriana]
Length=545

 Score =   426 bits (1095),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 240/554 (43%), Positives = 357/554 (64%), Gaps = 28/554 (5%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  S +  Y SK P V LP++P LD+ +FI S+ H G  A +D+ +G ++S+ EL  
Sbjct  7     RSGFCKSNSTFY-SKRPPVSLPANPSLDIKTFISSQAHRGKIAFIDAVTGKNLSFSELWR  65

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V+S+A+ L  MG+ +G V L+L PNSI+FPV+ L ++S+GA+  T NPL+T  EI KQ 
Sbjct  66    SVDSVASCLSDMGIRKGHVVLLLSPNSIFFPVVCLAVMSLGAIITTTNPLNTSGEISKQI  125

Query  1492  FDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPFRKLISS------DPKLAPTPR  1331
              D    LAF T   +  + + L  P++ + E   +DS     I+       + K     R
Sbjct  126   SDSKPVLAFTTAGLLPKIAADL--PMVLMDEEERVDSTCGARIAGILVEMMEKKRPSESR  183

Query  1330  IR----QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLD  1166
             +R    Q DTA +L+SSGTTG  K V  +H N I+MV+  V RF +   +     + ++ 
Sbjct  184   VRERVDQDDTATLLYSSGTTGASKGVVSSHKNLISMVQTVVNRFRSENGD--QGEHRFIC  241

Query  1165  VLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRK  986
              +PM+H+YGL+ F  GLL+ GST++++ K+++ E++ AI +Y  ++ P+ PP+LVA+   
Sbjct  242   TVPMFHIYGLAAFATGLLACGSTIIILSKFDMHEMMSAIGQYRASYLPLVPPILVAMVNG  301

Query  985   AKA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTA  812
             A     K  L SL+ +  G AP+S   I+ FV  +P++  +QGYG+TEST +G       
Sbjct  302   ADQIKRKYDLSSLQSILCGGAPLSKEVIEGFVEKYPNVRILQGYGLTESTGMGASTDTLE  361

Query  811   KLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNA  632
             + R Y + GLL+P+ME ++VD      G +L     GELWL+GPAIMKGY +N EA+ + 
Sbjct  362   ESRRYGTAGLLSPSMEGKIVD---PDSGRALGLNQTGELWLKGPAIMKGYFSNEEATSST  418

Query  631   VDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTS  452
             +D +GWL TGD+ +FDEDG+++V DRLKE+IKYKG+Q+ PA+LEA+L+ H +IVDAAV  
Sbjct  419   LDSEGWLRTGDLCYFDEDGFIFVVDRLKELIKYKGYQVPPAELEALLLVHQEIVDAAVIP  478

Query  451   AQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKI  272
                 E G+ P+A++V+K GS+  LS+ +V+DFV++QVAPYK++R+V F  SIPK+ SGKI
Sbjct  479   ----EAGQFPMAYIVRKPGSK--LSEKSVMDFVSEQVAPYKRIRKVAFVASIPKNPSGKI  532

Query  271   LRKELRNLLITSKI  230
             LRK+L   L TSK+
Sbjct  533   LRKDLIK-LATSKL  545



>ref|XP_002893114.1| opc-8:0 CoA ligase1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69373.1| opc-8:0 CoA ligase1 [Arabidopsis lyrata subsp. lyrata]
Length=546

 Score =   426 bits (1095),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 241/549 (44%), Positives = 350/549 (64%), Gaps = 30/549 (5%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F +S +  Y  + P + LP +P LDV +FI S+ H G  A +D+ +G ++++ EL  
Sbjct  7     RSGFCNSNSTFYSKRTP-IPLPPNPSLDVTTFISSQAHRGRIAFIDASTGQNLTFSELWR  65

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V S++  L  +G+ +G V L+L PNSI FPV+ L ++S+GA+  T NPL+T +EI KQ 
Sbjct  66    AVESVSDCLSEIGIRKGHVVLLLSPNSILFPVVCLSVMSLGAIITTTNPLNTSNEIAKQI  125

Query  1492  FDCNVRLAFATPDRVQNLGSTLG-IPVIGLPESLNLDS--PFRKLISSDPKLAPT-----  1337
              D N  LAF T   +  + +    +P++ + E   +DS    R+L+    K  P+     
Sbjct  126   KDSNPVLAFTTSQLLPKIAAAAKKLPIVLMDEE-RVDSVGKVRRLVEMMKK-EPSGNRVM  183

Query  1336  PRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLDVL  1160
              R+ Q DTA +L+SSGTTG  K V  +H N IAMV+  V RF +   E       ++  +
Sbjct  184   ERVDQDDTATLLYSSGTTGMSKGVISSHRNLIAMVQTIVNRFGSDDGE-----QRFICTV  238

Query  1159  PMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTR---  989
             PM+H+YGL+ F  GLL+ GST++V+ K+E+ E++ AI +Y  T  P+ PP+LVA+     
Sbjct  239   PMFHIYGLAAFATGLLAYGSTIIVLSKFEMHEMMSAIGKYQATSLPLVPPILVAMVNGAD  298

Query  988   --KAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNT  815
               KAK D   L SL  V  G AP+S    + F   +P +  +QGYG+TEST +G      
Sbjct  299   QIKAKYD---LSSLHTVLCGGAPLSKEVTEGFAEKYPTVKILQGYGLTESTGIGASTDTV  355

Query  814   AKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKN  635
              + R Y + G L+ +ME R+VD      G  L P   GELWL+GP+IMKGY +N EA+ +
Sbjct  356   EESRRYGTAGKLSASMEGRIVD---PVTGQILGPNQTGELWLKGPSIMKGYFSNEEATSS  412

Query  634   AVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVT  455
              +D +GWL TGD+ + DEDG+++V DRLKE+IKYKG+Q+APA+LEA+L++HP+I DAAV 
Sbjct  413   TLDSEGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVAPAELEALLLTHPEITDAAVI  472

Query  454   SAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGK  275
                 +EVG+ P+A+VV+K GS  SLS+ ++++FVAKQVAPYK++R+V F  SIPK+ SGK
Sbjct  473   PFPDKEVGQFPMAYVVRKTGS--SLSEKSIMEFVAKQVAPYKRIRKVAFVSSIPKNPSGK  530

Query  274   ILRKELRNL  248
             ILRK+L  L
Sbjct  531   ILRKDLIKL  539



>gb|AAP03021.1| 4-coumarate-CoA ligase-like protein [Arabidopsis thaliana]
Length=546

 Score =   426 bits (1094),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 239/545 (44%), Positives = 347/545 (64%), Gaps = 28/545 (5%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F +S +  Y  + P + LP +P LDV +FI S+ H G  A +D+ +G ++++ EL  
Sbjct  7     RSGFCNSNSTFYSKRTP-IPLPPNPSLDVTTFISSQAHRGRIAFIDASTGQNLTFTELWR  65

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V S+A  L  +G+ +G V L+L PNSI FPV+ L ++S+GA+  T NPL+T +EI KQ 
Sbjct  66    AVESVADCLSEIGIRKGHVVLLLSPNSILFPVVCLSVMSLGAIITTTNPLNTSNEIAKQI  125

Query  1492  FDCNVRLAFATPDRVQNLGSTLG-IPVIGLPESLNLDS--PFRKLISSDPKLAPTPRIR-  1325
              D N  LAF T   +  + +    +P++ + E   +DS    R+L+    K     R++ 
Sbjct  126   KDSNPVLAFTTSQLLPKISAAAKKLPIVLMDEE-RVDSVGDVRRLVEMMKKEPSGNRVKE  184

Query  1324  ---QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLDVLP  1157
                Q DTA +L+SSGTTG  K V  +H N IAMV+  V RF +   E       ++  +P
Sbjct  185   RVDQDDTATLLYSSGTTGMSKGVISSHRNLIAMVQTIVNRFGSDDGE-----QRFICTVP  239

Query  1156  MYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTR----  989
             M+H+YGL+ F  GLL+ GST++V+ K+E+ E++ AI +Y  T  P+ PP+LVA+      
Sbjct  240   MFHIYGLTAFATGLLAYGSTIIVLSKFEMHEMMSAIGKYQATSLPLVPPILVAMVNGADQ  299

Query  988   -KAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTA  812
              KAK D   L S+  V  G AP+S    + F   +P +  +QGYG+TEST +G       
Sbjct  300   IKAKYD---LSSMHTVLCGGAPLSKEVTEGFAEKYPTVKILQGYGLTESTGIGASTDTVE  356

Query  811   KLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNA  632
             + R Y + G L+ +ME R+VD      G  L P   GELWL+GP+IMKGY +N EA+ + 
Sbjct  357   ESRRYGTAGKLSASMEGRIVD---PVTGQILGPKQTGELWLKGPSIMKGYFSNEEATSST  413

Query  631   VDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTS  452
             +D +GWL TGD+ + DEDG+++V DRLKE+IKYKG+Q+APA+LEA+L++HP+I DAAV  
Sbjct  414   LDSEGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVAPAELEALLLTHPEITDAAVIP  473

Query  451   AQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKI  272
                +EVG+ P+A+VV+K GS  SLS+  +++FVAKQVAPYK++R+V F  SIPK+ SGKI
Sbjct  474   FPDKEVGQFPMAYVVRKTGS--SLSEKTIMEFVAKQVAPYKRIRKVAFVSSIPKNPSGKI  531

Query  271   LRKEL  257
             LRK+L
Sbjct  532   LRKDL  536



>ref|XP_010935869.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Elaeis guineensis]
Length=568

 Score =   426 bits (1095),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 242/546 (44%), Positives = 353/546 (65%), Gaps = 29/546 (5%)
 Frame = -2

Query  1840  YSSETGIYRSKH-PSVHLPSDPFLDVVSFILSR---NHGGLS----ALVDSQSGFSISYP  1685
             Y   TGIYRS H P   LP++P LD  SF+LS+    H  L+    ALVD+ +G  +++ 
Sbjct  22    YCPRTGIYRSPHRPCHQLPANPALDAASFVLSQFPPPH--LAEIKIALVDAATGRRVTFS  79

Query  1684  ELRSLVNSMAAGL-HRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSE  1508
             +LR    ++AA L H +G+ +GDV L+L PNSI +P I LG+LS GAV  T NPL+T +E
Sbjct  80    DLRRSALALAATLRHALGIQKGDVVLLLSPNSILYPAIVLGVLSAGAVVTTANPLNTAAE  139

Query  1507  IKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPFRKLISS-------DPK  1349
             + KQ+ D   +LA A P+      +  G+P I    S+ ++S     +S+       DP+
Sbjct  140   VAKQARDSGAKLAIAAPEEAHKT-TAAGVPTILTTRSVPVESGVGGPLSAEDLMEAGDPE  198

Query  1348  LAP-TPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVY  1172
              AP    + Q D A VL+SSGTTG  K V LTHAN IAMV L VR+ A      A  +V+
Sbjct  199   AAPPVAGVVQSDVAVVLYSSGTTGASKGVVLTHANVIAMVAL-VRWTAEATG--AAEDVH  255

Query  1171  LDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALT  992
             L  +PM+HVYGL  F +GL ++G+T VV+ +++   +++A++++GV++ P  PP+++A+T
Sbjct  256   LGFVPMFHVYGLGFFALGLPAVGATTVVMPRFDFRLMMQAVEKHGVSNIPAVPPVVLAMT  315

Query  991   RKAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTA  812
             +  K     L +L++V +GAAP+     + F R +P ++  +GYG+TES    T      
Sbjct  316   KAGKGGGWDLSALRRVGTGAAPLGADVGREFRRRYPWVELREGYGLTESAGAATFSAVAE  375

Query  811   KLRNYT-SVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKN  635
             + +    +VG L P  E RVV++ +G G        +GELWLRGP +M+GYL N EA+ +
Sbjct  376   EAKGRPGAVGQLLPGFEGRVVEVGTGKGVGP---GGVGELWLRGPTVMRGYLGNDEATAD  432

Query  634   AVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVT  455
             A+  DGWL TGD+V+FD+DGYLYV DR+KE+IK KGFQ+APA+LEA+L++HP I+DAAV 
Sbjct  433   AMAGDGWLKTGDLVYFDQDGYLYVVDRIKELIKVKGFQVAPAELEALLLTHPHILDAAVI  492

Query  454   SAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGK  275
               Q EE G++P+A+VV+   S+  L+   V+ FVA QVAPYKKV++V F ++IP+S +GK
Sbjct  493   PLQDEEAGQVPMAYVVRSPNSK--LTSEEVMQFVATQVAPYKKVKQVAFIEAIPRSTAGK  550

Query  274   ILRKEL  257
             ILRK+L
Sbjct  551   ILRKQL  556



>ref|NP_564115.1| OPC-8:0 CoA ligase1 [Arabidopsis thaliana]
 sp|Q84P21.2|4CLL5_ARATH RecName: Full=4-coumarate--CoA ligase-like 5; AltName: Full=4-coumarate--CoA 
ligase isoform 9; Short=At4CL9; AltName: Full=Peroxisomal 
OPC-8:0-CoA ligase 1 [Arabidopsis thaliana]
 gb|AAK25960.1|AF360250_1 unknown protein [Arabidopsis thaliana]
 gb|AAK64105.1| unknown protein [Arabidopsis thaliana]
 gb|ABJ98946.1| peroxisomal OPC-8:0 CoA ligase [Arabidopsis thaliana]
 gb|AEE29980.1| OPC-8:0 CoA ligase1 [Arabidopsis thaliana]
Length=546

 Score =   425 bits (1093),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 239/545 (44%), Positives = 347/545 (64%), Gaps = 28/545 (5%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F +S +  Y  + P + LP +P LDV +FI S+ H G  A +D+ +G ++++ EL  
Sbjct  7     RSGFCNSNSTFYSKRTP-IPLPPNPSLDVTTFISSQAHRGRIAFIDASTGQNLTFTELWR  65

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V S+A  L  +G+ +G V L+L PNSI FPV+ L ++S+GA+  T NPL+T +EI KQ 
Sbjct  66    AVESVADCLSEIGIRKGHVVLLLSPNSILFPVVCLSVMSLGAIITTTNPLNTSNEIAKQI  125

Query  1492  FDCNVRLAFATPDRVQNLGSTLG-IPVIGLPESLNLDS--PFRKLISSDPKLAPTPRIR-  1325
              D N  LAF T   +  + +    +P++ + E   +DS    R+L+    K     R++ 
Sbjct  126   KDSNPVLAFTTSQLLPKISAAAKKLPIVLMDEE-RVDSVGDVRRLVEMMKKEPSGNRVKE  184

Query  1324  ---QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLDVLP  1157
                Q DTA +L+SSGTTG  K V  +H N IAMV+  V RF +   E       ++  +P
Sbjct  185   RVDQDDTATLLYSSGTTGMSKGVISSHRNLIAMVQTIVNRFGSDDGE-----QRFICTVP  239

Query  1156  MYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTR----  989
             M+H+YGL+ F  GLL+ GST++V+ K+E+ E++ AI +Y  T  P+ PP+LVA+      
Sbjct  240   MFHIYGLAAFATGLLAYGSTIIVLSKFEMHEMMSAIGKYQATSLPLVPPILVAMVNGADQ  299

Query  988   -KAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTA  812
              KAK D   L S+  V  G AP+S    + F   +P +  +QGYG+TEST +G       
Sbjct  300   IKAKYD---LSSMHTVLCGGAPLSKEVTEGFAEKYPTVKILQGYGLTESTGIGASTDTVE  356

Query  811   KLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNA  632
             + R Y + G L+ +ME R+VD      G  L P   GELWL+GP+IMKGY +N EA+ + 
Sbjct  357   ESRRYGTAGKLSASMEGRIVD---PVTGQILGPKQTGELWLKGPSIMKGYFSNEEATSST  413

Query  631   VDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTS  452
             +D +GWL TGD+ + DEDG+++V DRLKE+IKYKG+Q+APA+LEA+L++HP+I DAAV  
Sbjct  414   LDSEGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVAPAELEALLLTHPEITDAAVIP  473

Query  451   AQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKI  272
                +EVG+ P+A+VV+K GS  SLS+  +++FVAKQVAPYK++R+V F  SIPK+ SGKI
Sbjct  474   FPDKEVGQFPMAYVVRKTGS--SLSEKTIMEFVAKQVAPYKRIRKVAFVSSIPKNPSGKI  531

Query  271   LRKEL  257
             LRK+L
Sbjct  532   LRKDL  536



>gb|KEH40252.1| acyl:CoA ligase [Medicago truncatula]
Length=560

 Score =   425 bits (1093),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 238/555 (43%), Positives = 355/555 (64%), Gaps = 25/555 (5%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F SS + I+ SK   + LP +  LD  +FI SR H G  A +D+ +G   +Y +L  
Sbjct  17    RSGFCSSNS-IFYSKRKPLPLPPNHSLDATTFISSRAHHGHIAFIDASTGHQFTYQQLWR  75

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V+S+ + L  MG+ +GDV L+L PNSIYFPV+ L ++S+GA+  T NPL+T  EI KQ 
Sbjct  76    SVDSVTSSLSNMGIRKGDVILLLSPNSIYFPVVCLSVMSLGAIITTTNPLNTSGEIAKQI  135

Query  1492  FDCNVRLAFATPDRVQNLG-STLGIPVIGLPESLNLDSP---------FRKLISSDPKLA  1343
              D    LAF T   +  +  ++  +P+I +  + N ++            +++  +P+L+
Sbjct  136   ADSKPVLAFTTQQLLSKITQASPSLPIILMDTNNNNNNSSSSSTTTTTLDEMMKKEPELS  195

Query  1342  P-TPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYL  1169
               T R+ Q DTA +L+SSGTTG  K V  +H N IAMV++ + RF   Q     T   ++
Sbjct  196   RVTERVNQNDTATLLYSSGTTGPSKGVVSSHKNLIAMVQVVMARFGKEQ----ETRETFI  251

Query  1168  DVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTR  989
               +PM+H+YGL++F MGLL++GST+VV+ K+E+ +++ +I+++  T  P+ PP+LVA+  
Sbjct  252   CTVPMFHIYGLAVFAMGLLAMGSTIVVLSKFEMHDMLSSIEKFRATFLPLVPPILVAMLN  311

Query  988   KAKA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNT  815
              A A   K  L SL  V SG AP+S    + F+  +P++   QGYG+TES+ +G    + 
Sbjct  312   NADAIKRKYDLSSLHTVVSGGAPLSKEVTEGFIEKYPNVSIFQGYGLTESSGIGASTESL  371

Query  814   AKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKN  635
              + R Y + GL++ + EA +VD         LP    GELWLRGP  MKGY +N EA+++
Sbjct  372   EESRKYGTAGLVSASTEAMIVD---TETAQPLPVNRTGELWLRGPTTMKGYFSNEEATRS  428

Query  634   AVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVT  455
              +  +GWL TGD+ + D DG+L+V DRLKE+IKYKG+Q+ PA+LEA+L++HP I+DAAV 
Sbjct  429   TITPEGWLKTGDVCYIDSDGFLFVVDRLKELIKYKGYQVPPAELEALLLTHPAILDAAVI  488

Query  454   SAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGK  275
                 +E G++P+A+VV+  GS +S SQ  V+DFVA+QVAPYK++R+V F  SIPK+ SGK
Sbjct  489   PYPDKEAGQVPMAYVVRNVGSNLSGSQ--VMDFVAEQVAPYKRIRKVAFISSIPKNPSGK  546

Query  274   ILRKELRNLLITSKI  230
             ILRK+L   L TSK+
Sbjct  547   ILRKDLIK-LATSKL  560



>ref|XP_007017973.1| OPC-8:0 CoA ligase1 isoform 2 [Theobroma cacao]
 gb|EOY15198.1| OPC-8:0 CoA ligase1 isoform 2 [Theobroma cacao]
Length=550

 Score =   424 bits (1091),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 242/554 (44%), Positives = 354/554 (64%), Gaps = 28/554 (5%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  S +  Y  + P + L  +  LDV +FI SR H G  A +D+ +G  +++ EL  
Sbjct  12    RSGFCRSNSTFYSKRKP-IPLAKNDSLDVTTFISSRAHHGKVAFIDAGTGRQLTFSELWR  70

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V+S+A  L  MG+ +G V L+L PNSIYFPV+ L ++S+GA+  T NPL+T +EI KQ 
Sbjct  71    AVDSVATCLSDMGIRKGHVVLLLSPNSIYFPVVCLSVMSLGAIITTTNPLNTAAEIGKQI  130

Query  1492  FDCNVRLAFATPDRVQNL-GSTLGIPVIGLPESLNLDSPFRKLISSDPKLAPTP------  1334
              D    LAF  P  +  L GST  IP++ L +    ++   K++++  ++  T       
Sbjct  131   SDSKPVLAFTIPQLLPKLAGST--IPIVLLDDHAISNASQAKIVTTLHQMMKTEPSGSRV  188

Query  1333  --RIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLDV  1163
               R+ Q DTA +L+SSGTTG  K V  +H N IAMV+  + RF   + E       ++  
Sbjct  189   RDRVNQDDTATLLYSSGTTGASKGVVSSHRNLIAMVQTVLNRFSLQEEER------FICT  242

Query  1162  LPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKA  983
             +PM+H+YGL  F  GLL+ GSTV+V+ K+E+ +++  I++Y  T+ P+ PP+LVA+   A
Sbjct  243   VPMFHIYGLVAFATGLLASGSTVIVLSKFEMHDMLSTIEKYRATYLPLVPPILVAMVNAA  302

Query  982   KA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAK  809
                  K  L SL    SG AP+S   I+ F+  +P +  +QGYG+TEST +G    +  +
Sbjct  303   DQIRKKYDLSSLHSALSGGAPLSKEVIEGFLDKYPTVKILQGYGLTESTGIGASTDSLEE  362

Query  808   LRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAV  629
              R Y + G+L+P+MEA++VD      G +L     GELWLRGP+IMKGY +N EA+ + +
Sbjct  363   SRKYGTAGMLSPSMEAKIVD---PDSGKALTVNQTGELWLRGPSIMKGYFSNPEATASTL  419

Query  628   DDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGF-QIAPADLEAVLMSHPDIVDAAVTS  452
             D +GWL TGDI + D+DG+++V DRLKE+IKYKG+ Q+ PA+LEA+L++HP+I DAAV  
Sbjct  420   DSEGWLKTGDICYIDDDGFIFVVDRLKELIKYKGYQQVPPAELEALLLTHPEIFDAAVIP  479

Query  451   AQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKI  272
                +EVG+ P+A+VV+K G   +LS+  V+DFVA+QVAPYK++R+V F  SIPK+ SGKI
Sbjct  480   FPDKEVGQFPMAYVVRKTG--CNLSETAVMDFVARQVAPYKRIRKVAFVSSIPKNPSGKI  537

Query  271   LRKELRNLLITSKI  230
             LRK+L   L TSK+
Sbjct  538   LRKDLIK-LATSKL  550



>gb|EYU17530.1| hypothetical protein MIMGU_mgv1a003887mg [Erythranthe guttata]
Length=557

 Score =   425 bits (1092),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 234/552 (42%), Positives = 355/552 (64%), Gaps = 24/552 (4%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  +++  Y  + P + LPS+  LDV +FI SR H G  A +D+ +G  +++ ++  
Sbjct  14    RSGFCGADSTFYSKRTP-IPLPSNESLDVTTFISSRAHRGKVAFIDAATGRRLTFADVWR  72

Query  1672  LVNSMAAGLH-RMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQ  1496
              V++++  L    G+ +G V L+L PNSIYFP++ L ++S+GAV  T NPL+T  EI KQ
Sbjct  73    AVDAVSTSLSAEFGIRKGHVILLLTPNSIYFPIVCLAVMSLGAVITTTNPLNTPREIGKQ  132

Query  1495  SFDCNVRLAFATPDRVQNL-GSTLGIPVIG----LPES-----LNLDSPFRKLISSDPKL  1346
               D    LAF  P+ +  L GS L I ++G     P S     L + +   +++  +P  
Sbjct  133   ISDSKPVLAFTVPELLPKLAGSNLPIILLGSDSCTPSSKSSTELRIVASIEEMMKKEPSQ  192

Query  1345  APT-PRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYL  1169
             +    R+ Q DTA +L+SSGTTG  K V  +H N IAMV+  V    ++++       ++
Sbjct  193   SRVKERVHQDDTATLLYSSGTTGASKGVVSSHRNLIAMVQTVV----NRFKLDDENQTFI  248

Query  1168  DVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTR  989
               +PM+H+YGL  F  GL++ GSTVV++ K+E+DE++ AI ++  T+ P+ PP+LVA+  
Sbjct  249   CTVPMFHIYGLVAFATGLIASGSTVVILSKFEMDEMLMAIQKFSATYLPLVPPILVAMVN  308

Query  988   KAKA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNT  815
              A     K    SL  V SG AP+S   I+ F   +P++  +QGYG+TEST +G    + 
Sbjct  309   NADIIRKKYDFSSLHSVLSGGAPLSKEVIEGFSEKYPNVTILQGYGLTESTGIGASTDSL  368

Query  814   AKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKN  635
              + R Y + GLL+PNM A++VD      G +L     GELWL+GP+IMKGY +N EA+ +
Sbjct  369   EESRKYGTAGLLSPNMAAKIVD---PETGEALSVNQTGELWLKGPSIMKGYFSNEEATAS  425

Query  634   AVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVT  455
              +D +GWL TGD+ + DEDG+++V DRLKE+IKYKG+Q+ PA+LEA+L++HP+I DAAV 
Sbjct  426   TLDSEGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVPPAELEALLLTHPEISDAAVI  485

Query  454   SAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGK  275
                 ++VG+ P+A+VV+K GS  ++S++ V+DF+AKQVAPYK++RRV F  S+PK+ SGK
Sbjct  486   PFPDKDVGQFPMAYVVRKAGS--AISESGVMDFIAKQVAPYKRIRRVAFVASVPKNPSGK  543

Query  274   ILRKELRNLLIT  239
             ILRK+L  L ++
Sbjct  544   ILRKDLIKLALS  555



>ref|XP_004253129.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Solanum lycopersicum]
Length=552

 Score =   424 bits (1091),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 247/547 (45%), Positives = 353/547 (65%), Gaps = 21/547 (4%)
 Frame = -2

Query  1840  YSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVNS  1661
             YS     + SK   +  P++  +DV +FI SR H G  A +D+ +G  +S+ ++ + V S
Sbjct  17    YSPANSTFYSKRRPIPFPANESIDVTTFISSRAHSGKIAFIDATTGRKLSFSDVWNAVES  76

Query  1660  MAAGLH-RMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             +A  L   M + +GDV L+L PNSI+FP+I L ++S+GA+  T NPL+T SEI KQ  D 
Sbjct  77    LATSLSVDMSIRKGDVVLLLSPNSIFFPIICLAVMSLGAIITTTNPLNTNSEIAKQIKDS  136

Query  1483  NVRLAFATPDRVQNLGSTLGIPVI---GLPES---LNLDSPFRKLISSDPKLAP-TPRIR  1325
             N  LAF  P  +  L +   +PVI   G+ +S   L +    +KLI   P  +    R+ 
Sbjct  137   NPVLAFTIPQLLPKL-TGFNLPVILIDGVNDSNSNLKIVGDLQKLIQRKPSESRLKERVT  195

Query  1324  QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHV  1145
             Q D A +L+SSGTTG  K V  +H N IAMV+  V    S++        ++  +PM+H+
Sbjct  196   QNDVATLLYSSGTTGASKGVISSHKNLIAMVQTIV----SRFNLDEGVQTFICTVPMFHI  251

Query  1144  YGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK--ADK  971
             YGL+ F  GLL+ GSTVVV+ K+E+DE++ +I +Y  T  P+ PP+LVAL   A     K
Sbjct  252   YGLAAFAAGLLASGSTVVVLSKFEMDEMLSSIHKYKATSLPLVPPILVALVNNADWIKKK  311

Query  970   CGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTS  791
               L SL+ V SG AP+S   I+ FV  +P +  +QGYG+TEST +G    +  + R Y +
Sbjct  312   YDLSSLESVLSGGAPLSKEVIEGFVEKYPSVRILQGYGLTESTGIGASTDSLEESRRYGT  371

Query  790   VGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWL  611
              G+L+P+ME ++VD      G +LP    GELWLRGP IMKGY +N EA+ + +D DGWL
Sbjct  372   AGMLSPSMEGKIVD---PESGKALPVNKTGELWLRGPTIMKGYFSNEEATASTLDSDGWL  428

Query  610   HTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVG  431
              TGD+ + DEDG+++V DRLKE+IKYKG+Q+ PA+LEA+L++HP+I DAAV     +EVG
Sbjct  429   RTGDLCYIDEDGFIFVVDRLKELIKYKGYQVPPAELEALLLTHPEISDAAVIPFPDKEVG  488

Query  430   EIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRN  251
             + P+A+VV+K GS  ++S++ V+DF+AKQVAPYK++RRV F  SIPK+ SGKILRK+L  
Sbjct  489   QFPMAYVVRKTGS--TISESAVMDFIAKQVAPYKRIRRVAFVASIPKNPSGKILRKDLIK  546

Query  250   LLITSKI  230
              L TSK+
Sbjct  547   -LATSKL  552



>ref|XP_002510640.1| AMP dependent CoA ligase, putative [Ricinus communis]
 gb|EEF52827.1| AMP dependent CoA ligase, putative [Ricinus communis]
Length=549

 Score =   424 bits (1091),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 238/552 (43%), Positives = 357/552 (65%), Gaps = 25/552 (5%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  S +  Y  + P + LP    +D+ +FI S+ H G +A +D+ +G  +S+ +L  
Sbjct  12    RSGFCRSNSTFYSKRKP-IPLPPKHSMDITTFISSQAHNGKTAFIDATTGRHLSFSDLWK  70

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V+S+A  L  MG+ +G V L+L PNSI+FP++ L ++S+GA+  T NPL+T  EI KQ 
Sbjct  71    AVDSVANCLCDMGIRKGHVVLLLSPNSIFFPIVCLSVMSLGAIITTTNPLNTPREIAKQI  130

Query  1492  FDCNVRLAFATPDRVQNLG-STLGIPVIGLPE-----SLNLDSPFRKLISSDP-KLAPTP  1334
              D    LAF TP  V  L  S+  +P++ + +     S  + +   ++++ +P +     
Sbjct  131   ADSKPLLAFTTPQLVPKLTESSSNLPIVLIDDDDHNCSAKILTTLTEMMTKEPSENRVKE  190

Query  1333  RIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RF-EASQYEYPATANVYLDVL  1160
             R+   DTA +L+SSGTTG  K V  +H N IAMV+  V RF E  ++++  T       +
Sbjct  191   RVSMDDTATLLYSSGTTGASKGVVSSHRNLIAMVQTIVGRFNEDREHKFICT-------V  243

Query  1159  PMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK  980
             PM+H+YGL+ F  GLL+ GST++V+ K+E+ E++  I+RY  T  P+ PP+LVA+   A 
Sbjct  244   PMFHIYGLAAFATGLLASGSTIIVLSKFEIHEMLSTIERYRATDLPLVPPILVAMINGAD  303

Query  979   AD--KCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKL  806
                 K  L SLK V SG AP+S   I+ F   +P +  +QGYG+TEST +G       + 
Sbjct  304   QMRLKYDLSSLKTVLSGGAPLSKEVIEGFAEKYPTVRILQGYGLTESTGIGASTDTLEES  363

Query  805   RNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVD  626
             R Y + GLL+P+MEA++V+      G +L     GELWLRGP+IMKGY +N EA+ + +D
Sbjct  364   RRYGTAGLLSPSMEAKIVE---PENGKALTVNHTGELWLRGPSIMKGYFSNAEATSSTLD  420

Query  625   DDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQ  446
              +GWL TGD+ + D+DG+++V DRLKE+IKYKG+Q+ PA+LEA+L++H +I DAAV    
Sbjct  421   SEGWLRTGDLCYIDDDGFVFVVDRLKELIKYKGYQVPPAELEALLLTHAEISDAAVIPFP  480

Query  445   SEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILR  266
              +E G++P+A+VV+K GS  +LS+++V+DFVA+QVAPYK++RRV F  +IPK+ SGKILR
Sbjct  481   DKEAGQVPMAYVVRKAGS--NLSESSVMDFVARQVAPYKRIRRVTFIAAIPKNPSGKILR  538

Query  265   KELRNLLITSKI  230
             K+L   L TSK+
Sbjct  539   KDLIK-LATSKL  549



>ref|XP_004514323.1| PREDICTED: 4-coumarate--CoA ligase-like 5-like [Cicer arietinum]
Length=552

 Score =   424 bits (1090),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 239/542 (44%), Positives = 340/542 (63%), Gaps = 18/542 (3%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F SS +  Y  + P   LP +  LDV +FI S +H G  A +D+ +G  I+Y +L  
Sbjct  17    RSGFCSSNSIFYSKRKPH-SLPPNHSLDVTTFISSCSHHGRIAFIDASTGQHITYQQLWR  75

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V ++   L  MG+ +GDV LIL PNSIYF V+ L +LS+GA+  T NPL T  EI KQ 
Sbjct  76    AVEAVTCSLSNMGIRKGDVILILSPNSIYFAVVCLSILSLGAIITTTNPLYTTREIAKQI  135

Query  1492  FDCNVRLAFAT---PDRVQNLGSTLGIPVIGLPESLNLDSPFRKLISSDPKLAPT-PRIR  1325
              D    LAF T     ++     TL  P+I +    N  +   K++  +P+L+    R+ 
Sbjct  136   ADSKPVLAFTTSPLAPKINKASPTL--PIILIESEDNSSNTVEKMMKEEPELSRVRERVN  193

Query  1324  QQDTAAVLFSSGTTGGCKAVALTHANFIAMVE-LFVRFEASQYEYPATANVYLDVLPMYH  1148
             Q D A +L+SSGTTG  K V  +H N I MV+ + V F   Q E+  T   ++  +PM+H
Sbjct  194   QDDIATLLYSSGTTGVSKGVISSHKNLIGMVQNIMVMFGKEQEEHGQT---FICTVPMFH  250

Query  1147  VYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKA--D  974
             +YGL+LF  GLL+LGST+VV+ K+E+ +++ +I+++  +  P+ PP+LVA+   A A   
Sbjct  251   MYGLALFATGLLALGSTIVVLSKFEMHDMLSSIEKFRASFVPLVPPILVAMINNADAIKS  310

Query  973   KCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYT  794
             K  L SL  + S  AP+S   I+ F+  +P++  +QGYG+TE++  G       + R Y 
Sbjct  311   KYDLSSLHSMFSAGAPLSKEVIEGFIEKYPNVTILQGYGLTETSGFGASTNCFEESRKYG  370

Query  793   SVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGW  614
             + GLL+ + EA +VD+ +      L     GELWLRGP IMKGYL N EA+K+ +  DGW
Sbjct  371   TTGLLSSSTEAMIVDIDTAQP---LAINQTGELWLRGPTIMKGYLRNEEATKSTLTSDGW  427

Query  613   LHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEV  434
             L TGD+ + D DGYL+V DRLKE+IKYKG+Q+ PA+LEA+L++HP I+D AV     +E 
Sbjct  428   LKTGDVCYIDSDGYLFVVDRLKELIKYKGYQVPPAELEALLLTHPAILDVAVIPYPDKEA  487

Query  433   GEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELR  254
             G+IP+A+VV+K GS  S+S+  VID+VA QVAPYKK+R+V F   IPK+ SGKILRK+L 
Sbjct  488   GQIPMAYVVRKAGS--SISEKQVIDYVAGQVAPYKKIRKVTFISFIPKNPSGKILRKDLV  545

Query  253   NL  248
              L
Sbjct  546   KL  547



>ref|XP_008787558.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Phoenix dactylifera]
Length=571

 Score =   424 bits (1090),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 240/549 (44%), Positives = 346/549 (63%), Gaps = 30/549 (5%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSR---NHGG--LSALVDSQSGFSISY  1688
             +S +Y   TG+YRS H   H    P LD  SF+LS+    H     +ALVDS +G  +++
Sbjct  24    QSGYYCPRTGVYRSPHRVCH--QIPALDAASFVLSQFPPPHLAEIKTALVDSATGRRLTF  81

Query  1687  PELRSLVNSMAAGL-HRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLS  1511
              +LR    ++AA L H +G+ +GDV L+L PNSI +P I LG+LS GAV  T NPL+T +
Sbjct  82    SDLRRSALALAATLRHGLGIQKGDVVLLLSPNSILYPAIVLGVLSAGAVVTTANPLNTAA  141

Query  1510  EIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVI----GLPESLNLDSPF---RKLISSDP  1352
             E+ KQ+ D   +LA A P+      +  G+P I      P+   +  P      +   DP
Sbjct  142   EVAKQARDSGAKLAIAAPEEAHKTAAA-GVPTILTTRSAPDESGVGGPVSVEELMEGGDP  200

Query  1351  KLAPTPR-IRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANV  1175
             +  P+   + Q D AA+L+SSGTTG  K V LTHAN IAMV L V++ A      A  +V
Sbjct  201   EAMPSLEGVAQSDVAALLYSSGTTGASKGVVLTHANLIAMVAL-VKWTAEASG--AVEDV  257

Query  1174  YLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVAL  995
             YL  +PM+HVYGL  F +GL + G+T VV+ +++   ++ A++++GV++ P  P +++A+
Sbjct  258   YLGFIPMFHVYGLGFFSLGLPAAGATTVVMPRFDFHAMLEAVEKHGVSNIPAVPSVVLAM  317

Query  994   TRKAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNT  815
              +        L +L++V +GAAP+     + F R +P ++  +GYG+TES    T  F+ 
Sbjct  318   AKAGNGGGRDLSALRRVGTGAAPLGAEVGREFRRRYPWVELREGYGLTESAGAAT--FSV  375

Query  814   AK---LRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEA  644
             A     R   +VG L P  E RVV++ +G G   + P  +GELWLRGP +M GYL N EA
Sbjct  376   AAEEAKRRPGAVGQLLPGFEGRVVEVGTGRG---VEPGEVGELWLRGPTVMPGYLGNDEA  432

Query  643   SKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDA  464
             + +A+  DGWL TGD+V+FD+DGYLYV DR+KE+IK KGFQ+APA+LEA+L++HP I+DA
Sbjct  433   TADALVGDGWLRTGDLVYFDQDGYLYVVDRIKELIKVKGFQVAPAELEALLLTHPQILDA  492

Query  463   AVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSA  284
             AV   Q EE G++P+++VV+   S+  L+   VI FVA QVAPYKKV+RV F  +IP+S 
Sbjct  493   AVIPLQDEEAGQVPISYVVRSPNSK--LTSEEVIQFVATQVAPYKKVKRVAFIDAIPRST  550

Query  283   SGKILRKEL  257
             +GKILRK+L
Sbjct  551   AGKILRKQL  559



>ref|XP_010267197.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Nelumbo nucifera]
Length=543

 Score =   423 bits (1087),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 231/538 (43%), Positives = 346/538 (64%), Gaps = 27/538 (5%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLS---ALVDSQSGFSISYPELRSLVNSMA  1655
             G+YRS  P V  P DP L +VSF+  RN    S   ALVD+ SG ++++ +L+S +  +A
Sbjct  10    GVYRSLRPPVVFPKDPNLSMVSFLF-RNSSSYSDKLALVDADSGDALNFSQLKSTIAKVA  68

Query  1654  AGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVR  1475
              GL R+G+ +GDV LIL PNS+ FP+ FLG++++GA+A T+NPL T +EI KQ  D   +
Sbjct  69    HGLVRLGIKKGDVVLILAPNSVQFPICFLGVVAIGAIATTVNPLYTTAEIAKQVNDSGPK  128

Query  1474  LAFATP---DRVQNLG---STLGIPVIGLPESLNLDSPFRKLIS------SDPKLAPTPR  1331
             L    P   D+V++ G     LG P      S    + F  L++      SD    P   
Sbjct  129   LVITVPPLWDKVKDFGLPAVFLGPPSASSIASRARTTSFFDLVNMAGGSVSD---FPVAS  185

Query  1330  IRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMY  1151
             ++Q DTAA+L+SSGTTG  K V LTH NFI+     +   A Q     T NV+L  LP++
Sbjct  186   VKQSDTAALLYSSGTTGTSKGVILTHRNFISAA---IMATADQDVDRETHNVFLCFLPLF  242

Query  1150  HVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADK  971
             H++GLS+     L  G+ VV + K++++ V+++ID+Y VT+  V PP+++AL +++   K
Sbjct  243   HIFGLSIITYAQLQRGNMVVTMGKFDIEMVLKSIDKYRVTYLFVVPPVMIALAKQSVVKK  302

Query  970   CGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTS  791
               + SL+++ SGAAP+    ++   + FP    +QGYG+TE+  + +        R+  S
Sbjct  303   YNVSSLRKLGSGAAPLGKEIMEECAKNFPQAVVVQGYGLTETCGIVSLDNPRGGARHTGS  362

Query  790   VGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWL  611
              G L P +EA++V + +      LPP  +GE+W+RGP +M+GY NN +A+K+ +D  GW+
Sbjct  363   TGTLVPGIEAQIVSVDTLKL---LPPNQLGEIWVRGPNMMQGYFNNPQATKSTIDKQGWV  419

Query  610   HTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVG  431
             HTGD+ +FD++G L+V DR+KE+IKYKGFQ+APA+LE +L+SHP+I+DA V      E G
Sbjct  420   HTGDLGYFDDEGRLFVVDRIKELIKYKGFQVAPAELEGLLLSHPEILDAVVIPLPDAEAG  479

Query  430   EIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             E+P+A+VV+   S  SL++ +V  F+AKQVAP+K++RRV FT S+PKSASGKILR+EL
Sbjct  480   EVPIAYVVRTPNS--SLTEEDVQKFIAKQVAPFKRLRRVTFTNSVPKSASGKILRREL  535



>emb|CDY33631.1| BnaC08g19310D [Brassica napus]
Length=553

 Score =   423 bits (1087),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 244/554 (44%), Positives = 352/554 (64%), Gaps = 33/554 (6%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F +S +  Y  + P + LP +P LDV +FI S+ H G +A +D+ +G ++++ EL  
Sbjct  7     RSGFCNSNSTFYSKRKP-IPLPPNPSLDVTTFISSQAHLGRTAFIDASTGKNLTFAELWR  65

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V S+   L  MG+ +G V L+L PNSI FPV+ L ++S+GAV  T NPL+T +EI KQ 
Sbjct  66    AVESVGDCLSDMGIRKGHVVLLLSPNSILFPVVCLSVMSLGAVITTTNPLNTAAEIAKQI  125

Query  1492  FDCNVRLAFATPDRVQNL-----GSTLGIPVIGLPESLNLDS--PFRKLIS------SDP  1352
              D N  +AF T + +  +     GS   +P++ + E   +DS    R+L        S  
Sbjct  126   KDSNPVIAFTTAELLPKIAAASGGSKKRLPIVLMDEE-RVDSAGEVRRLAEMMRRKPSGT  184

Query  1351  KLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEA---SQYEYPAT  1184
             ++A   R+ Q DTA +L+SSGTTG  K V  +H N IAMV+  V RF +   SQ E    
Sbjct  185   RVAE--RVDQDDTATLLYSSGTTGMSKGVVSSHRNLIAMVQTVVNRFGSDVGSQGE----  238

Query  1183  ANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLL  1004
                ++  +PM+H+YGL+ F  GLL+ GST++V+ K+E+ E++ AI +Y  T+ P+ PP+L
Sbjct  239   -QRFICTVPMFHIYGLAAFATGLLAYGSTIIVLSKFEMGEMLSAIGKYQATYLPLVPPIL  297

Query  1003  VALTRKAKA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGT  830
             VA+   A+    K  L SL  V  G AP+S    + F+  +P +  +QGYG+TEST +G 
Sbjct  298   VAMVNGAEQINAKYDLSSLHTVLCGGAPLSKEVTEGFMDKYPTVKILQGYGLTESTGIGA  357

Query  829   RGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNG  650
                   + R Y + G L+ +ME R+VD      G  L P   GELWL+GP+IMKGY +N 
Sbjct  358   STDTVEESRRYGTAGKLSASMEGRIVD---PVTGRVLGPNRTGELWLKGPSIMKGYFSNE  414

Query  649   EASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIV  470
             EA+ + +D +GWL TGD+ + DEDG+++V DRLKE+IKYKG+Q+ PA+LEA+L++HP+I 
Sbjct  415   EATSSTLDSEGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVPPAELEALLLTHPEIA  474

Query  469   DAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPK  290
             DAAV      EVG+ P+A+VV+K GS   LS+ +V++FVAKQVAPYK+VR+V F  SIPK
Sbjct  475   DAAVIPFPDREVGQFPMAYVVRKAGS--LLSEKSVMEFVAKQVAPYKRVRKVAFVSSIPK  532

Query  289   SASGKILRKELRNL  248
             + SGKILRK+L  L
Sbjct  533   NPSGKILRKDLIKL  546



>emb|CDX96633.1| BnaA08g21760D [Brassica napus]
Length=553

 Score =   423 bits (1087),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 240/552 (43%), Positives = 350/552 (63%), Gaps = 29/552 (5%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F +S +  Y  + P + LP +P LDV +FI S+ H G +A +D+ +G ++++ +L  
Sbjct  7     RSGFCNSNSTFYSKRKP-IPLPPNPSLDVTTFISSQAHLGRTAFIDASTGKNLTFAQLWR  65

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V S+   L  MG+ +G V L+L PNSI FPV+ L ++S+GAV  T NPL+T +EI KQ 
Sbjct  66    AVESVGDCLSDMGIRKGHVVLLLSPNSILFPVVCLSVMSLGAVITTTNPLNTAAEIAKQI  125

Query  1492  FDCNVRLAFATPDRVQNL-----GSTLGIPVIGLPESLNLDSP-----FRKLISSDPK-L  1346
              D N  +AF T + +  +     GS   +P++ + E   +DS        +++  +P   
Sbjct  126   KDSNPVMAFTTAELLPKIAAASGGSNKRLPIVLMDEE-RVDSAGEVRRLAEMMRREPSGT  184

Query  1345  APTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEA---SQYEYPATAN  1178
                 R+ Q DTA +L+SSGTTG  K V  +H N IAMV+  V RF +   SQ E      
Sbjct  185   RVAERVDQDDTATLLYSSGTTGMSKGVVSSHRNLIAMVQTVVNRFGSDVGSQGE-----Q  239

Query  1177  VYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVA  998
              ++  +PM+H+YGL+ F  GLL+ GST++V+ K+E+ E++ AI +Y  T+ P+ PP+LVA
Sbjct  240   RFICTVPMFHIYGLAAFATGLLAYGSTIIVLSKFEMGEMLSAIGKYQATYLPLVPPILVA  299

Query  997   LTRKAKA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRG  824
             +   A+    K  L SL  V  G AP+S    + F+  +P +  +QGYG+TEST +G   
Sbjct  300   MVNGAEQINAKYDLSSLHTVLCGGAPLSKEVTEGFMDKYPTVKILQGYGLTESTGIGAST  359

Query  823   FNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEA  644
                 + R Y + G L+ +ME R+VD      G  L P   GELWL+GP+IMKGY +N EA
Sbjct  360   DTVEESRRYGTAGKLSASMEGRIVD---PVTGRVLGPNRTGELWLKGPSIMKGYFSNEEA  416

Query  643   SKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDA  464
             + + +D +GWL TGD+ + DEDG+++V DRLKE+IKYKG+Q+ PA+LEA+L++HP+I DA
Sbjct  417   TSSTIDSEGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVPPAELEALLLTHPEIADA  476

Query  463   AVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSA  284
             AV      EVG+ P+A+VVKK GS   LS+ +V++FV+KQVAPYK+VR+V F  SIPK+ 
Sbjct  477   AVIPFPDREVGQFPMAYVVKKTGS--LLSEKSVMEFVSKQVAPYKRVRKVAFVSSIPKNP  534

Query  283   SGKILRKELRNL  248
             SGKILRK+L  L
Sbjct  535   SGKILRKDLIKL  546



>ref|XP_008387876.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Malus domestica]
Length=556

 Score =   422 bits (1086),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 234/547 (43%), Positives = 346/547 (63%), Gaps = 22/547 (4%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F SS + ++ SK  S+ LP +  LD+ +FI S+ H G  A +D  +G  ++Y +L  
Sbjct  10    RSGFCSSNS-VFYSKRRSIPLPPNDSLDITTFISSQAHRGNVAFIDGSTGQQLTYVQLWD  68

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V S+A+ L  MG+ +G V L+L PNSI+FPV+ L ++S+GA+  T NPL+T  EI KQ 
Sbjct  69    AVRSVASSLSDMGIRKGHVVLLLSPNSIFFPVVCLAVMSLGAIITTTNPLNTTREIAKQI  128

Query  1492  FDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPFRKLISSDPKLAPTPR------  1331
              D    LAF T   +  L   + +P++ + + ++     + ++++  K+    +      
Sbjct  129   ADSKPVLAFTTRQLIPKLAGPIPLPIVLINDEIDAPIDNKSIVNTLGKMMAIKKHDGLKS  188

Query  1330  ---IRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLDV  1163
                I Q DTA +L+SSGTTG  K V  +H N IAMV+  + RF +    +      +L  
Sbjct  189   REAIIQDDTATLLYSSGTTGASKGVVSSHRNLIAMVQTVIGRFYSDDNHH----QTFLCT  244

Query  1162  LPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKA  983
             +PM+H+YGL  F  GLL+ GST+VV+ K+E+ +++ +I R  V++ P+ PP+LVAL   A
Sbjct  245   VPMFHIYGLVAFATGLLASGSTIVVLSKFEMHDMLLSIQRNRVSYLPLVPPILVALINAA  304

Query  982   KADKC--GLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAK  809
                K    L SL+ V SG AP+S   I+ F+  +P +  +QGYG+TEST VG    +  +
Sbjct  305   DQVKAKYDLSSLRWVLSGGAPLSKEVIEGFLEKYPMVSILQGYGLTESTGVGASTDSLEE  364

Query  808   LRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAV  629
              R Y + GLL+ +MEA +VD      G  L     GELWL+GP IMKGY +N EA+ + +
Sbjct  365   SRKYGTAGLLSASMEAMIVD---PDSGHPLATNKTGELWLKGPTIMKGYFSNAEATASTL  421

Query  628   DDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSA  449
             D  GWL TGD+ + DEDG+++V DRLKE+IKYKG+Q+ PA+LEA+L++HP+I DAAV   
Sbjct  422   DSKGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVPPAELEALLLTHPEIADAAVIPF  481

Query  448   QSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKIL  269
               E+VG+ P+A+VV+  GS  SL+++ V++FV KQVAPYK++RRV F  S+PK+ SGKIL
Sbjct  482   PDEKVGQYPMAYVVRNAGS--SLTESGVMEFVGKQVAPYKRIRRVAFIDSVPKNPSGKIL  539

Query  268   RKELRNL  248
             RK+L  L
Sbjct  540   RKDLIQL  546



>gb|EYU18792.1| hypothetical protein MIMGU_mgv1a004091mg [Erythranthe guttata]
Length=544

 Score =   422 bits (1085),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 230/537 (43%), Positives = 338/537 (63%), Gaps = 24/537 (4%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLS---ALVDSQSGFSISYPELRSLVNSMA  1655
             G+YRS  P    P DP + +VSF+  RN    S   ALVDS +G ++++ + +S+VN +A
Sbjct  10    GVYRSLRPPFFPPKDPNISMVSFLF-RNISSFSDKRALVDSHTGETLNFAQFKSMVNKVA  68

Query  1654  AGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVR  1475
              GL ++GV + DV LI  PNSI FP+ FLG+++VGA+A T+NPL T+SE+ KQ  D   +
Sbjct  69    QGLLQLGVKKNDVVLIFSPNSIQFPLCFLGIVAVGAIATTVNPLYTVSELSKQVHDSKSK  128

Query  1474  LAFATPDRVQNLGSTLGIPVIGLPESLNLDS-----------PFRKLISSDPKLAPTPRI  1328
             L     + +  +    G+PVI L      DS            F +L+ +D  +     +
Sbjct  129   LIITVEELIPKV-KDFGLPVIILNTDKKWDSVSPIGKIPSITSFSELVDNDGSVNLDGAV  187

Query  1327  RQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYH  1148
             +Q DTAA+L+SSGTTG  K V LTH NFIA   +    + S  E   T  V+L VLPM+H
Sbjct  188   KQDDTAALLYSSGTTGISKGVVLTHRNFIASSLMITTDQESVSE---TNGVFLCVLPMFH  244

Query  1147  VYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKC  968
             V+GL++ +   L  GS VV + K++++ +++A+D+YG+TH  V PP+++ L + +   K 
Sbjct  245   VFGLAVIMYAQLQRGSAVVSMSKFDLEMILKAVDKYGITHMWVVPPIILGLAKNSIVKKY  304

Query  967   GLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSV  788
              L SLKQ++SGAAP+    +Q     FP     QGYGMTE+  + +     +  R+  S 
Sbjct  305   SLSSLKQIASGAAPLGRELMQECANNFPQAVVCQGYGMTETCGIVSIENPYSGPRHSGSA  364

Query  787   GLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLH  608
             G+L P +E ++V +        LPP  +GE+W+RGP +M+GY NN  A+K  +D   W+H
Sbjct  365   GMLVPGVECQIVSVDKSTP---LPPGQLGEIWVRGPNMMQGYFNNPVATKLTIDKQRWVH  421

Query  607   TGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGE  428
             TGD+ +FDEDG L+V DR+KE+IKYKG+Q+APA+LE +L+SHP+I DA V      E GE
Sbjct  422   TGDLGYFDEDGQLFVVDRIKELIKYKGYQVAPAELEGLLVSHPEISDAVVIPFPDAEAGE  481

Query  427   IPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             +P A+VV+   S  SLS+ ++  F+A+QVAP+K++RRV F  S+PKSA+GKILR+EL
Sbjct  482   VPAAYVVRAPNS--SLSEEDIKKFIAEQVAPFKRLRRVTFITSVPKSAAGKILRREL  536



>ref|XP_009110224.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Brassica rapa]
Length=553

 Score =   422 bits (1086),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 240/552 (43%), Positives = 349/552 (63%), Gaps = 29/552 (5%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F +S +  Y  + P + LP +P LDV +FI S+ H G +A +D+ +G ++++ EL  
Sbjct  7     RSGFCNSNSTFYSKRKP-IPLPPNPSLDVTTFISSQAHLGRTAFIDASTGKNLTFAELWR  65

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V S+   L  MG+ +G V L+L PNSI FPV+ L ++S+GAV  T NPL+T +EI KQ 
Sbjct  66    AVESVGDCLSDMGIRKGHVVLLLSPNSILFPVVCLSVMSLGAVITTTNPLNTAAEIAKQI  125

Query  1492  FDCNVRLAFATPDRVQNL-----GSTLGIPVIGLPESLNLDSP-----FRKLISSDPK-L  1346
              D N  +AF T + +  +     GS   +P++ + E   +DS        +++  +P   
Sbjct  126   KDSNPVMAFTTAELLPKIAAASGGSKKRLPIVLMDEE-RVDSAGEVRRLAEMMRREPSGT  184

Query  1345  APTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEA---SQYEYPATAN  1178
                 R+ Q DTA +L+SSGTTG  K V  +H N I MV+  V RF +   SQ E      
Sbjct  185   RVAERVDQDDTATLLYSSGTTGMSKGVVSSHRNLITMVQTVVNRFGSDVGSQGE-----Q  239

Query  1177  VYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVA  998
              ++  +PM+H+YGL+ F  GLL+ GST++V+ K+E+ E++ AI +Y  T+ P+ PP+LVA
Sbjct  240   RFICTVPMFHIYGLAAFATGLLAYGSTIIVLSKFEMGEMLSAIGKYQATYLPLVPPILVA  299

Query  997   LTRKAKA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRG  824
             +   A+    K  L SL  V  G AP+S    + F+  +P +  +QGYG+TEST +G   
Sbjct  300   MVNGAEQINAKYDLSSLHTVLCGGAPLSKEVTEGFMDKYPTVKILQGYGLTESTGIGAST  359

Query  823   FNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEA  644
                 + R Y + G L+ +ME R+VD      G  L P   GELWL+GP+IMKGY +N EA
Sbjct  360   DTVEESRRYGTAGKLSASMEGRIVD---PVTGRVLGPNRTGELWLKGPSIMKGYFSNEEA  416

Query  643   SKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDA  464
             + + +D +GWL TGD+ + DEDG+++V DRLKE+IKYKG+Q+ PA+LEA+L++HP+I DA
Sbjct  417   TSSTIDSEGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVPPAELEALLLTHPEIADA  476

Query  463   AVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSA  284
             AV      EVG+ P+A+VVKK GS   LS+ +V++FV+KQVAPYK+VR+V F  SIPK+ 
Sbjct  477   AVIPFPDREVGQFPMAYVVKKTGS--LLSEKSVMEFVSKQVAPYKRVRKVAFVSSIPKNP  534

Query  283   SGKILRKELRNL  248
             SGKILRK+L  L
Sbjct  535   SGKILRKDLIKL  546



>ref|XP_009774473.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Nicotiana sylvestris]
Length=556

 Score =   422 bits (1085),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 247/553 (45%), Positives = 357/553 (65%), Gaps = 28/553 (5%)
 Frame = -2

Query  1840  YSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVNS  1661
             YS     + SK   + LP++  LDV +FI SR H G  A +D+ +G  +++ ++ + V S
Sbjct  16    YSPADSTFYSKRDPIPLPANEALDVTTFISSRAHRGKVAFIDATTGQQLTFSDVWNAVES  75

Query  1660  MAAGLH-RMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             +A  L   MG+ +G+V L+L PNSIYFP++ L ++S+GA+  T NPL+T  EI KQ  D 
Sbjct  76    LATCLSIDMGIRKGNVVLLLSPNSIYFPIVCLAVMSLGAIITTTNPLNTPREINKQIKDS  135

Query  1483  NVRLAFATPDRVQNLGSTLGIPVI-------GLPESLNLD----SPFRKLISSDPKLAP-  1340
             N  +AF  P+ +  L  +  +P+I        L +  N +         LI   P  +  
Sbjct  136   NPVIAFTIPELLPKLVDS-NLPIILINNQTTNLTQKDNFNFKILGNLENLIQKKPVQSRL  194

Query  1339  TPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLDV  1163
               R+ Q DTA +L+SSGTTG  K V  +H N IAMV+  V RF+  Q E       ++  
Sbjct  195   KERVTQDDTATLLYSSGTTGASKGVVSSHRNLIAMVQTIVGRFKLDQGE-----QTFICT  249

Query  1162  LPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKA  983
             +PM+H+YGL+ F  GLL+ GSTVVV+ K+E+DE++ +I +Y  T+ P+ PP+LVAL   A
Sbjct  250   VPMFHIYGLAAFAAGLLASGSTVVVLSKFEMDEMLLSIHKYKATYLPLVPPILVALVNNA  309

Query  982   KA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAK  809
             +    K  L SLK+V SG AP+S   I+ F+  +P +  +QGYG+TESTA+G    +  +
Sbjct  310   EVIKKKYDLSSLKKVLSGGAPLSKEVIEGFLEKYPSVAILQGYGLTESTAIGASTDSLEE  369

Query  808   LRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAV  629
              R Y + G+L+P+M A++VD      G + P    GELWLRGP IMKGY +N EA+ + +
Sbjct  370   SRRYGTAGMLSPSMSAKIVD---PESGKAFPVNKTGELWLRGPTIMKGYFSNEEATASTL  426

Query  628   DDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSA  449
             D +GWL TGD+ + DEDG+++V DRLKE+IKYKG+Q+ PA+LEA+L++HP+I DAAV   
Sbjct  427   DSEGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVPPAELEALLLTHPEISDAAVIPF  486

Query  448   QSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKIL  269
               ++VG+ P+A+VV+K GS  SLS++ V+DF+AKQVAPYK++RRV F  SIPK+ SGKIL
Sbjct  487   PDKDVGQFPMAYVVRKSGS--SLSESAVMDFIAKQVAPYKRIRRVAFVASIPKNPSGKIL  544

Query  268   RKELRNLLITSKI  230
             RK+L   L TSK+
Sbjct  545   RKDLIK-LATSKL  556



>gb|EAY88402.1| hypothetical protein OsI_09863 [Oryza sativa Indica Group]
Length=565

 Score =   422 bits (1084),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 253/570 (44%), Positives = 351/570 (62%), Gaps = 52/570 (9%)
 Frame = -2

Query  1840  YSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPEL--RSLV  1667
             Y + T  +RS+   V LP+DP +DVVSF+ SR H G+ ALVD+ +G  I++ EL      
Sbjct  15    YCAATRTFRSRRADVPLPADPEVDVVSFLASRRHSGVVALVDAATGRRITFTELWRAVAG  74

Query  1666  NSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFD  1487
              + A   H + + +G VALIL PNS++FPV  L  +S+GAV  T NPL+T +EI KQ  D
Sbjct  75    AASALAAHPVSLRKGHVALILSPNSVHFPVAALAAMSLGAVLTTANPLNTPAEIAKQVAD  134

Query  1486  CNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPFRKLISSDPKL--------APTP-  1334
                 LAF T + +  L     + V+ L ES  L        SSDP++        A TP 
Sbjct  135   ARPVLAFTTRELLPKLPRAHDLRVVLL-ESARLPGD-----SSDPRIVATIEEISATTPD  188

Query  1333  ------RIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV---RFEASQYEYPATA  1181
                   R+ Q D A +L+SSGTTG  K V  TH + I+MV++ +   R E S        
Sbjct  189   PARRKDRVTQDDPATLLYSSGTTGPSKGVVATHRSLISMVQIIMTRFRLEGSD-----KT  243

Query  1180  NVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLV  1001
               +L  +PM+HVYGL  F  GLL  G+TVVV+ KYE+ E++R+I+ YGVT+ P+ PP+LV
Sbjct  244   ETFLCTVPMFHVYGLVAFATGLLGCGATVVVLSKYELPEMLRSINAYGVTYLPLVPPILV  303

Query  1000  ALTRKAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGF  821
             A+    K    G   +++V SG AP+    I+ F   +P ++ +QGYG+TESTA+G    
Sbjct  304   AMVAHPKPLPLG--QMRKVLSGGAPLGKELIEGFREKYPQVEILQGYGLTESTAIGASTD  361

Query  820   NTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMK---------  668
             +  + R Y + GLL+PN EA++VD      G +LP    GELW+RGP +MK         
Sbjct  362   SAEESRRYGTAGLLSPNTEAKIVD---PDSGEALPVNRTGELWIRGPYVMKVASIFIQNE  418

Query  667   ----GYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLE  500
                  Y  N EA+++ +  DGWL TGD+ + DEDGYL+V DRLKE+IKYKG+Q+ PA+LE
Sbjct  419   FHGISYFKNAEATQSTLTPDGWLKTGDLCYIDEDGYLFVVDRLKELIKYKGYQVPPAELE  478

Query  499   AVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVR  320
             A+L++HP++ D AV      EVG+ P+A++V+KKGS  +LS+  V++FVAKQVAPYKKVR
Sbjct  479   ALLLTHPEVTDVAVIPFPDREVGQFPMAYIVRKKGS--NLSEREVMEFVAKQVAPYKKVR  536

Query  319   RVYFTKSIPKSASGKILRKELRNLLITSKI  230
             +V F   IPK+ASGKILRK+L   L TSK+
Sbjct  537   KVAFVTDIPKNASGKILRKDLIK-LATSKL  565



>ref|XP_009413046.1| PREDICTED: 4-coumarate--CoA ligase-like 4 [Musa acuminata subsp. 
malaccensis]
Length=552

 Score =   421 bits (1082),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 239/547 (44%), Positives = 348/547 (64%), Gaps = 21/547 (4%)
 Frame = -2

Query  1840  YSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVNS  1661
             Y      + SK P + LP+DP L V +F+ SR H G +A +D+ +G  +S+  L   V +
Sbjct  17    YCDANSTFYSKRPPIALPADPNLSVTAFLASRRHSGTTAFIDAATGHRVSFTALWRSVAA  76

Query  1660  MAAGLHR--MGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFD  1487
             +A  L    + V +  V L+L PNS++FPV+ L ++S+GAV  T NPL+T  EI +Q  D
Sbjct  77    VATALASPPLSVRKPHVVLLLSPNSVHFPVVSLAVMSLGAVLTTTNPLNTPVEIGRQLAD  136

Query  1486  CNVRLAFATPDRVQNLGSTLGIPVIGLPESLN------LDSPFRKLISSDPKLAPTP-RI  1328
                 LAF T   +  L S   + ++ L +         + +   ++I+++P  A T   +
Sbjct  137   SCPVLAFTTRALIPKLASAPDLRIVLLDDRRRPSDDRRIVATIGEMIATEPDPARTAGAV  196

Query  1327  RQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLDVLPMY  1151
              Q DTA +L+SSGTTG  K V  TH N IAMV++ + RF+      P T   ++  +PM+
Sbjct  197   SQDDTATLLYSSGTTGTSKGVVATHRNLIAMVQIVLNRFKLEDGAEPET---FICTVPMF  253

Query  1150  HVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADK  971
             HV+GL  F  GLL  GSTVVV+ K+E+ E+VRAI+ YG T+ P+ PP+LVA+  +++   
Sbjct  254   HVFGLVAFATGLLGSGSTVVVLSKFELGEMVRAINEYGATYLPLVPPILVAMANQSRPLP  313

Query  970   CGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTS  791
              G   L++  SG AP+S   I+ F   +P ++ +QGYG+TE+T +G    +  + R Y +
Sbjct  314   LG--RLRRALSGGAPLSREVIEGFREKYPAVEILQGYGLTETTGIGASTDSAEESRRYGT  371

Query  790   VGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWL  611
              G+L+PN EAR+VD      G++LP    GELWLRGP +MK Y    EA++  + +DGWL
Sbjct  372   AGMLSPNTEARIVD---PDSGAALPVNRTGELWLRGPYVMKEYFKKPEATRTTLVEDGWL  428

Query  610   HTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVG  431
              TGD+ + DEDGYL+V DRLKE+IKYKG+Q+APA+LEA+L++HPDI DAAV     +E G
Sbjct  429   RTGDLCYIDEDGYLFVVDRLKELIKYKGYQVAPAELEALLLTHPDIADAAVIPYPDKEAG  488

Query  430   EIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRN  251
             +IP+A+VV+K GS  +LS+  VI FV +QVAPYK++R+V F  +IPK+ SGKILRK+L  
Sbjct  489   QIPMAYVVRKDGS--NLSEEEVIKFVGRQVAPYKRIRKVAFVSAIPKNPSGKILRKDLVK  546

Query  250   LLITSKI  230
              L TSK+
Sbjct  547   -LATSKL  552



>gb|EMT13889.1| 4-coumarate--CoA ligase-like protein 3 [Aegilops tauschii]
Length=341

 Score =   413 bits (1062),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 213/331 (64%), Positives = 258/331 (78%), Gaps = 8/331 (2%)
 Frame = -2

Query  1237  MVELFVRFEASQYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevv  1058
             MVELFVRFEASQY  PA  NVYL  LPM+HVYGLSLF  GLLSLGSTVVV+R+++V E V
Sbjct  1     MVELFVRFEASQYARPACDNVYLAALPMFHVYGLSLFAAGLLSLGSTVVVMRRFDVGEAV  60

Query  1057  RAIDRYGVTHFPVAPPLLVALTRKAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHI  878
             RA+ RY VTH P+ PP++ AL R        L SL QVSSGAAP+S   +Q+F++ FPH+
Sbjct  61    RAVHRYKVTHLPLVPPIMAALLRAKATGASSLDSLVQVSSGAAPLSGKLVQDFIKAFPHV  120

Query  877   DFIQGYGMTESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGE  698
             DFIQGYGMTESTAVGTRGFNT+K + Y SVGLLAPNM A++VDL     G  LPP S GE
Sbjct  121   DFIQGYGMTESTAVGTRGFNTSKHKKYASVGLLAPNMHAKIVDL---ETGLCLPPGSCGE  177

Query  697   LWLRGPAIMKGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQI  518
             LWL GPAIMKGYLN+ +       +DGWL TGD+ +FD DG LY+  RLK+ IKYKGFQI
Sbjct  178   LWLHGPAIMKGYLNDEDTCTR---NDGWLRTGDLAYFDSDGCLYIVGRLKDTIKYKGFQI  234

Query  517   APADLEAVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVA  338
             APADLEAVL+ HP+IVD AVTSA+ EE GEIPVAFVV++ GS ++  Q  V+++VAKQV+
Sbjct  235   APADLEAVLVQHPEIVDVAVTSAEDEEAGEIPVAFVVRRSGSRLTCVQ--VMEYVAKQVS  292

Query  337   PYKKVRRVYFTKSIPKSASGKILRKELRNLL  245
             PYKKVR+V F ++IPKSA+GK+LR+ L++ L
Sbjct  293   PYKKVRKVIFVEAIPKSAAGKVLRRLLKDSL  323



>ref|XP_010422413.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Camelina sativa]
Length=543

 Score =   420 bits (1080),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 229/536 (43%), Positives = 342/536 (64%), Gaps = 23/536 (4%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFIL--SRNHGGLSALVDSQSGFSISYPELRSLVNSMAA  1652
             GIYRS  P++ LP DP   +VSF+   S ++    AL DS +G S+++ +L+S V  +A 
Sbjct  10    GIYRSLRPTLVLPKDPNTSLVSFLFRNSSSYPSKLALADSDTGESLTFSQLKSAVARLAH  69

Query  1651  GLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRL  1472
             G HR+GV + DV LI  PNS  FP+ FL + ++G V  T NPL T++E+ KQ  D N ++
Sbjct  70    GFHRLGVRKNDVVLIFAPNSYQFPLCFLAVTAIGGVFTTANPLYTVNEVSKQVKDSNPKI  129

Query  1471  AFATP---DRVQNLGSTLGIPVIGLPESLNLDSPFRKLISSDPKLA--------PTPRIR  1325
               +     D+V+  G  L + ++G  +S+ +     K++S +  +         P   I+
Sbjct  130   IISVNQLFDKVK--GFDLPVVLLGSGDSVQIPKSNSKILSFNNVMELSGPVSEFPYVEIK  187

Query  1324  QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHV  1145
             Q DTAA+L+SSGTTG  K V LTH NFIA   +    +    EY     VYL  LPM+HV
Sbjct  188   QSDTAALLYSSGTTGTSKGVELTHGNFIAASLMVTMDQDLMGEYDG---VYLCFLPMFHV  244

Query  1144  YGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCG  965
             +GL++     L  G+ +V + ++E++ V++ I++Y VTH  V PP+ +AL++++   K  
Sbjct  245   FGLTVIAYSQLQRGNALVSMARFELELVLKNIEKYRVTHLWVVPPVFLALSKQSIVKKFD  304

Query  964   LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVG  785
             L SLK + SGAAP+    ++   R  P++  +QGYGMTE+  + +        RN  S G
Sbjct  305   LSSLKYIGSGAAPLGKDLMEECGRNIPNVLLMQGYGMTETCGIVSVEDPRLGKRNSGSAG  364

Query  784   LLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHT  605
             +LAP +EA++V + +       PP  +GE+W+RGP +MKGYLNN +A+K  +D  GW+HT
Sbjct  365   MLAPGVEAQIVSVETAKLQ---PPNQLGEIWVRGPNMMKGYLNNPQATKETIDKKGWVHT  421

Query  604   GDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEI  425
             GD+ +F+E+G LYV DR+KE+IKYKGFQ+APA+LE +L+SHP+I+DA V     EE GE+
Sbjct  422   GDLGYFNEEGNLYVVDRIKELIKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDEEAGEV  481

Query  424   PVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             P+AFVV+   S  S+++ ++  F+AKQVAPYK++RRV F  S+PKSA+GKILR+EL
Sbjct  482   PIAFVVRSPNS--SITEQDIQKFIAKQVAPYKRLRRVSFINSVPKSAAGKILRREL  535



>ref|XP_002532625.1| AMP dependent CoA ligase, putative [Ricinus communis]
 gb|EEF29756.1| AMP dependent CoA ligase, putative [Ricinus communis]
Length=572

 Score =   421 bits (1082),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 237/553 (43%), Positives = 345/553 (62%), Gaps = 28/553 (5%)
 Frame = -2

Query  1861  KGRRSCFYSS----ETGIYRSKH---PSVHLPSDPFLDVVSFILSR-----NHGGLSALV  1718
             K RR  F+ S    +TGIY S H    S+ +P+   LD  S++LS+     N     AL+
Sbjct  18    KARRPPFHQSGFDPQTGIYHSLHQLGESLRIPTRHDLDTASYVLSQFPHPDNAESRVALI  77

Query  1717  DSQSGFSISYPELRSLVNSMAAGL-HRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVA  1541
             D  +   +SY  L   + ++A+GL H + V +GDV L++ PN+I +P I L + S+GA+ 
Sbjct  78    DLATDHRLSYASLHRSIRALASGLYHGLRVRKGDVVLVVSPNTILYPTICLAIFSIGAIL  137

Query  1540  ATMNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDS---PFRK  1370
             +  NP++T SE+ KQ  D   +L  + P+ +  L    G+P++ L   +  DS      +
Sbjct  138   SPANPINTESELAKQILDSGAKLIISAPEELHKLNQN-GVPIV-LTTRITNDSNSVSIEE  195

Query  1369  LISS-DPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEY  1193
             LI   DP  +P  RI Q DTAAVL+SSGTTG  K V LTHANFIA++ L    + S Y  
Sbjct  196   LIECCDPVESPQVRIMQSDTAAVLYSSGTTGTSKGVILTHANFIAIMTLL---KWSVYAT  252

Query  1192  PATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAP  1013
              +  +V+L  +PM+H+YGL+ F +GL   G T V+++++++  ++ AI  + V + P  P
Sbjct  253   SSQNDVFLCFIPMFHIYGLAFFGLGLFCAGITTVLMQRFDLQAMLDAIKIHQVNNIPAVP  312

Query  1012  PLLVALTRKAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVG  833
             P+++ L + A   +C L SL++V SGAAP+S    Q F   FP ++  QGYG+TES A  
Sbjct  313   PVILGLVKHASKLQCDLSSLRRVGSGAAPLSKELTQEFRLRFPWVELRQGYGLTESCAAA  372

Query  832   TRGFNTAKLRNYT-SVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLN  656
             T   +  + + +  S G L P   A++VD  +G     LPP   GE+WL+   IMKGYL 
Sbjct  373   TFFASDEQAKAHPGSCGRLVPTFTAKIVDFETGMA---LPPLKEGEVWLKSGTIMKGYLR  429

Query  655   NGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPD  476
             N EA+   +D DGWL TGD+ +F EDG+LY+ DR+KE+IK+ G+Q+APA+LEA+L++HP 
Sbjct  430   NEEATAATLDSDGWLKTGDLGYFHEDGFLYIVDRIKELIKHNGYQVAPAELEAILLTHPQ  489

Query  475   IVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSI  296
             ++DAAV   + EE G+IP+A+VV+   +E  L++  VI FVA QVAPYKKVRRV F  +I
Sbjct  490   VLDAAVIPLEDEEAGQIPMAYVVRAASAE--LTEEQVIQFVASQVAPYKKVRRVSFISAI  547

Query  295   PKSASGKILRKEL  257
             PKSA+GKILRKEL
Sbjct  548   PKSAAGKILRKEL  560



>ref|XP_006488032.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Citrus sinensis]
Length=545

 Score =   420 bits (1080),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 237/540 (44%), Positives = 344/540 (64%), Gaps = 29/540 (5%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFIL--SRNHGGLSALVDSQSGFSISYPELRSLVNSMAA  1652
             GIYRS  P + LPS+P L +V F+   S ++    AL+D+ SG S+++ +L+S V   + 
Sbjct  10    GIYRSLRPPLVLPSEPNLSMVHFLFRNSASYPSKPALIDADSGESLTFSQLKSTVIKASH  69

Query  1651  GLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRL  1472
             G   +G+++ DV +I  PNSI FPV FLG+++ GA+A T NP+ ++SE+ KQ  D N +L
Sbjct  70    GFRHLGITKNDVVMIFAPNSIQFPVCFLGVIATGAIATTANPVYSVSELSKQVIDSNPKL  129

Query  1471  AFATP---DRVQN-------LGSTLGIPVIGLPESLNLDSPFRKLISSDPKLA--PTPRI  1328
                 P   D+V++       LGS   +   GL  S  +   F  LI     ++  P   I
Sbjct  130   IVTVPELWDKVKDFNLPAVLLGSKSKLASCGLSSSSKIVH-FHDLIELSGNISNFPDVSI  188

Query  1327  RQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFE---ASQYEYPATANVYLDVLP  1157
             +Q DTAA+L+SSGTTG  K V LTH NFIA   L V  +   A + +Y     V+L VLP
Sbjct  189   KQTDTAALLYSSGTTGVSKGVILTHKNFIAS-SLMVTMDQETAGELDY-----VFLCVLP  242

Query  1156  MYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKA  977
             ++HV+GL++   G L  G+ ++++ K++++  +RAI+++ VTH  V PPL++AL +    
Sbjct  243   LFHVFGLAVITCGQLQKGNCIILMAKFDLEMFLRAIEKFRVTHIWVVPPLILALAKHGLV  302

Query  976   DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNY  797
              K  L SLK V SGAAP+    ++   +  P    IQGYG+TE++ + T   + A  RN 
Sbjct  303   KKFDLSSLKLVGSGAAPLGKELMEECAKNVPSATVIQGYGLTETSGIATMENSFAGSRNI  362

Query  796   TSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDG  617
              S G LAP +EA +V + +      LPP  +GE+WLRGP +M+GY NN +A+K  +D  G
Sbjct  363   GSAGALAPGVEALIVSVDTQKP---LPPNQLGEIWLRGPNMMRGYYNNEQATKLTIDKKG  419

Query  616   WLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEE  437
             W+HTGD+ +FD DG LYV DR+KE+IKYKGFQ+APA+LE +L+SHP+I+DA V      E
Sbjct  420   WVHTGDLGYFDGDGQLYVVDRIKELIKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDAE  479

Query  436   VGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
              GE+P+A+VV+   S  SL++ +V  F+AKQVAP+K++RRV F  S+PKSASGKILR+EL
Sbjct  480   AGEVPLAYVVRSPNS--SLTEEDVQKFIAKQVAPFKRLRRVTFINSVPKSASGKILRREL  537



>ref|XP_006396627.1| hypothetical protein EUTSA_v10028562mg [Eutrema salsugineum]
 gb|ESQ38080.1| hypothetical protein EUTSA_v10028562mg [Eutrema salsugineum]
Length=543

 Score =   419 bits (1078),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 231/535 (43%), Positives = 342/535 (64%), Gaps = 21/535 (4%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFIL--SRNHGGLSALVDSQSGFSISYPELRSLVNSMAA  1652
             GIYRS  P++ LP DP   +VSF+   + ++    ALVDS SG ++S+ +L+S V+ +A 
Sbjct  10    GIYRSLRPTLVLPKDPNTSLVSFLFRNTSSYPSKPALVDSDSGDTLSFSQLKSAVSRLAH  69

Query  1651  GLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRL  1472
             G  R+GV + DV L   PNS  FP+ FL +  +G V  T+NPL T+SE  KQ  DCN ++
Sbjct  70    GFIRLGVRKHDVVLTFAPNSYKFPLCFLAVTGIGGVFTTVNPLYTVSEFSKQINDCNPKI  129

Query  1471  AFATPDRVQNLGSTLGIPVIGLPESLNLD-SPFRKLISSDPKLA--------PTPRIRQQ  1319
               +       +    GIP++ L ES+ +  S   K++S +  +         P+ +I+Q 
Sbjct  130   IISVHQLFDKI-KGFGIPIVLLEESVQIHGSKNSKILSFENVMELSGPVSDLPSVQIKQS  188

Query  1318  DTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVYG  1139
             DTAA+L+SSGTTG  K V LTH NFIA   +    +    EY     V+L  LPM+HV+G
Sbjct  189   DTAALLYSSGTTGTSKGVELTHGNFIAASLMATMDQDLMGEY---HGVFLCFLPMFHVFG  245

Query  1138  LSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCGLK  959
             L++     L  G+ V+ + K+E++ +++ I++Y VT   V PP+ +AL++++   K  L 
Sbjct  246   LAVITYSQLQRGNAVISMAKFELETLLKNIEKYRVTQLLVVPPVFIALSKQSIVRKYDLS  305

Query  958   SLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAV-GTRGFNTAKLRNYTSVGL  782
             SLK + SGAAP+    ++   R  P++  +QGY MTE+  V      +    RN  S G+
Sbjct  306   SLKYIGSGAAPLGKDLMEECARNIPNVVLMQGYAMTETCGVVSVENPSILGKRNSGSAGM  365

Query  781   LAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTG  602
             LAP +EAR+V + SG     +PP  +GE+W+RGP +MKGY NN +A+K  +D+ GW+HTG
Sbjct  366   LAPCVEARIVSIDSGNF---MPPNQLGEIWVRGPNMMKGYHNNPKATKETIDEQGWVHTG  422

Query  601   DIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIP  422
             D+ +F+EDG L+V DR+KE+IKYKGFQ+APA+LE +L+SHP+++DA V     EE GE+P
Sbjct  423   DLGYFNEDGNLFVVDRIKELIKYKGFQVAPAELEGLLLSHPELLDAVVIPLPDEEAGEVP  482

Query  421   VAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             +AFVV+   S  S+++ ++  F+AKQVAPYK++RRV F  S+PKSASGKILR+EL
Sbjct  483   IAFVVRSPNS--SITEEDIQKFIAKQVAPYKRLRRVSFISSVPKSASGKILRREL  535



>gb|KFK32221.1| hypothetical protein AALP_AA6G213500 [Arabis alpina]
Length=542

 Score =   419 bits (1078),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 236/535 (44%), Positives = 335/535 (63%), Gaps = 22/535 (4%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLS---ALVDSQSGFSISYPELRSLVNSMA  1655
             GIYRS  P + LP DP   +VSF+  RN    S   AL DS SG S ++ +L+S V+ +A
Sbjct  10    GIYRSLRPMLTLPKDPNTSLVSFLF-RNSSSYSSNLALADSDSGHSFTFSDLKSAVSRLA  68

Query  1654  AGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVR  1475
              G  R+G+ + DV LI  PNS  FP+ FL + ++G V  T NPL T++EI KQ  D N +
Sbjct  69    NGFLRLGIRKHDVVLIFAPNSYQFPLCFLAVTAIGGVFTTANPLYTVNEISKQIKDSNPK  128

Query  1474  LAFATPDRVQNLGSTLGIPVIGLPESLNLDSPFRKLISSDPKLA---------PTPRIRQ  1322
             +  +       +     +PV+ L    +L  P  K I S   +          P   ++Q
Sbjct  129   IIISVAQLFDTIKG-FDLPVVLLGSGDSLQVPESKKIYSFDNVMNLSEAVSDLPLVDVKQ  187

Query  1321  QDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVY  1142
              DTAA+L+SSGTTG  K V LTH NFIA   L V  +     +     V+L  LPM+HV+
Sbjct  188   SDTAALLYSSGTTGVSKGVELTHGNFIA-ASLMVTMDQDLMGW--NHGVFLCFLPMFHVF  244

Query  1141  GLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCGL  962
             GL++     L  G+ V+ + K+E++ V++ I++Y VTH  V PP+ +ALT+     K  L
Sbjct  245   GLAVITYSQLQRGNAVISMAKFELELVLKNIEKYRVTHLWVVPPVFIALTKYKNVKKFDL  304

Query  961   KSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGL  782
              SLK ++SGAAP+    ++   R  P++   QGYGMTE+T + +        RN  S G+
Sbjct  305   SSLKYLASGAAPLGKDLMEECARNMPNLVLTQGYGMTETTGIVSIEDTRFGKRNSGSAGM  364

Query  781   LAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTG  602
             LAP +EA++V + +G      PP  +GE+W+RGP +MKGYLNN +A+K  +D  GW+HTG
Sbjct  365   LAPGIEAQIVSVETGKYQ---PPNQLGEVWVRGPNMMKGYLNNPKATKETIDSKGWVHTG  421

Query  601   DIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIP  422
             D+ +F+EDG L+V DR+KE+IKYKGFQ+APA+LE +L+SHP+I+DAAV     EE GE+P
Sbjct  422   DLGYFNEDGNLFVVDRIKELIKYKGFQVAPAELEDLLVSHPEILDAAVIPFPDEEAGEVP  481

Query  421   VAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             +AFVV+   S  S+++ ++ DFVAKQVAPYK++RRV F  S+PKSA+GKILR+EL
Sbjct  482   IAFVVRSPNS--SITEKDIQDFVAKQVAPYKRLRRVSFINSVPKSAAGKILRREL  534



>ref|XP_006424490.1| hypothetical protein CICLE_v10028138mg [Citrus clementina]
 gb|ESR37730.1| hypothetical protein CICLE_v10028138mg [Citrus clementina]
Length=545

 Score =   419 bits (1078),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 237/540 (44%), Positives = 343/540 (64%), Gaps = 29/540 (5%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFIL--SRNHGGLSALVDSQSGFSISYPELRSLVNSMAA  1652
             GIYRS  P + LPS+P L +V F+   S ++    AL+D+ SG S+++ +L+S V   + 
Sbjct  10    GIYRSLRPPLVLPSEPNLSMVHFLFRNSASYPSKPALIDADSGESLTFSQLKSTVIKASH  69

Query  1651  GLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRL  1472
             G   +G+++ DV +I  PNS  FPV FLG+++ GA+A T NP+ ++SE+ KQ  D N +L
Sbjct  70    GFRHLGITKNDVVMIFAPNSTQFPVCFLGVIATGAIATTANPVYSVSELSKQVIDSNPKL  129

Query  1471  AFATP---DRVQN-------LGSTLGIPVIGLPESLNLDSPFRKLISSDPKLA--PTPRI  1328
                 P   D+V++       LGS   +   GL  S  +   F  LI     ++  P   I
Sbjct  130   IVTVPELWDKVKDFNLPAVLLGSKSKLASCGLSSSSKIVH-FHDLIELSGNISNFPDVSI  188

Query  1327  RQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFE---ASQYEYPATANVYLDVLP  1157
             +Q DTAA+L+SSGTTG  K V LTH NFIA   L V  +   A + +Y     V+L VLP
Sbjct  189   KQTDTAALLYSSGTTGVSKGVILTHKNFIAS-SLMVTMDQETAGELDY-----VFLCVLP  242

Query  1156  MYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKA  977
             ++HV+GL++   G L  GS ++++ K++++  +RAI+++ VTH  V PPL++AL +    
Sbjct  243   LFHVFGLAVITCGQLQKGSCIILMAKFDLEMFLRAIEKHRVTHIWVVPPLILALAKHGLV  302

Query  976   DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNY  797
              K  L SLK V SGAAP+    ++   +  P    IQGYG+TE++ + T   + A  RN 
Sbjct  303   KKFDLSSLKLVGSGAAPLGKELMEECAKNVPSATVIQGYGLTETSGIATMENSFAGSRNI  362

Query  796   TSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDG  617
              S G LAP +EA +V + +      LPP  +GE+WLRGP +M+GY NN +A+K  +D  G
Sbjct  363   GSAGALAPGVEALIVSVDTQKP---LPPNQLGEIWLRGPNMMQGYYNNEQATKLTIDKKG  419

Query  616   WLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEE  437
             W+HTGD+ +FD DG LYV DR+KE+IKYKGFQ+APA+LE +L+SHP+I+DA V      E
Sbjct  420   WVHTGDLGYFDGDGQLYVVDRIKELIKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDAE  479

Query  436   VGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
              GE+P+A+VV+   S  SL++ +V  F+AKQVAP+K++RRV F  S+PKSASGKILR+EL
Sbjct  480   AGEVPIAYVVRSPNS--SLTEEDVQKFIAKQVAPFKRLRRVTFINSVPKSASGKILRREL  537



>gb|KDP45075.1| hypothetical protein JCGZ_01575 [Jatropha curcas]
Length=577

 Score =   421 bits (1081),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 232/545 (43%), Positives = 347/545 (64%), Gaps = 24/545 (4%)
 Frame = -2

Query  1840  YSSETGIYRSKH---PSVHLPSDPFLDVVSFILSR----NHGGLS-ALVDSQSGFSISYP  1685
             + S TGIY + H       +P+   LD   ++LS+    +H     AL+D+ S   ++Y 
Sbjct  34    FDSSTGIYHTLHQLGEDFQIPTRHDLDTCRYVLSQFPHPDHAESKIALIDAYSNRQVTYA  93

Query  1684  ELRSLVNSMAAGL-HRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSE  1508
             +L   + ++AAGL H +GV +GD+  ++ PNSI +P I L + S+GA+ +  NP++T SE
Sbjct  94    QLHRSIRALAAGLYHCLGVQKGDMVFVVSPNSILYPTICLAIFSIGAILSPANPINTESE  153

Query  1507  IKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPF--RKLISS-DPKLAPT  1337
             I KQ  D   +L  + P+    L  + G+P++    + + ++     +LI   DP   P 
Sbjct  154   ITKQILDSGAKLIISAPEEQDKLKRS-GVPILLTTRTSDQNNSLSIEELIECCDPVEFPR  212

Query  1336  PRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLP  1157
              ++ Q DTAA+L+SSGTTG  K V LTHANFI+++ L    + S Y   +  +V+L  +P
Sbjct  213   VKLTQSDTAAILYSSGTTGISKGVILTHANFISIMTLL---KWSVYATSSQNDVFLCFIP  269

Query  1156  MYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKA  977
             ++H+YGL+ F +GL   G T V+++K++   ++ A+  + V + P  PP+++AL + A  
Sbjct  270   IFHIYGLAFFGLGLFCAGITTVLMQKFDFQAMLDAVQAHKVNNIPAVPPVILALVKYANK  329

Query  976   DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNT--AKLR  803
               C L SL++V SGAAP+S    + F + FP ++  QGYG+TES A  T   +   AK R
Sbjct  330   INCDLSSLRRVGSGAAPLSKELNEEFRKRFPWVELRQGYGLTESCAAATFYVSNEHAKAR  389

Query  802   NYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDD  623
             +  S G L P+  A++VD+ +G     LPP   GE+WL+ P IMKGYL N EA+ + +D 
Sbjct  390   S-GSCGRLVPSFSAKIVDIETGLA---LPPCREGEVWLKSPTIMKGYLRNKEATDSTLDS  445

Query  622   DGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQS  443
             DGWL TGD+ +FDEDG+LY+ DR+KE+IK+ G+Q+APA+LEA+L++HP ++DAAV   + 
Sbjct  446   DGWLRTGDLGYFDEDGFLYIVDRIKELIKHNGYQVAPAELEAILLNHPHVLDAAVIPVED  505

Query  442   EEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRK  263
             EE G+IP+A+VV+  GSE  L++  VI FVA QVAPYKKVRRV F  +IPKSA+GKILRK
Sbjct  506   EEAGQIPMAYVVRATGSE--LNEEQVIRFVASQVAPYKKVRRVSFITAIPKSAAGKILRK  563

Query  262   ELRNL  248
             EL  L
Sbjct  564   ELVTL  568



>ref|XP_002307770.1| 4-coumarate--CoA ligase family protein [Populus trichocarpa]
 gb|EEE94766.1| 4-coumarate--CoA ligase family protein [Populus trichocarpa]
Length=554

 Score =   420 bits (1079),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 240/555 (43%), Positives = 356/555 (64%), Gaps = 26/555 (5%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  S +  Y  + P + LP   FLDV +FI SR H G +A +D+ +G  +S+ +L  
Sbjct  12    RSGFCKSNSVFYSKRKP-IPLPLTDFLDVTTFISSRPHHGKTAFIDAATGRHLSFKDLWK  70

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V+S++  L+ MG+ +G V L+L PNSI+FP++ L ++S+GAV  T NPL+T  EI KQ 
Sbjct  71    AVDSVSTCLYDMGIRKGHVILLLSPNSIFFPIVCLSVMSLGAVITTTNPLNTPREIAKQI  130

Query  1492  FDCNVRLAFATPDRVQNL---GSTLGIPVI--GLPE-SLNLDSPFRKLISSDPKLAPTP-  1334
              +    LAF TP+ +  L    S L I +I  G+ + S   ++     +S   K  P+  
Sbjct  131   ANSKPSLAFTTPELLAKLTESNSNLTIILIDDGITDASTKTNAKIVTTLSEMVKKEPSGI  190

Query  1333  RIRQQ----DTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYL  1169
             R+R+Q    DTA +L+SSGTTG  K V  +H N IAMV+  V RF  ++ ++      ++
Sbjct  191   RVREQVNQDDTATLLYSSGTTGESKGVVSSHKNLIAMVQTIVERFRLNEGDHK-----FI  245

Query  1168  DVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTR  989
               +PM+H+YGL+ F  G+L+ GSTV+V+ K+E+ E++  I +Y  T+ P+ PP+LVAL  
Sbjct  246   CTVPMFHIYGLAAFATGILAAGSTVIVLSKFEMGEMLSTIVKYRATYLPLVPPILVALIN  305

Query  988   KAKA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNT  815
              A    ++  L SL  V SG AP+S   ++ F   +P +  +QGYG+TES  +G      
Sbjct  306   GADQLRERYDLSSLNFVLSGGAPLSKEMVEGFSEKYPGVTILQGYGLTESAGIGASTDTL  365

Query  814   AKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKN  635
              + R Y + GLL+PN EA++VD      G +L     GELWLR P++MKGY +N EA+ +
Sbjct  366   EESRRYGTAGLLSPNTEAKIVD---PESGKALLVNQTGELWLRAPSVMKGYFSNAEATSS  422

Query  634   AVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVT  455
              +D +GWL TGD+ + D+DG+++V DRLKE+IKYKG+Q+ PA+LEA+L++HP+I DAAV 
Sbjct  423   TIDSEGWLRTGDLCYIDDDGFIFVVDRLKELIKYKGYQVPPAELEALLLTHPEISDAAVI  482

Query  454   SAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGK  275
                 E+VG+ P+A+VV+K GS+  LS+  V+DF+A QVAPYK++RRV +  +IPK+ SGK
Sbjct  483   PFPDEQVGQFPMAYVVRKAGSK--LSEKAVMDFIAGQVAPYKRIRRVAYVAAIPKNPSGK  540

Query  274   ILRKELRNLLITSKI  230
             ILRK+L   L TSK+
Sbjct  541   ILRKDLIK-LATSKL  554



>gb|AHL44983.1| 4-coumarate:coenzyme A ligase 4 [Fraxinus mandshurica]
Length=543

 Score =   419 bits (1078),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 233/536 (43%), Positives = 342/536 (64%), Gaps = 23/536 (4%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLS---ALVDSQSGFSISYPELRSLVNSMA  1655
             GIYRS  P + LP DP L +VSF+  RN        ALVD  +G ++++ E +S+V+ ++
Sbjct  10    GIYRSLRPPLILPKDPNLSMVSFLF-RNISSFPDKPALVDFNTGQTLTFIEFKSVVSKVS  68

Query  1654  AGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVR  1475
              GL ++G+ + DV LI  PNSI FP+ F G++ +GA+A T+NP+ T+SE+ KQ  DC  +
Sbjct  69    YGLLQLGIKKKDVVLIYSPNSIQFPICFFGIIGIGAIATTVNPMYTISELSKQVQDCKPK  128

Query  1474  LAFATPDRVQNLGSTLGIPVIGLPESLNLDSP---------FRKLISSDPKL-APTPRIR  1325
             +     + +  +     +PVI L        P         F +L+ ++  +   +  I+
Sbjct  129   VIITVQELLPKV-KDFNLPVILLGTDKKPLEPIGKIPSIKLFTELVKNEGSVDLDSGIIK  187

Query  1324  QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHV  1145
             Q DTA +L+SSGTTG  K V L+H NFIA   L V   A Q       NV+L VLPM+HV
Sbjct  188   QNDTAVLLYSSGTTGTSKGVILSHRNFIA-ASLMV--TADQEWAGEMHNVFLCVLPMFHV  244

Query  1144  YGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCG  965
             +GL++ +   L  G++VV + K++++ +++AI++Y VTH  V PP+++AL +     K  
Sbjct  245   FGLAVIMYAQLQRGNSVVSMAKFDLEMILKAIEKYRVTHLWVVPPIILALAKNIVIKKYD  304

Query  964   LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVG  785
             L SLKQ+ SGAAP+    +Q   + FP    IQGYGMTE+  + +     A  R+  S G
Sbjct  305   LSSLKQIGSGAAPLGSELMQECAKNFPQAIVIQGYGMTETCGIVSIENQHAGPRHSGSTG  364

Query  784   LLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHT  605
             +L+P +E+++V +        LPP   GE+W+RGP +M+GY NN +A++  +D  GW+HT
Sbjct  365   MLSPGVESQIVSVDKLKP---LPPGQSGEIWVRGPNMMQGYFNNSQATRLTIDKQGWVHT  421

Query  604   GDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEI  425
             GDI +FDEDG LYV DR+KE+IKYKGFQIAPA+LE +L+SHP+I+DAAV      E GE+
Sbjct  422   GDIGYFDEDGQLYVVDRIKELIKYKGFQIAPAELEGLLVSHPEILDAAVIPFPDAEAGEV  481

Query  424   PVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             P+A+VV+   S  SL++ +V  F+A QVAP+K++RRV FT S+PKSASGKILR+EL
Sbjct  482   PIAYVVRSPNS--SLTEEDVQKFIADQVAPFKRLRRVTFTNSVPKSASGKILRREL  535



>ref|XP_002271586.3| PREDICTED: 4-coumarate--CoA ligase-like 5 [Vitis vinifera]
 emb|CAN70408.1| hypothetical protein VITISV_021990 [Vitis vinifera]
Length=569

 Score =   420 bits (1080),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 242/543 (45%), Positives = 343/543 (63%), Gaps = 28/543 (5%)
 Frame = -2

Query  1840  YSSETGIYRS--KHPSVH-LPSDPFLDVVSFILSR-----NHGGLSALVDSQSGFSISYP  1685
             + S TG+Y S  K    H +P+ P LD  +F+LS+           AL+DS +G  ++Y 
Sbjct  28    FDSRTGVYSSLIKLGGQHRVPTRPDLDTATFVLSQFPAPDCAESRVALIDSATGRRVTYA  87

Query  1684  ELRSLVNSMAAGL-HRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSE  1508
             ELR  +  +A GL H +G+ +GDV  +L PNS+ +P I L +LS+GAV  T NPL+T SE
Sbjct  88    ELRRSIRMLATGLYHGLGIRKGDVVFLLAPNSLLYPTICLAVLSIGAVLTTANPLNTQSE  147

Query  1507  IKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDS-PFRKLI-SSDPKL-APT  1337
             I KQ  D   ++A + P+ +  L  T G+P +    + + +S    +LI  SDP L  P 
Sbjct  148   ISKQVDDSGAKVAISAPEELHKLLQT-GVPTLLTHRTCDENSLSIEELIDCSDPALDLPP  206

Query  1336  PRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLP  1157
              ++ Q DTAA+L+SSGTTG  K V LTHA FIAM+ L    + S     +  +V+L  +P
Sbjct  207   AQMSQSDTAAILYSSGTTGTSKGVILTHAKFIAMMTLL---KWSVDITSSNNDVFLCFIP  263

Query  1156  MYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKA  977
             M+H+YGL+ F +GLL  G+T VV+ +++   ++ AI  Y V++ P  PP+++ L + + +
Sbjct  264   MFHIYGLAFFALGLLRSGTTTVVMPRFDSKAMLDAIQAYQVSNIPAVPPVILGLVKNSSS  323

Query  976   DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNT---AKL  806
               C L SL++V SGAAP+S    + F   FP ++   GYG+TES    T  F T   AK 
Sbjct  324   --CDLSSLRRVGSGAAPLSKEVAEGFREKFPWVELRTGYGLTESCGAATY-FVTDEQAKA  380

Query  805   RNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVD  626
             R  +S G L P   A+VVD      G +LPP   GELWL+ P +MKGYL N EA+   + 
Sbjct  381   RAGSS-GRLLPRFCAKVVD---TETGLALPPNREGELWLKSPTVMKGYLGNAEATAATIT  436

Query  625   DDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQ  446
              DGWL TGD+ +FDEDG+LY+ DR+KE+IK+ G+Q+APA+LEA+L+SHP ++DAAV   +
Sbjct  437   SDGWLRTGDLCYFDEDGFLYIVDRIKELIKHNGYQVAPAELEAILLSHPSVLDAAVIPVE  496

Query  445   SEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILR  266
              E  G+IP+A+VV+  GSE  L+Q  VI FVA QVAPYKKVR+V F  +IP+S +GKILR
Sbjct  497   DEAAGQIPMAYVVRAGGSE--LTQQEVIQFVAGQVAPYKKVRKVGFINAIPRSTAGKILR  554

Query  265   KEL  257
             K+L
Sbjct  555   KQL  557



>ref|XP_011041268.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Populus euphratica]
Length=554

 Score =   419 bits (1077),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 234/555 (42%), Positives = 352/555 (63%), Gaps = 26/555 (5%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  S +  Y  + P + LP   FLDV +FI SR H G +A +D+ +G  +S+ +L  
Sbjct  12    RSGFCKSNSVFYSKRKP-IPLPLTDFLDVTTFISSRPHHGKTAFIDAATGRHLSFKDLWK  70

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V+S++  L+ MG+ +G V L+L PNSI+FP++ L ++S+GAV  T NPL+T  EI KQ 
Sbjct  71    AVDSVSTCLYDMGIRKGHVILLLSPNSIFFPIVCLSVMSLGAVITTTNPLNTPREIAKQI  130

Query  1492  FDCNVRLAFATPDRVQNL---GSTLGIPVI-------GLPESLNLDSPFRKLISSDPK-L  1346
              +    LAF TP+ +  L    S L I +I              + +   +++  +P  +
Sbjct  131   ANSKPSLAFTTPELLAKLTESNSNLTIILIDDEITDASTKTKAKIVTTLSEMVKKEPSGI  190

Query  1345  APTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYL  1169
                 +++Q DTA +L+SSGTTG  K V  +H N IAMV+  V RF  ++ ++      ++
Sbjct  191   RVREQVKQDDTATLLYSSGTTGESKGVVSSHKNLIAMVQTIVERFRLNEGDHK-----FI  245

Query  1168  DVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTR  989
               +PM+H+YGL+ F  G+L+ GSTV+V+ K+E+ E++  I +Y  T+ P+ PP+LVAL  
Sbjct  246   CTVPMFHIYGLAAFATGILAAGSTVIVLSKFEMGEMLSTIVKYRATYLPLVPPILVALIN  305

Query  988   KAKA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNT  815
              A    ++  L SL  V SG AP+S   ++ F   +P +  +QGYG+TES  +G      
Sbjct  306   GADQIRERYDLSSLNFVLSGGAPLSKEMVEGFSEKYPGVTILQGYGLTESAGIGASTDTL  365

Query  814   AKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKN  635
              + R Y + GLL+PN EA++VD      G +L     GELWLR P++MKGY +N EA+ +
Sbjct  366   EESRRYGTAGLLSPNTEAKIVD---PESGKALLVNQTGELWLRAPSVMKGYFSNAEATSS  422

Query  634   AVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVT  455
              +D +GWL TGD+ + D+DG+++V DRLKE+IKYKG+Q+ PA+LEA+L++HP+I DAAV 
Sbjct  423   TIDSEGWLRTGDLCYIDDDGFIFVVDRLKELIKYKGYQVPPAELEALLLTHPEISDAAVI  482

Query  454   SAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGK  275
                 E+VG+ P+A+VV+K GS  +LS+  V+DF+A QVAPYK++RRV +  +IPK+ SGK
Sbjct  483   PFPDEQVGQFPMAYVVRKAGS--NLSEKAVMDFIAGQVAPYKRIRRVAYVAAIPKNPSGK  540

Query  274   ILRKELRNLLITSKI  230
             ILRK+L   L TSK+
Sbjct  541   ILRKDLIK-LATSKL  554



>ref|XP_010498483.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Camelina sativa]
 ref|XP_010498484.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Camelina sativa]
Length=549

 Score =   419 bits (1077),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 241/551 (44%), Positives = 351/551 (64%), Gaps = 31/551 (6%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F +S +  Y  + P + LP +P LDV +FI S+ H G  A +D+ +G ++++ EL  
Sbjct  7     RSGFCNSNSTFYSKRTP-IPLPPNPSLDVTTFISSQAHRGRIAFIDASTGNNLTFSELWR  65

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V+S+A  L+ MG+ +G V L+L PNSI FPV+ L ++S+GA+  T NPL+T  EI KQ 
Sbjct  66    AVDSVADCLYEMGIRKGHVVLLLSPNSILFPVVCLSVMSLGAIITTTNPLNTSGEIAKQI  125

Query  1492  FDCNVRLAFATPDRVQNLGSTLG-IPVIGLPESLNLDSPFR-KLISSDPKLAPT-----P  1334
              D N  LAF T   +  + +    +P++ + E   +DS  + + ++   K  P+      
Sbjct  126   KDSNPVLAFTTSQLLPKISAAAAKLPIVHMDEE-RVDSVGKVRRLAEMMKKEPSGNRVIE  184

Query  1333  RIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RF---EASQYEYPATANVYLD  1166
             R+ Q DTA +L+SSGTTG  K V  +H N IAMV+  V RF   + SQ E       ++ 
Sbjct  185   RVDQDDTATLLYSSGTTGMSKGVISSHRNLIAMVQTVVNRFGSDDGSQGE-----QRFIC  239

Query  1165  VLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTR-  989
              +PM+HVYGL+ F  GLL+ GST++V+ K+E+ E++ AI +Y  T  P+ PP+LVA+   
Sbjct  240   TVPMFHVYGLAAFATGLLAYGSTIIVLSKFEMHEMMSAIGKYQATFLPLVPPILVAMVNG  299

Query  988   ----KAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGF  821
                 KAK D   L SL  V  G AP+S    + F   +P +  +QGYG+TEST +G    
Sbjct  300   ADQIKAKYD---LSSLHTVLCGGAPLSKEVTEGFAEKYPTVKIMQGYGLTESTGIGASTD  356

Query  820   NTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEAS  641
                + R Y + G L+ +ME R+VD      G  L P   GEL L+GP+IMKGY +N EA+
Sbjct  357   TVEESRRYGTAGKLSASMEGRIVD---PVTGQILGPNQTGELLLKGPSIMKGYFSNEEAT  413

Query  640   KNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAA  461
              + +D +GWL TGD+ + DEDG+++V DRLKE+IKYKG+Q+APA+LE++L++HP+I DAA
Sbjct  414   SSTLDSEGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVAPAELESLLLTHPEIPDAA  473

Query  460   VTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSAS  281
             V     + VG+ P+A+VV+K GS  SLS+ ++++FVAKQVAPYK++R+V F  SIPK+ S
Sbjct  474   VIPFPDKAVGQFPMAYVVRKTGS--SLSEKSIMEFVAKQVAPYKRIRKVAFVSSIPKNPS  531

Query  280   GKILRKELRNL  248
             GKILRK+L  L
Sbjct  532   GKILRKDLIKL  542



>ref|XP_010459734.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Camelina sativa]
Length=549

 Score =   419 bits (1077),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 240/550 (44%), Positives = 348/550 (63%), Gaps = 29/550 (5%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F +S +  Y  + P + LP +P LDV +FI S+ H G  A +D+ +G ++++ EL  
Sbjct  7     RSGFCNSNSTFYSKRTP-IPLPPNPSLDVTTFISSQAHCGRIAFIDASTGNNLTFSELWR  65

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V+S+A  L+ MG+ +G V L+L PNSI FPV+ L ++S+GA+  T NPL+T  EI KQ 
Sbjct  66    AVDSVADCLYEMGIRKGHVVLLLSPNSILFPVVCLSVMSLGAIITTTNPLNTSGEIAKQI  125

Query  1492  FDCNVRLAFATPDRVQNLGSTLG-IPVIGLPE----SLNLDSPFRKLISSDPKLAPT-PR  1331
              D N  LAF T   +  + +    +P++ + E    S+       +++  +P       R
Sbjct  126   KDSNPVLAFTTSQLLPKISAAAAKLPIVLMDEERVGSVGKVRRLAEMMKKEPSGNRVIER  185

Query  1330  IRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RF---EASQYEYPATANVYLDV  1163
             + Q DTA +L+SSGTTG  K V  +H N IAMV+  V RF   + SQ E       ++  
Sbjct  186   VDQDDTATLLYSSGTTGMSKGVISSHRNLIAMVQTVVNRFGSDDGSQGE-----QRFICT  240

Query  1162  LPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTR--  989
             +PM+HVYGL+ F  GLL+ GST++V+ K+E+ E++ AI +Y  T  P+ PP+LVA+    
Sbjct  241   VPMFHVYGLAAFATGLLAYGSTIIVLSKFEMHEMMSAIGKYQATFLPLVPPILVAMVNGA  300

Query  988   ---KAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFN  818
                KAK D   L SL  V  G AP+S    + F   +P +  +QGYG+TEST +G     
Sbjct  301   DQIKAKYD---LSSLHTVLCGGAPLSKEVTEGFAEKYPTVKIMQGYGLTESTGIGASTDT  357

Query  817   TAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASK  638
               + R Y + G L+ +ME R+VD      G  L P   GEL L+GP+IMKGY +N EA+ 
Sbjct  358   VEESRRYGTAGKLSASMEGRIVD---PVTGQILGPNQTGELLLKGPSIMKGYFSNEEATS  414

Query  637   NAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAV  458
             + +D +GWL TGD+ + DEDG+++V DRLKE+IKYKG+Q+APA+LEA+L++HP+I DAAV
Sbjct  415   STLDSEGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVAPAELEALLLTHPEIPDAAV  474

Query  457   TSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASG  278
                  + VG+ P+A+VV+K GS  SLS+ ++++FVAKQVAPYK++R+V F  SIPK+ SG
Sbjct  475   IPFPDKAVGQFPMAYVVRKTGS--SLSEKSIMEFVAKQVAPYKRIRKVAFVSSIPKNPSG  532

Query  277   KILRKELRNL  248
             KILRK+L  L
Sbjct  533   KILRKDLIKL  542



>ref|XP_002276353.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Vitis vinifera]
Length=544

 Score =   419 bits (1076),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 223/536 (42%), Positives = 344/536 (64%), Gaps = 22/536 (4%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFILSR--NHGGLSALVDSQSGFSISYPELRSLVNSMAA  1652
             GIYRS  P + LP DP L +VSF+  +  ++    AL+++ SG ++++ + +S+V  ++ 
Sbjct  10    GIYRSLSPPLVLPKDPNLSLVSFLFRKASSYPRRPALIEAHSGETVNFAQFKSMVIKVSH  69

Query  1651  GLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRL  1472
             GL R+G+ + DV LI  PNSI +P+ F G++++GA+A T NPL T++EI+KQ  D N +L
Sbjct  70    GLTRLGLKKNDVVLIFAPNSIQYPLCFFGVIAIGAIATTANPLYTVAEIQKQVKDSNAKL  129

Query  1471  AFATPDRVQNLGSTLGIPVIGLPESLN----LDSPFRKLISSD-PKLA------PTPRIR  1325
                 P   + +   L +P + L  +      + SP +    SD  K+A      P   I 
Sbjct  130   VITIPQLWEKV-KALNLPAVILDSADTSKDTIQSPLKITYFSDLVKMAGEVSHFPKVSIT  188

Query  1324  QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHV  1145
             Q DTAA+L+SSGTTG  K V LTH NF+A   +    E    E     NV+L  LPM+HV
Sbjct  189   QGDTAALLYSSGTTGASKGVILTHGNFVAAALMVTMDEELMGE---MHNVFLCFLPMFHV  245

Query  1144  YGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCG  965
             +GL++ +   L +G T+V + K+++D  +++I++Y VTH  + PP+++AL ++ K D+  
Sbjct  246   FGLAVVMCAQLQMGYTIVSMPKFDLDVALKSIEKYRVTHMWLVPPVMLALVKQGKLDRYD  305

Query  964   LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVG  785
             + SLK + SGAAP+    ++   ++ PH+   QGYGMTE+  + ++      +++  S G
Sbjct  306   ISSLKHIGSGAAPLGKELMEECAKSLPHVAVGQGYGMTETCGIVSKEIPKIGIQHTGSTG  365

Query  784   LLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHT  605
              L   +EA+++ + +      LPP  +GE+W+RGP +MKGY NN +A+K  +D  GW+HT
Sbjct  366   PLVSGVEAQIISVDTLKP---LPPNQLGEIWVRGPNMMKGYFNNPQATKLTIDKKGWVHT  422

Query  604   GDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEI  425
             GD+ +FDE G L+V DR+KE+IKYKGFQ+APA+LEA+L+SHP+I+DA V      E GE+
Sbjct  423   GDVGYFDEQGKLFVVDRIKELIKYKGFQVAPAELEALLVSHPEILDAVVIPFPDAEAGEV  482

Query  424   PVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             P+A+VV+   S  SL++ +V  F+A QVAP+KK+RRV F  ++PKSASGKILR+EL
Sbjct  483   PIAYVVRSPNS--SLTEEDVKTFIANQVAPFKKLRRVSFINTVPKSASGKILRREL  536



>ref|XP_006287440.1| hypothetical protein CARUB_v10000646mg [Capsella rubella]
 gb|EOA20338.1| hypothetical protein CARUB_v10000646mg [Capsella rubella]
Length=544

 Score =   418 bits (1075),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 232/544 (43%), Positives = 339/544 (62%), Gaps = 38/544 (7%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLS---ALVDSQSGFSISYPELRSLVNSMA  1655
             GIYRS  P++ LP DP   +VSF+  RN    S   AL DS SG S+++ +L+S V  +A
Sbjct  10    GIYRSLRPTLVLPKDPNTSLVSFLF-RNSSSYSSKLALADSDSGESLTFSQLKSAVARLA  68

Query  1654  AGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVR  1475
              G HR+GV + D  LI  PNS  FP+ FL + ++G V  T NPL T++E+ KQ  D N +
Sbjct  69    HGFHRLGVRKNDAVLIFAPNSYQFPLCFLAVTAIGGVFTTANPLYTVNEVSKQIKDSNPK  128

Query  1474  LAFATP---DRVQNL---------GSTLGIP------VIGLPESLNLDSPFRKLISSDPK  1349
             +  +     DR++           G ++ +P      V+   + + L  P  +       
Sbjct  129   IIISVNQLFDRIKGFDLPVVLLGSGDSVQVPSESNAKVLSFNDVMELSEPISEF------  182

Query  1348  LAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYL  1169
               P   ++Q DTAA+L+SSGTTG  K V LTH NFIA   +    +    EY     V+L
Sbjct  183   --PYVEVKQSDTAALLYSSGTTGTSKGVELTHGNFIAASLMVTMDQDLMGEY---HGVFL  237

Query  1168  DVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTR  989
               LPM+HV+GL++ V   L  G+ +V + K+E++ V++ I +Y VTH  V PP+ +AL++
Sbjct  238   CFLPMFHVFGLTVIVYSQLQRGNALVSMAKFELELVLKNIQKYRVTHLWVVPPVFLALSK  297

Query  988   KAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAK  809
             ++   K  L SLK + SGAAP+    ++   R  P++  +QGYGMTE++ + +       
Sbjct  298   QSIVKKYDLSSLKYIGSGAAPLGKDLMEECGRNIPNVLLMQGYGMTETSGIVSVEDPRLG  357

Query  808   LRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAV  629
              RN  S G+LAP +EA++V + +G      PP  +GE+W+RGP +MKGYLNN +A+K  +
Sbjct  358   KRNSGSAGMLAPGVEAQIVSVETGKSQ---PPNQLGEIWVRGPNMMKGYLNNPQATKETI  414

Query  628   DDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSA  449
             D  GW+HTGD+ +F+EDG LYV DR+KE+IKYKGFQ+APA+LE +L+SH +I+DA V   
Sbjct  415   DKKGWVHTGDLGYFNEDGNLYVVDRIKELIKYKGFQVAPAELEGLLVSHSEILDAVVIPF  474

Query  448   QSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKIL  269
               EE GE+P+AFVV+   S  S+++ ++  F+AKQVAPYK++RRV F KS+PKSA+GKIL
Sbjct  475   PDEEAGEVPIAFVVRSPNS--SITEQDIQKFIAKQVAPYKRLRRVSFIKSVPKSAAGKIL  532

Query  268   RKEL  257
             R+EL
Sbjct  533   RREL  536



>ref|XP_002315339.1| hypothetical protein POPTR_0010s23680g [Populus trichocarpa]
 gb|EEF01510.1| hypothetical protein POPTR_0010s23680g [Populus trichocarpa]
Length=585

 Score =   419 bits (1078),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 234/556 (42%), Positives = 346/556 (62%), Gaps = 21/556 (4%)
 Frame = -2

Query  1888  SKIRNSAAEKGRRSCFYSSETGIYRSKH---PSVHLPSDPFLDVVSFILSR----NHGGL  1730
             S I    A+  +    ++ +TGIY S H    ++ +P+   LD  S++LS+    +H   
Sbjct  9     SIITEKEADNAQSKSGFNPKTGIYHSLHQLGENLQIPTRHDLDTSSYVLSQFPHPDHAET  68

Query  1729  S-ALVDSQSGFSISYPELRSLVNSMAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLS  1556
               ALVD  +   I+Y +L   ++++A+GL+  +GV +GDV  +L PNSI +P I L + S
Sbjct  69    KVALVDLATNQQITYAQLHRSIHALASGLYNGLGVRKGDVVFLLSPNSILYPTICLAVFS  128

Query  1555  VGAVAATMNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDS-P  1379
             +GA+ +  NP +T+SEI KQ  D   +L  + P+ +  L    G+P +      N DS  
Sbjct  129   IGAILSPANPANTISEILKQIRDSGAKLVISAPEELHKLVEN-GVPTLVTTRESNDDSLS  187

Query  1378  FRKLIS-SDPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQ  1202
              ++LI  + P   P  RI Q DTAA+L+SSGTTG  K V LTH+NFIA++ L    + S 
Sbjct  188   VKELIECTGPLELPQVRITQSDTAAILYSSGTTGTSKGVILTHSNFIAIMTLL---KWSV  244

Query  1201  YEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFP  1022
             Y   +  +++L  +P++H+YGL+ F +GL   G T V++++++   ++ A+  Y + + P
Sbjct  245   YASSSQNDIFLCFVPIFHIYGLAFFRLGLFCAGITTVLMQRFDFQAMLDAVQAYKINNIP  304

Query  1021  VAPPLLVALTRKAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTEST  842
               PP+++ L + A   KC L SL++V SGAAP+S      F + FP ++  QGYG+TES 
Sbjct  305   AVPPVILGLVKHANKVKCDLSSLRRVGSGAAPLSKELSDEFRQRFPWVELRQGYGLTESC  364

Query  841   AVGTRGFNTAKLRNY-TSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKG  665
                T   +  + + +  S G L P   A++VD      GS+LPP   GELWL+ P IMKG
Sbjct  365   GATTFFISDEQAKAHPASCGRLVPTFSAKIVD---TETGSALPPGRKGELWLKSPTIMKG  421

Query  664   YLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMS  485
             YL N  A+    D DGWL TGD+ +FDEDG+L++ DR+KE+IK+ G+Q+APA+LEA+L+ 
Sbjct  422   YLGNEAATAATFDPDGWLKTGDMGYFDEDGFLHIVDRIKELIKHNGYQVAPAELEAILLG  481

Query  484   HPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFT  305
             HP ++DAAV   + EE G+IP+A+VV+  GSE  L++  VI FVA QVAPYKKVRRV F 
Sbjct  482   HPQVLDAAVIPVEDEEAGQIPMAYVVRTAGSE--LTEEKVIQFVANQVAPYKKVRRVGFI  539

Query  304   KSIPKSASGKILRKEL  257
              +IPKSA+GKILRKEL
Sbjct  540   SAIPKSAAGKILRKEL  555



>ref|XP_010455853.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Camelina sativa]
Length=543

 Score =   417 bits (1073),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 230/536 (43%), Positives = 343/536 (64%), Gaps = 23/536 (4%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFIL--SRNHGGLSALVDSQSGFSISYPELRSLVNSMAA  1652
             GIYRS  P++ LP DP   +VSF+   S ++    AL DS +G ++++ +L+S V  +A 
Sbjct  10    GIYRSLRPTLVLPKDPNTSLVSFLFRNSSSYPSKLALADSDTGETLTFSQLKSAVARLAH  69

Query  1651  GLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRL  1472
             G  R+GV + DV LI  PNS  FP+ FL + ++G V  T NPL T++E+ KQ  D N ++
Sbjct  70    GFQRLGVRKNDVLLIFAPNSYQFPLCFLAVTAIGGVFTTANPLYTVNEVSKQVKDSNPKM  129

Query  1471  AFATP---DRVQNLGSTLGIPVIGLPESLNLDSPFRKLIS-------SDPKLA-PTPRIR  1325
               +     D+V+  G  L + ++G  +S+ +     K++S       S+P  A P   I+
Sbjct  130   IISVNQLFDKVK--GFDLPVVLLGSGDSVKIPESNSKVLSFNNVMELSEPVSAFPYVEIK  187

Query  1324  QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHV  1145
             Q DTAA+L+SSGTTG  K V LTH NFIA   +    +    EY     VYL  LPM+HV
Sbjct  188   QSDTAALLYSSGTTGTSKGVELTHGNFIAASLMVTMDQDLMREY---HGVYLCFLPMFHV  244

Query  1144  YGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCG  965
             +GL++     L  G+ +V + ++E++ V++ I++Y VTH  V PP+ +AL++++   K  
Sbjct  245   FGLTVIAYSQLQRGNALVSMARFELELVLKNIEKYRVTHLWVVPPVFLALSKQSIVKKFD  304

Query  964   LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVG  785
             L SLK + SGAAP+    ++   R  P++  +QGYGMTE+  + +        RN  S G
Sbjct  305   LSSLKYIGSGAAPLGKDLMEECGRNIPNVLLMQGYGMTETCGIVSVEDPRLGKRNSGSAG  364

Query  784   LLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHT  605
             +LAP +EA++V + +       PP  +GE+W+RGP +MKGYLNN +A+K  +D  GW+HT
Sbjct  365   MLAPGVEAQIVSVETAKLQ---PPNQLGEIWVRGPNMMKGYLNNPQATKETIDKKGWVHT  421

Query  604   GDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEI  425
             GD+ +F+E+G LYV DR+KE+IKYKGFQ+APA+LE +L+SHP+I+DA V     EE GE+
Sbjct  422   GDLGYFNEEGNLYVVDRIKELIKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDEEAGEV  481

Query  424   PVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             P+AFVV+   S  S+++ ++  F+AKQVAPYK++RRV F  S+PKSA+GKILR+EL
Sbjct  482   PIAFVVRSPNS--SITEQDIQKFIAKQVAPYKRLRRVSFINSVPKSAAGKILRREL  535



>gb|AGO89324.1| Ca4CL7 [Salix arbutifolia]
Length=554

 Score =   418 bits (1074),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 236/558 (42%), Positives = 353/558 (63%), Gaps = 32/558 (6%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  S +  Y  + P +  P   FLDV +FI SR H G +A +D+ +G  +S+ +L  
Sbjct  12    RSGFCISNSVFYSKRKP-IPFPQTDFLDVTTFISSRPHHGKTAFIDAATGRHLSFRDLWK  70

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V+S+A  LH MG+ +G V L+L PNSI+FP++ L ++S+GAV  T NPLST  EI KQ 
Sbjct  71    AVDSVATCLHDMGIRKGHVILLLSPNSIFFPIVCLSVMSLGAVITTSNPLSTPREIAKQI  130

Query  1492  FDCNVRLAFATPDRVQNLGST-LGIPVIGLPESL---------NLDSPFRKLISSDPKLA  1343
              +    LAF TP+ V  L  T   +P+I + + +          + +   +++ ++P  +
Sbjct  131   ANSKPSLAFTTPELVSKLNETNSNLPLILIDDEIIDASTKTKAKIVTTLSEMVKNEPSGS  190

Query  1342  PTPRIRQQ----DTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATAN  1178
                R+R+Q    DTA +L+SSGTTG  K V  +H N IAMV+  V RF  ++ ++     
Sbjct  191   ---RVREQVNQDDTATLLYSSGTTGESKGVVSSHKNLIAMVQTVVERFRLNEGDHK----  243

Query  1177  VYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVA  998
              ++  +PM+H+YGL++F  G+L+ GSTV+V+ K+++ E++  I +Y  T+ P+ PP+LVA
Sbjct  244   -FVCTVPMFHIYGLAVFATGILAAGSTVIVLSKFDMGEMLSTIVKYRATYLPLVPPILVA  302

Query  997   LTRKAKADKC--GLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRG  824
             L   A   +    L SLK V SG AP+S   I+ F   +P +  +Q YG+TES  VG   
Sbjct  303   LINGADQLRARYDLSSLKFVISGGAPLSKEAIEGFSEKYPGVTILQAYGLTESAGVGASM  362

Query  823   FNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEA  644
                 + R Y + GLL+PN EA++VD      G +L     GELWLR P++MKGY  N EA
Sbjct  363   DTLEESRRYGTAGLLSPNTEAKIVD---PESGKALLVNQTGELWLRAPSVMKGYFRNAEA  419

Query  643   SKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDA  464
             + + +D +GWL TGD+ + D+DG+++V DRLKE+IKYKG+Q+ PA+LEA+L++HP+I DA
Sbjct  420   TSSTIDSEGWLRTGDLCYIDDDGFIFVVDRLKELIKYKGYQVPPAELEALLLTHPEISDA  479

Query  463   AVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSA  284
             AV     ++ G+ P+A+VV+K GS  +LS+  V+DF+A  VAPYK++RRV F  +IP++ 
Sbjct  480   AVIPFPDKQAGQFPMAYVVRKAGS--NLSEKAVMDFIAGLVAPYKRIRRVAFIAAIPRNP  537

Query  283   SGKILRKELRNLLITSKI  230
             SGKILRK+L   L TSK+
Sbjct  538   SGKILRKDLIK-LATSKL  554



>ref|XP_006396625.1| hypothetical protein EUTSA_v10028563mg [Eutrema salsugineum]
 dbj|BAJ33700.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ38078.1| hypothetical protein EUTSA_v10028563mg [Eutrema salsugineum]
Length=543

 Score =   417 bits (1073),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 235/536 (44%), Positives = 345/536 (64%), Gaps = 23/536 (4%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFIL--SRNHGGLSALVDSQSGFSISYPELRSLVNSMAA  1652
             GIYRS  P++ LP DP   +VSF+   + ++    ALVDS SG ++S+ +L+S V+ +A 
Sbjct  10    GIYRSLRPTLVLPKDPNTSLVSFLFRNTSSYPSKPALVDSDSGDTLSFSQLKSAVSRLAH  69

Query  1651  GLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRL  1472
             G  R+G+ Q DV LI  PNS  FP+ FL + ++G V  T NPL T SEI KQ  D N ++
Sbjct  70    GFLRLGIRQNDVVLIFAPNSYQFPLCFLAVSAIGGVFTTANPLYTTSEISKQIKDSNPKI  129

Query  1471  AFATP---DRVQNLGSTLGIPVIGLPESLNLDSPFRKLIS-------SDP-KLAPTPRIR  1325
               +     D+++  G  L I ++G  ES+ +     K++S       S+P    PT +I+
Sbjct  130   IISVEQLFDKIK--GFDLPIVLLGSGESVQVPGSNSKILSFNNVMELSEPVSDLPTVQIK  187

Query  1324  QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHV  1145
             Q DTAA+L+SSGTTG  K V LTH NFIA   +    +    EY A   V+L  LPM+HV
Sbjct  188   QSDTAALLYSSGTTGISKGVELTHGNFIAASLMVTMDQDLMGEYHA---VFLCFLPMFHV  244

Query  1144  YGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCG  965
             +GL++     L  G+ V+ + K+E++ +++ I++Y VT   V PP+ +AL++++   K  
Sbjct  245   FGLTVITYSQLQRGNAVISMAKFELETLLKNIEKYRVTQLWVVPPVFLALSKQSIVKKYD  304

Query  964   LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVG  785
             L SLK + SGAAP+    ++   R   ++  +QGYGMTE+  + +        RN  S G
Sbjct  305   LSSLKYIGSGAAPLGKDLMEECGRNISNVVLMQGYGMTETCGIVSVEDPRLGKRNSGSAG  364

Query  784   LLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHT  605
             +LAP +EA++V + SG      PP  +GE+W+RGP +MKGYLNN +A+K  +D  GW+HT
Sbjct  365   MLAPGVEAQIVSVESGKSQ---PPNQLGEIWVRGPNMMKGYLNNPQATKETIDRKGWVHT  421

Query  604   GDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEI  425
             GD+ +F+EDG L+V DR+KE+IKYKGFQ+APA+LE +L+SHP+I+DA V     EE GE+
Sbjct  422   GDLGYFNEDGNLFVVDRIKELIKYKGFQVAPAELEGLLVSHPEILDAVVIPLPDEEAGEV  481

Query  424   PVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             P+AFVV+   S  S+++ ++  F+AKQVAPYK++RRV F  S+PKSA+GKILR+EL
Sbjct  482   PIAFVVRSPNS--SITEEDIQAFIAKQVAPYKRLRRVSFISSVPKSAAGKILRREL  535



>ref|XP_002285921.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Vitis vinifera]
Length=549

 Score =   417 bits (1073),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 238/554 (43%), Positives = 351/554 (63%), Gaps = 29/554 (5%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  S +  Y  + P + LP + F+DV +FI SR H G +A +D+ +G  +++ ++  
Sbjct  12    RSGFCKSNSIFYSKRRP-LSLPQNEFIDVATFISSRPHQGKTAFIDAATGRRLTFTDVWR  70

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V+S+++ L  +G+ +GDV L+L PNSI+FP++ L +LS+GAV  T NPL+T  EI KQ 
Sbjct  71    AVDSVSSCLSELGIRKGDVILLLTPNSIFFPIVCLSVLSLGAVVTTTNPLNTPREIGKQI  130

Query  1492  FDCNVRLAFATPDRVQNL-GSTLGIPVIGLPESLNLDSPFRKLISSDPKLAPTP------  1334
              D    L F T      L GS L  P++ + E  +  +    + S D  +   P      
Sbjct  131   VDSKPVLVFTTQSLAPKLTGSNL--PIVLMGEHGDYHAGAEVVGSLDEMIRKEPNGKRVG  188

Query  1333  -RIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLP  1157
              R+ Q+D A +L+SSGTTG  K V  +H N IAMV+  V   + + E  +    ++  LP
Sbjct  189   ERVNQEDAATLLYSSGTTGESKGVVSSHRNLIAMVQSIVSMNSFEDEEES----FVCFLP  244

Query  1156  MYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTR----  989
             M+H+YGL  F +G L+ GSTV+V+ ++E++E++  I +Y  T  P+ PP+LVAL      
Sbjct  245   MFHMYGLGAFALGRLARGSTVIVLPRFEMNEMLTTISKYRATCLPLVPPILVALVNGADQ  304

Query  988   -KAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTA  812
              KAK D   L SL+ +  G AP+S   I+ F+  +P+++  QGY +TEST VG       
Sbjct  305   IKAKYD---LSSLQYIICGGAPLSKEVIEEFLEKYPNVNIRQGYALTESTTVGASTHTLE  361

Query  811   KLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNA  632
             + R + + GLL+P+MEA++VD      G +L     GELWLRGP IMKGY  N EA+ +A
Sbjct  362   ESRRHGTAGLLSPSMEAKIVD---PESGKALSVNRAGELWLRGPTIMKGYFRNPEATASA  418

Query  631   VDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTS  452
             +D + WL TGD+ + D+DG+L+V DRLKE+IKYKG+Q+ P++LEA+L++HP+IVDAAV  
Sbjct  419   LDSNAWLRTGDLCYIDDDGFLFVVDRLKEVIKYKGYQVPPSELEALLLTHPEIVDAAVVP  478

Query  451   AQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKI  272
                +EVG+ P+A++ +K GS   LS+  V+DF++KQVAPYK++RRV F  SIPK+ SGKI
Sbjct  479   FPDKEVGQYPMAYIHRKAGS--CLSEDAVMDFISKQVAPYKRIRRVAFVASIPKTPSGKI  536

Query  271   LRKELRNLLITSKI  230
             LRK+L   L TSK+
Sbjct  537   LRKDLIQ-LATSKL  549



>ref|XP_006416390.1| hypothetical protein EUTSA_v10007270mg [Eutrema salsugineum]
 gb|ESQ34743.1| hypothetical protein EUTSA_v10007270mg [Eutrema salsugineum]
Length=553

 Score =   417 bits (1073),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 242/555 (44%), Positives = 348/555 (63%), Gaps = 35/555 (6%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F +S +  Y  + P + LP +P LDV +FI S+ H G  A +D+ +G ++++ EL  
Sbjct  7     RSGFCNSNSTFYSKRRP-IPLPPNPSLDVTTFISSQAHRGRIAFIDASTGKNLTFSELWR  65

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V S+   L  MG+ +G V L+L PNSI FPV+ L ++S+GAV  T NPL+T  EI KQ 
Sbjct  66    AVESVGDCLSEMGIRKGHVVLLLSPNSILFPVVCLSVMSLGAVITTTNPLNTPGEIAKQI  125

Query  1492  FDCNVRLAFATPDRVQNLGSTLG-----IPVIGLPESLNLDS--PFRKLISSDPKLAP--  1340
              D N  LAF T   +  + S        +P++ + E   +DS    R+L+    K+    
Sbjct  126   NDSNPVLAFTTSQLLPKIVSAASSGSKKLPIVLMDEE-RVDSVGDVRRLVEMMKKVPSGT  184

Query  1339  --TPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RF---EASQYEYPATAN  1178
                 R+ Q DTA +L+SSGTTG  K V  +H N IAMV+  V RF   + SQ E      
Sbjct  185   RVMERVDQDDTATLLYSSGTTGISKGVISSHRNLIAMVQTIVNRFGSDDGSQGE-----Q  239

Query  1177  VYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVA  998
              ++  +PM+H+YGL+ F  GLL+ GST+VV+ K+E+ E++ +I +Y  T+ P+ PP+LVA
Sbjct  240   RFICTVPMFHIYGLAAFATGLLAYGSTIVVLSKFEMHEMMFSIGKYQATYLPLVPPILVA  299

Query  997   LTR-----KAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVG  833
             +       KAK D   L SL  V  G AP+S    + F+  +P +  +QGYG+TEST +G
Sbjct  300   MINGADQIKAKYD---LSSLHTVLCGGAPLSKEVTEGFMEKYPTVKILQGYGLTESTGIG  356

Query  832   TRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNN  653
                    + R Y + G L+ +ME R+VD      G  L P   GELWL+GP+IMKGY +N
Sbjct  357   ASTDTVEESRRYGTAGKLSASMEGRIVD---SVTGQVLGPKHTGELWLKGPSIMKGYFSN  413

Query  652   GEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDI  473
              EA+ + +D +GWL TGD+ + DEDG+++V DRLKE+IKYKG+Q+ PA+LEA+L++HP+I
Sbjct  414   EEATSSTLDSEGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVPPAELEALLLTHPEI  473

Query  472   VDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIP  293
              DAAV     +EVG+ P+A+VV+K  S   LS+ ++++FVAKQVAPYK++R+V F  SIP
Sbjct  474   ADAAVIPFPDKEVGQFPMAYVVRKTKS--FLSEKSIMEFVAKQVAPYKRIRKVAFVSSIP  531

Query  292   KSASGKILRKELRNL  248
             K+ SGKILRK+L  L
Sbjct  532   KNPSGKILRKDLIKL  546



>ref|XP_010477286.1| PREDICTED: 4-coumarate--CoA ligase-like 5 isoform X1 [Camelina 
sativa]
Length=549

 Score =   416 bits (1070),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 240/548 (44%), Positives = 348/548 (64%), Gaps = 31/548 (6%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F +S +  Y  + P + LP +P LDV +FI S+ H G  A +D+ +G ++++ EL  
Sbjct  7     RSGFCNSNSTFYSKRTP-IPLPPNPSLDVTTFISSQAHRGRIAFIDASTGNNLTFSELWR  65

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V  +A  L+ MG+ +G V L+L PNSI FPV+ L ++S+GA+  T NPL+T  EI KQ 
Sbjct  66    AVECVADCLYEMGIRKGHVVLLLSPNSILFPVVCLSVMSLGAIITTTNPLNTSGEIAKQI  125

Query  1492  FDCNVRLAFATPDRVQNLGSTL-GIPVIGLPESLNLDSPFR-KLISSDPKLAPT-----P  1334
              D N  LAF T   +  + S    +P++ + E   +DS  + + ++   K  P+      
Sbjct  126   KDSNPVLAFTTSQLLPKIASAAEKLPIVLMDEE-RVDSVGKVRRLAEMMKKEPSGNRVME  184

Query  1333  RIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RF---EASQYEYPATANVYLD  1166
             R+ Q DTA +L+SSGTTG  K V  +H N IAMV+  V RF   + +Q E       ++ 
Sbjct  185   RVDQDDTATLLYSSGTTGMSKGVISSHRNLIAMVQTVVNRFGSDDGTQGE-----QRFIC  239

Query  1165  VLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTR-  989
              +PM+HVYGL+ F  GLL+ GST++V+ K+E+ E++ AI +Y  T  P+ PP+LVA+   
Sbjct  240   TVPMFHVYGLAAFATGLLAYGSTIIVLSKFEMHEMMSAIGKYKATFLPLVPPILVAMVNG  299

Query  988   ----KAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGF  821
                 KAK D   L SL  V  G AP+S    + F   +P +  +QGYG+TEST +G    
Sbjct  300   ADQIKAKYD---LSSLHTVLCGGAPLSKEVTEGFAEKYPTVKIMQGYGLTESTGIGASTD  356

Query  820   NTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEAS  641
                + R Y + G L+ +ME R+VD      G  L P   GEL L+GP+IMKGY +N EA+
Sbjct  357   TVEESRRYGTAGRLSASMEGRIVD---PVTGKILGPNQTGELLLKGPSIMKGYFSNEEAT  413

Query  640   KNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAA  461
              + +D +GWL TGD+ + DEDG+++V DRLKE+IKYKG+Q+APA+LEA+L++HP+I DAA
Sbjct  414   SSTLDSEGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVAPAELEALLLTHPEIPDAA  473

Query  460   VTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSAS  281
             V     + VG+ P+A+VV+K GS  SLS+ ++++FVAKQVAPYK++R+V F  SIPK+ S
Sbjct  474   VIPFPDKAVGQFPMAYVVRKTGS--SLSEKSIMEFVAKQVAPYKRIRKVAFVTSIPKNPS  531

Query  280   GKILRKEL  257
             GKILRK+L
Sbjct  532   GKILRKDL  539



>emb|CDY31883.1| BnaC07g15330D [Brassica napus]
Length=543

 Score =   416 bits (1069),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 239/557 (43%), Positives = 342/557 (61%), Gaps = 37/557 (7%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  S +  Y  ++P + LP++P LDV +FI S+ H G +A +D+ +G  +S+ EL +
Sbjct  8     RSGFCKSNSTFYSKRNP-LPLPANPSLDVTTFISSQTHRGTTAFIDAATGLRLSFSELWT  66

Query  1672  LVNSMAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQ  1496
              V  +A  LH  +G+ +G V LIL PNSIY PV+ L ++S+GAV  T N L+T  EI +Q
Sbjct  67    AVERVADCLHHDIGLRRGHVVLILSPNSIYIPVVSLAVMSLGAVVTTANTLNTAGEISRQ  126

Query  1495  SFDCNVRLAFATPDR------------VQNLGSTLGIPVIGLPESLNLDSPFRKLISSDP  1352
             + D N  LAF T D             ++ +GST G+ V+G    +    P  + +    
Sbjct  127   TADSNPTLAFTTADLAPKLAGSGISVVLERVGSTRGVNVVGAVSEMMEKEPSGQRVRD--  184

Query  1351  KLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVY  1172
                   R+ ++DTA +L+SSGTTG  K V  +H N  A V  FV       E      V+
Sbjct  185   ------RVNEEDTAMMLYSSGTTGPSKGVITSHRNLTASVARFVS------EKRIGGQVF  232

Query  1171  LDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALT  992
             L  +PM+H YGL  F M  +++GSTVV++R++++  ++ A+++Y  T   +APP++VA+T
Sbjct  233   LCTVPMFHTYGLLCFTMFTVAVGSTVVILRRFDLHGMMAAVEKYSATILALAPPVVVAMT  292

Query  991   RKAKA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFN  818
              +A     K  L SL+ V  G AP+S    + F+  +P +D + GY +TES   G     
Sbjct  293   NEADVIRAKYDLSSLRTVRCGGAPLSKEVTEGFMEKYPTVDILAGYALTESNGAGASIDT  352

Query  817   TAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASK  638
               + R Y SVGLLAP +EAR+VD      G  +     GELWLRGP+I KGY  NGEA+ 
Sbjct  353   VEESRRYGSVGLLAPGVEARIVD---PDTGRVMGVNQTGELWLRGPSISKGYFKNGEATN  409

Query  637   NAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAV  458
               ++ +GWL TGDI + DEDG+L+V DRLKE+IKYKG+Q+ PA+LEA+L++HPDI+DAAV
Sbjct  410   ETINLEGWLRTGDICYIDEDGFLFVVDRLKELIKYKGYQVPPAELEALLVTHPDILDAAV  469

Query  457   TSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAK-QVAPYKKVRRVYFTKSIPKSAS  281
                  +E G+ P+A+V +K  S+  LS+  +IDFV+K QVAPYKK+R+V F  SIPK+ S
Sbjct  470   IPFPDKEAGQYPMAYVTRKLESD--LSEKQIIDFVSKQQVAPYKKIRKVAFINSIPKNPS  527

Query  280   GKILRKELRNLLITSKI  230
             GK LRK+L   L TSKI
Sbjct  528   GKTLRKDLIK-LATSKI  543



>emb|CBI18880.3| unnamed protein product [Vitis vinifera]
Length=516

 Score =   415 bits (1066),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 236/546 (43%), Positives = 344/546 (63%), Gaps = 39/546 (7%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  S +  Y  + P + LP + F+DV +FI SR H G +A +D+ +G  +++ ++  
Sbjct  5     RSGFCKSNSIFYSKRRP-LSLPQNEFIDVATFISSRPHQGKTAFIDAATGRRLTFTDVWR  63

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V+S+++ L  +G+ +GDV L+L PNSI+FP++ L +LS+GAV  T NPL+T  EI KQ 
Sbjct  64    AVDSVSSCLSELGIRKGDVILLLTPNSIFFPIVCLSVLSLGAVVTTTNPLNTPREIGKQI  123

Query  1492  FDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPFRKLISSDPKLAPTPRIRQQDT  1313
              D    L F T    Q+L   L           NL  P  K +          R+ Q+D 
Sbjct  124   VDSKPVLVFTT----QSLAPKL--------TGSNLPIPNGKRVGE--------RVNQEDA  163

Query  1312  AAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVYGLS  1133
             A +L+SSGTTG  K V  +H N IAMV+  V   + + E  +    ++  LPM+H+YGL 
Sbjct  164   ATLLYSSGTTGESKGVVSSHRNLIAMVQSIVSMNSFEDEEES----FVCFLPMFHMYGLG  219

Query  1132  LFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTR-----KAKADKC  968
              F +G L+ GSTV+V+ ++E++E++  I +Y  T  P+ PP+LVAL       KAK D  
Sbjct  220   AFALGRLARGSTVIVLPRFEMNEMLTTISKYRATCLPLVPPILVALVNGADQIKAKYD--  277

Query  967   GLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSV  788
              L SL+ +  G AP+S   I+ F+  +P+++  QGY +TEST VG       + R + + 
Sbjct  278   -LSSLQYIICGGAPLSKEVIEEFLEKYPNVNIRQGYALTESTTVGASTHTLEESRRHGTA  336

Query  787   GLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLH  608
             GLL+P+MEA++VD      G +L     GELWLRGP IMKGY  N EA+ +A+D + WL 
Sbjct  337   GLLSPSMEAKIVD---PESGKALSVNRAGELWLRGPTIMKGYFRNPEATASALDSNAWLR  393

Query  607   TGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGE  428
             TGD+ + D+DG+L+V DRLKE+IKYKG+Q+ P++LEA+L++HP+IVDAAV     +EVG+
Sbjct  394   TGDLCYIDDDGFLFVVDRLKEVIKYKGYQVPPSELEALLLTHPEIVDAAVVPFPDKEVGQ  453

Query  427   IPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNL  248
              P+A++ +K GS   LS+  V+DF++KQVAPYK++RRV F  SIPK+ SGKILRK+L   
Sbjct  454   YPMAYIHRKAGS--CLSEDAVMDFISKQVAPYKRIRRVAFVASIPKTPSGKILRKDLIQ-  510

Query  247   LITSKI  230
             L TSK+
Sbjct  511   LATSKL  516



>ref|XP_010431672.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Camelina sativa]
Length=542

 Score =   415 bits (1067),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 231/536 (43%), Positives = 344/536 (64%), Gaps = 24/536 (4%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFIL--SRNHGGLSALVDSQSGFSISYPELRSLVNSMAA  1652
             GIYRS  P++ LP DP   +VSF+   S ++    AL DS +G S+++ +L+S V  +A 
Sbjct  10    GIYRSLRPTLVLPKDPNTSLVSFLFRNSSSYPSKLALADSDTGESLTFSQLKSAVARLAH  69

Query  1651  GLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRL  1472
             G HR+GV + DV LI  PNS  FP+ FL + ++G V  T NPL T++E+ KQ  D N ++
Sbjct  70    GFHRLGVRKTDVVLIFAPNSYQFPLCFLAVTAIGGVFTTANPLYTVNEVSKQVKDSNPKI  129

Query  1471  AFATP---DRVQNLGSTLGIPVIGLPESLNLDSPFRKLIS-------SDP-KLAPTPRIR  1325
               +     D+V+  G  L + ++G  +S+ +     K++S       S+P    P   I+
Sbjct  130   IISVIQLFDKVK--GFDLPVVLLGSGDSVQIPESNSKILSFNNVMELSEPVSEFPYVEIK  187

Query  1324  QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHV  1145
             Q DTAA+L+SSGTTG  K V LTH NFIA   +    +    EY     VYL  LPM+HV
Sbjct  188   QSDTAALLYSSGTTGQSKGVELTHGNFIAASLMVTMDQDLMGEY---HGVYLCFLPMFHV  244

Query  1144  YGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCG  965
             +GL++     L  G+ +V + ++E++ V++ I++Y VT+  V PP+ +AL++++   K  
Sbjct  245   FGLAVIAYSQLQRGNALVSMARFELELVLKNIEKYKVTNLWVVPPVFLALSKQSIVKKFD  304

Query  964   LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVG  785
             L SLK + SGAAP+    +++  R  P++ F QGYGMTE+  + +        RN  S G
Sbjct  305   LSSLKYIGSGAAPLGKDLMEDCGRNIPNVWF-QGYGMTETCGIVSVEDPRLGKRNSGSAG  363

Query  784   LLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHT  605
             +LAP +EA++V + +       PP  +GE+W+RGP +MKGYLNN +A+K  +D  GW+HT
Sbjct  364   MLAPGVEAQIVSVETAKLQ---PPNQLGEIWVRGPNMMKGYLNNPQATKETIDKKGWVHT  420

Query  604   GDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEI  425
             GD+ +F+EDG LYV DR+KE+IKYKGFQ+APA+LE +L+SHP+I+DA V     EE GE+
Sbjct  421   GDLGYFNEDGNLYVVDRIKELIKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDEEAGEV  480

Query  424   PVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             P+AFVV+   S  S+++ ++  F+AKQVAPYK++RRV F  ++PKSA+GKILR+EL
Sbjct  481   PIAFVVRSPNS--SITEQDIQKFIAKQVAPYKRLRRVSFINTVPKSAAGKILRREL  534



>ref|XP_010534096.1| PREDICTED: 4-coumarate--CoA ligase-like 2 [Tarenaya hassleriana]
Length=559

 Score =   416 bits (1068),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 242/568 (43%), Positives = 356/568 (63%), Gaps = 37/568 (7%)
 Frame = -2

Query  1876  NSAAEKGRRSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFS  1697
             ++  E  RRS F  S   I+ SK   + LP +PFLDV SFI ++ H G +A VD+ +   
Sbjct  10    DNTPEIDRRSGFCKS-NAIFYSKRDPIALPPNPFLDVTSFISTQPHHGETAFVDALTDRR  68

Query  1696  ISYPELRSLVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLST  1517
             I + EL   V+++   L   GV + DV L+L PNS+ FPV+ L ++S+GA+  T NPL+T
Sbjct  69    ICFSELWRAVDNVGGSLSGFGVRKDDVVLVLSPNSVLFPVVCLSVMSIGAIITTANPLNT  128

Query  1516  LSEIKKQSFDCNVRLAFATPDRVQNLG---STLGIPVIGLPES-------LNLDSPFRKL  1367
              +EI  Q  D    LAF T   V  L    S   +PV+ + E        + +     ++
Sbjct  129   SAEIANQIGDSCPVLAFTTSRLVPKLATAASGRNLPVVLMEEERVNHTHGVKVVGRLEEM  188

Query  1366  ISSDPK---LAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELF-VRFEASQY  1199
             ++++P+   +    R+ Q+DTAA+L+SSGTTG  K V LTH N IA+V+ +  RFE  Q 
Sbjct  189   MNTEPEPSWVRVKYRVNQEDTAALLYSSGTTGTSKGVMLTHRNLIALVQTYRARFELEQR  248

Query  1198  EYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPV  1019
                      +  +PM+HV+G   F +G +++G TVVV+ ++++ +++ A++ +  ++  +
Sbjct  249   T--------ICTIPMFHVFGFVSFAIGFVAVGWTVVVLPRFDMTQMLSAVENHRASYLTL  300

Query  1018  APPLLVALTR-----KAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGM  854
              PP+LVA+       KAK D   L SL  V +G A +S   I+ FVR +P +  +QGYG+
Sbjct  301   VPPILVAMINNSDDIKAKHD---LGSLHTVVAGGASLSKEVIEGFVRKYPAVKILQGYGL  357

Query  853   TESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAI  674
             TESTAV +  F   + + Y + G+LAP++EA+++D    G G  L     GELWLR P +
Sbjct  358   TESTAVASSMFTQEESKMYGTSGILAPSVEAKIMD---TGTGRVLGVNQTGELWLRSPTV  414

Query  673   MKGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAV  494
             MKGY  N EA+ +A+D +GWL TGD+ + DEDG+L+V DRLKE+IKYKG+Q+ PA+LEA+
Sbjct  415   MKGYFKNEEATASAIDSEGWLKTGDLCYIDEDGFLHVVDRLKELIKYKGYQVPPAELEAL  474

Query  493   LMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRV  314
             L+SH DI DAAV     ++ G+ P+A+VV+K GS  +LSQ  V+DFVAKQVAPYK++R+V
Sbjct  475   LLSHRDIADAAVIPYPDKDAGQFPMAYVVRKDGS--NLSQNEVMDFVAKQVAPYKRIRKV  532

Query  313   YFTKSIPKSASGKILRKELRNLLITSKI  230
              F  SIPK+ SGKILRK+L   L TSK+
Sbjct  533   SFVSSIPKNPSGKILRKDLIK-LSTSKL  559



>ref|XP_003545004.1| PREDICTED: 4-coumarate--CoA ligase-like 5-like [Glycine max]
Length=549

 Score =   415 bits (1066),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 242/555 (44%), Positives = 348/555 (63%), Gaps = 27/555 (5%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F SS + I+ SK   + LP +  LDV +FI SR H   +A VD+ +   ++Y +L  
Sbjct  8     RSGFCSSNS-IFYSKRKPLPLPPNNALDVTTFISSRAHRATTAFVDAATARRLTYTQLWR  66

Query  1672  LVNSMAAGLH-RMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQ  1496
              V  +AA L   MG+ +G+V LIL PNSI+FPV+ L ++S+GA+  T NPL+T  EI KQ
Sbjct  67    SVEGVAASLSVDMGIRKGNVVLILSPNSIHFPVVCLAVMSLGAIITTTNPLNTTREIAKQ  126

Query  1495  SFDCNVRLAFATPDRVQNL-GSTLGIPVIGLPES--------LNLDSPFRKLISSDPKLA  1343
               D    LAF   D +  +  +   +P++ +            N+ +   ++   +P   
Sbjct  127   IADSKPLLAFTISDLLPKITAAAPSLPIVLMDNDGANNNNNNNNIVATLDEMAKKEPVAQ  186

Query  1342  PT-PRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYL  1169
                 R+ Q DTA +L+SSGTTG  K V  +H N IAMV++ + RF   + E       ++
Sbjct  187   RVKERVEQDDTATLLYSSGTTGPSKGVVSSHRNLIAMVQIVLGRFHMEENE------TFI  240

Query  1168  DVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTR  989
               +PM+H+YGL  F  GLL+ GST+VV+ K+E+ +++ +I+R+  T+ P+ PP+LVA+  
Sbjct  241   CTVPMFHIYGLVAFATGLLASGSTIVVLSKFEMHDMLSSIERFRATYLPLVPPILVAMLN  300

Query  988   KAKA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNT  815
              A A   K  + SL  V SG AP+S   I+ FV  +P++  +QGYG+TEST VG    + 
Sbjct  301   NAAAIKGKYDITSLHSVLSGGAPLSKEVIEGFVAKYPNVTILQGYGLTESTGVGASTDSL  360

Query  814   AKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKN  635
              + R Y + GLL+P  +A +VD      G SLP    GELWLRGP IMKGY +N EA+ +
Sbjct  361   EESRRYGTAGLLSPATQAMIVD---PESGQSLPVNRTGELWLRGPTIMKGYFSNEEATTS  417

Query  634   AVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVT  455
              +D  GWL TGDI + D DG++++ DRLKE+IKYKG+Q+ PA+LEA+L++HP I+DAAV 
Sbjct  418   TLDSKGWLRTGDICYIDNDGFIFIVDRLKELIKYKGYQVPPAELEALLLTHPAILDAAVI  477

Query  454   SAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGK  275
                 +E G+ P+A+VV+K GS  SLS+  V+DFVA QVAPYK++R+V F  SIPK+ SGK
Sbjct  478   PYPDKEAGQHPMAYVVRKAGS--SLSETQVMDFVAGQVAPYKRIRKVAFISSIPKNPSGK  535

Query  274   ILRKELRNLLITSKI  230
             ILRK+L   L TSK+
Sbjct  536   ILRKDLIK-LATSKL  549



>ref|XP_006303947.1| hypothetical protein CARUB_v10008763mg [Capsella rubella]
 gb|EOA36845.1| hypothetical protein CARUB_v10008763mg [Capsella rubella]
Length=549

 Score =   415 bits (1066),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 237/552 (43%), Positives = 348/552 (63%), Gaps = 33/552 (6%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F +S    Y  + P + LP +P LDV +FI S+ H G  A +D+ +G ++++ EL  
Sbjct  7     RSGFCNSNKTFYSKRTP-IPLPPNPSLDVTTFISSQAHRGRIAFIDASTGKNLTFSELWR  65

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V S+A  L++MG+ +G V L+L PNSI FPV+ L ++S+GA+  T NPL+T  EI KQ 
Sbjct  66    AVESVADCLYQMGIRKGHVVLLLSPNSILFPVVCLSVMSLGAIITTTNPLNTSGEIAKQI  125

Query  1492  FDCNVRLAFATPDRVQNLGSTLG-IPVIGLPESLNLDSPFR--KLISSDPKLAPT-----  1337
              D N  +AF T   +  + +    +P++ + E   +DS  +  +L+    K  P+     
Sbjct  126   KDSNPVIAFTTAQLLPKISAAAAKLPIVLMDEE-RVDSVGKVGRLVEM-MKRKPSGNRVM  183

Query  1336  PRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RF---EASQYEYPATANVYL  1169
              R+ Q DTA +L+SSGTTG  K V  +H N IAMV+  V RF   + +Q E       ++
Sbjct  184   ERVEQDDTATLLYSSGTTGMSKGVISSHRNLIAMVQTVVNRFGSDDGTQGE-----QRFI  238

Query  1168  DVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTR  989
               +PM+H+YGL+ F  GLL+ GST++V+ K+E+ E++ AI +Y  T  P+ PP+LVA+  
Sbjct  239   CTVPMFHIYGLAAFATGLLAYGSTIIVLSKFEMHEMMSAIGKYQATFLPLVPPILVAMVN  298

Query  988   -----KAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRG  824
                  KAK D   L S+  V  G AP+S    + F   +  +  +QGYG+TEST +G   
Sbjct  299   GADQIKAKYD---LSSMHTVLCGGAPLSKEVTEGFAEKYSTVKIMQGYGLTESTGIGAST  355

Query  823   FNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEA  644
                 + R Y + G L+ +ME R+VD      G  L P   GELWL+GP+IMKGY +N EA
Sbjct  356   DTVEESRRYGTAGKLSASMEGRIVD---PVTGQILGPNQTGELWLKGPSIMKGYFSNEEA  412

Query  643   SKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDA  464
             + + +D +GWL TGD+ + DEDG+++V DRLKE+IKYKG+Q+APA+LEA+L++HP+I DA
Sbjct  413   TSSTLDSEGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVAPAELEALLLTHPEITDA  472

Query  463   AVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSA  284
             A      + VG+ P+A+VV+  GS  SLS+ ++++FVAKQVAPYK++R+V F  SIPK+ 
Sbjct  473   ACIPFPDKAVGQFPMAYVVRNTGS--SLSEKSIMEFVAKQVAPYKRIRKVVFVTSIPKNP  530

Query  283   SGKILRKELRNL  248
             SGKILRK+L  L
Sbjct  531   SGKILRKDLIKL  542



>ref|XP_011024331.1| PREDICTED: 4-coumarate--CoA ligase-like 5 isoform X1 [Populus 
euphratica]
Length=583

 Score =   415 bits (1067),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 235/567 (41%), Positives = 352/567 (62%), Gaps = 23/567 (4%)
 Frame = -2

Query  1888  SKIRNSAAEKGRRSCFYSSETGIYRSKH---PSVHLPSDPFLDVVSFILSR----NHGGL  1730
             S I    A+  +    +  +TGIY S H    ++ +P+   LD  S++LS+    +H   
Sbjct  26    SIITKKEADDAQSKSGFDPKTGIYHSLHQLGENLQIPTRHDLDTTSYVLSQFPHPDHAET  85

Query  1729  S-ALVDSQSGFSISYPELRSLVNSMAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLS  1556
               ALVD  +   ++Y +L   ++++A+GL+  +GV +GDV  +L PNSI +P I L + S
Sbjct  86    KVALVDLATNQQVTYAQLHRSIHALASGLYNGLGVRKGDVVFLLSPNSILYPTICLAVFS  145

Query  1555  VGAVAATMNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDS-P  1379
             +GA+ +  NP +T+SEI KQ  D   +L  + P+ +  L    G+P +      N DS  
Sbjct  146   IGAILSPANPANTVSEILKQIRDSGAKLVISAPEELHKLVEN-GVPTLVTTRESNDDSLS  204

Query  1378  FRKLIS-SDPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQ  1202
              ++LI  S P   P  RI Q DTAA+L+SSGTTG  K V LTH+NF+A++ L    + S 
Sbjct  205   VKELIECSGPLELPQVRITQSDTAAILYSSGTTGTSKGVILTHSNFVAIMTLL---KWSV  261

Query  1201  YEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFP  1022
             Y   +  +++L  +P++H+YGL+ F +GL   G T V++++++   ++ A+  Y + + P
Sbjct  262   YASSSQNDIFLCFVPIFHIYGLAFFGLGLFCAGITTVLMQRFDFQAMLDAVQAYKINNIP  321

Query  1021  VAPPLLVALTRKAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTEST  842
               PP+++ L ++A   +C L SL++V SGAAP+S      F + FP ++  QGYG+TES+
Sbjct  322   AVPPVILGLVKRANKVECDLSSLRRVGSGAAPLSKELSDEFRQRFPWVELRQGYGLTESS  381

Query  841   AVGTRGFNTAKLRNY-TSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKG  665
                T   +  + + +  S G L P   A++VD      GS+LPP   GEL L+ P IMKG
Sbjct  382   GATTFFISDEQAKAHPASCGRLVPTFSAKIVD---TETGSALPPGRKGELLLKSPTIMKG  438

Query  664   YLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMS  485
             YL N  A+    D DGWL TGDI +FDEDG+L++ DR+KE+IK+ G+Q+APA+LEA+L+ 
Sbjct  439   YLGNEAATAATFDPDGWLKTGDIGYFDEDGFLHIVDRIKELIKHNGYQVAPAELEAILLG  498

Query  484   HPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFT  305
             HP ++DAAV   + EE G+IP+A+VV+  GSE  L++  VI FVA QVAPYKKVRRV F 
Sbjct  499   HPQVLDAAVVPVEDEEAGQIPMAYVVRTAGSE--LTEEQVIQFVANQVAPYKKVRRVGFI  556

Query  304   KSIPKSASGKILRKEL--RNLLITSKI  230
              +IPKSA+GKILRKEL   + L+ SK+
Sbjct  557   SAIPKSAAGKILRKELVSHSQLVISKL  583



>ref|XP_009334310.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Pyrus x bretschneideri]
Length=578

 Score =   415 bits (1066),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 230/547 (42%), Positives = 342/547 (63%), Gaps = 22/547 (4%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F SS +  Y  + P + LP +  LD+ +FI S+ H G  A +D  +G  ++Y +L  
Sbjct  33    RSGFCSSNSVFYSKRRP-IPLPPNDSLDITTFISSQAHRGNVAFIDGSTGQQLTYVQLWD  91

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V S+A+ L  MG+ +G V L+L PNSI+FPV+ L ++S+GA+  T NPL+T  EI KQ 
Sbjct  92    AVRSVASSLSDMGIRKGHVVLLLSPNSIFFPVVCLAVMSLGAIITTTNPLNTSREIAKQI  151

Query  1492  FDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPFRKLISSDPKLAPTPR------  1331
              D    LAF T   +  L     +P++ + + +      + ++++  K+    +      
Sbjct  152   ADSKPVLAFTTRQLIPKLAGPNPLPIVLIDDEIEAPIDNKSIVNTLGKMMSNKKHDGLKS  211

Query  1330  ---IRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLDV  1163
                I Q +TA +L+SSGTTG  K V  +H N IAMV+  + RF +    +      +L  
Sbjct  212   REAITQDNTATLLYSSGTTGASKGVVSSHRNLIAMVQTVIGRFYSDDNHH----QTFLCT  267

Query  1162  LPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKA  983
             +PM+H+YGL  F  GLL+ GST+VV+ K+E+ +++ +I    V++ P+ PP+LVAL   A
Sbjct  268   VPMFHIYGLVAFATGLLASGSTIVVLPKFEMHDMLLSIQMNRVSYLPLVPPILVALINAA  327

Query  982   KADKC--GLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAK  809
                K    L SL+ V SG AP+S   I+ F+  +P +  +QGYG+TEST +G    +  +
Sbjct  328   DQLKAKYDLSSLRWVLSGGAPLSKEVIEGFLEKYPMVTILQGYGLTESTGIGASTDSLEE  387

Query  808   LRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAV  629
              R Y + G+L+ +MEA +VD      G  L     GELWL+GP IMKGY +N EA+ + +
Sbjct  388   SRKYGTAGMLSASMEAMIVD---PDSGHPLAANKTGELWLKGPTIMKGYFSNAEATASTL  444

Query  628   DDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSA  449
             D  GWL TGD+ + DEDG+++V DRLKE+IKYKG+Q+ PA+LEA+L++HP+I DAAV   
Sbjct  445   DSKGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVPPAELEALLLTHPEIADAAVIPF  504

Query  448   QSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKIL  269
               E+VG+ P+A+VV+  GS  SL+++ V++FVAKQVAPYK++RRV F  S+PK+ SGKIL
Sbjct  505   PDEKVGQYPLAYVVRNAGS--SLTESGVMEFVAKQVAPYKRIRRVAFIDSVPKNPSGKIL  562

Query  268   RKELRNL  248
             RK+L  L
Sbjct  563   RKDLIQL  569



>ref|XP_002523698.1| AMP dependent CoA ligase, putative [Ricinus communis]
 gb|EEF38638.1| AMP dependent CoA ligase, putative [Ricinus communis]
Length=542

 Score =   414 bits (1063),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 230/536 (43%), Positives = 337/536 (63%), Gaps = 24/536 (4%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLS---ALVDSQSGFSISYPELRSLVNSMA  1655
             GIYRS  P + LP DP L +VSF+  RN        AL+D+    ++S+ +L+S+V  ++
Sbjct  10    GIYRSLRPLLVLPKDPNLSMVSFLF-RNCNSYPHKPALIDADLSKTLSFSQLKSIVIKVS  68

Query  1654  AGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVR  1475
              GL ++G+S+ DV LI  PNS  FP+ FL + S+GA+A T NPL T +EI KQ  D N +
Sbjct  69    HGLLKLGISKNDVVLIFAPNSYQFPICFLAITSIGAIATTANPLYTTTEISKQIKDSNPK  128

Query  1474  LAFATPDRVQNLGSTLGIPVI--GLPESLNLDSPFRKLISSDPKLA--------PTPRIR  1325
             L    P+ + N      +P +  G  ESL L  P  ++ S D  +         PT  ++
Sbjct  129   LVITVPE-LWNKVKDFNLPAVFLGAKESL-LIEPNSRIKSFDHLVELGGSNSEFPTINVK  186

Query  1324  QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHV  1145
             Q D A +L+SSGTTG  K V LTH NFIA  ++    +    E     NV+L  LPM+HV
Sbjct  187   QTDIATLLYSSGTTGISKGVILTHGNFIAASQMITMDQEIAGEL---HNVFLCFLPMFHV  243

Query  1144  YGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCG  965
             +GL++     L  G+ VV + K++ + V++A+++Y +TH  V PP+++AL +++   K  
Sbjct  244   FGLAVIAYSQLQTGNAVVSMGKFDFELVLKAVEKYRITHLWVVPPVILALAKQSLVKKYD  303

Query  964   LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVG  785
             L SL+ V SGAAP+S   ++   +T PH    QGYGMTE+T + +       +R+  S G
Sbjct  304   LSSLQHVGSGAAPLSKELMEECAKTIPHAAIAQGYGMTETTGIVSVENPRIGVRHSGSAG  363

Query  784   LLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHT  605
              LA  +EA+++ + +      LPP  +GE+W+RGP +M+GY NN +A+K  +D  GWLHT
Sbjct  364   TLAAGIEAQIISVDTLKP---LPPNQLGEIWVRGPNMMRGYFNNPQATKQTIDKKGWLHT  420

Query  604   GDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEI  425
             GD+ +FDEDG LYV DR+KE+IKYKGFQ+APA+LE +L+SHP+++DA V      E GE+
Sbjct  421   GDLGYFDEDGKLYVVDRIKELIKYKGFQVAPAELEGLLVSHPELLDAVVIPFPDAEAGEV  480

Query  424   PVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             PVA+VV+   S  SL++  V  ++A QVAP+K++RRV F  ++PKSASGKILR+EL
Sbjct  481   PVAYVVRSPNS--SLTEEEVQKYIADQVAPFKRLRRVTFINTVPKSASGKILRREL  534



>gb|KFK44167.1| hypothetical protein AALP_AA1G223400 [Arabis alpina]
Length=552

 Score =   414 bits (1064),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 234/546 (43%), Positives = 340/546 (62%), Gaps = 18/546 (3%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             R+ F +S +  Y  + P + LP +P LDV +FI S+ H G  A +D+ +G ++++ +L +
Sbjct  7     RTGFCNSNSTFYSQRKP-IPLPPNPSLDVTTFISSQAHRGRIAFIDASTGENLTFFDLWT  65

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V S+A  L  MG+ +G V L+L PNSI FPV+ L ++S+GA+  T NPL+T  EI KQ 
Sbjct  66    AVASVADCLSDMGIRKGHVILLLSPNSILFPVVCLSVMSLGAIITTTNPLNTPGEISKQI  125

Query  1492  FDCNVRLAFAT----PDRVQNLGSTLGIPVIGLPESLNLDSPFRKLISSDPKLAPT----  1337
              D    L F T    P  V   GS     VI   E +  D      +    K  P+    
Sbjct  126   NDSKPVLVFTTNQLLPKIVAATGSKKLPVVIMDEERVESDGEVAGRLVEMMKKKPSGNRV  185

Query  1336  -PRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVL  1160
               R+ Q DTA +L+SSGTTG  K V  +H N IAMV+  V +     +     + ++  +
Sbjct  186   KERVDQDDTATLLYSSGTTGMSKGVISSHRNLIAMVQT-VMYRLGSEDGSQGEDRFICTV  244

Query  1159  PMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK  980
             PM+H+YGL++F  GLL+ GST+VV+ K+E+ E++ +I +Y  T+ P+ PP+LVA+   A+
Sbjct  245   PMFHIYGLAMFATGLLAYGSTIVVLSKFEMGEMMFSIGKYQATYLPLVPPILVAMINGAE  304

Query  979   ADKC--GLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKL  806
               K    L SL  V  G AP+S    + F+  +P +  +QGYG+TEST +G       + 
Sbjct  305   QIKAKYDLSSLHTVLCGGAPLSKEVTEGFMEKYPMVKILQGYGLTESTGIGASTDTVEEG  364

Query  805   RNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVD  626
             R Y + G L+ +ME R+VD      G  L P   GELWL+GP IMKGY +N EA+ + +D
Sbjct  365   RRYGTAGKLSASMEGRIVD---PVTGQILGPKHTGELWLKGPTIMKGYFSNEEATSSTLD  421

Query  625   DDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQ  446
              +GWL TGD+ + DEDG+++V DRLKE+IKYKG+Q+ PA+LEA+L++HP+I DAAV    
Sbjct  422   SEGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVPPAELEALLLTHPEIADAAVIPFP  481

Query  445   SEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILR  266
               EVG+ P+A+VV+K GS  SLS+ ++++FVAKQVAPYK++R+V F  S+PK+ SGKILR
Sbjct  482   DREVGQFPMAYVVRKTGS--SLSEKSIMEFVAKQVAPYKRIRKVAFISSVPKNPSGKILR  539

Query  265   KELRNL  248
             K+L  L
Sbjct  540   KDLIKL  545



>ref|XP_009613176.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Nicotiana tomentosiformis]
Length=556

 Score =   414 bits (1064),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 242/553 (44%), Positives = 356/553 (64%), Gaps = 28/553 (5%)
 Frame = -2

Query  1840  YSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVNS  1661
             YS     + SK   + LP++  LDV +FI SR H G  A +D+ +G  +++ ++ + V S
Sbjct  16    YSPVNSTFYSKRDPIPLPANDALDVTTFISSRAHRGKIAYIDATTGQRLTFSDVWNAVES  75

Query  1660  MAAGLH-RMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             +A  L   MG+ +G+V L+L PNSIYFP++ L ++S+GA+  T NPL+T  EI KQ  D 
Sbjct  76    LATCLSIDMGIRKGNVVLLLSPNSIYFPIVCLAVMSLGAIITTTNPLNTPREINKQIKDS  135

Query  1483  NVRLAFATPDRVQNLGSTLGIPVIGLP-ESLNLDSP----------FRKLISSDPKLAP-  1340
             N  +AF  P+ +  L  +  +P+I +  ++ NL                LI   P  +  
Sbjct  136   NPVIAFTIPELLPKLVDS-NLPIILIKSQTTNLTQKGNFNFKIVGNLENLIQKKPVQSRL  194

Query  1339  TPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLDV  1163
               R+ Q DTA +L+SSGTTG  K V  +H N IAMV+  V RF+  + E       ++  
Sbjct  195   KERVTQDDTATLLYSSGTTGASKGVVSSHRNLIAMVQTIVGRFKLDEGE-----QTFICT  249

Query  1162  LPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKA  983
             +PM+H+YGL+ F  GLL+ GST+VV+ K+E+DE++ +I +Y  T+ P+ PP+LVAL   A
Sbjct  250   VPMFHIYGLAAFAAGLLASGSTIVVLSKFEMDEMLLSIHKYKATYLPLVPPILVALVNNA  309

Query  982   KA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAK  809
             +    K  L SLK+V SG AP+S    + F+  +P +  +QGYG+TEST +G    +  +
Sbjct  310   EVIKKKYDLSSLKKVLSGGAPLSKEVTEGFLEKYPSVAILQGYGLTESTGIGASTDSLEE  369

Query  808   LRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAV  629
              R Y + G+L+P+M A++VD      G +LP    GELWLRGP IMKGY +N EA+ + +
Sbjct  370   SRRYGTAGMLSPSMSAKIVD---PESGKALPVNKTGELWLRGPTIMKGYFSNEEATASTL  426

Query  628   DDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSA  449
             D +GWL TGD+ + DEDG+++V DRLKE+IKYKG+Q+ PA+LEA+L++HP I DAAV   
Sbjct  427   DSEGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVPPAELEALLLNHPQISDAAVIPF  486

Query  448   QSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKIL  269
               ++VG+ P+A+VV+K GS  ++S++ V+DF+AKQVAPYK++RRV F  SIPK+ SGKIL
Sbjct  487   PDKDVGQFPMAYVVRKSGS--TMSESAVMDFIAKQVAPYKRIRRVAFVASIPKNPSGKIL  544

Query  268   RKELRNLLITSKI  230
             RK+L   L TSK+
Sbjct  545   RKDLIK-LATSKL  556



>ref|XP_006416394.1| hypothetical protein EUTSA_v10007272mg [Eutrema salsugineum]
 gb|ESQ34747.1| hypothetical protein EUTSA_v10007272mg [Eutrema salsugineum]
Length=552

 Score =   414 bits (1063),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 235/565 (42%), Positives = 345/565 (61%), Gaps = 47/565 (8%)
 Frame = -2

Query  1852  RSCFYSSETGIYRS------KHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSIS  1691
             +SC   S +G  RS      K   + LP++P LDV +FI S+ H G +A +D+ +G  +S
Sbjct  11    QSCLVDSRSGFCRSNSTFYSKRTPLTLPANPSLDVTTFISSQPHRGTTAFIDAATGHRLS  70

Query  1690  YPELRSLVNSMAAGLH-RMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTL  1514
             + +L   V+ +A  LH  +G+ +GDV LIL PNSI+ PV+ L ++S+GAV  T N L+T+
Sbjct  71    FSDLWRAVDRVADYLHHEIGIRKGDVVLILSPNSIHVPVVCLSVMSLGAVLTTANTLNTV  130

Query  1513  SEIKKQSFDCNVRLAFATPDR------------VQNLGSTLGIPVIGLPESLNLDSPFRK  1370
              EI KQ  D N +LAF TPD             ++ +G T G+ V+G+   +    P  K
Sbjct  131   GEISKQISDSNPKLAFTTPDLAPKLADSAIPLVLERVGPTRGVKVVGILSEMMKKEPSGK  190

Query  1369  LISSDPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYP  1190
              +          R+ Q DTA +L+SSGTTG  K V  +H N  A +  FV  +  + E  
Sbjct  191   RVRE--------RVNQDDTAVMLYSSGTTGPSKGVISSHGNLTAQMARFVSDKWKEEE--  240

Query  1189  ATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPP  1010
                 ++L  +PM+H +GL  F MG ++LG+TVV++R++E+ +++ A+++Y  T   +APP
Sbjct  241   ----IFLCTVPMFHTFGLICFAMGTVALGTTVVILRRFELHDMMAAVEKYRATILALAPP  296

Query  1009  LLVALTR-----KAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTES  845
             ++VA+       KAK D   L SL+ V  G AP+S    + F+  +P +D   GY +TES
Sbjct  297   VVVAMINGADLIKAKYD---LSSLRMVRCGGAPLSKEVTEGFLEKYPTVDIFAGYALTES  353

Query  844   TAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKG  665
                G    +  + R Y + GLL+  +EAR+VD      G  +     GELWL+GP+I KG
Sbjct  354   NGAGASIESVEESRRYGAAGLLSSGVEARIVD---PETGRVMGANQTGELWLKGPSIAKG  410

Query  664   YLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMS  485
             Y  N EA+   ++ +GWL TGD+ + D+DG+L+V DRLKE+IKYKG+Q+ PA+LEA+LM+
Sbjct  411   YFRNKEATDETINSEGWLKTGDLCYIDDDGFLFVVDRLKELIKYKGYQVPPAELEALLMT  470

Query  484   HPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFT  305
             HPDI+DAAV     +E G+ P+A+V +K   E +LS+  VIDF++KQVAPYKK+R+V F 
Sbjct  471   HPDILDAAVIPFPDKEAGQYPMAYVARKL--ESNLSEKQVIDFISKQVAPYKKIRKVAFI  528

Query  304   KSIPKSASGKILRKELRNLLITSKI  230
              SIPKS SGK LRK+L   L TSK+
Sbjct  529   NSIPKSVSGKTLRKDLIK-LATSKL  552



>gb|KFK44161.1| hypothetical protein AALP_AA1G222800 [Arabis alpina]
Length=545

 Score =   412 bits (1060),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 231/546 (42%), Positives = 345/546 (63%), Gaps = 21/546 (4%)
 Frame = -2

Query  1855  RRSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELR  1676
             R+S F  S T I+ SK   + LP +  LDV +FI S+ H G +A VD+ +G  +S+PE  
Sbjct  17    RKSGFCKS-TSIFYSKREPISLPPNQSLDVTTFISSQPHRGTTAFVDAVTGRHLSFPEFW  75

Query  1675  SLVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQ  1496
               V  + A ++ +GV +G+V +IL PNSI+FP++ L ++S+GA+  T NP+ST  EI KQ
Sbjct  76    LRVERVTACIYALGVRKGNVVIILSPNSIFFPIVSLSVMSLGAIITTANPISTSGEISKQ  135

Query  1495  SFDCNVRLAFATPDRVQNLGS-TLGIPVIGLP-ESLNLDSPFRKLISSDPKLAPTPRIRQ  1322
               D N  LAF T   V  L +  L +PV+ +  E+ +L++     +S         R+  
Sbjct  136   IEDSNPVLAFTTRQLVSKLTTANLNLPVVLMDGETWSLEAMMETELSES---RVKHRVEL  192

Query  1321  QDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVY  1142
              DTAA+L+SSGTTG  K V +TH N IA+V+      A++  Y         + PMYH++
Sbjct  193   DDTAALLYSSGTTGKSKGVMITHRNLIALVQ------ATRARYGLEQRTVCTI-PMYHIF  245

Query  1141  GLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKA--DKC  968
             G   F  GL++LG T+VV+ K+++ +++ A++ +  ++  + PP++VA+   AK    K 
Sbjct  246   GFGSFTTGLIALGWTIVVLPKFDMAQLLTAVEIHRSSYLSLVPPIVVAMLNGAKEINSKY  305

Query  967   GLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSV  788
              L SL  V +G AP+S    + FV +FP +  +QGYG+TESTA+    F   +   Y S 
Sbjct  306   DLSSLHTVVAGGAPLSREVTEKFVESFPKVKVLQGYGLTESTAISASMFTKEETERYGSS  365

Query  787   GLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLH  608
             GLLAP++E ++VD      G  L     GELW+R P +MKGY  N EA+  ++D +GWL 
Sbjct  366   GLLAPSVEGKIVD---PDSGRVLGVGQTGELWMRSPTVMKGYFKNEEATAASIDSEGWLK  422

Query  607   TGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGE  428
             TGD+ + D DG+++V DRLKE+IK  G+Q+APA+LEA+L++HP+I DAAV      + GE
Sbjct  423   TGDLCYIDSDGFVFVVDRLKELIKCNGYQVAPAELEALLLAHPEIADAAVIPIADVKAGE  482

Query  427   IPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNL  248
              P+A++V+K GS  +LS++ ++DFVAKQVAPYK++R+V F  SIPK+ SGKILR+EL+  
Sbjct  483   YPMAYIVRKAGS--NLSESEIMDFVAKQVAPYKRIRKVSFLASIPKNPSGKILRRELKK-  539

Query  247   LITSKI  230
             L TSK+
Sbjct  540   LTTSKL  545



>gb|KHN37880.1| 4-coumarate--CoA ligase-like 5 [Glycine soja]
Length=570

 Score =   413 bits (1062),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 245/564 (43%), Positives = 352/564 (62%), Gaps = 33/564 (6%)
 Frame = -2

Query  1894  NISKIRNSAAEKGRRSCFYSSETGIYRS------KHPSVHLPSDPFLDVVSFILSR-NHG  1736
             N  K   S    G RS  Y+S TGIY S      KH    +P+ P L+  +F+LS+    
Sbjct  10    NEEKYNRSQPPFGSRSG-YNSRTGIYHSLIKLGIKH---EIPTRPDLNTANFVLSQFPQA  65

Query  1735  GLS----ALVDSQSGFSISYPELRSLVNSMAAGL-HRMGVSQGDVALILLPNSIYFPVIF  1571
              L+    A +D+++  S+SY ELR  + S+A+ L H + V +GDV  +L PNS  +  I 
Sbjct  66    HLAEARIAFIDARTNLSVSYGELRRSIYSLASALFHGLEVRKGDVVFVLSPNSTLYSTIC  125

Query  1570  LGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPES--  1397
             L +LSVGAV  T NP++T +EI KQ  D + +LA + P+ +  L  T G+P I       
Sbjct  126   LAVLSVGAVLTTANPINTATEIAKQVHDSSAKLAISAPEELHKLVPT-GVPTILTSHCSD  184

Query  1396  ---LNLDSPFRKLISSDPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVEL  1226
                L+++   +   +S P+L   P + Q DTAA+L+SSGTTG  K V LTHAN I+++ L
Sbjct  185   GNMLSVEELIKGCCTS-PELPQVP-VAQSDTAAILYSSGTTGVSKGVVLTHANLISIMRL  242

Query  1225  FVRFEASQYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAID  1046
              +    S     +  +V+L  +PM+H+YGL  F +GLL +G T ++++KY+   ++ AI 
Sbjct  243   LLW---SADVSGSQDDVFLAFIPMFHIYGLVFFGLGLLCVGVTTILMQKYDFQAMLDAIQ  299

Query  1045  RYGVTHFPVAPPLLVALTRKAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQ  866
             ++ V + P  PP+++AL + A+  +C L SL++V SGAAP+S      F R FP I+  Q
Sbjct  300   KHKVNNLPAVPPVILALVKHARKARCDLSSLRRVGSGAAPLSKEVALEFRRMFPWIELRQ  359

Query  865   GYGMTESTAVGTRGFNTAKLRNY-TSVGLLAPNMEARVVDLssggggsSLPPTSMGELWL  689
             GYG+TES+   T   +    + +  S G L P   A+VVD+  G     LPP   GELW 
Sbjct  360   GYGLTESSGGATFFASDKDAKAHPDSCGKLIPTFCAKVVDIEKGKP---LPPHKEGELWF  416

Query  688   RGPAIMKGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPA  509
             + P IMKGYL N EA+  A+D +GWL TGD+ + DE+G++Y+ +R+KE+IK+ G+Q+APA
Sbjct  417   KSPTIMKGYLGNLEATSAAIDSEGWLRTGDLGYIDENGFVYIVERIKELIKHNGYQVAPA  476

Query  508   DLEAVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYK  329
             +LE+VL+SHP IVDAAV   + EE G+IP+A+VV+  GSE  LS+  VI FVA QVAPYK
Sbjct  477   ELESVLLSHPLIVDAAVIPVEDEETGQIPMAYVVRAAGSE--LSENQVIQFVAGQVAPYK  534

Query  328   KVRRVYFTKSIPKSASGKILRKEL  257
             KVR+V F  +IPKSA+GKILRK+L
Sbjct  535   KVRKVSFIDTIPKSAAGKILRKDL  558



>ref|XP_002872738.1| hypothetical protein ARALYDRAFT_490166 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48997.1| hypothetical protein ARALYDRAFT_490166 [Arabidopsis lyrata subsp. 
lyrata]
Length=544

 Score =   412 bits (1059),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 229/537 (43%), Positives = 340/537 (63%), Gaps = 24/537 (4%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFIL--SRNHGGLSALVDSQSGFSISYPELRSLVNSMAA  1652
             GIYRS  P++ LP DP   +VSF+   S ++    A+ DS SG S+S+ +L+S V  +A 
Sbjct  10    GIYRSLRPTLVLPKDPNTSLVSFLFRNSSSYPSKLAIADSDSGDSLSFSQLKSAVARLAH  69

Query  1651  GLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRL  1472
             G  R+GV + DV LI  PNS  FP+ FL + ++G V  T NPL T++E+ KQ  D N ++
Sbjct  70    GFQRLGVRKNDVVLIFAPNSYQFPLCFLAVTAIGGVFTTANPLYTVNEVSKQIKDSNPKI  129

Query  1471  AFATP---DRVQNLGSTLGIPVIGLPESLNLDS-------PFRKLISSDPKLAPTP--RI  1328
               +     D+++  G  L + ++G  +S+ +          F  ++     ++  P   I
Sbjct  130   IISVNQLFDKIK--GFNLPVVLLGSKDSVQIPPGSNSKILSFNDVMELSEPVSDYPFVEI  187

Query  1327  RQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYH  1148
             +Q DTAA+L+SSGTTG  K V LTH NFIA   +    +    EY     V+L  LPM+H
Sbjct  188   KQSDTAALLYSSGTTGTSKGVELTHGNFIAASLMVTMDQDLMGEY---HGVFLCFLPMFH  244

Query  1147  VYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKC  968
             V+GL++     L  G+ +V + K+E++ V++ I++Y VTH  V PP+ +AL++++   K 
Sbjct  245   VFGLTVITYSQLQRGNALVSMAKFELELVLKNIEKYRVTHLWVVPPVFLALSKQSIVKKF  304

Query  967   GLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSV  788
              L SLK + SGAAP+    ++   R  P++  +QGYGMTE+  + +        RN  S 
Sbjct  305   DLSSLKYIGSGAAPLGKDLMEECGRNIPNVLLMQGYGMTETCGIVSVEDPRLGKRNSGSA  364

Query  787   GLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLH  608
             G+LAP +EA++V + +G      PP   GE+W+RGP +MKGYLNN +A+K  +D  GW+H
Sbjct  365   GMLAPGVEAQIVSVETGNSQ---PPNQQGEIWVRGPNMMKGYLNNPQATKETIDKKGWVH  421

Query  607   TGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGE  428
             TGD+ +F+EDG LYV DRLKE+IKYKGFQ+APA+LE +L+SHP+I+DA V     EE GE
Sbjct  422   TGDLGYFNEDGNLYVVDRLKELIKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDEEAGE  481

Query  427   IPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             +P+AFVV+   S  S+++ ++  F+AKQVAPYK++RRV F  ++PKSA+GKILR+EL
Sbjct  482   VPIAFVVRSPNS--SITEQDIQKFIAKQVAPYKRLRRVSFINTVPKSAAGKILRREL  536



>gb|AGW27195.1| 4-coumarate:coenzyme A ligase 5 [Salvia miltiorrhiza]
Length=545

 Score =   412 bits (1058),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 222/538 (41%), Positives = 340/538 (63%), Gaps = 25/538 (5%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLS---ALVDSQSGFSISYPELRSLVNSMA  1655
             G++RS  P + LP++P L +VSF+  RN    +   AL+D+ +G ++++   +S+V+ +A
Sbjct  10    GVFRSLRPPLSLPTNPNLSLVSFLF-RNTSSFAEKRALIDAHTGETLTFSHFKSMVSRVA  68

Query  1654  AGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVR  1475
              GL ++G+ + DV LI  PNSI FP+ F G++++GAVA T+NP+ T  E+ KQ  D   +
Sbjct  69    HGLLQLGIKKNDVVLIFSPNSIQFPLCFFGIIAIGAVATTVNPVYTAREVSKQLKDSMAK  128

Query  1474  LAFATPDRVQNLGSTLGIPVIGLPESLNLDSP---------FRKLISSDPKL---APTPR  1331
             +     + +  + +   +P+I L +S    SP         F KL+ ++  +     +  
Sbjct  129   MIITVEELLPKV-NDFDLPIILLGDSEKPVSPNGRTPKITLFSKLVENEGSVDIDGNSFG  187

Query  1330  IRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMY  1151
             I+Q DTAA+L+SSGTTG  K V LTH NFIA  ++     A Q        V++ VLPM+
Sbjct  188   IKQNDTAALLYSSGTTGASKGVILTHRNFIASSQMIT---ADQEMAGEVNCVFMCVLPMF  244

Query  1150  HVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADK  971
             HV+GL++ ++  L  GS ++ + K++ + ++R +++Y VTH  V PP+++AL + +   K
Sbjct  245   HVFGLAVIMLSQLQRGSAIISMSKFDFEMLLRTVEKYAVTHLWVVPPIILALAKNSVVKK  304

Query  970   CGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTS  791
               + SLKQV SGAAP+    +Q   +TFP    +QGYGMTE+  + +     A  R+  S
Sbjct  305   YDMSSLKQVGSGAAPLGKELMQECAKTFPQAVVMQGYGMTETCGIVSVENAYAGPRHSGS  364

Query  790   VGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWL  611
              G+L P +E ++V + +      LPPT MGE+W+RG  +M+GY  N +A+K  +D  GW+
Sbjct  365   AGMLVPGVECQIVSVETLKP---LPPTQMGEIWVRGQNMMQGYFRNPQATKLTIDKQGWV  421

Query  610   HTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVG  431
             HTGD+ +FDEDG LYV DR+KE+IKYKG Q+APA+LE +L+SHP+I DA V      E G
Sbjct  422   HTGDLGYFDEDGLLYVVDRIKELIKYKGLQVAPAELEGLLVSHPEISDAVVIPYPDAEAG  481

Query  430   EIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             E+P A+VV+   S  SLS+ ++  F+A QVAP+K++RRV F  S+PKSASGKILR+EL
Sbjct  482   EVPAAYVVRAPNS--SLSEEDIKKFIADQVAPFKRLRRVTFINSVPKSASGKILRREL  537



>gb|ADG46006.1| 4-coumarate coenzyme A ligase [Isatis tinctoria]
Length=543

 Score =   412 bits (1058),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 229/536 (43%), Positives = 341/536 (64%), Gaps = 23/536 (4%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFIL--SRNHGGLSALVDSQSGFSISYPELRSLVNSMAA  1652
             GIYRS  P++ LP DP L +VSF+   S ++    A+VDS SG S+S+ +L+S V+ +A 
Sbjct  10    GIYRSLRPTLVLPKDPNLSLVSFLFRNSSSYPSKPAIVDSDSGDSLSFSQLKSAVSRLAQ  69

Query  1651  GLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRL  1472
             G  R+G+ + DV LI  PNS  FP+ FL + ++G V  T NPL T +E+ KQ  D N +L
Sbjct  70    GFLRLGIRKNDVVLIFAPNSYQFPLCFLAVSAIGGVFTTANPLYTTNEVSKQIKDSNPKL  129

Query  1471  AFATP---DRVQNLGSTLGIPVIGLPESLNLDSPFRKLIS-------SDP-KLAPTPRIR  1325
               +     D+V+  G  L + ++G  ES+ +     K+++       SDP    P   I+
Sbjct  130   IVSVERLFDKVK--GFNLPVVLLGSGESVQIPESDSKILTFDNVMELSDPVSDLPVVDIK  187

Query  1324  QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHV  1145
             Q DTAA+L+SSGTTG  K V LTH NF+A   +    +    EY     V+L  LPM+HV
Sbjct  188   QSDTAALLYSSGTTGISKGVELTHGNFVAASLMTTMDQDLMGEY---HGVFLCFLPMFHV  244

Query  1144  YGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCG  965
             +GL++     L  G+ ++ + ++E++ +++ I++Y VT   V PP+ +AL++++   K  
Sbjct  245   FGLAVIAYSQLQRGNALISMARFELEALLKNIEKYRVTQLWVVPPVFLALSKQSIVKKYD  304

Query  964   LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVG  785
             L SLK + SGAAP+    ++   +  P+I  +QGYGMTE+  + +        RN  S G
Sbjct  305   LSSLKYIGSGAAPLGKDLMEECGKNIPNIVLMQGYGMTETCGIVSVEDPRLGKRNSGSAG  364

Query  784   LLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHT  605
             +LAP +EA++V + +G      PP   GE+W+RG  +MKGY NN +A+K  +D  GW+HT
Sbjct  365   MLAPGVEAQIVSVETGKSQ---PPNQQGEIWVRGANMMKGYFNNPQATKETIDKKGWVHT  421

Query  604   GDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEI  425
             GD+ +F+EDG L+V DR+KE+IKYKGFQ+APA+LE +L+SHP+I+DA V     EE GE+
Sbjct  422   GDLGYFNEDGNLFVVDRIKELIKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDEEAGEV  481

Query  424   PVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             P+AFVV+   S  S++Q ++  F+AKQVAPYK++RRV F  S+PKSA+GKILR+EL
Sbjct  482   PIAFVVRSPKS--SITQEDIQKFIAKQVAPYKRLRRVSFISSVPKSAAGKILRREL  535



>ref|XP_003536288.1| PREDICTED: 4-coumarate--CoA ligase-like 5-like [Glycine max]
Length=570

 Score =   412 bits (1059),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 245/564 (43%), Positives = 351/564 (62%), Gaps = 33/564 (6%)
 Frame = -2

Query  1894  NISKIRNSAAEKGRRSCFYSSETGIYRS------KHPSVHLPSDPFLDVVSFILSR-NHG  1736
             N  K   S    G RS  Y+S TGIY S      KH    +P+ P L+  +F+LS+    
Sbjct  10    NEEKYNRSQPPFGSRSG-YNSRTGIYHSLIKLGIKH---EIPTRPDLNTANFVLSQFPQA  65

Query  1735  GLS----ALVDSQSGFSISYPELRSLVNSMAAGL-HRMGVSQGDVALILLPNSIYFPVIF  1571
              L+    A +D+++  S+SY ELR  + S+A+ L H + V +GDV  +L PNS  +  I 
Sbjct  66    HLAEARIAFIDARTNLSVSYGELRRSIYSLASALFHGLEVRKGDVVFVLSPNSTLYSTIC  125

Query  1570  LGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPES--  1397
             L +LSVGAV  T NP++T +EI KQ  D + +LA + P+ +  L  T G+P I       
Sbjct  126   LAVLSVGAVLTTANPINTATEIAKQVHDSSAKLAISAPEELHKLVPT-GVPTILTSHCSD  184

Query  1396  ---LNLDSPFRKLISSDPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVEL  1226
                L+++   +   +S P+L   P + Q DTAA+L+SSGTTG  K V LTHAN I+++ L
Sbjct  185   GNMLSVEELIKGCCTS-PELPQVP-VAQSDTAAILYSSGTTGVSKGVVLTHANLISIMRL  242

Query  1225  FVRFEASQYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAID  1046
              +    S     +  +V+L  +PM+H+YGL  F +GLL +G T ++++KY+   ++ AI 
Sbjct  243   LLW---SADVSGSQDDVFLAFIPMFHIYGLVFFGLGLLCVGVTTILMQKYDFQAMLDAIQ  299

Query  1045  RYGVTHFPVAPPLLVALTRKAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQ  866
             ++ V + P  PP+++AL + A+   C L SL++V SGAAP+S      F R FP I+  Q
Sbjct  300   KHKVNNLPAVPPVILALVKHARKATCDLSSLRRVGSGAAPLSKEVALEFRRMFPWIELRQ  359

Query  865   GYGMTESTAVGTRGFNTAKLRNY-TSVGLLAPNMEARVVDLssggggsSLPPTSMGELWL  689
             GYG+TES+   T   +    + +  S G L P   A+VVD+  G     LPP   GELW 
Sbjct  360   GYGLTESSGGATFFASDKDAKAHPDSCGKLIPTFCAKVVDIEKGKP---LPPHKEGELWF  416

Query  688   RGPAIMKGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPA  509
             + P IMKGYL N EA+  A+D +GWL TGD+ + DE+G++Y+ +R+KE+IK+ G+Q+APA
Sbjct  417   KSPTIMKGYLGNLEATSAAIDSEGWLRTGDLGYIDENGFVYIVERIKELIKHNGYQVAPA  476

Query  508   DLEAVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYK  329
             +LE+VL+SHP IVDAAV   + EE G+IP+A+VV+  GSE  LS+  VI FVA QVAPYK
Sbjct  477   ELESVLLSHPLIVDAAVIPVEDEETGQIPMAYVVRAAGSE--LSENQVIQFVAGQVAPYK  534

Query  328   KVRRVYFTKSIPKSASGKILRKEL  257
             KVR+V F  +IPKSA+GKILRK+L
Sbjct  535   KVRKVSFIDTIPKSAAGKILRKDL  558



>ref|XP_009103339.1| PREDICTED: 4-coumarate--CoA ligase-like 4 [Brassica rapa]
Length=542

 Score =   410 bits (1055),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 237/557 (43%), Positives = 343/557 (62%), Gaps = 38/557 (7%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  S +  Y  ++P + LP++P LDV +FI S+ H G +A +D+ +G  +S+ EL +
Sbjct  8     RSGFCKSNSTFYSKRNP-LPLPANPSLDVTTFISSQPHRGTTAFIDAATGHRLSFSELWT  66

Query  1672  LVNSMAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQ  1496
              V  +A  LH  +G+ +G V LIL PNSIY PV+ L ++S+GAV  T N L+T +EI +Q
Sbjct  67    AVERVADCLHHDIGLKRGHVVLILSPNSIYIPVVSLAVMSLGAVVTTANTLNTAAEISRQ  126

Query  1495  SFDCNVRLAFATPDR------------VQNLGSTLGIPVIG-LPESLNLDSPFRKLISSD  1355
               D N  LAF T D             ++ +GST G+ V+G + E +  +   +++    
Sbjct  127   LADSNPTLAFTTADLAPKLAGSGISVVLERVGSTRGVDVVGAVSEMMKKERRGQRV----  182

Query  1354  PKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANV  1175
                    R+ ++DTA +L+SSGTTG  K V  +H N  A V  FV       E      V
Sbjct  183   -----RDRVNEEDTAMMLYSSGTTGPSKGVITSHRNLTASVARFVS------EKRIGGEV  231

Query  1174  YLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVAL  995
             +L  +PM+H YGL  F M  +++GSTVV++R++++  ++ A+++Y  T   + PP++VA+
Sbjct  232   FLCTVPMFHTYGLLCFTMFTVAVGSTVVILRRFDLHGMMAAVEKYSATILALTPPVVVAM  291

Query  994   TRKAKA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGF  821
             T +A     K  L SL+ V  G AP+S    + F+  +P +D + GY +TES   G    
Sbjct  292   TNEADVIRAKYDLSSLRTVRCGGAPLSKEVTEGFMEKYPTVDILAGYALTESNGAGASID  351

Query  820   NTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEAS  641
                + R Y SVGLLAP +EAR+VD      G  +     GELWLRGP+I KGY  N EA+
Sbjct  352   TVEESRRYGSVGLLAPGVEARIVD---PDTGRVMGVNQTGELWLRGPSISKGYFKNEEAT  408

Query  640   KNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAA  461
                ++ +GWL TGDI + DEDG+L+V DRLKE+IKYKG+Q+ PA+LEA+L++HPDI+DAA
Sbjct  409   NETINLEGWLKTGDICYIDEDGFLFVVDRLKELIKYKGYQVPPAELEALLVTHPDILDAA  468

Query  460   VTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSAS  281
             V     +E G+ P+A+V +K   E +LS+  +IDFV+KQVAPYKK+R+V F  SIPK+ S
Sbjct  469   VIPFPDKEAGQYPMAYVTRK--IESNLSEKQIIDFVSKQVAPYKKIRKVAFINSIPKNPS  526

Query  280   GKILRKELRNLLITSKI  230
             GK LRK+L   L TSKI
Sbjct  527   GKTLRKDLIK-LATSKI  542



>ref|XP_007219482.1| hypothetical protein PRUPE_ppa022057mg [Prunus persica]
 gb|EMJ20681.1| hypothetical protein PRUPE_ppa022057mg [Prunus persica]
Length=569

 Score =   411 bits (1056),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 244/563 (43%), Positives = 343/563 (61%), Gaps = 44/563 (8%)
 Frame = -2

Query  1840  YSSETGIYRSKHPSVHL---PSDPFLDVVSFILSR---NHGGLS--ALVDSQSGFSISYP  1685
             + ++TGIY +     HL   P+ P LD  +F+LS+   +H   S  AL+DS +   ++Y 
Sbjct  21    FDAKTGIYHALPNLGHLHKIPTRPDLDTATFVLSQFPPHHQAKSRVALIDSATNQRVTYA  80

Query  1684  ELRSLVNSMAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSE  1508
             +L   +  +A+GL++ +GV +GDV  +L PNS+ +P I L +LS+GAV  T NPL+T SE
Sbjct  81    QLHHSIQCLASGLYQGLGVRKGDVVFLLSPNSLLYPTICLAVLSIGAVLTTANPLNTKSE  140

Query  1507  IKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPFRKLISSDPKLA-----  1343
             I KQ  D   +LA + P+ +  L  T G+P I       L S  R L+S D  L      
Sbjct  141   IGKQVRDSGAKLAISAPEELHKLAPT-GVPTI-------LTS--RPLLSGDNSLCIEELI  190

Query  1342  ----PTP------RIRQQDTAAVLFSSGTTGGCKAVALTHANFIA-MVELFVRFEASQYE  1196
                 P P      R  Q DTAA+L+SSGTTG  K V LTHANFIA M  L    + +   
Sbjct  191   EGCDPIPTELIQARPTQSDTAAILYSSGTTGTSKGVVLTHANFIAVMTTLRWTVDGTS--  248

Query  1195  YPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVA  1016
               A  +V+L  +PM+H+YGL+ F +GL   G T V+++K+E + ++ AI  + V++ P  
Sbjct  249   --AQDDVFLCFIPMFHIYGLAFFGLGLFCSGITTVLMQKFEFNTMLDAIKTHKVSNIPAV  306

Query  1015  PPLLVALTRKAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAV  836
             PP+++ L + A    C L SL++VSSGAAP+S   +  F   FP +    GYG+TES   
Sbjct  307   PPVILGLVKYASKAACDLSSLRRVSSGAAPLSKEVVDEFRERFPWVQMRPGYGLTESCGA  366

Query  835   GTRGFNTAKLRNY-TSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYL  659
              T   +  + R +  S GLL P   A++VD+ +G     LPP   GELW++ P IMK YL
Sbjct  367   ATFFISDEQARGHPASCGLLLPTFCAKIVDIETGEA---LPPYKEGELWMKSPTIMKEYL  423

Query  658   NNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHP  479
              N EA+   +D DGWL TGD+ +FDE+G LY+ DR+KE+IK+ G+Q+APA+LEA+L+SHP
Sbjct  424   GNVEATAATIDSDGWLKTGDLCYFDENGLLYIVDRIKELIKHNGYQVAPAELEAILLSHP  483

Query  478   DIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKS  299
              I+DAAV   + EE G+IP+A+VV +  S   L++  VI FVA QVAPYKKVRRV F  +
Sbjct  484   QILDAAVIPVEDEEAGQIPMAYVV-RAASPDGLTEDQVIQFVAGQVAPYKKVRRVGFISA  542

Query  298   IPKSASGKILRKELRNLLITSKI  230
             IP+S + KILRKEL NL    +I
Sbjct  543   IPRSPASKILRKELVNLQSKQQI  565



>ref|XP_008232324.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Prunus mume]
Length=569

 Score =   410 bits (1055),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 244/563 (43%), Positives = 344/563 (61%), Gaps = 44/563 (8%)
 Frame = -2

Query  1840  YSSETGIYRSKHPSVH---LPSDPFLDVVSFILSR---NHGGLS--ALVDSQSGFSISYP  1685
             + ++TGIY +     H   +P+   LD  +F+LS+   +H   S  AL+DS +   ++Y 
Sbjct  21    FDAKTGIYHALPKLGHRHKIPTRHDLDTATFVLSQFPPHHQAKSRVALIDSTTNQRVTYA  80

Query  1684  ELRSLVNSMAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSE  1508
             +L   +  +A+GL++ +GV +GDV  +L PNS+ +P I L +LS+GAV  T NPL+T SE
Sbjct  81    QLHHSIQCLASGLYQGLGVRKGDVVFLLSPNSLLYPTICLAVLSIGAVLTTANPLNTKSE  140

Query  1507  IKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPFRKLISSDPKLA-----  1343
             I KQ  D   +LA + P+ +  L  T G+P I       L S  R L++ D  L      
Sbjct  141   IGKQVRDSGAKLAISAPEELHKLAPT-GVPTI-------LTS--RPLLTGDNSLCIEELI  190

Query  1342  ----PTP------RIRQQDTAAVLFSSGTTGGCKAVALTHANFIA-MVELFVRFEASQYE  1196
                 P P      R  Q DTAA+L+SSGTTG  K V LTHANFIA M  L    + +   
Sbjct  191   EGCDPIPTELIQARPTQSDTAAILYSSGTTGTSKGVVLTHANFIAVMTTLRWTVDGTS--  248

Query  1195  YPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVA  1016
               A  +V+L  +PM+H+YGL+ F +GL   G+T V+++KYE + ++ AI  + V++ P  
Sbjct  249   --AQDDVFLCFIPMFHIYGLAFFGLGLFCSGTTTVLMQKYEFNTMLDAIKTHKVSNIPAV  306

Query  1015  PPLLVALTRKAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAV  836
             PP+++ L + A    C L SL++VSSGAAP+S   +  F   FP +    GYG+TES   
Sbjct  307   PPVILGLVKHASKAACDLSSLRRVSSGAAPLSKEVVDEFRERFPWVQMRPGYGLTESCGA  366

Query  835   GTRGFNTAKLRNYT-SVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYL  659
              T   +  + R ++ S GLL P   A++VD+ +G     LPP   GELW++ P IMK YL
Sbjct  367   ATFFISDEQARAHSASCGLLLPTFCAKIVDIETGEA---LPPYKEGELWMKSPTIMKEYL  423

Query  658   NNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHP  479
              N EA+   VD DGWL TGD+ +FDEDG LY+ DR+KE+IK+ G+Q+APA+LEA+L+SHP
Sbjct  424   GNVEATAATVDSDGWLKTGDLCYFDEDGLLYIVDRIKELIKHNGYQVAPAELEAILLSHP  483

Query  478   DIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKS  299
              I+DAAV   + EE G+IP+A+VV +  S   L++  VI FVA QVAPYKKVRRV F  +
Sbjct  484   QILDAAVIPVEDEEAGQIPMAYVV-RAASPDGLTEDQVIQFVAGQVAPYKKVRRVGFISA  542

Query  298   IPKSASGKILRKELRNLLITSKI  230
             IP+S + KILRKEL NL    +I
Sbjct  543   IPRSPASKILRKELVNLQSKEQI  565



>ref|XP_010111818.1| 4-coumarate--CoA ligase-like 7 [Morus notabilis]
 gb|EXC31783.1| 4-coumarate--CoA ligase-like 7 [Morus notabilis]
Length=665

 Score =   413 bits (1062),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 226/532 (42%), Positives = 337/532 (63%), Gaps = 19/532 (4%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFIL--SRNHGGLSALVDSQSGFSISYPELRSLVNSMAA  1652
             GI+RS  P + LP DP L  VSF+   S ++    AL+D+ SG  +S+ +L+S V  ++ 
Sbjct  10    GIFRSLRPPLVLPKDPNLSAVSFLFRNSSSYPNKPALIDADSGEILSFSQLKSTVAKVSH  69

Query  1651  GLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRL  1472
             G   +G+ + DV LI  PNSI+FPV FLG++++GA+A T NPL T+SE+ KQ  D N +L
Sbjct  70    GFLHLGIKKNDVVLIFAPNSIHFPVCFLGIIAIGAIATTSNPLYTVSELSKQVKDSNPKL  129

Query  1471  AFATPDRVQNLGSTLGIPVIGLPESLNLDSPFRKL-------ISSDPKLAPTPRIRQQDT  1313
                 P+  + +     +P + L  + +   P + L       +S      P+  +++ DT
Sbjct  130   IITVPELWEKV-KGFNLPTVML-SAEHKSVPKKVLTFNGLVNLSGSASDFPSVNVKRSDT  187

Query  1312  AAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVYGLS  1133
             A +L+SSGTTG  K V LTH NFIA   L V  +  Q       NV+L VLPM+HV+GL+
Sbjct  188   AVLLYSSGTTGTSKGVVLTHGNFIA-ASLMVAMD--QEIAKEMHNVFLCVLPMFHVFGLA  244

Query  1132  LFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCGLKSL  953
             +     L  G+ VV + K+++++++  ++RY +THF V PP+++AL + +   K  L SL
Sbjct  245   VITYSQLQRGNAVVSMAKFDLEKILMTVERYKITHFWVVPPIVLALAKNSVVKKYNLSSL  304

Query  952   KQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGLLAP  773
             K + SGAAP+    ++   +  P    IQGYGMTE+  + +        RN  S G L  
Sbjct  305   KHIGSGAAPLGKELMEECAKIIPQGVVIQGYGMTETCGIVSVEDTRGGKRNTGSAGTLVS  364

Query  772   NMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTGDIV  593
              +EA++V + +      LPP  +GE+W+RGP +M+GYLNN +A+K+ +D  GW+HTGD+ 
Sbjct  365   GVEAQIVGVDTLKP---LPPNQLGEIWVRGPNMMQGYLNNPQATKSTMDKKGWVHTGDLG  421

Query  592   HFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIPVAF  413
             +FDEDG+L+V DR+KE+IKYKGFQ+APA+LE +L+SHP+I+DA V      E GE+PVA+
Sbjct  422   YFDEDGHLFVVDRIKELIKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDAEAGEVPVAY  481

Query  412   VVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             VV+   S  SL++ +V  F+A QVAP+K++R+V F  S+PKSASGKILR+EL
Sbjct  482   VVRSPNS--SLTEEDVQKFIANQVAPFKRLRKVTFINSVPKSASGKILRREL  531



>ref|XP_006843037.1| hypothetical protein AMTR_s00076p00189570 [Amborella trichopoda]
 gb|ERN04712.1| hypothetical protein AMTR_s00076p00189570 [Amborella trichopoda]
Length=543

 Score =   409 bits (1051),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 219/537 (41%), Positives = 345/537 (64%), Gaps = 25/537 (5%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFILSRN---HGGLSALVDSQSGFSISYPELRSLVNSMA  1655
             GIYRS  P V  P DP+L+++SF+  RN   +G   A+ D+++   +++ EL  +V+ + 
Sbjct  10    GIYRSLRPPVVFPKDPYLNMMSFMF-RNSSLYGEKLAVADAETDEGLNFRELEVVVDRVR  68

Query  1654  AGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVR  1475
              GL+++G+ +GDV LI  PNS++F   F G++S+GA+A T+NP+ T  E+ KQ  D   +
Sbjct  69    NGLNKIGIRRGDVVLIFAPNSMHFATCFFGVVSLGAIATTVNPMYTSMEVAKQVKDSGSK  128

Query  1474  LAFATPDRVQNLGSTLGIPVIGL----PESLNLD------SPFRKLISSDPKLAPTPRIR  1325
             L    P   + + + LG+P + L      S+N        S   ++ +S     P  R+R
Sbjct  129   LVITVPQLWEKV-NCLGLPAVILDYAKTSSINSQRGITYYSDLLEMGASTKNSLPVARVR  187

Query  1324  QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATA-NVYLDVLPMYH  1148
             Q DTAA+L+SSGTTG  K V LTH NFIA   +     AS  ++     N +L V+PM+H
Sbjct  188   QSDTAALLYSSGTTGTSKGVILTHGNFIAASLM----AASDQDWKGELHNRFLCVIPMFH  243

Query  1147  VYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKC  968
             ++GLS+     L  G+ VV++ ++++ +++R+++++ VTH  V PP+++AL ++    K 
Sbjct  244   IFGLSILNYAQLQRGNAVVIMSRFDLHQMLRSVEKFRVTHLFVVPPIMIALAKQTVVSKY  303

Query  967   GLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSV  788
              L SL+Q+  GAAP+    +++  R  P  + +QGYGMTES  + +         ++ S 
Sbjct  304   DLSSLRQLGVGAAPVGKDILEDCARNIPLAEVVQGYGMTESCGIISLEMRMKGKHHFGST  363

Query  787   GLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLH  608
             G L P +EA++V++ +      LPP  +GE+W+RGP IM+GY NN +A+K+ +  +GWL 
Sbjct  364   GFLVPGVEAKIVNVDTLKP---LPPNQLGEIWIRGPHIMQGYFNNPQATKSTIVKEGWLL  420

Query  607   TGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGE  428
             TGD+ +FD++G L+V DR+KE+IKYK FQIAPA+LE +L+SHP+I+DA V      E GE
Sbjct  421   TGDLGYFDDEGRLFVVDRIKELIKYKAFQIAPAELEGLLLSHPEILDAVVIPFPDAEAGE  480

Query  427   IPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             +P+A+VV+ +GS  S+++ +V +FVAKQVA +K++RRV F  S+PKSASGKILR+EL
Sbjct  481   VPIAYVVRSQGS--SITEKDVQEFVAKQVASFKRLRRVTFVNSVPKSASGKILRREL  535



>gb|AGW47873.1| 4-coumarate:coenzyme A ligase 8 [Phaseolus vulgaris]
Length=548

 Score =   409 bits (1052),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 222/542 (41%), Positives = 347/542 (64%), Gaps = 25/542 (5%)
 Frame = -2

Query  1840  YSSETGIYRSKHPSVHLPSDPFLDVVSFILSR--NHGGLSALVDSQSGFSISYPELRSLV  1667
             Y S+ G YRS+ PS+ LP +P L +VSF+     +    +ALVD+ S  ++++ +L++ V
Sbjct  10    YCSD-GTYRSQRPSLVLPKNPNLSLVSFLFQSVSSFPSKTALVDADSSQTLTFAQLKARV  68

Query  1666  NSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFD  1487
              ++A G  ++G+ + DV L+L PN+I+FPV FL + ++GA+ +T NP+ T+ E+  Q  D
Sbjct  69    ATLAHGFLKLGIKKNDVVLLLAPNTIHFPVCFLAVTAIGAIVSTANPIYTVHELSNQVKD  128

Query  1486  CNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPFR----KLISSDPKLA--------  1343
              N +L    P+ + +    L +P + L  + NL +P +    K+ S +  +         
Sbjct  129   SNPKLVITVPE-LWDKAKNLNLPAVILSTN-NLQNPTKNVSGKITSLEAVMEMAGPVTEL  186

Query  1342  PTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDV  1163
             P   ++Q DTAA+L+SSGTTG  K V LTH NFIA   +    +    E     +V+L V
Sbjct  187   PESGVKQGDTAALLYSSGTTGLSKGVVLTHGNFIAASVMISMDDDLAGE---VNDVFLCV  243

Query  1162  LPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKA  983
             LPM+HV+GL++     L  GS +V + K+E++  ++AI+++ VT   + PP+L+A+ +++
Sbjct  244   LPMFHVFGLAVVTYTALRRGSAMVSMGKFELEAFLKAIEKHRVTKLWLVPPILLAMAKQS  303

Query  982   KADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLR  803
                   L SLK++ SGAAP+    +Q   R FPH+   QGYGMTE+  + +     A +R
Sbjct  304   VVQSYDLSSLKRIGSGAAPLGKELMQECGRRFPHVAICQGYGMTETCGIVSVENPRAGIR  363

Query  802   NYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDD  623
             +  S G+LA  +EA++V + +      LPPT  GE+W+RGP +MKGY NN +A++  +D+
Sbjct  364   HTGSTGMLASGVEAQIVTVDTQKP---LPPTQSGEIWVRGPNMMKGYHNNPQATRLTIDE  420

Query  622   DGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQS  443
              GW+HTGDI +FDEDG LYV DR+KE+IKYKGFQ+APA+LE +L+SHP+I+DA V     
Sbjct  421   KGWVHTGDIGYFDEDGQLYVVDRIKELIKYKGFQVAPAELEGLLISHPEILDAVVVPYPD  480

Query  442   EEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRK  263
             +E GE+P+A+VV+   S  SL++  +  F+A QVAP+KK+RRV F  S+P+++SGKILR+
Sbjct  481   DEAGEVPIAYVVRSPNS--SLTEEEIKKFIANQVAPFKKLRRVTFISSVPRTSSGKILRR  538

Query  262   EL  257
             E+
Sbjct  539   EI  540



>ref|XP_008787716.1| PREDICTED: 4-coumarate--CoA ligase-like 5 isoform X2 [Phoenix 
dactylifera]
Length=553

 Score =   409 bits (1052),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 238/540 (44%), Positives = 339/540 (63%), Gaps = 26/540 (5%)
 Frame = -2

Query  1840  YSSETGIYRSKHPSVHLPSDPF-LDVVSFILSRNHGGL---SALVDSQSGFSISYPELRS  1673
             +  ET  + S  P+  LP +   L  V++ LS     L   SAL+D+ +G +ISYPE  S
Sbjct  20    FCHETKTFHSLRPAAPLPDENLPLSAVAYTLSFLPSPLPSNSALIDAGTGAAISYPEFVS  79

Query  1672  LVNSMAAGLH-RMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQ  1496
              V ++AA L  R G+S+GDVA +L P  +  P+++  LLS+G V +  NPLST +EI  Q
Sbjct  80    CVRTLAASLRSRAGLSKGDVAFVLSPTRLDVPLLYFALLSLGVVVSPANPLSTAAEISHQ  139

Query  1495  SFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSP-FRKLISSDPKLAPTP--RIR  1325
                    +AFAT      L S L I        + LDSP FR  + +    A  P   + 
Sbjct  140   IRLSKPSVAFATAATADKLPSDLPI--------ILLDSPRFRSFLYTAAPAAAPPPAEVS  191

Query  1324  QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHV  1145
             Q DTAA+L+SSGTTG  K V LTH NF+A++  F     +        +V L  +P++HV
Sbjct  192   QSDTAAILYSSGTTGRVKGVVLTHRNFVALIAGFHAAREAAEAPTEGPSVALFTIPLFHV  251

Query  1144  YGLSLFVMGL--LSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADK  971
             +G   F M L  ++LG T V++ ++E   ++RA++R+ VT+ PV+PPL+VA+ +  + D+
Sbjct  252   FG---FFMALRTVALGETTVMMERFEFGAMLRAVERHRVTYIPVSPPLVVAMAKSDEVDR  308

Query  970   CGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTS  791
               L SL+ V+ G AP+     + F   FP+I+ +QGYG+TEST   +    + + + Y S
Sbjct  309   YDLSSLRLVACGGAPLGREVAERFTARFPNIEVVQGYGLTESTGGASATMGSEESQKYGS  368

Query  790   VGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWL  611
              G L+  +EA++VD      G +LPP   GELWLRGP IMKGY+ + EA+ + +D +GWL
Sbjct  369   AGRLSACLEAKIVD---PTTGEALPPGRRGELWLRGPIIMKGYIGDAEATASTLDSEGWL  425

Query  610   HTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVG  431
              TGD+ +FD+DG+++V DRLKE+IKYK +Q+ PA+LE +L SHP+I DAAV     EE G
Sbjct  426   KTGDLCYFDQDGFIFVVDRLKELIKYKAYQVPPAELEHLLQSHPEIADAAVIPLPDEEAG  485

Query  430   EIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRN  251
             +IP+AF+V++ GS  SLS+  V++FVAKQVAPYKKVRRV F  SIPKSA+GKILR+EL N
Sbjct  486   QIPMAFIVRQPGS--SLSEEQVMNFVAKQVAPYKKVRRVAFVSSIPKSAAGKILRRELIN  543



>emb|CDY39155.1| BnaC09g21890D [Brassica napus]
Length=542

 Score =   409 bits (1050),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 230/537 (43%), Positives = 340/537 (63%), Gaps = 26/537 (5%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFIL---SRNHGGLSALVDSQSGFSISYPELRSLVNSMA  1655
             GIYRS  P + LP DP   +VSF+    S ++    A++DS SG S+S+ +L+S V  +A
Sbjct  10    GIYRSLRPPLVLPKDPNTSLVSFLFRNSSSSYPSKPAIIDSDSGDSLSFSDLKSSVARLA  69

Query  1654  AGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVR  1475
              G  R+G+ Q DV LI  PNS  FP+ FL + ++GAV  T NPL T +E+ KQ  D N +
Sbjct  70    HGFLRLGIRQNDVVLIFAPNSYQFPLCFLAVSAIGAVFTTANPLYTTNEVSKQIKDSNPK  129

Query  1474  LAFATP---DRVQNLGSTLGIPVIGL---PESLNLDSP---FRKLISSDPKLA--PTPRI  1328
             L  +     D+V++      +PV+ L    ESL+ +S    F+ ++    +++  P   I
Sbjct  130   LIISVEQLFDKVKDFN----LPVVLLGTCNESLDSNSKILTFKNVMELSDQVSDLPVAAI  185

Query  1327  RQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYH  1148
             +Q DTAA+L+SSGTTG  K V LTH NFIA   +    +    EY     V+L  LP++H
Sbjct  186   KQTDTAALLYSSGTTGISKGVELTHGNFIAASLMVTMDQDLMGEY---HGVFLCFLPLFH  242

Query  1147  VYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKC  968
             V+GL++     L  G+ +V + ++E++ +++ I+RY VT   V PP+ +AL +++   K 
Sbjct  243   VFGLAVIAYSQLQRGNALVSMARFELELLLKNIERYRVTQLWVVPPVFLALAKQSVVKKY  302

Query  967   GLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSV  788
              L SLK + SGAAP+    ++   +  P +  +QGYGMTE+  + +        RN  S 
Sbjct  303   DLSSLKYIGSGAAPLGKDLMEECGKNIPSVVLMQGYGMTETCGIVSVEDPRLGKRNSGSA  362

Query  787   GLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLH  608
             G+LAP +EA++V + SG      PP   GE+W+RGP +MKGY NN +A+K  +D  GW+H
Sbjct  363   GMLAPGIEAQIVSVESGKPQ---PPNQQGEIWVRGPNMMKGYFNNPQATKETIDRKGWVH  419

Query  607   TGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGE  428
             TGD+ +F+EDG L+V DRLKE+IKYKGFQ+APA+LE +L+SHP+I+DA V     EE GE
Sbjct  420   TGDLGYFNEDGNLFVVDRLKELIKYKGFQVAPAELEGLLVSHPEILDAVVIPLPDEEAGE  479

Query  427   IPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             +P+AFVV+   S  S+++ ++  F+AKQVAPYK++RRV F  ++PKSA+GKILR+EL
Sbjct  480   VPIAFVVRSPNS--SITEEDIQKFIAKQVAPYKRLRRVSFISTVPKSAAGKILRREL  534



>gb|ABR17274.1| unknown [Picea sitchensis]
Length=540

 Score =   408 bits (1049),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 227/532 (43%), Positives = 331/532 (62%), Gaps = 18/532 (3%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFIL--SRNHGGLSALVDSQSGFSISYPELRSLVNSMAA  1652
             GI+RS  P ++LP D   ++VSF+   S ++    AL D+ SG  +S+ + +  V+ + +
Sbjct  10    GIFRSLRPPLNLPKDENANMVSFMFRDSSSYADKLALADADSGEKLSFRDFKDKVSMVGS  69

Query  1651  GLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRL  1472
             GL ++G+ +GDV L+  PNSI+ P  FLG++S+GAVA T+NPL T  E+ KQ  D   +L
Sbjct  70    GLSQLGIRKGDVVLLFSPNSIHVPPCFLGIVSIGAVATTVNPLYTAMELAKQVQDSQSKL  129

Query  1471  AFATPDRVQNLGSTLGIP--VIGLP-ESLNLDSP----FRKLISSDPKLAPTPRIRQQDT  1313
                 P+ + +    LG+P  VIG   +S    SP    F  L     K  P   I Q DT
Sbjct  130   IITVPE-LWDKAKDLGLPAIVIGRKGDSKRASSPTISFFEVLTMGAQKNPPEVIIEQTDT  188

Query  1312  AAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVYGLS  1133
             AA+L+SSGTTG  K V LTH NFIA   + +  +  + E   T   +L ++PM+HVYGL 
Sbjct  189   AALLYSSGTTGTNKGVVLTHRNFIASALMVISDQELEGERHLT---HLCLVPMFHVYGLG  245

Query  1132  LFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCGLKSL  953
               V G L  G+ VV + K+    ++ AI  Y +TH P+ PP+++A+ ++    +  L SL
Sbjct  246   CIVYGQLQRGNAVVSMGKFTFVRMLEAIQEYKITHLPLVPPIVIAVAKENIVARYDLSSL  305

Query  952   KQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGLLAP  773
             K+V SGAAP+    ++   +  P     QGYG+TES  + T  F   +  ++ S G L P
Sbjct  306   KKVMSGAAPLGKDIMEECAKRIPQAAVTQGYGLTESCGIATITFPKERNSHFGSAGTLVP  365

Query  772   NMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTGDIV  593
              +EA++V+L +G     LPP   GE+WLRGP IM GY NN  A+K  +D +GWLHTGD+ 
Sbjct  366   GLEAKIVNLETGRS---LPPNQSGEVWLRGPNIMTGYFNNPNATKMTLDKEGWLHTGDMG  422

Query  592   HFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIPVAF  413
             +FD++G L++ DR+KE+IKYKGFQ+ PA+LE +L++HP IVDA V        GE+P+A+
Sbjct  423   YFDDEGGLFIVDRIKELIKYKGFQVPPAELEGLLLTHPQIVDAGVIPLPDLNAGEVPIAY  482

Query  412   VVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             VV+  GS  SL++ +V+ +VAKQVAP+K++ R+ F  SIPKS+SGKILR+EL
Sbjct  483   VVRTPGS--SLTEKDVMAYVAKQVAPFKRLHRINFVDSIPKSSSGKILRREL  532



>ref|XP_007132314.1| hypothetical protein PHAVU_011G084300g [Phaseolus vulgaris]
 gb|ESW04308.1| hypothetical protein PHAVU_011G084300g [Phaseolus vulgaris]
Length=548

 Score =   408 bits (1048),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 225/545 (41%), Positives = 347/545 (64%), Gaps = 31/545 (6%)
 Frame = -2

Query  1840  YSSETGIYRSKHPSVHLPSDPFLDVVSFILSR--NHGGLSALVDSQSGFSISYPELRSLV  1667
             Y S+ G YRS+ PS+ LP +P L +VSF+     +    +ALVD+ S  ++++ +L++ V
Sbjct  10    YCSD-GTYRSQRPSLVLPDNPNLSLVSFLFQSVSSFPSKTALVDADSSQTLTFAQLKARV  68

Query  1666  NSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFD  1487
              ++A G  ++G+ + DV L+L PN+I+FPV FL   ++GA+ +T NP+ T+ E+  Q  D
Sbjct  69    ATLAHGFLKLGIKKNDVVLLLAPNTIHFPVCFLAATAIGAIVSTANPIYTVHELSNQVKD  128

Query  1486  CNVRLAFATP---DRVQNLGSTLGIPVIGLPESLNLDSPFR----KLISSDPKLA-----  1343
              N +L    P   D+ +NL     +P + L  + NL +P +    K+ S +  +      
Sbjct  129   SNPKLVITVPELCDKAKNLN----LPAVILSTN-NLQNPTKNVSGKITSLEAVMEMAGPV  183

Query  1342  ---PTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVY  1172
                P   ++Q DTAA+L+SSGTTG  K V LTH NFIA   +    +    E     +V+
Sbjct  184   TELPESGVKQGDTAALLYSSGTTGLSKGVVLTHGNFIAASVMISMDDDLAGE---VNDVF  240

Query  1171  LDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALT  992
             L VLPM+HV+GL++     L  GS VV + K+E++  ++AI+++ VT   + PP+L+A+ 
Sbjct  241   LCVLPMFHVFGLAVVTYTALRRGSAVVSMGKFELEAFLKAIEKHRVTKLWLVPPILLAMA  300

Query  991   RKAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTA  812
             +++      L SLK++ SGAAP+    +Q   R FPH+   QGYGMTE+  + +     A
Sbjct  301   KQSVVQSYDLSSLKRIGSGAAPLGKELMQECGRRFPHVAICQGYGMTETCGIVSVENPRA  360

Query  811   KLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNA  632
              +R+  S G+LA  +EA++V + +      LPPT  GE+W+RGP +MKGY NN +A++  
Sbjct  361   GIRHTGSTGMLASGVEAQIVTVDTQKP---LPPTQSGEIWVRGPNMMKGYHNNPQATRLT  417

Query  631   VDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTS  452
             +D+ GW+HTGDI +FDEDG LYV DR+KE+IKYKGFQ+APA+LE +L+SHP+I+DA V  
Sbjct  418   IDEKGWVHTGDIGYFDEDGQLYVVDRIKELIKYKGFQVAPAELEGLLISHPEILDAVVVP  477

Query  451   AQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKI  272
                +E GE+P+A+VV+   S  SL++  +  F+A QVAP+KK+RRV F  S+P+++SGKI
Sbjct  478   YPDDEAGEVPIAYVVRSPNS--SLTEEEIKKFIANQVAPFKKLRRVTFISSVPRTSSGKI  535

Query  271   LRKEL  257
             LR+E+
Sbjct  536   LRREI  540



>ref|XP_003555474.1| PREDICTED: 4-coumarate--CoA ligase-like 5-like [Glycine max]
Length=569

 Score =   409 bits (1050),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 243/548 (44%), Positives = 347/548 (63%), Gaps = 36/548 (7%)
 Frame = -2

Query  1840  YSSETGIYRS------KHPSVHLPSDPFLDVVSFILSR---NHGGLS--ALVDSQSGFSI  1694
             Y S TGIY S      KH    +P+ P L+  +F+LS+    H   +  A +DS +  S+
Sbjct  26    YDSRTGIYHSLIKLVTKH---EIPTRPDLNTANFVLSQFPQTHLAEARIAFIDSGTSRSV  82

Query  1693  SYPELRSLVNSMAAGL-HRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLST  1517
             SY EL+  + S+A+ L H + + +GDV  +L PNS  +  I L +LSVGAV  T NP++T
Sbjct  83    SYGELKRSIYSLASALFHGLEIRKGDVVFVLSPNSTLYSAICLAVLSVGAVLTTANPINT  142

Query  1516  LSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVI--GLPESLNLDSPFRKLIS---SDP  1352
              +EI KQ  D   +LA + P+ +  L  T G+P+I    P   N+ S   +LI    + P
Sbjct  143   ATEIAKQVHDSGAKLAISAPEELHKLVPT-GVPIILTSRPSDGNMLS-VEELIEGCCTSP  200

Query  1351  KLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVEL-FVRFEASQYEYPATANV  1175
             +L   P + Q DTAA+L+SSGTTG  K V LTHAN I+++ L F   + S  +     +V
Sbjct  201   ELPQVP-VAQSDTAAILYSSGTTGVSKGVVLTHANLISIMRLLFWSADVSGSQ----DDV  255

Query  1174  YLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVAL  995
             +L  +PM+H+YGL  F +GLL +G T ++++KY+   ++ AI ++ V +    PP+++AL
Sbjct  256   FLAFIPMFHIYGLVFFGLGLLCVGVTTILMQKYDFQGMLDAIQKHKVNNIAAVPPVILAL  315

Query  994   TRKAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNT  815
              ++AK  +C L SL++V SGAAP+S    Q F R FP ++  QGYG+TES+  G   F +
Sbjct  316   VKQAKKTRCDLSSLRRVGSGAAPLSKEVAQEFRRMFPWVELRQGYGLTESSG-GATFFPS  374

Query  814   AK--LRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEAS  641
              K    +  S G L P   A+VVD+ +G     LPP   GELW + P IMKGYL N EA+
Sbjct  375   DKDAKAHPDSCGKLIPTFCAKVVDIETGKP---LPPHKEGELWFKSPTIMKGYLGNLEAT  431

Query  640   KNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAA  461
                +D +GWL TGD+ + DE G++Y+ +R+KE+IK+ G+Q+APA+LE+VL+SHP IVDAA
Sbjct  432   SATIDSEGWLKTGDLGYIDEKGFVYIVERIKELIKHNGYQVAPAELESVLLSHPLIVDAA  491

Query  460   VTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSAS  281
             V   + EE G+IP+A+VV+  GSE  LS+  VI FVA QVAPYKKVR+V F  +IPKSA+
Sbjct  492   VIPVEDEETGQIPMAYVVRAAGSE--LSENQVIQFVAGQVAPYKKVRKVSFIVTIPKSAA  549

Query  280   GKILRKEL  257
             GKILRK+L
Sbjct  550   GKILRKDL  557



>ref|NP_192425.1| 4-coumarate--CoA ligase-like 7 [Arabidopsis thaliana]
 sp|Q9M0X9.1|4CLL7_ARATH RecName: Full=4-coumarate--CoA ligase-like 7; AltName: Full=4-coumarate--CoA 
ligase isoform 6; Short=At4CL6 [Arabidopsis 
thaliana]
 emb|CAB81058.1| 4-coumarate--CoA ligase-like protein [Arabidopsis thaliana]
 gb|AAM13899.1| putative 4-coumarate--CoA ligase [Arabidopsis thaliana]
 gb|AAM67483.1| putative 4-coumarate--CoA ligase [Arabidopsis thaliana]
 gb|AAP03022.1| 4-coumarate-CoA ligase-like protein [Arabidopsis thaliana]
 gb|AEE82486.1| 4-coumarate--CoA ligase-like 7 [Arabidopsis thaliana]
Length=544

 Score =   407 bits (1047),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 225/536 (42%), Positives = 335/536 (63%), Gaps = 22/536 (4%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFIL--SRNHGGLSALVDSQSGFSISYPELRSLVNSMAA  1652
             GIYRS  P++ LP DP   +VSF+   S ++    A+ DS +G S+++ +L+S V  +A 
Sbjct  10    GIYRSLRPTLVLPKDPNTSLVSFLFRNSSSYPSKLAIADSDTGDSLTFSQLKSAVARLAH  69

Query  1651  GLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRL  1472
             G HR+G+ + DV LI  PNS  FP+ FL + ++G V  T NPL T++E+ KQ  D N ++
Sbjct  70    GFHRLGIRKNDVVLIFAPNSYQFPLCFLAVTAIGGVFTTANPLYTVNEVSKQIKDSNPKI  129

Query  1471  AFATPDRVQNLGSTLGIPVIGLPESLNLDSP---FRKLISSDPKLA--------PTPRIR  1325
               +       +     +PV+ L     ++ P     K++S D  +         P   I+
Sbjct  130   IISVNQLFDKI-KGFDLPVVLLGSKDTVEIPPGSNSKILSFDNVMELSEPVSEYPFVEIK  188

Query  1324  QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHV  1145
             Q DTAA+L+SSGTTG  K V LTH NFIA   +    +    EY     V+L  LPM+HV
Sbjct  189   QSDTAALLYSSGTTGTSKGVELTHGNFIAASLMVTMDQDLMGEY---HGVFLCFLPMFHV  245

Query  1144  YGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCG  965
             +GL++     L  G+ +V + ++E++ V++ I+++ VTH  V PP+ +AL++++   K  
Sbjct  246   FGLAVITYSQLQRGNALVSMARFELELVLKNIEKFRVTHLWVVPPVFLALSKQSIVKKFD  305

Query  964   LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVG  785
             L SLK + SGAAP+    ++   R  P++  +QGYGMTE+  + +        RN  S G
Sbjct  306   LSSLKYIGSGAAPLGKDLMEECGRNIPNVLLMQGYGMTETCGIVSVEDPRLGKRNSGSAG  365

Query  784   LLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHT  605
             +LAP +EA++V + +G      PP   GE+W+RGP +MKGYLNN +A+K  +D   W+HT
Sbjct  366   MLAPGVEAQIVSVETGKSQ---PPNQQGEIWVRGPNMMKGYLNNPQATKETIDKKSWVHT  422

Query  604   GDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEI  425
             GD+ +F+EDG LYV DR+KE+IKYKGFQ+APA+LE +L+SHPDI+DA V     EE GE+
Sbjct  423   GDLGYFNEDGNLYVVDRIKELIKYKGFQVAPAELEGLLVSHPDILDAVVIPFPDEEAGEV  482

Query  424   PVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             P+AFVV+   S  S+++ ++  F+AKQVAPYK++RRV F   +PKSA+GKILR+EL
Sbjct  483   PIAFVVRSPNS--SITEQDIQKFIAKQVAPYKRLRRVSFISLVPKSAAGKILRREL  536



>ref|XP_006416393.1| hypothetical protein EUTSA_v10007280mg [Eutrema salsugineum]
 gb|ESQ34746.1| hypothetical protein EUTSA_v10007280mg [Eutrema salsugineum]
Length=549

 Score =   407 bits (1047),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 230/556 (41%), Positives = 349/556 (63%), Gaps = 35/556 (6%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             R+ F ++ +  Y  ++P + LP++  LD+ +FI S+ H G +A +D+ +G  IS+ +L  
Sbjct  14    RNGFCNANSTFYSKRNP-LPLPANTSLDITTFISSQPHRGTTAFIDAATGHRISFSDLWR  72

Query  1672  LVNSMAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQ  1496
              VN +A  LH  +G+ +GDV LIL PNSI  PV+ L ++S+GAV  T NPL+T  EI +Q
Sbjct  73    AVNRVADCLHHDVGIRRGDVVLILSPNSISIPVVCLAVMSLGAVVTTSNPLNTAGEISRQ  132

Query  1495  SFDCNVRLAFATPDR------------VQNLGSTLGIPVIGLPESLNLDSPFRKLISSDP  1352
               D N +LAF TP+             ++ +G+T G+ V+G+   +    P  + +    
Sbjct  133   ISDSNPKLAFTTPELAPKVLAGIPIVLLERVGATRGVRVVGVLSEMMKKEPSGERVRD--  190

Query  1351  KLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVY  1172
                   R+ Q DTA +L+SSGTTG  K V  +H N IA V  ++    ++     T  ++
Sbjct  191   ------RVSQDDTAMLLYSSGTTGRSKGVNSSHGNLIAHVARYIAEPTTE-----TNEIF  239

Query  1171  LDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALT  992
             L  +PM+H +GL  FV+  ++LGSTVV++RK+E++E++ A+++Y  T   + PP+LVA+ 
Sbjct  240   LCTVPMFHTFGLLNFVIASVALGSTVVILRKFELEEMMAAVEKYRATVLILVPPVLVAMI  299

Query  991   RKAK--ADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFN  818
               +     K  L SL+ V  G AP+S    + F+  +P +D  QGY +TES   G    +
Sbjct  300   NGSDLIKRKFDLSSLRTVRCGGAPLSKEVTEGFLEKYPTVDIFQGYALTESNGAGASIDS  359

Query  817   TAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASK  638
               + R + +VGLL+  +EAR+VD      G  +     GELWL+GP+I KGY  N EA+K
Sbjct  360   VEESRRFGAVGLLSSGVEARIVD---RNTGRVMGVNQTGELWLKGPSIAKGYYGNEEATK  416

Query  637   NAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAV  458
                D +GWL TGD+ + D+DG++++ DRLKE+IKYKG+Q+ PA+LEA+L++HPDI+DAAV
Sbjct  417   ATFDSEGWLKTGDLCYIDDDGFVFIVDRLKELIKYKGYQVPPAELEALLLNHPDILDAAV  476

Query  457   TSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASG  278
                  +EVG+ P+A+V +K  S+  LS+  VIDF++KQVAPYKK+R+V F  SIPK+ASG
Sbjct  477   IPFPDKEVGQCPMAYVARKPESD--LSEKQVIDFISKQVAPYKKIRKVAFIDSIPKTASG  534

Query  277   KILRKELRNLLITSKI  230
             K LRK+L N + TSK+
Sbjct  535   KTLRKDLIN-MATSKL  549



>gb|AAF79611.1|AC027665_12 F5M15.17 [Arabidopsis thaliana]
Length=580

 Score =   409 bits (1050),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 240/579 (41%), Positives = 347/579 (60%), Gaps = 62/579 (11%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F +S +  Y  + P + LP +P LDV +FI S+ H G  A +D+ +G ++++ EL  
Sbjct  7     RSGFCNSNSTFYSKRTP-IPLPPNPSLDVTTFISSQAHRGRIAFIDASTGQNLTFTELWR  65

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V S+A  L  +G+ +G V L+L PNSI FPV+ L ++S+GA+  T NPL+T +EI KQ 
Sbjct  66    AVESVADCLSEIGIRKGHVVLLLSPNSILFPVVCLSVMSLGAIITTTNPLNTSNEIAKQI  125

Query  1492  FDCNVRLAFATPDRVQNLGSTL-GIPVIGLPESLNLDS--PFRKLISSDPKLAPTPRIR-  1325
              D N  LAF T   +  + +    +P++ + E   +DS    R+L+    K     R++ 
Sbjct  126   KDSNPVLAFTTSQLLPKISAAAKKLPIVLMDEE-RVDSVGDVRRLVEMMKKEPSGNRVKE  184

Query  1324  ---QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLDVLP  1157
                Q DTA +L+SSGTTG  K V  +H N IAMV+  V RF +   E       ++  +P
Sbjct  185   RVDQDDTATLLYSSGTTGMSKGVISSHRNLIAMVQTIVNRFGSDDGE-----QRFICTVP  239

Query  1156  MYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTR----  989
             M+H+YGL+ F  GLL+ GST++V+ K+E+ E++ AI +Y  T  P+ PP+LVA+      
Sbjct  240   MFHIYGLAAFATGLLAYGSTIIVLSKFEMHEMMSAIGKYQATSLPLVPPILVAMVNGADQ  299

Query  988   -KAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTA  812
              KAK D   L S+  V  G AP+S    + F   +P +  +QGYG+TEST +G       
Sbjct  300   IKAKYD---LSSMHTVLCGGAPLSKEVTEGFAEKYPTVKILQGYGLTESTGIGASTDTVE  356

Query  811   KLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNA  632
             + R Y + G L+ +ME R+VD      G  L P   GELWL+GP+IMKGY +N EA+ + 
Sbjct  357   ESRRYGTAGKLSASMEGRIVD---PVTGQILGPKQTGELWLKGPSIMKGYFSNEEATSST  413

Query  631   VDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQI----------------------  518
             +D +GWL TGD+ + DEDG+++V DRLKE+IKYKG+QI                      
Sbjct  414   LDSEGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQIYSPFEALENADESKIVFCELMI  473

Query  517   ------------APADLEAVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQ  374
                         APA+LEA+L++HP+I DAAV     +EVG+ P+A+VV+K GS  SLS+
Sbjct  474   ESACSDMLMDHVAPAELEALLLTHPEITDAAVIPFPDKEVGQFPMAYVVRKTGS--SLSE  531

Query  373   ANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
               +++FVAKQVAPYK++R+V F  SIPK+ SGKILRK+L
Sbjct  532   KTIMEFVAKQVAPYKRIRKVAFVSSIPKNPSGKILRKDL  570



>ref|XP_007017971.1| OPC-8:0 CoA ligase1 [Theobroma cacao]
 gb|EOY15196.1| OPC-8:0 CoA ligase1 [Theobroma cacao]
Length=550

 Score =   407 bits (1047),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 238/552 (43%), Positives = 345/552 (63%), Gaps = 24/552 (4%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             R+ F SS +  Y  + P   LPS+  LD+ +FI S  H G +A +++ +G  +S+ EL  
Sbjct  12    RNGFCSSNSTFYSKRKP-FPLPSNRCLDITTFISSYPHHGKTAFIEAATGRDLSFSELWR  70

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V+ +A  L  +G+ +G V LI+ PNSI+FP++ L ++S+GA+  T NPL+T  EI  Q 
Sbjct  71    GVDLVATCLSDLGIRKGHVVLIIAPNSIFFPMVCLSVMSLGAIITTSNPLNTPREIALQM  130

Query  1492  FDCNVRLAFATPDRVQNL-GSTLGIPVIGLPESLNLDSPFRKLISS-DPKLAPTP-----  1334
              D    L F T   V  L GS+L  P++ L E   + +   K++++ D  +   P     
Sbjct  131   ADSKPALIFTTSQLVPKLAGSSL--PIVLLDEQEIITTSEAKIVATMDQMMKKEPTGSRV  188

Query  1333  --RIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVL  1160
               R+ Q D A++L+SSGTTG  K V  +H N +A+++ F    +           ++  +
Sbjct  189   RDRVYQDDPASLLYSSGTTGVSKGVISSHRNLMALMQSF----SCMANPDEVLQTHICTV  244

Query  1159  PMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK  980
             PM+H+YG   F +G L+ GSTVV++ K++ +E++ AI++Y  T  P+ PP+L+ L + A 
Sbjct  245   PMFHIYGFGAFAIGKLTAGSTVVILSKFDTNEMLSAIEKYRATCLPLVPPILLGLVKGAD  304

Query  979   A--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKL  806
                 K  L SL+ V  G AP+S   I  F+  FP ++  QGY +TE+T  G   ++  + 
Sbjct  305   QIRRKYDLSSLQSVLCGGAPLSKALINGFLEKFPTVNIRQGYALTETTGFGASMYSPEES  364

Query  805   RNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVD  626
             R Y +VGLL   +EAR+VD      GS+L     GELWLRGP+IMKGYLNN EA+ + +D
Sbjct  365   RKYGTVGLLMARLEARIVD---PATGSALQVNQTGELWLRGPSIMKGYLNNVEATASTLD  421

Query  625   DDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQ  446
              DGWL TGD+ + D DG+L+V DRLKE+IKYKG+Q+ PA+LEA+L+SHP+I DAAV    
Sbjct  422   SDGWLKTGDLCYIDGDGFLHVVDRLKEVIKYKGYQVPPAELEALLLSHPEISDAAVIPFP  481

Query  445   SEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILR  266
              EEVG+ P+A+VV+K GS V  S+  VIDFVA+QVAPYKK+R++ F  SIPK+ SGKILR
Sbjct  482   DEEVGQYPMAYVVRKTGSNV--SETEVIDFVARQVAPYKKIRKLAFVTSIPKNPSGKILR  539

Query  265   KELRNLLITSKI  230
             + L   L TSKI
Sbjct  540   RALVK-LATSKI  550



>ref|XP_010068871.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Eucalyptus grandis]
 gb|KCW65469.1| hypothetical protein EUGRSUZ_G02879 [Eucalyptus grandis]
Length=568

 Score =   408 bits (1048),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 233/523 (45%), Positives = 325/523 (62%), Gaps = 27/523 (5%)
 Frame = -2

Query  1786  SDPFLDVVSFILSRNHGGLS----ALVDSQSGFSISYPELRSLVNSMAAGL-HRMGVSQG  1622
             +D  LDV S +LS+    L+    AL+D+ +   ISY  L   + S+A GL H +GV +G
Sbjct  48    TDRNLDVASCVLSQFPHALAESRIALIDAATNCQISYAHLYRSIRSLAYGLYHAVGVRKG  107

Query  1621  DVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRLAFATPDRVQN  1442
             DV  ++ PNS+ +P I L +LSVGA+    NPL+T  EI KQ  D   +LA   P+ +  
Sbjct  108   DVVFLVAPNSLLYPTISLAILSVGAILTPANPLNTTLEIAKQVADSGAKLAICAPEELHK  167

Query  1441  LGSTLGIPVIGLPESLNLDSPFRKLISS-------DPKLAPTPRIRQQDTAAVLFSSGTT  1283
             L     IP   LP  L   +    L+S+       DP   P  R  Q DTAAVL+SSGTT
Sbjct  168   L-----IPT-KLPTMLTTKTSDGTLLSAEEFIECFDPIDLPPERPTQTDTAAVLYSSGTT  221

Query  1282  GGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLG  1103
             G  K V LTHAN I+++ L    + S     +  +V+L  +PM+H+YGL+ FV+GL   G
Sbjct  222   GTSKGVILTHANLISVISLL---KWSVSASSSQDDVFLCFIPMFHIYGLAFFVLGLFCSG  278

Query  1102  STvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCGLKSLKQVSSGAAPI  923
              T VV+++++   ++  I  + V + P  PP+++AL + A   KC L SL++V SGAAP+
Sbjct  279   ITTVVMQRFDFQAMLDVIKVHRVNNIPAVPPVILALVKHASNMKCDLSSLRRVGSGAAPL  338

Query  922   SITCIQNFVRTFPHIDFIQGYGMTESTAVGTR-GFNTAKLRNYTSVGLLAPNMEARVVDL  746
             S      F   FP ++  QGYG+TE+    +    +     +  S G L P+  A++VD+
Sbjct  339   SKEVTDGFREKFPWVELRQGYGLTETCGAASFFALDEDAKAHSGSCGSLLPHFSAKIVDI  398

Query  745   ssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLY  566
              +G     LPP   GELWLR P IMKGYL N EA+   +D +GWL TGD+ +FDEDG+LY
Sbjct  399   KTGSP---LPPNKEGELWLRSPTIMKGYLRNEEATTATLDPEGWLRTGDLGYFDEDGFLY  455

Query  565   VHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEV  386
             + DR+KE+IK+ G+Q+APA+LEA+L+SHP IVDAAV   ++EE G++P+A+VVK  GSE 
Sbjct  456   IVDRIKELIKHNGYQVAPAELEALLLSHPQIVDAAVIPLENEEAGQVPMAYVVKASGSE-  514

Query  385   SLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
              L++  VI F+A QVAPYKKVRRV F  +IPKSA+GKILRK+L
Sbjct  515   -LTENQVIRFIADQVAPYKKVRRVGFISTIPKSAAGKILRKQL  556



>ref|XP_001761993.1| predicted protein [Physcomitrella patens]
 gb|EDQ73097.1| predicted protein [Physcomitrella patens]
Length=552

 Score =   407 bits (1047),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 238/544 (44%), Positives = 333/544 (61%), Gaps = 25/544 (5%)
 Frame = -2

Query  1840  YSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVNS  1661
             Y S  GIY SK   V +P    LD+ S++ +   G   AL+D+ SG  ++Y +L   V +
Sbjct  14    YRSSDGIYFSKRKPVWIPQACDLDLGSYVFAPQFGDKKALMDAPSGRHLTYDQLERQVRA  73

Query  1660  MAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             +AAGL++ + V Q DV ++L PN I FPVIFL ++S+GAV  T++  +T  E++KQ  D 
Sbjct  74    LAAGLYKCLNVRQYDVVMLLSPNCIEFPVIFLAVVSLGAVLTTVHQANTAGEVQKQMKDS  133

Query  1483  NVRLAFATPDRVQNL-GSTLGIPVIGLPE-----SLNLDSPFRKLISSDPKLAPTPRIRQ  1322
               RL F T    + + G  L + + G  E     S      + +L+ +DP   P  +I+Q
Sbjct  134   GTRLIFTTAALTEKIAGFDLPVVIFGDDEVVPGFSSKPIHQYTELLRTDPYGVPRVKIKQ  193

Query  1321  QDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVY  1142
              DTAA+L+SSGTTG  K V LTH NFI+   L     A   E  +  +V L +LPM+HVY
Sbjct  194   HDTAALLYSSGTTGTSKGVVLTHRNFIS---LCCMLNAGSDETLSPDDVLLLLLPMFHVY  250

Query  1141  GLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCGL  962
             GL +  +  L+ G  +VV+ +++   ++  I  Y VTH P+ PP+++ L ++    K  L
Sbjct  251   GLGICTVASLARGIMLVVMPQFDFVNMLSTIQTYRVTHLPLVPPIVIGLAKQDIVFKFDL  310

Query  961   KSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLR------N  800
              SL Q+ SGAAP+    ++   +  P + F QGY +TESTA    G  T  +       +
Sbjct  311   SSLVQIISGAAPLGKEMLEACAKRLPTVQFKQGYALTESTA----GCTTCPVNVDDAAAH  366

Query  799   YTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDD  620
             + S G L PNMEA VVD         LPPT  GELW+RGP IMKGYLNN +A+  ++D D
Sbjct  367   FGSSGWLLPNMEAMVVD---PNTNQPLPPTKEGELWIRGPTIMKGYLNNPKATSESLDKD  423

Query  619   GWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSE  440
             GWLHTGD+V  D DGYL V DRLKE+IKY  FQ+APA+LEA+L+SHP ++D AV     E
Sbjct  424   GWLHTGDLVVIDNDGYLDVKDRLKELIKYNAFQVAPAELEALLLSHPAVLDCAVIPYPDE  483

Query  439   EVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKE  260
               GEIP+A++V++   E  L++  ++D++AKQVAPYKKVR+V F  +IPKSASGKILRK+
Sbjct  484   ISGEIPMAWIVRQ--PEQQLNEDEIMDWIAKQVAPYKKVRKVAFVDAIPKSASGKILRKD  541

Query  259   LRNL  248
             L  L
Sbjct  542   LVQL  545



>ref|XP_009603383.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Nicotiana tomentosiformis]
Length=538

 Score =   407 bits (1045),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 222/530 (42%), Positives = 338/530 (64%), Gaps = 16/530 (3%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLS---ALVDSQSGFSISYPELRSLVNSMA  1655
             GIYRS  P + LP D  L +VSF+  RN        AL D+ SG ++++ + +++V+ ++
Sbjct  10    GIYRSLRPPLFLPKDQNLSMVSFLF-RNISSFPEKPALFDADSGQTLTFSQFKTIVSKIS  68

Query  1654  AGL-HRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNV  1478
              GL H+ G+ + DV LI  PNSI FP+ F G++++GA+A T+NP+ T+SE+ KQ  DC  
Sbjct  69    HGLIHQFGIKKNDVVLIFAPNSIQFPLCFFGVIALGAIATTVNPMYTISELSKQIKDCKP  128

Query  1477  RLAFATPDRVQNL-GSTLGIPVIGLPESLNLDS-PFRKLISSDPKL-APTPRIRQQDTAA  1307
             +L  + P+ +  + G  L I ++G  ++ N     F +L+     +      I+Q DTAA
Sbjct  129   KLIISVPELLDKISGFNLPILLLGHKKNSNFSGVTFTELVDKAGYVNLDNSGIKQSDTAA  188

Query  1306  VLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVYGLSLF  1127
             +L+SSGTTG  K V L+H NFIA   L V   A Q       NV+L VLPM+HV+GL++ 
Sbjct  189   LLYSSGTTGISKGVVLSHRNFIA-ASLMV--TADQDLKGEMHNVFLCVLPMFHVFGLAVI  245

Query  1126  VMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCGLKSLKQ  947
             +   L  GS +V + +++++ +++ +D+Y VTH  + PP+++AL +     K  L SL+ 
Sbjct  246   MYAQLQRGSAIVSMARFDLEMILKTVDKYRVTHLWIVPPVVLALAKNPVVKKYNLTSLRN  305

Query  946   VSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGLLAPNM  767
             + SGAAP+    +++  + FP     QGYGMTE+  +          R+  S G L P +
Sbjct  306   IGSGAAPLGKDLMEDCAKNFPQAVVFQGYGMTETCGIVAVESPYVGPRHTGSAGTLVPGV  365

Query  766   EARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTGDIVHF  587
             EA++V +        LPP  +GE+W+RGP +M+GY NN +A+K  +D+ GW+HTGD+ +F
Sbjct  366   EAQIVSVDKLKP---LPPGQLGEIWVRGPNMMQGYFNNPQATKLTIDNQGWVHTGDLGYF  422

Query  586   DEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIPVAFVV  407
             DE+G LYV DR+KE+IKYKGFQ+APA+LE +L+SHP+I+DA V      E GE+P+A+VV
Sbjct  423   DEEGMLYVVDRIKELIKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDAEAGEVPIAYVV  482

Query  406   KKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             +   S  SL++ +V  F+A QVAP+K++R+V F  S+PKSASGKILR+EL
Sbjct  483   RSPNS--SLTEEDVQKFIADQVAPFKRLRKVTFVNSVPKSASGKILRREL  530



>gb|EPS70306.1| hypothetical protein M569_04447, partial [Genlisea aurea]
Length=540

 Score =   407 bits (1045),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 233/539 (43%), Positives = 339/539 (63%), Gaps = 28/539 (5%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFIL--SRNHGGLSALVDSQSGFSISYPELRSLVNSMAA  1652
             G+YRS  P V LP DP L +VSF+   S  +    AL+D+ +G  +S+ +  +LV  +A 
Sbjct  10    GVYRSLRPPVSLPEDPNLSMVSFLFRNSSTYSDKPALIDAHTGNVVSFSQFETLVAKLAL  69

Query  1651  GLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRL  1472
             GL ++GV + DV LI  PNSI FP+ F G +++GA+A+T+NP  T+SE+ KQ  DC+ +L
Sbjct  70    GLLQLGVGKNDVVLIFSPNSIEFPLAFFGAVAIGAIASTVNPAYTVSELSKQIKDCSPKL  129

Query  1471  AFATPD---RVQN-------LGSTLG--IPVIGLPESLNLDSPFRKLISSDPKLAPTP--  1334
              F   D   +V++       LGS     +P+  +P    L+     L+ ++   +     
Sbjct  130   IFTVVDLLPKVKDFKLPVIILGSNSQPPLPIGNIPSITTLND----LLHNNGSWSSIHEM  185

Query  1333  RIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPM  1154
             RI+Q D AA+L+SSGTTG  K V LTH NFIA   L V   + Q       NV+L VLPM
Sbjct  186   RIKQDDAAALLYSSGTTGPSKGVVLTHRNFIA-ASLMVT--SDQVFAGEKHNVFLCVLPM  242

Query  1153  YHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKAD  974
             +HV+GLS+ +   L  G+ VV + K+ ++  ++A++ Y VT   + PP+++AL++    +
Sbjct  243   FHVFGLSVIMFSQLQHGNAVVSMSKFNLEMSLKAVETYRVTDLFIVPPIVLALSKNMAVE  302

Query  973   KCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYT  794
                L SLK + SGAAP+    +    + FP     QGYGMTE+  + +        RN  
Sbjct  303   NYDLSSLKLIGSGAAPLGRELMIECAKKFPQAAICQGYGMTETCGIISIESPHMGPRNSG  362

Query  793   SVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGW  614
             S G+LAP +E+R+V + +      LPP  +GE+W+RG  +M+GYLNN EASK  +D  GW
Sbjct  363   SSGMLAPGVESRIVSVENSKA---LPPGEVGEIWVRGQNMMRGYLNNPEASKLTIDKQGW  419

Query  613   LHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEV  434
             +HTGD+ +FDE+G ++V DR+KE+IKYKGFQ+APA+LE +L+SH +I+DAAV     EE 
Sbjct  420   VHTGDLGYFDEEGLVHVVDRIKELIKYKGFQVAPAELEGLLISHDEILDAAVVPYPDEEA  479

Query  433   GEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             G++PVAFVV+   S  SLS+ +V  FVA QVAP+K++RRV F  ++PKSASGKILR+EL
Sbjct  480   GQVPVAFVVRLPTS--SLSEEDVKKFVADQVAPFKRLRRVSFVTAVPKSASGKILRREL  536



>emb|CDY46375.1| BnaA09g19890D [Brassica napus]
Length=542

 Score =   407 bits (1045),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 229/537 (43%), Positives = 334/537 (62%), Gaps = 26/537 (5%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFIL---SRNHGGLSALVDSQSGFSISYPELRSLVNSMA  1655
             GIYRS  P + LP DP   +VSF+    S ++    A++DS SG S+S+ +L+S V  +A
Sbjct  10    GIYRSLRPPLLLPKDPNTSLVSFLFRNSSSSYPSKPAIIDSDSGVSLSFSDLKSSVARLA  69

Query  1654  AGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVR  1475
              G  R+G+ Q DV LI  PNS  FP+ FL + ++GAV  T NPL T +EI KQ  D N +
Sbjct  70    RGFLRLGIRQNDVVLIFAPNSYQFPLCFLAVSAIGAVFTTANPLYTTNEISKQIKDSNPK  129

Query  1474  LAFATP---DRVQNLGSTLGIPVIGLPESLNLDSPFRKLISSDPKLA--------PTPRI  1328
             L  +     D+V++      +PV+ L  S     P  K++S    +         P   I
Sbjct  130   LIISVQQLFDKVKDFN----LPVVLLGSSNESLEPSSKILSFKNVMELSDQVSDLPVVEI  185

Query  1327  RQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYH  1148
             +Q DTAA+L+SSGTTG  K V LTH NFIA   +    +    EY     V+L  LPM+H
Sbjct  186   KQTDTAALLYSSGTTGISKGVELTHGNFIAASLMVTMDQDLMGEY---HGVFLCFLPMFH  242

Query  1147  VYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKC  968
             V+GL++     L  G+ +V + ++E++ +++ I++Y VT   V PP+ +AL +++   K 
Sbjct  243   VFGLAVIAYSQLQRGNALVSMARFELELLLKNIEKYRVTQLWVVPPVFLALAKQSIVKKY  302

Query  967   GLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSV  788
              L SLK + SGAAP+    ++   +   ++  +QGYGMTE+  + +        RN  S 
Sbjct  303   DLSSLKYIGSGAAPLGKDLMEECGKNIHNVVLMQGYGMTETCGIVSVEDPRLGKRNSGSA  362

Query  787   GLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLH  608
             G+LAP +EA++V + SG      PP   GE+W+RGP +MKGY NN +A+K  +D  GW+H
Sbjct  363   GMLAPGIEAQIVSVESGKPQ---PPNQQGEIWVRGPNMMKGYFNNPQATKETIDRKGWVH  419

Query  607   TGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGE  428
             TGD+ +F+EDG L+V DRLKE+IKYKGFQ+APA+LE +L+SHP+I+DA V     EE GE
Sbjct  420   TGDLGYFNEDGNLFVVDRLKELIKYKGFQVAPAELEGLLVSHPEILDAVVIPLPDEEAGE  479

Query  427   IPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             +P+AFVV+   S  S+++ ++  F+AKQVAPYK++RRV F  ++PKSA+GKILR+EL
Sbjct  480   VPIAFVVRSPNS--SITEEDIQKFIAKQVAPYKRLRRVSFISTVPKSAAGKILRREL  534



>ref|XP_011004441.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Populus euphratica]
Length=543

 Score =   406 bits (1044),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 231/535 (43%), Positives = 340/535 (64%), Gaps = 21/535 (4%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFIL--SRNHGGLSALVDSQSGFSISYPELRSLVNSMAA  1652
             GIYRS  P + LP DP L +VSF+   S ++    AL+D+    ++S+ EL+S+V  +A 
Sbjct  10    GIYRSLRPKLVLPKDPNLSLVSFLFRNSNSYPHKPALIDADLSITLSFSELKSIVIKVAH  69

Query  1651  GLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRL  1472
             GL  +G+S+ DV LI  PNS  FP+ FL + S GA+A T NPL T SE+ KQ  D N RL
Sbjct  70    GLLNLGISKNDVVLIFAPNSYQFPICFLAITSTGAIATTANPLYTTSELSKQIKDSNPRL  129

Query  1471  AFATP---DRVQ--NLGST-LGIPVIGLP-ESLNLDSPFRKLIS---SDPKLAPTPRIRQ  1322
                 P   D+V+  NL +  LG   + LP ES +  + F  L+    S+ +  P+  ++Q
Sbjct  130   IITVPELWDKVKGFNLPAVFLGPKRVSLPLESGSRITSFDSLVGLGGSNSQF-PSSNVKQ  188

Query  1321  QDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVY  1142
              D + +L+SSGTTG  K V LTH NFIA   L V  +  Q       NV+L  LPM+HV+
Sbjct  189   SDISTLLYSSGTTGVSKGVVLTHENFIA-ASLMVTMD--QVMAGEMHNVFLCFLPMFHVF  245

Query  1141  GLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCGL  962
             GL++     L +G+ VV + K+E + V++ I+++ VTH  V PP+++AL ++    K  L
Sbjct  246   GLAVITYSQLQMGNAVVSMGKFEFEMVLKTIEKHRVTHMWVVPPVVLALAKQDMVKKYDL  305

Query  961   KSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGL  782
              SL+ + SGAAP+    ++   +  P     QGYGMTE+  + +   +   +R+  S G+
Sbjct  306   SSLRNIGSGAAPLGKDLMKECAKNLPDTIISQGYGMTETCGIVSVEDSRLGVRHSGSAGI  365

Query  781   LAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTG  602
             LA  +EA++V + +      LPP  +GE+W+RGP +M+GY NN +A+K+ +D  GWLHTG
Sbjct  366   LAAGIEAQIVSVETLKP---LPPNQLGEIWVRGPNMMRGYFNNPQATKDTIDKRGWLHTG  422

Query  601   DIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIP  422
             D+ +FD+DG L+V DR+KE+IKYKGFQ+APA+LE +L+SHP I+DA V      E GE+P
Sbjct  423   DLGYFDDDGQLFVVDRIKELIKYKGFQVAPAELEGLLVSHPQILDAVVIPYPDAEAGEVP  482

Query  421   VAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             VA+VV+   S  +L++ +V  F+A QVAP+K++R+V FT ++PKSASGKILR+EL
Sbjct  483   VAYVVRSPNS--ALTEVDVQKFIADQVAPFKRLRKVTFTNTVPKSASGKILRREL  535



>gb|KHG20084.1| 4-coumarate--CoA ligase-like 5 [Gossypium arboreum]
Length=552

 Score =   407 bits (1045),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 229/551 (42%), Positives = 339/551 (62%), Gaps = 25/551 (5%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             +S F SS +  Y  + P   LPS+  LD+ +FI S  H G +A +D+ +G  +S+ +L  
Sbjct  12    KSGFCSSNSTFYSKRVP-FPLPSNHALDITTFISSYPHHGKTAFIDATTGRHLSFSQLWQ  70

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V+S++  L  +G+ +G++ +I+ PNSI+ P++ L ++S+GA+  T NPL+T  E   Q 
Sbjct  71    SVDSVSTCLSELGIRKGNIVIIIAPNSIFIPIVCLSVMSLGAIITTSNPLNTSREFAVQM  130

Query  1492  FDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPFR-KLISS---------DPKLA  1343
              D    L F T   V  L  +  +P++ L E +  +   + K++++           K+ 
Sbjct  131   ADSKPVLVFTTSQVVPKLAGS-PLPIVLLDEQVATEKTGQVKIVTTISEMLKKETKDKIR  189

Query  1342  PTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATA-NVYLD  1166
                R+ Q D A +L+SSGTTG  K V  +H N +A+++ F     S    P      ++ 
Sbjct  190   VRDRVYQDDAATLLYSSGTTGASKGVISSHGNLMALMQSF-----SHLSNPDEGEQTHIC  244

Query  1165  VLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRK  986
              +PM+H+YG   F +G L  GS VVV+ K+++ E++ AI++Y VT  P+ PP+L+ + ++
Sbjct  245   AVPMFHIYGFGAFAIGKLPQGSKVVVLSKFDMKEMLSAIEKYRVTCLPLVPPILLVMVKE  304

Query  985   AKA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTA  812
             A     K  L SL+ +  G AP+S   I  F+  FP ID  QGY MTEST  G       
Sbjct  305   ADEIRKKYDLSSLQSIVCGGAPLSKDLINRFMEKFPSIDIRQGYAMTESTGFGASMQTPE  364

Query  811   KLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNA  632
             +   Y SVGLL+PN+EA++VD      G++L     GELWLRGP+IMKGYLNN EA+   
Sbjct  365   ECLKYGSVGLLSPNLEAKIVD---PTTGTALKVNQKGELWLRGPSIMKGYLNNAEATAAT  421

Query  631   VDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTS  452
             +D  GWL TGD+ + D+DGY+YV DRLKE+IKYKG+Q+ PA+LEA+L+SHP I DAAV  
Sbjct  422   LDSQGWLKTGDLCYIDDDGYVYVVDRLKELIKYKGYQVPPAELEALLLSHPQISDAAVIP  481

Query  451   AQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKI  272
                EEVG+ P+A+VV+K GS +  S   ++DFVAKQVAPYK++R+V F  SIPK+ SGKI
Sbjct  482   FPDEEVGQYPMAYVVRKSGSNI--SDTALMDFVAKQVAPYKRIRKVAFVTSIPKNPSGKI  539

Query  271   LRKELRNLLIT  239
             LR+++  L I+
Sbjct  540   LRRDIIKLAIS  550



>ref|XP_009114499.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Brassica rapa]
Length=542

 Score =   406 bits (1044),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 230/538 (43%), Positives = 338/538 (63%), Gaps = 28/538 (5%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSA----LVDSQSGFSISYPELRSLVNSM  1658
             GIYRS  P + LP DP   +VSF+  RN          ++DS SG S+S+ +L+S V  +
Sbjct  10    GIYRSLRPPLVLPKDPNTSLVSFLF-RNSSSSYPSKPSIIDSDSGVSLSFSDLKSSVARL  68

Query  1657  AAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNV  1478
             A G  R+G+ Q DV LI  PNS  FP+ FL + ++GAV  T NPL T +E+ KQ  D N 
Sbjct  69    ARGFLRLGIRQNDVVLIFAPNSYQFPLCFLAVSAIGAVFTTANPLYTTNEVSKQIKDSNP  128

Query  1477  RLAFATP---DRVQNLGSTLGIPVIGL---PESLNLDSP---FRKLISSDPKLA--PTPR  1331
             +L  +     D+V++      +PV+ L    ESL  +S    F+ ++    +++  P   
Sbjct  129   KLIISVQQLFDKVKDFN----LPVVLLGSSNESLEPNSKILSFKNVMELSDQVSDLPVVE  184

Query  1330  IRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMY  1151
             I+Q DTAA+L+SSGTTG  K V LTH NFIA   +    +    EY     V+L  LPM+
Sbjct  185   IKQTDTAALLYSSGTTGISKGVELTHGNFIAASLMVTMDQDLMGEY---HGVFLCFLPMF  241

Query  1150  HVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADK  971
             HV+GL++     L  G+ +V + ++E++ +++ I++Y VT   V PP+ +AL +++   K
Sbjct  242   HVFGLAVIAYSQLQRGNALVSMARFELELLLKYIEKYRVTQLWVVPPVFLALAKQSVVKK  301

Query  970   CGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTS  791
               L SLK + SGAAP+    ++   +  P++  +QGYGMTE+  + +        RN  S
Sbjct  302   YDLSSLKYIGSGAAPLGKDLMEECGKNIPNVVLMQGYGMTETCGIVSVEDPRLGKRNSGS  361

Query  790   VGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWL  611
              G+LAP +EA++V + SG      PP   GE+W+RGP +MKGY NN +A+K  +D  GW+
Sbjct  362   AGMLAPGIEAQIVSVESGKPQ---PPNQQGEIWVRGPNMMKGYFNNPQATKETIDRKGWV  418

Query  610   HTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVG  431
             HTGD+ +F+EDG L+V DRLKE+IKYKGFQ+APA+LE +L+SHP+I+DA V     EE G
Sbjct  419   HTGDLGYFNEDGNLFVVDRLKELIKYKGFQVAPAELEGLLVSHPEILDAVVIPLPDEEAG  478

Query  430   EIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             E+P+AFVV+   S  S+++ ++  F+AKQVAPYK++RRV F  ++PKSA+GKILR+EL
Sbjct  479   EVPIAFVVRSPSS--SITEEDIQKFIAKQVAPYKRLRRVSFISTVPKSAAGKILRREL  534



>ref|XP_006340129.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Solanum tuberosum]
Length=541

 Score =   406 bits (1043),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 219/532 (41%), Positives = 339/532 (64%), Gaps = 17/532 (3%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFIL--SRNHGGLSALVDSQSGFSISYPELRSLVNSMAA  1652
             GIYRS  P +  P D  L +VSF+   S ++    A  D+ +G ++S+ + +S+V+ ++ 
Sbjct  10    GIYRSLRPPLFYPKDENLSMVSFLFRNSSSYPEKPAFFDADNGETLSFSQFKSMVSRISH  69

Query  1651  GL-HRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVR  1475
             GL H+MG+ + DV LI  PNS+ FP+ F G++++GA+A T+NP+ T+SE+ KQ  DC  +
Sbjct  70    GLIHQMGIKKNDVVLIFAPNSVQFPLSFFGVIAIGAIATTVNPMYTVSELSKQIKDCKPK  129

Query  1474  LAFATPDRVQNLGS-TLGIPVIGLPESLNLDSP----FRKLISSDPKL-APTPRIRQQDT  1313
             L   +P+    +    L I ++G P + N ++     F +L+            I+Q DT
Sbjct  130   LIITSPELFDKVNRFNLPILLLGHPGNSNSNNSGVVRFTELVGKAGYFDLDKTVIKQTDT  189

Query  1312  AAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVYGLS  1133
             AA+L+SSGTTG  K V LTH NFI+   +     + Q       NVYL +LPM+HV+GL+
Sbjct  190   AALLYSSGTTGVSKGVVLTHRNFISAALMVT---SDQELAGEMHNVYLCILPMFHVFGLA  246

Query  1132  LFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCGLKSL  953
             + +   L  G+ +V + K++++ +++ +D+Y V+H  + PP+++AL +     K  L S+
Sbjct  247   VIMYAQLQRGNAIVSMAKFDLETLLKNVDKYRVSHLWIVPPIVLALAKNPVVKKYNLMSI  306

Query  952   KQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGLLAP  773
             KQ+ SGAAP+    +++  + FP    +QGYGMTE+  + +     A  R+  S G LA 
Sbjct  307   KQIGSGAAPLGKDLMEDCAKNFPQAVVMQGYGMTETCGIVSMENVYAGPRHTGSAGTLAS  366

Query  772   NMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTGDIV  593
              +EA++V +        LPP  +GE+W+RGP +MKGY NN +A+K  +D+ GW+HTGD+ 
Sbjct  367   GVEAQIVSVDKSKP---LPPGQLGEIWVRGPNMMKGYFNNPQATKLTIDNQGWVHTGDLG  423

Query  592   HFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIPVAF  413
             +F EDG LYV DR+KE+IKYKGFQ+APA+LE +L+SHP+I+DA V      E GE+PVA+
Sbjct  424   YFTEDGLLYVVDRIKELIKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDAEAGEVPVAY  483

Query  412   VVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             VV+   S  SL++ NV  F+A QVAP+K++++V F  S+PKSA+GKILR+EL
Sbjct  484   VVRSPNS--SLTEENVQKFIADQVAPFKRLKKVTFINSVPKSAAGKILRREL  533



>ref|XP_011089239.1| PREDICTED: LOW QUALITY PROTEIN: 4-coumarate--CoA ligase-like 
7 [Sesamum indicum]
Length=549

 Score =   406 bits (1044),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 221/542 (41%), Positives = 338/542 (62%), Gaps = 29/542 (5%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLS---ALVDSQSGFSISYPELRSLVNSMA  1655
             G+YRS  P + LP DP L +VSF+  RN    +   AL+DS +G  +++ + +S+V+ ++
Sbjct  10    GVYRSLRPPLFLPKDPNLSMVSFLF-RNASSFADKPALIDSHTGKILTFAQFKSMVSRVS  68

Query  1654  AGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVR  1475
              GL ++G+ + D+ LI  PNSI +P+ F G++++GAVA T+NP+ T+SE+ KQ  D   +
Sbjct  69    HGLLQLGIKKNDIVLIYAPNSIQYPLCFFGIVAIGAVATTVNPIYTVSELSKQVQDSKAK  128

Query  1474  LAFATPDRVQNLGSTLGIPVIGLPESLNLDSP---------FRKLISSDPKLAPTPR---  1331
             L     D +  +    G+PVI L    N   P         F +L++S+  ++       
Sbjct  129   LIITVEDLLPKV-KDFGLPVILLGTEKNSVLPIGRIPSITLFSELVNSEGSVSLDSNRNG  187

Query  1330  IRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMY  1151
             I+Q DTA +L+SSGTTG  K V L+H NFIA   L V   A Q       N++L VLPM+
Sbjct  188   IKQNDTAVLLYSSGTTGTSKGVILSHRNFIA-ASLMV--TADQELAGEMNNIFLCVLPMF  244

Query  1150  HVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADK  971
             HV+GL++ +   L  G+ +V + K++++ +++ +++Y +TH  V PP+++ L + +   K
Sbjct  245   HVFGLAVIMFSQLQRGNAIVSMSKFDLEMILKTVEKYRITHMWVVPPIILGLAKSSMVKK  304

Query  970   CGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAV----GTRGFNTAKLR  803
               L SLKQ+ SGAAP+    +Q   + FP    +QGYGMTE+  +               
Sbjct  305   YNLSSLKQIGSGAAPLGRELMQECAKNFPQAVVVQGYGMTETCGIVSIENPYASAXXXXX  364

Query  802   NYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDD  623
             +  S G LAP +E ++V +        LPP  +GE+W+RGP +M+GY NN +A+K  +D 
Sbjct  365   HSGSAGTLAPGVEGQIVSVDKLKP---LPPGQLGEIWVRGPNMMQGYFNNPQATKLTIDK  421

Query  622   DGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQS  443
              GW+HTGD+ +FD++G LYV DR+KE+IKYKGFQ+APA+LE +L+SHP+I+DA V     
Sbjct  422   QGWVHTGDLGYFDDEGQLYVVDRIKELIKYKGFQVAPAELEGLLVSHPEILDAVVIPFPD  481

Query  442   EEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRK  263
              E GE+P+A+VV+   S  SL++ +V  F+A QVAP+K++RRV F  S+PKSASGKILR+
Sbjct  482   AEAGEVPIAYVVRAPNS--SLTEEDVKKFIADQVAPFKRLRRVTFINSVPKSASGKILRR  539

Query  262   EL  257
             EL
Sbjct  540   EL  541



>emb|CDY01369.1| BnaA07g11420D [Brassica napus]
Length=543

 Score =   406 bits (1043),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 237/558 (42%), Positives = 343/558 (61%), Gaps = 39/558 (7%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F  S +  Y  ++P + LP++P LDV +FI S+ H G +A +D+ +G  +S+ EL +
Sbjct  8     RSGFCKSNSTFYSKRNP-LPLPANPSLDVTTFISSQPHRGTTAFIDAATGHRLSFSELWT  66

Query  1672  LVNSMAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQ  1496
              V  +A  LH  +G+ +G V LIL PNSIY PV+ L ++S+GAV  T N L+T +EI +Q
Sbjct  67    AVERVADCLHHDIGLKRGHVVLILSPNSIYIPVVSLAVMSLGAVVTTANTLNTAAEISRQ  126

Query  1495  SFDCNVRLAFATPDR------------VQNLGSTLGIPVIG-LPESLNLDSPFRKLISSD  1355
               D N  LAF T D             ++ +GST G+ V+G + E +  +   +++    
Sbjct  127   LADSNPTLAFTTADLAPKLAGSGISVVLERVGSTRGVDVVGAVSEMMKKERRGQRV----  182

Query  1354  PKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANV  1175
                    R+ ++DTA +L+SSGTTG  K V  +H N  A V  FV       E      V
Sbjct  183   -----RDRVNEEDTAMMLYSSGTTGPSKGVITSHRNLTASVARFVS------EKRIGGEV  231

Query  1174  YLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVAL  995
             +L  +PM+H YGL  F M  +++GSTVV++R++++  ++ A+++Y  T   + PP++VA+
Sbjct  232   FLCTVPMFHTYGLLCFTMFTVAVGSTVVILRRFDLHGMMAAVEKYSATILALTPPVVVAM  291

Query  994   TRKAKA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGF  821
             T +A     K  L SL+ V  G AP+S    + F+  +P +D + GY +TES   G    
Sbjct  292   TNEADVIRAKYDLSSLRTVRCGGAPLSKEVTEGFMEKYPTVDILAGYALTESNGAGASID  351

Query  820   NTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEAS  641
                + R Y SVGLLAP +EAR+VD      G  +     GELWLRGP+I KGY  N EA+
Sbjct  352   TVEESRRYGSVGLLAPGVEARIVD---PDTGRVMGVNQTGELWLRGPSISKGYFKNEEAT  408

Query  640   KNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAA  461
                ++ +GWL TGDI + DEDG+L+V DRLKE+IKYKG+Q+ PA+LEA+L++HPDI+DAA
Sbjct  409   NETINLEGWLKTGDICYIDEDGFLFVVDRLKELIKYKGYQVPPAELEALLVTHPDILDAA  468

Query  460   VTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAK-QVAPYKKVRRVYFTKSIPKSA  284
             V     +E G+ P+A+V +K   E +LS+  +IDFV+K QVAPYKK+R+V F  SIPK+ 
Sbjct  469   VIPFPDKEAGQYPMAYVTRK--IESNLSEKQIIDFVSKQQVAPYKKIRKVAFINSIPKNP  526

Query  283   SGKILRKELRNLLITSKI  230
             SGK LRK+L   L TSKI
Sbjct  527   SGKTLRKDLIK-LATSKI  543



>ref|XP_009361476.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Pyrus x bretschneideri]
Length=569

 Score =   407 bits (1045),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 235/548 (43%), Positives = 350/548 (64%), Gaps = 27/548 (5%)
 Frame = -2

Query  1840  YSSETGIYRSKHPSVH---LPSDPFLDVVSFILSR---NHGGLS--ALVDSQSGFSISYP  1685
             +  +TGIY S     H   +P+   LD  +F+LS+    H   +  AL+DS +   ++Y 
Sbjct  22    FDPKTGIYHSVLNLGHRYKVPTRHNLDTATFVLSQFPPRHQAETRVALIDSATNGRVTYE  81

Query  1684  ELRSLVNSMAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSE  1508
             +LR  V+++A+GL++ +GV +GDV  +L PNS+ +P I + +LS+GA+  T NP++T SE
Sbjct  82    QLRHSVHALASGLYQGLGVRKGDVVFLLSPNSLLYPTICMAVLSIGAILTTANPVNTQSE  141

Query  1507  IKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPF--RKLIS-SDPKLAPT  1337
             I KQ  D   +LA ++P+ +  L  T G+P I     L+ D+     +LI   DP   PT
Sbjct  142   IGKQVRDSGAKLAISSPEELHKLVPT-GVPTILTSRPLSDDTSLTIEELIEGCDP--IPT  198

Query  1336  ----PRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYL  1169
                  R  Q DTAA+L+SSGTTG  K V LTHANFIA++ + +R+   +    A  +V+L
Sbjct  199   DLMQARPTQSDTAAILYSSGTTGISKGVVLTHANFIAIIAM-LRWTVDKTS--AQDDVFL  255

Query  1168  DVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTR  989
               +PM+H+YGL+ F +GL   G+T V+++K+E+++++ AI  + V++ P  PP+++ L +
Sbjct  256   CFIPMFHIYGLAFFGLGLFCGGTTTVLMQKFELNKMLDAIKTHKVSNIPAVPPVILGLVK  315

Query  988   KAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAK  809
              A    C L SL++V SGAAP+S   I  F + FP ++   GYG+TES    T   +  +
Sbjct  316   HASKTACDLSSLRRVGSGAAPLSKELIDEFRKRFPWVEMRPGYGLTESCGAATFFISDKQ  375

Query  808   LRNYT-SVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNA  632
              + ++ S G L P   A++VD+ +G     LPP   GELWL+ P IMK YL N EA+   
Sbjct  376   AKAHSASCGELLPGFLAKIVDVETGEA---LPPYKEGELWLKSPTIMKEYLGNVEATLAT  432

Query  631   VDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTS  452
             +D DGWL TGD+ +FDE+G LY+ DR+KE+IK+ G+Q+APA+LEA+L+SHP I+DAAV  
Sbjct  433   IDSDGWLKTGDLCYFDEEGLLYIVDRIKELIKHNGYQVAPAELEAILLSHPQILDAAVIP  492

Query  451   AQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKI  272
              + EE G+IP+A+VV+    +  L++  VI FVA QVAPYKKVRRV+F  +IP+S + KI
Sbjct  493   VEDEEAGQIPMAYVVRAATPD-GLTEDQVIQFVAGQVAPYKKVRRVHFISAIPRSPASKI  551

Query  271   LRKELRNL  248
             LRKEL  L
Sbjct  552   LRKELVTL  559



>ref|XP_009350226.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Pyrus x bretschneideri]
 ref|XP_009350228.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Pyrus x bretschneideri]
Length=569

 Score =   407 bits (1045),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 235/548 (43%), Positives = 350/548 (64%), Gaps = 27/548 (5%)
 Frame = -2

Query  1840  YSSETGIYRSKHPSVH---LPSDPFLDVVSFILSR---NHGGLS--ALVDSQSGFSISYP  1685
             +  +TGIY S     H   +P+   LD  +F+LS+    H   +  AL+DS +   ++Y 
Sbjct  22    FDPKTGIYHSVLNLGHRYKVPTRHNLDTATFVLSQFPPRHQAETRVALIDSATNGRVTYE  81

Query  1684  ELRSLVNSMAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSE  1508
             +LR  V+++A+GL++ +GV +GDV  +L PNS+ +P I + +LS+GA+  T NP++T SE
Sbjct  82    QLRHSVHALASGLYQGLGVRKGDVVFLLSPNSLLYPTICMAVLSIGAILTTANPVNTQSE  141

Query  1507  IKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPF--RKLIS-SDPKLAPT  1337
             I KQ  D   +LA ++P+ +  L  T G+P I     L+ D+     +LI   DP   PT
Sbjct  142   IGKQVRDSGAKLAISSPEELHKLVPT-GVPTILTSRPLSDDTSLTIEELIEGCDP--IPT  198

Query  1336  ----PRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYL  1169
                  R  Q DTAA+L+SSGTTG  K V LTHANFIA++ + +R+   +    A  +V+L
Sbjct  199   DLMQARPTQSDTAAILYSSGTTGISKGVVLTHANFIAIIAM-LRWTVDKTS--AQDDVFL  255

Query  1168  DVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTR  989
               +PM+H+YGL+ F +GL   G+T V+++K+E+++++ AI  + V++ P  PP+++ L +
Sbjct  256   CFIPMFHIYGLAFFGLGLFCGGTTTVLMQKFELNKMLDAIKTHKVSNIPAVPPVILGLVK  315

Query  988   KAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAK  809
              A    C L SL++V SGAAP+S   I  F + FP ++   GYG+TES    T   +  +
Sbjct  316   HASKTACDLSSLRRVGSGAAPLSKELIDEFRKRFPWVEMRPGYGLTESCGAATFFISDKQ  375

Query  808   LRNYT-SVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNA  632
              + ++ S G L P   A++VD+ +G     LPP   GELWL+ P IMK YL N EA+   
Sbjct  376   AKAHSASCGELLPGFLAKIVDVETGEA---LPPYKEGELWLKSPTIMKEYLGNVEATLAT  432

Query  631   VDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTS  452
             +D DGWL TGD+ +FDE+G LY+ DR+KE+IK+ G+Q+APA+LEA+L+SHP I+DAAV  
Sbjct  433   IDSDGWLKTGDLCYFDEEGLLYIVDRIKELIKHNGYQVAPAELEAILLSHPQILDAAVIP  492

Query  451   AQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKI  272
              + EE G+IP+A+VV+    +  L++  VI FVA QVAPYKKVRRV+F  +IP+S + KI
Sbjct  493   VEDEEAGQIPMAYVVRAATPD-GLTEDQVIQFVAGQVAPYKKVRRVHFISAIPRSPASKI  551

Query  271   LRKELRNL  248
             LRKEL  L
Sbjct  552   LRKELVTL  559



>ref|NP_173472.1| AMP-dependent synthetase and ligase family protein [Arabidopsis 
thaliana]
 sp|Q84P25.2|4CLL2_ARATH RecName: Full=4-coumarate--CoA ligase-like 2 [Arabidopsis thaliana]
 gb|AEE29977.1| AMP-dependent synthetase and ligase family protein [Arabidopsis 
thaliana]
Length=565

 Score =   407 bits (1045),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 232/569 (41%), Positives = 347/569 (61%), Gaps = 31/569 (5%)
 Frame = -2

Query  1888  SKIRNSAAEKGRRSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQ  1709
             S+I +      R+S F  S T I+ SK   + LP + FLDV SFI S+ H G +  VD+ 
Sbjct  12    SEIESRTLAVDRKSGFCES-TSIFYSKREPMALPPNQFLDVTSFIASQPHRGKTVFVDAV  70

Query  1708  SGFSISYPELRSLVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMN  1529
             +G  +S+PEL   V  +A  L+ +GV +G+V +IL PNSI FP++ L ++S+GA+  T N
Sbjct  71    TGRRLSFPELWLGVERVAGCLYALGVRKGNVVIILSPNSILFPIVSLSVMSLGAIITTAN  130

Query  1528  PLSTLSEIKKQSFDCNVRLAFATPDRVQNLG--STLGIPVIGLPE----------SLNLD  1385
             P++T  EI KQ  D    LAF T   V  L   S   +PV+ + +           + L 
Sbjct  131   PINTSDEISKQIGDSRPVLAFTTCKLVSKLAAASNFNLPVVLMDDYHVPSQSYGDRVKLV  190

Query  1384  SPFRKLISSDPKLAPTP-RIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELF-VRFE  1211
                  +I ++P  +    R+ Q DTAA+L+SSGTTG  K V L+H N IA+V+ +  RF 
Sbjct  191   GRLETMIETEPSESRVKQRVNQDDTAALLYSSGTTGTSKGVMLSHRNLIALVQAYRARFG  250

Query  1210  ASQYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVT  1031
               Q          +  +PM H++G   F  GL++LG T+VV+ K+++ +++ A++ +  +
Sbjct  251   LEQRT--------ICTIPMCHIFGFGGFATGLIALGWTIVVLPKFDMAKLLSAVETHRSS  302

Query  1030  HFPVAPPLLVALTRKAKA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYG  857
             +  + PP++VA+   A     K  L SL  V +G AP+S    + FV  +P +  +QGYG
Sbjct  303   YLSLVPPIVVAMVNGANEINSKYDLSSLHTVVAGGAPLSREVTEKFVENYPKVKILQGYG  362

Query  856   MTESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPA  677
             +TESTA+    FN  + + Y + GLLAPN+E ++VD      G  L     GELW+R P 
Sbjct  363   LTESTAIAASMFNKEETKRYGASGLLAPNVEGKIVD---PDTGRVLGVNQTGELWIRSPT  419

Query  676   IMKGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEA  497
             +MKGY  N EA+ + +D +GWL TGD+ + D DG+++V DRLKE+IK  G+Q+APA+LEA
Sbjct  420   VMKGYFKNKEATASTIDSEGWLKTGDLCYIDGDGFVFVVDRLKELIKCNGYQVAPAELEA  479

Query  496   VLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRR  317
             +L++HP+I DAAV      + G+ P+A++V+K GS  +LS++ ++ FVAKQV+PYKK+R+
Sbjct  480   LLLAHPEIADAAVIPIPDMKAGQYPMAYIVRKVGS--NLSESEIMGFVAKQVSPYKKIRK  537

Query  316   VYFTKSIPKSASGKILRKELRNLLITSKI  230
             V F  SIPK+ SGKILR+EL   L TSK+
Sbjct  538   VTFLASIPKNPSGKILRRELTK-LTTSKL  565



>gb|KDP43987.1| hypothetical protein JCGZ_05454 [Jatropha curcas]
Length=542

 Score =   405 bits (1042),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 221/535 (41%), Positives = 338/535 (63%), Gaps = 22/535 (4%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFIL--SRNHGGLSALVDSQSGFSISYPELRSLVNSMAA  1652
             GIYRS  P++  P DP L +VSF+   S ++    AL+D+    ++S+ +L+S+V  ++ 
Sbjct  10    GIYRSLRPTIVFPKDPNLSMVSFLFRNSSSYPHKPALIDADLSLTLSFSQLKSIVIKVSH  69

Query  1651  GLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRL  1472
             GL R+G+S+ DV LI  PNS ++P+ FL + S+GA+A T NP+ T +E+ KQ  D N +L
Sbjct  70    GLLRLGISKNDVVLIFAPNSYHYPICFLAITSIGAIATTANPVYTTTEVSKQIKDSNPKL  129

Query  1471  AFATPDRVQNLGSTLGIPVI--GLPESLNLDSPFR--------KLISSDPKLAPTPRIRQ  1322
                 P+ + N      +P +  G  ESL +D   R        +L  S+ +  P   ++Q
Sbjct  130   IITVPE-LWNKVKDFNLPTVFLGAKESLTMDPNSRIKSFHDLVELGGSNSEF-PASNVKQ  187

Query  1321  QDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVY  1142
              D AA+L+SSGTTG  K V LTH NFIA   L V  +  Q       +V+L  LPM+HV+
Sbjct  188   TDVAALLYSSGTTGISKGVILTHGNFIA-ASLMVTID--QEIAGEMHHVFLCCLPMFHVF  244

Query  1141  GLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCGL  962
             GL++     +  G+ VV + K++ + +++ +++Y VTH  V PP+++AL + +   K  L
Sbjct  245   GLAVITYSQMQKGNAVVSMGKFDFEMLLKTVEKYRVTHMWVVPPIILALAKHSLVKKYDL  304

Query  961   KSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGL  782
              SL+ V SGAAP+    ++   ++ P+    QGYGMTE+T + +       +R+  S G 
Sbjct  305   SSLQHVGSGAAPLGKELMEECAKSIPNAVVAQGYGMTETTGIISVENPRIGVRHTGSAGT  364

Query  781   LAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTG  602
             L P +EA++V + +      LPP   GE+W+RGP +M+GY NN +A+K+ +D  GW+HTG
Sbjct  365   LVPGVEAQIVSVDTLKP---LPPKQTGEIWVRGPNMMRGYFNNPQATKDTIDRKGWVHTG  421

Query  601   DIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIP  422
             D+ +FDEDG LYV DR+KE+IKYKGFQ+APA+LE +L+SHP+I+DA V      E GE+P
Sbjct  422   DLGYFDEDGRLYVVDRIKELIKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDAEAGEVP  481

Query  421   VAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             +A+VV+   S  SL++ +V  F+A QVAP+K+++RV F  ++PKSA+GKILR+EL
Sbjct  482   IAYVVRSPNS--SLTEEDVQKFIADQVAPFKRLKRVSFINTVPKSAAGKILRREL  534



>ref|XP_010041733.1| PREDICTED: 4-coumarate--CoA ligase 1-like, partial [Eucalyptus 
grandis]
Length=518

 Score =   405 bits (1040),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 232/519 (45%), Positives = 322/519 (62%), Gaps = 27/519 (5%)
 Frame = -2

Query  1774  LDVVSFILSRNHGGLS----ALVDSQSGFSISYPELRSLVNSMAAGL-HRMGVSQGDVAL  1610
             LDV S +LS+    L+    AL+D+ +   ISY  L   + S+A GL H +GV +GDV  
Sbjct  2     LDVASCVLSQFPHALAESRIALIDAATNCQISYAHLYRSIRSLAYGLYHAVGVRKGDVVF  61

Query  1609  ILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGST  1430
             ++ PNS+ +P I L +LSVGA+    NPL+T  EI KQ  D   +LA   P+ +  L   
Sbjct  62    LVAPNSLLYPTICLAILSVGAILTPANPLNTTLEIAKQVADSGAKLAICAPEELHKL---  118

Query  1429  LGIPVIGLPESLNLDSPFRKLIS-------SDPKLAPTPRIRQQDTAAVLFSSGTTGGCK  1271
               IP   LP  L   +    L+S       S+P   P  R  Q DTAAVL+SSGTTG  K
Sbjct  119   --IPT-KLPTMLTTKTSDGTLLSAEELIECSNPIDLPLERPTQTDTAAVLYSSGTTGTSK  175

Query  1270  AVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvv  1091
              V LTHAN I+++ L    + S     +  +V+L  +PM+H+YGL+ FV+GL   G T V
Sbjct  176   GVVLTHANLISVISLL---KWSVSASSSQDDVFLCFIPMFHIYGLAFFVLGLFCSGITTV  232

Query  1090  vvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCGLKSLKQVSSGAAPISITC  911
             V+++++   ++  I  + V + P  PP+++AL + A   KC L SL++V SGAAP++   
Sbjct  233   VMQRFDFQAMLDVIKVHRVNYIPAVPPVILALVKHASNMKCDLSSLRRVGSGAAPLNKEV  292

Query  910   IQNFVRTFPHIDFIQGYGMTEST-AVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssgg  734
                F   FP I+  Q YG+TE+  A      +     +  S G L P+  A++VD+ +G 
Sbjct  293   TDGFREKFPWIELRQAYGLTETCGAASVFALDEDAKAHPGSCGSLLPHFSAKIVDIETGS  352

Query  733   ggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDR  554
                 LPP   GELWLR P IMKGYL N EA+   +D +GWL TGD+ +FDEDG+LY+ DR
Sbjct  353   P---LPPNKEGELWLRSPTIMKGYLQNEEATTAMLDPEGWLRTGDLGYFDEDGFLYIVDR  409

Query  553   LKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQ  374
             +KE+IK+ G+Q+APA+LEA+L+SHP IVDAAV   ++EE G++P+A+VVK  GSE  L++
Sbjct  410   IKELIKHNGYQVAPAELEALLLSHPQIVDAAVIPLENEEAGQVPMAYVVKASGSE--LTE  467

Query  373   ANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
               VI F+A QVAPYKKVRRV F  +IPKSA+GKILRK+L
Sbjct  468   NQVIRFIADQVAPYKKVRRVGFISTIPKSAAGKILRKQL  506



>ref|XP_008347063.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Malus domestica]
Length=569

 Score =   406 bits (1044),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 235/546 (43%), Positives = 347/546 (64%), Gaps = 23/546 (4%)
 Frame = -2

Query  1840  YSSETGIYRSKHPSVH---LPSDPFLDVVSFILSR---NHGGLS--ALVDSQSGFSISYP  1685
             +  +TGIY S     H   +P+   LD  +F+LS+    H   +  AL+DS +   ++Y 
Sbjct  22    FDPKTGIYHSLLNLGHRYKVPTRHNLDTATFVLSQFPPRHQAETRVALIDSATNERVTYE  81

Query  1684  ELRSLVNSMAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSE  1508
             +LR  V+++A+GL++ +GV +GDV  +L PNS+ +P I L +LS+GA+  T NP++T SE
Sbjct  82    QLRHSVHALASGLYQGLGVRKGDVVFLLSPNSLLYPTICLAVLSIGAILTTANPVNTESE  141

Query  1507  IKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPF--RKLIS-SDPKLAPT  1337
             I KQ  D   +LA ++P+ +  L  T G+P I     L+ DS     +LI   DP    +
Sbjct  142   IGKQVRDSGAKLAISSPEELHKLVPT-GVPTILTSRPLSDDSSLTIEELIEGCDPIPTES  200

Query  1336  PRIR--QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDV  1163
              + R  Q DTAA+L+SSGTTG  K V LTHANFIA++ + +R+   +    A  +V+L  
Sbjct  201   MQARPTQSDTAAILYSSGTTGVSKGVVLTHANFIAIIAM-LRWTVDKTS--AQDDVFLCF  257

Query  1162  LPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKA  983
             +PM+H+YGL+ F +GL   G+T V+++K+E++ ++ AI  + V++ P  PP+++ L + A
Sbjct  258   IPMFHIYGLAFFGLGLFCGGTTTVLMQKFELNNMLDAIKTHKVSNIPAVPPVILGLVKHA  317

Query  982   KADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLR  803
                 C L SL++V SGAAP+S   I  F   FP ++   GYG+TES    T   +  + +
Sbjct  318   SKTACDLSSLRRVGSGAAPLSKELIDEFRNRFPWVEMRPGYGLTESCGAATFFISDKQAK  377

Query  802   NYT-SVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVD  626
              ++ S G L P   A++VD+ +G     LPP   GELWL+ P IMK YL N EA+   +D
Sbjct  378   AHSASCGELLPGFLAKIVDIETGEA---LPPYKEGELWLKSPTIMKEYLGNVEATLATID  434

Query  625   DDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQ  446
              DGWL TGD+ +FDE+G LY+ DR+KE+IK+ G+Q+APA+LEA+L+SHP I+DAAV   +
Sbjct  435   SDGWLKTGDLCYFDEEGLLYIADRIKELIKHNGYQVAPAELEAILLSHPQILDAAVIPVE  494

Query  445   SEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILR  266
              EE G+IP+A+VV+    +  L++  VI FVA QVAPYKKVRRV F  +IP+S + KILR
Sbjct  495   DEEAGQIPMAYVVRAATPD-GLTEDQVIQFVAGQVAPYKKVRRVDFISAIPRSPASKILR  553

Query  265   KELRNL  248
             KEL  L
Sbjct  554   KELVTL  559



>gb|AAP03016.1| 4-coumarate-CoA ligase-like protein [Arabidopsis thaliana]
Length=565

 Score =   406 bits (1043),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 231/558 (41%), Positives = 342/558 (61%), Gaps = 31/558 (6%)
 Frame = -2

Query  1855  RRSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELR  1676
             R+S F  S T I+ SK   + LP + FLDV SFI S+ H G +  VD+ +G  +S+PEL 
Sbjct  23    RKSGFCES-TSIFYSKREPMALPPNQFLDVTSFIASQPHRGKTVFVDAVTGRQLSFPELW  81

Query  1675  SLVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQ  1496
               V  +A  L+ +GV +G+V +IL PNSI FP++ L ++S+GA+  T NP++T  EI KQ
Sbjct  82    LGVERVAGCLYALGVRKGNVVIILSPNSILFPIVSLSVMSLGAIITTANPINTSDEISKQ  141

Query  1495  SFDCNVRLAFATPDRVQNLG--STLGIPVIGLPE----------SLNLDSPFRKLISSDP  1352
               D    LAF T   V  L   S   +PV+ + +           + L      +I ++P
Sbjct  142   IGDSRPVLAFTTCKLVSKLAAASNFNLPVVLMDDYHVPSQTYGDRVKLVGRLETMIETEP  201

Query  1351  KLAPTP-RIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELF-VRFEASQYEYPATAN  1178
               +    R+ Q DTAA+L+SSGTTG  K V L+H N IA+V+ +  RF   Q        
Sbjct  202   SESRVKQRVNQDDTAALLYSSGTTGTSKGVMLSHRNLIALVQAYRARFGLEQRT------  255

Query  1177  VYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVA  998
               +  +PM H++G   F  GL++LG T+VV+ K+++ +++ A++ +  ++  + PP++VA
Sbjct  256   --ICTIPMCHIFGFGGFATGLIALGWTIVVLPKFDMAKLLSAVETHRSSYLSLVPPIVVA  313

Query  997   LTRKAKA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRG  824
             +   A     K  L SL  V +G AP+S    + FV  +P    +QGYG+TESTA+    
Sbjct  314   MVNGANEINSKYDLSSLHTVVAGGAPLSREVTEKFVENYPKFKILQGYGLTESTAIAASM  373

Query  823   FNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEA  644
             FN  + + Y + GLLAPN+E ++VD      G  L     GELW+R P +MKGY  N EA
Sbjct  374   FNKEETKRYGASGLLAPNVEGKIVD---PDTGRVLGVNQTGELWIRSPTVMKGYFKNKEA  430

Query  643   SKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDA  464
             + + +D +GWL TGD+ + D DG+++V DRLKE+IK  G+Q+APA+LEA+L++HP+I DA
Sbjct  431   TASTIDSEGWLKTGDLCYIDGDGFVFVVDRLKELIKCNGYQVAPAELEALLLAHPEIADA  490

Query  463   AVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSA  284
             AV      + G+ PVA++V+K GS  +LS++ ++ FVAKQV+PYKK+R+V F  SIPK+ 
Sbjct  491   AVIPIPDMKAGQYPVAYIVRKVGS--NLSESEIMGFVAKQVSPYKKIRKVTFLASIPKNP  548

Query  283   SGKILRKELRNLLITSKI  230
             SGKILR+EL   L TSK+
Sbjct  549   SGKILRRELTK-LTTSKL  565



>ref|XP_002982252.1| hypothetical protein SELMODRAFT_179406 [Selaginella moellendorffii]
 gb|EFJ16497.1| hypothetical protein SELMODRAFT_179406 [Selaginella moellendorffii]
Length=553

 Score =   405 bits (1042),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 242/559 (43%), Positives = 333/559 (60%), Gaps = 42/559 (8%)
 Frame = -2

Query  1858  GRRSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLS-----ALVDSQSGFSI  1694
             G R C      GIY S    V +P  P LD VS++ S+  G        A+VD +SG S+
Sbjct  9     GYREC-----DGIYASLASPVAMPLHPHLDFVSYMFSQRFGRPESASNVAIVDGKSGQSL  63

Query  1693  SYPELRSLVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTL  1514
             +  +LR  + ++A GLH  G+ QGDV +ILLPNS+ FPV+F   L +GAV  TMNP +T 
Sbjct  64    TCSQLRRSIEAVATGLHESGIRQGDVVMILLPNSLEFPVMFNAALRIGAVVTTMNPQNTP  123

Query  1513  SEIKKQSFDCNVRLAF---ATPDRVQNLGSTLGIPVIGLPE------SLNLDS------P  1379
             +EI +Q  D   ++     A  D+V+     L I ++   E      +LN D       P
Sbjct  124   AEIARQMLDSRPKMVLTNRAGVDKVRAASPDLPIVLVDEEEREEHGRTLNSDEKKPQFIP  183

Query  1378  FRKLISSDPKLAPTPR--IRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEAS  1205
             F + ++SDP   P  R  IRQ D AA+L+SSGTTG  K V ++H N IA   + V+ +  
Sbjct  184   FSRFLASDPDQRPRNRCLIRQSDPAALLYSSGTTGLSKGVVISHGNLIA--AMAVQNQVP  241

Query  1204  QYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHF  1025
             +       NV L   PMYH+ GL     G +  G T V++++Y + +++RA++R+G    
Sbjct  242   EEMDRGDTNVVL--FPMYHIGGLMWLCCGAIMGGPTFVLLQRYGLADLLRAVERHGANKI  299

Query  1024  PVAPPLLVALTRKAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHID-FIQGYGMTE  848
               APP+ + L   A+  +  L+SL+ +   AAP+S   IQ  +  FPH++ FIQ YGMTE
Sbjct  300   TSAPPVALDLLHSAETARYDLRSLRALICAAAPLSKETIQGLMIKFPHLEMFIQMYGMTE  359

Query  847   STAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMK  668
             +  VG+ G          S G L   +EA VVDL +      LPP   GELWLRGP IM+
Sbjct  360   TVTVGSGGRGV-----MGSSGRLNATLEAMVVDLETRKS---LPPNQRGELWLRGPPIMQ  411

Query  667   GYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLM  488
             GYLNN  A+  A+D +GWLHTGD+V+FD  GYLY+ DRLKE+IKYKG+Q+APA+LEA+L+
Sbjct  412   GYLNNPVATAEAIDSEGWLHTGDLVYFDSKGYLYIVDRLKELIKYKGYQVAPAELEALLL  471

Query  487   SHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYF  308
             +HP IVD AV     E  GEIP AF+V+ + +  S+S   V+ +VA QVAPYK++RRV F
Sbjct  472   THPAIVDCAVVPFPDEVAGEIPQAFIVRARDN--SISSEEVMRYVADQVAPYKRIRRVSF  529

Query  307   TKSIPKSASGKILRKELRN  251
                IPKSA+GKILR EL+ 
Sbjct  530   LDKIPKSAAGKILRNELKK  548



>ref|XP_010045319.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Eucalyptus grandis]
Length=544

 Score =   405 bits (1040),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 229/536 (43%), Positives = 335/536 (63%), Gaps = 22/536 (4%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFIL--SRNHGGLSALVDSQSGFSISYPELRSLVNSMAA  1652
             GIYRS  PS+ LP DP L +VSF+   S ++    ALV++ +  ++++ +  S V  +A 
Sbjct  10    GIYRSLRPSLALPRDPDLSMVSFLFRNSASYADKPALVEADTDETLTFAQFESRVIKLAH  69

Query  1651  GLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRL  1472
             GL  +G+ +GDV LI  PNSI FP+ F G+ S+GA+A T NPL T  E+ KQ  D N +L
Sbjct  70    GLLSLGLRKGDVVLIFAPNSIQFPLCFFGVTSIGAIATTANPLYTSFELSKQVKDSNPKL  129

Query  1471  AFATPDRVQNLGSTLGIPVI------GLPESLNLDS---PFRKLISSDPKLAPTPRI--R  1325
                 P   + +   L +P +       LP  ++  S    F  L+S     +  P++  +
Sbjct  130   IVTVPGLWEKV-KDLDLPAVILGGSKSLPPQISSRSRILSFHDLVSLGDGASRFPKVGVK  188

Query  1324  QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHV  1145
             Q D AA+L+SSGTTG  K V LTH NFIA   L V  +  Q        V+L VLPM+HV
Sbjct  189   QGDVAALLYSSGTTGTSKGVILTHGNFIA-ASLMVTMD--QEMAGDMHRVFLCVLPMFHV  245

Query  1144  YGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCG  965
             +GL++     L  G+ +V + ++E D ++RA+++Y +TH  V PP+++AL +++   K  
Sbjct  246   FGLAVIAYSQLQKGNALVSMGRFEFDSLLRAVEKYRITHLWVVPPIVLALAKQSAVRKYD  305

Query  964   LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVG  785
             L SLK + SGAAP+    +++  + FP  D +QGYGMTE+  + +        R+  S G
Sbjct  306   LSSLKHIGSGAAPLGKDVMEDCAKNFPQADVMQGYGMTETCGIVSVENANFGPRHTGSAG  365

Query  784   LLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHT  605
              L   +EA+V+ + +      LPP  +GE+W+RGP +MKGY NN +A+K  +D+ GW+HT
Sbjct  366   QLVAGVEAQVISVDTLKS---LPPNQLGEIWVRGPNMMKGYYNNPQATKLTIDNKGWVHT  422

Query  604   GDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEI  425
             GD+ +FDE+G LYV DR+KE+IKYKGFQIAPA+LE +L+SHP+I+DA V      E GE+
Sbjct  423   GDLGYFDEEGQLYVVDRIKELIKYKGFQIAPAELEGLLLSHPEILDAVVIPFPDAEAGEV  482

Query  424   PVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             P+A+VV+   S  SL++  V  F+A QVAP+K++RRV F  S+PKSASGKILR+EL
Sbjct  483   PIAYVVRSPTS--SLTEEEVQKFIANQVAPFKRLRRVTFVNSVPKSASGKILRREL  536



>gb|AIR95612.1| 4-coumarate:CoA ligase-like protein [Betula pendula]
Length=545

 Score =   404 bits (1039),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 226/538 (42%), Positives = 338/538 (63%), Gaps = 25/538 (5%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFIL--SRNHGGLSALVDSQSGFSISYPELRSLVNSMAA  1652
             GIYRS  P + LP DP L +V+F+   S ++    AL+D+ S  ++S+ + +S V +++ 
Sbjct  10    GIYRSVRPPLVLPKDPNLSMVTFLFRNSSSYPHKPALIDADSSQTLSFSQFKSTVATISR  69

Query  1651  GLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRL  1472
             G   +G+++ DV LI  PNSI FP+ FLG++++GA+A T NPL T+ E+ +Q  D N +L
Sbjct  70    GFLGLGITKNDVVLIFAPNSIQFPLCFLGIVAIGAIATTANPLYTVHELARQVKDSNPKL  129

Query  1471  AFATP---DRVQNLG----------STLGIPVIGLPESLNLDSPFRKLISSDPKLAPTPR  1331
                 P   D+V+N            S+    VI   + +NL   +    S      P   
Sbjct  130   IITVPELWDKVKNFNLPAVFLGSNHSSSSSNVIHFDDLVNLGGTWSG--SRSGSDFPDSN  187

Query  1330  IRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMY  1151
             ++Q DTAA+L+SSGTTG  K V LTH NFIA   L V  +  Q       NV+L VLPM+
Sbjct  188   VKQNDTAALLYSSGTTGMSKGVILTHGNFIA-ASLMVSMD--QELSGEAHNVFLCVLPMF  244

Query  1150  HVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADK  971
             HV+GL++ +   L +G+ VV + ++E+++++RA++RY V+H  V PP+++AL ++    K
Sbjct  245   HVFGLAVILYSQLQIGNAVVSMGRFELEKILRAVERYRVSHLWVVPPIILALAKQDVVKK  304

Query  970   CGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTS  791
               L SLK V SGAAP+    ++   R  P     QGYGMTE+  V +       +R+  S
Sbjct  305   YDLSSLKHVGSGAAPLGKDLMEECARNIPQAVVAQGYGMTETCGVVSVENPRVGVRHTGS  364

Query  790   VGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWL  611
              GLL   +E+++V + +      LPP  +GE+W+RGP +M+GY NN +A+K  +D  GW+
Sbjct  365   AGLLVSGVESQIVSVDTLKP---LPPNQLGEIWVRGPNMMQGYYNNPQATKLTIDKQGWV  421

Query  610   HTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVG  431
             HTGD+ +FD DG+LYV DR+KE+IKYKGFQ+APA+LE +L+SHP+I+DA V      E G
Sbjct  422   HTGDLGYFDGDGHLYVVDRIKELIKYKGFQVAPAELEGLLISHPEILDAVVIPFPDAEAG  481

Query  430   EIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             E+P+A+VV+   S  SL++ + + F+A QVAP+K++RRV F   +PKSASGKILR+EL
Sbjct  482   EVPIAYVVRSPNS--SLTEVDAMKFIANQVAPFKRLRRVTFINKVPKSASGKILRREL  537



>ref|XP_011021220.1| PREDICTED: 4-coumarate--CoA ligase-like 7 isoform X1 [Populus 
euphratica]
Length=543

 Score =   404 bits (1039),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 231/537 (43%), Positives = 339/537 (63%), Gaps = 25/537 (5%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFIL--SRNHGGLSALVDSQSGFSISYPELRSLVNSMAA  1652
             GIYRS  P++ LP D  L +VSF+   S ++   SAL+D+    ++S+ EL+S+V   A 
Sbjct  10    GIYRSLRPTLVLPKDSNLSLVSFLFRNSNSYPHKSALIDADLSITLSFSELKSIVIKFAH  69

Query  1651  GLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRL  1472
             GL  +G+S+ D  LI  PNS  FP+ FL + S+GAVA T+NPL T SE+ KQ  D N +L
Sbjct  70    GLLNLGISKNDAVLIFAPNSYQFPICFLAITSIGAVATTVNPLYTTSELSKQIKDSNPKL  129

Query  1471  AFATP---DRVQ--NLGST-LGIPVIGLPESLNLDSPFR------KLISSDPKLAPTPRI  1328
                 P   D+V+  NL +  LG   + LP  L  DS  R      +L  S+ +  P   +
Sbjct  130   VITVPELWDKVKGFNLPAVFLGPKEVSLP--LESDSRIRSFHSLVELGGSNSEF-PVSDV  186

Query  1327  RQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYH  1148
             +Q D A +L+SSGTTG  K V LTH NFIA   L V  +  Q       NV+L  LPM+H
Sbjct  187   KQSDIATLLYSSGTTGVSKGVILTHGNFIA-ASLMVSMD--QVMAGEIHNVFLCFLPMFH  243

Query  1147  VYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKC  968
             V+GL++     L +G+ VV + K++ + V+R I++Y VTH  V PP+++AL+++    K 
Sbjct  244   VFGLAVITYSQLQMGNAVVSMGKFQFEMVLRTIEKYRVTHMWVVPPVILALSKQNLVKKY  303

Query  967   GLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSV  788
              L SL+ + SGAAP+    ++   +  P    IQG+GMTE+  + +       +R+  S 
Sbjct  304   DLSSLRNIGSGAAPLGKDLMKECAKNLPDTTIIQGFGMTETCGIVSLEDPRIGVRHSGSA  363

Query  787   GLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLH  608
             G+L   +EA++V + +      LPP  +GE+W+RGP +M+GY NN +A+K+ +D  GWLH
Sbjct  364   GILNAGIEAQIVSVETLKP---LPPNQLGEIWVRGPNMMRGYFNNPQATKDTIDKRGWLH  420

Query  607   TGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGE  428
             TGD+ +FD+DG L+V DR+KE+IKYKGFQ+APA+LE +L+SHP+I+DA VT     E G 
Sbjct  421   TGDLGYFDDDGQLFVVDRIKELIKYKGFQVAPAELEGLLVSHPEILDAVVTPYPDAEAGA  480

Query  427   IPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             +PVA+VV+   S  +L++ +V  F++ QVAP+K++R+V F  S+PKSASGKILR+EL
Sbjct  481   VPVAYVVRSPNS--ALTEEDVQKFISDQVAPFKRLRKVTFISSVPKSASGKILRREL  535



>ref|XP_006485343.1| PREDICTED: 4-coumarate--CoA ligase-like 5-like [Citrus sinensis]
Length=566

 Score =   405 bits (1041),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 231/544 (42%), Positives = 344/544 (63%), Gaps = 28/544 (5%)
 Frame = -2

Query  1840  YSSETGIYRSK---HPSVHLPSDPFLDVVSFILSR-NHGGLSA----LVDSQSGFSISYP  1685
             + SETGIY S      +  +P+   LD  +F+LSR  H  L+A    L+DS +   ++Y 
Sbjct  23    FDSETGIYHSLIQLGENYRIPTRTDLDTATFVLSRFPHPDLAASRVALIDSATRERVTYA  82

Query  1684  ELRSLVNSMAAGL-HRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSE  1508
             +L   + S+A GL H +GV +GDV  +L PNS+ +P I L + S+GA+ +  NP++T SE
Sbjct  83    QLHRSIRSLAFGLYHALGVRKGDVVFVLAPNSLLYPSICLAIFSLGAILSPANPINTESE  142

Query  1507  IKKQSFDCNVRLAFATPDRVQNLGSTLGIPVI------GLPESLNLDSPFRKLISSDPKL  1346
             I KQ  D   +L  +  + +Q L + + +PVI         +S++++       ++D   
Sbjct  143   IVKQVRDSGAKLIISASEELQKL-AKVKVPVIVTSRDQSNDKSVSVEELIECCDAADE--  199

Query  1345  APTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLD  1166
              P  ++ Q DTAA+L+SSGTTG  K V LTHANFI++++L +R+        A  +++L 
Sbjct  200   LPGCQLTQDDTAAILYSSGTTGTSKGVILTHANFISIMQL-LRWTVDVTH--AQNDIFLC  256

Query  1165  VLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRK  986
             ++PM+H+YGL+ F  GL   G T+VV++++++  ++ AI  Y V + P+ PP+++ L + 
Sbjct  257   MIPMFHIYGLAFFATGLFCCGVTIVVMQRFDLQAMIEAIKTYQVNNIPLVPPVILGLVKY  316

Query  985   AKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKL  806
              K D   L SL++V SGAAP+S      F   FP ++  QGYG+TES    T   +  + 
Sbjct  317   CK-DSSYLTSLRRVGSGAAPLSKELADEFRAKFPWVELRQGYGLTESCGATTFMVSPEQA  375

Query  805   RNYT-SVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAV  629
             R  + S G L+P   A+VVD        +LPP   GELWL+ P IM+GY  N EA+  A 
Sbjct  376   RARSGSCGALSPTFCAKVVD---TETRLALPPYQRGELWLKSPTIMRGYFGNEEATAAAF  432

Query  628   DDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSA  449
             D+DGWL TGD+ +FD +G+LY+ DR+KE+IK+ G+Q+APA+LEAVL+SHP+I+DAAV   
Sbjct  433   DEDGWLKTGDLCYFDGEGFLYIVDRIKELIKHNGYQVAPAELEAVLLSHPNILDAAVIPL  492

Query  448   QSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKIL  269
             + EE G+IP+A+VV+  GS+  L++  V+ FV  QVAPYKKVRRV F  +IPKSA+GKIL
Sbjct  493   EDEEAGQIPMAYVVRAAGSQ--LTEDQVMQFVTSQVAPYKKVRRVAFISAIPKSAAGKIL  550

Query  268   RKEL  257
             RKEL
Sbjct  551   RKEL  554



>gb|AGO89328.1| Ca4CL11 [Salix arbutifolia]
Length=543

 Score =   404 bits (1039),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 231/535 (43%), Positives = 336/535 (63%), Gaps = 21/535 (4%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFIL--SRNHGGLSALVDSQSGFSISYPELRSLVNSMAA  1652
             GIYRS  P + LP DP L +VSF+   S ++    AL+D+    ++SY EL+S+V  +A 
Sbjct  10    GIYRSLRPKLVLPKDPNLSMVSFLFRNSDSYPHKPALIDADLSITLSYSELKSVVIKVAH  69

Query  1651  GLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRL  1472
             GL  +GVS+ DV LI  PNS  FP+ FL ++S GA+A T NPL T SE+ KQ  D + +L
Sbjct  70    GLLNLGVSKNDVVLIFAPNSYQFPICFLAIISTGAIATTANPLYTTSELSKQIKDSDPKL  129

Query  1471  AFATP---DRVQNLGST---LGIPVIGLP-ESLNLDSPFRKLIS---SDPKLAPTPRIRQ  1322
                 P   D+V+        LG   + LP ES +    F  L+    S+ +  P+  ++Q
Sbjct  130   IITVPELWDKVKGFNVPAVFLGPKRVSLPLESGSRIRSFDSLVELGGSNSQF-PSSNVKQ  188

Query  1321  QDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVY  1142
              D + +L+SSGTTG  K V LTH NFIA   +         E     NV+L  LPM+HV+
Sbjct  189   SDISTLLYSSGTTGVSKGVMLTHGNFIAASLMVTMDHVMAGE---MHNVFLCFLPMFHVF  245

Query  1141  GLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCGL  962
             GL++     L +G+TVV + K+E + V++ ID+Y VTH  V PP+++AL ++    K  L
Sbjct  246   GLAVITYSQLQMGNTVVSMGKFEFEMVLKTIDKYRVTHMWVVPPVVLALAKQNLVKKYDL  305

Query  961   KSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGL  782
              SL+ + SGAAP+    ++   +  P     QGYGMTE++   +   +    R+  S G+
Sbjct  306   SSLRSIGSGAAPLGKDLMKECAKNLPGTIITQGYGMTETSGFVSMEDSRLGTRHSGSAGM  365

Query  781   LAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTG  602
             LA  +EA++V + +      LPPT  GE+W+RG  +M+GYLNN +A+K+ +D+ GW+HTG
Sbjct  366   LAAGIEAQIVSVETLKP---LPPTQSGEIWVRGLNMMRGYLNNPQATKDTIDEKGWVHTG  422

Query  601   DIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIP  422
             DI +FDEDG L+V DR+KE+IKYKGFQ+APA+LE +L+SHP+I+DA V      E GE+P
Sbjct  423   DIGYFDEDGQLFVVDRIKELIKYKGFQVAPAELEGLLVSHPEILDAVVIPYPDAEAGEVP  482

Query  421   VAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             VA+VV+   S  +L++ +V  F+A+QVAP+K++R+V F  S+PKSASGKILR+ L
Sbjct  483   VAYVVRSPNS--ALTEVDVKKFIAEQVAPFKRLRKVTFVNSVPKSASGKILRRVL  535



>ref|XP_009346102.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Pyrus x bretschneideri]
Length=570

 Score =   405 bits (1041),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 228/545 (42%), Positives = 345/545 (63%), Gaps = 27/545 (5%)
 Frame = -2

Query  1840  YSSETGIYRSK---HPSVHLPSDPFLDVVSFILSR-----NHGGLSALVDSQSGFSISYP  1685
             +  +TGIY S     P   +P+   LD  +F+LS+           AL+DS +   ++Y 
Sbjct  23    FDPKTGIYHSLLNLGPRYKIPTKHNLDTAAFVLSQFLPRYEAESRVALIDSATNERVTYE  82

Query  1684  ELRSLVNSMAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSE  1508
             +LR  ++++A+GL++ +GV +GDV  +L PNS+ +P I L +L++GA+  T NP++T SE
Sbjct  83    QLRHSIHALASGLYQALGVRKGDVVFLLSPNSLLYPTICLAVLTIGAILTTANPINTESE  142

Query  1507  IKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPF--RKLISS-DPKLAPT  1337
             I KQ  D   +LA ++P+ +  L  T G+P I     L+ D      +LI   DP   PT
Sbjct  143   IGKQVRDSGAKLAISSPEELHKLVPT-GVPTILTSRPLSGDDSLTIEQLIEGYDP--IPT  199

Query  1336  ----PRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYL  1169
                  R  Q DTAA+L+SSGTTG  K V LTHANFIA++ + +R+     E  A  +V+L
Sbjct  200   DLMQARPTQSDTAAILYSSGTTGTSKGVVLTHANFIAIITM-LRWTVD--ETSAQDDVFL  256

Query  1168  DVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTR  989
               +PM+H+YGL+ F +GL   G+T V+++++E + ++ AI  + V++ P  PP+++ L +
Sbjct  257   CFIPMFHIYGLAFFGLGLFCAGTTTVLMQRFEFNTMLDAIKTHKVSNIPAVPPVILGLVK  316

Query  988   KAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAK  809
              A    C L SL++VSSGAAP+S   I  F   FP ++   GYG+TES    T   +  +
Sbjct  317   YASKAACDLSSLRRVSSGAAPLSKELIDEFRERFPWVEMRPGYGLTESCGAATIFISDKQ  376

Query  808   LRNYT-SVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNA  632
              + ++ S G+L P   A++VD+ +G     LPP   GELWL+ P IMK YL N E++   
Sbjct  377   AKAHSASCGVLLPGFSAKIVDIETGEA---LPPYKEGELWLKSPTIMKEYLGNVESTLAT  433

Query  631   VDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTS  452
             +D +GWL TGD+ +F+E+G+L++ DR+KE+IK+ G+Q+APA+LEA+L+SHP I+DAAV  
Sbjct  434   IDSNGWLKTGDLCYFNEEGFLFIVDRIKELIKHNGYQVAPAELEAILLSHPQILDAAVIP  493

Query  451   AQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKI  272
              + E+ G+IP+A+VV+    +  L++  VI FVA QVAPYKKVRRV F  +IP+S + KI
Sbjct  494   VEDEQAGQIPMAYVVRAASPD-GLTEDQVIQFVASQVAPYKKVRRVDFISAIPRSPASKI  552

Query  271   LRKEL  257
             LRKEL
Sbjct  553   LRKEL  557



>ref|XP_002966178.1| hypothetical protein SELMODRAFT_143817 [Selaginella moellendorffii]
 gb|EFJ32205.1| hypothetical protein SELMODRAFT_143817 [Selaginella moellendorffii]
Length=553

 Score =   404 bits (1039),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 241/559 (43%), Positives = 333/559 (60%), Gaps = 42/559 (8%)
 Frame = -2

Query  1858  GRRSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLS-----ALVDSQSGFSI  1694
             G R C      GIY S    V +P  P LD VS++ S+  G        A++D +SG S+
Sbjct  9     GYREC-----DGIYSSLASPVAMPLHPHLDFVSYMFSQRFGRPESASNVAILDGKSGQSL  63

Query  1693  SYPELRSLVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTL  1514
             +  +LR  + ++A GLH  G+ QGDV +ILLPN++ FPV+F   L +GAV  TMNP +T 
Sbjct  64    TCSQLRRSIEAVATGLHESGICQGDVVMILLPNTLEFPVMFNAALRIGAVVTTMNPQNTP  123

Query  1513  SEIKKQSFDCNVRLAF---ATPDRVQNLGSTLGIPVIGLPE------SLNLDS------P  1379
             +EI +Q  D   ++     A  D+V+     L I ++   E      +LN D       P
Sbjct  124   AEIARQMLDSRPKMVLTNRAGVDKVRAASPDLPIVLVDEEEREEHGRTLNSDEKKPQFIP  183

Query  1378  FRKLISSDPKLAPTPR--IRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEAS  1205
             F + ++SDP   P  R  IRQ D AA+L+SSGTTG  K V ++H N IA   + V+ +  
Sbjct  184   FSRFLASDPDQRPRNRCLIRQSDPAALLYSSGTTGLSKGVVISHGNLIA--AMAVQNQVP  241

Query  1204  QYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHF  1025
             +       NV L   PMYH+ GL     G +  G T V++++Y + +++RA++R+G    
Sbjct  242   EEMDRGDTNVVL--FPMYHIGGLMWLCCGAIMGGPTFVLLQRYGLADLLRAVERHGANKI  299

Query  1024  PVAPPLLVALTRKAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHID-FIQGYGMTE  848
               APP+ + L   A+  +  L+SL+ +   AAP+S   IQ  +  FPH++ FIQ YGMTE
Sbjct  300   TSAPPVALDLLHSAQTVRYDLRSLRALICAAAPLSKETIQGLMIKFPHLEMFIQMYGMTE  359

Query  847   STAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMK  668
             +  VG+ G          S G L   +EARVVDL +      LPP   GELWLRG  IM+
Sbjct  360   TVTVGSGGRGV-----MGSSGRLNATLEARVVDLETRKS---LPPNQRGELWLRGSPIMQ  411

Query  667   GYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLM  488
             GYLNN  A+  A+D DGWLHTGD+V+FD  GYLY+ DRLKE+IKYKG+Q+APA+LEA+L+
Sbjct  412   GYLNNPVATAEAIDSDGWLHTGDLVYFDSKGYLYIVDRLKELIKYKGYQVAPAELEALLL  471

Query  487   SHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYF  308
             +HP IVD AV     E  GEIP AF+V+ + +  S+S   V+ +VA QVAPYK++RRV F
Sbjct  472   THPAIVDCAVVPFPDEVAGEIPQAFIVRARDN--SISSEEVMRYVADQVAPYKRIRRVSF  529

Query  307   TKSIPKSASGKILRKELRN  251
                IPKSA+GKILR EL+ 
Sbjct  530   LDKIPKSAAGKILRNELKK  548



>ref|XP_010090435.1| 4-coumarate--CoA ligase-like 5 [Morus notabilis]
 gb|EXB39450.1| 4-coumarate--CoA ligase-like 5 [Morus notabilis]
Length=572

 Score =   405 bits (1041),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 233/546 (43%), Positives = 343/546 (63%), Gaps = 28/546 (5%)
 Frame = -2

Query  1840  YSSETGIYRSKH---PSVHLPSDPFLDVVSFILSR----NHGGLS-ALVDSQSGFSISYP  1685
             ++   GIYRS H       +P DP LD  +F+LS+    +H  L  AL+DS +   ++Y 
Sbjct  25    FNERNGIYRSLHCLGERHKIPKDPNLDTATFVLSQFPSLHHAELRIALIDSATNQRVTYA  84

Query  1684  ELRSLVNSMAAGL-HRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSE  1508
             +L   V S+A+GL H + + + DV  +L PNS+ +P I L +LS+GA+  T NPL+T SE
Sbjct  85    QLHRSVLSLASGLQHALKIQKNDVVFVLSPNSLLYPTICLAVLSIGAILTTANPLNTESE  144

Query  1507  IKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLN-----LDSPFRKLISSDP-KL  1346
             I KQ  D + +LA + PD +  L  T G+P I      +     L S    + S +P +L
Sbjct  145   IAKQVSDSDPKLAISGPDELHKLIPT-GVPTILTSRPTDGGEDVLLSVEELIESCEPAEL  203

Query  1345  APTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLD  1166
                 R  Q DTAA+L+SSGTTG  K V LTHANFI+++ L    + S     A  +V+L 
Sbjct  204   ERKNRPCQSDTAAILYSSGTTGTSKGVVLTHANFISVITLL---KWSMDVTSAQNDVFLC  260

Query  1165  VLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRK  986
              +P++H+YGL+ F +GL  +G+T V+++K+E+  ++ A+  Y V + P  PP+++ + + 
Sbjct  261   FIPLFHIYGLAFFGLGLFCVGTTTVLMKKFELKVMLDAVKEYRVNNIPAVPPVILGMVKY  320

Query  985   A-KADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGT--RGFNT  815
             A K     L SL++V SGAAP+S   ++ F + FP ++   GYG+TES    T       
Sbjct  321   AGKFAGVDLSSLRRVGSGAAPLSKELVEEFRQRFPWVELRPGYGLTESCGAATIFASNKD  380

Query  814   AKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKN  635
             AK R+ +S G L P   A++VD+ +      LPP   GELW++ P +MK YL   EA+  
Sbjct  381   AKTRSGSS-GRLIPGFCAKIVDVETRKS---LPPYKEGELWIKSPTVMKEYLGKTEATAE  436

Query  634   AVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVT  455
              +  DGWL TGD+ +FDEDG+LYV DRLKE+IK+ G+Q+APA+LEA+L++HP I+D AV 
Sbjct  437   TIVSDGWLRTGDLCYFDEDGFLYVVDRLKELIKHNGYQVAPAELEAILLAHPRILDTAVI  496

Query  454   SAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGK  275
               + EE G+IP+A+VV+  GS+  L++A VI++VA QVAPYKKVR+V FT +IP+S +GK
Sbjct  497   PVEDEEAGQIPMAYVVRAVGSQ--LTEAQVIEYVANQVAPYKKVRKVGFTNAIPRSTAGK  554

Query  274   ILRKEL  257
             ILRK+L
Sbjct  555   ILRKDL  560



>ref|XP_010477287.1| PREDICTED: 4-coumarate--CoA ligase-like 5 isoform X2 [Camelina 
sativa]
 ref|XP_010477288.1| PREDICTED: 4-coumarate--CoA ligase-like 5 isoform X2 [Camelina 
sativa]
Length=542

 Score =   404 bits (1038),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 234/541 (43%), Positives = 341/541 (63%), Gaps = 31/541 (6%)
 Frame = -2

Query  1852  RSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRS  1673
             RS F +S +  Y  + P + LP +P LDV +FI S+ H G  A +D+ +G ++++ EL  
Sbjct  7     RSGFCNSNSTFYSKRTP-IPLPPNPSLDVTTFISSQAHRGRIAFIDASTGNNLTFSELWR  65

Query  1672  LVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQS  1493
              V  +A  L+ MG+ +G V L+L PNSI FPV+ L ++S+GA+  T NPL+T  EI KQ 
Sbjct  66    AVECVADCLYEMGIRKGHVVLLLSPNSILFPVVCLSVMSLGAIITTTNPLNTSGEIAKQI  125

Query  1492  FDCNVRLAFATPDRVQNLGSTL-GIPVIGLPESLNLDSPFR-KLISSDPKLAPT-----P  1334
              D N  LAF T   +  + S    +P++ + E   +DS  + + ++   K  P+      
Sbjct  126   KDSNPVLAFTTSQLLPKIASAAEKLPIVLMDEE-RVDSVGKVRRLAEMMKKEPSGNRVME  184

Query  1333  RIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RF---EASQYEYPATANVYLD  1166
             R+ Q DTA +L+SSGTTG  K V  +H N IAMV+  V RF   + +Q E       ++ 
Sbjct  185   RVDQDDTATLLYSSGTTGMSKGVISSHRNLIAMVQTVVNRFGSDDGTQGE-----QRFIC  239

Query  1165  VLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTR-  989
              +PM+HVYGL+ F  GLL+ GST++V+ K+E+ E++ AI +Y  T  P+ PP+LVA+   
Sbjct  240   TVPMFHVYGLAAFATGLLAYGSTIIVLSKFEMHEMMSAIGKYKATFLPLVPPILVAMVNG  299

Query  988   ----KAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGF  821
                 KAK D   L SL  V  G AP+S    + F   +P +  +QGYG+TEST +G    
Sbjct  300   ADQIKAKYD---LSSLHTVLCGGAPLSKEVTEGFAEKYPTVKIMQGYGLTESTGIGASTD  356

Query  820   NTAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEAS  641
                + R Y + G L+ +ME R+VD      G  L P   GEL L+GP+IMKGY +N EA+
Sbjct  357   TVEESRRYGTAGRLSASMEGRIVD---PVTGKILGPNQTGELLLKGPSIMKGYFSNEEAT  413

Query  640   KNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAA  461
              + +D +GWL TGD+ + DEDG+++V DRLKE+IKYKG+Q+APA+LEA+L++HP+I DAA
Sbjct  414   SSTLDSEGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVAPAELEALLLTHPEIPDAA  473

Query  460   VTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSAS  281
             V     + VG+ P+A+VV+K GS  SLS+ ++++FVAKQVAPYK++R+V F  SIPK+ S
Sbjct  474   VIPFPDKAVGQFPMAYVVRKTGS--SLSEKSIMEFVAKQVAPYKRIRKVAFVTSIPKNPS  531

Query  280   G  278
             G
Sbjct  532   G  532



>ref|XP_009346655.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Pyrus x bretschneideri]
Length=570

 Score =   405 bits (1040),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 228/545 (42%), Positives = 344/545 (63%), Gaps = 27/545 (5%)
 Frame = -2

Query  1840  YSSETGIYRSK---HPSVHLPSDPFLDVVSFILSR-----NHGGLSALVDSQSGFSISYP  1685
             +  +TGIY S     P   +P+   LD  +F+LS+           AL+DS +   ++Y 
Sbjct  23    FDPKTGIYHSLLNLGPRYKIPAKHNLDTAAFVLSQFLPRYEAESRVALIDSATNERVTYE  82

Query  1684  ELRSLVNSMAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSE  1508
             +LR  ++++A+GL++ +GV +GDV  +L PNS+ +P I L +LS+GA+  T NP++T SE
Sbjct  83    QLRHSIHALASGLYQALGVRKGDVVFLLSPNSLLYPTICLAVLSIGAILTTANPINTESE  142

Query  1507  IKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDSPF--RKLISS-DPKLAPT  1337
             I KQ  D + +LA ++P+ +  L  T G+P I     L+ D      +LI   DP   PT
Sbjct  143   IGKQVCDSSAKLAISSPEELHKLVPT-GVPTILTSRPLSGDDSLTIEQLIEGYDP--IPT  199

Query  1336  P----RIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYL  1169
                  R  Q DTAA+L+SSGTTG  K V LTHANFIA++ + +R+     E  A  +V+L
Sbjct  200   ELMQARPTQSDTAAILYSSGTTGTSKGVVLTHANFIAIITM-LRWTVD--ETSAQDDVFL  256

Query  1168  DVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTR  989
               +PM+H+YGL+ F +GL   G+T V+++++E + ++ AI  + V++ P  P +++ L +
Sbjct  257   CFIPMFHIYGLAFFGLGLFCAGTTTVLMQRFEFNTMLDAIKTHKVSNIPAVPLVILGLVK  316

Query  988   KAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAK  809
              A    C L SL++VSSGAAP+S   I  F   FP ++   GYG+TES    T   +  +
Sbjct  317   YASKAACDLSSLRRVSSGAAPLSKELIDEFRERFPWVEMRPGYGLTESCGAATIFISDKQ  376

Query  808   LRNYT-SVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNA  632
              + ++ S G+L P   A++VD+ +      LPP   GELWL+ P IMK YL N E++   
Sbjct  377   AKAHSASCGVLLPGFSAKIVDIETREA---LPPYKEGELWLKSPTIMKEYLGNVESTLAT  433

Query  631   VDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTS  452
             +D +GWL TGD+ +F+E+G+L++ DR+KE+IK+ G+Q+APA+LEA+L+SHP I+DAAV  
Sbjct  434   IDSNGWLKTGDLCYFNEEGFLFIVDRIKELIKHNGYQVAPAELEAILLSHPQILDAAVIP  493

Query  451   AQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKI  272
              + EE G+IP+A+VV+    +  L++  VI FVA QVAPYKKVRRV F  +IP+S + KI
Sbjct  494   VEDEEAGQIPMAYVVRAASPD-GLTEDQVIQFVASQVAPYKKVRRVDFISAIPRSPASKI  552

Query  271   LRKEL  257
             LRKEL
Sbjct  553   LRKEL  557



>ref|XP_002311981.1| hypothetical protein POPTR_0008s03140g [Populus trichocarpa]
 gb|EEE89348.1| hypothetical protein POPTR_0008s03140g [Populus trichocarpa]
Length=555

 Score =   404 bits (1039),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 228/542 (42%), Positives = 334/542 (62%), Gaps = 25/542 (5%)
 Frame = -2

Query  1828  TGIYRSKH---PSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVNSM  1658
             TGIY S H    +  +P+   +D  ++          AL+D  +   ++Y +L   + ++
Sbjct  30    TGIYHSLHQLGENFQIPTRHDIDTSTYTKV-------ALIDLATNHQVNYSQLHRSIRAL  82

Query  1657  AAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCN  1481
             A+GL+  +GV +GDV  +L  NSI +P I L + S+GA+ +  NP++T SEI KQ  D  
Sbjct  83    ASGLYNGLGVRKGDVVFLLSQNSILYPTICLAIFSIGAILSPANPVNTKSEISKQIQDSG  142

Query  1480  VRLAFATPDRVQNLGSTLGIPVIGLPESLNLDS-PFRKLIS-SDPKLAPTPRIRQQDTAA  1307
              +L  + P+ +  L   +G+P +      N DS    +LI  SDP   P   I Q DTAA
Sbjct  143   AKLVISAPEELHKL-LEIGVPTLVTTRESNGDSLSVEELIEYSDPLELPQVGITQSDTAA  201

Query  1306  VLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVYGLSLF  1127
             +L+SSGTTG  K V LTH+NFIA++ L    + S +   +  + +L  +P++H+YGL+ F
Sbjct  202   ILYSSGTTGTSKGVILTHSNFIAVMTLL---KWSVFATSSQNDTFLCFIPIFHIYGLAFF  258

Query  1126  VMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCGLKSLKQ  947
              +GL   G T V++R+++   ++ A+  Y + + P  PP+++ L +     KC L SL++
Sbjct  259   GLGLFCAGITTVLMRRFDFQAMLDAVQAYKINNIPAVPPVILGLVKNGSKVKCDLSSLRR  318

Query  946   VSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNY-TSVGLLAPN  770
             V SGAAP+S      F R FP ++  QGYG+TES A  T   +  + + +  S G L P 
Sbjct  319   VGSGAAPLSKELSDEFRRRFPWVELRQGYGLTESCAAATFFISDEQAKKHPASCGRLVPT  378

Query  769   MEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTGDIVH  590
               A++VD      GS+LPP   GELWL+ P IMKGYL N  A+   +D DGWL TGD+ +
Sbjct  379   FSAKIVD---TETGSALPPGRKGELWLKSPTIMKGYLGNEAATAATIDPDGWLKTGDMGY  435

Query  589   FDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIPVAFV  410
              DEDG+L++ DR+KE+IK+ G+Q+APA+LEA+L+ HP ++DAAV   + EE G+IP+A+V
Sbjct  436   LDEDGFLHLVDRIKELIKHNGYQVAPAELEAILLGHPQVLDAAVIPVEDEEAGQIPMAYV  495

Query  409   VKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL--RNLLITS  236
             V+  GSE  L++  VI FVA QVAPYKKVRRV F  +IPKSA+GKILRKEL   +  ITS
Sbjct  496   VRAAGSE--LTEEQVIQFVANQVAPYKKVRRVGFISAIPKSAAGKILRKELVSHSQQITS  553

Query  235   KI  230
             K+
Sbjct  554   KL  555



>ref|XP_007208457.1| hypothetical protein PRUPE_ppa003893mg [Prunus persica]
 gb|EMJ09656.1| hypothetical protein PRUPE_ppa003893mg [Prunus persica]
Length=542

 Score =   404 bits (1037),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 220/533 (41%), Positives = 331/533 (62%), Gaps = 18/533 (3%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFIL--SRNHGGLSALVDSQSGFSISYPELRSLVNSMAA  1652
             GI+RS  P + LP D  L +VSF+   S ++    AL+D++S  ++S+ + +SLV  ++ 
Sbjct  10    GIFRSLRPPLVLPRDLNLSMVSFLFRNSSSYSNKPALIDAESSETLSFSQFKSLVIKVSH  69

Query  1651  GLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRL  1472
             GL  +G+ + DV LI  PNSI FP+ FLG+++ GA+A T NPL T+SE+ KQ  D N +L
Sbjct  70    GLLHLGIKKNDVVLIFAPNSIQFPICFLGIIASGAIATTSNPLYTVSELSKQVKDSNPKL  129

Query  1471  AFATPDRVQNLGS-TLGIPVIGLPESLNLDS-----PFRKLISSDPKLA--PTPRIRQQD  1316
                 P+  + +    L   ++G   + ++ S      F  L+ S    +  P   I+Q D
Sbjct  130   VITVPELFEKVKDFNLPAVILGSQGASHIASRSKILTFHDLVESAGSASDFPLANIKQTD  189

Query  1315  TAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHVYGL  1136
             TAA+L+SSGTTG  K V LTH NFIA   L    E  Q       +V+L VLPM+HV+GL
Sbjct  190   TAALLYSSGTTGMSKGVVLTHKNFIAS-SLMCTME--QEMTGEMHHVFLCVLPMFHVFGL  246

Query  1135  SLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCGLKS  956
             ++     L  G+ VV + ++++ +++ A+++Y VTH  V PP+++AL + +   K  L S
Sbjct  247   AIITYSQLQKGNAVVSMSRFDLQKILMAVEKYKVTHLWVVPPIVLALAKNSAVKKFNLSS  306

Query  955   LKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGLLA  776
             L+ + SGAAP+    ++   +  P     QGYGMTE+  + +        R+  S G+L 
Sbjct  307   LRHIGSGAAPLGKELMEECAKVIPQGLIAQGYGMTETCGIASVENTLVGPRHTGSTGMLV  366

Query  775   PNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTGDI  596
               +E ++V + +       PP  +GE+W+RGP +M GY NN +A+   +D +GW+HTGD+
Sbjct  367   SGVECQIVSVDTLKPQ---PPNKLGEIWVRGPNMMSGYFNNPQATNETIDKNGWVHTGDL  423

Query  595   VHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIPVA  416
              +FDEDG LYV DR+KE+IKYKGFQ+APA+LE +L+SHP+I+DA V      E GE+PVA
Sbjct  424   GYFDEDGQLYVVDRIKELIKYKGFQVAPAELEGLLISHPEILDAVVIPFPDAEAGEVPVA  483

Query  415   FVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             + V+   S  SL++ +V +F+A QVAP+K++RRV F  S+PKSASGKILR+EL
Sbjct  484   YCVRTPNS--SLTEEDVKNFIANQVAPFKRLRRVTFINSVPKSASGKILRREL  534



>ref|XP_011031616.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Populus euphratica]
Length=567

 Score =   404 bits (1039),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 231/565 (41%), Positives = 344/565 (61%), Gaps = 23/565 (4%)
 Frame = -2

Query  1882  IRNSAAEKGRRSCFYSSETGIYRSKH---PSVHLPSDPFLDVVSFILSR----NHGGLS-  1727
             I    A+  +    +   TGIY S H    +  +P+   +D  +++LS+    +H     
Sbjct  12    ITEEEADTAQSKSGFDPLTGIYHSLHQLGENFQIPTRHDIDTTTYVLSQFPHPDHAPTKV  71

Query  1726  ALVDSQSGFSISYPELRSLVNSMAAGLHR-MGVSQGDVALILLPNSIYFPVIFLGLLSVG  1550
             AL+D  +   ++Y +L   + ++A+GL+  +GV +GDV  +L  NSI +P I L + S G
Sbjct  72    ALIDLATNHQVNYSQLHRSIRALASGLYNGLGVRKGDVVFLLSQNSILYPTICLAIFSTG  131

Query  1549  AVAATMNPLSTLSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVIGLPESLNLDS-PFR  1373
             A+ +  NP++T SEI KQ  D   +L  ++P+ +  L   +G+P +      N DS    
Sbjct  132   AILSPANPVNTKSEISKQIQDSGAKLVISSPEELHKL-LEIGVPTLVTTRESNGDSLSVE  190

Query  1372  KLIS-SDPKLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYE  1196
             +LI  SDP   P   I Q DTAA+L+SSGTTG  K V LTH+NFIA++ L    + S + 
Sbjct  191   ELIEYSDPLELPQVGITQSDTAAILYSSGTTGTSKGVILTHSNFIAVMTLL---KWSVFA  247

Query  1195  YPATANVYLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVA  1016
               +  + +L  +P++H+YGL+ F +GL   G T V++R+++   ++ A+  Y + + P  
Sbjct  248   TSSQNDTFLCFIPIFHIYGLAFFGLGLFCAGITTVLMRRFDFQAMLDAVQAYKINNIPAV  307

Query  1015  PPLLVALTRKAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAV  836
             PP+++ L +     K  L SL++V SGAAP+S      F R FP ++  QGYG+TES A 
Sbjct  308   PPVILGLVKNGSKVKRDLSSLRRVGSGAAPLSKDLSDEFRRRFPWVELRQGYGLTESCAA  367

Query  835   GTRGFNTAKLRNY-TSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYL  659
              T   +  + + +  S G L P   A++VD      GS+LPP   GELWL+ P IMKGYL
Sbjct  368   ATFFISDEQAKKHPASCGRLVPTFSAKIVD---TETGSALPPGGKGELWLKSPTIMKGYL  424

Query  658   NNGEASKNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHP  479
              N  A+   +D DGWL TGD+ + DEDG+L++ DR+KE+IK+ G+Q+APA+LEA+L+ HP
Sbjct  425   GNEAATAATIDPDGWLKTGDMGYLDEDGFLHLVDRIKELIKHNGYQVAPAELEAILLGHP  484

Query  478   DIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKS  299
              ++DAAV   + EE G+IP+A+VV+  GSE  L++  VI FVA QVAPYKKVRRV F  +
Sbjct  485   QVLDAAVIPVEDEEAGQIPMAYVVRAAGSE--LTEEQVIQFVANQVAPYKKVRRVGFISA  542

Query  298   IPKSASGKILRKEL--RNLLITSKI  230
             IPKSA+GKILR+EL   +  ITSK+
Sbjct  543   IPKSAAGKILRRELVSHSQQITSKL  567



>ref|XP_010477284.1| PREDICTED: 4-coumarate--CoA ligase-like 2 isoform X1 [Camelina 
sativa]
 ref|XP_010477285.1| PREDICTED: 4-coumarate--CoA ligase-like 2 isoform X2 [Camelina 
sativa]
Length=558

 Score =   404 bits (1038),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 228/556 (41%), Positives = 343/556 (62%), Gaps = 29/556 (5%)
 Frame = -2

Query  1855  RRSCFYSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELR  1676
             R+S F  S +  Y  + P +  P + FLDV +FI S+ H G +  VD+ +G  +S+ +L 
Sbjct  18    RKSGFCDSTSTFYSKREP-MAFPPNQFLDVTTFISSQPHSGKTVFVDAVTGRRLSFSDLW  76

Query  1675  SLVNSMAAGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQ  1496
               V  +A  L+ +GV +GDV +IL PNSI FP++ L ++S+GA+  T NP++T  EI KQ
Sbjct  77    LGVERVAGSLYALGVRKGDVVIILSPNSILFPIVTLSVMSLGAIITTANPINTPGEISKQ  136

Query  1495  SFDCNVRLAFATPDRVQNLGSTL---GIPVIGLP-------ESLNLDSPFRKLISSDP-K  1349
               +    LAF T   V  L S      +PV+ +        E + +      +I ++P +
Sbjct  137   IDNSRPVLAFTTCQLVSKLASAASNSNLPVVLMDRNYVPRDEQVKIVGRLETMIETEPSE  196

Query  1348  LAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELF-VRFEASQYEYPATANVY  1172
                  R+ Q DTAA+L+SSGTTG  K V LTH N IA+V+ + +RF+  Q          
Sbjct  197   QRVKQRVNQDDTAALLYSSGTTGTSKGVMLTHRNLIALVQAYRIRFDLEQRT--------  248

Query  1171  LDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALT  992
             +  +PM HVYG   F  GL++LG T+VV+ ++E+ +++ A++ +  ++  + PP+LVA+ 
Sbjct  249   VCTIPMCHVYGFGSFATGLIALGWTIVVLPRFEMAQLLSAVEVHRSSYLSLVPPILVAMV  308

Query  991   RKAKA--DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFN  818
               AK    K  L SL  V +G AP+S   I+ FV ++P +  +QGYG+TESTAV    + 
Sbjct  309   NGAKEINSKYDLSSLHTVVAGGAPLSREMIEKFVESYPTVKVLQGYGLTESTAVAASMYT  368

Query  817   TAKLRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASK  638
               +   Y + GLLAPN+EA++VD      G  L     GE+W+R P +MKGY  N EA+ 
Sbjct  369   KEETERYGASGLLAPNVEAKIVD---PDTGRVLGVNQTGEMWIRSPTVMKGYFKNEEATA  425

Query  637   NAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAV  458
               +D +GWL TGD+ + D +G+++V DRLKE+IK  G+Q+APA+LEA+L++HP+I DAAV
Sbjct  426   ATIDSEGWLKTGDLCYIDSEGFVFVVDRLKELIKCNGYQVAPAELEALLLAHPEIADAAV  485

Query  457   TSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASG  278
                   + G+ P+A++V+K GS  +LS++ ++ FVAKQVAPYK++R+V F  SIPK+ SG
Sbjct  486   VPIPDMKAGQYPMAYIVRKAGS--NLSESEIMGFVAKQVAPYKRIRKVAFLASIPKNPSG  543

Query  277   KILRKELRNLLITSKI  230
             KILR+EL  L  TSK+
Sbjct  544   KILRRELIKLR-TSKL  558



>ref|XP_010538202.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Tarenaya hassleriana]
Length=546

 Score =   404 bits (1037),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 230/545 (42%), Positives = 340/545 (62%), Gaps = 21/545 (4%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFIL--SRNHGGLSALVDSQSGFSISYPELRSLVNSMAA  1652
             GI+RS  P + LP DP L +VSF+   S ++    AL+D+ SG S+S+ +L+S V  +A 
Sbjct  10    GIFRSLRPPLVLPKDPNLSLVSFLFRDSSSYPMKPALIDADSGESLSFSQLKSTVARLAH  69

Query  1651  GLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRL  1472
             G  R+G+ + DV LI  PNS  FP+ F  + ++G VA T NPL T+ E+ KQ  D   ++
Sbjct  70    GFLRLGIHKNDVVLIFAPNSFQFPLCFFAVTAIGGVATTANPLYTVEELSKQIKDSKPKI  129

Query  1471  AFATPDRVQNL-GSTLGIPVIGLPESLNLDS--------PFRKL--ISSDPKLAPTPRIR  1325
               +    +  + G  L + +IG  ES+ +           F  +  +S      P   ++
Sbjct  130   IVSVHQLLDKIKGFDLPVVLIGPGESIQVPRTGSSTKVMSFHDVMNLSGSSSDFPIVDVK  189

Query  1324  QQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYHV  1145
             Q DTAA+L+SSGTTG  K V LTH NFIA   L +  +  Q       +V+L  LPM+HV
Sbjct  190   QSDTAALLYSSGTTGTSKGVELTHRNFIA-ASLMITMD--QELMGEMHHVFLCFLPMFHV  246

Query  1144  YGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCG  965
             +GL++     L  G+ VV + K+E+D +++ I++Y VT+  V PP+ +AL++++ A K  
Sbjct  247   FGLAVITYSQLRKGNAVVSMAKFELDALLKNIEKYRVTNLWVVPPVFLALSKQSAARKYD  306

Query  964   LKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVG  785
             L SLK + SGAAP+    +    +  P++  +QGYGMTE+  + +        RN  S G
Sbjct  307   LSSLKYIGSGAAPLGKELMDECGKNMPNVMLLQGYGMTETCGIISLEDPRLGKRNTGSAG  366

Query  784   LLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHT  605
             +L   +EA+VV + +       PP  +GE+W+RGP +M+GY NN +A+K  +D  GW+HT
Sbjct  367   MLVSGVEAQVVSVETQKPS---PPKQLGEIWVRGPNMMRGYFNNPKATKETIDKKGWVHT  423

Query  604   GDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEI  425
             GD+ +FDEDG LYV DR+KE+IKYKGFQ+APA+LE +L+SHP+I+DA V     EE GE+
Sbjct  424   GDLGYFDEDGNLYVVDRIKELIKYKGFQVAPAELEGLLVSHPEILDAVVIPYPDEEAGEV  483

Query  424   PVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNLL  245
             P+AFVV+  GS  SL++  + +F+AKQVAP+K++RRV F  S+PKSASGKILR+EL + +
Sbjct  484   PIAFVVRAPGS--SLTKEEIQNFIAKQVAPFKRLRRVSFISSVPKSASGKILRRELVHQV  541

Query  244   ITSKI  230
               SKI
Sbjct  542   RRSKI  546



>ref|XP_006342547.1| PREDICTED: 4-coumarate--CoA ligase-like 5-like [Solanum tuberosum]
Length=551

 Score =   404 bits (1037),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 247/547 (45%), Positives = 350/547 (64%), Gaps = 21/547 (4%)
 Frame = -2

Query  1840  YSSETGIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLSALVDSQSGFSISYPELRSLVNS  1661
             YS     + SK   +  P++  LDV +FI SR H G  A +D+ +G  +++ ++ + V S
Sbjct  16    YSPANSTFYSKRKPIPFPANESLDVTTFISSRAHSGKIAFIDATTGRKLTFSDVWNAVES  75

Query  1660  MAAGLH-RMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDC  1484
             +A  L   M + +GDV L+L PNSI+FP+I L ++S+GA+  T NPL+T +EI KQ  D 
Sbjct  76    LATSLSVDMSIRKGDVVLLLSPNSIFFPIICLAVMSLGAIITTTNPLNTNNEIAKQIKDS  135

Query  1483  NVRLAFATPDRVQNL-GSTLGIPVI-GLPES---LNLDSPFRKLISSDPKLAP-TPRIRQ  1322
             N  LAF  P  +  L GS L + +I G+ +S   L +    +K+I   P  +    R+ Q
Sbjct  136   NPVLAFTIPQLLPKLTGSNLPVILIDGVNDSNSNLKIVGDLQKMIQRKPSESRLKERVTQ  195

Query  1321  QDTAAVLFSSGTTGGCKAVALTHANFIAMVELFV-RFEASQYEYPATANVYLDVLPMYHV  1145
              D A +L+SSGTTG  K V  +H N IAMV+  V RF   +         ++  +PM+H+
Sbjct  196   NDVATLLYSSGTTGASKGVISSHKNLIAMVQTIVGRFNLDE-----GVRTFICTVPMFHI  250

Query  1144  YGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAK--ADK  971
             YGL+ F  GLL+ GSTVVV+ K+E+DE++ +I +Y  T  P+ PP+LVAL   A     K
Sbjct  251   YGLAAFAAGLLASGSTVVVLSKFEMDEMLSSIHKYKATSLPLVPPILVALVNNADLIKKK  310

Query  970   CGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTS  791
               L SL  V SG AP+S   I+ FV  +P +  +QGYG+TEST +G    +  + R Y +
Sbjct  311   YDLSSLVSVLSGGAPLSKEVIEGFVEKYPSVRILQGYGLTESTGIGASTDSLEESRRYGT  370

Query  790   VGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWL  611
              G+L+P+ME ++VD      G +LP    GELWLRGP IMKGY +N EA+ + +D DGWL
Sbjct  371   AGMLSPSMEGKIVD---PESGKALPVNKTGELWLRGPTIMKGYFSNEEATASTLDSDGWL  427

Query  610   HTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVG  431
              TGD+ + DEDG+++V DRLKE+IKYKG+Q+ PA+LEA+L++HP+I DAAV     + VG
Sbjct  428   RTGDLCYIDEDGFIFVVDRLKELIKYKGYQVPPAELEALLLTHPEISDAAVIPFPDKMVG  487

Query  430   EIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRN  251
             + P+A+VV+K GS +S S   V+DF+AKQVAPYK++RRV F  SIPK+ SGKILRK+L  
Sbjct  488   QFPMAYVVRKTGSTISASA--VMDFIAKQVAPYKRIRRVAFVASIPKNPSGKILRKDLIK  545

Query  250   LLITSKI  230
              L TSK+
Sbjct  546   -LATSKL  551



>ref|XP_011021221.1| PREDICTED: 4-coumarate--CoA ligase-like 7 isoform X2 [Populus 
euphratica]
Length=543

 Score =   403 bits (1036),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 230/537 (43%), Positives = 339/537 (63%), Gaps = 25/537 (5%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFIL--SRNHGGLSALVDSQSGFSISYPELRSLVNSMAA  1652
             GIYRS  P++ LP D  L +VSF+   S ++   SAL+D+    ++S+ EL+S+V   A 
Sbjct  10    GIYRSLRPTLVLPKDSNLSLVSFLFRNSNSYPHKSALIDADLSITLSFSELKSIVIKFAH  69

Query  1651  GLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRL  1472
             GL  +G+S+ D  LI  PNS  FP+ FL + S+GAVA T+NPL T SE+ KQ  D N +L
Sbjct  70    GLLNLGISKNDAVLIFAPNSYQFPICFLAITSIGAVATTVNPLYTTSELSKQIKDSNPKL  129

Query  1471  AFATP---DRVQ--NLGST-LGIPVIGLPESLNLDSPFR------KLISSDPKLAPTPRI  1328
                 P   D+V+  NL +  LG   + LP  L  DS  R      +L  S+ +  P   +
Sbjct  130   VITVPELWDKVKGFNLPAVFLGPKEVSLP--LESDSRIRSFHSLVELGGSNSEF-PVSDV  186

Query  1327  RQQDTAAVLFSSGTTGGCKAVALTHANFIAMVELFVRFEASQYEYPATANVYLDVLPMYH  1148
             +Q D A +L+SSGTTG  K V LTH NFIA   L V  +  Q       NV+L  LPM+H
Sbjct  187   KQSDIATLLYSSGTTGVSKGVILTHGNFIA-ASLMVSMD--QVMAGEIHNVFLCFLPMFH  243

Query  1147  VYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKC  968
             V+GL++     L +G+ VV + K++ + V+R I++Y VTH  V PP+++AL+++    K 
Sbjct  244   VFGLAVITYSQLQMGNAVVSMGKFQFEMVLRTIEKYRVTHMWVVPPVILALSKQNLVKKY  303

Query  967   GLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSV  788
              L SL+ + SGAAP+    ++   +  P    IQG+GMTE+  + +       +R+  S 
Sbjct  304   DLSSLRNIGSGAAPLGKDLMKECAKNLPDTTIIQGFGMTETCGIVSLEDPRIGVRHSGSA  363

Query  787   GLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLH  608
             G+L   +EA++V + +      LPP  +GE+W+RGP +M+GY NN +A+K+ +D  GWLH
Sbjct  364   GILNAGIEAQIVSVETLKP---LPPNQLGEIWVRGPNMMRGYFNNPQATKDTIDKRGWLH  420

Query  607   TGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGE  428
             TGD+ +FD+DG L+V DR+KE+IKYKGFQ+APA+LE +L+SHP+I+DA VT     E G 
Sbjct  421   TGDLGYFDDDGQLFVVDRIKELIKYKGFQVAPAELEGLLVSHPEILDAVVTPYPDAEAGA  480

Query  427   IPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
             +PVA+VV+   S  +L++ +V  F++ Q+AP+K++R+V F  S+PKSASGKILR+EL
Sbjct  481   VPVAYVVRSPNS--ALTEEDVQKFISDQLAPFKRLRKVTFISSVPKSASGKILRREL  535



>ref|XP_009335967.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Pyrus x bretschneideri]
Length=545

 Score =   403 bits (1035),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 225/540 (42%), Positives = 334/540 (62%), Gaps = 29/540 (5%)
 Frame = -2

Query  1825  GIYRSKHPSVHLPSDPFLDVVSFILSRNHGGLS---ALVDSQSGFSISYPELRSLVNSMA  1655
             GI+RS  P + LP DP L + SF+  RN    S   AL++ +S  ++S+ + +S V  ++
Sbjct  10    GIFRSLRPPLVLPRDPNLSMASFLF-RNSSSYSHKPALIEGESSETLSFSQFKSKVIQVS  68

Query  1654  AGLHRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVR  1475
              GL  +G+ + DV LIL PNSI FP+ FLG+++ G +A T NPL T+SE+ KQ  D N +
Sbjct  69    HGLIHLGIKKNDVVLILAPNSIQFPICFLGIIASGGIATTSNPLYTVSELSKQVRDSNPK  128

Query  1474  LAFATP---DRVQNLG-STLGIPVIGLPESLNLDSP-----FRKLISSDPKLA--PTPRI  1328
             L    P   D+V+     T+ +   GL    ++ S      F  L+ S   ++  P+  I
Sbjct  129   LVITLPELWDKVKGFNLPTVFLVSKGLSGKSHVGSTSKILTFHDLVESARYVSDFPSVNI  188

Query  1327  RQQDTAAVLFSSGTTGGCKAVALTHANFIA---MVELFVRFEASQYEYPATANVYLDVLP  1157
             +Q DTAA+L+SSGTTG  K V LTH NFIA   M+ +        +      +V+L VLP
Sbjct  189   KQTDTAALLYSSGTTGDSKGVVLTHKNFIASSLMITMDQELAGEMH------HVFLCVLP  242

Query  1156  MYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKA  977
             M+HV+GL++     L  G+ VV + ++++++ + AI++Y VTHF V PP+++AL + +  
Sbjct  243   MFHVFGLAIITCAQLQKGNAVVSMARFDLEKTLMAIEKYKVTHFWVVPPIVLALAKNSMV  302

Query  976   DKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNY  797
              K  L SLK + SGAAP+    ++   + FP     QGYGMTES    +     A  ++ 
Sbjct  303   KKFNLSSLKHICSGAAPLGKELMEECAKKFPQGVVAQGYGMTESCGTISVDCTLAGTQHT  362

Query  796   TSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDG  617
              S G+L   +E ++V + +       PP  +GE+W+RGP++M GY NN EA+   +D +G
Sbjct  363   GSTGMLVSGVECQIVSVDTQKPQ---PPKQLGEIWVRGPSMMAGYFNNPEATNETIDKNG  419

Query  616   WLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEE  437
             W+HTGDI + DE+G LYV DR+KE+IKYKGFQ+APA+LE +L+SHP+I+D+ V      E
Sbjct  420   WVHTGDIGYIDENGLLYVVDRIKELIKYKGFQVAPAELEGLLVSHPEILDSVVIPLPDAE  479

Query  436   VGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKEL  257
              GE+PVA+ V+   S  SL++ +V  F+A QVA +K++RRV F KS+PKSASGKILR+EL
Sbjct  480   AGEVPVAYCVRTPNS--SLTEEDVKSFIANQVASFKRLRRVTFIKSVPKSASGKILRREL  537



>ref|XP_002985111.1| hypothetical protein SELMODRAFT_157069 [Selaginella moellendorffii]
 gb|EFJ13986.1| hypothetical protein SELMODRAFT_157069 [Selaginella moellendorffii]
Length=523

 Score =   402 bits (1032),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 226/525 (43%), Positives = 335/525 (64%), Gaps = 19/525 (4%)
 Frame = -2

Query  1792  LPSDPFLDVVSFILS--RNHGGLSALVDSQSGFSISYPELRSLVNSMAAGLHRMGVSQGD  1619
             +P DP +DV +F++S   N     AL+D+++G +I+Y +L+  + S+  GL  +GV QGD
Sbjct  1     MPEDPCMDVTTFVMSGKDNLADKPALIDAKTGHTITYSQLQHAICSVELGLVSIGVRQGD  60

Query  1618  VALILLPNSIYFPVIFLGLLSVGAVAATMNPLSTLSEIKKQSFDCNVRLAFATPDRVQNL  1439
             V +++  NS+++PV FL   SVG V AT+NPL++ +E KKQ+     R      + V  +
Sbjct  61    VVMLVSRNSVHYPVAFLATTSVGGVLATLNPLTSAAEAKKQAEAAGARFVIVEEEFVDKV  120

Query  1438  GSTLGIPVIGLPESLNL-----DSPFRKLISSDPKL--APTPRIRQQDTAAVLFSSGTTG  1280
              + LG+P++ + +   +     +  F  L++SDP    AP  +I Q D A VL+S+GTTG
Sbjct  121   -AELGVPLVIIEKGDKIKVGSTEVAFSDLLASDPSCSSAPETKISQDDPALVLYSAGTTG  179

Query  1279  GCKAVALTHANFIAM-VELFVRFEASQYEYPATANVYLDVLPMYHVYGLSLFVMGLLSLG  1103
               K V L+H N IA  + + + F+ + Y+ P    VYL V+PM+HV+GL +     LS G
Sbjct  180   PSKGVVLSHKNIIAHSLSVSIFFQVTPYKKPG--EVYLCVIPMFHVFGLVIVTYTQLSRG  237

Query  1102  STvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVALTRKAKADKCGLKSLKQVSSGAAPI  923
               +VV+  ++ + ++ AI R+ +TH P+ PP+++AL +        L SL+++ SGAAP+
Sbjct  238   VPIVVMPSFDFEAMLGAIQRFKITHVPLVPPIVIALGKSPAVKAFDLSSLREIGSGAAPL  297

Query  922   SITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNTAKLRNYTSVGLLAPNMEARVVDLs  743
                 I   +  FP +   QGYG+TESTA+ +   +   L +Y S GLL+ N  A+V+D+ 
Sbjct  298   GREVINACLERFPDVKVRQGYGLTESTAIASVA-DPDDLEHYGSAGLLSSNTLAKVIDVG  356

Query  742   sggggsSLPPTSMGELWLRGPAIMKGYLNNGEASKNAVDDDGWLHTGDIVHFDEDGYLYV  563
             SG     LPP   GE+W+ GP IM GYLNN +A+   VD +GWLHTGD+ +FD+ G LYV
Sbjct  357   SGRP---LPPNQQGEIWIHGPTIMDGYLNNPKATAETVDAEGWLHTGDLGYFDDSGNLYV  413

Query  562   HDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAAVTSAQSEEVGEIPVAFVVKKKGSEVS  383
              DR+KE+IKYKGFQ+APA+LEA+L+SH  +VDAAV     EE G++P+A +V+K+G   S
Sbjct  414   VDRIKELIKYKGFQVAPAELEALLLSHSQVVDAAVIPFPDEEAGQVPLAVIVRKQGC--S  471

Query  382   LSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSASGKILRKELRNL  248
             L    V+ FV+ QVAPYKKVR+V F  +IPKSASGKILR+EL  +
Sbjct  472   LDGQGVMKFVSDQVAPYKKVRKVMFIDAIPKSASGKILRRELVQM  516



>ref|XP_006590186.1| PREDICTED: 4-coumarate--CoA ligase-like 5-like [Glycine max]
Length=570

 Score =   403 bits (1035),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 245/548 (45%), Positives = 342/548 (62%), Gaps = 36/548 (7%)
 Frame = -2

Query  1840  YSSETGIYRS------KHPSVHLPSDPFLDVVSFILSR-NHGGLS----ALVDSQSGFSI  1694
             Y S TGIY S      KH    +P+ P L   +F+LS+     L+    A +DS +  S+
Sbjct  27    YDSRTGIYHSLVKLGTKH---EIPTKPDLGTANFVLSQFPQAHLAEARIAFIDSGTNRSV  83

Query  1693  SYPELRSLVNSMAAGL-HRMGVSQGDVALILLPNSIYFPVIFLGLLSVGAVAATMNPLST  1517
             SY ELR  + S+A+ L +R+ V +GDV  +L PNS  +  I L +LSVGAV  T NP++T
Sbjct  84    SYGELRRSIYSLASALFNRLKVRKGDVVFVLSPNSTLYSTICLAVLSVGAVVTTANPINT  143

Query  1516  LSEIKKQSFDCNVRLAFATPDRVQNLGSTLGIPVI--GLPESLNLDSPFRKLISS---DP  1352
              SEI KQ  D   +LA +T + +  L  T GIP I    P   N+ S   +LI      P
Sbjct  144   ESEIAKQVHDSGAKLAISTLEDLHKLVPT-GIPTILTSRPFDGNMLS-IEELIEDCYGSP  201

Query  1351  KLAPTPRIRQQDTAAVLFSSGTTGGCKAVALTHANFIAMVEL-FVRFEASQYEYPATANV  1175
             +L   P + Q DTAA+L+SSGTTG  K V LTHAN I+++ L F + + S     +  +V
Sbjct  202   QLPQVP-VAQSDTAAILYSSGTTGRSKGVLLTHANIISIMRLLFWQVDVSG----SQDDV  256

Query  1174  YLDVLPMYHVYGLSLFVMGLLSLGSTvvvvrkyevdevvRAIDRYGVTHFPVAPPLLVAL  995
             +   +PM+H+YG+  F +GLL +G T V+++KY+   ++ AI +Y V + P  PP+++AL
Sbjct  257   FFAFIPMFHIYGMIFFGLGLLCIGITTVLMQKYDFQAMLVAIQKYKVNNLPAVPPVILAL  316

Query  994   TRKAKADKCGLKSLKQVSSGAAPISITCIQNFVRTFPHIDFIQGYGMTESTAVGTRGFNT  815
              + +   KC L SLK+V SGAAP+S    Q F R FP ++  QGYG+TES+  G   F +
Sbjct  317   VKHSSKVKCDLSSLKRVGSGAAPLSKEVAQEFRRMFPSVELRQGYGLTESSG-GAAFFAS  375

Query  814   AK--LRNYTSVGLLAPNMEARVVDLssggggsSLPPTSMGELWLRGPAIMKGYLNNGEAS  641
              K    +  S G L P   A+V+D+ +G     LPP   GELW + P IMK YL N E +
Sbjct  376   DKDAKAHPDSCGKLIPTFCAKVIDIETGKP---LPPRKEGELWFKSPTIMKEYLGNMEET  432

Query  640   KNAVDDDGWLHTGDIVHFDEDGYLYVHDRLKEMIKYKGFQIAPADLEAVLMSHPDIVDAA  461
                +D +GWL TGD+ + DE+G++Y+ +R+KE+IK+ G+Q+APA+LE+VL+SHP IVDAA
Sbjct  433   SATIDSEGWLRTGDLGYIDENGFVYIVERIKELIKHNGYQVAPAELESVLLSHPLIVDAA  492

Query  460   VTSAQSEEVGEIPVAFVVKKKGSEVSLSQANVIDFVAKQVAPYKKVRRVYFTKSIPKSAS  281
             V   + EE G+IP+A+VV   GSE  LS+  VI FVA +VAPYKKVRRV F  +IPKSA+
Sbjct  493   VIPVEDEETGQIPMAYVVIAAGSE--LSEDQVIQFVAGEVAPYKKVRRVSFIDTIPKSAA  550

Query  280   GKILRKEL  257
             GKILRK+L
Sbjct  551   GKILRKDL  558



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5998204766208