BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19001_g2_i1 len=1175 path=[1:0-246 3553:247-252 254:253-253
255:254-1174]

Length=1175
                                                                      Score     E

ref|XP_002511399.1|  1-deoxy-D-xylulose 5-phosphate reductoisomer...    555   0.0      Ricinus communis
ref|XP_008374435.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    550   0.0      
ref|XP_009363023.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    549   0.0      
ref|XP_002318048.2|  1-deoxy-D-xylulose 5-phosphate reductoisomer...    548   0.0      Populus trichocarpa [western balsam poplar]
gb|AIR72281.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         547   0.0      
gb|AFP43697.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         546   0.0      
gb|ABC74566.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         546   0.0      Picrorhiza kurrooa
gb|ADN39416.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         545   0.0      
ref|XP_008393034.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    545   0.0      
ref|XP_006345056.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    545   0.0      
gb|ABO38177.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         544   0.0      Croton stellatopilosus
gb|ABH08964.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         544   0.0      Nicotiana tabacum [American tobacco]
ref|NP_001234553.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase    543   0.0      
gb|AFZ93643.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         542   0.0      
ref|XP_011001537.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    542   0.0      
ref|XP_004298943.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    542   0.0      
gb|AGO04400.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         541   0.0      
ref|XP_009627984.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    541   0.0      
gb|AHL17584.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         541   0.0      
gb|AFU93070.1|  chloroplast 1-deoxy-D-xylulose-5-phosphate reductase    541   0.0      
ref|XP_009774468.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    541   0.0      
ref|XP_010243034.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    541   0.0      
ref|XP_011071850.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    540   0.0      
gb|AFR79418.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         540   0.0      
ref|XP_010027708.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    540   0.0      
gb|AFO64619.1|  1-deoxy-d-xylulose 5-phosphate reductoisomerase         540   0.0      
gb|AHW46302.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         539   0.0      
gb|AGQ04155.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         540   0.0      
ref|XP_009363022.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    539   0.0      
gb|AEZ55867.1|  chloroplast 1-deoxy-D-xylulose 5-phosphate reduct...    538   0.0      
ref|XP_002321599.1|  1-deoxy-D-xylulose 5-phosphate reductoisomer...    539   0.0      Populus trichocarpa [western balsam poplar]
emb|CDP12403.1|  unnamed protein product                                538   0.0      
gb|ACK57535.1|  1-deoxy-d-xylulose 5-phosphate reductoisomerase         538   0.0      Salvia miltiorrhiza [Chinese salvia]
gb|AEZ53171.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         537   0.0      
gb|AIA82922.1|  DXR                                                     537   0.0      
ref|XP_002282761.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    537   0.0      Vitis vinifera
gb|AFI98879.1|  chloroplast 1-deoxy-D-xylulose-5-phosphate reductase    537   0.0      
gb|AAY87151.2|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         537   0.0      Rauvolfia verticillata
ref|XP_002866510.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase    536   0.0      
gb|ABD92702.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         536   0.0      Hevea brasiliensis [jebe]
gb|AFU93071.1|  chloroplast 1-deoxy-D-xylulose-5-phosphate reductase    536   0.0      
gb|AHX36947.1|  putative 1-deoxy-d-xylulose 5-phosphate reductois...    535   0.0      
gb|ACR57217.1|  1-deoxy-d-xylulose 5-phosphate reductoisomerase         535   0.0      Salvia miltiorrhiza [Chinese salvia]
gb|AGO04398.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         535   0.0      
gb|KFK28008.1|  hypothetical protein AALP_AA8G459700                    535   0.0      
ref|XP_011028721.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    536   0.0      
dbj|BAF98290.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase        533   0.0      Hevea brasiliensis [jebe]
gb|AID55340.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         533   0.0      
emb|CAE00491.2|  1-deoxy-D-xylulose-5-phosphate reductoisomerase        532   0.0      Populus tremula x Populus alba [gray poplar]
ref|XP_010546027.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    532   0.0      
gb|KHN34312.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase, ...    532   0.0      
ref|XP_008239764.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    531   0.0      
gb|ABJ80680.1|  1-deoxy-d-xylulose 5-phosphate reductoisomerase         531   0.0      Salvia miltiorrhiza [Chinese salvia]
ref|NP_001240062.1|  1-deoxy-D-xylulose 5-phosphate reductoisomer...    531   0.0      
ref|XP_006439815.1|  hypothetical protein CICLE_v10020004mg             527   0.0      
ref|XP_007036224.1|  1-deoxy-D-xylulose 5-phosphate reductoisomer...    532   0.0      
ref|XP_007036223.1|  1-deoxy-D-xylulose 5-phosphate reductoisomer...    531   0.0      
ref|XP_007210092.1|  hypothetical protein PRUPE_ppa020981mg             530   0.0      
gb|AAF65154.1|AF250235_1  1-deoxy-D-xylulose-5-phosphate reductoi...    531   0.0      Catharanthus roseus [chatas]
gb|AAR99081.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         530   0.0      Plectranthus barbatus
ref|XP_010678763.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    530   0.0      
gb|KDO69664.1|  hypothetical protein CISIN_1g012004mg                   525   0.0      
ref|NP_201085.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase       529   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KDO69663.1|  hypothetical protein CISIN_1g012004mg                   527   0.0      
gb|KHG00451.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase, ...    528   0.0      
gb|AIG92785.1|  1-deoxy-d-xylulose 5-phosphate synthase                 528   0.0      
ref|XP_006394351.1|  hypothetical protein EUTSA_v10004122mg             528   0.0      
ref|XP_006439818.1|  hypothetical protein CICLE_v10020004mg             528   0.0      
gb|AAS94121.1|  putative 1-deoxy-D-xylulose 5-phosphate reductois...    528   0.0      Hevea brasiliensis [jebe]
gb|EYU42570.1|  hypothetical protein MIMGU_mgv1a004650mg                528   0.0      
gb|ACL54288.1|  unknown                                                 524   0.0      Zea mays [maize]
ref|XP_010101212.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    527   0.0      
ref|XP_010459323.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    527   0.0      
gb|ADD82536.1|  1-deoxyxylulose-5-phosphate reductoisomerase            526   0.0      Narcissus tazetta var. chinensis
tpg|DAA53826.1|  TPA: hypothetical protein ZEAMMB73_662532              525   0.0      
tpg|DAA53825.1|  TPA: 1-deoxy-D-xylulose 5-phosphate reductoisome...    526   0.0      
ref|NP_001105139.1|  dxr protein                                        526   0.0      Zea mays [maize]
gb|EYU42569.1|  hypothetical protein MIMGU_mgv1a004650mg                528   0.0      
ref|XP_007155428.1|  hypothetical protein PHAVU_003G200300g             526   0.0      
ref|XP_006476776.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    525   0.0      
sp|Q9XES0.2|DXR_MENPI  RecName: Full=1-deoxy-D-xylulose 5-phospha...    525   0.0      Mentha x piperita
ref|XP_010483992.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    525   0.0      
gb|AES91160.2|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         525   0.0      
ref|XP_004967950.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    525   0.0      
ref|XP_006844992.1|  hypothetical protein AMTR_s00058p00194850          525   0.0      
ref|XP_010910760.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    521   0.0      
gb|AAW28998.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         524   0.0      Antirrhinum majus [garden snapdragon]
gb|ABC86579.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         524   0.0      Camptotheca acuminata
gb|EAY72208.1|  hypothetical protein OsI_00059                          524   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_010940050.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    524   0.0      
gb|AHZ96598.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         524   0.0      
gb|ABN13969.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         524   0.0      Gossypium barbadense [Egyptian cotton]
gb|AHJ57307.1|  chloroplast 1-deoxy-D-xylulose-5-phosphate reduct...    524   0.0      
ref|XP_009112033.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    524   0.0      
ref|NP_001041780.1|  Os01g0106900                                       523   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AAD56391.2|AF182287_1  1-deoxy-D-xylulose-5-phosphate reductoi...    523   0.0      Artemisia annua [sweet Annie]
gb|ACS26204.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         523   1e-180   Amomum villosum [sha ren]
gb|AEK69520.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         523   1e-180   
ref|XP_006280395.1|  hypothetical protein CARUB_v10026322mg             522   3e-180   
ref|XP_010444132.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    522   3e-180   
ref|XP_003569639.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    522   4e-180   
emb|CAD22156.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase        521   5e-180   Stevia rebaudiana
ref|XP_004138108.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    521   6e-180   
gb|ACD70397.1|  putative chloroplast 1-deoxy-D-xylulose 5-phospha...    519   7e-180   Populus trichocarpa [western balsam poplar]
emb|CAE47438.1|  putative 1-deoxy-D-xylulose 5-phosphate reductoi...    521   8e-180   Hordeum vulgare [barley]
emb|CDY00327.1|  BnaA06g22280D                                          521   9e-180   
dbj|BAE79548.1|  1-deoxyxylulose 5-phosphate reductoisomerase           521   1e-179   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AFK42788.1|  unknown                                                 520   1e-179   
gb|AAL37560.1|AF367205_1  1-deoxy-D-xylulose 5-phosphate reductoi...    520   1e-179   Oryza sativa Japonica Group [Japonica rice]
gb|EMT13515.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase, ...    520   2e-179   
emb|CDY56743.1|  BnaC09g50930D                                          520   3e-179   
ref|XP_006643650.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    520   3e-179   
ref|XP_003549624.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    519   4e-179   
gb|AER00470.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         519   5e-179   
ref|XP_008655547.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    519   7e-179   
ref|XP_009151404.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    519   8e-179   
ref|XP_008464564.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    518   1e-178   
gb|KHG02709.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase, ...    518   1e-178   
emb|CAF22092.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase        518   2e-178   Linum usitatissimum
ref|XP_008787962.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    517   2e-178   
emb|CDX84354.1|  BnaC03g51460D                                          517   5e-178   
ref|NP_001190600.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    516   1e-177   
gb|AID51429.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         513   2e-177   
ref|XP_011101328.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    514   6e-177   
ref|XP_009390196.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    513   8e-177   
gb|AGT29340.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         513   9e-177   
ref|XP_008782463.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    512   2e-176   
gb|EYU42568.1|  hypothetical protein MIMGU_mgv1a005810mg                512   3e-176   
emb|CAB43344.1|  1-deoxy-d-xylulose-5-phosphate reductoisomerase        508   9e-176   Arabidopsis thaliana [mouse-ear cress]
gb|ACN40563.1|  unknown                                                 511   1e-175   Picea sitchensis
gb|EPS70216.1|  hypothetical protein M569_04544                         505   2e-175   
gb|EMT26408.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase, ...    510   2e-175   
ref|XP_004967949.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    511   2e-175   
ref|XP_009393605.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    509   3e-175   
ref|XP_004510245.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    509   5e-175   
gb|AAT47184.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         508   7e-175   Taxus cuspidata [ichii]
gb|AAR95700.1|  putative 1-deoxy-D-xylulose 5-phosphate reductois...    506   4e-174   Ginkgo biloba [ginkgo]
gb|ACJ67022.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         506   5e-174   Pinus taeda
gb|ABX57721.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         506   8e-174   Vanda hybrid cultivar
emb|CDY16759.1|  BnaA09g06230D                                          506   2e-173   
gb|AAU87836.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         504   5e-173   Taxus x media [hybrid yew]
gb|KEH18121.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         499   2e-172   
gb|AAQ84168.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         501   5e-172   Pueraria montana var. lobata [kudzu]
gb|EMS62178.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase, ...    501   6e-172   
gb|KEH18120.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         500   1e-171   
gb|AAP56260.3|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         500   2e-171   Cistus creticus
gb|ACC54558.1|  putative 1-D-deoxyxylulose 5-phosphate reductoiso...    499   3e-171   Pinus densiflora [Japanese red pine]
ref|XP_003547784.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    498   5e-171   
ref|XP_010444134.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    498   1e-170   
ref|XP_006439820.1|  hypothetical protein CICLE_v10019836mg             498   2e-170   
ref|XP_007134144.1|  hypothetical protein PHAVU_010G023000g             495   9e-170   
gb|KHN20432.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase, ...    493   2e-169   
gb|AEB91529.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         493   4e-169   
ref|XP_006376853.1|  hypothetical protein POPTR_0012s08230g             491   6e-169   
gb|AFK42658.1|  unknown                                                 492   1e-168   
ref|XP_006477542.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    492   4e-168   
ref|XP_010483991.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    491   4e-168   
ref|XP_003608963.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    490   8e-168   
ref|XP_002991775.1|  hypothetical protein SELMODRAFT_229643             489   4e-167   
ref|XP_002989706.1|  hypothetical protein SELMODRAFT_229487             489   4e-167   
gb|AHJ38612.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         483   1e-164   
ref|XP_001765145.1|  predicted protein                                  478   9e-164   
ref|XP_001763690.1|  predicted protein                                  476   4e-163   
ref|XP_010459335.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    478   1e-162   
gb|AFK73395.1|  2-C-methyl-D-erythritol 4-phosphate synthase            469   2e-159   
ref|XP_006439816.1|  hypothetical protein CICLE_v10020004mg             462   2e-158   
gb|KDO69665.1|  hypothetical protein CISIN_1g012004mg                   459   3e-157   
gb|AFW79783.1|  hypothetical protein ZEAMMB73_057914                    455   1e-153   
gb|ACJ84756.1|  unknown                                                 440   3e-150   Medicago truncatula
gb|AFB70979.1|  1-deoxy-D-xylylose 5-phosphate reductoisomerase         436   2e-149   
ref|XP_005648272.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    441   2e-148   
dbj|BAM73270.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase        433   9e-148   
gb|EMS64636.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase, ...    434   7e-146   
gb|AAS99589.1|  chloroplast 1-deoxy-D-xylulose-5-phosphate reduct...    426   1e-145   Elaeis guineensis
ref|XP_002953640.1|  hypothetical protein VOLCADRAFT_82431              429   6e-144   
gb|AEY80027.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         423   1e-141   
ref|XP_010459153.1|  PREDICTED: 1-deoxy-D-xylulose 5-phosphate re...    418   9e-140   
ref|XP_005850817.1|  hypothetical protein CHLNCDRAFT_29723              415   2e-138   
ref|WP_007354673.1|  MULTISPECIES: 1-deoxy-D-xylulose 5-phosphate...    411   7e-138   
ref|WP_023075619.1|  1-deoxy-d-xylulose 5-phosphate reductoisomerase    410   2e-137   
ref|WP_006517324.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    409   4e-137   
gb|ACT21081.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         411   4e-137   
ref|WP_009456040.1|  MULTISPECIES: 1-deoxy-D-xylulose 5-phosphate...    408   1e-136   
ref|WP_007310195.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    408   1e-136   
ref|WP_015214585.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    407   3e-136   
ref|WP_008319237.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    407   3e-136   
ref|WP_027840920.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    407   5e-136   
ref|WP_016865179.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    407   5e-136   
ref|WP_015185775.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    407   6e-136   
ref|WP_006511828.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    406   7e-136   
ref|WP_017311607.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    406   1e-135   
ref|WP_015203328.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    405   2e-135   
ref|WP_026719879.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    405   2e-135   
ref|WP_012161212.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    405   2e-135   
gb|ACU24603.1|  unknown                                                 401   3e-135   Glycine max [soybeans]
ref|WP_009546877.1|  MULTISPECIES: 1-deoxy-D-xylulose 5-phosphate...    405   3e-135   
ref|WP_017652891.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    405   3e-135   
ref|WP_017299578.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    404   4e-135   
ref|WP_007304873.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    404   4e-135   
ref|WP_010481168.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    404   4e-135   
ref|WP_039204531.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    404   6e-135   
ref|WP_016950625.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    404   7e-135   
ref|WP_028091655.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    404   8e-135   
ref|WP_015171312.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    404   9e-135   
ref|WP_028085119.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    403   1e-134   
ref|WP_009787067.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    403   1e-134   
ref|WP_015111122.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    403   1e-134   
ref|WP_021835260.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    403   1e-134   
ref|WP_016860920.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    403   1e-134   
ref|WP_015078139.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    403   2e-134   
ref|WP_009633806.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    402   2e-134   
ref|WP_015210302.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    402   2e-134   
ref|WP_027402501.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    402   2e-134   
ref|WP_011610275.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    407   3e-134   
ref|WP_023067885.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    402   3e-134   
ref|WP_039726023.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    402   3e-134   
gb|ABG49879.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         407   3e-134   Trichodesmium erythraeum IMS101
ref|WP_013190135.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    402   4e-134   
ref|WP_017315308.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    402   4e-134   
ref|WP_012412204.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    402   5e-134   
ref|WP_006617252.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    401   6e-134   
ref|WP_008273954.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    401   8e-134   
ref|WP_019501430.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    400   8e-134   
ref|WP_014276615.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    400   1e-133   
ref|WP_015223384.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    400   1e-133   
ref|WP_015133881.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    400   2e-133   
ref|WP_015160708.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    400   2e-133   
ref|WP_022607671.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    400   2e-133   
ref|WP_015142023.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    399   3e-133   
ref|WP_026731568.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    399   3e-133   
ref|WP_006196388.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    400   3e-133   
gb|AHJ27390.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         400   4e-133   
ref|WP_017303762.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    399   4e-133   
ref|WP_015147522.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    400   6e-133   
ref|WP_008180769.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    399   6e-133   
ref|WP_015129138.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    399   6e-133   
ref|WP_030007587.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    399   7e-133   
ref|WP_017320504.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    399   7e-133   
ref|WP_017719772.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    399   1e-132   
ref|WP_035986731.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    398   1e-132   
ref|WP_016872446.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    398   2e-132   
ref|WP_008206915.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    397   2e-132   
ref|WP_024969036.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    397   2e-132   
ref|WP_002773162.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    397   2e-132   
ref|WP_026785741.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    397   2e-132   
ref|WP_027255459.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    397   2e-132   
ref|WP_016515763.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    397   2e-132   
ref|WP_002733165.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    397   2e-132   
dbj|GAL94569.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase        397   2e-132   
ref|WP_026795561.1|  MULTISPECIES: 1-deoxy-D-xylulose 5-phosphate...    397   2e-132   
ref|WP_002795870.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    397   3e-132   
ref|WP_002769631.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    397   3e-132   
ref|WP_002748600.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    397   3e-132   
ref|WP_002763350.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    397   3e-132   
ref|WP_002800013.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    397   3e-132   
ref|WP_002784854.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    396   4e-132   
ref|WP_024544887.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    396   4e-132   
ref|XP_006376854.1|  hypothetical protein POPTR_0012s08230g             393   5e-132   
ref|WP_035159223.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    396   5e-132   
ref|WP_002789762.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    396   6e-132   
ref|WP_012306446.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    396   7e-132   
ref|WP_009343408.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    396   7e-132   
ref|WP_039742457.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    396   7e-132   
ref|WP_015117230.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    396   7e-132   
ref|WP_012595966.1|  MULTISPECIES: 1-deoxy-D-xylulose 5-phosphate...    395   1e-131   
ref|WP_006456097.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    395   1e-131   
gb|ACI45953.1|  putative plastid 1-deoxy-D-xylulose 5-phosphate r...    397   1e-131   Mantoniella squamata
ref|WP_013324581.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    395   2e-131   
ref|WP_019505515.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    395   2e-131   
ref|WP_039713739.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    395   2e-131   
ref|WP_002792702.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    395   2e-131   
ref|WP_018398392.1|  hypothetical protein                               401   2e-131   
ref|WP_002755544.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    394   3e-131   
ref|WP_006105793.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    394   3e-131   
ref|WP_015188173.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    394   3e-131   
ref|WP_006275979.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    394   3e-131   
ref|WP_006624138.1|  MULTISPECIES: 1-deoxy-D-xylulose 5-phosphate...    394   4e-131   
ref|WP_011318136.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    394   5e-131   
gb|KEI68499.1|  Dxr                                                     394   6e-131   
ref|WP_010998488.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    393   1e-130   
ref|WP_012629365.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    392   1e-130   
ref|WP_017289582.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    392   1e-130   
ref|WP_011056883.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    393   2e-130   
ref|WP_024124169.1|  1-deoxy-D-xylulose 5-phosphate reductoisomer...    392   2e-130   
ref|WP_006530416.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    391   4e-130   
ref|WP_026134957.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    391   6e-130   
ref|WP_006632174.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    391   6e-130   
dbj|BAP17688.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase        391   7e-130   
ref|WP_015140390.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    391   8e-130   
gb|KIE08131.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         390   1e-129   
ref|WP_036482521.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    388   7e-129   
ref|WP_017745044.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    388   1e-128   
ref|WP_009628655.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    387   1e-128   
ref|WP_012597707.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    387   2e-128   
ref|WP_015174025.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    387   3e-128   
ref|WP_026723858.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    387   3e-128   
ref|WP_015156637.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    386   5e-128   
ref|WP_037222816.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    385   9e-128   
gb|AIH14761.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         385   1e-127   
ref|WP_029633928.1|  1-deoxy-D-xylulose 5-phosphate reductoisomer...    385   1e-127   
ref|XP_001417285.1|  1-deoxy-D-xylulose 5-phosphate reductoisomer...    388   1e-127   
ref|XP_003059636.1|  predicted protein                                  387   1e-127   
ref|WP_015196479.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    385   2e-127   
gb|AIH14807.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         385   2e-127   
ref|WP_035999313.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    385   2e-127   
ref|WP_015192479.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    384   2e-127   
ref|WP_010873411.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    384   3e-127   
ref|WP_015229928.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    384   4e-127   
ref|WP_017710846.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    384   4e-127   
ref|WP_015218614.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    384   5e-127   
ref|WP_015226600.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    383   6e-127   
ref|WP_009555229.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    383   1e-126   
gb|ACJ85147.1|  unknown                                                 380   2e-126   
ref|WP_036535202.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    382   3e-126   
ref|WP_015169365.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    381   3e-126   
ref|WP_015165824.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    380   9e-126   
ref|WP_011244808.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    380   2e-125   
ref|WP_017308622.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    378   1e-124   
ref|WP_015125241.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    377   2e-124   
ref|WP_017294474.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    375   1e-123   
gb|AIE73112.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         375   2e-123   
emb|CEF97637.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase,...    377   2e-123   
ref|WP_008230017.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    372   5e-122   
ref|WP_008234517.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    370   1e-121   
ref|WP_011429108.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    369   2e-121   
emb|CBJ29720.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase,...    370   4e-121   
ref|WP_019493713.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    366   3e-120   
ref|WP_012953442.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    365   6e-120   
ref|WP_011376787.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    365   8e-120   
ref|WP_011432861.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    365   1e-119   
ref|WP_032518389.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    365   2e-119   
ref|WP_029983489.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    365   2e-119   
ref|WP_029977860.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    364   3e-119   
ref|WP_029979532.1|  MULTISPECIES: 1-deoxy-D-xylulose 5-phosphate...    364   3e-119   
ref|WP_025946170.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    363   9e-119   
ref|WP_029983558.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    362   2e-118   
ref|WP_029978759.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    362   2e-118   
ref|WP_032524829.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    362   2e-118   
gb|KFF41728.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         361   2e-118   
ref|WP_029948476.1|  MULTISPECIES: 1-deoxy-D-xylulose 5-phosphate...    362   2e-118   
ref|WP_029981476.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    362   2e-118   
ref|WP_029978974.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    362   3e-118   
ref|WP_029985912.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    362   3e-118   
ref|WP_029954091.1|  MULTISPECIES: 1-deoxy-D-xylulose 5-phosphate...    362   3e-118   
gb|KGF86566.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         362   3e-118   
ref|WP_029979131.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    362   3e-118   
ref|WP_029970824.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    361   4e-118   
ref|WP_032521575.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    361   4e-118   
gb|KGG02956.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         361   4e-118   
ref|WP_029981403.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    361   5e-118   
ref|WP_025956812.1|  MULTISPECIES: 1-deoxy-D-xylulose 5-phosphate...    361   5e-118   
ref|WP_025925417.1|  MULTISPECIES: 1-deoxy-D-xylulose 5-phosphate...    361   5e-118   
ref|WP_025968732.1|  MULTISPECIES: 1-deoxy-D-xylulose 5-phosphate...    361   6e-118   
ref|WP_029973988.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    361   6e-118   
ref|WP_029958400.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    361   6e-118   
ref|WP_029956075.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    361   7e-118   
ref|WP_025969312.1|  MULTISPECIES: 1-deoxy-D-xylulose 5-phosphate...    360   7e-118   
ref|WP_029985279.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    360   7e-118   
ref|WP_029984859.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    360   8e-118   
ref|WP_025881816.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    357   8e-118   
ref|WP_029972386.1|  MULTISPECIES: 1-deoxy-D-xylulose 5-phosphate...    360   8e-118   
ref|WP_032516550.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    360   8e-118   
ref|WP_029975945.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    360   9e-118   
ref|WP_033829797.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    360   1e-117   
ref|WP_032520353.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    360   1e-117   
ref|WP_025914842.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    360   1e-117   
gb|ABE11004.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         360   1e-117   
ref|WP_011818742.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    359   2e-117   
gb|AHI58844.1|  WelD1                                                   359   2e-117   
ref|WP_025968171.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    359   2e-117   
ref|WP_029976826.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    359   2e-117   
ref|WP_032527081.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    359   3e-117   
ref|WP_029965903.1|  MULTISPECIES: 1-deoxy-D-xylulose 5-phosphate...    359   4e-117   
ref|WP_029977090.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    359   4e-117   
ref|WP_017326448.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    357   7e-117   
ref|WP_029981710.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    358   7e-117   
ref|WP_029973414.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    358   7e-117   
gb|KGF97268.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         358   7e-117   
ref|WP_032512893.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    358   7e-117   
ref|WP_029984646.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    358   9e-117   
ref|XP_007511716.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    359   1e-116   
gb|AIQ95387.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         357   1e-116   
gb|KGG00416.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         357   1e-116   
gb|EEE40436.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         357   2e-116   
gb|KGG09131.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         357   2e-116   
ref|WP_029960390.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    357   2e-116   
ref|WP_011863268.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    356   4e-116   
gb|ABV02018.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         349   4e-116   
ref|WP_012008020.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    356   4e-116   
gb|KGF96821.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         356   4e-116   
gb|KGF91879.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         355   1e-115   
ref|WP_011142249.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    354   1e-115   
gb|AIJ28557.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         354   1e-115   
ref|XP_005535940.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    357   2e-115   
gb|ABE10930.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         354   3e-115   
ref|XP_005824263.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    354   1e-114   
gb|AIJ28526.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         351   2e-114   
gb|ACI45960.1|  putative plastid 1-deoxy-D-xylulose 5-phosphate r...    352   4e-114   
ref|XP_005711686.1|  Putative plastid 1-deoxy-D-xylulose 5-phosph...    352   8e-114   
gb|ABI96275.1|  chloroplast 1-deoxy-D-xylulose 5-phosphate reduct...    349   3e-113   
ref|WP_023175255.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    348   5e-113   
gb|ABI96273.1|  chloroplast 1-deoxy-D-xylulose 5-phosphate reduct...    347   6e-112   
ref|WP_036896803.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    345   8e-112   
ref|XP_002504113.1|  predicted protein                                  343   2e-111   
ref|WP_036930563.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    344   3e-111   
ref|WP_038545947.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    343   4e-111   
ref|WP_011936091.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    343   5e-111   
ref|XP_005703142.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase    345   1e-110   
gb|ACN66492.1|  1-deoxyxylulose 5-phosphate reductoisomerase            334   2e-110   
ref|WP_011132775.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    340   4e-110   
ref|WP_028952563.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    341   4e-110   
ref|WP_011820612.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    340   6e-110   
ref|WP_026032293.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    337   7e-110   
ref|WP_037979835.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    340   1e-109   
ref|WP_011359499.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    340   1e-109   
gb|AHF64408.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         340   2e-109   
ref|WP_025782566.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    336   2e-109   
gb|EAQ75989.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         340   2e-109   
ref|WP_038005029.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    339   2e-109   
gb|EAR18106.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         339   3e-109   
ref|WP_010310413.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    339   3e-109   
ref|WP_019475768.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    338   5e-109   
ref|WP_011364920.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    338   8e-109   
ref|WP_012195768.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    337   1e-108   
ref|WP_006852215.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    337   2e-108   
ref|WP_011294839.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    336   4e-108   
ref|WP_015108783.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    336   4e-108   
ref|WP_035832237.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    335   7e-108   
gb|AII45825.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         335   1e-107   
ref|WP_011824160.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    334   1e-107   
ref|WP_036918064.1|  MULTISPECIES: 1-deoxy-D-xylulose 5-phosphate...    334   2e-107   
ref|WP_011933523.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    334   2e-107   
ref|WP_011618856.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    334   2e-107   
ref|WP_038553722.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    333   3e-107   
ref|WP_038024236.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    333   4e-107   
ref|WP_036904990.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    333   6e-107   
ref|WP_038653679.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    333   6e-107   
ref|WP_011127565.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    332   7e-107   
ref|WP_036914335.1|  MULTISPECIES: 1-deoxy-D-xylulose 5-phosphate...    333   7e-107   
ref|WP_011130532.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    332   1e-106   
gb|EAU74199.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         333   2e-106   
ref|WP_010315736.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    331   2e-106   
emb|CDP19463.1|  unnamed protein product                                327   3e-106   
ref|WP_011125388.1|  MULTISPECIES: 1-deoxy-D-xylulose 5-phosphate...    331   4e-106   
ref|WP_036902554.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    330   5e-106   
ref|WP_011825525.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    330   7e-106   
ref|WP_006909794.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    330   8e-106   
ref|YP_002048696.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    329   2e-105   
ref|WP_007100291.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    329   2e-105   
sp|Q7V6J8.1|DXR_PROMM  RecName: Full=1-deoxy-D-xylulose 5-phospha...    327   1e-104   
ref|XP_009037498.1|  hypothetical protein AURANDRAFT_2913               326   1e-104   
ref|WP_009790288.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    326   4e-104   
gb|KDO69661.1|  hypothetical protein CISIN_1g040690mg                   320   2e-103   
dbj|BAG14386.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase        326   1e-102   
gb|AAR20833.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         309   3e-101   
gb|ABI96271.1|  chloroplast 1-deoxy-D-xylulose 5-phosphate reduct...    320   4e-101   
ref|XP_001693958.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    318   4e-101   
gb|AII31130.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         309   6e-101   
gb|AII31131.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         308   8e-101   
gb|AFD50367.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         308   9e-101   
gb|AFD50364.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         306   5e-100   
gb|AFN16223.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         305   1e-99    
gb|AAW82148.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         306   2e-99    
ref|WP_027641585.1|  1-deoxy-D-xylulose 5-phosphate reductoisomer...    311   4e-99    
gb|AFN16242.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         303   4e-99    
gb|AII31134.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         303   1e-98    
gb|AFN16236.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         302   2e-98    
gb|AFN16228.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         302   2e-98    
gb|AII31135.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         302   2e-98    
ref|XP_002176954.1|  1-deoxy-d-xylulose-5-phosphate reductoisomerase    313   2e-98    
ref|WP_028829370.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    310   2e-98    
emb|CAJ85787.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase        305   2e-98    
ref|WP_021982814.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    309   3e-98    
ref|WP_018132525.1|  hypothetical protein                               309   3e-98    
ref|WP_007857984.1|  1-deoxy-D-xylulose 5-phosphate reductoisomer...    309   3e-98    
ref|XP_002295597.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    312   4e-98    
gb|AIB08914.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         301   9e-98    
gb|EJK49569.1|  hypothetical protein THAOC_31545                        309   5e-97    
gb|AII31136.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         298   6e-97    
gb|AHF07525.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         305   1e-96    
ref|WP_021167619.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    305   1e-96    
ref|WP_021893360.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    305   2e-96    
gb|ABI96272.1|  chloroplast 1-deoxy-D-xylulose 5-phosphate reduct...    307   2e-96    
ref|WP_028595543.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    304   3e-96    
ref|WP_038671291.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    304   4e-96    
gb|ENZ10928.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase [ [     304   4e-96    
ref|WP_038295233.1|  1-deoxy-D-xylulose 5-phosphate reductoisomer...    304   4e-96    
ref|WP_034558082.1|  MULTISPECIES: 1-deoxy-D-xylulose 5-phosphate...    304   4e-96    
gb|ENZ34637.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase [ [     304   4e-96    
ref|WP_002564422.1|  1-deoxy-D-xylulose 5-phosphate reductoisomer...    303   6e-96    
ref|WP_038281961.1|  1-deoxy-D-xylulose 5-phosphate reductoisomer...    303   6e-96    
ref|WP_033102351.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    303   7e-96    
ref|WP_027872148.1|  1-deoxy-D-xylulose 5-phosphate reductoisomer...    303   1e-95    
gb|AFN16239.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         294   1e-95    
gb|AFD50365.1|  1-deoxy-D-xylulose-5-phosphate reductoisomerase         294   2e-95    
ref|WP_021869542.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    302   2e-95    
gb|EST52525.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase         301   3e-95    
ref|WP_002583364.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    301   3e-95    
ref|WP_038259813.1|  1-deoxy-D-xylulose 5-phosphate reductoisomer...    301   4e-95    
ref|WP_015520460.1|  1-deoxy-D-xylulose 5-phosphate reductoisomerase    301   4e-95    



>ref|XP_002511399.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplast 
precursor, putative [Ricinus communis]
 gb|EEF52001.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplast 
precursor, putative [Ricinus communis]
Length=467

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/367 (80%), Positives = 323/367 (88%), Gaps = 9/367 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGMRVKCSSqaaaaqpq  922
             MALN +S AE K+ SF       S  +    KL G  +++RK+ G +V+CS+QA      
Sbjct  1     MALNLLSPAELKSVSFLD-----STRSSQLPKLPGSFSLKRKEFGRKVQCSAQAPPPAWP  55

Query  921   pawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLL  742
                 GRAVAE  RKTWDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSNVTLL
Sbjct  56    ----GRAVAEPGRKTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLL  111

Query  741   AHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIV  562
             A QVKTFKP+LVS+RDESLVDELKEAL+D+DEKPEIIPGE+G++EVARHPD V+VVTGIV
Sbjct  112   ADQVKTFKPQLVSVRDESLVDELKEALADVDEKPEIIPGEQGIVEVARHPDAVSVVTGIV  171

Query  561   GCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQG  382
             GCAGLKPTVAAIEAGKDI LANKETLIAGGPFVLPLAHK+NVKILPADSEHSAIFQCIQG
Sbjct  172   GCAGLKPTVAAIEAGKDICLANKETLIAGGPFVLPLAHKYNVKILPADSEHSAIFQCIQG  231

Query  381   LPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEV  202
             LPEGALRRIILTASGGAFRDWPVEKLKD KV DALKHP W+MGKKITVDSATLFNKGLEV
Sbjct  232   LPEGALRRIILTASGGAFRDWPVEKLKDVKVADALKHPNWNMGKKITVDSATLFNKGLEV  291

Query  201   IEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYC  22
             IEAHYLFG DYDNIEIVIHPQSIIHSMVET+DSSVLAQLG PD R+P+LYT+SWPDRIYC
Sbjct  292   IEAHYLFGADYDNIEIVIHPQSIIHSMVETEDSSVLAQLGWPDMRIPILYTMSWPDRIYC  351

Query  21    SEITWPR  1
             SEITWPR
Sbjct  352   SEITWPR  358



>ref|XP_008374435.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Malus domestica]
Length=473

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/371 (78%), Positives = 322/371 (87%), Gaps = 11/371 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM----RVKCSSqaaa  934
             MALN +S AE KA SF       +  +    KL GG A+RR+D G     RV+CS+    
Sbjct  1     MALNLLSPAEIKAISFLD----STKSSTHLPKLPGGFALRRRDCGTVIGRRVQCSAAQTP  56

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                 P   GRAVAE SR+TWDGPKPISI+GSTGS+GTQ L++VAENP+K+R+VALAAGSN
Sbjct  57    PPAWP---GRAVAETSRRTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRIVALAAGSN  113

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLL  QVK FKP+LV++ +ESLV+ELKEAL+DLDEKPEIIPGE+G++EVARHPD VTVV
Sbjct  114   VTLLVDQVKRFKPQLVAVGNESLVNELKEALADLDEKPEIIPGEQGVVEVARHPDAVTVV  173

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ
Sbjct  174   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  233

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGG+FRDWPVEKLKD KV DALKHP W+MGKKITVDSATLFNK
Sbjct  234   CIQGLPEGALRRIILTASGGSFRDWPVEKLKDVKVADALKHPNWNMGKKITVDSATLFNK  293

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SWPD
Sbjct  294   GLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPD  353

Query  33    RIYCSEITWPR  1
             RIYCSE+TWPR
Sbjct  354   RIYCSEVTWPR  364



>ref|XP_009363023.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=470

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/371 (78%), Positives = 322/371 (87%), Gaps = 11/371 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM----RVKCSSqaaa  934
             MALN +S AE KA SF       +  +    KL GG A+RR+D G     RV+CS+    
Sbjct  1     MALNLLSPAEIKAISFLD----STKSSCHLPKLPGGFALRRRDCGTVIGRRVQCSAAQTP  56

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                 P   GRA AE SR+TWDGPKPISI+GSTGS+GTQ L++VAENP+K+R+VALAAGSN
Sbjct  57    PPAWP---GRAAAETSRRTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRIVALAAGSN  113

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLL  QV+ FKP+LV++R+ESLV+ELKEAL+DLDEKPEIIPGE+G++EVARHPD VTVV
Sbjct  114   VTLLVDQVRRFKPQLVAVRNESLVNELKEALADLDEKPEIIPGEQGVVEVARHPDAVTVV  173

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ
Sbjct  174   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  233

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGG+FRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  234   CIQGLPEGALRRIILTASGGSFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNK  293

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YDNIEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SWP+
Sbjct  294   GLEVIEAHYLFGAEYDNIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPE  353

Query  33    RIYCSEITWPR  1
             RIYCSE+TWPR
Sbjct  354   RIYCSEVTWPR  364



>ref|XP_002318048.2| 1-deoxy-D-xylulose 5-phosphate reductoisomerase family protein 
[Populus trichocarpa]
 gb|EEE96268.2| 1-deoxy-D-xylulose 5-phosphate reductoisomerase family protein 
[Populus trichocarpa]
Length=471

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/368 (79%), Positives = 328/368 (89%), Gaps = 7/368 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKD-GGMRVKCSSqaaaaqp  925
             MALN +S AE KA SF       S  +    KLQGG++++RKD GG R++CS      QP
Sbjct  1     MALNILSPAEIKAISFLD-----STKSNRLPKLQGGLSLKRKDCGGRRIQCS-VQNQNQP  54

Query  924   qpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTL  745
              PAWPGRA  E  RKTWDGPKPISI+GSTGS+GTQ L++VAENP+K++VVALAAGSNVTL
Sbjct  55    PPAWPGRACPEPGRKTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFKVVALAAGSNVTL  114

Query  744   LAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGI  565
             LA QV+TFKP+L+++R+ESLVDELKEAL+D++EKPEIIPGE+G++EVARHPD V+VVTGI
Sbjct  115   LADQVRTFKPQLIAVRNESLVDELKEALADVEEKPEIIPGEQGVVEVARHPDAVSVVTGI  174

Query  564   VGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQ  385
             VGCAGLKPTVAAIEAGKDI LANKETLIAGGPFVLPLAHK+NVKILPADSEHSAIFQCIQ
Sbjct  175   VGCAGLKPTVAAIEAGKDICLANKETLIAGGPFVLPLAHKYNVKILPADSEHSAIFQCIQ  234

Query  384   GLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLE  205
             GLPEGALRRIILTASGGAFRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFNKGLE
Sbjct  235   GLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLE  294

Query  204   VIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
             VIEAHYLFG DYDNI+IVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SWPDR+Y
Sbjct  295   VIEAHYLFGADYDNIDIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPDRVY  354

Query  24    CSEITWPR  1
             CSEITWPR
Sbjct  355   CSEITWPR  362



>gb|AIR72281.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Pyrus communis]
Length=470

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/371 (77%), Positives = 322/371 (87%), Gaps = 11/371 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM----RVKCSSqaaa  934
             MALN +S AE KA SF       +  +    KL GG A+RR+D G     RV+CS+    
Sbjct  1     MALNLLSPAEIKAISFLD----STKSSCHLPKLPGGFALRRRDCGTVIGRRVQCSAAQTP  56

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                 P   GRA AE SR+TWDGPKPISI+GSTGS+GTQ L++VAENP+K+R+VALAAGSN
Sbjct  57    PPAWP---GRAAAETSRRTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRIVALAAGSN  113

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLL  QV+ FKP+LV++R+ESLV+ELKEAL+DLDEKPEIIPGE+G++EVARHPD VTVV
Sbjct  114   VTLLVDQVRRFKPQLVAVRNESLVNELKEALADLDEKPEIIPGEQGVVEVARHPDAVTVV  173

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ
Sbjct  174   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  233

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGG+FRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  234   CIQGLPEGALRRIILTASGGSFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNK  293

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SWP+
Sbjct  294   GLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPE  353

Query  33    RIYCSEITWPR  1
             RIYCSE+TWPR
Sbjct  354   RIYCSEVTWPR  364



>gb|AFP43697.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Eriobotrya japonica]
Length=473

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/371 (78%), Positives = 323/371 (87%), Gaps = 11/371 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM----RVKCSSqaaa  934
             MALN +S AE KA SF       +  +    KL GG A+RR+D G     RV+CS+  A 
Sbjct  1     MALNLLSPAEIKAISFLD----STKSSRYLPKLPGGFALRRRDCGTVIGRRVQCSAAQAP  56

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                 P   GRAVAE SR+TWDGPKPISI+GSTGS+GTQ L++VAENP+K+R+VALAAGSN
Sbjct  57    PPAWP---GRAVAETSRRTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRIVALAAGSN  113

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLL  QV+ FKP+LV++ +ESLV+ELKEAL+DLDEKPEIIPGE+G++EVARHPD VTVV
Sbjct  114   VTLLVDQVRRFKPQLVAVGNESLVNELKEALADLDEKPEIIPGEQGVVEVARHPDAVTVV  173

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ
Sbjct  174   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  233

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGG+FRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  234   CIQGLPEGALRRIILTASGGSFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNK  293

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SWP+
Sbjct  294   GLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPE  353

Query  33    RIYCSEITWPR  1
             RIYCSE+TWPR
Sbjct  354   RIYCSEVTWPR  364



>gb|ABC74566.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Picrorhiza kurrooa]
Length=475

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/371 (78%), Positives = 327/371 (88%), Gaps = 9/371 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGG----MRVKCSSqaaa  934
             MALN +S +E K+ SF +   SKSN+N   L  QGG +++RK+ G    +RV+CS+ A  
Sbjct  1     MALNLLSPSEIKSLSFLESSKSKSNFNSFKL--QGGFSLKRKENGRTAALRVQCSASAQP  58

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                 P   GRAVA    K+W+GPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSN
Sbjct  59    PPAWP---GRAVANSGHKSWEGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSN  115

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             +TLLA Q+KTFKP+LVS+RDESL+DELKEAL+DL+ KPEIIPGE+G+IEVARHPD VTVV
Sbjct  116   ITLLADQIKTFKPELVSVRDESLIDELKEALADLEHKPEIIPGEQGIIEVARHPDAVTVV  175

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ
Sbjct  176   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  235

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRR+ILTASGGAFRD PVEKLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  236   CIQGLPEGALRRVILTASGGAFRDLPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNK  295

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YD+I+IVIHPQSIIHSM+ETQDSS+LAQLG PD RLP+LYTLSWPD
Sbjct  296   GLEVIEAHYLFGAEYDDIDIVIHPQSIIHSMIETQDSSILAQLGWPDMRLPILYTLSWPD  355

Query  33    RIYCSEITWPR  1
             RIYCSEITWPR
Sbjct  356   RIYCSEITWPR  366



>gb|ADN39416.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Withania somnifera]
Length=474

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/371 (79%), Positives = 328/371 (88%), Gaps = 9/371 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKD----GGMRVKCSSqaaa  934
             MALN +S AE K  SF    TSKS+YNL+ LK  GGV++RRK+       RV+CS+Q   
Sbjct  1     MALNLLSPAEFKTISFLD--TSKSSYNLNHLKFAGGVSIRRKERSGTSAKRVQCSAQPPP  58

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                 P   GRAVAE  R+TWDGPKPISI+GSTGS+GTQ L++V+ENP+K+RVVALAAGSN
Sbjct  59    PPAWP---GRAVAEPGRQTWDGPKPISIVGSTGSIGTQTLDIVSENPDKFRVVALAAGSN  115

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QVKTF+PKLV++R+ESLV+ELK+AL+D+D+KPE+IPGE+G++EVARHPD VTVV
Sbjct  116   VTLLADQVKTFRPKLVAVRNESLVEELKDALADMDDKPEVIPGEQGVMEVARHPDAVTVV  175

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQ
Sbjct  176   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQ  235

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             C+QGLPEGALRRIILTASGGAFRD PV KLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  236   CVQGLPEGALRRIILTASGGAFRDLPVVKLKEVKVADALKHPNWNMGKKITVDSATLFNK  295

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YDNIEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYTLSWPD
Sbjct  296   GLEVIEAHYLFGAEYDNIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPD  355

Query  33    RIYCSEITWPR  1
             RIYCSEITWPR
Sbjct  356   RIYCSEITWPR  366



>ref|XP_008393034.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like 
[Malus domestica]
Length=473

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/371 (77%), Positives = 321/371 (87%), Gaps = 11/371 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM----RVKCSSqaaa  934
             MALN +S AE KA SF       +  +    KL GG A+RR+D G     RV+CS+    
Sbjct  1     MALNLLSPAEIKAISFLD----SAKSSCHLPKLPGGFALRRRDCGTVIGRRVQCSAAQTP  56

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                 P   GRA  E SR+TWDGPKPISI+GSTGS+GTQ L++VAENP+K+R+VALAAGSN
Sbjct  57    PPAWP---GRAAVETSRRTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRIVALAAGSN  113

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLL  QV+ FKP+LV++R+ESLV+ELKEAL+DLDEKPEIIPGE+G++EVARHPD VTVV
Sbjct  114   VTLLVDQVRRFKPQLVAVRNESLVNELKEALADLDEKPEIIPGEQGVVEVARHPDAVTVV  173

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ
Sbjct  174   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  233

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGG+FRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  234   CIQGLPEGALRRIILTASGGSFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNK  293

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SWP+
Sbjct  294   GLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPE  353

Query  33    RIYCSEITWPR  1
             RIYCSE+TWPR
Sbjct  354   RIYCSEVTWPR  364



>ref|XP_006345056.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like 
[Solanum tuberosum]
Length=475

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/371 (80%), Positives = 330/371 (89%), Gaps = 9/371 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRK--DGGM--RVKCSSqaaa  934
             MALN +S  E K+ SF    TSKS+YNL+ LK  GG+++RRK   G    RV+CS+Q   
Sbjct  1     MALNLLSPTEIKSISFLD--TSKSSYNLNHLKFSGGLSIRRKGCSGAFAKRVQCSAQPPP  58

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                 P   GRAVAE  R++W+GPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSN
Sbjct  59    PPAWP---GRAVAEPGRQSWEGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSN  115

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QVKTF+PKLV++R+ESLV+ELK+AL+D+++KPEIIPGE+G+IEVARHPD VTVV
Sbjct  116   VTLLADQVKTFRPKLVAVRNESLVEELKDALADMEDKPEIIPGEQGVIEVARHPDAVTVV  175

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQ
Sbjct  176   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQ  235

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGGAFRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  236   CIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNK  295

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YDNIEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYTLSWPD
Sbjct  296   GLEVIEAHYLFGAEYDNIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPD  355

Query  33    RIYCSEITWPR  1
             R+YCSEITWPR
Sbjct  356   RVYCSEITWPR  366



>gb|ABO38177.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Croton stellatopilosus]
Length=467

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/367 (80%), Positives = 322/367 (88%), Gaps = 8/367 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGMRVKCSSqaaaaqpq  922
             MALN +S AE K+ SF       S  +    KL G  +++RKD G +V+CS     + P 
Sbjct  1     MALNLLSPAEIKSISFLD-----SAKSNQLPKLTGSFSLKRKDLGRKVQCS---VQSPPP  52

Query  921   pawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLL  742
             PAWPG A  E  RKTWDGPKPISI+GSTGS+GTQ L++VAENPEK++VVALAAGSNVTLL
Sbjct  53    PAWPGTAFPEPGRKTWDGPKPISIVGSTGSIGTQTLDIVAENPEKFKVVALAAGSNVTLL  112

Query  741   AHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIV  562
             A QVKTFKP+LV++R+ESLVDELKEAL+DL+EKPEIIPGEEG++EVARHPD  +VVTGIV
Sbjct  113   ADQVKTFKPQLVAVRNESLVDELKEALADLEEKPEIIPGEEGVVEVARHPDAASVVTGIV  172

Query  561   GCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQG  382
             GCAGL+PTVAAIEAGKDI LANKETLIAGGPFVLPLA+K+NVKILPADSEHSAIFQCIQG
Sbjct  173   GCAGLRPTVAAIEAGKDICLANKETLIAGGPFVLPLANKYNVKILPADSEHSAIFQCIQG  232

Query  381   LPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEV  202
             LPEGALRRIILTASGGAFRDWPVEKLKD KV DALKHP W+MGKKITVDSATLFNKGLEV
Sbjct  233   LPEGALRRIILTASGGAFRDWPVEKLKDVKVADALKHPNWNMGKKITVDSATLFNKGLEV  292

Query  201   IEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYC  22
             IEAHYLFG DYDNIEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYT+SWPDRIYC
Sbjct  293   IEAHYLFGADYDNIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTMSWPDRIYC  352

Query  21    SEITWPR  1
             SEITWPR
Sbjct  353   SEITWPR  359



>gb|ABH08964.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Nicotiana tabacum]
Length=473

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/371 (81%), Positives = 333/371 (90%), Gaps = 11/371 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKD----GGMRVKCSSqaaa  934
             MALN +S +E K  SF    TS S+YNL+ LK QGGVA++RK+     G RV+CS     
Sbjct  1     MALNLLSPSEIKTISFLD--TSTSSYNLNHLKFQGGVAIKRKEWSGISGKRVQCS----V  54

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
               P PAWPGRAVAE +RKTWDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSN
Sbjct  55    QAPPPAWPGRAVAE-ARKTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSN  113

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QVKTFKPKLV++R+ESLV+ELK+AL+D+++KPEIIPGE+G+IEVARHPD VTVV
Sbjct  114   VTLLADQVKTFKPKLVAVRNESLVEELKDALADMEDKPEIIPGEQGIIEVARHPDAVTVV  173

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAI+AGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQ
Sbjct  174   TGIVGCAGLKPTVAAIKAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQ  233

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGGAFRD PVEKLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  234   CIQGLPEGALRRIILTASGGAFRDLPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNK  293

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YD+IEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYTLSWPD
Sbjct  294   GLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPD  353

Query  33    RIYCSEITWPR  1
             RIYCSE+TWPR
Sbjct  354   RIYCSEVTWPR  364



>ref|NP_001234553.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Solanum lycopersicum]
 gb|AAK96063.2|AF331705_1 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Solanum lycopersicum]
Length=475

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/371 (80%), Positives = 329/371 (89%), Gaps = 9/371 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDG----GMRVKCSSqaaa  934
             MALN +S AE K+ SF     SKS+YNLS LK  GG+++RRK+       RV+CS+Q   
Sbjct  1     MALNLLSPAEIKSISFLD--NSKSSYNLSHLKFTGGLSIRRKECSGAFAKRVQCSAQLPP  58

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                 P   GRAVAE  R++WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSN
Sbjct  59    PPAWP---GRAVAEPGRQSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSN  115

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QVKTF+PKLV++R+ESLV+ELK+AL+D+++KPEIIPGE+G+IEVARHPD VTVV
Sbjct  116   VTLLADQVKTFRPKLVAVRNESLVEELKDALADMEDKPEIIPGEQGVIEVARHPDAVTVV  175

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLP AHKH VKILPADSEHSAIFQ
Sbjct  176   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPPAHKHKVKILPADSEHSAIFQ  235

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGGAFRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  236   CIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNK  295

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YDNIEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYTLSWPD
Sbjct  296   GLEVIEAHYLFGAEYDNIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPD  355

Query  33    RIYCSEITWPR  1
             R+YCSEITWPR
Sbjct  356   RVYCSEITWPR  366



>gb|AFZ93643.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Euphorbia lathyris]
Length=471

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/368 (78%), Positives = 322/368 (88%), Gaps = 7/368 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKD-GGMRVKCSSqaaaaqp  925
             MALN +S AE KA SF       +  N    KL GG+++RRK  G  +V+CS+QA    P
Sbjct  1     MALNLLSPAEIKAISFLD----SAKSNFHLPKLTGGLSLRRKAFGAAKVQCSAQAQPPPP  56

Query  924   qpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTL  745
                  G A+ E  RKT+DGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSNVTL
Sbjct  57    AWP--GTALPEPGRKTYDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTL  114

Query  744   LAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGI  565
             LA QV+ FKP+LV++R+ESLVDELKEAL+DLDEKPEIIPGE+G++EVARHPD V+VVTGI
Sbjct  115   LADQVRIFKPQLVAVRNESLVDELKEALADLDEKPEIIPGEQGVVEVARHPDAVSVVTGI  174

Query  564   VGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQ  385
             VGCAGLKPTVAAIEAGKDI LANKETLIAGGPFVLPLA K+NVKILPADSEHSAIFQCIQ
Sbjct  175   VGCAGLKPTVAAIEAGKDICLANKETLIAGGPFVLPLARKYNVKILPADSEHSAIFQCIQ  234

Query  384   GLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLE  205
             GLPEGALRRIILTASGGAFRDWPVEKLKD KV DALKHP W+MGKKITVDSATLFNKGLE
Sbjct  235   GLPEGALRRIILTASGGAFRDWPVEKLKDVKVADALKHPNWNMGKKITVDSATLFNKGLE  294

Query  204   VIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
             VIEAHYL+GTDYDNIEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SWPDR+Y
Sbjct  295   VIEAHYLYGTDYDNIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPDRVY  354

Query  24    CSEITWPR  1
             CSE+TWPR
Sbjct  355   CSEVTWPR  362



>ref|XP_011001537.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Populus euphratica]
Length=473

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/369 (78%), Positives = 326/369 (88%), Gaps = 7/369 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKD-GGMRVKCS-Sqaaaaq  928
             MALN +S AE KA SF       S  +    KLQGG++++RKD GG R++CS       Q
Sbjct  1     MALNILSPAEIKAISFLD-----STKSNRLPKLQGGLSLKRKDCGGRRIQCSVQNQNQNQ  55

Query  927   pqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVT  748
             P PAWPGRA  E  RKTWDGPKPISI+GSTGS+GTQ L++VAENP+K++VVALAAGSNVT
Sbjct  56    PPPAWPGRACPEAGRKTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFKVVALAAGSNVT  115

Query  747   LLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTG  568
             LLA QV+TFKP+L+++R+ESLVDELKEAL+D++EKPEIIPGE+G++EVARHPD V  VTG
Sbjct  116   LLADQVRTFKPQLIAVRNESLVDELKEALADVEEKPEIIPGEQGVVEVARHPDAVRGVTG  175

Query  567   IVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCI  388
             IVGCAGLKPTVAAIEAGKDI LANKETLIAGGPFVLPLAHK+NVKILPADSEHSAIFQCI
Sbjct  176   IVGCAGLKPTVAAIEAGKDICLANKETLIAGGPFVLPLAHKYNVKILPADSEHSAIFQCI  235

Query  387   QGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGL  208
             QGLPEGALRRIILTASGGAFRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFNKGL
Sbjct  236   QGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGL  295

Query  207   EVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRI  28
             EVIEAHYLFG +YDNI+I+IHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SWPDR+
Sbjct  296   EVIEAHYLFGAEYDNIDIIIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPDRV  355

Query  27    YCSEITWPR  1
             YCSEITWPR
Sbjct  356   YCSEITWPR  364



>ref|XP_004298943.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=471

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/371 (78%), Positives = 319/371 (86%), Gaps = 13/371 (4%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM----RVKCSSqaaa  934
             MALN +S AE KA SF       S  +    KL GG A+RRKD G     R++CS+QA  
Sbjct  1     MALNLLSPAEIKAISFLD-----STKSTHLPKLPGGFALRRKDCGTVIGRRIQCSAQAPP  55

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                     G A  E  R+TWDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSN
Sbjct  56    PAWP----GSAFPEPGRRTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSN  111

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLL  QVK FKPKLV++R+ESLVDELKEALS L++KPEIIPGE+G+IEVARHPD VTVV
Sbjct  112   VTLLVDQVKRFKPKLVAVRNESLVDELKEALSGLEDKPEIIPGEQGVIEVARHPDAVTVV  171

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGL+PTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ
Sbjct  172   TGIVGCAGLRPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  231

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGGAFRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  232   CIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWTMGKKITVDSATLFNK  291

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYL+G DYD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SWP+
Sbjct  292   GLEVIEAHYLYGADYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPE  351

Query  33    RIYCSEITWPR  1
             RIYCSE+TWPR
Sbjct  352   RIYCSEVTWPR  362



>gb|AGO04400.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rosa x centifolia]
 gb|AGO04401.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rosa x damascena]
Length=472

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/371 (78%), Positives = 320/371 (86%), Gaps = 12/371 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDG----GMRVKCSSqaaa  934
             MALN +S AE KA SF       S  +    KL GG A+RR+D     G R++CS+QA  
Sbjct  1     MALNLLSPAEIKAISFLD-----STKSTHLPKLPGGFALRRRDCRTVIGRRIQCSAQAPP  55

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                 P   G A  E  R+TWDGPKPIS++GSTGS+GTQ L++VAENPEK+RVVALAAGSN
Sbjct  56    PPAWP---GSAFPEPGRRTWDGPKPISVVGSTGSIGTQTLDIVAENPEKFRVVALAAGSN  112

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLL  QVK FKPKLV++R+ESLV+ELKEALS L++KPEIIPGE+G+IEVARHPD VTVV
Sbjct  113   VTLLVDQVKRFKPKLVAVRNESLVNELKEALSGLEDKPEIIPGEQGVIEVARHPDAVTVV  172

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ
Sbjct  173   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  232

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGGAFRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  233   CIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNK  292

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYL+G DYD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SWP+
Sbjct  293   GLEVIEAHYLYGADYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPE  352

Query  33    RIYCSEITWPR  1
             RIYCSE+TWPR
Sbjct  353   RIYCSEVTWPR  363



>ref|XP_009627984.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Nicotiana tomentosiformis]
Length=473

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/371 (81%), Positives = 333/371 (90%), Gaps = 11/371 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKD----GGMRVKCSSqaaa  934
             MALN +S AE K  SF    TSKS+YNL+ LK QGGV ++RK+     G RV+CS     
Sbjct  1     MALNLLSPAEIKTISFLD--TSKSSYNLNHLKFQGGVCVKRKECRGISGKRVQCS----V  54

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
               P PAWPGRAVAE +RK+WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSN
Sbjct  55    QAPPPAWPGRAVAE-ARKSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSN  113

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QVKTFKPKLV++R+ESLV+ELK+AL+D+++KPEIIPGE+G+IEVARHPD VTVV
Sbjct  114   VTLLADQVKTFKPKLVAVRNESLVEELKDALADMEDKPEIIPGEQGIIEVARHPDAVTVV  173

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAI+AGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQ
Sbjct  174   TGIVGCAGLKPTVAAIKAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQ  233

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGGAFRD PVEKLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  234   CIQGLPEGALRRIILTASGGAFRDLPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNK  293

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YD+IEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYTLSWPD
Sbjct  294   GLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPD  353

Query  33    RIYCSEITWPR  1
             RIYCSE+TWPR
Sbjct  354   RIYCSEVTWPR  364



>gb|AHL17584.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Jatropha curcas]
 gb|KDP31100.1| hypothetical protein JCGZ_11476 [Jatropha curcas]
Length=467

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/367 (78%), Positives = 317/367 (86%), Gaps = 9/367 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGMRVKCSSqaaaaqpq  922
             MALN +S AE KA SF       S  +    KL G  +++RKD G +V+CS+Q       
Sbjct  1     MALNLLSPAEIKAISFLD-----STKSNQLPKLPGSFSLKRKDLGRKVQCSAQPPPPAWP  55

Query  921   pawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLL  742
                 GRA  E  RKTWDGPKPISI+GSTGS+GTQ L++VAENP K++VVALAAGSNVTLL
Sbjct  56    ----GRAFPEPGRKTWDGPKPISIVGSTGSIGTQTLDIVAENPNKFKVVALAAGSNVTLL  111

Query  741   AHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIV  562
             A QVKTFKP+LV++R+ESLVDELKEAL+D++EKPEIIPGE+G++EVARHPD V+VVTGIV
Sbjct  112   ADQVKTFKPQLVAVRNESLVDELKEALADVEEKPEIIPGEQGIVEVARHPDAVSVVTGIV  171

Query  561   GCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQG  382
             GCAGLKPTVAAIEAGKDI LANKETLIAGGPFVLPLAHK+NVKILPADSEHSAIFQCIQG
Sbjct  172   GCAGLKPTVAAIEAGKDICLANKETLIAGGPFVLPLAHKYNVKILPADSEHSAIFQCIQG  231

Query  381   LPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEV  202
             LPEGALRRIILTASGGAFRD PVEKLKD KV DALKHP W+MGKKITVDSATLFNKGLEV
Sbjct  232   LPEGALRRIILTASGGAFRDLPVEKLKDVKVADALKHPNWNMGKKITVDSATLFNKGLEV  291

Query  201   IEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYC  22
             IEAHYLFG DYDNIEIVIHPQSIIHSMVET+DSSVLAQLG PD RLP+LYT+SWPDRI C
Sbjct  292   IEAHYLFGADYDNIEIVIHPQSIIHSMVETEDSSVLAQLGWPDMRLPILYTMSWPDRISC  351

Query  21    SEITWPR  1
             SEITWPR
Sbjct  352   SEITWPR  358



>gb|AFU93070.1| chloroplast 1-deoxy-D-xylulose-5-phosphate reductase [Eucommia 
ulmoides]
Length=478

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/373 (77%), Positives = 317/373 (85%), Gaps = 10/373 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKD----GGMRVKCSSqaaa  934
             MALN +   E    SFF      S  N +   LQGG A +RKD     G+RV CS++   
Sbjct  1     MALNLLPRTEFNPVSFFH----TSKSNRNLFNLQGGFAFKRKDIGATNGLRVHCSAEEVG  56

Query  933   aqpqpawP--GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAG  760
                 P     GRAV E  RK+WDGPKPISI+GSTGS+GTQ L++VAENP+K++VVALAAG
Sbjct  57    VAVAPPPAWPGRAVVEPGRKSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFKVVALAAG  116

Query  759   SNVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVT  580
             SNVTLLA QVKTFKP+LV++R+ESLVDELKEAL+D +  PEIIPGE+G+IEVARHPD VT
Sbjct  117   SNVTLLADQVKTFKPQLVAVRNESLVDELKEALADAEYTPEIIPGEQGVIEVARHPDAVT  176

Query  579   VVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAI  400
             VVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAI
Sbjct  177   VVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAI  236

Query  399   FQCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLF  220
             FQCIQGLPEGALRRIILTASGGAFRD PV+KLKD KV DALKHP W+MGKKITVDSATLF
Sbjct  237   FQCIQGLPEGALRRIILTASGGAFRDLPVDKLKDVKVADALKHPNWNMGKKITVDSATLF  296

Query  219   NKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSW  40
             NKGLEVIEAHYLFG +YD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SW
Sbjct  297   NKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSW  356

Query  39    PDRIYCSEITWPR  1
             PDRI+CSEITWPR
Sbjct  357   PDRIFCSEITWPR  369



>ref|XP_009774468.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Nicotiana sylvestris]
Length=473

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/371 (81%), Positives = 333/371 (90%), Gaps = 11/371 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKD----GGMRVKCSSqaaa  934
             MALN +S +E K  SF    TSKS+YNL+ LK QGGVA++RK+     G RV+CS     
Sbjct  1     MALNLLSPSEIKTISFLD--TSKSSYNLNHLKFQGGVAIKRKEWSGISGKRVQCS----V  54

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
               P PAWPGRAVAE +RKTWDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSN
Sbjct  55    QAPPPAWPGRAVAE-ARKTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSN  113

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QVKTF+PKLV++R+ESLV+ELK+AL+D+++KPEIIPGE+G+IEVARHPD VTVV
Sbjct  114   VTLLADQVKTFRPKLVAVRNESLVEELKDALADMEDKPEIIPGEQGIIEVARHPDAVTVV  173

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQ
Sbjct  174   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQ  233

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGGAFRD PVEKLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  234   CIQGLPEGALRRIILTASGGAFRDLPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNK  293

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YD+IEIVIHPQSIIHSMVETQDSSVLAQLG  D RLP+LYTLSWPD
Sbjct  294   GLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWADMRLPILYTLSWPD  353

Query  33    RIYCSEITWPR  1
             RIYCSE+TWPR
Sbjct  354   RIYCSEVTWPR  364



>ref|XP_010243034.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Nelumbo nucifera]
Length=471

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/371 (79%), Positives = 315/371 (85%), Gaps = 13/371 (4%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDG----GMRVKCSSqaaa  934
             MAL F S  E    SF        +      KL+GG  ++RK+     G +  CS+QA  
Sbjct  1     MALKFPSPTEIGGISFLD------SSKADLFKLKGGFTLKRKENRVTFGRKAHCSAQAPP  54

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                 P   GRAV E  RK+WDGPKPISIIGSTGS+GTQ L++VAENP+K+RVVALAAGSN
Sbjct  55    PPAWP---GRAVPEPGRKSWDGPKPISIIGSTGSIGTQTLDIVAENPDKFRVVALAAGSN  111

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QVK FKPKLVS+R+ESL+DELKEALSD + KPEIIPGE+GLIEVARHPD VTVV
Sbjct  112   VTLLADQVKRFKPKLVSVRNESLLDELKEALSDAEHKPEIIPGEQGLIEVARHPDAVTVV  171

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ
Sbjct  172   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  231

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRI+LTASGGAFRDWPVEKLKD KV DALKHP W+MGKKITVDSATLFNK
Sbjct  232   CIQGLPEGALRRILLTASGGAFRDWPVEKLKDVKVADALKHPNWNMGKKITVDSATLFNK  291

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YDNIEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP++YTLSWPD
Sbjct  292   GLEVIEAHYLFGAEYDNIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPIIYTLSWPD  351

Query  33    RIYCSEITWPR  1
             RIYCSEITWPR
Sbjct  352   RIYCSEITWPR  362



>ref|XP_011071850.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Sesamum indicum]
Length=474

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/367 (80%), Positives = 326/367 (89%), Gaps = 2/367 (1%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGMRVKCSSqaaaaqpq  922
             MALN +S  E K  SF    +SKSNY+L+ LK QGG A+++K+ G          A  P 
Sbjct  1     MALNMLSPTEIKTLSFLD--SSKSNYSLNHLKFQGGFALKKKENGCTAANRVLCLAQPPP  58

Query  921   pawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLL  742
             PAWPGRAV E  RK+WDGPKPISI+GSTGS+GTQ L++VAENP+K++VVALAAGSNVTLL
Sbjct  59    PAWPGRAVPEPGRKSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFKVVALAAGSNVTLL  118

Query  741   AHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIV  562
             A Q+KTFKP+LVS+RDESLV ELKEAL+D+++KPEIIPGE+G+IEVARHPD VTVVTGIV
Sbjct  119   ADQIKTFKPQLVSVRDESLVGELKEALADVEDKPEIIPGEQGIIEVARHPDAVTVVTGIV  178

Query  561   GCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQG  382
             GCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQG
Sbjct  179   GCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQG  238

Query  381   LPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEV  202
             LPEGALRRIILTASGGAFRD PV+KLKD KV DALKHP W+MGKKITVDSATLFNKGLEV
Sbjct  239   LPEGALRRIILTASGGAFRDLPVDKLKDVKVADALKHPNWNMGKKITVDSATLFNKGLEV  298

Query  201   IEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYC  22
             IEAHYLFG +YD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYTLSWPDRIYC
Sbjct  299   IEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTLSWPDRIYC  358

Query  21    SEITWPR  1
             SEITWPR
Sbjct  359   SEITWPR  365



>gb|AFR79418.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rosa hybrid 
cultivar]
 gb|AGO04396.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rosa rugosa]
 gb|AGO04397.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rosa hybrid 
cultivar]
 gb|AGO04399.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rosa rugosa]
Length=472

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/371 (78%), Positives = 320/371 (86%), Gaps = 12/371 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDG----GMRVKCSSqaaa  934
             MALN +S AE KA SF       S  +    KL GG A+RR+D     G R++CS+QA  
Sbjct  1     MALNLLSPAEIKAISFLD-----STKSTHLPKLPGGFALRRRDCRTVIGRRIQCSAQAPP  55

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                 P   G A  E  R+TWDGPKPIS++GSTGS+GTQ L++VAENPEK+RVVALAAGSN
Sbjct  56    PPAWP---GSAFPEPGRRTWDGPKPISVVGSTGSIGTQTLDIVAENPEKFRVVALAAGSN  112

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLL  QVK FKPKLV++R+ESL++ELKEALS L++KPEIIPGE+G+IEVARHPD VTVV
Sbjct  113   VTLLVDQVKRFKPKLVAVRNESLLNELKEALSGLEDKPEIIPGEQGVIEVARHPDAVTVV  172

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ
Sbjct  173   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  232

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGGAFRDWPVEKLK+ KV DALKHP WSMGKKITVDSATLFNK
Sbjct  233   CIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNK  292

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYL+G +YD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SWP+
Sbjct  293   GLEVIEAHYLYGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPE  352

Query  33    RIYCSEITWPR  1
             RIYCSE+TWPR
Sbjct  353   RIYCSEVTWPR  363



>ref|XP_010027708.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Eucalyptus grandis]
 gb|KCW83382.1| hypothetical protein EUGRSUZ_B00316 [Eucalyptus grandis]
Length=472

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/368 (78%), Positives = 320/368 (87%), Gaps = 6/368 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKD-GGMRVKCSSqaaaaqp  925
             MALN +S AE KA SF    T  +++     KL G   ++RKD G  R+ CS+Q      
Sbjct  1     MALNLLSPAEIKAVSFLD-STKSNHHLHHLNKLPGVYTLKRKDCGTRRIHCSAQPPPPAW  59

Query  924   qpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTL  745
                  GRAV E +RK WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSNVTL
Sbjct  60    P----GRAVPETNRKLWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTL  115

Query  744   LAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGI  565
             L+ QVK FKP+LV++R+ESLVDELKEALSD+++KPEIIPGE+G+IEVARHPD VTVVTGI
Sbjct  116   LSDQVKRFKPQLVAVRNESLVDELKEALSDVEDKPEIIPGEQGVIEVARHPDAVTVVTGI  175

Query  564   VGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQ  385
             VGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQCIQ
Sbjct  176   VGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQ  235

Query  384   GLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLE  205
             GLPEGALRRIILTASGGAFRDWPV+KLK+ KV DALKHP W+MGKKITVDSATLFNKGLE
Sbjct  236   GLPEGALRRIILTASGGAFRDWPVDKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLE  295

Query  204   VIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
             VIEAHYL+G DYD+IEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYT+SWP+RIY
Sbjct  296   VIEAHYLYGADYDHIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTMSWPERIY  355

Query  24    CSEITWPR  1
             CSEITWPR
Sbjct  356   CSEITWPR  363



>gb|AFO64619.1| 1-deoxy-d-xylulose 5-phosphate reductoisomerase [Centella asiatica]
Length=474

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/371 (78%), Positives = 319/371 (86%), Gaps = 11/371 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKD----GGMRVKCSSqaaa  934
             MALN +S  E  A SF       S  N   LKLQ GV ++RKD     G R++CS     
Sbjct  1     MALNMLSPTEINAISFLD----TSRTNNHLLKLQAGVVLKRKDLGAAFGKRIQCS---VQ  53

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
               P  AWPG AV E  R+TWDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSN
Sbjct  54    QAPPSAWPGTAVVEPGRRTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSN  113

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QVKTFKP+LV++R+ESLV+ELKEAL D D KPEIIPGE+G+IEVARHPD  TVV
Sbjct  114   VTLLADQVKTFKPQLVAVRNESLVNELKEALVDADYKPEIIPGEQGVIEVARHPDCATVV  173

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGK+IALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQ
Sbjct  174   TGIVGCAGLKPTVAAIEAGKNIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQ  233

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGGAFRDWPV+KLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  234   CIQGLPEGALRRIILTASGGAFRDWPVDKLKEVKVADALKHPNWNMGKKITVDSATLFNK  293

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYL+G+DYDNIEIVIHPQSIIHSM+ETQDSS+LAQLG PD RLP+LYTLSWPD
Sbjct  294   GLEVIEAHYLYGSDYDNIEIVIHPQSIIHSMIETQDSSILAQLGWPDMRLPILYTLSWPD  353

Query  33    RIYCSEITWPR  1
             RIYCSE+TWPR
Sbjct  354   RIYCSEVTWPR  364



>gb|AHW46302.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Tripterygium 
wilfordii]
Length=469

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/367 (77%), Positives = 318/367 (87%), Gaps = 7/367 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGMRVKCSSqaaaaqpq  922
             MALN +S AE K+ S F   TS S+  L      GG A+R+K  G+R+ CS+Q       
Sbjct  1     MALNLLSPAEIKSISLFGSTTSNSSQRLKH---SGGFALRKKCNGIRIHCSAQQPQPAWP  57

Query  921   pawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLL  742
                 GRA  E  RKTWDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSNVTLL
Sbjct  58    ----GRAYPEPGRKTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLL  113

Query  741   AHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIV  562
             A QVKTFKP+LV++R+ESLVDELKEAL+D ++KPEIIPGE+G+IEVARHP+ V+VVTGIV
Sbjct  114   ADQVKTFKPQLVAVRNESLVDELKEALADAEQKPEIIPGEQGVIEVARHPEAVSVVTGIV  173

Query  561   GCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQG  382
             GCAGLKPTVAAIEAGKDI LANKETLIAGGPFVLPLA+K+NVKI PADSEHSAIFQCIQG
Sbjct  174   GCAGLKPTVAAIEAGKDICLANKETLIAGGPFVLPLANKYNVKIPPADSEHSAIFQCIQG  233

Query  381   LPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEV  202
             LPEGALRRIILTASGGAFRDWPV KLK+ KV DALKHP W+MGKKITVDSATLFNKGLEV
Sbjct  234   LPEGALRRIILTASGGAFRDWPVSKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEV  293

Query  201   IEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYC  22
             IEAHYL+G DYDNIEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SWP+RIYC
Sbjct  294   IEAHYLYGADYDNIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPERIYC  353

Query  21    SEITWPR  1
             SE+TWPR
Sbjct  354   SEVTWPR  360



>gb|AGQ04155.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lavandula angustifolia]
Length=475

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/371 (80%), Positives = 326/371 (88%), Gaps = 9/371 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDG----GMRVKCSSqaaa  934
             MALN  S  E K  SF    +SKSNYNL+SLK QGG + +RKD       RV CS+Q + 
Sbjct  1     MALNLTSPTEIKTLSFLD--SSKSNYNLNSLKFQGGFSFKRKDSRCITSKRVHCSAQTSP  58

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                 P   GRAV E  RKTW+GPKPIS+IGSTGS+GTQ L++VAENP+K+RV+ALAAGSN
Sbjct  59    PPAWP---GRAVPESGRKTWEGPKPISVIGSTGSIGTQTLDIVAENPDKFRVIALAAGSN  115

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA Q+KTFKPKLVS++DESL++ELKEAL+D+++KPEIIPGE+G+IEVARHPD VTVV
Sbjct  116   VTLLADQIKTFKPKLVSVKDESLINELKEALADVEDKPEIIPGEQGMIEVARHPDAVTVV  175

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ
Sbjct  176   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  235

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGG+FRD PVEKLKD KV DALKHP W+MGKKITVDSATLFNK
Sbjct  236   CIQGLPEGALRRIILTASGGSFRDLPVEKLKDVKVADALKHPNWNMGKKITVDSATLFNK  295

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YD+IEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYTLSWPD
Sbjct  296   GLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPD  355

Query  33    RIYCSEITWPR  1
             R+ CSEITWPR
Sbjct  356   RVPCSEITWPR  366



>ref|XP_009363022.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=484

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/385 (75%), Positives = 322/385 (84%), Gaps = 25/385 (6%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM----RVKCSSqaaa  934
             MALN +S AE KA SF       +  +    KL GG A+RR+D G     RV+CS+    
Sbjct  1     MALNLLSPAEIKAISFLD----STKSSCHLPKLPGGFALRRRDCGTVIGRRVQCSAAQTP  56

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                 P   GRA AE SR+TWDGPKPISI+GSTGS+GTQ L++VAENP+K+R+VALAAGSN
Sbjct  57    PPAWP---GRAAAETSRRTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRIVALAAGSN  113

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLL  QV+ FKP+LV++R+ESLV+ELKEAL+DLDEKPEIIPGE+G++EVARHPD VTVV
Sbjct  114   VTLLVDQVRRFKPQLVAVRNESLVNELKEALADLDEKPEIIPGEQGVVEVARHPDAVTVV  173

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILP----------  424
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILP          
Sbjct  174   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPXXXXXXXXXX  233

Query  423   ----ADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSM  256
                 ADSEHSAIFQCIQGLPEGALRRIILTASGG+FRDWPVEKLK+ KV DALKHP W+M
Sbjct  234   XXXPADSEHSAIFQCIQGLPEGALRRIILTASGGSFRDWPVEKLKEVKVADALKHPNWNM  293

Query  255   GKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLP  76
             GKKITVDSATLFNKGLEVIEAHYLFG +YDNIEIVIHPQSIIHSM+ETQDSSVLAQLG P
Sbjct  294   GKKITVDSATLFNKGLEVIEAHYLFGAEYDNIEIVIHPQSIIHSMIETQDSSVLAQLGWP  353

Query  75    DFRLPLLYTLSWPDRIYCSEITWPR  1
             D RLP+LYT+SWP+RIYCSE+TWPR
Sbjct  354   DMRLPILYTMSWPERIYCSEVTWPR  378



>gb|AEZ55867.1| chloroplast 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mitragyna 
speciosa]
Length=438

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/368 (78%), Positives = 316/368 (86%), Gaps = 6/368 (2%)
 Frame = -3

Query  1101  MALNFIS-CAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGMRVKCSSqaaaaqp  925
             MALN +S   E K  SF    +  +      LK QGG + +R   G +V+CS+Q      
Sbjct  1     MALNLLSPTTEMKTISFLD-SSKSNYNLNHLLKFQGGFSFKRGTVGKKVQCSAQPPPPAW  59

Query  924   qpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTL  745
                  GRAVAE  RK+WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSNVTL
Sbjct  60    P----GRAVAEPGRKSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTL  115

Query  744   LAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGI  565
             LA QVKTFKP+LV++R+ESLVDEL+EAL+D + KPEIIPGEEG++EVARHPD V+VVTGI
Sbjct  116   LADQVKTFKPQLVAVRNESLVDELEEALADFEYKPEIIPGEEGVVEVARHPDAVSVVTGI  175

Query  564   VGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQ  385
             VGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQCIQ
Sbjct  176   VGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQ  235

Query  384   GLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLE  205
             GLPEGALRRIILTASGGAFRD PVEKLK+ KV DALKHP W+MGKKITVDSATLFNKGLE
Sbjct  236   GLPEGALRRIILTASGGAFRDLPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLE  295

Query  204   VIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
             VIEAHYLFG +YDNIEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYT+SWPDRIY
Sbjct  296   VIEAHYLFGAEYDNIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTMSWPDRIY  355

Query  24    CSEITWPR  1
             CSEITWPR
Sbjct  356   CSEITWPR  363



>ref|XP_002321599.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase family protein 
[Populus trichocarpa]
 gb|EEF05726.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase family protein 
[Populus trichocarpa]
Length=471

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/368 (79%), Positives = 322/368 (88%), Gaps = 7/368 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKD-GGMRVKCSSqaaaaqp  925
             MALNF+S AE KA SF       S  +    KL G + ++RKD  G R++CS      QP
Sbjct  1     MALNFLSPAEIKAISFLD-----STKSNHIPKLPGRLGLKRKDCRGRRIQCS-VQNQNQP  54

Query  924   qpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTL  745
              PAWPGRA  E  RKTWDGPKPISI+GSTGS+GTQ L++V ENP+K+ VVALAAGSNVTL
Sbjct  55    PPAWPGRAFPEPGRKTWDGPKPISIVGSTGSIGTQTLDIVTENPDKFTVVALAAGSNVTL  114

Query  744   LAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGI  565
             LA QV+ FKP+LV++R+ESLVDELKEAL+D++EKPEIIPGE+G+IEVARHPD V+VVTGI
Sbjct  115   LADQVRRFKPQLVAVRNESLVDELKEALADVEEKPEIIPGEQGVIEVARHPDAVSVVTGI  174

Query  564   VGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQ  385
             VGCAGLKPTVAAIEAGKDI LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQ
Sbjct  175   VGCAGLKPTVAAIEAGKDICLANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQ  234

Query  384   GLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLE  205
             GLPEGALRRIILTASGGAFRDWPVEKLK+ KV DALKHP WSMGKKITVDSATLFNKGLE
Sbjct  235   GLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLE  294

Query  204   VIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
             VIEAHYLFG DYDNI+IVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYTLSWP+R+Y
Sbjct  295   VIEAHYLFGADYDNIDIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTLSWPERVY  354

Query  24    CSEITWPR  1
             CSEITWPR
Sbjct  355   CSEITWPR  362



>emb|CDP12403.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/372 (76%), Positives = 321/372 (86%), Gaps = 10/372 (3%)
 Frame = -3

Query  1101  MALNFIS-CAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGG----MRVKCSSqaa  937
             MALN  S   E KA SF    +  +      LKLQGG++++RKD G     +V+CS+Q  
Sbjct  1     MALNLFSPTTEIKAISFLD-SSKSNYNLNHLLKLQGGISLKRKDNGGTVGKKVQCSAQPP  59

Query  936   aaqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGS  757
                      G A+ E  RK+WDGPKP+S++GSTGS+GTQ L++VAENP+K+RVVALAAGS
Sbjct  60    PPAWP----GTALVEPGRKSWDGPKPLSVVGSTGSIGTQTLDIVAENPDKFRVVALAAGS  115

Query  756   NVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTV  577
             NVTLLA QV+TF+P+LV++R+ESLVDELKEAL+D+++KPEIIPGEEG++EVARHPD V+V
Sbjct  116   NVTLLADQVRTFRPQLVAVRNESLVDELKEALADVEDKPEIIPGEEGVVEVARHPDAVSV  175

Query  576   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIF  397
             VTGIVGCAGLKPTVAAIEAGKDI LANKETLIAGGPFVLPLAHKH VKILPADSEHSAIF
Sbjct  176   VTGIVGCAGLKPTVAAIEAGKDICLANKETLIAGGPFVLPLAHKHQVKILPADSEHSAIF  235

Query  396   QCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFN  217
             QCIQGLPEGALRRIILTASGGAFRDWPVEKLKD KV DALKHP W+MGKKITVDSATLFN
Sbjct  236   QCIQGLPEGALRRIILTASGGAFRDWPVEKLKDVKVADALKHPNWNMGKKITVDSATLFN  295

Query  216   KGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWP  37
             KGLEVIEAHYL+G DYD+IEIVIHPQSIIHSMVETQDSS+LAQLG PD RLP+LYT+SWP
Sbjct  296   KGLEVIEAHYLYGADYDDIEIVIHPQSIIHSMVETQDSSILAQLGWPDMRLPILYTMSWP  355

Query  36    DRIYCSEITWPR  1
             DRIYCSEITWPR
Sbjct  356   DRIYCSEITWPR  367



>gb|ACK57535.1| 1-deoxy-d-xylulose 5-phosphate reductoisomerase [Salvia miltiorrhiza]
Length=474

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/371 (80%), Positives = 322/371 (87%), Gaps = 9/371 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKD----GGMRVKCSSqaaa  934
             MALN +S  E K  SF    +SKSNYNL+ LK QGG A +RKD       RV CS+Q   
Sbjct  1     MALNLMSPTEIKTLSFLD--SSKSNYNLNPLKFQGGFAFKRKDSRCTASKRVHCSAQPPP  58

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                 P   GRAVAE  R TW+GPKPIS+IGSTGS+GTQ L++VAENP+K+R+VALAAGSN
Sbjct  59    PPAWP---GRAVAEPGRMTWEGPKPISVIGSTGSIGTQTLDIVAENPDKFRIVALAAGSN  115

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QV+ FKPKLVS+RDESLV ELKEAL+D ++KPEIIPGE+G+IEVARHPD VTVV
Sbjct  116   VTLLADQVRAFKPKLVSVRDESLVSELKEALADFEDKPEIIPGEQGMIEVARHPDAVTVV  175

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA KHNVKILPADSEHSAIFQ
Sbjct  176   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAKKHNVKILPADSEHSAIFQ  235

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGGAFRD PVEKLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  236   CIQGLPEGALRRIILTASGGAFRDLPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNK  295

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YD+IEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYTLSWP+
Sbjct  296   GLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPE  355

Query  33    RIYCSEITWPR  1
             RIYCSEI+WPR
Sbjct  356   RIYCSEISWPR  366



>gb|AEZ53171.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Rosa rugosa]
Length=472

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/371 (77%), Positives = 320/371 (86%), Gaps = 12/371 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDG----GMRVKCSSqaaa  934
             MALN +S AE KA SF       S  +    KL GG A+RR+D     G R++CS+QA  
Sbjct  1     MALNLLSPAEIKAISFLD-----STKSTHLPKLPGGFALRRRDCRTVIGRRIQCSAQAPP  55

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                 P   G A  E  R+TWDGPKPIS++GSTGS+GTQ L++VAENPEK+RVVALAAGSN
Sbjct  56    PPAWP---GSAFPEPGRRTWDGPKPISVVGSTGSIGTQTLDIVAENPEKFRVVALAAGSN  112

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLL  QVK FKPKLV++R+ESL++ELKEALS L++KPEIIPGE+G+IEVARHPD VTVV
Sbjct  113   VTLLVDQVKRFKPKLVAVRNESLLNELKEALSGLEDKPEIIPGEQGVIEVARHPDAVTVV  172

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ
Sbjct  173   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  232

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGGAFRDWPVEKLK+ KV DALKHP WSMGKKITVDSATLFNK
Sbjct  233   CIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNK  292

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYL+G +YD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+L+T+SWP+
Sbjct  293   GLEVIEAHYLYGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILHTMSWPE  352

Query  33    RIYCSEITWPR  1
             RIYCSE+TWPR
Sbjct  353   RIYCSEVTWPR  363



>gb|AIA82922.1| DXR [Gentiana rigescens]
Length=474

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/367 (80%), Positives = 322/367 (88%), Gaps = 3/367 (1%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGMRVKCSSqaaaaqpq  922
             MALN +S  E K+ SF    +S S YNLS LK QG +  + KDGG +     Q +  QP 
Sbjct  1     MALNLLSPTEVKSISFLD--SSNSTYNLSLLKTQGSLTFQ-KDGGAKFSKKIQCSVQQPP  57

Query  921   pawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLL  742
             PAWPGRAV E   K+WDGPKPISI+GSTGS+GTQ L++VAENP K+RVVALAAGSNVTLL
Sbjct  58    PAWPGRAVVEPGHKSWDGPKPISIVGSTGSIGTQTLDIVAENPGKFRVVALAAGSNVTLL  117

Query  741   AHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIV  562
             A QVK F+P+LV++R+E+LV+ELKEALSD+D K EIIPGE+G+IEVARHPD VTVVTGIV
Sbjct  118   ADQVKLFRPQLVAVRNEALVEELKEALSDVDYKLEIIPGEQGVIEVARHPDAVTVVTGIV  177

Query  561   GCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQG  382
             GCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA KHNVKILPADSEHSAIFQCIQG
Sbjct  178   GCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAQKHNVKILPADSEHSAIFQCIQG  237

Query  381   LPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEV  202
             LPEGALRRIILTASGG+FRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFNKGLEV
Sbjct  238   LPEGALRRIILTASGGSFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEV  297

Query  201   IEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYC  22
             IEAHYLFG DYDNI+IVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYTLSWPDRIYC
Sbjct  298   IEAHYLFGADYDNIDIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTLSWPDRIYC  357

Query  21    SEITWPR  1
             SEITWPR
Sbjct  358   SEITWPR  364



>ref|XP_002282761.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Vitis vinifera]
 emb|CBI15031.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/371 (77%), Positives = 318/371 (86%), Gaps = 13/371 (4%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM----RVKCSSqaaa  934
             MALN +  AE K  SF       S  +    KL GG  ++RKD G     RV CS+Q   
Sbjct  1     MALNLLPPAEIKLISFLD-----STKSTRLPKLPGGFVLKRKDYGATFGRRVNCSAQPPP  55

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                     GRAV E  RKTWDGPKP+S++GSTGS+GTQ L++VAENP+K+R+VALAAGSN
Sbjct  56    PAWP----GRAVPELGRKTWDGPKPLSVVGSTGSIGTQTLDIVAENPDKFRIVALAAGSN  111

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QVKTFKP+LV++R+E+LV+ELKEAL+D + KPEIIPGE+G+IEVARHP+ VTVV
Sbjct  112   VTLLADQVKTFKPQLVAVRNEALVNELKEALADCEHKPEIIPGEQGVIEVARHPEAVTVV  171

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ
Sbjct  172   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  231

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRI+LTASGGAFRDWPV+KLK+AKV DALKHP W+MGKKITVDSATLFNK
Sbjct  232   CIQGLPEGALRRILLTASGGAFRDWPVDKLKEAKVSDALKHPNWNMGKKITVDSATLFNK  291

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YD+IEI+IHPQSIIHSMVETQDSSVLAQLG PD RLP+LYTLSWPD
Sbjct  292   GLEVIEAHYLFGAEYDDIEIIIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPD  351

Query  33    RIYCSEITWPR  1
             RIYCSEITWPR
Sbjct  352   RIYCSEITWPR  362



>gb|AFI98879.1| chloroplast 1-deoxy-D-xylulose-5-phosphate reductase [Withania 
somnifera]
Length=475

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/371 (79%), Positives = 325/371 (88%), Gaps = 9/371 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKD----GGMRVKCSSqaaa  934
             MALN +S AE K  SF    TSKS+YNL+ LK  GGV +RRK+       RV+CS+Q   
Sbjct  1     MALNLLSPAEFKTISFLD--TSKSSYNLNYLKYSGGVPIRRKEWSGTSAKRVQCSAQPPP  58

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                 P   GRAVAE  R++WDGPKPISI+GSTGS+GTQ L++V+ENP+K+RVVALAAGSN
Sbjct  59    PPAWP---GRAVAEPGRQSWDGPKPISIVGSTGSIGTQTLDIVSENPDKFRVVALAAGSN  115

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QVKTF+P LV++R+ESLV+ELK+AL+D+++KPEIIPGE+G+IEVARHPD VTVV
Sbjct  116   VTLLADQVKTFRPNLVAVRNESLVEELKDALTDMEDKPEIIPGEQGVIEVARHPDAVTVV  175

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGL PTVAAIEAGKDIALANKETLIAGGPFVLPLA KH VKILPADSEHSAIFQ
Sbjct  176   TGIVGCAGLNPTVAAIEAGKDIALANKETLIAGGPFVLPLAQKHKVKILPADSEHSAIFQ  235

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGGAFRD PVEKLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  236   CIQGLPEGALRRIILTASGGAFRDLPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNK  295

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YD+IEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYTLSWPD
Sbjct  296   GLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPD  355

Query  33    RIYCSEITWPR  1
             RIYCSEITWPR
Sbjct  356   RIYCSEITWPR  366



>gb|AAY87151.2| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rauvolfia verticillata]
Length=474

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/367 (81%), Positives = 326/367 (89%), Gaps = 2/367 (1%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGMRVKCSSqaaaaqpq  922
             MALN +S  E K  SF    +SKSNYNL+ LKLQGG A ++KD G  V    Q +   P 
Sbjct  1     MALNLLSPTEIKTISFLD--SSKSNYNLNLLKLQGGFAFKKKDCGATVGKKIQCSVQPPP  58

Query  921   pawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLL  742
             PAWPGRAVAE   KTW+G KPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSNVTLL
Sbjct  59    PAWPGRAVAEPGYKTWEGQKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLL  118

Query  741   AHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIV  562
             A QVKTFKP+LV++R+ESLVDELKEALSD+++KPEIIPGE+G++EVARHPD VTVVTGIV
Sbjct  119   ADQVKTFKPQLVAVRNESLVDELKEALSDVEDKPEIIPGEQGVVEVARHPDAVTVVTGIV  178

Query  561   GCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQG  382
             GCAGLKPTVAAIEAGK+I LANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQCIQG
Sbjct  179   GCAGLKPTVAAIEAGKNIVLANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQG  238

Query  381   LPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEV  202
             LPEGALRR+ILTASGGAFRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFNKGLEV
Sbjct  239   LPEGALRRVILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEV  298

Query  201   IEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYC  22
             IEAHYLFG +YDNI+IVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYT SWPDRIYC
Sbjct  299   IEAHYLFGAEYDNIDIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTPSWPDRIYC  358

Query  21    SEITWPR  1
             SEITWPR
Sbjct  359   SEITWPR  365



>ref|XP_002866510.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42769.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Arabidopsis 
lyrata subsp. lyrata]
Length=476

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/371 (77%), Positives = 323/371 (87%), Gaps = 9/371 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRK----DGGMRVKCSSqaaa  934
             M LN +S AE KAFSF       ++      ++ GG ++RR+    D G  VKCS +   
Sbjct  2     MTLNSLSPAESKAFSFLD-----TSRFNPIPQISGGFSLRRRNQGRDFGKGVKCSVKVEQ  56

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
              QP PAWPGRAV E  R++WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSN
Sbjct  57    QQPPPAWPGRAVPEAPRQSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSN  116

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QV+ FKP LV++R+ESL++ELKEAL+DLD KPEIIPGE+G+IEVARHP+ VTVV
Sbjct  117   VTLLADQVRRFKPALVAVRNESLINELKEALADLDYKPEIIPGEQGVIEVARHPEAVTVV  176

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA+KHNVKILPADSEHSAIFQ
Sbjct  177   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLANKHNVKILPADSEHSAIFQ  236

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALR+IILTASGGAFRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  237   CIQGLPEGALRKIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNK  296

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SWPD
Sbjct  297   GLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPD  356

Query  33    RIYCSEITWPR  1
             R+ CSE+TWPR
Sbjct  357   RVPCSEVTWPR  367



>gb|ABD92702.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Hevea brasiliensis]
 gb|ABF18928.1| putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Hevea 
brasiliensis]
Length=471

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/371 (77%), Positives = 320/371 (86%), Gaps = 13/371 (4%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM----RVKCSSqaaa  934
             MALN +S AE KA SF       S  +    KL GG +++RKD G     +V+CS+Q   
Sbjct  1     MALNLLSPAEIKAISFLD-----STKSSHLTKLPGGFSLKRKDFGAAFGKKVQCSAQPPP  55

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                     GRA  +  RKTWDGPKPIS++GSTGS+GTQ L++VAENP+K+RVVALAAGSN
Sbjct  56    PAWP----GRAFPDLGRKTWDGPKPISVVGSTGSIGTQTLDIVAENPDKFRVVALAAGSN  111

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QVKTFKP+LV++R+ESLV EL+EAL+D++EKPEIIPGE+G++EVARHPD V+VV
Sbjct  112   VTLLADQVKTFKPQLVAVRNESLVHELREALADVEEKPEIIPGEQGVVEVARHPDAVSVV  171

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDI LANKETLIAGGPFVLPLAHK+NVKILPADSEHSAIFQ
Sbjct  172   TGIVGCAGLKPTVAAIEAGKDICLANKETLIAGGPFVLPLAHKYNVKILPADSEHSAIFQ  231

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLP+GALRRIILTASGGAFRDWPV+KLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  232   CIQGLPDGALRRIILTASGGAFRDWPVDKLKEVKVADALKHPNWNMGKKITVDSATLFNK  291

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YDNIEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYT+SWPD
Sbjct  292   GLEVIEAHYLFGAEYDNIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTMSWPD  351

Query  33    RIYCSEITWPR  1
             RIYCSEITWPR
Sbjct  352   RIYCSEITWPR  362



>gb|AFU93071.1| chloroplast 1-deoxy-D-xylulose-5-phosphate reductase [Eucommia 
ulmoides]
Length=472

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/367 (79%), Positives = 318/367 (87%), Gaps = 4/367 (1%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGMRVKCSSqaaaaqpq  922
             MALN IS  E K+  FF      S  +   LKLQGG+A RRK+ G+         A  P 
Sbjct  1     MALNLISPTEIKSVYFFD----ASKSSHHPLKLQGGLAFRRKEYGVSTSKRVYCLAQPPP  56

Query  921   pawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLL  742
             PAWPGRAV E  RK WDGPKPIS++GSTGS+GTQ L++VAENP+K+RVVALAAGSNVTLL
Sbjct  57    PAWPGRAVVEPGRKPWDGPKPISVVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLL  116

Query  741   AHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIV  562
             A QVKTFKP+LV +R+ESLVDEL+EAL+D + KPEIIPGE+G+IEVA HPD VTVVTGIV
Sbjct  117   ADQVKTFKPQLVVVRNESLVDELREALADSEHKPEIIPGEQGVIEVACHPDAVTVVTGIV  176

Query  561   GCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQG  382
             GCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQCIQG
Sbjct  177   GCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQG  236

Query  381   LPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEV  202
             LPEGALRRIILTASGGAFRDWPV++LKD KV DALKHP W+MGKKITVDSATLFNKGLEV
Sbjct  237   LPEGALRRIILTASGGAFRDWPVDRLKDVKVADALKHPNWNMGKKITVDSATLFNKGLEV  296

Query  201   IEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYC  22
             IEAHYL+G +YD+IEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYTLSWP+RIYC
Sbjct  297   IEAHYLYGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPERIYC  356

Query  21    SEITWPR  1
             SEITWPR
Sbjct  357   SEITWPR  363



>gb|AHX36947.1| putative 1-deoxy-d-xylulose 5-phosphate reductoisomerase [Betula 
platyphylla]
Length=471

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/371 (78%), Positives = 319/371 (86%), Gaps = 13/371 (4%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM----RVKCSSqaaa  934
             MALN +S  E KA SF       S  +   LKL  G A++RKD G+    R++CS+Q   
Sbjct  1     MALNLVSPLEIKAVSFLD-----SAKSTHFLKLPAGFALKRKDCGVVFGGRIRCSAQPPP  55

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                     GRAV E  RKTWDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSN
Sbjct  56    PAWP----GRAVPEPGRKTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSN  111

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             V LLA QVKTFKP+LV++R+ESLVDELKEAL+DL++KPEIIPGE+G+IEVARHPD VTVV
Sbjct  112   VALLADQVKTFKPQLVAVRNESLVDELKEALADLEQKPEIIPGEQGVIEVARHPDAVTVV  171

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA KH +KILPADSEHSAIFQ
Sbjct  172   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAQKHKIKILPADSEHSAIFQ  231

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGGAFRD PV+KLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  232   CIQGLPEGALRRIILTASGGAFRDLPVDKLKEVKVADALKHPNWNMGKKITVDSATLFNK  291

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YD+IEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYT+SWPD
Sbjct  292   GLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTMSWPD  351

Query  33    RIYCSEITWPR  1
             RIYCSEITWPR
Sbjct  352   RIYCSEITWPR  362



>gb|ACR57217.1| 1-deoxy-d-xylulose 5-phosphate reductoisomerase [Salvia miltiorrhiza]
Length=474

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/371 (79%), Positives = 321/371 (87%), Gaps = 9/371 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKD----GGMRVKCSSqaaa  934
             MALN +   E K  SF    +SKSNYNL+ LK QGG A +RKD       RV CS+Q   
Sbjct  1     MALNLMYPTEIKTLSFLD--SSKSNYNLNPLKFQGGFAFKRKDSRCTASKRVHCSAQPPP  58

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                 P   GRAVAE  R TW+GPKPIS+IGSTGS+GTQ L++VAENP+K+R+VALAAGSN
Sbjct  59    PPAWP---GRAVAEPGRMTWEGPKPISVIGSTGSIGTQTLDIVAENPDKFRIVALAAGSN  115

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QV+ FKPKLVS+RDESLV ELKEAL+D ++KPEIIPGE+G+IEVARHPD VTVV
Sbjct  116   VTLLADQVRAFKPKLVSVRDESLVSELKEALADFEDKPEIIPGEQGMIEVARHPDAVTVV  175

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA KHNVKILPADSEHSAIFQ
Sbjct  176   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAKKHNVKILPADSEHSAIFQ  235

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGGAFRD PVEKLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  236   CIQGLPEGALRRIILTASGGAFRDLPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNK  295

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YD+IEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYTLSWP+
Sbjct  296   GLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPE  355

Query  33    RIYCSEITWPR  1
             RIYCSEI+WPR
Sbjct  356   RIYCSEISWPR  366



>gb|AGO04398.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rosa rugosa 
x Rosa sertata]
Length=472

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/371 (77%), Positives = 319/371 (86%), Gaps = 12/371 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDG----GMRVKCSSqaaa  934
             MALN +S AE KA SF       S  +    KL GG A+RR+D     G R++CS+QA  
Sbjct  1     MALNLLSPAEIKAISFLD-----STKSTHLPKLPGGFALRRRDCRTVIGRRIQCSAQAPP  55

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                 P   G A  E  R+TWDGPKPIS++GSTGS+GTQ L++VAENPEK+RVVALAAGSN
Sbjct  56    PPAWP---GSAFPEPGRRTWDGPKPISVVGSTGSIGTQTLDIVAENPEKFRVVALAAGSN  112

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLL  QVK FKPKLV++R+ESL++ELKEALS L++KPEIIPGE+G+IEVARHPD VTVV
Sbjct  113   VTLLVDQVKRFKPKLVAVRNESLLNELKEALSGLEDKPEIIPGEQGVIEVARHPDAVTVV  172

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ
Sbjct  173   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  232

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGGAFRDWPVEKLK+ KV DALKHP WSMGKKITVDSATLFNK
Sbjct  233   CIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNK  292

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYL+G +YD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SWP+
Sbjct  293   GLEVIEAHYLYGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDVRLPILYTMSWPE  352

Query  33    RIYCSEITWPR  1
             RIYCSE+T PR
Sbjct  353   RIYCSEVTRPR  363



>gb|KFK28008.1| hypothetical protein AALP_AA8G459700 [Arabis alpina]
Length=473

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/368 (77%), Positives = 320/368 (87%), Gaps = 6/368 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGMRVKCS-Sqaaaaqp  925
             M LN +S AE KA SF       ++      K+ GG ++R+++ G  VKCS      + P
Sbjct  2     MTLNSLSPAESKAISFLD-----TSRFNHFPKIPGGFSLRKRNQGKGVKCSVKVHQQSPP  56

Query  924   qpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTL  745
              PAWPGRAV E  R++WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSNVTL
Sbjct  57    PPAWPGRAVPESPRQSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTL  116

Query  744   LAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGI  565
             LA QV+ FKP LV++R+ESLV ELKEAL+DLD KPEIIPGE+G+IEVARHPD VTVVTGI
Sbjct  117   LADQVRRFKPSLVAVRNESLVGELKEALADLDYKPEIIPGEQGVIEVARHPDAVTVVTGI  176

Query  564   VGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQ  385
             VGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA+KHNVKILPADSEHSAIFQCIQ
Sbjct  177   VGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLANKHNVKILPADSEHSAIFQCIQ  236

Query  384   GLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLE  205
             GLPEGALRRIILTASGGAFRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFNKGLE
Sbjct  237   GLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLE  296

Query  204   VIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
             VIEAHYLFG +YD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD R+P+LYT+SWPDRI 
Sbjct  297   VIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRIPILYTMSWPDRIP  356

Query  24    CSEITWPR  1
             CSE+TWPR
Sbjct  357   CSEVTWPR  364



>ref|XP_011028721.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Populus euphratica]
Length=517

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/371 (78%), Positives = 325/371 (88%), Gaps = 7/371 (2%)
 Frame = -3

Query  1110  VRKMALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKD-GGMRVKCSSqaaa  934
             +R+ ALNF+S AE KA SF       S  +    KL G + ++RKD GG R++CS     
Sbjct  44    LRQDALNFLSPAEIKAISFLD-----STKSSHIPKLPGRLGLKRKDCGGRRIQCS-VQNQ  97

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
              QP PAWPGRA  E  RKTWDGPKPISI+GSTGS+GTQ L++V ENP+K+ VVALAAGSN
Sbjct  98    NQPPPAWPGRAFPEPGRKTWDGPKPISIVGSTGSIGTQTLDIVTENPDKFTVVALAAGSN  157

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QV+ FKP+LV++R+ESLVDELKEAL+D++EKPEIIPGE+G+IEVARHPD V+VV
Sbjct  158   VTLLADQVRRFKPQLVAVRNESLVDELKEALADVEEKPEIIPGEQGVIEVARHPDAVSVV  217

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDI LANKETLIAGGPFVLPLAHK+NVKILPADSEHSAIFQ
Sbjct  218   TGIVGCAGLKPTVAAIEAGKDICLANKETLIAGGPFVLPLAHKYNVKILPADSEHSAIFQ  277

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGGAFRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  278   CIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNK  337

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YDNI+I+IHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SWP+
Sbjct  338   GLEVIEAHYLFGAEYDNIDIIIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPE  397

Query  33    RIYCSEITWPR  1
             R+YCSEITWPR
Sbjct  398   RVYCSEITWPR  408



>dbj|BAF98290.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Hevea brasiliensis]
Length=471

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/371 (76%), Positives = 318/371 (86%), Gaps = 13/371 (4%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM----RVKCSSqaaa  934
             MALN +S AE KA SF       S  +    KL G  ++ RKD G     +V+CS+Q   
Sbjct  1     MALNLLSPAEIKAISFLD-----STKSSHLTKLPGSFSLNRKDFGAAFGKKVQCSAQPPP  55

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                     GRA  +  RKTWDGPKPIS++GSTGS+GTQ L++VAENP+K+RVVALAAGSN
Sbjct  56    PAWT----GRAFPDLGRKTWDGPKPISVVGSTGSIGTQTLDIVAENPDKFRVVALAAGSN  111

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QVKTFKP+LV++R+ESLV EL+EAL+D++EKPEIIPGE+G++EVARHPD V+VV
Sbjct  112   VTLLADQVKTFKPQLVAVRNESLVHELREALADVEEKPEIIPGEQGVVEVARHPDAVSVV  171

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDI LANKETLIAGGPFVLPLAHK+NVKILPADSEHSAIFQ
Sbjct  172   TGIVGCAGLKPTVAAIEAGKDICLANKETLIAGGPFVLPLAHKYNVKILPADSEHSAIFQ  231

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLP+GALRRIILTASGGAFRDWPV+KLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  232   CIQGLPDGALRRIILTASGGAFRDWPVDKLKEVKVADALKHPNWNMGKKITVDSATLFNK  291

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YDNIEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYT+SWPD
Sbjct  292   GLEVIEAHYLFGAEYDNIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTMSWPD  351

Query  33    RIYCSEITWPR  1
             RIYCSEITWPR
Sbjct  352   RIYCSEITWPR  362



>gb|AID55340.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Actinidia arguta]
Length=473

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/371 (77%), Positives = 317/371 (85%), Gaps = 11/371 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGMR----VKCSSqaaa  934
             MALN +S  E K  SF +   S    N   LKLQGG A++RKD G      + CS+Q   
Sbjct  1     MALNLLSPTEIKRISFLE---SSKPSNQHLLKLQGGFALKRKDCGSTFGRIIHCSAQQPP  57

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                     GRAV E  RKTWDGPKPIS++GSTGS+GTQ L++VAENP+K+R+VALAAGSN
Sbjct  58    PAWP----GRAVVEPDRKTWDGPKPISVVGSTGSIGTQTLDIVAENPDKFRIVALAAGSN  113

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QVK FKP+LV++R+ESLV EL EAL+D+++KPEIIPGE+G+IEVARHP+ VTVV
Sbjct  114   VTLLADQVKRFKPQLVAVRNESLVSELTEALADVEDKPEIIPGEQGVIEVARHPEAVTVV  173

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQ
Sbjct  174   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQ  233

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGGAFRD PV+KLKD KV DALKHP W+MGKKITVDSATLFNK
Sbjct  234   CIQGLPEGALRRIILTASGGAFRDLPVDKLKDVKVADALKHPNWNMGKKITVDSATLFNK  293

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YD+IEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYTLSWPD
Sbjct  294   GLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPD  353

Query  33    RIYCSEITWPR  1
             RIYCSEITWPR
Sbjct  354   RIYCSEITWPR  364



>emb|CAE00491.2| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Populus tremula 
x Populus alba]
Length=472

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/385 (75%), Positives = 325/385 (84%), Gaps = 23/385 (6%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKD-GGMRVKCSSqaaaaqp  925
             MALN +S AE KA SF       S  +    KLQGG+ ++RKD GG R++CS Q    QP
Sbjct  1     MALNILSPAEIKAISFLD-----STKSNRLPKLQGGLCLKRKDCGGRRIQCSVQNQNNQP  55

Query  924   qpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTL  745
              PAWPGRA  E  RKTWDGPKPISI+GSTGS+GTQ L++VAENP+K++VVALAAGSNV L
Sbjct  56    PPAWPGRACPEPGRKTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFKVVALAAGSNVAL  115

Query  744   LAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGI  565
             LA QV+TFKP+L+++R+E LVDELKEAL+D++EKPEIIPGE+G++EVARHPD V+VVTGI
Sbjct  116   LADQVRTFKPQLIAVRNELLVDELKEALADVEEKPEIIPGEQGVVEVARHPDAVSVVTGI  175

Query  564   VGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQ  385
             VGCAGLKPTVAAIEAGKDI LANKETLIAGGPFVLPLAHK+NVKILPADSEHSAIFQCIQ
Sbjct  176   VGCAGLKPTVAAIEAGKDICLANKETLIAGGPFVLPLAHKYNVKILPADSEHSAIFQCIQ  235

Query  384   GLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLE  205
             GLPEGALRRIILTASGGAFRDWPVEKLK+ KV DALKHP WSMGKKITVDSATLFNKGLE
Sbjct  236   GLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLE  295

Query  204   VIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
             VIEAHYLFG +YDNI+IVIH QSIIHSM+ETQDSSV+AQLG PD RLP+LYT+SWPDR+Y
Sbjct  296   VIEAHYLFGAEYDNIDIVIHQQSIIHSMIETQDSSVIAQLGWPDMRLPILYTMSWPDRVY  355

Query  24    CS-----------------EITWPR  1
             CS                 EITWPR
Sbjct  356   CSKAPDNVKYPSMDLAYAAEITWPR  380



>ref|XP_010546027.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Tarenaya hassleriana]
Length=473

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/365 (78%), Positives = 315/365 (86%), Gaps = 7/365 (2%)
 Frame = -3

Query  1095  LNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGMRVKCSSqaaaaqpqpa  916
             LN  S AE KA  F       S       K+ G V M+R++ G RV+CS      QP PA
Sbjct  7     LNSFSPAESKAACFMD-----SARFNQIPKIPGRVGMKRRNQGRRVQCS--VEGVQPPPA  59

Query  915   wPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAH  736
             WPGRA  E +R +WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSNVTLLA 
Sbjct  60    WPGRAAPEPARVSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLAD  119

Query  735   QVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGC  556
             Q+K FKP+LVSIRD +LV+ELKEAL+D++  PEIIPG++G+IEVARHPD VTVVTGIVGC
Sbjct  120   QIKRFKPELVSIRDVALVNELKEALADVERMPEIIPGDQGVIEVARHPDAVTVVTGIVGC  179

Query  555   AGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLP  376
             AGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA KHNVKILPADSEHSAIFQCIQGLP
Sbjct  180   AGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAKKHNVKILPADSEHSAIFQCIQGLP  239

Query  375   EGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIE  196
             EGALRRIILTASGGAFRDWPV+KLKD KV DALKHP W+MGKKITVDSATLFNKGLEVIE
Sbjct  240   EGALRRIILTASGGAFRDWPVDKLKDVKVADALKHPNWNMGKKITVDSATLFNKGLEVIE  299

Query  195   AHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSE  16
             AHYLFG +YDNI+IVIHPQSIIHSMVETQDSSVLAQLG PD R+P+LYT+SWPDRIYCSE
Sbjct  300   AHYLFGAEYDNIDIVIHPQSIIHSMVETQDSSVLAQLGWPDMRIPILYTMSWPDRIYCSE  359

Query  15    ITWPR  1
             ITWPR
Sbjct  360   ITWPR  364



>gb|KHN34312.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Glycine soja]
Length=475

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/371 (78%), Positives = 319/371 (86%), Gaps = 10/371 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKD----GGMRVKCSSqaaa  934
             MALN  S AE K+  F          N  + K  GG A +RK+     G RV CS    A
Sbjct  2     MALNISSPAEVKSIFF----ADSFKSNCLTAKFSGGFAFKRKERRAASGGRVYCS--VQA  55

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
               P PAWPGRAV E+ RKTWDGPKPISI+GSTGS+GTQ L++VAENP+K++VVALAAGSN
Sbjct  56    TPPPPAWPGRAVPEQGRKTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFKVVALAAGSN  115

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QVK FKP+LV++R+ESL+ EL+EAL D++EKPEIIPGE+G+IEVARHPD V+VV
Sbjct  116   VTLLADQVKRFKPQLVAVRNESLIAELEEALHDVEEKPEIIPGEQGIIEVARHPDAVSVV  175

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA KHNVKILPADSEHSAIFQ
Sbjct  176   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAQKHNVKILPADSEHSAIFQ  235

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRR+ILTASGGAFRDWPV+KLKD KV DALKHP W+MGKKITVDSATLFNK
Sbjct  236   CIQGLPEGALRRVILTASGGAFRDWPVDKLKDVKVADALKHPNWNMGKKITVDSATLFNK  295

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG DYD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYTLSWPD
Sbjct  296   GLEVIEAHYLFGADYDHIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTLSWPD  355

Query  33    RIYCSEITWPR  1
             RIYCSE+TWPR
Sbjct  356   RIYCSEVTWPR  366



>ref|XP_008239764.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Prunus mume]
Length=473

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/371 (76%), Positives = 316/371 (85%), Gaps = 11/371 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDG----GMRVKCSSqaaa  934
             MALN +S AE KA SF       S  +    KL GG A+RRKD     G R++CS+ A  
Sbjct  1     MALNLLSPAEIKAISFLD-----STKSTHLPKLPGGFALRRKDCKTVVGRRIQCSAAAQT  55

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
               P     GRAV E SR+TWDGPKPISI+GSTGS+GTQ L++VAENP+K+R+VALAAGSN
Sbjct  56    PPPAWP--GRAVLETSRRTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRIVALAAGSN  113

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLL  QVK FKP+LV++R+ESLV+EL EAL+DL+EKPEIIPGE+G+IEVARHPD VTVV
Sbjct  114   VTLLVDQVKRFKPQLVAVRNESLVNELNEALADLEEKPEIIPGEQGVIEVARHPDAVTVV  173

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHK      PADSEHSAIFQ
Sbjct  174   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKRXXXXXPADSEHSAIFQ  233

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGG+FRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  234   CIQGLPEGALRRIILTASGGSFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNK  293

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YDNI+IVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SWP+
Sbjct  294   GLEVIEAHYLFGAEYDNIDIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPE  353

Query  33    RIYCSEITWPR  1
             RIYCSE+TWPR
Sbjct  354   RIYCSEVTWPR  364



>gb|ABJ80680.1| 1-deoxy-d-xylulose 5-phosphate reductoisomerase [Salvia miltiorrhiza]
Length=474

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/371 (79%), Positives = 320/371 (86%), Gaps = 9/371 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKD----GGMRVKCSSqaaa  934
             MALN +S  E K  SF    +SKSNYNL+ LK QGG A ++KD       RV CS+Q   
Sbjct  1     MALNLMSPTEIKTLSFLD--SSKSNYNLNPLKFQGGFAFKKKDSTCTASKRVHCSAQPPP  58

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                 P   GRAVAE  R TW+GPKPIS+IGSTGS+GT  L++ AENP+K+R+VALAAGSN
Sbjct  59    PPAWP---GRAVAEPGRMTWEGPKPISVIGSTGSIGTHTLDIFAENPDKFRIVALAAGSN  115

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QV+ FKPKLVS+RDESLV ELKEAL+D ++KPEIIPGE+G+IEVARHPD VTVV
Sbjct  116   VTLLADQVRAFKPKLVSVRDESLVSELKEALADFEDKPEIIPGEQGMIEVARHPDAVTVV  175

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA KHNVKILPADSEHSAIFQ
Sbjct  176   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAKKHNVKILPADSEHSAIFQ  235

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGGAFRD PVEKLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  236   CIQGLPEGALRRIILTASGGAFRDLPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNK  295

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YD+IEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYTLSWP+
Sbjct  296   GLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPE  355

Query  33    RIYCSEITWPR  1
             RIYCSEI+WPR
Sbjct  356   RIYCSEISWPR  366



>ref|NP_001240062.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like 
[Glycine max]
 gb|AEB91528.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Glycine max]
Length=474

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/371 (78%), Positives = 319/371 (86%), Gaps = 10/371 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKD----GGMRVKCSSqaaa  934
             MALN  S AE K+  F          N  + K  GG A +RK+     G RV CS    A
Sbjct  1     MALNISSPAEVKSIFF----ADSFKSNCLTAKFSGGFAFKRKERRAASGGRVYCS--VQA  54

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
               P PAWPGRAV E+ RKTWDGPKPISI+GSTGS+GTQ L++VAENP+K++VVALAAGSN
Sbjct  55    TPPPPAWPGRAVPEQGRKTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFKVVALAAGSN  114

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QVK FKP+LV++R+ESL+ EL+EAL D++EKPEIIPGE+G+IEVARHPD V+VV
Sbjct  115   VTLLADQVKRFKPQLVAVRNESLIAELEEALHDVEEKPEIIPGEQGIIEVARHPDAVSVV  174

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA KHNVKILPADSEHSAIFQ
Sbjct  175   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAQKHNVKILPADSEHSAIFQ  234

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRR+ILTASGGAFRDWPV+KLKD KV DALKHP W+MGKKITVDSATLFNK
Sbjct  235   CIQGLPEGALRRVILTASGGAFRDWPVDKLKDVKVADALKHPNWNMGKKITVDSATLFNK  294

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG DYD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYTLSWPD
Sbjct  295   GLEVIEAHYLFGADYDHIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTLSWPD  354

Query  33    RIYCSEITWPR  1
             RIYCSE+TWPR
Sbjct  355   RIYCSEVTWPR  365



>ref|XP_006439815.1| hypothetical protein CICLE_v10020004mg [Citrus clementina]
 ref|XP_006439817.1| hypothetical protein CICLE_v10020004mg [Citrus clementina]
 gb|ESR53055.1| hypothetical protein CICLE_v10020004mg [Citrus clementina]
 gb|ESR53057.1| hypothetical protein CICLE_v10020004mg [Citrus clementina]
Length=369

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/372 (74%), Positives = 316/372 (85%), Gaps = 13/372 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDG-----GMRVKCSSqaa  937
             MALN  S AE KA SF +     +  N    KL GG  ++RKD      G  V+CS+Q  
Sbjct  1     MALNLQSPAEIKALSFLE----TTRSNHRLPKLSGGFPLKRKDNATATFGRIVQCSAQGP  56

Query  936   aaqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGS  757
                      GRAV E  RKTWDGPKPIS++GSTGS+GTQ L++VAE+ +K+RVVALAAGS
Sbjct  57    PPAWP----GRAVTETFRKTWDGPKPISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGS  112

Query  756   NVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTV  577
             N+TLLA QVK FKP++V++R+ESL+DE+KEAL++++EKPEI+ GE+G+IE ARHPD VTV
Sbjct  113   NITLLADQVKRFKPQVVAVRNESLLDEIKEALANVEEKPEILAGEQGVIEAARHPDAVTV  172

Query  576   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIF  397
             VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHN+KILPADSEHSAIF
Sbjct  173   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIF  232

Query  396   QCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFN  217
             QCIQGLPEGALRRIILTASGGAFRDWPVEKLK+ KV DALKHP WSMGKKITVDSATLFN
Sbjct  233   QCIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFN  292

Query  216   KGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWP  37
             KGLEVIEAHYLFG +YDNIEI+IHPQSIIHSMVETQDSSV+ QLG PD RLP++YT+SWP
Sbjct  293   KGLEVIEAHYLFGAEYDNIEIIIHPQSIIHSMVETQDSSVIGQLGWPDMRLPIIYTMSWP  352

Query  36    DRIYCSEITWPR  1
             +RIYCSE+TWPR
Sbjct  353   ERIYCSELTWPR  364



>ref|XP_007036224.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase isoform 2 [Theobroma 
cacao]
 gb|EOY20725.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase isoform 2 [Theobroma 
cacao]
Length=487

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/371 (77%), Positives = 317/371 (85%), Gaps = 8/371 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM----RVKCSSqaaa  934
             MALN IS  E K+ SF    ++KS  N       GG  ++RKD G     RV+CS+QA  
Sbjct  1     MALNLISSPEIKSISFLD--STKSKSNFLPKLFPGGFVLKRKDCGTTFGRRVQCSAQAPQ  58

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
               P     GRA  E  RKTWDGPKPISI+GSTGS+GTQ L++VAENP+K+RVV LAAGSN
Sbjct  59    PPPAWP--GRAFPEPGRKTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVGLAAGSN  116

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLL  QVKTFKP++V++R+ESLV ELKEAL+D+++KPEIIPGE+G+IEVARHPD V+VV
Sbjct  117   VTLLTDQVKTFKPQIVAVRNESLVSELKEALADMEQKPEIIPGEQGVIEVARHPDAVSVV  176

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQ
Sbjct  177   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQ  236

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPE ALRRIILTASGGAFRD PVEKLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  237   CIQGLPESALRRIILTASGGAFRDLPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNK  296

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YDNIEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYT+SWP+
Sbjct  297   GLEVIEAHYLFGAEYDNIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTMSWPE  356

Query  33    RIYCSEITWPR  1
             RIYCSEI+WPR
Sbjct  357   RIYCSEISWPR  367



>ref|XP_007036223.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase isoform 1 [Theobroma 
cacao]
 gb|EOY20724.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase isoform 1 [Theobroma 
cacao]
Length=476

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/371 (77%), Positives = 317/371 (85%), Gaps = 8/371 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM----RVKCSSqaaa  934
             MALN IS  E K+ SF    ++KS  N       GG  ++RKD G     RV+CS+QA  
Sbjct  1     MALNLISSPEIKSISFLD--STKSKSNFLPKLFPGGFVLKRKDCGTTFGRRVQCSAQAPQ  58

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
               P     GRA  E  RKTWDGPKPISI+GSTGS+GTQ L++VAENP+K+RVV LAAGSN
Sbjct  59    PPPAWP--GRAFPEPGRKTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVGLAAGSN  116

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLL  QVKTFKP++V++R+ESLV ELKEAL+D+++KPEIIPGE+G+IEVARHPD V+VV
Sbjct  117   VTLLTDQVKTFKPQIVAVRNESLVSELKEALADMEQKPEIIPGEQGVIEVARHPDAVSVV  176

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQ
Sbjct  177   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQ  236

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPE ALRRIILTASGGAFRD PVEKLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  237   CIQGLPESALRRIILTASGGAFRDLPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNK  296

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YDNIEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYT+SWP+
Sbjct  297   GLEVIEAHYLFGAEYDNIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTMSWPE  356

Query  33    RIYCSEITWPR  1
             RIYCSEI+WPR
Sbjct  357   RIYCSEISWPR  367



>ref|XP_007210092.1| hypothetical protein PRUPE_ppa020981mg, partial [Prunus persica]
 gb|EMJ11291.1| hypothetical protein PRUPE_ppa020981mg, partial [Prunus persica]
Length=443

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/336 (81%), Positives = 304/336 (90%), Gaps = 6/336 (2%)
 Frame = -3

Query  996  GVAMRRKDG----GMRVKCSSqaaaaqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSV  829
            G A+RRKD     G R++CS+ A    P     GRAV E SR+TWDGPKPISI+GSTGS+
Sbjct  1    GFALRRKDCKTVVGRRIQCSAAAQTPPPAWP--GRAVLETSRRTWDGPKPISIVGSTGSI  58

Query  828  GTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLD  649
            GTQ L++VAENP+K+R+VALAAGSNVTLL  QVK FKP+LV++R+ESLV+EL EAL+DL+
Sbjct  59   GTQTLDIVAENPDKFRIVALAAGSNVTLLVDQVKRFKPQLVAVRNESLVNELNEALADLE  118

Query  648  ekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGP  469
            EKPEIIPGE+G+IEVARHPD VTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGP
Sbjct  119  EKPEIIPGEQGVIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGP  178

Query  468  FVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKV  289
            FVLPLA KHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGG+FRDWPVEKLK+ KV
Sbjct  179  FVLPLARKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGSFRDWPVEKLKEVKV  238

Query  288  GDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQ  109
             DALKHP W+MGKKITVDSATLFNKGLEVIEAHYLFG +YDNI+IVIHPQSIIHSM+ETQ
Sbjct  239  ADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNIDIVIHPQSIIHSMIETQ  298

Query  108  DSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            DSSVLAQLG PD RLP+LYT+SWP+RIYCSE+TWPR
Sbjct  299  DSSVLAQLGWPDMRLPILYTMSWPERIYCSELTWPR  334



>gb|AAF65154.1|AF250235_1 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Catharanthus 
roseus]
Length=474

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/371 (80%), Positives = 326/371 (88%), Gaps = 10/371 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKD----GGMRVKCSSqaaa  934
             MALN +S  + K  SF    +SKSNYNL+ LKL GG A ++KD    GG +++CS     
Sbjct  1     MALNSLSPPKIKTISFLD--SSKSNYNLNLLKLPGGFAFKKKDFGASGGKKIQCS----V  54

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
               P PAWPGRAVAE   KTW+G KPISI+GSTGSVGTQ L++VAENP+K+RVVALAAGSN
Sbjct  55    QPPPPAWPGRAVAEPGYKTWEGQKPISIVGSTGSVGTQTLDIVAENPDKFRVVALAAGSN  114

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QVKTFKP+LVS+R+ESLV+ELKEALSD+D+KPEIIPGE+G++EV RH D VTVV
Sbjct  115   VTLLADQVKTFKPQLVSVRNESLVNELKEALSDVDDKPEIIPGEQGVVEVVRHSDAVTVV  174

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAG PFVLPLAHKH VKILPADSEHSAIFQ
Sbjct  175   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGXPFVLPLAHKHKVKILPADSEHSAIFQ  234

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGGAFRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  235   CIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNK  294

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YDNI+IVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYTLSWPD
Sbjct  295   GLEVIEAHYLFGAEYDNIDIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPD  354

Query  33    RIYCSEITWPR  1
             RI CSEITWPR
Sbjct  355   RISCSEITWPR  365



>gb|AAR99081.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Plectranthus 
barbatus]
Length=469

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/371 (79%), Positives = 320/371 (86%), Gaps = 14/371 (4%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKD----GGMRVKCSSqaaa  934
             MALN     E KA SF    +SKS+YNL+ LKL GG A +RKD       RV CS+Q   
Sbjct  1     MALNL----EIKALSFLD--SSKSSYNLNPLKLHGGFAFKRKDSRCSAPNRVHCSAQPPP  54

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                     GRAV E  RKTW+GPKPIS+IGSTGS+GTQ L++VAE+P+K+RVVALAAGSN
Sbjct  55    PAWP----GRAVYEPGRKTWEGPKPISVIGSTGSIGTQTLDIVAESPDKFRVVALAAGSN  110

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             V LLA QVK FKPKLVSI+DESLV ELKEAL+D+++KPEIIPGE+G+IEVARHPD VTVV
Sbjct  111   VALLADQVKAFKPKLVSIKDESLVSELKEALADVEDKPEIIPGEQGMIEVARHPDAVTVV  170

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHN KILPADSEHSAIFQ
Sbjct  171   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNAKILPADSEHSAIFQ  230

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGGAFRD PVEKLKD KV DALKHP W+MGKKITVDSATLFNK
Sbjct  231   CIQGLPEGALRRIILTASGGAFRDLPVEKLKDVKVADALKHPNWNMGKKITVDSATLFNK  290

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YD+IEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYTLSWPD
Sbjct  291   GLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPD  350

Query  33    RIYCSEITWPR  1
             R+YCSE+TWPR
Sbjct  351   RVYCSEVTWPR  361



>ref|XP_010678763.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=473

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/369 (77%), Positives = 318/369 (86%), Gaps = 7/369 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKD--GGMRVKCSSqaaaaq  928
             MALNF+S  E +A SF     S  ++ L     +G  + +RKD     R  C S  +A  
Sbjct  1     MALNFLSTVEIRAVSFLDSSNSTQHHKL-----KGNFSWKRKDIQTFSRKICCSAQSAQV  55

Query  927   pqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVT  748
             P PAWPGRAV E  RK WDGPKPISI+GSTGS+GTQ L++VAENP+K+R+VALAAGSNVT
Sbjct  56    PPPAWPGRAVVEPGRKAWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRIVALAAGSNVT  115

Query  747   LLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTG  568
             LLA Q+K FKP+LV++R+E+L+ EL+EA++D + KPEIIPGEEG++EVARHPD  TVVTG
Sbjct  116   LLADQIKRFKPELVAVRNEALLGELREAIADAEYKPEIIPGEEGVVEVARHPDAATVVTG  175

Query  567   IVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCI  388
             IVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCI
Sbjct  176   IVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCI  235

Query  387   QGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGL  208
             QGL EG+LRRIILTASGGAFRDWPVEKLK+AKV DALKHP WSMGKKITVDSATLFNKGL
Sbjct  236   QGLTEGSLRRIILTASGGAFRDWPVEKLKEAKVADALKHPNWSMGKKITVDSATLFNKGL  295

Query  207   EVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRI  28
             EVIEAHYLFG +YD+IEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYT+SWP+RI
Sbjct  296   EVIEAHYLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTMSWPERI  355

Query  27    YCSEITWPR  1
             YCSEITWPR
Sbjct  356   YCSEITWPR  364



>gb|KDO69664.1| hypothetical protein CISIN_1g012004mg [Citrus sinensis]
Length=369

 Score =   525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/372 (74%), Positives = 315/372 (85%), Gaps = 13/372 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDG-----GMRVKCSSqaa  937
             MALN    AE KA SF +     +  N    KL GG  ++RKD      G  V+CS+Q  
Sbjct  1     MALNLQIPAEIKALSFLE----TTRSNHRLPKLSGGFPLKRKDNATATFGRIVQCSAQGP  56

Query  936   aaqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGS  757
                      GRAV E  RKTWDGPKPIS++GSTGS+GTQ L++VAE+ +K+RVVALAAGS
Sbjct  57    PPAWP----GRAVTETFRKTWDGPKPISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGS  112

Query  756   NVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTV  577
             N+TLLA QVK FKP++V++R+ESL+DE+KEAL++++EKPEI+ GE+G+IE ARHPD VTV
Sbjct  113   NITLLADQVKRFKPQVVAVRNESLLDEIKEALANVEEKPEILAGEQGVIEAARHPDAVTV  172

Query  576   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIF  397
             VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHN+KILPADSEHSAIF
Sbjct  173   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIF  232

Query  396   QCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFN  217
             QCIQGLPEGALRRIILTASGGAFRDWPVEKLK+ KV DALKHP WSMGKKITVDSATLFN
Sbjct  233   QCIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFN  292

Query  216   KGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWP  37
             KGLEVIEAHYLFG +YDNIEI+IHPQSIIHSMVETQDSSV+ QLG PD RLP++YT+SWP
Sbjct  293   KGLEVIEAHYLFGAEYDNIEIIIHPQSIIHSMVETQDSSVIGQLGWPDMRLPIIYTMSWP  352

Query  36    DRIYCSEITWPR  1
             +RIYCSE+TWPR
Sbjct  353   ERIYCSELTWPR  364



>ref|NP_201085.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Arabidopsis 
thaliana]
 sp|Q9XFS9.2|DXR_ARATH RecName: Full=1-deoxy-D-xylulose 5-phosphate reductoisomerase, 
chloroplastic; Short=1-deoxyxylulose-5-phosphate reductoisomerase; 
Short=DXP reductoisomerase; AltName: Full=2-C-methyl-D-erythritol 
4-phosphate synthase; AltName: Full=Protein PIGMENT-DEFECTIVE 
EMBRYO 129; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF73140.1|AF148852_1 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Arabidopsis 
thaliana]
 dbj|BAB10848.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Arabidopsis 
thaliana]
 gb|AAK73992.1| AT5g62790/MQB2_90 [Arabidopsis thaliana]
 gb|AAK92737.1| putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase DXR 
[Arabidopsis thaliana]
 gb|AAK96873.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Arabidopsis 
thaliana]
 gb|AAM10015.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Arabidopsis 
thaliana]
 gb|AAM14344.1| putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXR) 
[Arabidopsis thaliana]
 gb|AAM19962.1| AT5g62790/MQB2_90 [Arabidopsis thaliana]
 gb|AAM61343.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase DXR [Arabidopsis 
thaliana]
 gb|AED97657.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Arabidopsis 
thaliana]
Length=477

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/372 (76%), Positives = 320/372 (86%), Gaps = 10/372 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGMR----VKCS-Sqaa  937
             M LN +S AE KA SF       ++      KL GG ++RR++ G      VKCS     
Sbjct  2     MTLNSLSPAESKAISFLD-----TSRFNPIPKLSGGFSLRRRNQGRGFGKGVKCSVKVQQ  56

Query  936   aaqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGS  757
               QP PAWPGRAV E  R++WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGS
Sbjct  57    QQQPPPAWPGRAVPEAPRQSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGS  116

Query  756   NVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTV  577
             NVTLLA QV+ FKP LV++R+ESL++ELKEAL+DLD K EIIPGE+G+IEVARHP+ VTV
Sbjct  117   NVTLLADQVRRFKPALVAVRNESLINELKEALADLDYKLEIIPGEQGVIEVARHPEAVTV  176

Query  576   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIF  397
             VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA+KHNVKILPADSEHSAIF
Sbjct  177   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLANKHNVKILPADSEHSAIF  236

Query  396   QCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFN  217
             QCIQGLPEGALR+IILTASGGAFRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFN
Sbjct  237   QCIQGLPEGALRKIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFN  296

Query  216   KGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWP  37
             KGLEVIEAHYLFG +YD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SWP
Sbjct  297   KGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWP  356

Query  36    DRIYCSEITWPR  1
             DR+ CSE+TWPR
Sbjct  357   DRVPCSEVTWPR  368



>gb|KDO69663.1| hypothetical protein CISIN_1g012004mg [Citrus sinensis]
Length=435

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/372 (74%), Positives = 315/372 (85%), Gaps = 13/372 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDG-----GMRVKCSSqaa  937
             MALN    AE KA SF +     +  N    KL GG  ++RKD      G  V+CS+Q  
Sbjct  1     MALNLQIPAEIKALSFLE----TTRSNHRLPKLSGGFPLKRKDNATATFGRIVQCSAQGP  56

Query  936   aaqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGS  757
                      GRAV E  RKTWDGPKPIS++GSTGS+GTQ L++VAE+ +K+RVVALAAGS
Sbjct  57    PPAWP----GRAVTETFRKTWDGPKPISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGS  112

Query  756   NVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTV  577
             N+TLLA QVK FKP++V++R+ESL+DE+KEAL++++EKPEI+ GE+G+IE ARHPD VTV
Sbjct  113   NITLLADQVKRFKPQVVAVRNESLLDEIKEALANVEEKPEILAGEQGVIEAARHPDAVTV  172

Query  576   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIF  397
             VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHN+KILPADSEHSAIF
Sbjct  173   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIF  232

Query  396   QCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFN  217
             QCIQGLPEGALRRIILTASGGAFRDWPVEKLK+ KV DALKHP WSMGKKITVDSATLFN
Sbjct  233   QCIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFN  292

Query  216   KGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWP  37
             KGLEVIEAHYLFG +YDNIEI+IHPQSIIHSMVETQDSSV+ QLG PD RLP++YT+SWP
Sbjct  293   KGLEVIEAHYLFGAEYDNIEIIIHPQSIIHSMVETQDSSVIGQLGWPDMRLPIIYTMSWP  352

Query  36    DRIYCSEITWPR  1
             +RIYCSE+TWPR
Sbjct  353   ERIYCSELTWPR  364



>gb|KHG00451.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Gossypium arboreum]
Length=473

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/370 (76%), Positives = 315/370 (85%), Gaps = 9/370 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDG---GMRVKCSSqaaaa  931
             MALN +S  E  + SF       +  +  S    GG  +++  G   G +V+CS+QA   
Sbjct  1     MALNLVSPPEIHSISFL----GSTKSSSFSKLFPGGFVLKKDCGTTFGRKVQCSAQAPQP  56

Query  930   qpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNV  751
              P     GRA  +  RKTWDGPKPISI+GSTGS+GTQ L++V ENP+K+RVVALAAGSNV
Sbjct  57    PPAWP--GRAFPDPGRKTWDGPKPISIVGSTGSIGTQTLDIVGENPDKFRVVALAAGSNV  114

Query  750   TLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVT  571
             TLL  QVKTFKP+LV++R+ESLV+ELKEAL+D+++KPEIIPGE G+IEVARHPD VTVVT
Sbjct  115   TLLVDQVKTFKPQLVAVRNESLVNELKEALADMEQKPEIIPGESGVIEVARHPDAVTVVT  174

Query  570   GIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQC  391
             GIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQC
Sbjct  175   GIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQC  234

Query  390   IQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKG  211
             IQGLPEGALRRIILTASGGAFRDWPV+KLK+ KV DALKHP W+MGKKITVDSATLFNKG
Sbjct  235   IQGLPEGALRRIILTASGGAFRDWPVDKLKEVKVADALKHPNWNMGKKITVDSATLFNKG  294

Query  210   LEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDR  31
             LEVIEAHYLFG +YD+IEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYT+SWP+R
Sbjct  295   LEVIEAHYLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTMSWPER  354

Query  30    IYCSEITWPR  1
             IYCSEITWPR
Sbjct  355   IYCSEITWPR  364



>gb|AIG92785.1| 1-deoxy-d-xylulose 5-phosphate synthase [Cymbopogon winterianus]
Length=475

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/303 (88%), Positives = 289/303 (95%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAVAE  R++WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSNVTLLA QV
Sbjct  64   GRAVAEPGRRSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQV  123

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            KTFKPKLV++R+ESLVDELKEAL+D +EKPEIIPGE+G+IEVARHPD VTVVTGIVGCAG
Sbjct  124  KTFKPKLVAVRNESLVDELKEALADCEEKPEIIPGEQGVIEVARHPDAVTVVTGIVGCAG  183

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQCIQGL EG
Sbjct  184  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLSEG  243

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
            ALRRIILTASGGAFRDWPV++LKD KV DALKHP W+MGKKITVDSATLFNKGLEVIEAH
Sbjct  244  ALRRIILTASGGAFRDWPVDRLKDVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAH  303

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YLFG +YD+IEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYTLSWPDRIYCSE+T
Sbjct  304  YLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPDRIYCSEVT  363

Query  9    WPR  1
            WPR
Sbjct  364  WPR  366



>ref|XP_006394351.1| hypothetical protein EUTSA_v10004122mg [Eutrema salsugineum]
 gb|ESQ31637.1| hypothetical protein EUTSA_v10004122mg [Eutrema salsugineum]
Length=477

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/372 (77%), Positives = 317/372 (85%), Gaps = 10/372 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRR----KDGGMRVKCS-Sqaa  937
             M LN +S AE KA SF       ++      K+ GG  +RR    KD G  VKCS     
Sbjct  2     MTLNSLSPAESKAISFLD-----TSRLNPIPKIPGGFCLRRTNQRKDFGKEVKCSVKVHQ  56

Query  936   aaqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGS  757
                P PAWPGRA+ E  R++WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGS
Sbjct  57    QPPPPPAWPGRAIPEPPRQSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGS  116

Query  756   NVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTV  577
             NVTLL  QVK FKP LV++R+ESLV+ELKEAL+ LD KPEIIPGE+G+IEVARHP+ VTV
Sbjct  117   NVTLLVDQVKRFKPALVAVRNESLVNELKEALAGLDYKPEIIPGEQGVIEVARHPEAVTV  176

Query  576   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIF  397
             VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA+KHNVKILPADSEHSAIF
Sbjct  177   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLANKHNVKILPADSEHSAIF  236

Query  396   QCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFN  217
             QCIQGLPEGALRRIILTASGGAFRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFN
Sbjct  237   QCIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFN  296

Query  216   KGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWP  37
             KGLEVIEAHYLFG +YD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SWP
Sbjct  297   KGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWP  356

Query  36    DRIYCSEITWPR  1
             DR+ CSE+TWPR
Sbjct  357   DRVPCSEVTWPR  368



>ref|XP_006439818.1| hypothetical protein CICLE_v10020004mg [Citrus clementina]
 gb|ESR53058.1| hypothetical protein CICLE_v10020004mg [Citrus clementina]
Length=473

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/372 (74%), Positives = 316/372 (85%), Gaps = 13/372 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDG-----GMRVKCSSqaa  937
             MALN  S AE KA SF +     +  N    KL GG  ++RKD      G  V+CS+Q  
Sbjct  1     MALNLQSPAEIKALSFLE----TTRSNHRLPKLSGGFPLKRKDNATATFGRIVQCSAQGP  56

Query  936   aaqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGS  757
                      GRAV E  RKTWDGPKPIS++GSTGS+GTQ L++VAE+ +K+RVVALAAGS
Sbjct  57    PPAWP----GRAVTETFRKTWDGPKPISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGS  112

Query  756   NVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTV  577
             N+TLLA QVK FKP++V++R+ESL+DE+KEAL++++EKPEI+ GE+G+IE ARHPD VTV
Sbjct  113   NITLLADQVKRFKPQVVAVRNESLLDEIKEALANVEEKPEILAGEQGVIEAARHPDAVTV  172

Query  576   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIF  397
             VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHN+KILPADSEHSAIF
Sbjct  173   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIF  232

Query  396   QCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFN  217
             QCIQGLPEGALRRIILTASGGAFRDWPVEKLK+ KV DALKHP WSMGKKITVDSATLFN
Sbjct  233   QCIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFN  292

Query  216   KGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWP  37
             KGLEVIEAHYLFG +YDNIEI+IHPQSIIHSMVETQDSSV+ QLG PD RLP++YT+SWP
Sbjct  293   KGLEVIEAHYLFGAEYDNIEIIIHPQSIIHSMVETQDSSVIGQLGWPDMRLPIIYTMSWP  352

Query  36    DRIYCSEITWPR  1
             +RIYCSE+TWPR
Sbjct  353   ERIYCSELTWPR  364



>gb|AAS94121.1| putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Hevea 
brasiliensis]
Length=471

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/371 (76%), Positives = 316/371 (85%), Gaps = 13/371 (4%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM----RVKCSSqaaa  934
             M LN +S AE KA SF       S  +    K  G ++++RKD G     +V+CS+Q   
Sbjct  1     MELNLLSPAEIKAISFLD-----STKSNHLPKFPGVISLKRKDFGAAFGRKVQCSAQPPP  55

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                     GRA  E  RKTWDGPKPIS++GSTGS+GTQ L++VAENP K+RVVALAAGSN
Sbjct  56    PAWP----GRAFPEPGRKTWDGPKPISVVGSTGSIGTQTLDIVAENPGKFRVVALAAGSN  111

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QVKTFKP+LV++R+ESL DELK+AL+DL+EKPEIIPGEEG++EVARHPD V+VV
Sbjct  112   VTLLADQVKTFKPQLVAVRNESLADELKDALADLEEKPEIIPGEEGVVEVARHPDAVSVV  171

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDI LANKETLIAGGPFVLPLAHK+NVKILPADSEHSA+FQ
Sbjct  172   TGIVGCAGLKPTVAAIEAGKDICLANKETLIAGGPFVLPLAHKYNVKILPADSEHSAVFQ  231

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLP+GALRRIILTASGGAFRDWPV++LK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  232   CIQGLPDGALRRIILTASGGAFRDWPVDRLKEVKVADALKHPNWNMGKKITVDSATLFNK  291

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG DYDNIEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+L T+SWP+
Sbjct  292   GLEVIEAHYLFGADYDNIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILCTMSWPE  351

Query  33    RIYCSEITWPR  1
             RIYCSEITWPR
Sbjct  352   RIYCSEITWPR  362



>gb|EYU42570.1| hypothetical protein MIMGU_mgv1a004650mg [Erythranthe guttata]
Length=475

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/371 (77%), Positives = 319/371 (86%), Gaps = 9/371 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGG----MRVKCSSqaaa  934
             MALN +S  E K  SF    +SKSNYNL+ LK  G  ++++K+ G     R +CS+    
Sbjct  1     MALNMLSPTELKTLSFMD--SSKSNYNLNLLKFPGVFSLKKKENGSTGSRRFRCSAAQPP  58

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                 P   GRAV E  RKTWDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSN
Sbjct  59    PPAWP---GRAVIEPGRKTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSN  115

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QVK FKP+LVS++DESLV+EL+EAL+ ++  PEIIPGE+G+IEVARHPD VT V
Sbjct  116   VTLLADQVKRFKPQLVSVKDESLVNELREALAGVENMPEIIPGEQGIIEVARHPDAVTTV  175

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA KHNVKILPADSEHSAIFQ
Sbjct  176   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAKKHNVKILPADSEHSAIFQ  235

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGGAFRD PVEKLKD KV DALKHP W+MGKKITVDSATLFNK
Sbjct  236   CIQGLPEGALRRIILTASGGAFRDLPVEKLKDVKVADALKHPNWNMGKKITVDSATLFNK  295

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YD+I+IVIHPQSIIHSM+ETQDSSVLAQLG PD R+P+LYTLSWPD
Sbjct  296   GLEVIEAHYLFGAEYDDIDIVIHPQSIIHSMIETQDSSVLAQLGWPDMRIPILYTLSWPD  355

Query  33    RIYCSEITWPR  1
             RIYCSEITWPR
Sbjct  356   RIYCSEITWPR  366



>gb|ACL54288.1| unknown [Zea mays]
Length=383

 Score =   524 bits (1350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/303 (88%), Positives = 289/303 (95%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAVAE  R++WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSNVTLLA QV
Sbjct  11   GRAVAEPGRRSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQV  70

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            KTFKPKLV++R+ESLVDELKEAL+D +EKPEIIPGE+G+IEVARHPD VTVVTGIVGCAG
Sbjct  71   KTFKPKLVAVRNESLVDELKEALADCEEKPEIIPGEQGVIEVARHPDAVTVVTGIVGCAG  130

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQCIQGL EG
Sbjct  131  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLSEG  190

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
            ALRRIILTASGGAFRDWPV++LKD KV DALKHP W+MG+KITVDSATLFNKGLEVIEAH
Sbjct  191  ALRRIILTASGGAFRDWPVDRLKDVKVADALKHPNWNMGRKITVDSATLFNKGLEVIEAH  250

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YLFG +YD+IEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYTLSWPDRIYCSE+T
Sbjct  251  YLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPDRIYCSEVT  310

Query  9    WPR  1
            WPR
Sbjct  311  WPR  313



>ref|XP_010101212.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Morus notabilis]
 gb|EXB87886.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Morus notabilis]
Length=471

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/371 (76%), Positives = 317/371 (85%), Gaps = 13/371 (4%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKD----GGMRVKCSSqaaa  934
             MALN +S AE KA SF       +  +    KL GG+ ++RKD       RV CS     
Sbjct  1     MALNLLSPAEVKAISFLD-----TTKSTCLPKLPGGITLQRKDCRAVSRRRVHCS----V  51

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
               P PAWPGRAV E SR +WDGPKPIS++GSTGS+GTQ L++VAENP+K+RVV LAAGSN
Sbjct  52    QSPPPAWPGRAVPEPSRNSWDGPKPISVLGSTGSIGTQTLDIVAENPDKFRVVGLAAGSN  111

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLL  QVK FKP++V++R+E+ + ELKEAL+D++EKPEIIPGE+G+IEVARHPD VTVV
Sbjct  112   VTLLVDQVKRFKPQIVAVRNEASIGELKEALADVEEKPEIIPGEQGVIEVARHPDAVTVV  171

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPF+LPLAHKHN+KILPADSEHSAIFQ
Sbjct  172   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFILPLAHKHNIKILPADSEHSAIFQ  231

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGL +GALRRIILTASGGAFRDWPVEKL + KV DALKHP W+MGKKITVDSATLFNK
Sbjct  232   CIQGLSDGALRRIILTASGGAFRDWPVEKLNEVKVADALKHPNWNMGKKITVDSATLFNK  291

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG DYDNI+IVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYT+SWPD
Sbjct  292   GLEVIEAHYLFGADYDNIDIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTMSWPD  351

Query  33    RIYCSEITWPR  1
             RIYCSEITWPR
Sbjct  352   RIYCSEITWPR  362



>ref|XP_010459323.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like 
[Camelina sativa]
Length=480

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/373 (75%), Positives = 315/373 (84%), Gaps = 11/373 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRK----DGGMRVKCSSqaaa  934
             M LN +S AE  A SFF      ++      K+ GG  +R++    D G  VKCS +   
Sbjct  3     MTLNSLSPAESVAISFFD-----TSRFNLIPKIPGGFGLRKRNQGRDFGKGVKCSVKVQQ  57

Query  933   aqpqpawP--GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAG  760
                 P     GRAV E  R++WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAG
Sbjct  58    QSSSPPPAWPGRAVPEAPRQSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAG  117

Query  759   SNVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVT  580
             SNVTLLA QV+ FKP LV++R+ESL++ELKEAL+DLD KPEIIPGE+G+IEVARHP+ VT
Sbjct  118   SNVTLLADQVRRFKPALVAVRNESLINELKEALADLDYKPEIIPGEQGVIEVARHPEAVT  177

Query  579   VVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAI  400
             VVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA KHNVKILPADSEHSAI
Sbjct  178   VVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAKKHNVKILPADSEHSAI  237

Query  399   FQCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLF  220
             FQCIQGLPEGALR+IILTASGGAFRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLF
Sbjct  238   FQCIQGLPEGALRKIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLF  297

Query  219   NKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSW  40
             NKGLEVIEAHYLFG +YD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SW
Sbjct  298   NKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSW  357

Query  39    PDRIYCSEITWPR  1
             PDR+ CSE+TWPR
Sbjct  358   PDRVPCSEVTWPR  370



>gb|ADD82536.1| 1-deoxyxylulose-5-phosphate reductoisomerase [Narcissus tazetta 
var. chinensis]
Length=470

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/332 (82%), Positives = 302/332 (91%), Gaps = 0/332 (0%)
 Frame = -3

Query  996  GVAMRRKDGGMRVKCSSqaaaaqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQC  817
            G  ++RK+ G  ++ +  +    P PAWPGRAV EE RK+WDGPKPISI+GSTGS+GTQ 
Sbjct  30   GFPLKRKERGTSLRRACCSMQQAPPPAWPGRAVVEEGRKSWDGPKPISIVGSTGSIGTQT  89

Query  816  LEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpe  637
            L++VAENP+K+RVVALAAGSNVTLLA QVK F P+LV++R+E+LVDELKEALSD+  KPE
Sbjct  90   LDIVAENPDKFRVVALAAGSNVTLLADQVKRFNPQLVAVRNEALVDELKEALSDVQHKPE  149

Query  636  iipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLP  457
            IIPGE+G+IEVARHPD V+VVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLP
Sbjct  150  IIPGEQGVIEVARHPDAVSVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLP  209

Query  456  LAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDAL  277
            LA KH VKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLK+ KV DAL
Sbjct  210  LAQKHKVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADAL  269

Query  276  KHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSV  97
            KHP W+MG+KITVDSATLFNKGLEVIEAHYLFG DYDN+EIVIHPQSIIHSMVETQDSSV
Sbjct  270  KHPNWNMGRKITVDSATLFNKGLEVIEAHYLFGADYDNVEIVIHPQSIIHSMVETQDSSV  329

Query  96   LAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            LAQLG PD RLP+LYT+SWP+RIYCSEITWPR
Sbjct  330  LAQLGWPDMRLPILYTMSWPERIYCSEITWPR  361



>tpg|DAA53826.1| TPA: hypothetical protein ZEAMMB73_662532 [Zea mays]
Length=433

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/303 (88%), Positives = 289/303 (95%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAVAE  R++WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSNVTLLA QV
Sbjct  61   GRAVAEPGRRSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQV  120

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            KTFKPKLV++R+ESLVDELKEAL+D +EKPEIIPGE+G+IEVARHPD VTVVTGIVGCAG
Sbjct  121  KTFKPKLVAVRNESLVDELKEALADCEEKPEIIPGEQGVIEVARHPDAVTVVTGIVGCAG  180

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQCIQGL EG
Sbjct  181  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLSEG  240

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
            ALRRIILTASGGAFRDWPV++LKD KV DALKHP W+MG+KITVDSATLFNKGLEVIEAH
Sbjct  241  ALRRIILTASGGAFRDWPVDRLKDVKVADALKHPNWNMGRKITVDSATLFNKGLEVIEAH  300

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YLFG +YD+IEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYTLSWPDRIYCSE+T
Sbjct  301  YLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPDRIYCSEVT  360

Query  9    WPR  1
            WPR
Sbjct  361  WPR  363



>tpg|DAA53825.1| TPA: 1-deoxy-D-xylulose 5-phosphate reductoisomeraseputative 
1-deoxy-D-xylulose 5-phosphate reductoisomerase [Zea mays]
Length=472

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/303 (88%), Positives = 289/303 (95%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAVAE  R++WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSNVTLLA QV
Sbjct  61   GRAVAEPGRRSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQV  120

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            KTFKPKLV++R+ESLVDELKEAL+D +EKPEIIPGE+G+IEVARHPD VTVVTGIVGCAG
Sbjct  121  KTFKPKLVAVRNESLVDELKEALADCEEKPEIIPGEQGVIEVARHPDAVTVVTGIVGCAG  180

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQCIQGL EG
Sbjct  181  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLSEG  240

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
            ALRRIILTASGGAFRDWPV++LKD KV DALKHP W+MG+KITVDSATLFNKGLEVIEAH
Sbjct  241  ALRRIILTASGGAFRDWPVDRLKDVKVADALKHPNWNMGRKITVDSATLFNKGLEVIEAH  300

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YLFG +YD+IEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYTLSWPDRIYCSE+T
Sbjct  301  YLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPDRIYCSEVT  360

Query  9    WPR  1
            WPR
Sbjct  361  WPR  363



>ref|NP_001105139.1| dxr protein [Zea mays]
 emb|CAC03581.1| putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Zea 
mays]
 gb|ACG33012.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Zea mays]
Length=472

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/303 (88%), Positives = 289/303 (95%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAVAE  R++WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSNVTLLA QV
Sbjct  61   GRAVAEPGRRSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQV  120

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            KTFKPKLV++R+ESLVDELKEAL+D +EKPEIIPGE+G+IEVARHPD VTVVTGIVGCAG
Sbjct  121  KTFKPKLVAVRNESLVDELKEALADCEEKPEIIPGEQGVIEVARHPDAVTVVTGIVGCAG  180

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQCIQGL EG
Sbjct  181  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLSEG  240

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
            ALRRIILTASGGAFRDWPV++LKD KV DALKHP W+MG+KITVDSATLFNKGLEVIEAH
Sbjct  241  ALRRIILTASGGAFRDWPVDRLKDVKVADALKHPNWNMGRKITVDSATLFNKGLEVIEAH  300

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YLFG +YD+IEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYTLSWPDRIYCSE+T
Sbjct  301  YLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPDRIYCSEVT  360

Query  9    WPR  1
            WPR
Sbjct  361  WPR  363



>gb|EYU42569.1| hypothetical protein MIMGU_mgv1a004650mg [Erythranthe guttata]
Length=516

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/372 (77%), Positives = 320/372 (86%), Gaps = 9/372 (2%)
 Frame = -3

Query  1104  KMALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGG----MRVKCSSqaa  937
             +MALN +S  E K  SF    +SKSNYNL+ LK  G  ++++K+ G     R +CS+   
Sbjct  41    EMALNMLSPTELKTLSFMD--SSKSNYNLNLLKFPGVFSLKKKENGSTGSRRFRCSAAQP  98

Query  936   aaqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGS  757
                  P   GRAV E  RKTWDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGS
Sbjct  99    PPPAWP---GRAVIEPGRKTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGS  155

Query  756   NVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTV  577
             NVTLLA QVK FKP+LVS++DESLV+EL+EAL+ ++  PEIIPGE+G+IEVARHPD VT 
Sbjct  156   NVTLLADQVKRFKPQLVSVKDESLVNELREALAGVENMPEIIPGEQGIIEVARHPDAVTT  215

Query  576   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIF  397
             VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA KHNVKILPADSEHSAIF
Sbjct  216   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAKKHNVKILPADSEHSAIF  275

Query  396   QCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFN  217
             QCIQGLPEGALRRIILTASGGAFRD PVEKLKD KV DALKHP W+MGKKITVDSATLFN
Sbjct  276   QCIQGLPEGALRRIILTASGGAFRDLPVEKLKDVKVADALKHPNWNMGKKITVDSATLFN  335

Query  216   KGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWP  37
             KGLEVIEAHYLFG +YD+I+IVIHPQSIIHSM+ETQDSSVLAQLG PD R+P+LYTLSWP
Sbjct  336   KGLEVIEAHYLFGAEYDDIDIVIHPQSIIHSMIETQDSSVLAQLGWPDMRIPILYTLSWP  395

Query  36    DRIYCSEITWPR  1
             DRIYCSEITWPR
Sbjct  396   DRIYCSEITWPR  407



>ref|XP_007155428.1| hypothetical protein PHAVU_003G200300g [Phaseolus vulgaris]
 gb|ESW27422.1| hypothetical protein PHAVU_003G200300g [Phaseolus vulgaris]
Length=470

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/367 (77%), Positives = 317/367 (86%), Gaps = 6/367 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGMRVKCSSqaaaaqpq  922
             MALN  S AE K+  F    +     N  + K  GG A ++K+ G RV CS    A  P 
Sbjct  1     MALNISSPAEVKSLFF----SDSFKSNCLTAKFPGGFAFKKKECGRRVSCS--VKAPPPP  54

Query  921   pawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLL  742
             PAWPGRA  E+  KTW+GPKPISI+GSTGS+GTQ L++VAENP+K++VVALAAGSNVTLL
Sbjct  55    PAWPGRAFPEQVGKTWEGPKPISIVGSTGSIGTQTLDIVAENPDKFKVVALAAGSNVTLL  114

Query  741   AHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIV  562
             A Q+KTFKP+LV++R+ESL+ EL+EAL D++ KPEIIPGE+G++EVARHPD V+VVTGIV
Sbjct  115   ADQIKTFKPQLVAVRNESLIAELEEALHDVEHKPEIIPGEQGIVEVARHPDAVSVVTGIV  174

Query  561   GCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQG  382
             GCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA KHNVKILPADSEHSAIFQCIQG
Sbjct  175   GCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAQKHNVKILPADSEHSAIFQCIQG  234

Query  381   LPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEV  202
             LPEGALRRIILTASGGAFRD PV+KLKD KV DALKHP W+MGKKITVDSATLFNKGLEV
Sbjct  235   LPEGALRRIILTASGGAFRDLPVDKLKDVKVADALKHPNWNMGKKITVDSATLFNKGLEV  294

Query  201   IEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYC  22
             IEAHYLFG +YD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYTLSWPDR+YC
Sbjct  295   IEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTLSWPDRVYC  354

Query  21    SEITWPR  1
             SE+TWPR
Sbjct  355   SEVTWPR  361



>ref|XP_006476776.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like 
[Citrus sinensis]
 gb|KDO69662.1| hypothetical protein CISIN_1g012004mg [Citrus sinensis]
Length=473

 Score =   525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/372 (74%), Positives = 315/372 (85%), Gaps = 13/372 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDG-----GMRVKCSSqaa  937
             MALN    AE KA SF +     +  N    KL GG  ++RKD      G  V+CS+Q  
Sbjct  1     MALNLQIPAEIKALSFLE----TTRSNHRLPKLSGGFPLKRKDNATATFGRIVQCSAQGP  56

Query  936   aaqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGS  757
                      GRAV E  RKTWDGPKPIS++GSTGS+GTQ L++VAE+ +K+RVVALAAGS
Sbjct  57    PPAWP----GRAVTETFRKTWDGPKPISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGS  112

Query  756   NVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTV  577
             N+TLLA QVK FKP++V++R+ESL+DE+KEAL++++EKPEI+ GE+G+IE ARHPD VTV
Sbjct  113   NITLLADQVKRFKPQVVAVRNESLLDEIKEALANVEEKPEILAGEQGVIEAARHPDAVTV  172

Query  576   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIF  397
             VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHN+KILPADSEHSAIF
Sbjct  173   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIF  232

Query  396   QCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFN  217
             QCIQGLPEGALRRIILTASGGAFRDWPVEKLK+ KV DALKHP WSMGKKITVDSATLFN
Sbjct  233   QCIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFN  292

Query  216   KGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWP  37
             KGLEVIEAHYLFG +YDNIEI+IHPQSIIHSMVETQDSSV+ QLG PD RLP++YT+SWP
Sbjct  293   KGLEVIEAHYLFGAEYDNIEIIIHPQSIIHSMVETQDSSVIGQLGWPDMRLPIIYTMSWP  352

Query  36    DRIYCSEITWPR  1
             +RIYCSE+TWPR
Sbjct  353   ERIYCSELTWPR  364



>sp|Q9XES0.2|DXR_MENPI RecName: Full=1-deoxy-D-xylulose 5-phosphate reductoisomerase, 
chloroplastic; Short=1-deoxyxylulose-5-phosphate reductoisomerase; 
Short=DXP reductoisomerase; AltName: Full=2-C-methyl-D-erythritol 
4-phosphate synthase; Flags: Precursor [Mentha 
x piperita]
 gb|AAD24768.2|AF116825_1 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Mentha x piperita]
Length=470

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/338 (81%), Positives = 300/338 (89%), Gaps = 6/338 (2%)
 Frame = -3

Query  1002  QGGVAMRRKDGGM----RVKCSSqaaaaqpqpawPGRAVAEESRKTWDGPKPISIIGSTG  835
             QGG A +RKD G     RV CS+Q+ +  P     GRA  E  R TW+GPKPIS+IGSTG
Sbjct  27    QGGFAFKRKDSGCTAAKRVHCSAQSQSPPPAWP--GRAFPEPGRMTWEGPKPISVIGSTG  84

Query  834   SVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESLVDELKEALSD  655
             S+GTQ L++VAENP+K+R+VALAAGSNVTLLA QVK FKPKLVS++DESL+ ELKEAL+ 
Sbjct  85    SIGTQTLDIVAENPDKFRIVALAAGSNVTLLADQVKAFKPKLVSVKDESLISELKEALAG  144

Query  654   LDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAG  475
              ++ PEIIPGE+G+IEVARHPD VTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAG
Sbjct  145   FEDMPEIIPGEQGMIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAG  204

Query  474   GPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKDA  295
             GPFVLPLA KHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRD PVEKLK+ 
Sbjct  205   GPFVLPLAKKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDLPVEKLKEV  264

Query  294   KVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVE  115
             KV DALKHP W+MGKKITVDSATLFNKGLEVIEAHYLFG +YD+IEIVIHPQSIIHSMVE
Sbjct  265   KVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMVE  324

Query  114   TQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
             TQDSSVLAQLG PD RLP+LYTLSWP+RIYCSEITWPR
Sbjct  325   TQDSSVLAQLGWPDMRLPILYTLSWPERIYCSEITWPR  362



>ref|XP_010483992.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Camelina sativa]
Length=478

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/372 (76%), Positives = 320/372 (86%), Gaps = 10/372 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGMR----VKCS-Sqaa  937
             M LN +S AE  A SF       ++      KL GG ++R+++ G+     +KCS     
Sbjct  2     MTLNSLSPAESIAISFLD-----TSRFNLIPKLPGGFSLRKRNQGIGFGKGIKCSVKVQQ  56

Query  936   aaqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGS  757
              + P PAWPGRAV E  R++WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGS
Sbjct  57    QSSPPPAWPGRAVPEAPRQSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGS  116

Query  756   NVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTV  577
             NVTLLA QV+ FKP LV++R+ESL++ELKEAL DLD KPEIIPGE+G+IEVARHP+ VTV
Sbjct  117   NVTLLADQVRRFKPALVAVRNESLINELKEALVDLDYKPEIIPGEQGVIEVARHPEAVTV  176

Query  576   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIF  397
             VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA+KHNVKILPADSEHSAIF
Sbjct  177   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLANKHNVKILPADSEHSAIF  236

Query  396   QCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFN  217
             QCIQGLPEGALR+IILTASGGAFRDWPVEKLKD KV DALKHP W+MGKKITVDSATLFN
Sbjct  237   QCIQGLPEGALRKIILTASGGAFRDWPVEKLKDVKVADALKHPNWNMGKKITVDSATLFN  296

Query  216   KGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWP  37
             KGLEVIEAHYLFG +YD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SWP
Sbjct  297   KGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWP  356

Query  36    DRIYCSEITWPR  1
             DR+ CSE+TWPR
Sbjct  357   DRVPCSEVTWPR  368



>gb|AES91160.2| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Medicago truncatula]
Length=475

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/371 (77%), Positives = 319/371 (86%), Gaps = 9/371 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM----RVKCSSqaaa  934
             MALN  S AE K+  FF   T     N  + K  GGVA++RK+ G     RV CS   + 
Sbjct  1     MALNLYSPAELKS-GFF---TDPLKSNRFTPKFPGGVALKRKENGTASGTRVYCS-VQST  55

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
             + P PAWPGRA+ E   KTW+GPKPISI+G TGS+GTQ L++VAENP+K+RVVALAAGSN
Sbjct  56    SGPPPAWPGRAIPELGNKTWEGPKPISIVGCTGSIGTQTLDIVAENPDKFRVVALAAGSN  115

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             +TLL  QVK FKP+LV++R+ESL+ EL+EAL D++EKPEIIPGE+G+IEVARHPD VTVV
Sbjct  116   ITLLVDQVKRFKPQLVAVRNESLLAELQEALKDVEEKPEIIPGEQGVIEVARHPDAVTVV  175

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA KHNVKILPADSEHSAIFQ
Sbjct  176   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLARKHNVKILPADSEHSAIFQ  235

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGL EGALRR+ILTASGGAFRDWPVEKLKD KV DALKHP WSMGKKITVDSATLFNK
Sbjct  236   CIQGLTEGALRRVILTASGGAFRDWPVEKLKDVKVADALKHPNWSMGKKITVDSATLFNK  295

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG DYD+I+IVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYTLSWPD
Sbjct  296   GLEVIEAHYLFGADYDDIDIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTLSWPD  355

Query  33    RIYCSEITWPR  1
             R+YCSE+TWPR
Sbjct  356   RVYCSEVTWPR  366



>ref|XP_004967950.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like 
isoform X2 [Setaria italica]
Length=472

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/303 (87%), Positives = 289/303 (95%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAVAE  R++WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSNVTLLA QV
Sbjct  61   GRAVAEPGRRSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQV  120

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            KTFKPKLV++R+ESLVDELKEA++D +EKPEIIPGE+G+IEVARHPD VTVVTGIVGCAG
Sbjct  121  KTFKPKLVAVRNESLVDELKEAIADCEEKPEIIPGEQGVIEVARHPDAVTVVTGIVGCAG  180

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQCIQGL EG
Sbjct  181  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLSEG  240

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
            ALRR+ILTASGGAFRDWPV+KLKD KV DALKHP W+MGKKITVDSATLFNKGLEVIEAH
Sbjct  241  ALRRVILTASGGAFRDWPVDKLKDVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAH  300

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YLFG +YD+IEIVIHPQSIIHSMVETQDSSVLAQLG PD R+P+LYTLSWPDRIYCSE+T
Sbjct  301  YLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRIPILYTLSWPDRIYCSEVT  360

Query  9    WPR  1
            WPR
Sbjct  361  WPR  363



>ref|XP_006844992.1| hypothetical protein AMTR_s00058p00194850 [Amborella trichopoda]
 gb|ERN06667.1| hypothetical protein AMTR_s00058p00194850 [Amborella trichopoda]
Length=474

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/338 (81%), Positives = 299/338 (88%), Gaps = 7/338 (2%)
 Frame = -3

Query  1002  QGGVAMRRKDGGM---RVKCSSqaaaaqpqpawPGRAVAEE-SRKTWDGPKPISIIGSTG  835
             +G V +++KD G    R  CS+        P   GRAV E+  +KTWDGPKPIS++GSTG
Sbjct  32    KGTVGLKKKDRGFCGNRTYCSAATQPPPAWP---GRAVLEDGKKKTWDGPKPISVVGSTG  88

Query  834   SVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESLVDELKEALSD  655
             S+GTQ L++VAENP+K+RVVALAAGSNVTLLA QVKTFKP+LV++R+ESL DELKEAL+D
Sbjct  89    SIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQVKTFKPQLVAVRNESLFDELKEALAD  148

Query  654   LDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAG  475
              D KPEIIPGE+G+IEVARHPD VTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAG
Sbjct  149   ADYKPEIIPGEKGVIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAG  208

Query  474   GPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKDA  295
             GPFVLPLA KH VKILPADSEHSAIFQCIQGLPEGALRRI+LTASGGAFRDWPV KLK  
Sbjct  209   GPFVLPLARKHKVKILPADSEHSAIFQCIQGLPEGALRRIVLTASGGAFRDWPVAKLKQV  268

Query  294   KVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVE  115
             KV DALKHP W+MGKKITVDSATLFNKGLEVIEAHYLFG +YDNIEIVIHPQSIIHSMVE
Sbjct  269   KVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNIEIVIHPQSIIHSMVE  328

Query  114   TQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
             TQDSSVLAQLG PD RLP+LYT+SWPDRIYCSEITWPR
Sbjct  329   TQDSSVLAQLGWPDMRLPILYTMSWPDRIYCSEITWPR  366



>ref|XP_010910760.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like, 
partial [Elaeis guineensis]
Length=375

 Score =   521 bits (1341),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/303 (88%), Positives = 286/303 (94%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAVAE SRK+WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSNVTLLA QV
Sbjct  61   GRAVAESSRKSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQV  120

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            K FKP+LVS+R+ESLV ELKEAL+D + KPEIIPGE+G+IEVARHPD VTVVTGIVGCAG
Sbjct  121  KQFKPQLVSVRNESLVGELKEALADAEHKPEIIPGEQGVIEVARHPDAVTVVTGIVGCAG  180

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAG DIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQCIQGLPEG
Sbjct  181  LKPTVAAIEAGIDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLPEG  240

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
            ALRRIILTASGGAFRD PVEKLK+ KV DALKHP W+MGKKITVDSATLFNKGLEVIEAH
Sbjct  241  ALRRIILTASGGAFRDLPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAH  300

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YLFG +YDNIEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYT+SWP+RIYCSEIT
Sbjct  301  YLFGAEYDNIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTMSWPERIYCSEIT  360

Query  9    WPR  1
            WPR
Sbjct  361  WPR  363



>gb|AAW28998.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Antirrhinum 
majus]
Length=471

 Score =   524 bits (1350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/371 (77%), Positives = 324/371 (87%), Gaps = 13/371 (4%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM----RVKCSSqaaa  934
             MALN +S +E K+ SF    +SKSNYNL+  KLQG   ++RK+ G     RV+C +Q   
Sbjct  1     MALNMLSPSEIKSLSFLD--SSKSNYNLNLFKLQG---LKRKENGCSAVKRVQCLAQTPP  55

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                     GRAVA+   K W+GPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSN
Sbjct  56    PAWA----GRAVADPGHKRWEGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSN  111

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA Q++TFKP+LVS+RDESL++ELKEAL D+++KPEIIPGE+G+IEVARHPD VTVV
Sbjct  112   VTLLADQIRTFKPQLVSVRDESLINELKEALFDVEDKPEIIPGEQGIIEVARHPDAVTVV  171

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQ
Sbjct  172   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQ  231

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRR+ILTASGGAFRD PVEKLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  232   CIQGLPEGALRRVILTASGGAFRDLPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNK  291

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YD+IEIVIHPQSIIHSM+ETQDSS+LAQLG PD RLP+LYTLSWPD
Sbjct  292   GLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSILAQLGWPDMRLPILYTLSWPD  351

Query  33    RIYCSEITWPR  1
             R++CSEITWPR
Sbjct  352   RVHCSEITWPR  362



>gb|ABC86579.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Camptotheca 
acuminata]
Length=472

 Score =   524 bits (1350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/371 (75%), Positives = 313/371 (84%), Gaps = 11/371 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM----RVKCSSqaaa  934
             MALN +S  E KA SF     S  + N   LKLQGG+A++RKD G     R+ CS+Q   
Sbjct  1     MALNLLSPTEIKAISFLD---SSKSNNSYLLKLQGGIALKRKDYGATFGKRIHCSTQPPP  57

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                     GRAVAE  RK WDGPKPI+++GSTGS+GTQ L++VAE+P+K+RVVALAAGSN
Sbjct  58    PAWP----GRAVAEPGRKIWDGPKPIAVVGSTGSIGTQTLDIVAEHPDKFRVVALAAGSN  113

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             V LLA QV+ FKPKLV+IR+ESL+ ELK ALSD + KPEII GEEG+ EVARHP+ V+V+
Sbjct  114   VALLADQVRQFKPKLVAIRNESLITELKAALSDFEPKPEIISGEEGIAEVARHPEAVSVM  173

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQ
Sbjct  174   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQ  233

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGGAFRDW V KLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  234   CIQGLPEGALRRIILTASGGAFRDWLVGKLKEVKVSDALKHPNWNMGKKITVDSATLFNK  293

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYL+G DYDNIEIVIHPQSI+HSMVETQDSSVLAQLG PD RLP+LYT+SWP+
Sbjct  294   GLEVIEAHYLYGADYDNIEIVIHPQSIVHSMVETQDSSVLAQLGWPDMRLPILYTMSWPE  353

Query  33    RIYCSEITWPR  1
             R+ CSE+TWPR
Sbjct  354   RVPCSEVTWPR  364



>gb|EAY72208.1| hypothetical protein OsI_00059 [Oryza sativa Indica Group]
Length=473

 Score =   524 bits (1350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/303 (87%), Positives = 287/303 (95%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAV E  R++WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSNVTLLA QV
Sbjct  62   GRAVVEPGRRSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQV  121

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            KTFKPKLV++R+ESLVDELKEAL+D D KPEIIPGE+G+IEVARHPD VTVVTGIVGCAG
Sbjct  122  KTFKPKLVAVRNESLVDELKEALADCDWKPEIIPGEQGVIEVARHPDAVTVVTGIVGCAG  181

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGPFVLPLA KH VKILPADSEHSAIFQCIQGLPEG
Sbjct  182  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAQKHKVKILPADSEHSAIFQCIQGLPEG  241

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
            ALRRIILTASGGAFRDWPV+KLK+ KV DALKHP W+MGKKITVDSATLFNKGLEVIEAH
Sbjct  242  ALRRIILTASGGAFRDWPVDKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAH  301

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YLFG +YD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD R+P+LYT+SWPDRIYCSEIT
Sbjct  302  YLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRIPILYTMSWPDRIYCSEIT  361

Query  9    WPR  1
            WPR
Sbjct  362  WPR  364



>ref|XP_010940050.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Elaeis guineensis]
Length=470

 Score =   524 bits (1349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/329 (83%), Positives = 295/329 (90%), Gaps = 2/329 (1%)
 Frame = -3

Query  987  MRRKDGGMRVKCSSqaaaaqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEV  808
            MRR+ G  R  C S   A  P     GRAVAE  RK+WDGPKPISI+GSTGS+GTQ L++
Sbjct  35   MRRRIGSSRRTCCSMQQAPPPAWP--GRAVAESGRKSWDGPKPISIVGSTGSIGTQTLDI  92

Query  807  VAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiip  628
            VAENP+K+RVVALAAGSNVTLLA QVKTFKP+LV++R+ESL+ ELKEAL+D + KPEIIP
Sbjct  93   VAENPDKFRVVALAAGSNVTLLADQVKTFKPQLVAVRNESLIGELKEALADAEHKPEIIP  152

Query  627  geegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAH  448
            GE+G+IEVARHPD VTVVTGIVGCAGLKPTVAAIEAG DIALANKETLIAGGPFVLPLAH
Sbjct  153  GEQGVIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGIDIALANKETLIAGGPFVLPLAH  212

Query  447  KHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHP  268
            KH VKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRD PVEKLK+ KV DALKHP
Sbjct  213  KHKVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDLPVEKLKEVKVVDALKHP  272

Query  267  IWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQ  88
             W+MGKKITVDSATLFNKGLEVIEAHYLFG DYDNIEIVIHPQSIIHSMVETQDSSVLAQ
Sbjct  273  NWNMGKKITVDSATLFNKGLEVIEAHYLFGADYDNIEIVIHPQSIIHSMVETQDSSVLAQ  332

Query  87   LGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            LG PD RLP+LYT+SWP RIYCSEITWPR
Sbjct  333  LGWPDMRLPILYTMSWPQRIYCSEITWPR  361



>gb|AHZ96598.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Aquilaria sinensis]
Length=478

 Score =   524 bits (1350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/371 (78%), Positives = 319/371 (86%), Gaps = 6/371 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM----RVKCSSqaaa  934
             MALN     E K+ +F    + KSN+ L      GG ++RRK GG     R+ C++Q  A
Sbjct  1     MALNLACPTEIKSIAFLD--SLKSNFILFPKTCPGGFSLRRKVGGTTYGTRLVCAAQNQA  58

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
              QP PAWPGRA  E  RK+ D  KPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSN
Sbjct  59    QQPPPAWPGRAFPEPGRKSSDSAKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSN  118

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QVKTFKP+LV++R+E LVDELKEAL+D++EKP II GE+G+IEVARHPD VTVV
Sbjct  119   VTLLADQVKTFKPQLVAVRNELLVDELKEALADMEEKPAIIRGEQGVIEVARHPDAVTVV  178

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQ
Sbjct  179   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQ  238

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRRIILTASGGAFRD PVEKLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  239   CIQGLPEGALRRIILTASGGAFRDLPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNK  298

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YDNIEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYT+SWP+
Sbjct  299   GLEVIEAHYLFGAEYDNIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTMSWPE  358

Query  33    RIYCSEITWPR  1
             RIYCSEITWPR
Sbjct  359   RIYCSEITWPR  369



>gb|ABN13969.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Gossypium barbadense]
Length=473

 Score =   524 bits (1349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/370 (75%), Positives = 313/370 (85%), Gaps = 9/370 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDG---GMRVKCSSqaaaa  931
             MALN +S  E  + SF       +  +  S    GG  +++  G   G  V+CS+QA   
Sbjct  1     MALNLVSPPEIHSISFL----GSTKSSSFSKLFPGGFVLKKDCGTTFGREVQCSAQAPQP  56

Query  930   qpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNV  751
              P     GRA  +  RKTWDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSNV
Sbjct  57    PPAWP--GRAFPDPGRKTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNV  114

Query  750   TLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVT  571
             TLL  QVKTFKP+LV++R+ESLV+ELKEAL+D+++KPEIIPGE G+IEVARHPD VTVVT
Sbjct  115   TLLVDQVKTFKPQLVAVRNESLVNELKEALADMEQKPEIIPGESGVIEVARHPDAVTVVT  174

Query  570   GIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQC  391
             GIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPAD EHSAIFQC
Sbjct  175   GIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADFEHSAIFQC  234

Query  390   IQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKG  211
             IQGLPEGALR IILTASGGAFRDWPV+KLK+ KV DALKHP W+MGKKITVDSATLFNKG
Sbjct  235   IQGLPEGALRHIILTASGGAFRDWPVDKLKEVKVADALKHPNWNMGKKITVDSATLFNKG  294

Query  210   LEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDR  31
             LEVIEAHYLFG +YD+IEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYT+SWP+R
Sbjct  295   LEVIEAHYLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTMSWPER  354

Query  30    IYCSEITWPR  1
             IYCSEITWPR
Sbjct  355   IYCSEITWPR  364



>gb|AHJ57307.1| chloroplast 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Lilium 
longiflorum]
Length=472

 Score =   524 bits (1349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/336 (82%), Positives = 301/336 (90%), Gaps = 7/336 (2%)
 Frame = -3

Query  996  GVAMRRKDGGM----RVKCSSqaaaaqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSV  829
            G+   RKD GM    RV CS       P PAWPGRAV+E  RK+WDGPKPISI+GSTGS+
Sbjct  31   GIHAMRKDEGMSCMKRVSCS---MQQGPPPAWPGRAVSEPGRKSWDGPKPISIVGSTGSI  87

Query  828  GTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLD  649
            GTQ L++VAENP+K+RVVALAAGSNVTLLA QVKTF+P+LV++R+ESL+ ELKEAL+D D
Sbjct  88   GTQTLDIVAENPDKFRVVALAAGSNVTLLADQVKTFRPQLVAVRNESLLGELKEALADAD  147

Query  648  ekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGP  469
             KP II GEEG++EVARHPD VTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGP
Sbjct  148  YKPIIIIGEEGVVEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGP  207

Query  468  FVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKV  289
            FVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDW VE+LK+ KV
Sbjct  208  FVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWDVERLKEVKV  267

Query  288  GDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQ  109
             DALKHP W+MGKKITVDSATLFNKGLEVIEAHYLFG +YD++EIVIHPQSIIHSM+ETQ
Sbjct  268  ADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDDVEIVIHPQSIIHSMIETQ  327

Query  108  DSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            DSSVLAQLG PD RLP+LYTLSWP+RIYCSE TWPR
Sbjct  328  DSSVLAQLGWPDMRLPILYTLSWPERIYCSEKTWPR  363



>ref|XP_009112033.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Brassica rapa]
Length=475

 Score =   524 bits (1349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/371 (76%), Positives = 319/371 (86%), Gaps = 10/371 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDG----GMRVKCSSqaaa  934
             M L  +S A+ K+ S F   TS+ N         GG ++R+++     G  VKCS     
Sbjct  2     MTLTSLSPADSKSLSSFLDTTSRFNPTPKL---PGGFSLRKRNQRRGFGKGVKCS---VQ  55

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
               P PAWPGRAV E  R++WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSN
Sbjct  56    QPPPPAWPGRAVPELPRQSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSN  115

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QVK FKP LV++R+ESL++ELKEAL+DLD KPEIIPGE+G+IEVARHPD VTVV
Sbjct  116   VTLLADQVKRFKPALVAVRNESLLNELKEALADLDYKPEIIPGEQGVIEVARHPDAVTVV  175

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA+KHNVKILPADSEHSAIFQ
Sbjct  176   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLANKHNVKILPADSEHSAIFQ  235

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALR+IILTASGGAFRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  236   CIQGLPEGALRKIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNK  295

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SWPD
Sbjct  296   GLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPD  355

Query  33    RIYCSEITWPR  1
             R+ CSE+TWPR
Sbjct  356   RVPCSEVTWPR  366



>ref|NP_001041780.1| Os01g0106900 [Oryza sativa Japonica Group]
 sp|Q8W250.2|DXR_ORYSJ RecName: Full=1-deoxy-D-xylulose 5-phosphate reductoisomerase, 
chloroplastic; Short=1-deoxyxylulose-5-phosphate reductoisomerase; 
Short=DXP reductoisomerase; AltName: Full=2-C-methyl-D-erythritol 
4-phosphate synthase; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAB16915.1| putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Oryza 
sativa Japonica Group]
 dbj|BAB78606.1| putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Oryza 
sativa Japonica Group]
 dbj|BAF03694.1| Os01g0106900 [Oryza sativa Japonica Group]
 dbj|BAG94262.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53719.1| hypothetical protein OsJ_00058 [Oryza sativa Japonica Group]
Length=473

 Score =   523 bits (1348),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/303 (87%), Positives = 287/303 (95%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAV E  R++WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSNVTLLA QV
Sbjct  62   GRAVVEPGRRSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQV  121

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            KTFKPKLV++R+ESLVDELKEAL+D D KPEIIPGE+G+IEVARHPD VTVVTGIVGCAG
Sbjct  122  KTFKPKLVAVRNESLVDELKEALADCDWKPEIIPGEQGVIEVARHPDAVTVVTGIVGCAG  181

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGPFVLPLA KH VKILPADSEHSAIFQCIQGLPEG
Sbjct  182  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAQKHKVKILPADSEHSAIFQCIQGLPEG  241

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
            ALRRIILTASGGAFRDWPV+KLK+ KV DALKHP W+MGKKITVDSATLFNKGLEVIEAH
Sbjct  242  ALRRIILTASGGAFRDWPVDKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAH  301

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YLFG +YD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD R+P+LYT+SWPDRIYCSE+T
Sbjct  302  YLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRIPILYTMSWPDRIYCSEVT  361

Query  9    WPR  1
            WPR
Sbjct  362  WPR  364



>gb|AAD56391.2|AF182287_1 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Artemisia annua]
Length=472

 Score =   523 bits (1348),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/368 (75%), Positives = 314/368 (85%), Gaps = 7/368 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGMR-VKCSSqaaaaqp  925
             M+LN +S +E +  SF       +  N +  KLQGGV+++RKD  +  ++CS+ A+   P
Sbjct  1     MSLNTLSPSEIRVNSFLD----TTKSNTNLFKLQGGVSVKRKDSKVNGIQCSAAASTPPP  56

Query  924   qpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTL  745
                  G A+ +   K W GPKPISIIGSTGS+GTQ L++VAENP+K++VVALAAGSNVTL
Sbjct  57    AWP--GTALVQPGTKNWSGPKPISIIGSTGSIGTQTLDIVAENPDKFKVVALAAGSNVTL  114

Query  744   LAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGI  565
             LA Q+K FKP+LVSI++ESLV ELKEAL+  D  PEIIPG+EG++EVARHPD VTVVTGI
Sbjct  115   LAEQIKAFKPQLVSIKNESLVAELKEALAGSDYMPEIIPGDEGVVEVARHPDCVTVVTGI  174

Query  564   VGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQ  385
             VGCAGLKPTVAAIEAGK+IALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQ
Sbjct  175   VGCAGLKPTVAAIEAGKNIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQ  234

Query  384   GLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLE  205
             G PEGALRRIILTASGGAFRDWPVEKLKD KV DALKHP WSMG+KITVDSATLFNKGLE
Sbjct  235   GFPEGALRRIILTASGGAFRDWPVEKLKDVKVADALKHPNWSMGRKITVDSATLFNKGLE  294

Query  204   VIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
             VIEAHYL+G+ YDNI+IVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYTLSWPDR+ 
Sbjct  295   VIEAHYLYGSSYDNIDIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPDRVQ  354

Query  24    CSEITWPR  1
             CSEITWPR
Sbjct  355   CSEITWPR  362



>gb|ACS26204.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Amomum villosum]
Length=472

 Score =   523 bits (1347),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 266/303 (88%), Positives = 285/303 (94%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAVAE  RK+WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSNVTLLA Q+
Sbjct  61   GRAVAEPGRKSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQI  120

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            KTFKP+LVS+R+ESLV ELK AL D++ KPEIIPGEEG++EVARHPD VTVVTGIVGCAG
Sbjct  121  KTFKPQLVSVRNESLVAELKNALEDVEHKPEIIPGEEGIVEVARHPDAVTVVTGIVGCAG  180

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPE 
Sbjct  181  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPED  240

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
            ALRRIILTASGGAFRD PVEKLKD KV DALKHP W+MGKKITVDSATLFNKGLEVIEAH
Sbjct  241  ALRRIILTASGGAFRDLPVEKLKDVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAH  300

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YLFG DYDNIEIVIHPQSIIHSMVETQDSS+LAQLG PD RLP+LYTLSWP+RIYCSE T
Sbjct  301  YLFGADYDNIEIVIHPQSIIHSMVETQDSSILAQLGWPDMRLPILYTLSWPERIYCSETT  360

Query  9    WPR  1
            WPR
Sbjct  361  WPR  363



>gb|AEK69520.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Alpinia officinarum]
Length=472

 Score =   523 bits (1347),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 266/303 (88%), Positives = 286/303 (94%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAVAE  RK+WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSNVTLLA Q+
Sbjct  61   GRAVAEPGRKSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQI  120

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            KTFKP+LVS+R+ESLV ELK AL D++ KPEIIPGEEG++EVARHPD VTVVTGIVGCAG
Sbjct  121  KTFKPQLVSVRNESLVAELKNALEDVEHKPEIIPGEEGIVEVARHPDAVTVVTGIVGCAG  180

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPE 
Sbjct  181  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPED  240

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
            ALRRIILTASGGAFRD+PVEKLKD KV DALKHP W+MGKKITVDSATLFNKGLEVIEAH
Sbjct  241  ALRRIILTASGGAFRDFPVEKLKDVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAH  300

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YLFG DYDNIEIVIHPQSIIHSMVET+DSSVLAQLG PD RLP+LYTLSWP+RIYCSE T
Sbjct  301  YLFGADYDNIEIVIHPQSIIHSMVETEDSSVLAQLGWPDMRLPILYTLSWPERIYCSETT  360

Query  9    WPR  1
            WPR
Sbjct  361  WPR  363



>ref|XP_006280395.1| hypothetical protein CARUB_v10026322mg [Capsella rubella]
 gb|EOA13293.1| hypothetical protein CARUB_v10026322mg [Capsella rubella]
Length=478

 Score =   522 bits (1345),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 281/372 (76%), Positives = 318/372 (85%), Gaps = 10/372 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRK----DGGMRVKCS-Sqaa  937
             M LN +S AE  A SF       ++      K+ GG + RR+    D G  VKCS     
Sbjct  3     MTLNSLSPAESVAISFLD-----TSRFSLIPKIPGGFSSRRRNQGRDFGKGVKCSVKVQQ  57

Query  936   aaqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGS  757
              + P PAWPGRA  E  R++WDGPKPISI+GSTGS+GTQ L++VA+NP+K+RVVALAAGS
Sbjct  58    QSSPPPAWPGRAFPEAPRQSWDGPKPISIVGSTGSIGTQTLDIVADNPDKFRVVALAAGS  117

Query  756   NVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTV  577
             NVTLLA QV+ FKP LV++R+ESL++ELKEAL+DLD KPEIIPGE+G+IEVARHP+ VTV
Sbjct  118   NVTLLADQVRRFKPALVAVRNESLINELKEALADLDYKPEIIPGEQGVIEVARHPEAVTV  177

Query  576   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIF  397
             VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA+KHNVKILPADSEHSAIF
Sbjct  178   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLANKHNVKILPADSEHSAIF  237

Query  396   QCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFN  217
             QCIQGLPEGALR+IILTASGGAFRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFN
Sbjct  238   QCIQGLPEGALRKIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFN  297

Query  216   KGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWP  37
             KGLEVIEAHYLFG +YD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SWP
Sbjct  298   KGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWP  357

Query  36    DRIYCSEITWPR  1
             DR+ CSE+TWPR
Sbjct  358   DRVPCSEVTWPR  369



>ref|XP_010444132.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like 
[Camelina sativa]
Length=479

 Score =   522 bits (1345),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 282/372 (76%), Positives = 317/372 (85%), Gaps = 10/372 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRK----DGGMRVKCS-Sqaa  937
             M LN +S AE  A SF       ++      K+ GG  +RR+    D G  VKCS     
Sbjct  3     MTLNSLSPAESIAISFLD-----TSRFNLIPKIPGGFGLRRRNQGRDFGKGVKCSVKVQQ  57

Query  936   aaqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGS  757
              + P PAWPGRAV E  R++WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGS
Sbjct  58    QSSPPPAWPGRAVPEAPRQSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGS  117

Query  756   NVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTV  577
             NVTLLA QV+ FKP LV++R+ESL++ELKEAL+DLD KPEIIPGE+G+IEVARHP+ VTV
Sbjct  118   NVTLLADQVRRFKPALVAVRNESLINELKEALADLDYKPEIIPGEQGVIEVARHPEAVTV  177

Query  576   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIF  397
             VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA KHNVKILPADSEHSAIF
Sbjct  178   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAKKHNVKILPADSEHSAIF  237

Query  396   QCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFN  217
             QCIQGLPEGALR+IILTASGGAFRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFN
Sbjct  238   QCIQGLPEGALRKIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFN  297

Query  216   KGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWP  37
             KGLEVIEAHYLFG +YD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+ YT+SWP
Sbjct  298   KGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPIHYTMSWP  357

Query  36    DRIYCSEITWPR  1
             DR+ CSE+TWPR
Sbjct  358   DRVPCSEVTWPR  369



>ref|XP_003569639.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Brachypodium distachyon]
Length=473

 Score =   522 bits (1344),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 263/303 (87%), Positives = 287/303 (95%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAV E  RK+WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSNVTLLA QV
Sbjct  62   GRAVVEPGRKSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQV  121

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            KTFKPKLV++R+ESL++ELKEAL+D +E PEIIPGE+G+IEVARH D VTVVTGIVGCAG
Sbjct  122  KTFKPKLVAVRNESLLNELKEALADCEEMPEIIPGEQGVIEVARHLDAVTVVTGIVGCAG  181

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGL EG
Sbjct  182  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLSEG  241

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
            +LRRIILTASGGAFRDWPVE+LKD KV DALKHP W+MGKKITVDSATLFNKGLEVIEAH
Sbjct  242  SLRRIILTASGGAFRDWPVERLKDVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAH  301

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YLFG +YD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYTLSWPDRIYCSE+T
Sbjct  302  YLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTLSWPDRIYCSEVT  361

Query  9    WPR  1
            WPR
Sbjct  362  WPR  364



>emb|CAD22156.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Stevia rebaudiana]
 gb|ACI45244.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Stevia rebaudiana]
Length=473

 Score =   521 bits (1343),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 278/370 (75%), Positives = 309/370 (84%), Gaps = 10/370 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKD---GGMRVKCSSqaaaa  931
             M+L+++S  +    +F    +         LKLQGG   +RKD    G  ++CS+Q    
Sbjct  1     MSLSYLSPTQTNLITF----SDTCKSQTHLLKLQGGFCFKRKDVKLAGKGIRCSAQPPPP  56

Query  930   qpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNV  751
                P   G A+ +   K WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSNV
Sbjct  57    PAWP---GTALVDPGTKNWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNV  113

Query  750   TLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVT  571
             TLLA Q+K FKP+LVSI++ESLV ELKEAL+D D  PEIIPG++G+IEVARHPD VTVVT
Sbjct  114   TLLAEQIKAFKPQLVSIQNESLVGELKEALADADYMPEIIPGDQGIIEVARHPDCVTVVT  173

Query  570   GIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQC  391
             GIVGCAGLKPTVAAIEAGK+IALANKETLIAGGPFVLPLA KHNVKILPADSEHSAIFQC
Sbjct  174   GIVGCAGLKPTVAAIEAGKNIALANKETLIAGGPFVLPLARKHNVKILPADSEHSAIFQC  233

Query  390   IQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKG  211
             IQG PEGALRRIILTASGGAFRD PVEKLKD KV DALKHP WSMGKKITVDSATLFNKG
Sbjct  234   IQGFPEGALRRIILTASGGAFRDLPVEKLKDVKVADALKHPNWSMGKKITVDSATLFNKG  293

Query  210   LEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDR  31
             LEVIEAHYL+G+DYDNIEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYTLSWPDR
Sbjct  294   LEVIEAHYLYGSDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPDR  353

Query  30    IYCSEITWPR  1
             I CSEITWPR
Sbjct  354   ISCSEITWPR  363



>ref|XP_004138108.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004155015.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like 
[Cucumis sativus]
 gb|KGN63580.1| hypothetical protein Csa_1G004930 [Cucumis sativus]
Length=469

 Score =   521 bits (1342),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 280/369 (76%), Positives = 314/369 (85%), Gaps = 11/369 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMR--RKDGGMRVKCSSqaaaaq  928
             MALN ++  E KA SF +     S+ +    KLQGG +++  R     R+ CSSQ     
Sbjct  1     MALNVLAPPEIKALSFLE-----SSRSRHFTKLQGGSSIKECRTIVHKRIHCSSQPPPPA  55

Query  927   pqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVT  748
                   G+AV     K WDG KPISI+GSTGS+GTQ L++VAENPEK++VV LAAGSN+T
Sbjct  56    WP----GQAVVPPGYKKWDGRKPISILGSTGSIGTQTLDIVAENPEKFKVVGLAAGSNIT  111

Query  747   LLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTG  568
             LLA QVKTFKP+LV++R+ESL+DELKEAL+DLDEKPEIIPGE+G+IEVARHPD VTVVTG
Sbjct  112   LLADQVKTFKPQLVAVRNESLIDELKEALADLDEKPEIIPGEQGVIEVARHPDAVTVVTG  171

Query  567   IVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCI  388
             IVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCI
Sbjct  172   IVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCI  231

Query  387   QGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGL  208
             QGLPEGALRRIILTASGGAFRD PVEKLKD KV DALKHP WSMGKKITVDSATLFNKGL
Sbjct  232   QGLPEGALRRIILTASGGAFRDLPVEKLKDVKVADALKHPNWSMGKKITVDSATLFNKGL  291

Query  207   EVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRI  28
             EVIEAHYLFG +YD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+ YT++WP+R+
Sbjct  292   EVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPIAYTITWPERL  351

Query  27    YCSEITWPR  1
             YCSE+TWPR
Sbjct  352   YCSEVTWPR  360



>gb|ACD70397.1| putative chloroplast 1-deoxy-D-xylulose 5-phosphate reductoisomerase 
[Populus trichocarpa]
Length=426

 Score =   519 bits (1337),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 261/303 (86%), Positives = 286/303 (94%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRA  E  RKTWDGPKPISI+GSTGS+GTQ L++V ENP+K+ VVALAAGSNVTLLA QV
Sbjct  15   GRAFPEPGRKTWDGPKPISIVGSTGSIGTQTLDIVTENPDKFTVVALAAGSNVTLLADQV  74

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            + FKP+LV++R+ESLVDELKEAL+D++EKPEIIPGE+G+IEVARHPD V+VVTGIVGCAG
Sbjct  75   RRFKPQLVAVRNESLVDELKEALADVEEKPEIIPGEQGVIEVARHPDAVSVVTGIVGCAG  134

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDI LANKETLIAGGPFVLPLAHK+NVKILPADSEHSAIFQCIQGLPEG
Sbjct  135  LKPTVAAIEAGKDICLANKETLIAGGPFVLPLAHKYNVKILPADSEHSAIFQCIQGLPEG  194

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
            ALRRIILTASGGAFRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFNKGLEVIEAH
Sbjct  195  ALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAH  254

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YLFG DYDNI+IVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SWPDR+YCSEIT
Sbjct  255  YLFGADYDNIDIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPDRVYCSEIT  314

Query  9    WPR  1
            WPR
Sbjct  315  WPR  317



>emb|CAE47438.1| putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Hordeum 
vulgare subsp. vulgare]
Length=484

 Score =   521 bits (1343),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 261/303 (86%), Positives = 287/303 (95%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAV E  R++W+GPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSNVTLLA QV
Sbjct  72   GRAVVEPGRRSWEGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQV  131

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            KTFKPKLV++RDESL++ELKEAL+  +E PEIIPGE+G+IEVARHPD VTVVTGIVGCAG
Sbjct  132  KTFKPKLVALRDESLLNELKEALAGCEEMPEIIPGEQGVIEVARHPDAVTVVTGIVGCAG  191

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGL EG
Sbjct  192  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLSEG  251

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
            +LRR+ILTASGGAFRDWPVEKLKD KV DALKHP WSMGKKITVDSATLFNKGLEVIEAH
Sbjct  252  SLRRVILTASGGAFRDWPVEKLKDVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAH  311

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YLFG +YD+I+IVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYTLSWPDR+YCSE+T
Sbjct  312  YLFGAEYDDIDIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTLSWPDRVYCSEVT  371

Query  9    WPR  1
            WPR
Sbjct  372  WPR  374



>emb|CDY00327.1| BnaA06g22280D [Brassica napus]
Length=479

 Score =   521 bits (1342),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 285/374 (76%), Positives = 320/374 (86%), Gaps = 12/374 (3%)
 Frame = -3

Query  1101  MALNFIS-CAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGMR-----VKCS-Sq  943
             M LN +S  AE  +  FF+     ++    + KL GG ++R+++ G       VKCS   
Sbjct  2     MTLNSLSPSAESISLCFFE-----TSRFNQTPKLPGGCSLRKRNQGRGFGKGVVKCSVKV  56

Query  942   aaaaqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAA  763
                 QP PAWPGRAV E  R++WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAA
Sbjct  57    QQQQQPPPAWPGRAVPEPPRQSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAA  116

Query  762   GSNVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIV  583
             GSNV LLA QVK FKP LV++R+ESLVDELKEAL+ LD KPEIIPGE+G+IEVARHPD V
Sbjct  117   GSNVALLADQVKRFKPALVAVRNESLVDELKEALAGLDYKPEIIPGEQGVIEVARHPDAV  176

Query  582   TVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSA  403
             TVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA+KHNVKILPADSEHSA
Sbjct  177   TVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLANKHNVKILPADSEHSA  236

Query  402   IFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATL  223
             IFQCIQGLPEGALR+IILTASGGAFRDWPVEKLK+ KV DALKHP WSMGKKITVDSATL
Sbjct  237   IFQCIQGLPEGALRKIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATL  296

Query  222   FNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLS  43
             FNKGLEVIEAHYLFG +YD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+S
Sbjct  297   FNKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMS  356

Query  42    WPDRIYCSEITWPR  1
             WPDR+ CSE+TWPR
Sbjct  357   WPDRVPCSEVTWPR  370



>dbj|BAE79548.1| 1-deoxyxylulose 5-phosphate reductoisomerase [Chrysanthemum x 
morifolium]
Length=487

 Score =   521 bits (1343),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 276/368 (75%), Positives = 314/368 (85%), Gaps = 7/368 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGMR-VKCSSqaaaaqp  925
             M+LN +S +E +  SF       +  N +  KLQGGV+++RKD  +  ++CS+ A+   P
Sbjct  1     MSLNTLSPSEIRVTSFLD----TTKANTNLFKLQGGVSVKRKDSKVNGIQCSAAASGPPP  56

Query  924   qpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTL  745
                  G A+ +   K W GPKPISI+GSTGS+GTQ L++VAENP+K++VVALAAGSNVTL
Sbjct  57    AWP--GTALVQPGTKNWSGPKPISIVGSTGSIGTQTLDIVAENPDKFKVVALAAGSNVTL  114

Query  744   LAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGI  565
             LA Q+K FKP+LVSI++ESLV ELKEAL+  D  PEIIPG+EG++EVARHPD VTVVTGI
Sbjct  115   LAEQIKAFKPQLVSIKNESLVAELKEALAGSDYMPEIIPGDEGVVEVARHPDCVTVVTGI  174

Query  564   VGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQ  385
             VGCAGLKPTVAAIEAGK+IALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQ
Sbjct  175   VGCAGLKPTVAAIEAGKNIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQ  234

Query  384   GLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLE  205
             G PEGALRRIILTASGGAFRDWPVEKLKD KV DALKHP WSMG+KITVDSATLFNKGLE
Sbjct  235   GFPEGALRRIILTASGGAFRDWPVEKLKDVKVADALKHPNWSMGRKITVDSATLFNKGLE  294

Query  204   VIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
             VIEAHYL+G+ YDNI+IVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYTLSWPDR+ 
Sbjct  295   VIEAHYLYGSSYDNIDIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPDRVE  354

Query  24    CSEITWPR  1
             CSEITWPR
Sbjct  355   CSEITWPR  362



>gb|AFK42788.1| unknown [Medicago truncatula]
Length=475

 Score =   520 bits (1340),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 285/371 (77%), Positives = 318/371 (86%), Gaps = 9/371 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM----RVKCSSqaaa  934
             MALN  S AE K+  FF   T     N  + K  GGVA++RK+ G     RV CS   + 
Sbjct  1     MALNLYSPAELKS-GFF---TDPLKSNRFTPKFPGGVALKRKENGTASGTRVYCS-VQST  55

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
             + P PAWPGRA+ E   KTW+GPKPISI+G TGS+GTQ L++VAENP+K+RVVALAAGSN
Sbjct  56    SGPPPAWPGRAIPELGNKTWEGPKPISIVGCTGSIGTQTLDIVAENPDKFRVVALAAGSN  115

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             +TLL  QVK FKP+LV++R+ESL+ EL+EAL D++EKPEIIPGE+G+IEVARHPD VTVV
Sbjct  116   ITLLVDQVKRFKPQLVAVRNESLLAELQEALKDVEEKPEIIPGEQGVIEVARHPDAVTVV  175

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA KHNVKILPADSEHSAIFQ
Sbjct  176   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLARKHNVKILPADSEHSAIFQ  235

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
              IQGL EGALRR+ILTASGGAFRDWPVEKLKD KV DALKHP WSMGKKITVDSATLFNK
Sbjct  236   RIQGLTEGALRRVILTASGGAFRDWPVEKLKDVKVADALKHPNWSMGKKITVDSATLFNK  295

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG DYD+I+IVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYTLSWPD
Sbjct  296   GLEVIEAHYLFGADYDDIDIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTLSWPD  355

Query  33    RIYCSEITWPR  1
             R+YCSE+TWPR
Sbjct  356   RVYCSEVTWPR  366



>gb|AAL37560.1|AF367205_1 1-deoxy-D-xylulose 5-phosphate reductoisomerase precursor [Oryza 
sativa]
Length=473

 Score =   520 bits (1340),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 262/303 (86%), Positives = 286/303 (94%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAV E  R++WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSNVTLLA QV
Sbjct  62   GRAVVEPGRRSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQV  121

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            KTFKPK V++R+ESLVDELKEAL+D D KPEIIPGE+G+IEVARHPD VTVVTGIVGCAG
Sbjct  122  KTFKPKHVAVRNESLVDELKEALADCDWKPEIIPGEQGVIEVARHPDAVTVVTGIVGCAG  181

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGPFVLPLA KH VKILPADSEHSAIFQCIQGLPEG
Sbjct  182  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAQKHKVKILPADSEHSAIFQCIQGLPEG  241

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
            ALRRIILTASGGAFRDWPV+KLK+ KV DALKHP W+MGKKITVDSATLFNKGLEVIEAH
Sbjct  242  ALRRIILTASGGAFRDWPVDKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAH  301

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YLFG +YD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD R+P+LYT+SWPDRIYCSE+T
Sbjct  302  YLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRIPILYTMSWPDRIYCSEVT  361

Query  9    WPR  1
            WPR
Sbjct  362  WPR  364



>gb|EMT13515.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Aegilops tauschii]
Length=483

 Score =   520 bits (1340),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 261/303 (86%), Positives = 287/303 (95%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAVAE  R++W+GPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSNVTLLA QV
Sbjct  71   GRAVAEPERRSWEGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQV  130

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            KTFKPKLV++R+ESL++ELKEAL+  +E PEIIPGE+G+IEVARHPD VTVVTGIVGCAG
Sbjct  131  KTFKPKLVAVRNESLLNELKEALAGCEEMPEIIPGEQGVIEVARHPDAVTVVTGIVGCAG  190

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKIL ADSEHSAIFQCIQGL EG
Sbjct  191  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILTADSEHSAIFQCIQGLSEG  250

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
            +LRR+ILTASGGAFRDWPVEKLKD KV DALKHP WSMGKKITVDSATLFNKGLEVIEAH
Sbjct  251  SLRRVILTASGGAFRDWPVEKLKDVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAH  310

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YLFG +YD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYTLSWPDR+YCSE+T
Sbjct  311  YLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTLSWPDRVYCSEVT  370

Query  9    WPR  1
            WPR
Sbjct  371  WPR  373



>emb|CDY56743.1| BnaC09g50930D [Brassica napus]
Length=475

 Score =   520 bits (1338),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 281/371 (76%), Positives = 318/371 (86%), Gaps = 10/371 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDG----GMRVKCSSqaaa  934
             M L  +S A+ K+ S F      S+    + KL GG ++++++     G  VKCS     
Sbjct  2     MTLTSLSPADSKSLSSF---LDTSSRFNPTPKLPGGFSLKKRNQRRGFGKGVKCS---VQ  55

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
               P PAWPGRAV E  R++WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSN
Sbjct  56    QPPPPAWPGRAVPEPPRQSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSN  115

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QVK FKP LV++R+ESL+ ELKEAL+DLD KPEIIPGE+G+IEVARHPD VTVV
Sbjct  116   VTLLADQVKRFKPALVAVRNESLLSELKEALADLDYKPEIIPGEQGVIEVARHPDAVTVV  175

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA+KHNVKILPADSEHSAIFQ
Sbjct  176   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLANKHNVKILPADSEHSAIFQ  235

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEG LR+IILTASGGAFRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFNK
Sbjct  236   CIQGLPEGTLRKIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNK  295

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SWPD
Sbjct  296   GLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPD  355

Query  33    RIYCSEITWPR  1
             R+ CSE+TWPR
Sbjct  356   RVPCSEVTWPR  366



>ref|XP_006643650.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like 
[Oryza brachyantha]
Length=472

 Score =   520 bits (1338),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 260/303 (86%), Positives = 289/303 (95%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAVAE  RK+WDGPKPISI+GSTGS+GTQ L+++AE+P+K+RVVALAAGSNVTLLA QV
Sbjct  61   GRAVAEPGRKSWDGPKPISIVGSTGSIGTQTLDIIAEHPDKFRVVALAAGSNVTLLADQV  120

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            KTFKPKLV++R+ESLVDELKEAL+D +EKPEIIPGE+G+IEVARHPD VTVVTGIVGCAG
Sbjct  121  KTFKPKLVAVRNESLVDELKEALADCEEKPEIIPGEQGVIEVARHPDAVTVVTGIVGCAG  180

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQCIQGLPEG
Sbjct  181  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLPEG  240

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
            ALRRIILTASGGAFR+WPV++LK+ KV DALKHP W+MGKKITVDSATLFNKGLEVIEAH
Sbjct  241  ALRRIILTASGGAFREWPVDRLKEVKVADALKHPNWTMGKKITVDSATLFNKGLEVIEAH  300

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YLFG +YD+IEIV+HPQSIIHSM+ETQDSSVLAQLG  D R+P+LYT+SWPDRIYCSE+T
Sbjct  301  YLFGAEYDDIEIVVHPQSIIHSMIETQDSSVLAQLGWADMRIPILYTMSWPDRIYCSEVT  360

Query  9    WPR  1
            WPR
Sbjct  361  WPR  363



>ref|XP_003549624.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like 
[Glycine max]
 gb|KHN18458.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Glycine soja]
Length=474

 Score =   519 bits (1337),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 286/370 (77%), Positives = 315/370 (85%), Gaps = 11/370 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKD----GGMRVKCSSqaaa  934
             MALN  S AE K+  F  +       N  + K  GG A +RK+     G RV CS     
Sbjct  2     MALNISSPAEVKSIFFADY----FKSNCITAKFTGGFAFKRKERGAASGGRVCCS---VL  54

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
             A P PAWPGRAV E+  KTWDGPKPISI+G TGS+GTQ L++VAENP+K++VVALAAGSN
Sbjct  55    APPPPAWPGRAVPEQGSKTWDGPKPISIVGCTGSIGTQTLDIVAENPDKFKVVALAAGSN  114

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QVK FKP+LV++R+ESL+ ELKEAL D++EKPEIIPGE+G+IEVARHPD V+VV
Sbjct  115   VTLLADQVKRFKPQLVAVRNESLIAELKEALHDVEEKPEIIPGEQGIIEVARHPDAVSVV  174

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGK IALANKETLIAGGPFVLPLA KHNVKILPADSEHSAIFQ
Sbjct  175   TGIVGCAGLKPTVAAIEAGKYIALANKETLIAGGPFVLPLAQKHNVKILPADSEHSAIFQ  234

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRR+ILTASGGAFRDWPV+KLKD KV DALKHP W+MGKKITVDSATLFNK
Sbjct  235   CIQGLPEGALRRVILTASGGAFRDWPVDKLKDVKVADALKHPNWNMGKKITVDSATLFNK  294

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG DYD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYTLSWPD
Sbjct  295   GLEVIEAHYLFGADYDHIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTLSWPD  354

Query  33    RIYCSEITWP  4
             RIYCSE TWP
Sbjct  355   RIYCSEDTWP  364



>gb|AER00470.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Tanacetum parthenium]
Length=472

 Score =   519 bits (1337),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 274/368 (74%), Positives = 312/368 (85%), Gaps = 7/368 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGMR-VKCSSqaaaaqp  925
             M+ N +S +E +  SF       +  N +  KLQGGV+++RKD  ++ ++C + A+   P
Sbjct  1     MSFNTLSPSEIRVTSFLD----TTKSNTNLFKLQGGVSLKRKDSKVKGIQCPAAASTPPP  56

Query  924   qpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTL  745
                  G A+ +   K W GPKPISIIGSTGS+GTQ L++VAENP+K++VVALAAGSNVTL
Sbjct  57    AWP--GTALVQPGTKNWSGPKPISIIGSTGSIGTQTLDIVAENPDKFKVVALAAGSNVTL  114

Query  744   LAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGI  565
             LA Q+K FKP+LVSI++ESLV ELKEAL+  D  PEIIPG+EG++EVARHPD VTVVTGI
Sbjct  115   LAEQIKAFKPQLVSIKNESLVAELKEALAGSDYMPEIIPGDEGVVEVARHPDCVTVVTGI  174

Query  564   VGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQ  385
             VGCAGLKPTVAAIEAGK+IALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQ
Sbjct  175   VGCAGLKPTVAAIEAGKNIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQ  234

Query  384   GLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLE  205
             G PEGALRRIILTASGGAFRDWPVEKLKD KV DALKHP WSMG+KITVDSATLFNKGLE
Sbjct  235   GFPEGALRRIILTASGGAFRDWPVEKLKDVKVPDALKHPNWSMGRKITVDSATLFNKGLE  294

Query  204   VIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
             VIE HYL+G+ YDNI+IVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYTLSWPDR+ 
Sbjct  295   VIEVHYLYGSSYDNIDIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPDRVQ  354

Query  24    CSEITWPR  1
             CSEITWPR
Sbjct  355   CSEITWPR  362



>ref|XP_008655547.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like 
[Zea mays]
 gb|AFW79784.1| hypothetical protein ZEAMMB73_057914 [Zea mays]
Length=475

 Score =   519 bits (1336),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 262/303 (86%), Positives = 288/303 (95%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAVAE  R++ DGPKPISI+GSTGS+GTQ L++VAENP+K+RVVAL+AGSNVTLLA QV
Sbjct  64   GRAVAEPGRRSLDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALSAGSNVTLLADQV  123

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            KTFKPKLV++R+E+LVDELKEAL+D +EKPEIIPGE+G+IEVARHPD +TVVTGIVGCAG
Sbjct  124  KTFKPKLVAVRNETLVDELKEALADCEEKPEIIPGEQGVIEVARHPDAITVVTGIVGCAG  183

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQCIQGL EG
Sbjct  184  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLSEG  243

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
            ALRRIILTASGGAFRDWPV++LKD KV DALKHP W+MGKKITVDSATLFNKGLEVIEAH
Sbjct  244  ALRRIILTASGGAFRDWPVDRLKDVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAH  303

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YLFG +YD+IEIVIHPQSIIHSMVETQDSSVLAQLG PD R+P+LYTLSWPDRIYCSE+T
Sbjct  304  YLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRIPILYTLSWPDRIYCSEVT  363

Query  9    WPR  1
            WPR
Sbjct  364  WPR  366



>ref|XP_009151404.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Brassica rapa]
Length=482

 Score =   519 bits (1336),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 275/342 (80%), Positives = 304/342 (89%), Gaps = 9/342 (3%)
 Frame = -3

Query  999  GGVAMRRKDGGMR-----VKCS----SqaaaaqpqpawPGRAVAEESRKTWDGPKPISII  847
            GG ++R+++ G       VKCS     Q     P PAWPGRAV E  R++WDGPKPISI+
Sbjct  32   GGCSLRKRNQGRGFGKGVVKCSVKVQQQQQQQPPPPAWPGRAVPEPPRQSWDGPKPISIV  91

Query  846  GSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESLVDELKE  667
            GSTGS+GTQ L++VAENP+K+RVVALAAGSNV LLA QVK FKP LV++R+ESLVDELKE
Sbjct  92   GSTGSIGTQTLDIVAENPDKFRVVALAAGSNVALLADQVKRFKPALVAVRNESLVDELKE  151

Query  666  ALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIALANKET  487
            AL+ LD KPEIIPGE+G+IEVARHPD VTVVTGIVGCAGLKPTVAAIEAGKDIALANKET
Sbjct  152  ALAGLDYKPEIIPGEQGVIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKET  211

Query  486  LIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEK  307
            LIAGGPFVLPLA+KHNVKILPADSEHSAIFQCIQGLPEGALR+IILTASGGAFRDWPVEK
Sbjct  212  LIAGGPFVLPLANKHNVKILPADSEHSAIFQCIQGLPEGALRKIILTASGGAFRDWPVEK  271

Query  306  LKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIH  127
            LK+ KV DALKHP WSMGKKITVDSATLFNKGLEVIEAHYLFG +YD+IEIVIHPQSIIH
Sbjct  272  LKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGAEYDDIEIVIHPQSIIH  331

Query  126  SMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            SM+ETQDSSVLAQLG PD RLP+LYT+SWPDR+ CSE+TWPR
Sbjct  332  SMIETQDSSVLAQLGWPDMRLPILYTMSWPDRVPCSEVTWPR  373



>ref|XP_008464564.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Cucumis melo]
Length=469

 Score =   518 bits (1334),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 280/369 (76%), Positives = 314/369 (85%), Gaps = 11/369 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMR--RKDGGMRVKCSSqaaaaq  928
             MALN ++  E KA SF +     S+ +    KLQGG +++  R     R+ CSSQ     
Sbjct  1     MALNVLAPPEIKALSFLE-----SSRSRHLTKLQGGSSIKDCRTIVHKRIHCSSQPPPPA  55

Query  927   pqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVT  748
                   G+AV     K WDG KPISI+GSTGS+GTQ L++VAE+PEK++VV LAAGSN+T
Sbjct  56    WP----GQAVVPPGYKKWDGRKPISILGSTGSIGTQTLDIVAEHPEKFKVVGLAAGSNIT  111

Query  747   LLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTG  568
             LLA QVKTFKP+LV++R+ESL+DELKEAL+DLDEKPEIIPGE+G+IEVARHPD VTVVTG
Sbjct  112   LLADQVKTFKPQLVAVRNESLIDELKEALADLDEKPEIIPGEQGIIEVARHPDAVTVVTG  171

Query  567   IVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCI  388
             IVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCI
Sbjct  172   IVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCI  231

Query  387   QGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGL  208
             QGLPEGALRRIILTASGGAFRD PVEKLKD KV DALKHP WSMGKKITVDSATLFNKGL
Sbjct  232   QGLPEGALRRIILTASGGAFRDLPVEKLKDVKVADALKHPNWSMGKKITVDSATLFNKGL  291

Query  207   EVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRI  28
             EVIEAHYLFG +YD+IEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+ YT++WP+R+
Sbjct  292   EVIEAHYLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPIAYTITWPERL  351

Query  27    YCSEITWPR  1
             YCSE+TWPR
Sbjct  352   YCSEVTWPR  360



>gb|KHG02709.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Gossypium arboreum]
Length=478

 Score =   518 bits (1334),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 280/374 (75%), Positives = 314/374 (84%), Gaps = 13/374 (3%)
 Frame = -3

Query  1101  MALNFISCAEP-KAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM------RVKCSSq  943
             MALN +  +E  K+ SFF      +N         GG   +RK          R++CS+Q
Sbjct  1     MALNMVYPSEMIKSTSFFH----PTNSVSLPNLSTGGFVWKRKGYSTAIGRIRRLQCSAQ  56

Query  942   aaaaqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAA  763
             A    P     GRA     RKTWDGPKPISI+GSTGS+GTQ L++VAENP+K+R+V LAA
Sbjct  57    APHPPPAWP--GRAFPHPGRKTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRIVGLAA  114

Query  762   GSNVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIV  583
             GSNVTLLAHQVKTFKP+LV++R+ESLV+ELK+AL+D+++KPEIIPGE+G+IEVARHPD V
Sbjct  115   GSNVTLLAHQVKTFKPQLVAVRNESLVNELKDALADMEQKPEIIPGEQGVIEVARHPDAV  174

Query  582   TVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSA  403
             +VVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSA
Sbjct  175   SVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSA  234

Query  402   IFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATL  223
             IFQCIQGLPE ALRRIILTASGGAFRD PV+KLKD KV DALKHP W+MGKKITVDSATL
Sbjct  235   IFQCIQGLPECALRRIILTASGGAFRDLPVDKLKDVKVADALKHPNWNMGKKITVDSATL  294

Query  222   FNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLS  43
             FNKGLEVIEAHYLFG +YD+IEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYTLS
Sbjct  295   FNKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLS  354

Query  42    WPDRIYCSEITWPR  1
             WP+RIYCSEITWPR
Sbjct  355   WPERIYCSEITWPR  368



>emb|CAF22092.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Linum usitatissimum]
Length=476

 Score =   518 bits (1334),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 277/370 (75%), Positives = 319/370 (86%), Gaps = 6/370 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM---RVKCSSqaaaa  931
             M+LN +S AE K+ SF    TSKS ++ +  KL GG ++++K   +   R++CS    + 
Sbjct  1     MSLNMLSPAEVKSISFLD--TSKSFHSHALPKLPGGFSVKKKSSALSLRRIQCS-VQQSQ  57

Query  930   qpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNV  751
             QP  AWPG A+ E  RK WDGPKPISI+GSTGS+GTQ L++V+ENP+K++VVALAAGSN+
Sbjct  58    QPPSAWPGTAIPEPGRKIWDGPKPISIVGSTGSIGTQTLDIVSENPDKFKVVALAAGSNI  117

Query  750   TLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVT  571
              LLA Q++TFKP+LVS+++ESL  ELKEAL+ L+  PEIIPGEEG++EVARHPD  TVVT
Sbjct  118   ALLADQIRTFKPQLVSVKNESLAKELKEALAGLEVMPEIIPGEEGIVEVARHPDAATVVT  177

Query  570   GIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQC  391
             GIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQC
Sbjct  178   GIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQC  237

Query  390   IQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKG  211
             IQGLPEGALRRIILTASGG+FRD PVEKLKD KV DALKHP WSMGKKITVDSATLFNKG
Sbjct  238   IQGLPEGALRRIILTASGGSFRDLPVEKLKDVKVADALKHPNWSMGKKITVDSATLFNKG  297

Query  210   LEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDR  31
             LEVIEAHYLFG DYDNI+IVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SWPD+
Sbjct  298   LEVIEAHYLFGADYDNIDIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPDQ  357

Query  30    IYCSEITWPR  1
             + CSE+TWPR
Sbjct  358   VPCSEVTWPR  367



>ref|XP_008787962.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Phoenix dactylifera]
Length=470

 Score =   517 bits (1332),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 270/329 (82%), Positives = 292/329 (89%), Gaps = 2/329 (1%)
 Frame = -3

Query  987  MRRKDGGMRVKCSSqaaaaqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEV  808
            M+   G  R  C S   A  P     GRAVA   RK+WDGPKPISI+GSTGS+GTQ L++
Sbjct  35   MKNHTGSCRRICCSMQQAPPPAWP--GRAVAGSGRKSWDGPKPISIVGSTGSIGTQTLDI  92

Query  807  VAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiip  628
            VAENP+K+RVVALAAGSNVTLLA QVKTFKP+LV++R+ESL+ ELKEAL+D + KPEIIP
Sbjct  93   VAENPDKFRVVALAAGSNVTLLADQVKTFKPQLVAVRNESLIGELKEALADAEYKPEIIP  152

Query  627  geegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAH  448
            GE+G+IEVARHPD VTV+TGIVGCAGLKPTVAAIEAG DIALANKETLIAGGPFVLPLAH
Sbjct  153  GEQGVIEVARHPDAVTVITGIVGCAGLKPTVAAIEAGIDIALANKETLIAGGPFVLPLAH  212

Query  447  KHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHP  268
            KH VKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRD PVEKLK+ KV DALKHP
Sbjct  213  KHKVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDLPVEKLKEVKVADALKHP  272

Query  267  IWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQ  88
             W+MGKKITVDSATLFNKGLEVIEAHYLFG DYDNIEIVIHPQSIIHSMVETQDSSVLAQ
Sbjct  273  NWNMGKKITVDSATLFNKGLEVIEAHYLFGADYDNIEIVIHPQSIIHSMVETQDSSVLAQ  332

Query  87   LGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            LG PD RLP+LYT+SWP RIYCSEITWPR
Sbjct  333  LGWPDMRLPILYTMSWPQRIYCSEITWPR  361



>emb|CDX84354.1| BnaC03g51460D [Brassica napus]
Length=483

 Score =   517 bits (1331),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 274/343 (80%), Positives = 304/343 (89%), Gaps = 10/343 (3%)
 Frame = -3

Query  999  GGVAMRRKDGGMR-----VKCS-----SqaaaaqpqpawPGRAVAEESRKTWDGPKPISI  850
            GG ++R+++ G       VKCS      Q    QP PAWPGRA+ E  R++WDGPKPISI
Sbjct  32   GGCSLRKRNQGRSFGKGVVKCSVKVQQQQQQQQQPPPAWPGRAIPEPPRQSWDGPKPISI  91

Query  849  IGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESLVDELK  670
            +GSTGS+GTQ L++VAENP+K+RVVALAAGSNV LLA QVK FKP LV++R ESLVDELK
Sbjct  92   VGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVALLADQVKRFKPALVAVRKESLVDELK  151

Query  669  EALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIALANKE  490
            +AL+ LD KPEIIPGE+G+IEVARHPD VTVVTGIVGCAGLKPTVAAIEAGKDIALANKE
Sbjct  152  DALAGLDYKPEIIPGEQGVIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKE  211

Query  489  TLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVE  310
            TLIAGGPFVLPLA+KHNVKILPADSEHSAIFQCIQGLPEGALR+IILTASGGAFRDWPVE
Sbjct  212  TLIAGGPFVLPLANKHNVKILPADSEHSAIFQCIQGLPEGALRKIILTASGGAFRDWPVE  271

Query  309  KLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIHPQSII  130
            KLK+ KV DALKHP WSMGKKITVDSATLFNKGLEVIEAHYLFG +YD+IEIVIHPQSII
Sbjct  272  KLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGAEYDDIEIVIHPQSII  331

Query  129  HSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            HSM+ETQDSSVLAQLG PD RLP+LYT+SWPDR+ CSE+TWPR
Sbjct  332  HSMIETQDSSVLAQLGWPDMRLPILYTMSWPDRVPCSEVTWPR  374



>ref|NP_001190600.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Arabidopsis 
thaliana]
 gb|AED97658.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Arabidopsis 
thaliana]
Length=497

 Score =   516 bits (1330),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 283/393 (72%), Positives = 320/393 (81%), Gaps = 31/393 (8%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGMR----VKCS-Sqaa  937
             M LN +S AE KA SF       ++      KL GG ++RR++ G      VKCS     
Sbjct  1     MTLNSLSPAESKAISFLD-----TSRFNPIPKLSGGFSLRRRNQGRGFGKGVKCSVKVQQ  55

Query  936   aaqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGS  757
               QP PAWPGRAV E  R++WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGS
Sbjct  56    QQQPPPAWPGRAVPEAPRQSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGS  115

Query  756   NVTLLAHQ---------------------VKTFKPKLVSIRDESLVDELKEALSDLDekp  640
             NVTLLA Q                     ++ FKP LV++R+ESL++ELKEAL+DLD K 
Sbjct  116   NVTLLADQFSGSIISKIVLTRYVSDQTREIRRFKPALVAVRNESLINELKEALADLDYKL  175

Query  639   eiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVL  460
             EIIPGE+G+IEVARHP+ VTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVL
Sbjct  176   EIIPGEQGVIEVARHPEAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVL  235

Query  459   PLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDA  280
             PLA+KHNVKILPADSEHSAIFQCIQGLPEGALR+IILTASGGAFRDWPVEKLK+ KV DA
Sbjct  236   PLANKHNVKILPADSEHSAIFQCIQGLPEGALRKIILTASGGAFRDWPVEKLKEVKVADA  295

Query  279   LKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSS  100
             LKHP W+MGKKITVDSATLFNKGLEVIEAHYLFG +YD+IEIVIHPQSIIHSM+ETQDSS
Sbjct  296   LKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSS  355

Query  99    VLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
             VLAQLG PD RLP+LYT+SWPDR+ CSE+TWPR
Sbjct  356   VLAQLGWPDMRLPILYTMSWPDRVPCSEVTWPR  388



>gb|AID51429.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase, partial [Astragalus 
membranaceus]
Length=418

 Score =   513 bits (1321),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 255/303 (84%), Positives = 285/303 (94%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRA+ E  RKTW+GPKPISI+G TGS+GTQ L++VAENP+K++VVALAAGSN+TLL  QV
Sbjct  7    GRAIPEVGRKTWEGPKPISIVGCTGSIGTQTLDIVAENPDKFKVVALAAGSNITLLVEQV  66

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            K FKP+LV++R+ESL+ EL+EAL D+++KPEIIPGE+G+IEVARHPD VTVVTGIVGCAG
Sbjct  67   KQFKPQLVAVRNESLIAELEEALRDVEQKPEIIPGEQGVIEVARHPDAVTVVTGIVGCAG  126

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            L+PTVAAIEAGKDIALANKETLIAGGPFVLPLA KHNVKILPADSEHSAIFQCIQGLPEG
Sbjct  127  LQPTVAAIEAGKDIALANKETLIAGGPFVLPLAQKHNVKILPADSEHSAIFQCIQGLPEG  186

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
            ALRR+ILTASGGAFRDWPVEKLKD KV DALKHP WSMGKKITVDSATLFNKGLEVIEAH
Sbjct  187  ALRRVILTASGGAFRDWPVEKLKDVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAH  246

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YLFG DYD+I+IVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYTLSWP+R+YCSE+T
Sbjct  247  YLFGADYDHIDIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTLSWPERVYCSEVT  306

Query  9    WPR  1
            WPR
Sbjct  307  WPR  309



>ref|XP_011101328.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like 
[Sesamum indicum]
Length=475

 Score =   514 bits (1323),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 278/370 (75%), Positives = 316/370 (85%), Gaps = 7/370 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM---RVKCSSqaaaa  931
             MALN +   + K+  F     S S+ NL  L+       R+++GG    RV+CS Q+   
Sbjct  1     MALNVLYPVQIKSLYFLDSSKSSSSLNLLKLQGDQFCLRRKQNGGAAVKRVRCSGQSPPP  60

Query  930   qpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNV  751
                    GRAVAE SRK+ +G KPISI+GSTGS+GTQ LE+VAENP+K++VVALAAGSNV
Sbjct  61    AWP----GRAVAEPSRKSREGAKPISIVGSTGSIGTQTLEIVAENPDKFKVVALAAGSNV  116

Query  750   TLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVT  571
             TLLA QVK FKP+LV++R+ES +D+LKEAL+D+++KPEIIPGE+G+IEVARHPD VTVVT
Sbjct  117   TLLADQVKLFKPQLVAVRNESFLDKLKEALADVEDKPEIIPGEQGVIEVARHPDAVTVVT  176

Query  570   GIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQC  391
             GIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQC
Sbjct  177   GIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQC  236

Query  390   IQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKG  211
             IQGLPEGAL RIILTASGGAFRDWPV+KLK+ KV DALKHP W+MGKKITVDSATLFNKG
Sbjct  237   IQGLPEGALGRIILTASGGAFRDWPVDKLKEVKVADALKHPNWNMGKKITVDSATLFNKG  296

Query  210   LEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDR  31
             LEVIEAHYLFG DYD+I+IVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYTLSWPDR
Sbjct  297   LEVIEAHYLFGADYDDIDIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPDR  356

Query  30    IYCSEITWPR  1
             IYCS++TWPR
Sbjct  357   IYCSQLTWPR  366



>ref|XP_009390196.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=472

 Score =   513 bits (1322),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 273/337 (81%), Positives = 298/337 (88%), Gaps = 8/337 (2%)
 Frame = -3

Query  996  GVAMRRKDGGM-----RVKCSSqaaaaqpqpawPGRAVAEESRKTWDGPKPISIIGSTGS  832
            G   RRK+ G      R  CS       P PAWPGRAVAE  R +W GPKPISI+GSTGS
Sbjct  30   GFPSRRKEKGTVPSRGRTSCS---IQQAPPPAWPGRAVAEPGRTSWGGPKPISIVGSTGS  86

Query  831  VGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDL  652
            +GTQ L++VAE+P+K++VVALAAGSNVTLLA Q+KTFKP+LV+IR+ESLV ELKEAL+D 
Sbjct  87   IGTQTLDIVAEHPDKFKVVALAAGSNVTLLADQIKTFKPQLVAIRNESLVSELKEALADA  146

Query  651  DekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGG  472
            + KPEIIPGEEG++EVARHPD VTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGG
Sbjct  147  EHKPEIIPGEEGIVEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGG  206

Query  471  PFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAK  292
            PFVLPLAHKH VKILPADSEHSA+FQCIQGL +GALRR+ILTASGGAFRDWPVEKLKD K
Sbjct  207  PFVLPLAHKHKVKILPADSEHSAVFQCIQGLTDGALRRVILTASGGAFRDWPVEKLKDVK  266

Query  291  VGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVET  112
            V DALKHP W+MGKKITVDSATLFNKGLEVIEAHYLFG +YDNI+IVIHPQSIIHSMVET
Sbjct  267  VADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNIDIVIHPQSIIHSMVET  326

Query  111  QDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            QDSSVLAQLG PD RLP+LYTLSWPDRI CSEITWPR
Sbjct  327  QDSSVLAQLGWPDMRLPILYTLSWPDRISCSEITWPR  363



>gb|AGT29340.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Dendrobium catenatum]
Length=470

 Score =   513 bits (1321),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 258/303 (85%), Positives = 286/303 (94%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAV EESR++W+GPKPI+I+GSTGS+GTQ L++VAENP+K+RVVALAAGSNVTLLA QV
Sbjct  59   GRAVVEESRRSWEGPKPIAIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQV  118

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            KTFKP+LV++R+ESL  ELKEAL+D + +PEIIPGEEG+IEVA H D VTVVTGIVGCAG
Sbjct  119  KTFKPQLVAVRNESLFSELKEALADAEHQPEIIPGEEGVIEVAWHRDAVTVVTGIVGCAG  178

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQCIQGLPEG
Sbjct  179  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLPEG  238

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
            ALRRIILTASGGAFRDWPVEKL++ KV DALKHP W+MGKKITVDSATLFNKGLEVIEAH
Sbjct  239  ALRRIILTASGGAFRDWPVEKLREVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAH  298

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YL+G +YD+IEI+IHPQSIIHSMVETQDSSVLAQLG PD RLP+LYT+SWPDRIYCSE+T
Sbjct  299  YLYGAEYDSIEILIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTMSWPDRIYCSEVT  358

Query  9    WPR  1
            WPR
Sbjct  359  WPR  361



>ref|XP_008782463.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like 
[Phoenix dactylifera]
Length=469

 Score =   512 bits (1319),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 273/333 (82%), Positives = 295/333 (89%), Gaps = 3/333 (1%)
 Frame = -3

Query  996  GVAMRRK-DGGMRVKCSSqaaaaqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQ  820
            G  +RRK  G  R  C        P PAWPGRA AE  +K+WDGPKPISI+GSTGS+GTQ
Sbjct  30   GFPLRRKGSGSSRRTCC--LMQQAPPPAWPGRAAAESRQKSWDGPKPISIVGSTGSIGTQ  87

Query  819  CLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekp  640
             L++VAENP+K+RVVALAAGSNVTLLA QVK FKP+LVS+R+ESL  ELKEAL+D + KP
Sbjct  88   TLDIVAENPDKFRVVALAAGSNVTLLADQVKQFKPQLVSVRNESLFGELKEALADAEHKP  147

Query  639  eiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVL  460
            EIIPGE+G+IEVARHPD VTVVTGIVGCAGLKPTVAAIEAG DIALANKETLIAGGPFVL
Sbjct  148  EIIPGEQGVIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGIDIALANKETLIAGGPFVL  207

Query  459  PLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDA  280
            PLAHKH VKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRD PVEKLK+ KV DA
Sbjct  208  PLAHKHKVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDLPVEKLKEVKVADA  267

Query  279  LKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSS  100
            LKHP W+MGKKITVDSATLFNKGLEVIEAHYLFG +YDNIEIVIHPQSIIHSMVETQDSS
Sbjct  268  LKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNIEIVIHPQSIIHSMVETQDSS  327

Query  99   VLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            VLAQLG PD RLP+LYT+SWP+RIYCSE TWPR
Sbjct  328  VLAQLGWPDMRLPILYTMSWPERIYCSEKTWPR  360



>gb|EYU42568.1| hypothetical protein MIMGU_mgv1a005810mg [Erythranthe guttata]
Length=469

 Score =   512 bits (1318),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 278/372 (75%), Positives = 312/372 (84%), Gaps = 11/372 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGG----MRVKCSSqaaa  934
             MAL  +S  E K  SF    +SKSNYNL+ L   G  +++RK+ G     +V+CS+ A  
Sbjct  1     MALKMLSPTEIKPLSFLD--SSKSNYNLNLLSFPGVFSLKRKENGSTPAKQVRCSAAAPP  58

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
                     GRAVAE  RK WD PKPISIIGSTGS+GTQ L +VAENP+K+ V+ALAAGSN
Sbjct  59    PAWP----GRAVAEPDRKKWDSPKPISIIGSTGSIGTQTLGIVAENPDKFNVIALAAGSN  114

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QVK FKPKLVSIR+ESLVDEL+EAL+ ++E PEII G++G IEVARHPD VT V
Sbjct  115   VTLLADQVKRFKPKLVSIRNESLVDELREALAGIEEMPEIITGDQGTIEVARHPDSVTTV  174

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA KHNVKILPADSEHSAIFQ
Sbjct  175   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAKKHNVKILPADSEHSAIFQ  234

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIW-SMGKKITVDSATLFN  217
             CIQGLPEGALRRIILTASGG FRD PVEKLKD    +ALKHPIW +MGKK+T+DSATLFN
Sbjct  235   CIQGLPEGALRRIILTASGGTFRDLPVEKLKDVTAAEALKHPIWNNMGKKVTIDSATLFN  294

Query  216   KGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWP  37
             KGLEVIEAHYLFG +YD+IEIVIHPQSIIHSM+ETQDSSV+AQLG PD R+P+LYTLSWP
Sbjct  295   KGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVIAQLGWPDMRIPILYTLSWP  354

Query  36    DRIYCSEITWPR  1
             +R+YCSEITWPR
Sbjct  355   ERVYCSEITWPR  366



>emb|CAB43344.1| 1-deoxy-d-xylulose-5-phosphate reductoisomerase [Arabidopsis 
thaliana]
Length=406

 Score =   508 bits (1308),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 252/295 (85%), Positives = 281/295 (95%), Gaps = 0/295 (0%)
 Frame = -3

Query  885  RKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLV  706
            R++WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSNVTLLA QV+ FKP LV
Sbjct  3    RQSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQVRRFKPALV  62

Query  705  SIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAI  526
            ++R+ESL++ELKEAL+DLD K EIIPGE+G+IEVARHP+ VTVVTGIVGCAGLKPTVAAI
Sbjct  63   AVRNESLINELKEALADLDYKLEIIPGEQGVIEVARHPEAVTVVTGIVGCAGLKPTVAAI  122

Query  525  EAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILT  346
            EAGKDIALANKETLIAGGPFVLPLA+KHNVKILPADSEHSAIFQCIQGLPEGALR+IILT
Sbjct  123  EAGKDIALANKETLIAGGPFVLPLANKHNVKILPADSEHSAIFQCIQGLPEGALRKIILT  182

Query  345  ASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYD  166
            ASGGAFRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFNKGLEVIEAHYLFG +YD
Sbjct  183  ASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYD  242

Query  165  NIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            +IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SWPDR+ CSE+TWPR
Sbjct  243  DIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPDRVPCSEVTWPR  297



>gb|ACN40563.1| unknown [Picea sitchensis]
Length=479

 Score =   511 bits (1315),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 259/303 (85%), Positives = 282/303 (93%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAV +E RK WDGPKP SI+GSTGS+GTQ L++VAE+P+K+RVVALAAGSNVTLLA QV
Sbjct  69   GRAVVDEDRKVWDGPKPFSIVGSTGSIGTQTLDIVAEHPDKFRVVALAAGSNVTLLADQV  128

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            + FKPKLVSI +ESL  ELKEALS+++ KPEII GEEG+IEVA+HP+ V+VVTGIVGCAG
Sbjct  129  RRFKPKLVSISNESLAGELKEALSNIEPKPEIIFGEEGIIEVAQHPEAVSVVTGIVGCAG  188

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQCIQGLPEG
Sbjct  189  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLPEG  248

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
            ALRRIILTASGGAFRDWPVEKLK+ KV DALKHP WSMGKKITVDSATLFNKGLEVIEAH
Sbjct  249  ALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAH  308

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YL+G DYDNIEI+IHPQSIIHSMVETQDSSVLAQLG PD RLP+LYT+SWP+RI CSEIT
Sbjct  309  YLYGVDYDNIEIMIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTMSWPERISCSEIT  368

Query  9    WPR  1
            WPR
Sbjct  369  WPR  371



>gb|EPS70216.1| hypothetical protein M569_04544, partial [Genlisea aurea]
Length=339

 Score =   505 bits (1300),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 259/303 (85%), Positives = 282/303 (93%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAV E  RKTWDG KPISIIGSTGS+GTQ L++VAENP+K++VVALAAGSNVTLLA Q+
Sbjct  33   GRAVLEPDRKTWDGQKPISIIGSTGSIGTQTLDIVAENPDKFKVVALAAGSNVTLLADQI  92

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            KTFKP+LVS+R+ +L +EL+EALS ++ KPEIIPGEEG+IE ARHPD VTVVTGIVGCAG
Sbjct  93   KTFKPQLVSVRNSALANELREALSGVENKPEIIPGEEGIIEAARHPDAVTVVTGIVGCAG  152

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGPFVLPLA KHNVKILPADSEHSAIFQCIQGLPEG
Sbjct  153  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAQKHNVKILPADSEHSAIFQCIQGLPEG  212

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
            ALRRIILTASGGAFRD PVEKLKD KV DALKHP W+MGKKITVDSATLFNKGLEVIEAH
Sbjct  213  ALRRIILTASGGAFRDLPVEKLKDVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAH  272

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YLFG +YD+I+IVIHPQSIIHSM+ETQDSSV+AQLG PD RLP+LYTLSWPDRI CSEIT
Sbjct  273  YLFGAEYDDIDIVIHPQSIIHSMIETQDSSVIAQLGWPDMRLPILYTLSWPDRIPCSEIT  332

Query  9    WPR  1
            WPR
Sbjct  333  WPR  335



>gb|EMT26408.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Aegilops tauschii]
Length=475

 Score =   510 bits (1313),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 255/303 (84%), Positives = 281/303 (93%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAVAE  R++WD PKPISIIGSTGSVGTQ L +VAENP+K+RVVALAAGSNVTLLA QV
Sbjct  63   GRAVAEPERRSWDSPKPISIIGSTGSVGTQTLAIVAENPDKFRVVALAAGSNVTLLADQV  122

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            K FKP LV+I +ESL++ELKEAL+D +  PEIIPGE+G+IEVARHPD VTVVTGIVGCAG
Sbjct  123  KMFKPNLVAIGNESLLNELKEALADCEYMPEIIPGEQGVIEVARHPDAVTVVTGIVGCAG  182

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            L+PTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGL EG
Sbjct  183  LEPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLSEG  242

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
            +LRR+ILTASGGAFRDWP+E+LKD +V DALKHP W MGKKITVDSATLFNKGLEVIEAH
Sbjct  243  SLRRVILTASGGAFRDWPIERLKDVQVADALKHPNWKMGKKITVDSATLFNKGLEVIEAH  302

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YLFG +YDNIEI+IHPQSIIHSM+ET+DSSVLAQLG  D RLP+LYTLSWP+R+YCSEIT
Sbjct  303  YLFGVEYDNIEIMIHPQSIIHSMIETKDSSVLAQLGRTDMRLPILYTLSWPERVYCSEIT  362

Query  9    WPR  1
            WPR
Sbjct  363  WPR  365



>ref|XP_004967949.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like 
isoform X1 [Setaria italica]
Length=497

 Score =   511 bits (1315),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 265/328 (81%), Positives = 289/328 (88%), Gaps = 25/328 (8%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAVAE  R++WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSNVTLLA QV
Sbjct  61   GRAVAEPGRRSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQV  120

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            KTFKPKLV++R+ESLVDELKEA++D +EKPEIIPGE+G+IEVARHPD VTVVTGIVGCAG
Sbjct  121  KTFKPKLVAVRNESLVDELKEAIADCEEKPEIIPGEQGVIEVARHPDAVTVVTGIVGCAG  180

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQCIQGL EG
Sbjct  181  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLSEG  240

Query  369  ALRRIILTASGGAF-------------------------RDWPVEKLKDAKVGDALKHPI  265
            ALRR+ILTASGGAF                         RDWPV+KLKD KV DALKHP 
Sbjct  241  ALRRVILTASGGAFRQVHSHMCLCTSGNIRIHLISIDHDRDWPVDKLKDVKVADALKHPN  300

Query  264  WSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQL  85
            W+MGKKITVDSATLFNKGLEVIEAHYLFG +YD+IEIVIHPQSIIHSMVETQDSSVLAQL
Sbjct  301  WNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQL  360

Query  84   GLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            G PD R+P+LYTLSWPDRIYCSE+TWPR
Sbjct  361  GWPDMRIPILYTLSWPDRIYCSEVTWPR  388



>ref|XP_009393605.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009393606.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=471

 Score =   509 bits (1312),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 271/333 (81%), Positives = 302/333 (91%), Gaps = 1/333 (0%)
 Frame = -3

Query  996  GVAMRRKDGG-MRVKCSSqaaaaqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQ  820
            G+ ++RK+ G + ++ +S +    PQPAWPGRAVAE   K+WD PKPISI+GSTGSVGTQ
Sbjct  30   GLHLKRKEKGKVLLRKTSCSVQQAPQPAWPGRAVAEPGHKSWDVPKPISIVGSTGSVGTQ  89

Query  819  CLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekp  640
             L++VAE+P+K++VVALAAGSNVTLLA QVK FKP+LVS+R ESLV ELKEAL+D ++KP
Sbjct  90   TLDIVAEHPDKFKVVALAAGSNVTLLADQVKRFKPQLVSVRHESLVGELKEALADAEQKP  149

Query  639  eiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVL  460
            EIIPGEEG++EVA HPD VTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVL
Sbjct  150  EIIPGEEGIVEVACHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVL  209

Query  459  PLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDA  280
            PLAHKH VKILPADSEHSAIFQCIQGLP+GALRR+ILTASGGAFRDWPVEKLK+ KV DA
Sbjct  210  PLAHKHKVKILPADSEHSAIFQCIQGLPDGALRRLILTASGGAFRDWPVEKLKEVKVADA  269

Query  279  LKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSS  100
            LKHP WSMGKKITVDSATLFNKGLEVIEAHYLFG DYDNI+IVIHP+SIIHSMVETQDSS
Sbjct  270  LKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGADYDNIDIVIHPESIIHSMVETQDSS  329

Query  99   VLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            VL QLG PD RLP+LYTLSWPDRI+CSE TWPR
Sbjct  330  VLGQLGWPDMRLPILYTLSWPDRIHCSETTWPR  362



>ref|XP_004510245.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like 
[Cicer arietinum]
Length=478

 Score =   509 bits (1311),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 263/334 (79%), Positives = 300/334 (90%), Gaps = 1/334 (0%)
 Frame = -3

Query  999  GGVAMRRKDGGMRVKCSSqaaaaqpqpawPGRAVAEESR-KTWDGPKPISIIGSTGSVGT  823
            G  A++RK+G  R+K     +A+  QPAWPG A+ E S  KTWDGPKPIS++GSTGS+GT
Sbjct  41   GNFALKRKEGNTRIKRRVYCSASSLQPAWPGTAIPEPSDFKTWDGPKPISVLGSTGSIGT  100

Query  822  QCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDek  643
            Q L +VAE PE++RVV LAAGSNVTLLA Q+KTFKP+LV++RDES +DELKEAL+DL+ K
Sbjct  101  QTLNIVAEFPERFRVVGLAAGSNVTLLADQIKTFKPQLVALRDESRIDELKEALADLEYK  160

Query  642  peiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFV  463
            PEIIPGE+G+IEVARHPD  TVVTGIVGCAGLKPTVAAIEA KDIALANKET+IAGG FV
Sbjct  161  PEIIPGEQGVIEVARHPDAATVVTGIVGCAGLKPTVAAIEARKDIALANKETMIAGGAFV  220

Query  462  LPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGD  283
            LPLAHK+N+KILPADSEHSAIFQCIQGLP+GALR+I LT SGGAFR+WP EK+KD KV D
Sbjct  221  LPLAHKNNIKILPADSEHSAIFQCIQGLPKGALRKIQLTGSGGAFREWPAEKMKDIKVAD  280

Query  282  ALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDS  103
            ALKHPIWS+G+KITVDSATLFNKGLEVIEAHYLFG +YD+IEIVIHPQSIIHS+VETQDS
Sbjct  281  ALKHPIWSLGRKITVDSATLFNKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSLVETQDS  340

Query  102  SVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            SV+AQLGLPD RLPLLYTLSWP+R+YCSEITWPR
Sbjct  341  SVIAQLGLPDMRLPLLYTLSWPERVYCSEITWPR  374



>gb|AAT47184.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Taxus cuspidata]
Length=477

 Score =   508 bits (1309),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 253/303 (83%), Positives = 281/303 (93%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            G AV  E RK WDGPKP SIIGSTGS+GTQ L++VAE+P+K++VVALAAGSNVTLLA QV
Sbjct  67   GTAVVGEDRKVWDGPKPFSIIGSTGSIGTQTLDIVAEHPDKFKVVALAAGSNVTLLAEQV  126

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            + FKPKLVS+R+ESL  ELKEAL+D++ KPEI+ G+EG++EVA+HP+ V+VVTGIVGCAG
Sbjct  127  RMFKPKLVSVRNESLATELKEALADIEHKPEIVYGDEGMVEVAQHPEAVSVVTGIVGCAG  186

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQCIQGLPEG
Sbjct  187  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLPEG  246

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
            ALRRIILTASGG+FRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFNKGLEVIEAH
Sbjct  247  ALRRIILTASGGSFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAH  306

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YL+G DYDNIEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYT+SWP+R+ CSEIT
Sbjct  307  YLYGVDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTMSWPERVPCSEIT  366

Query  9    WPR  1
            WPR
Sbjct  367  WPR  369



>gb|AAR95700.1| putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Ginkgo 
biloba]
Length=477

 Score =   506 bits (1304),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 253/303 (83%), Positives = 279/303 (92%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAV +E RK WDGPKP SI+GSTGS+GTQ L++VAE+P+K+RVVALAAGSNV LLA QV
Sbjct  67   GRAVVDEDRKVWDGPKPFSIVGSTGSIGTQTLDIVAEHPDKFRVVALAAGSNVALLADQV  126

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            + FKPKLV+IR+ESL+ ELK ALSD + KPEII GEEG++EVARHP+ V+VVTGIVGCAG
Sbjct  127  RQFKPKLVAIRNESLITELKAALSDFEPKPEIISGEEGIVEVARHPEAVSVVTGIVGCAG  186

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQCIQGLPEG
Sbjct  187  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLPEG  246

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
             LRRIILTASGGAFRDWPV KLK+ KV DALKHP W+MGKKITVDSATLFNKGLEVIEAH
Sbjct  247  GLRRIILTASGGAFRDWPVGKLKEVKVSDALKHPNWNMGKKITVDSATLFNKGLEVIEAH  306

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YL+G DYDNIEIVIHPQSI+HSMVETQDSSVLAQLG PD RLP+LYT+SWP+R+ CSE+T
Sbjct  307  YLYGADYDNIEIVIHPQSIVHSMVETQDSSVLAQLGWPDMRLPILYTMSWPERVPCSEVT  366

Query  9    WPR  1
            WPR
Sbjct  367  WPR  369



>gb|ACJ67022.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pinus taeda]
Length=479

 Score =   506 bits (1304),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 254/303 (84%), Positives = 282/303 (93%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAV +E RK WDGPKP S++GSTGS+GTQ L++VAE+P+K+RVVALAAGSNVTLLA QV
Sbjct  69   GRAVVDEDRKVWDGPKPFSVVGSTGSIGTQTLDIVAEHPDKFRVVALAAGSNVTLLADQV  128

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            + FKPKLVSI +E+L  ELKEAL+D++ KPEI+ GEEG+IEVA+HP+ V+VVTGIVGCAG
Sbjct  129  RRFKPKLVSIGNEALAAELKEALADVEPKPEILFGEEGIIEVAQHPEAVSVVTGIVGCAG  188

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQCIQGLPEG
Sbjct  189  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLPEG  248

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
            ALRRIILTASGGAFRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFNKGLEVIEAH
Sbjct  249  ALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAH  308

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YL+G DYDNIEI+IHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SWP+RI CSEIT
Sbjct  309  YLYGVDYDNIEIMIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPERISCSEIT  368

Query  9    WPR  1
            WPR
Sbjct  369  WPR  371



>gb|ABX57721.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vanda hybrid 
cultivar]
Length=473

 Score =   506 bits (1302),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 255/304 (84%), Positives = 282/304 (93%), Gaps = 1/304 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GR + EE R++W+GPKPI+I+GSTGS+GTQ L++VAENP+K+RVVALAAGSN TLLA QV
Sbjct  61   GRVIVEEGRRSWEGPKPIAIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNATLLADQV  120

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            KTFKP+LV+IR+ES+ DELKEAL+D + +PEIIPGEEG+IEVARH D VTVVTGIVGCAG
Sbjct  121  KTFKPQLVAIRNESMFDELKEALADAEHQPEIIPGEEGVIEVARHRDAVTVVTGIVGCAG  180

Query  549  LKPTVAAIEAGKDIALANK-ETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPE  373
            LKPTVAAIEAGKDIALANK   LIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPE
Sbjct  181  LKPTVAAIEAGKDIALANKARGLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPE  240

Query  372  GALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEA  193
            G LRRIILTASGGAFRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFNKGLEVIEA
Sbjct  241  GGLRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEA  300

Query  192  HYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEI  13
            HYL+G  YD+IEI+IHPQSIIHSMVETQDSS+LAQLG PD RLP+LYT+SWPDRIYCSEI
Sbjct  301  HYLYGAAYDSIEIIIHPQSIIHSMVETQDSSILAQLGWPDMRLPILYTMSWPDRIYCSEI  360

Query  12   TWPR  1
            TWPR
Sbjct  361  TWPR  364



>emb|CDY16759.1| BnaA09g06230D [Brassica napus]
Length=497

 Score =   506 bits (1303),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 281/394 (71%), Positives = 319/394 (81%), Gaps = 33/394 (8%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDG----GMRVKCSSqaaa  934
             M L  +S A+ K+ S F      S+    + KL GG ++++++     G  VKCS     
Sbjct  1     MTLTSLSPADSKSLSSF---LDTSSRFNPTPKLPGGFSLKKRNQRRGFGKGVKCS---VQ  54

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
               P PAWPGRAV E  R++WDGPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSN
Sbjct  55    QPPPPAWPGRAVPELPRQSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSN  114

Query  753   VTLLAHQV-----------------------KTFKPKLVSIRDESLVDELKEALSDLDek  643
             VTLLA QV                       K FKP LV++R+ESL++ELKEAL+DLD K
Sbjct  115   VTLLADQVHKHHASESVFISQFCNYHKQDIVKRFKPALVAVRNESLLNELKEALADLDYK  174

Query  642   peiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFV  463
             PEIIPGE+G+IEVARHPD VTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFV
Sbjct  175   PEIIPGEQGVIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFV  234

Query  462   LPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGD  283
             LPLA+KHNVKILPADSEHSAIFQCIQGLPEGALR+IILTASGGAFRDWPVEKLK+ KV D
Sbjct  235   LPLANKHNVKILPADSEHSAIFQCIQGLPEGALRKIILTASGGAFRDWPVEKLKEVKVAD  294

Query  282   ALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDS  103
             A KHP W+MGKKITVDSATLFNKGLEVIEAHYLFG +YD+IEIVIHPQSIIHSM+ETQDS
Sbjct  295   AFKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDS  354

Query  102   SVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
             SVLAQLG PD RLP+LYT+SWPDR+ CSE+TWPR
Sbjct  355   SVLAQLGWPDMRLPILYTMSWPDRVPCSEVTWPR  388



>gb|AAU87836.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Taxus x media]
 gb|AHB62204.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Taxus wallichiana 
var. chinensis]
Length=477

 Score =   504 bits (1297),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 251/303 (83%), Positives = 279/303 (92%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            G AV  E RK WDGPKP SIIGSTGS+GTQ L++VAE+P+K++VVALAAGSNVTLLA QV
Sbjct  67   GTAVVGEDRKVWDGPKPFSIIGSTGSIGTQTLDIVAEHPDKFKVVALAAGSNVTLLAEQV  126

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            + FKPKLVS+R+ESL  ELKEAL+D++ KPEI+ G+EG++EVA+HP+ V+VVTGIVGCAG
Sbjct  127  RMFKPKLVSVRNESLATELKEALADIEHKPEIVYGDEGMVEVAQHPEAVSVVTGIVGCAG  186

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQCIQGLPEG
Sbjct  187  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLPEG  246

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
            ALRRIILTASGGAFRDWPV KLK+ KV DALKHP W+MGKKITVDSATLFNKGLEVIEAH
Sbjct  247  ALRRIILTASGGAFRDWPVGKLKEVKVSDALKHPNWNMGKKITVDSATLFNKGLEVIEAH  306

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YL+G DYDNIEIVIHPQSI HSMVETQDSSVLAQLG PD RLP+LYT+SWP+R+ CSE+T
Sbjct  307  YLYGADYDNIEIVIHPQSIAHSMVETQDSSVLAQLGWPDMRLPILYTMSWPERVPCSEVT  366

Query  9    WPR  1
            WPR
Sbjct  367  WPR  369



>gb|KEH18121.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Medicago truncatula]
Length=384

 Score =   499 bits (1284),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 270/373 (72%), Positives = 312/373 (84%), Gaps = 13/373 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM-----RVKCSSqaa  937
             MALN  S A+ K  SFF   +   N  ++  KL G  A++RK+G       RV CS+  +
Sbjct  1     MALNLPSPAQVKP-SFF---SDIINPVITPTKLPGSFALKRKEGDTKVVKRRVYCSAAHS  56

Query  936   aaqpqpawPGRAVAEESR-KTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAG  760
                  P   G A+ E S  KTWDGPKPIS++GSTGS+GTQ L +VAE PE++RVV LAAG
Sbjct  57    PQPAWP---GTAIPEPSDFKTWDGPKPISVLGSTGSIGTQTLNIVAEFPERFRVVGLAAG  113

Query  759   SNVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVT  580
             SNVTLLA QV+ FKP+LV++RDES +DELKEAL+ +D KPEIIPGE+G+IEVARHPD  T
Sbjct  114   SNVTLLAEQVRIFKPELVALRDESKIDELKEALAGIDHKPEIIPGEQGVIEVARHPDAAT  173

Query  579   VVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAI  400
             VVTGIVGCAGLKPTVAAIEAGKDIALANKET+IAGG FVLPLAHK+N+KILPADSEHSAI
Sbjct  174   VVTGIVGCAGLKPTVAAIEAGKDIALANKETMIAGGAFVLPLAHKNNIKILPADSEHSAI  233

Query  399   FQCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLF  220
             FQCIQGLP+GALR+I LT SGGAFR+WP EK+KD K+ DALKHPIWS+G+KIT+DSATLF
Sbjct  234   FQCIQGLPKGALRKIQLTGSGGAFREWPAEKMKDIKLKDALKHPIWSLGRKITIDSATLF  293

Query  219   NKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSW  40
             NKGLEVIEAHYLFG +YD+IEIVIHPQSIIHS+VETQDSSV+AQLGLPD RLPLLYTLSW
Sbjct  294   NKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSLVETQDSSVIAQLGLPDMRLPLLYTLSW  353

Query  39    PDRIYCSEITWPR  1
             P+R+YCSEITWPR
Sbjct  354   PERVYCSEITWPR  366



>gb|AAQ84168.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pueraria montana 
var. lobata]
Length=465

 Score =   501 bits (1290),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 262/372 (70%), Positives = 308/372 (83%), Gaps = 16/372 (4%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM----RVKCSSqaaa  934
             MALN  S A+ K   F    ++K           G  +++RKD       RV CS+ + +
Sbjct  1     MALNLPSPAQVKPLFFSSNNSTKL---------PGSFSLKRKDSDTTVERRVYCSAASQS  51

Query  933   aqpqpawPGRAVAEESR-KTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGS  757
               P     G A+ E S  KTWDGPKPISI+GSTGS+GTQ L +VAE PE+++VV+LAAGS
Sbjct  52    PSPAWP--GTAIPEPSDFKTWDGPKPISILGSTGSIGTQTLSIVAEFPERFKVVSLAAGS  109

Query  756   NVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTV  577
             N+TLLA Q+KTFKP++V +R+ESL+DELKEAL+D++ KPEIIPGE+G+IE ARHPD  TV
Sbjct  110   NITLLADQIKTFKPEVVGLRNESLIDELKEALADVEHKPEIIPGEQGVIEAARHPDSTTV  169

Query  576   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIF  397
             VTGIVGCAGLKPTVAAIEAGKDIALANKET+IAG PFVLPLAHKHN+KILPADSEHSAIF
Sbjct  170   VTGIVGCAGLKPTVAAIEAGKDIALANKETMIAGAPFVLPLAHKHNIKILPADSEHSAIF  229

Query  396   QCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFN  217
             Q IQGLP+GALR+I+LT SGGAFR+WP EK+KD K+ DALKHPIWS+G+KIT+DSATLFN
Sbjct  230   QSIQGLPKGALRKILLTGSGGAFREWPAEKMKDIKLADALKHPIWSLGRKITIDSATLFN  289

Query  216   KGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWP  37
             KGLEVIEAHYLFG  YD+IEIVIHPQSIIHS+VETQDSSV+AQLG+PD RLPLLYTLSWP
Sbjct  290   KGLEVIEAHYLFGASYDDIEIVIHPQSIIHSLVETQDSSVIAQLGIPDMRLPLLYTLSWP  349

Query  36    DRIYCSEITWPR  1
             +RIYCSE+TWPR
Sbjct  350   ERIYCSEVTWPR  361



>gb|EMS62178.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Triticum urartu]
Length=465

 Score =   501 bits (1289),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 255/315 (81%), Positives = 282/315 (90%), Gaps = 12/315 (4%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAVAE +R++WD PKPISIIGSTGSVGTQ L +VAENP+K+RVVALAAGSNVTLLA QV
Sbjct  41   GRAVAEPARRSWDRPKPISIIGSTGSVGTQTLAIVAENPDKFRVVALAAGSNVTLLADQV  100

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            K FKP LV+I +ESL++ELKEAL+D +  PEIIPGE+G+IEVARHPD VTVVTGIVGCAG
Sbjct  101  KMFKPNLVAIGNESLLNELKEALADCEYMPEIIPGEQGVIEVARHPDAVTVVTGIVGCAG  160

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGL EG
Sbjct  161  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLSEG  220

Query  369  ALRRIILTASGGAF------------RDWPVEKLKDAKVGDALKHPIWSMGKKITVDSAT  226
            +LRR+ILTASGGAF            RDWP+E+LKD +V DALKHP W MGKKITVDSAT
Sbjct  221  SLRRVILTASGGAFSIILHLISLDDIRDWPIERLKDVQVADALKHPNWKMGKKITVDSAT  280

Query  225  LFNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTL  46
            LFNKGLEVIEAHYLFG +YDNIEI+IHPQSIIHSM+ET+DSSVLAQLG  D RLP+LYTL
Sbjct  281  LFNKGLEVIEAHYLFGVEYDNIEIMIHPQSIIHSMIETKDSSVLAQLGRTDMRLPILYTL  340

Query  45   SWPDRIYCSEITWPR  1
            SWP+R+YCSE+TWPR
Sbjct  341  SWPERVYCSEVTWPR  355



>gb|KEH18120.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Medicago truncatula]
Length=470

 Score =   500 bits (1288),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 270/373 (72%), Positives = 312/373 (84%), Gaps = 13/373 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM-----RVKCSSqaa  937
             MALN  S A+ K  SFF   +   N  ++  KL G  A++RK+G       RV CS+  +
Sbjct  1     MALNLPSPAQVKP-SFF---SDIINPVITPTKLPGSFALKRKEGDTKVVKRRVYCSAAHS  56

Query  936   aaqpqpawPGRAVAEESR-KTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAG  760
                  P   G A+ E S  KTWDGPKPIS++GSTGS+GTQ L +VAE PE++RVV LAAG
Sbjct  57    PQPAWP---GTAIPEPSDFKTWDGPKPISVLGSTGSIGTQTLNIVAEFPERFRVVGLAAG  113

Query  759   SNVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVT  580
             SNVTLLA QV+ FKP+LV++RDES +DELKEAL+ +D KPEIIPGE+G+IEVARHPD  T
Sbjct  114   SNVTLLAEQVRIFKPELVALRDESKIDELKEALAGIDHKPEIIPGEQGVIEVARHPDAAT  173

Query  579   VVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAI  400
             VVTGIVGCAGLKPTVAAIEAGKDIALANKET+IAGG FVLPLAHK+N+KILPADSEHSAI
Sbjct  174   VVTGIVGCAGLKPTVAAIEAGKDIALANKETMIAGGAFVLPLAHKNNIKILPADSEHSAI  233

Query  399   FQCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLF  220
             FQCIQGLP+GALR+I LT SGGAFR+WP EK+KD K+ DALKHPIWS+G+KIT+DSATLF
Sbjct  234   FQCIQGLPKGALRKIQLTGSGGAFREWPAEKMKDIKLKDALKHPIWSLGRKITIDSATLF  293

Query  219   NKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSW  40
             NKGLEVIEAHYLFG +YD+IEIVIHPQSIIHS+VETQDSSV+AQLGLPD RLPLLYTLSW
Sbjct  294   NKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSLVETQDSSVIAQLGLPDMRLPLLYTLSW  353

Query  39    PDRIYCSEITWPR  1
             P+R+YCSEITWPR
Sbjct  354   PERVYCSEITWPR  366



>gb|AAP56260.3| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Cistus creticus]
Length=486

 Score =   500 bits (1287),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 269/370 (73%), Positives = 304/370 (82%), Gaps = 7/370 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRR---KDGGMRVKCSSqaaaa  931
             MALN +  AE K+ SF    ++KS          G   ++R   K  G R++CS+ A   
Sbjct  1     MALNLLHPAEIKSISFLD--STKSKSINFPKPFPGVFTLKRNCYKTFGGRIQCSAHAHEP  58

Query  930   qpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNV  751
                    GRA      +   GPK ISI+GSTGS+GTQ L++VAENP+K++VVALAAGSNV
Sbjct  59    PSAWP--GRASPXPRPQAIGGPKSISIVGSTGSIGTQTLDIVAENPDKFKVVALAAGSNV  116

Query  750   TLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVT  571
             TLLA QV+ F+P+LV+IR+E+L+ EL+EAL+DLD KPEIIPGEEG+IEVARHPD  TVVT
Sbjct  117   TLLAEQVRRFRPQLVAIRNEALLGELREALADLDYKPEIIPGEEGVIEVARHPDAATVVT  176

Query  570   GIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQC  391
             GIVGCAGLKPTVAAIEAGKDI  ANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQC
Sbjct  177   GIVGCAGLKPTVAAIEAGKDIXXANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQC  236

Query  390   IQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKG  211
             IQGLP+GALRRIILTASGGAFRDWPVEKLK+ KV DALKHP WSMGKKITVDSATLFNKG
Sbjct  237   IQGLPDGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKG  296

Query  210   LEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDR  31
             LEVIEAHYLFG +YDNIEIVIHPQSIIHSMVE QDSS+LAQ+G PD RLP+LYT+SWPDR
Sbjct  297   LEVIEAHYLFGAEYDNIEIVIHPQSIIHSMVELQDSSILAQMGWPDMRLPILYTMSWPDR  356

Query  30    IYCSEITWPR  1
             +YCSEITWPR
Sbjct  357   VYCSEITWPR  366



>gb|ACC54558.1| putative 1-D-deoxyxylulose 5-phosphate reductoisomerase [Pinus 
densiflora]
Length=479

 Score =   499 bits (1286),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 250/303 (83%), Positives = 281/303 (93%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            G+ V +E+RK WDGP P S++GSTGS+GTQ L++VAE+P+K+RVVALAAGSNVTLLA QV
Sbjct  69   GKLVVDENRKVWDGPNPFSVVGSTGSIGTQTLDIVAEHPDKFRVVALAAGSNVTLLADQV  128

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            + FKPKLVSI +E+L  ELK+AL+D++ KPEI+ GEEG+IEVA+HP+ V+VVTGIVGCAG
Sbjct  129  RRFKPKLVSIGNEALAAELKDALADVEPKPEILFGEEGIIEVAQHPEAVSVVTGIVGCAG  188

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH VKILPADSEHSAIFQCIQGLPEG
Sbjct  189  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLPEG  248

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
            ALRRIILTASGGAFRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFNKGLEVIEAH
Sbjct  249  ALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAH  308

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YL+G DYDNIEI+IHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SWP+RI CSEIT
Sbjct  309  YLYGVDYDNIEIMIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPERISCSEIT  368

Query  9    WPR  1
            WPR
Sbjct  369  WPR  371



>ref|XP_003547784.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like 
[Glycine max]
Length=465

 Score =   498 bits (1283),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 262/372 (70%), Positives = 307/372 (83%), Gaps = 16/372 (4%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM----RVKCSSqaaa  934
             MALN  S A+ K   F    ++K           G  +++RKD       RV CS+ A +
Sbjct  1     MALNLPSPAQVKPLFFSSNNSTKL---------PGSFSLKRKDSDTTVERRVYCSAAAQS  51

Query  933   aqpqpawPGRAVAEESR-KTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGS  757
               P     G A+ E S  KTWDG KPIS++GSTGS+GTQ L +VAE PE+++VV+LAAGS
Sbjct  52    PPPAWP--GTAIPEPSDFKTWDGQKPISVLGSTGSIGTQTLSIVAEFPERFKVVSLAAGS  109

Query  756   NVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTV  577
             N+TLLA Q+KTFKP++V +R+ESL+DELKEAL+D+D KPEIIPGE+G+IE ARHPD  TV
Sbjct  110   NITLLADQIKTFKPEVVGLRNESLIDELKEALADVDHKPEIIPGEQGVIEAARHPDATTV  169

Query  576   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIF  397
             VTGIVGCAGLKPTVAAIEAGKDIALANKET+IAG PFVLPLAHKHN+KILPADSEHSAIF
Sbjct  170   VTGIVGCAGLKPTVAAIEAGKDIALANKETMIAGAPFVLPLAHKHNIKILPADSEHSAIF  229

Query  396   QCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFN  217
             Q IQGLP+GALR+I+LT SGGAFR+WP EK+KD K+ DALKHPIWS+G+KIT+DSATLFN
Sbjct  230   QSIQGLPKGALRKILLTGSGGAFREWPAEKMKDIKLADALKHPIWSLGRKITIDSATLFN  289

Query  216   KGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWP  37
             KGLEVIEAHYLFG  YD+IEIVIHPQSIIHS+VETQDSSV+AQLG+PD RLPLLYTLSWP
Sbjct  290   KGLEVIEAHYLFGASYDDIEIVIHPQSIIHSLVETQDSSVIAQLGIPDMRLPLLYTLSWP  349

Query  36    DRIYCSEITWPR  1
             +RIYCSE+TWPR
Sbjct  350   ERIYCSEVTWPR  361



>ref|XP_010444134.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like 
[Camelina sativa]
Length=478

 Score =   498 bits (1281),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 273/373 (73%), Positives = 312/373 (84%), Gaps = 13/373 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRK----DGGMRVKCS-Sqaa  937
             M LN I  AE  A SF       S +NL+     GG+ +R++    D G  VKCS     
Sbjct  4     MTLNSIPPAESVALSFLD----TSRFNLTPKLSSGGLGLRKRNQGRDFGKGVKCSVKVQQ  59

Query  936   aaqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGS  757
              + P PAWPGRAV E  R++WDGPKPISI+GSTGS+GTQ L +VAENP+K+RVVALAAGS
Sbjct  60    QSSPPPAWPGRAVPEAPRQSWDGPKPISIVGSTGSIGTQTLGIVAENPDKFRVVALAAGS  119

Query  756   NVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTV  577
             NVTLLA QV+ FKP LV +R+ESL+DELKEAL+DLD KPEIIPGE+G+IEVARHP+ VT+
Sbjct  120   NVTLLADQVRRFKPALVDLRNESLIDELKEALADLDYKPEIIPGEQGVIEVARHPEAVTL  179

Query  576   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIF  397
             VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA+KH VKILPADSEHSAIF
Sbjct  180   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLANKHKVKILPADSEHSAIF  239

Query  396   QCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIW-SMGKKITVDSATLF  220
             QCIQGLPEG LR+IILTASGG+FRDWPVEKLK+  V +AL HPIW SMGKK+T+DSATLF
Sbjct  240   QCIQGLPEGGLRKIILTASGGSFRDWPVEKLKEVTVAEALNHPIWTSMGKKVTIDSATLF  299

Query  219   NKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSW  40
             NKGLEVIEAHYLFG +YD+IEIVIHPQSIIHSM+ETQDSSV+AQLG PD R+P+LYT+SW
Sbjct  300   NKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVIAQLGWPDMRIPILYTMSW  359

Query  39    PDRIYCSEITWPR  1
             P+R+ CS   WPR
Sbjct  360   PERVPCS---WPR  369



>ref|XP_006439820.1| hypothetical protein CICLE_v10019836mg [Citrus clementina]
 gb|ESR53060.1| hypothetical protein CICLE_v10019836mg [Citrus clementina]
Length=497

 Score =   498 bits (1282),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 255/353 (72%), Positives = 296/353 (84%), Gaps = 6/353 (2%)
 Frame = -3

Query  1062  FSFFQFQTsksnynlsslkLQGGVAMRRKDGGMRVKCSSqaaaaqpqpawPGRAVAEESR  883
             FSF  F      ++ +      G A      G RVKCS QA+         GRAVAE   
Sbjct  41    FSFIYFNKLGGIWSKTKRNKDNGTATF----GRRVKCSGQASPPASAWP--GRAVAESRP  94

Query  882   KTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVS  703
             KTW+G KPI+++GSTGS+GTQ L+++AE+ +K+RVVALAAGSNVTLLA QVK FKP+LV+
Sbjct  95    KTWEGRKPITVLGSTGSIGTQTLDIIAEHEDKFRVVALAAGSNVTLLADQVKRFKPQLVA  154

Query  702   IRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIE  523
             IR+ESLVDELKEAL++++EKPEI+  E+G+IE ARHPD  TVVTGIVGCAGLKPTVAAIE
Sbjct  155   IRNESLVDELKEALANVEEKPEIMTEEQGVIEAARHPDAATVVTGIVGCAGLKPTVAAIE  214

Query  522   AGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTA  343
             AGKDIALANKET+IAGGPF+LPLAHKHN+K LPADSEHSA+FQCIQGLPEGALRRIILTA
Sbjct  215   AGKDIALANKETMIAGGPFILPLAHKHNIKFLPADSEHSAVFQCIQGLPEGALRRIILTA  274

Query  342   SGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDN  163
             SGGA RDWPVEK+K+  V DALKHPIW++GKKIT+DSATLFNKGLEVIEAHYLFG  YDN
Sbjct  275   SGGASRDWPVEKMKEITVADALKHPIWTLGKKITIDSATLFNKGLEVIEAHYLFGAGYDN  334

Query  162   IEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWP  4
             IEIVIHPQSI+HSM+ETQDSSV+ QLG  D R+PLLYT+SWP+RIYCSE+TWP
Sbjct  335   IEIVIHPQSILHSMIETQDSSVIGQLGWADMRIPLLYTMSWPERIYCSEVTWP  387



>ref|XP_007134144.1| hypothetical protein PHAVU_010G023000g [Phaseolus vulgaris]
 gb|ESW06138.1| hypothetical protein PHAVU_010G023000g [Phaseolus vulgaris]
Length=465

 Score =   495 bits (1275),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 253/338 (75%), Positives = 297/338 (88%), Gaps = 7/338 (2%)
 Frame = -3

Query  999  GGVAMRRKDGGM----RVKCSSqaaaaqpqpawPGRAVAEESR-KTWDGPKPISIIGSTG  835
            G   ++RK+       RV CS+ A +  P     G A+ E S  KTW+GPKPI+++GSTG
Sbjct  26   GNFCLKRKESDRIEERRVYCSAAAQSPPPAWP--GTAIPEPSDFKTWEGPKPITVLGSTG  83

Query  834  SVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESLVDELKEALSD  655
            S+GTQ L +VAE PE+++VVALAAGSN+TLLA Q+KTFKP++V +R+ESLVDEL+EA++D
Sbjct  84   SIGTQTLSIVAEFPERFKVVALAAGSNITLLADQIKTFKPQVVGLRNESLVDELREAIAD  143

Query  654  LDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAG  475
            ++ KPEIIPGE+G+IE ARHPD VTVVTGIVGCAGLKPTVAAIEAGKDIALANKET+IAG
Sbjct  144  VEHKPEIIPGEQGVIEAARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETMIAG  203

Query  474  GPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKDA  295
             PFVLPLA KHN+KILPADSEHSAIFQ IQGLP+GALR+I+LT SGGAFR+WP EK+KD 
Sbjct  204  APFVLPLAKKHNIKILPADSEHSAIFQSIQGLPKGALRKILLTGSGGAFREWPAEKMKDI  263

Query  294  KVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVE  115
            K+ DALKHPIWS+G+KIT+DSATLFNKGLEVIEAHYLFG+DYD+IEIVIHPQSIIHS+VE
Sbjct  264  KLADALKHPIWSLGRKITIDSATLFNKGLEVIEAHYLFGSDYDDIEIVIHPQSIIHSLVE  323

Query  114  TQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            TQDSSV+AQLG+PD RLPLLYTLSWPDRIYCSEITWPR
Sbjct  324  TQDSSVIAQLGIPDMRLPLLYTLSWPDRIYCSEITWPR  361



>gb|KHN20432.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Glycine soja]
Length=442

 Score =   493 bits (1270),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 252/335 (75%), Positives = 294/335 (88%), Gaps = 7/335 (2%)
 Frame = -3

Query  990  AMRRKDGGM----RVKCSSqaaaaqpqpawPGRAVAEESR-KTWDGPKPISIIGSTGSVG  826
            +++RKD       RV CS+ A +  P     G A+ E S  KTWDG KPIS++GSTGS+G
Sbjct  6    SLKRKDSDTTVERRVYCSAAAQSPPPAWP--GTAIPEPSDFKTWDGQKPISVLGSTGSIG  63

Query  825  TQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDe  646
            TQ L +VAE PE+++VV+LAAGSN+TLLA Q+KTFKP++V +R+ESL+DELKEAL+D+D 
Sbjct  64   TQTLSIVAEFPERFKVVSLAAGSNITLLADQIKTFKPEVVGLRNESLIDELKEALADVDH  123

Query  645  kpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPF  466
            KPEIIPGE+G+IE ARHPD  TVVTGIVGCAGLKPTVAAIEAGKDIALANKET+IAG PF
Sbjct  124  KPEIIPGEQGVIEAARHPDATTVVTGIVGCAGLKPTVAAIEAGKDIALANKETMIAGAPF  183

Query  465  VLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVG  286
            VLPLAHKHN+KILPADSEHSAIFQ IQGLP+GALR+I+LT SGGAFR+WP EK+KD K+ 
Sbjct  184  VLPLAHKHNIKILPADSEHSAIFQSIQGLPKGALRKILLTGSGGAFREWPAEKMKDIKLA  243

Query  285  DALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQD  106
            DALKHPIWS+G+KIT+DSATLFNKGLEVIEAHYLFG  YD+IEIVIHPQSIIHS+VETQD
Sbjct  244  DALKHPIWSLGRKITIDSATLFNKGLEVIEAHYLFGASYDDIEIVIHPQSIIHSLVETQD  303

Query  105  SSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            SSV+AQLG+PD RLPLLYTLSWP+RIYCSE+TWPR
Sbjct  304  SSVIAQLGIPDMRLPLLYTLSWPERIYCSEVTWPR  338



>gb|AEB91529.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Glycine max]
Length=465

 Score =   493 bits (1270),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 261/372 (70%), Positives = 306/372 (82%), Gaps = 16/372 (4%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM----RVKCSSqaaa  934
             MALN  S A+ K   F    ++K           G  +++RKD       RV CS+ A +
Sbjct  1     MALNLPSPAQVKPLFFSSNNSTKL---------PGSFSLKRKDSDTTVERRVYCSAAAQS  51

Query  933   aqpqpawPGRAVAEESR-KTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGS  757
               P     G A+ E S  KTWDG KPIS++GSTGS+GTQ L +VAE PE+++VV+LAAGS
Sbjct  52    PPPAWP--GTAIPEPSDFKTWDGQKPISVLGSTGSIGTQTLSIVAEFPERFKVVSLAAGS  109

Query  756   NVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTV  577
             N+TLLA Q+KTFKP++V +R+ESL+DELKEAL+D+D KPEIIPGE+G+IE ARHPD  TV
Sbjct  110   NITLLADQIKTFKPEVVGLRNESLIDELKEALADVDHKPEIIPGEQGVIEAARHPDATTV  169

Query  576   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIF  397
             VTGIVGCAGLKPTVAAIEAGKDIALANKET+IAG PFVLPLAHKHN+KILPADSEHSAIF
Sbjct  170   VTGIVGCAGLKPTVAAIEAGKDIALANKETMIAGAPFVLPLAHKHNIKILPADSEHSAIF  229

Query  396   QCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFN  217
             Q IQGLP+GALR+I+LT SGGAFR+WP EK+KD K+ DALKHPI S+G+KIT+DSATLFN
Sbjct  230   QSIQGLPKGALRKILLTGSGGAFREWPAEKMKDIKLADALKHPIRSLGRKITIDSATLFN  289

Query  216   KGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWP  37
             KGLEVIEAHYLFG  YD+IEIVIHPQSIIHS+VETQDSSV+AQLG+PD RLPLLYTLSWP
Sbjct  290   KGLEVIEAHYLFGASYDDIEIVIHPQSIIHSLVETQDSSVIAQLGIPDMRLPLLYTLSWP  349

Query  36    DRIYCSEITWPR  1
             +RIYCSE+TWPR
Sbjct  350   ERIYCSEVTWPR  361



>ref|XP_006376853.1| hypothetical protein POPTR_0012s08230g [Populus trichocarpa]
 gb|ERP54650.1| hypothetical protein POPTR_0012s08230g [Populus trichocarpa]
Length=429

 Score =   491 bits (1265),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 262/368 (71%), Positives = 286/368 (78%), Gaps = 49/368 (13%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKD-GGMRVKCSSqaaaaqp  925
             MALN +S AE KA SF       S  +    KLQGG++++RKD GG R++CS      QP
Sbjct  1     MALNILSPAEIKAISFLD-----STKSNRLPKLQGGLSLKRKDCGGRRIQCS-VQNQNQP  54

Query  924   qpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTL  745
              PAWPGRA  E  RKTWDGPKPISI+GSTGS+GTQ L++VAENP+K++VVALAAGSNVTL
Sbjct  55    PPAWPGRACPEPGRKTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFKVVALAAGSNVTL  114

Query  744   LAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGI  565
             LA QV                                          ARHPD V+VVTGI
Sbjct  115   LADQV------------------------------------------ARHPDAVSVVTGI  132

Query  564   VGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQ  385
             VGCAGLKPTVAAIEAGKDI LANKETLIAGGPFVLPLAHK+NVKILPADSEHSAIFQCIQ
Sbjct  133   VGCAGLKPTVAAIEAGKDICLANKETLIAGGPFVLPLAHKYNVKILPADSEHSAIFQCIQ  192

Query  384   GLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLE  205
             GLPEGALRRIILTASGGAFRDWPVEKLK+ KV DALKHP W+MGKKITVDSATLFNKGLE
Sbjct  193   GLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLE  252

Query  204   VIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
             VIEAHYLFG DYDNI+IVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT+SWPDR+Y
Sbjct  253   VIEAHYLFGADYDNIDIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPDRVY  312

Query  24    CSEITWPR  1
             CSEITWPR
Sbjct  313   CSEITWPR  320



>gb|AFK42658.1| unknown [Lotus japonicus]
Length=467

 Score =   492 bits (1267),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 262/368 (71%), Positives = 308/368 (84%), Gaps = 6/368 (2%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGMRVKCSSqaaaaqpq  922
             MALN  S A+ K   F     S +  + +S KL G    ++K+    VK     +A  P 
Sbjct  1     MALNLPSPAQVKPLFF-----SDTLNSNTSTKLSGSFVFKKKELETTVKRRVICSAQSPP  55

Query  921   pawPGRAVAEESR-KTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTL  745
              AWPG A+ E S  KTWDGPKPI+++GSTGS+GTQ L +VAE  +++++V LAAGSNVTL
Sbjct  56    SAWPGTAIPEPSDFKTWDGPKPITVLGSTGSIGTQTLNIVAEFSDRFKIVGLAAGSNVTL  115

Query  744   LAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGI  565
             LA QVKTFKP++V++RDES +DELKEAL+DLD KPEI+ GE+G++EVA HPD  TVVTGI
Sbjct  116   LADQVKTFKPQVVALRDESRIDELKEALADLDHKPEILVGEQGVVEVAGHPDAATVVTGI  175

Query  564   VGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQ  385
             VGCAGLKPTVAAI+AGKDIALANKET+IAG PF+LPLAHKHN+K LPADSEHSAIFQCIQ
Sbjct  176   VGCAGLKPTVAAIQAGKDIALANKETMIAGAPFILPLAHKHNIKFLPADSEHSAIFQCIQ  235

Query  384   GLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLE  205
             GLP GALR+I LTASGGAFR+WPVEK+KD KV DALKHPIW++G+KITVDSATLFNKGLE
Sbjct  236   GLPIGALRKIQLTASGGAFREWPVEKMKDIKVSDALKHPIWTLGRKITVDSATLFNKGLE  295

Query  204   VIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
             VIEAHYLFG +YD+IEIVIHPQSIIHSM+ETQDSSV+AQLG+PD RLPLLYTLSWP+RIY
Sbjct  296   VIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVIAQLGIPDMRLPLLYTLSWPERIY  355

Query  24    CSEITWPR  1
             CSEIT+PR
Sbjct  356   CSEITYPR  363



>ref|XP_006477542.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like 
[Citrus sinensis]
Length=489

 Score =   492 bits (1266),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 264/381 (69%), Positives = 305/381 (80%), Gaps = 17/381 (4%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlssl------kLQGGV---AMRRKDGGM-----  964
             MALN +S  E KA SF     S       S          GG+     R KD G      
Sbjct  1     MALNLVSPTEIKALSFLDTTRSNHRLRKLSNFHFFFFNKLGGIWSKTKRNKDNGTATFGR  60

Query  963   RVKCSSqaaaaqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKY  784
             R KCS QA+         GRAVAE   K+W+G KPI+++GSTGS+GTQ L+++AE+ +K+
Sbjct  61    REKCSGQASPPASAWP--GRAVAESRPKSWEGRKPITVLGSTGSIGTQTLDIIAEHEDKF  118

Query  783   RVVALAAGSNVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEV  604
             RVVALAAGSNVTLLA QVK FKP+LV+IR+ESLVDELKEAL++++EKPEI+ GE+G+IE 
Sbjct  119   RVVALAAGSNVTLLADQVKRFKPQLVAIRNESLVDELKEALANVEEKPEIMTGEQGVIEA  178

Query  603   ARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILP  424
             ARHPD  TVVTGIVGCAGLKPTVAAIEAGKDIALANKET+IAGGPF+LPLAHKHN+K LP
Sbjct  179   ARHPDAATVVTGIVGCAGLKPTVAAIEAGKDIALANKETMIAGGPFILPLAHKHNIKFLP  238

Query  423   ADSEHSAIFQCIQGLPEGALRRIILTASGGAFR-DWPVEKLKDAKVGDALKHPIWSMGKK  247
             ADSEHSA+FQCIQGLPEGAL RIILTASGGAFR DWPVEK+K+  V DALKHPIW++GKK
Sbjct  239   ADSEHSAVFQCIQGLPEGALWRIILTASGGAFRFDWPVEKMKEITVADALKHPIWTLGKK  298

Query  246   ITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFR  67
             IT+DSATLFNKGLEVIEAHYLFG  YDNIEIVIHPQSI+HSM+E QDSSV+ QLG  D R
Sbjct  299   ITIDSATLFNKGLEVIEAHYLFGAGYDNIEIVIHPQSILHSMIERQDSSVIGQLGWADMR  358

Query  66    LPLLYTLSWPDRIYCSEITWP  4
             +PLLYT+SWP+RIYCSE+TWP
Sbjct  359   IPLLYTMSWPERIYCSEVTWP  379



>ref|XP_010483991.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like 
[Camelina sativa]
Length=473

 Score =   491 bits (1265),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 269/373 (72%), Positives = 307/373 (82%), Gaps = 17/373 (5%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGMR----VKCS-Sqaa  937
             M LN I  AE  A SF                L GG + RR++ G      VKCS     
Sbjct  3     MTLNSIPPAESVALSFLD--------TSRFKVLPGGFSSRRRNQGRGFGKGVKCSVKVQQ  54

Query  936   aaqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGS  757
              + P PAWPGRAV E  R++WDGPKPISI+GSTGS+GTQ L +VAENP+K+RVVALAAGS
Sbjct  55    QSSPPPAWPGRAVPEAPRQSWDGPKPISIVGSTGSIGTQTLGIVAENPDKFRVVALAAGS  114

Query  756   NVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTV  577
             NVTLLA QV+ FKP LV++R+ESL+ ELKEAL+DLD KPEIIPGE+G+IEVARHP+ VT+
Sbjct  115   NVTLLADQVRRFKPALVALRNESLIKELKEALADLDYKPEIIPGEQGVIEVARHPEAVTL  174

Query  576   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIF  397
             VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA+KH VKILPADSEHSAIF
Sbjct  175   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLANKHKVKILPADSEHSAIF  234

Query  396   QCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIW-SMGKKITVDSATLF  220
             QCIQGLPEG LR+IILTASGG+FRDWPVEKLK+  V +AL HPIW SMGKK+T+DSATLF
Sbjct  235   QCIQGLPEGGLRKIILTASGGSFRDWPVEKLKEVTVAEALNHPIWTSMGKKVTIDSATLF  294

Query  219   NKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSW  40
             NKGLEVIEAHYLFG +YD+IEIVIHPQSIIHSM+ETQDSSV+AQLG PD R+P+LYT+SW
Sbjct  295   NKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVIAQLGWPDMRIPILYTMSW  354

Query  39    PDRIYCSEITWPR  1
             P+R+ CS   +PR
Sbjct  355   PERVPCS---YPR  364



>ref|XP_003608963.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase, partial [Medicago 
truncatula]
Length=468

 Score =   490 bits (1262),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 274/372 (74%), Positives = 308/372 (83%), Gaps = 10/372 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM----RVKCSSqaaa  934
             MALN  S AE K+  FF   T     N  + K  GGVA++RK+ G     RV CS   + 
Sbjct  1     MALNLYSPAELKS-GFF---TDPLKSNRFTPKFPGGVALKRKENGTASGTRVYCS-VQST  55

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
             + P PAWPGRA+ E   KTW+GPKPISI+G TGS+GTQ L++VAENP+K+RVVALAAGSN
Sbjct  56    SGPPPAWPGRAIPELGNKTWEGPKPISIVGCTGSIGTQTLDIVAENPDKFRVVALAAGSN  115

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             +TLL  QVK FKP+LV++R+ESL+ EL+EAL D++EKPEIIPGE+G+IEVARHPD VTVV
Sbjct  116   ITLLVDQVKRFKPQLVAVRNESLLAELQEALKDVEEKPEIIPGEQGVIEVARHPDAVTVV  175

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA KHNVK           F+
Sbjct  176   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLARKHNVKYFLLIPNILLFFR  235

Query  393   -CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFN  217
              CIQGL EGALRR+ILTASGGAFRDWPVEKLKD KV DALKHP WSMGKKITVDSATLFN
Sbjct  236   VCIQGLTEGALRRVILTASGGAFRDWPVEKLKDVKVADALKHPNWSMGKKITVDSATLFN  295

Query  216   KGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWP  37
             KGLEVIEAHYLFG DYD+I+IVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYTLSWP
Sbjct  296   KGLEVIEAHYLFGADYDDIDIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTLSWP  355

Query  36    DRIYCSEITWPR  1
             DR+YCSE+TWPR
Sbjct  356   DRVYCSEVTWPR  367



>ref|XP_002991775.1| hypothetical protein SELMODRAFT_229643 [Selaginella moellendorffii]
 gb|EFJ07179.1| hypothetical protein SELMODRAFT_229643 [Selaginella moellendorffii]
Length=488

 Score =   489 bits (1260),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 243/328 (74%), Positives = 283/328 (86%), Gaps = 5/328 (2%)
 Frame = -3

Query  981  RKDGGMRVKCSSqaaaaqpqpawPGRAVAEESRK-TWDGPKPISIIGSTGSVGTQCLEVV  805
            R  G  +++CSS    +       GRA+ + +RK +WDGPKPIS++GSTGS+GTQ L++V
Sbjct  56   RNAGSSKIRCSSNGPPSAWP----GRAMVDGARKKSWDGPKPISLLGSTGSIGTQTLDIV  111

Query  804  AENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipg  625
            +ENP++++VV LAAGSNVTLLA QV+ FKP +V IRD SL+DELKEA++DLD KPEI+ G
Sbjct  112  SENPDRFKVVGLAAGSNVTLLADQVRRFKPSMVGIRDASLIDELKEAIADLDVKPEIVVG  171

Query  624  eegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHK  445
            +EG +++A HP+ V VVTGIVGCAGLKPTVAAI AGKDIALANKETLIAGGP+VLPLA K
Sbjct  172  DEGTVQIACHPEAVEVVTGIVGCAGLKPTVAAIAAGKDIALANKETLIAGGPYVLPLAKK  231

Query  444  HNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPI  265
            H + ILPADSEHSAIFQCIQGLPEG +RRI+LTASGGAFRDWPVE+LKD K  DALKHP 
Sbjct  232  HGINILPADSEHSAIFQCIQGLPEGGMRRIVLTASGGAFRDWPVERLKDVKPADALKHPN  291

Query  264  WSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQL  85
            WSMGKKITVDSATL NKGLEVIEAHYLFG DYD+I+IVIHPQSIIHSM+ETQDSS+LAQL
Sbjct  292  WSMGKKITVDSATLMNKGLEVIEAHYLFGADYDDIDIVIHPQSIIHSMIETQDSSILAQL  351

Query  84   GLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            G PD RLP+LYTLSWPDR+ CSEITWPR
Sbjct  352  GWPDMRLPILYTLSWPDRVPCSEITWPR  379



>ref|XP_002989706.1| hypothetical protein SELMODRAFT_229487 [Selaginella moellendorffii]
 gb|EFJ09183.1| hypothetical protein SELMODRAFT_229487 [Selaginella moellendorffii]
Length=488

 Score =   489 bits (1259),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 243/328 (74%), Positives = 283/328 (86%), Gaps = 5/328 (2%)
 Frame = -3

Query  981  RKDGGMRVKCSSqaaaaqpqpawPGRAVAEESRK-TWDGPKPISIIGSTGSVGTQCLEVV  805
            R  G  +++CSS    +       GRA+ + +RK +WDGPKPIS++GSTGS+GTQ L++V
Sbjct  56   RNAGSSKIRCSSNGPPSAWP----GRAMVDGARKKSWDGPKPISLLGSTGSIGTQTLDIV  111

Query  804  AENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipg  625
            +ENP++++VV LAAGSNVTLLA QV+ FKP +V IRD SL+DELKEA++DLD KPEI+ G
Sbjct  112  SENPDRFKVVGLAAGSNVTLLADQVRRFKPSMVGIRDASLIDELKEAIADLDVKPEIVVG  171

Query  624  eegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHK  445
            +EG +++A HP+ V VVTGIVGCAGLKPTVAAI AGKDIALANKETLIAGGP+VLPLA K
Sbjct  172  DEGTVQIACHPEAVEVVTGIVGCAGLKPTVAAIAAGKDIALANKETLIAGGPYVLPLAKK  231

Query  444  HNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPI  265
            H + ILPADSEHSAIFQCIQGLPEG +RRI+LTASGGAFRDWPVE+LKD K  DALKHP 
Sbjct  232  HGINILPADSEHSAIFQCIQGLPEGGMRRIVLTASGGAFRDWPVERLKDVKPADALKHPN  291

Query  264  WSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQL  85
            WSMGKKITVDSATL NKGLEVIEAHYLFG DYD+I+IVIHPQSIIHSM+ETQDSS+LAQL
Sbjct  292  WSMGKKITVDSATLMNKGLEVIEAHYLFGADYDDIDIVIHPQSIIHSMIETQDSSILAQL  351

Query  84   GLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            G PD RLP+LYTLSWPDR+ CSEITWPR
Sbjct  352  GWPDMRLPILYTLSWPDRVPCSEITWPR  379



>gb|AHJ38612.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Huperzia serrata]
Length=479

 Score =   483 bits (1243),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 240/304 (79%), Positives = 272/304 (89%), Gaps = 1/304 (0%)
 Frame = -3

Query  909  GRAVAEESRK-TWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQ  733
            GRA  E +RK TW+G KPIS+IGSTGS+GTQ L++ AE+PEK++VVALAAGSN+TLLA Q
Sbjct  67   GRATVEGARKKTWEGAKPISLIGSTGSIGTQTLDIAAEHPEKFKVVALAAGSNITLLAEQ  126

Query  732  VKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCA  553
            ++TFKP LV+IR+    DELK A+ D+  +PEI+ G+EG+IEVARHP+ VTVVTGIVGCA
Sbjct  127  IRTFKPSLVAIRNGESADELKSAIKDVQPQPEIVFGDEGIIEVARHPEAVTVVTGIVGCA  186

Query  552  GLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPE  373
            GLKPTVAAIEAGKDIALANKETLIAGGP+VLPLA KH +KILPADSEHSAIFQCIQGLPE
Sbjct  187  GLKPTVAAIEAGKDIALANKETLIAGGPYVLPLAQKHGIKILPADSEHSAIFQCIQGLPE  246

Query  372  GALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEA  193
            G LRRIILTASGGAFRDWPVEKLKD +  DALKHP WSMGKKITVDSATL NKGLEVIEA
Sbjct  247  GGLRRIILTASGGAFRDWPVEKLKDVRPADALKHPNWSMGKKITVDSATLMNKGLEVIEA  306

Query  192  HYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEI  13
            HYLFG  YD+I+IVIHPQSI+HSM+ETQDSS+LAQLG PD RLP+LYTLSWP+RI CS+I
Sbjct  307  HYLFGASYDDIDIVIHPQSIVHSMIETQDSSILAQLGWPDMRLPILYTLSWPERIACSDI  366

Query  12   TWPR  1
            TWPR
Sbjct  367  TWPR  370



>ref|XP_001765145.1| predicted protein [Physcomitrella patens]
 gb|EDQ70140.1| predicted protein [Physcomitrella patens]
Length=422

 Score =   478 bits (1231),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 240/303 (79%), Positives = 274/303 (90%), Gaps = 1/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAVAEE  K  +GPKPIS+IGSTGS+GTQ L++VAENP++++VVALAAGSN+TLLA Q+
Sbjct  11   GRAVAEEV-KIRNGPKPISLIGSTGSIGTQTLDIVAENPDRFKVVALAAGSNITLLAEQI  69

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            K FKP LV++++ S V  L+EAL+ L++ PEI+ G+EG++EVARHP+ VTVVTGIVGCAG
Sbjct  70   KVFKPSLVAVKEASSVPALREALAGLEKLPEIMVGDEGIVEVARHPEAVTVVTGIVGCAG  129

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGP+VLPLA KH +KILPADSEHSAIFQCIQGLPE 
Sbjct  130  LKPTVAAIEAGKDIALANKETLIAGGPYVLPLAKKHGIKILPADSEHSAIFQCIQGLPES  189

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
             LRRIILTASGGAFRDWPVEKLKD KV DALKHP WSMG+KITVDSATL NKGLEVIEAH
Sbjct  190  GLRRIILTASGGAFRDWPVEKLKDVKVADALKHPNWSMGRKITVDSATLMNKGLEVIEAH  249

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YLFG DYD+I+IV+HPQSIIHSMVETQDSSV+AQLG PD RLP+LYT+SWP+RI CSE T
Sbjct  250  YLFGADYDDIDIVVHPQSIIHSMVETQDSSVIAQLGWPDMRLPILYTMSWPERIPCSEKT  309

Query  9    WPR  1
            WPR
Sbjct  310  WPR  312



>ref|XP_001763690.1| predicted protein [Physcomitrella patens]
 gb|EDQ71580.1| predicted protein [Physcomitrella patens]
Length=422

 Score =   476 bits (1226),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 240/303 (79%), Positives = 272/303 (90%), Gaps = 1/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAV E+  K  +GPKPIS+IGSTGS+GTQ L++VAENP K++VVALAAGSNV+LLA Q+
Sbjct  11   GRAVIEDV-KIRNGPKPISLIGSTGSIGTQTLDIVAENPNKFKVVALAAGSNVSLLAEQI  69

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            K F+P LV++++ S V  LKEAL+ LD+ PEI+ GEEG++EVARHP+ VTVVTGIVGCAG
Sbjct  70   KAFRPSLVAVKNASSVPALKEALAGLDKLPEIMVGEEGIVEVARHPEAVTVVTGIVGCAG  129

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGP+VLPLA KH + ILPADSEHSAIFQCIQGLPEG
Sbjct  130  LKPTVAAIEAGKDIALANKETLIAGGPYVLPLAKKHGINILPADSEHSAIFQCIQGLPEG  189

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
             LRRIILTASGGAFRDWPVEKLK+ KV DALKHP WSMG+KITVDSATL NKGLEVIEAH
Sbjct  190  GLRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGRKITVDSATLMNKGLEVIEAH  249

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YLFG DYD+I+IV+HPQSIIHSMVETQDSSV+AQLG PD RLP+LYT+SWP+RI CSE T
Sbjct  250  YLFGADYDDIDIVVHPQSIIHSMVETQDSSVIAQLGWPDMRLPILYTMSWPERISCSEKT  309

Query  9    WPR  1
            WPR
Sbjct  310  WPR  312



>ref|XP_010459335.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like 
[Camelina sativa]
Length=479

 Score =   478 bits (1229),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 259/375 (69%), Positives = 302/375 (81%), Gaps = 15/375 (4%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGMR----VKCSSqaaa  934
             M LN I  +E  A SF    +  +          GG + R+++ G      VKCS +   
Sbjct  3     MTLNSIPPSESFALSFLDTSSRFNLTPKL----PGGFSSRKRNQGRGFGKGVKCSVKVQQ  58

Query  933   aqpqpawP--GRAVAEES-RKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAA  763
                 P     GRAV  E+ R++WDGPKPISI+GSTGS+GTQ L +VAENP+K+RVVALAA
Sbjct  59    QSSPPPPAWPGRAVPPETPRQSWDGPKPISIVGSTGSIGTQTLGIVAENPDKFRVVALAA  118

Query  762   GSNVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIV  583
             GSN TLLA QV+ FKP LV++R+ESL+ ELKEAL+DLD KPEIIPGE+G+IEV RHP+ V
Sbjct  119   GSNFTLLADQVRKFKPALVALRNESLIGELKEALADLDYKPEIIPGEQGVIEVGRHPEAV  178

Query  582   TVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSA  403
             T+VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA+KH VKILPADSEHSA
Sbjct  179   TLVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLANKHKVKILPADSEHSA  238

Query  402   IFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIW-SMGKKITVDSAT  226
             IFQCIQGLPEG LR+IILTASGG+FRDWPVEKLK+  V ++L HPIW SMGKK+T+DSAT
Sbjct  239   IFQCIQGLPEGGLRKIILTASGGSFRDWPVEKLKEVTVAESLNHPIWTSMGKKVTIDSAT  298

Query  225   LFNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTL  46
             LFNKGLEVIEAHYLFG +YD+IEIVIHPQSIIHSM+ET+DSSV+AQLG PD R+P+LYTL
Sbjct  299   LFNKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETEDSSVIAQLGWPDMRIPILYTL  358

Query  45    SWPDRIYCSEITWPR  1
             SWPDR+  S   +PR
Sbjct  359   SWPDRVPTS---YPR  370



>gb|AFK73395.1| 2-C-methyl-D-erythritol 4-phosphate synthase [Plagiochasma appendiculatum]
 gb|AFM78686.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Plagiochasma 
appendiculatum]
Length=491

 Score =   469 bits (1208),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 235/303 (78%), Positives = 267/303 (88%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAV E  +K + GPKPIS+IGSTGS+GTQ L++VAENP+K+++VALAAG+NVTLLA QV
Sbjct  75   GRAVDEGVKKNYTGPKPISLIGSTGSIGTQTLDIVAENPDKFKIVALAAGANVTLLADQV  134

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            + F+P LV IR    V EL+EA++D+  +PEI+ GE G++EVA+HP+ VTVVTGIVGCAG
Sbjct  135  RRFRPNLVCIRHAGQVAELREAIADVYPQPEIVVGESGILEVAQHPEAVTVVTGIVGCAG  194

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAGGP+VLPLA KH +KILPADSEHSAIFQCIQGLP G
Sbjct  195  LKPTVAAIEAGKDIALANKETLIAGGPYVLPLAKKHGIKILPADSEHSAIFQCIQGLPVG  254

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
             LRRIILTASGGAFRDWPVEKLK+ KV DALKHP W+MG+KITVDSATL NKGLEVIEAH
Sbjct  255  GLRRIILTASGGAFRDWPVEKLKNVKVADALKHPNWTMGRKITVDSATLMNKGLEVIEAH  314

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YLFG +YD+IEIVIHPQSIIHSMVETQDSSVL QLG PD RLP+LYTL WP R+ CSE T
Sbjct  315  YLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLGQLGWPDMRLPILYTLPWPQRVPCSEST  374

Query  9    WPR  1
            WPR
Sbjct  375  WPR  377



>ref|XP_006439816.1| hypothetical protein CICLE_v10020004mg [Citrus clementina]
 gb|ESR53056.1| hypothetical protein CICLE_v10020004mg [Citrus clementina]
Length=353

 Score =   462 bits (1188),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 250/336 (74%), Positives = 283/336 (84%), Gaps = 13/336 (4%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDG-----GMRVKCSSqaa  937
             MALN  S AE KA SF +     +  N    KL GG  ++RKD      G  V+CS+Q  
Sbjct  1     MALNLQSPAEIKALSFLE----TTRSNHRLPKLSGGFPLKRKDNATATFGRIVQCSAQGP  56

Query  936   aaqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGS  757
                      GRAV E  RKTWDGPKPIS++GSTGS+GTQ L++VAE+ +K+RVVALAAGS
Sbjct  57    PPAWP----GRAVTETFRKTWDGPKPISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGS  112

Query  756   NVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTV  577
             N+TLLA QVK FKP++V++R+ESL+DE+KEAL++++EKPEI+ GE+G+IE ARHPD VTV
Sbjct  113   NITLLADQVKRFKPQVVAVRNESLLDEIKEALANVEEKPEILAGEQGVIEAARHPDAVTV  172

Query  576   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIF  397
             VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHN+KILPADSEHSAIF
Sbjct  173   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIF  232

Query  396   QCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFN  217
             QCIQGLPEGALRRIILTASGGAFRDWPVEKLK+ KV DALKHP WSMGKKITVDSATLFN
Sbjct  233   QCIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFN  292

Query  216   KGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQ  109
             KGLEVIEAHYLFG +YDNIEI+IHPQSIIHSMVETQ
Sbjct  293   KGLEVIEAHYLFGAEYDNIEIIIHPQSIIHSMVETQ  328



>gb|KDO69665.1| hypothetical protein CISIN_1g012004mg [Citrus sinensis]
 gb|KDO69666.1| hypothetical protein CISIN_1g012004mg [Citrus sinensis]
Length=353

 Score =   459 bits (1181),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 249/336 (74%), Positives = 282/336 (84%), Gaps = 13/336 (4%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDG-----GMRVKCSSqaa  937
             MALN    AE KA SF +     +  N    KL GG  ++RKD      G  V+CS+Q  
Sbjct  1     MALNLQIPAEIKALSFLE----TTRSNHRLPKLSGGFPLKRKDNATATFGRIVQCSAQGP  56

Query  936   aaqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGS  757
                      GRAV E  RKTWDGPKPIS++GSTGS+GTQ L++VAE+ +K+RVVALAAGS
Sbjct  57    PPAWP----GRAVTETFRKTWDGPKPISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGS  112

Query  756   NVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTV  577
             N+TLLA QVK FKP++V++R+ESL+DE+KEAL++++EKPEI+ GE+G+IE ARHPD VTV
Sbjct  113   NITLLADQVKRFKPQVVAVRNESLLDEIKEALANVEEKPEILAGEQGVIEAARHPDAVTV  172

Query  576   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIF  397
             VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHN+KILPADSEHSAIF
Sbjct  173   VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIF  232

Query  396   QCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFN  217
             QCIQGLPEGALRRIILTASGGAFRDWPVEKLK+ KV DALKHP WSMGKKITVDSATLFN
Sbjct  233   QCIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFN  292

Query  216   KGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQ  109
             KGLEVIEAHYLFG +YDNIEI+IHPQSIIHSMVETQ
Sbjct  293   KGLEVIEAHYLFGAEYDNIEIIIHPQSIIHSMVETQ  328



>gb|AFW79783.1| hypothetical protein ZEAMMB73_057914 [Zea mays]
Length=500

 Score =   455 bits (1171),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 246/329 (75%), Positives = 273/329 (83%), Gaps = 27/329 (8%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQ-----------------------CLEVVAE  799
            GRAVAE  R++ DGPKPISI+GSTGS+GTQ                        L++VAE
Sbjct  64   GRAVAEPGRRSLDGPKPISIVGSTGSIGTQIIRSSSMLLYSAALIFNLLHNAKTLDIVAE  123

Query  798  NPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgee  619
            NP+K+RVVAL+AGSNVTLLA QVKTFKPKLV++R+E+LVDELKEAL+D +EKPEIIPGE+
Sbjct  124  NPDKFRVVALSAGSNVTLLADQVKTFKPKLVAVRNETLVDELKEALADCEEKPEIIPGEQ  183

Query  618  gliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHN  439
            G+IEVARHPD +TVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKH 
Sbjct  184  GVIEVARHPDAITVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHK  243

Query  438  VKILPADSEHSAIFQC---IQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHP  268
            VKILPADSEHSAIFQ    I  +      RI L  S    RDWPV++LKD KV DALKHP
Sbjct  244  VKILPADSEHSAIFQASPSICVICTSVNMRIHLI-SNAHDRDWPVDRLKDVKVADALKHP  302

Query  267  IWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQ  88
             W+MGKKITVDSATLFNKGLEVIEAHYLFG +YD+IEIVIHPQSIIHSMVETQDSSVLAQ
Sbjct  303  NWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQ  362

Query  87   LGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            LG PD R+P+LYTLSWPDRIYCSE+TWPR
Sbjct  363  LGWPDMRIPILYTLSWPDRIYCSEVTWPR  391



>gb|ACJ84756.1| unknown [Medicago truncatula]
Length=326

 Score =   440 bits (1132),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 251/331 (76%), Positives = 280/331 (85%), Gaps = 9/331 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGM----RVKCSSqaaa  934
             MALN  S AE K+  FF   T     N  + K  GGVA++RK+ G     RV CS   + 
Sbjct  1     MALNLYSPAELKS-GFF---TDPLKSNRFTPKFPGGVALKRKENGTASGTRVYCS-VQST  55

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
             + P PAWPGRA+ E   KTW+GPKPISI+G TGS+GTQ L++VAENP+K+RVVALAAGSN
Sbjct  56    SGPPPAWPGRAIPELGNKTWEGPKPISIVGCTGSIGTQTLDIVAENPDKFRVVALAAGSN  115

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             +TLL  QVK FKP+LV++R+ESL+ EL+EAL D++EKPEIIPGE+G+IEVARHPD VTVV
Sbjct  116   ITLLVDQVKRFKPQLVAVRNESLLAELQEALKDVEEKPEIIPGEQGVIEVARHPDAVTVV  175

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA KHNVKILPADSEHSAIFQ
Sbjct  176   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLARKHNVKILPADSEHSAIFQ  235

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
              IQGL EGALRR+ILTASGGAFRDWPVEKLKD KV DALKHP WSMGKKITVDSATLFNK
Sbjct  236   RIQGLTEGALRRVILTASGGAFRDWPVEKLKDVKVADALKHPNWSMGKKITVDSATLFNK  295

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSM  121
             GLEVIEAHYLFG DYD+I+IVIHPQSIIHSM
Sbjct  296   GLEVIEAHYLFGADYDDIDIVIHPQSIIHSM  326



>gb|AFB70979.1| 1-deoxy-D-xylylose 5-phosphate reductoisomerase, partial [Mitragyna 
speciosa]
Length=258

 Score =   436 bits (1120),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 226/258 (88%), Positives = 244/258 (95%), Gaps = 0/258 (0%)
 Frame = -3

Query  837  GSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESLVDELKEALS  658
            GS+GTQ L++ AENP+K+RVVALAAGSNVTLLA QVKTFKP+LV++R+ESLVDEL+EAL+
Sbjct  1    GSIGTQTLDIAAENPDKFRVVALAAGSNVTLLADQVKTFKPQLVAVRNESLVDELEEALA  60

Query  657  DLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIA  478
            D + KPEIIPGEEG++EVARHPD V+VVTGIVGCAGLKPTVAAIEAGKDIALANKETLIA
Sbjct  61   DFEYKPEIIPGEEGVVEVARHPDAVSVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIA  120

Query  477  GGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKD  298
            GGPFVLPLAHKH VKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRD PVEKLK+
Sbjct  121  GGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDLPVEKLKE  180

Query  297  AKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMV  118
             KV DALKHP W+MGKKITVDSATLFNKGLEVIEAHYLFG +YDNIEIVIHPQSIIHSMV
Sbjct  181  VKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNIEIVIHPQSIIHSMV  240

Query  117  ETQDSSVLAQLGLPDFRL  64
            ETQDSSVLAQLG PD RL
Sbjct  241  ETQDSSVLAQLGWPDMRL  258



>ref|XP_005648272.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23728.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Coccomyxa subellipsoidea 
C-169]
Length=475

 Score =   441 bits (1135),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 224/303 (74%), Positives = 258/303 (85%), Gaps = 1/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GR +  E  K  +G K  SI+GSTGS+GTQ L++V E+ +++ VVALAAG NV LLA Q+
Sbjct  63   GRVIVPEVTKR-EGVKKFSIVGSTGSIGTQTLDIVKEHGDRFEVVALAAGGNVALLAEQI  121

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            + F+PKLV+IRD S V ELKEA+ D+  +PEI+ G+EG IEVARHP+I  VVTGIVGCAG
Sbjct  122  REFQPKLVAIRDASKVAELKEAIRDVPRQPEILVGDEGAIEVARHPEIDAVVTGIVGCAG  181

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            L+PTVAAI+AGKDI LANKETLIAGGP+VLPLA +H V ILPADSEHSAIFQC+QGLPEG
Sbjct  182  LQPTVAAIKAGKDICLANKETLIAGGPYVLPLAREHGVNILPADSEHSAIFQCLQGLPEG  241

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
             LRRIILTASGGAFRDWPVE+LK+    DA+KHP WSMG KITVDSATL NKGLEVIEAH
Sbjct  242  GLRRIILTASGGAFRDWPVERLKEVTAADAVKHPNWSMGPKITVDSATLMNKGLEVIEAH  301

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YLFG  YD+IEIVIHPQSIIHSMVETQDSSVLAQLG PD RLP+LYT+SWP+R+ CSE+T
Sbjct  302  YLFGAAYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTMSWPERVPCSEVT  361

Query  9    WPR  1
            WPR
Sbjct  362  WPR  364



>dbj|BAM73270.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase, partial [Dianthus 
caryophyllus]
Length=300

 Score =   433 bits (1113),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 222/256 (87%), Positives = 239/256 (93%), Gaps = 0/256 (0%)
 Frame = -3

Query  768  AAGSNVTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPD  589
            AAGSNVTLLA QVK FKP+LV++R+  LV ELKEAL+D D KP IIPGEEG+IEVARHPD
Sbjct  1    AAGSNVTLLADQVKRFKPELVAVRNAFLVGELKEALADADYKPHIIPGEEGVIEVARHPD  60

Query  588  IVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEH  409
             V+VVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADS H
Sbjct  61   AVSVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSGH  120

Query  408  SAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSA  229
            SAIFQCIQGLPEGALRRIILTASGGAFRD PVEKLK+ KV DALKHP W+MGKKITVDSA
Sbjct  121  SAIFQCIQGLPEGALRRIILTASGGAFRDLPVEKLKEVKVADALKHPNWNMGKKITVDSA  180

Query  228  TLFNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYT  49
            TLFNKGLEVIEAHYLFG +YD+IEIVIHPQS+IHSM+ETQDSSVLAQLG PD RLP+LYT
Sbjct  181  TLFNKGLEVIEAHYLFGAEYDDIEIVIHPQSVIHSMIETQDSSVLAQLGWPDMRLPILYT  240

Query  48   LSWPDRIYCSEITWPR  1
            +SWP+R+YCSEITWPR
Sbjct  241  MSWPERVYCSEITWPR  256



>gb|EMS64636.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic 
[Triticum urartu]
Length=460

 Score =   434 bits (1116),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 232/316 (73%), Positives = 258/316 (82%), Gaps = 43/316 (14%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GRAVAE  R++W+GPKPISI+GSTGS+GTQ L++VAENP+K+RVVALAAGSNVTLLA QV
Sbjct  65   GRAVAEPERRSWEGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQV  124

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            KTFKPKLV++R+ESL++ELKEAL+  +E PEIIPGE+G+IEVARHPD VTVVTGIVGCAG
Sbjct  125  KTFKPKLVAVRNESLLNELKEALAGCEEMPEIIPGEQGVIEVARHPDAVTVVTGIVGCAG  184

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDIALANKETLIAG                              GL EG
Sbjct  185  LKPTVAAIEAGKDIALANKETLIAG------------------------------GLSEG  214

Query  369  ALRRIILTASGGAF-------------RDWPVEKLKDAKVGDALKHPIWSMGKKITVDSA  229
            +LRR+ILTASGGAF             RDWPVEKLKD KV DALKHP WSMGKKITVDSA
Sbjct  215  SLRRVILTASGGAFRSIELHLISIDDDRDWPVEKLKDVKVADALKHPNWSMGKKITVDSA  274

Query  228  TLFNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYT  49
            TLFNKGLEVIEAHYLFG +YD+IEIVIHPQSIIHSM+ETQDSSVLAQLG PD RLP+LYT
Sbjct  275  TLFNKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYT  334

Query  48   LSWPDRIYCSEITWPR  1
            LSWPDR+YCSE+TWPR
Sbjct  335  LSWPDRVYCSEVTWPR  350



>gb|AAS99589.1| chloroplast 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Elaeis 
guineensis]
Length=257

 Score =   426 bits (1095),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 225/257 (88%), Positives = 240/257 (93%), Gaps = 0/257 (0%)
 Frame = -3

Query  837  GSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESLVDELKEALS  658
            GS+GTQ L++VAENP+K+RVVALAAGSNVTLLA QVK FKP+LVS+R+ESLV ELKEAL+
Sbjct  1    GSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQVKQFKPQLVSVRNESLVGELKEALA  60

Query  657  DLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIA  478
            D + KPEIIPGE+G+IEVARHPD VTVVTGIVGCAGLKPTVAAIEAG DIALANKETLIA
Sbjct  61   DAEHKPEIIPGEQGVIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGIDIALANKETLIA  120

Query  477  GGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKD  298
            GGPFVLPLAHKH VKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRD PVEKLK+
Sbjct  121  GGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDLPVEKLKE  180

Query  297  AKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMV  118
             KV DALKHP W+MGKKITVDSATLFNKGLEVIEAHYLFG +YD IEIVIHPQSIIHSMV
Sbjct  181  VKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDIIEIVIHPQSIIHSMV  240

Query  117  ETQDSSVLAQLGLPDFR  67
            ETQDSSVLAQLG PD R
Sbjct  241  ETQDSSVLAQLGWPDMR  257



>ref|XP_002953640.1| hypothetical protein VOLCADRAFT_82431 [Volvox carteri f. nagariensis]
 gb|EFJ45264.1| hypothetical protein VOLCADRAFT_82431 [Volvox carteri f. nagariensis]
Length=456

 Score =   429 bits (1103),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 212/289 (73%), Positives = 248/289 (86%), Gaps = 0/289 (0%)
 Frame = -3

Query  867  PKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDES  688
            PK  S++GSTGS+GTQ L+++AE PEK+++VALAAGSNV LLA QV+ FKP++V+IRD S
Sbjct  56   PKRFSVLGSTGSIGTQTLDIIAEFPEKFKLVALAAGSNVQLLADQVRKFKPEMVAIRDAS  115

Query  687  LVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDI  508
             + ELKEA+ D+  +P I+ G+EG +EVARHP   +VVTGIVGCAGL PTVAAI+A KDI
Sbjct  116  KIPELKEAIKDVHPQPVILAGDEGAVEVARHPAAESVVTGIVGCAGLLPTVAAIKAKKDI  175

Query  507  ALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAF  328
             LANKETLIAGGPF+LPLA ++  KILPADSEHSAIFQ +QGLPEG LRRIILTASGGAF
Sbjct  176  CLANKETLIAGGPFILPLAQEYGAKILPADSEHSAIFQVMQGLPEGGLRRIILTASGGAF  235

Query  327  RDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVI  148
            RDWP+EKLK+  V  A  HP WSMGKKITVDSATL NKGLEVIEAHYLFG DYDNI+IVI
Sbjct  236  RDWPLEKLKEVTVAQATSHPNWSMGKKITVDSATLMNKGLEVIEAHYLFGVDYDNIDIVI  295

Query  147  HPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            HPQSIIHSM+ETQDSSVLAQLG PD RLP++YT+SWP+R+  S+ TWPR
Sbjct  296  HPQSIIHSMIETQDSSVLAQLGWPDMRLPIMYTMSWPERVPVSDATWPR  344



>gb|AEY80027.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Haematococcus 
pluvialis]
Length=450

 Score =   423 bits (1088),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 213/297 (72%), Positives = 253/297 (85%), Gaps = 3/297 (1%)
 Frame = -3

Query  891  ESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPK  712
            +SRK   GPK  S++GSTGS+GTQ L+++AE P+K+ +VALAAGSN+ LLA QV+ FKPK
Sbjct  43   QSRK---GPKKFSLLGSTGSIGTQTLDIIAEFPDKFELVALAAGSNIELLAKQVRQFKPK  99

Query  711  LVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVA  532
            +V+I+D S +  LKEA+ DL E+PE++ G+EG +EVARH D  +VVTGIVGCAGL PTVA
Sbjct  100  MVAIKDGSKLAALKEAIKDLPEQPELLVGDEGAVEVARHKDADSVVTGIVGCAGLLPTVA  159

Query  531  AIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRII  352
            AI+A K+I LANKETLIAGGPFVLPLA ++ V ILPADSEHSAIFQC+QGLPEG LRRII
Sbjct  160  AIKARKEICLANKETLIAGGPFVLPLAKEYGVNILPADSEHSAIFQCMQGLPEGGLRRII  219

Query  351  LTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTD  172
            LTASGGAFRDWP EKLK+  V  A+ HP WSMGKKIT DSATL NKGLEVIEAHYLFG D
Sbjct  220  LTASGGAFRDWPAEKLKEVTVQQAITHPNWSMGKKITTDSATLMNKGLEVIEAHYLFGVD  279

Query  171  YDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            YDNI+IVIHPQSIIHSM+ETQDSSVLAQLG PD RLP++YT+SWP+R+  ++ +WPR
Sbjct  280  YDNIDIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPIMYTMSWPERVPVTDASWPR  336



>ref|XP_010459153.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like 
[Camelina sativa]
Length=450

 Score =   418 bits (1075),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 235/371 (63%), Positives = 273/371 (74%), Gaps = 36/371 (10%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKDGGMRVKCSSqaaaaqpq  922
             M LN I  +E  A SF    +  +               +R+  G  VKCS +    Q  
Sbjct  3     MTLNSIPPSESFALSFLDTSSRFNLTPKLPGGFSSRQRNQRRGFGKGVKCSVKVQQQQSS  62

Query  921   pawP--GRAVAEE-SRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNV  751
             P     GRAV  E  R++WDGPKPISI+GSTGS+GTQ                       
Sbjct  63    PPPAWPGRAVPPEVPRQSWDGPKPISIVGSTGSIGTQ-----------------------  99

Query  750   TLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVT  571
                   V+ FKP+LV++R+ESL+DELKEAL+DLD KPEIIPGE+G+IEVARHP+ VT+VT
Sbjct  100   ------VRRFKPELVALRNESLIDELKEALADLDYKPEIIPGEQGVIEVARHPEAVTLVT  153

Query  570   GIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQC  391
             GIVGCAGLK T AAIE GKDIALANKETLIAGGPFVLPLA KHN+KILPADSEHSAIFQC
Sbjct  154   GIVGCAGLKRTFAAIEVGKDIALANKETLIAGGPFVLPLAKKHNIKILPADSEHSAIFQC  213

Query  390   IQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIW-SMGKKITVDSATLFNK  214
             IQGLPEG LR+IILTASGG+FRDWPVEKLK+  V ++L HPIW SMGKK+T+DSATLFNK
Sbjct  214   IQGLPEGGLRKIILTASGGSFRDWPVEKLKEVTVAESLNHPIWTSMGKKVTIDSATLFNK  273

Query  213   GLEVIEAHYLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPD  34
             GLEVIEAHYLFG +YD+IEIVIHPQSIIHSM+ET+DSSV+AQLG PD R+P+LYTLSWPD
Sbjct  274   GLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETEDSSVIAQLGWPDMRIPILYTLSWPD  333

Query  33    RIYCSEITWPR  1
             R+  S   +PR
Sbjct  334   RVPTS---YPR  341



>ref|XP_005850817.1| hypothetical protein CHLNCDRAFT_29723 [Chlorella variabilis]
 gb|EFN58715.1| hypothetical protein CHLNCDRAFT_29723 [Chlorella variabilis]
Length=455

 Score =   415 bits (1067),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 214/303 (71%), Positives = 242/303 (80%), Gaps = 0/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GR    E+    DGPK  S++GSTGS+GTQ L++VAE+P+K+ V ALAAG N+ LLA Q+
Sbjct  44   GRVPVPETLPQRDGPKKFSLLGSTGSIGTQTLDIVAEHPDKFAVTALAAGGNLELLAQQI  103

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            + F+P LVS+RD   V  L+E +     +PEI+ GEEG+  VA H +  + VTGIVGCAG
Sbjct  104  RQFQPALVSVRDGGKVAALRELIKGAPRQPEILVGEEGICAVAAHGEADSCVTGIVGCAG  163

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            LKPTVAAIEAGKDI LANKETLIAGGPFVLPLA KH V ILPADSEHSAIFQC+QGLPEG
Sbjct  164  LKPTVAAIEAGKDICLANKETLIAGGPFVLPLAKKHGVHILPADSEHSAIFQCLQGLPEG  223

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
             +RRIILTASGGAFRD PV+KL      DALKHP WSMG KITVDSATL NKGLEVIEAH
Sbjct  224  GMRRIILTASGGAFRDLPVDKLPGVTKADALKHPNWSMGPKITVDSATLMNKGLEVIEAH  283

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YLFG  YD I+IVIHPQSIIHSMVET DSSVLAQLG PD RLP+LYT+SWP R+ CSE T
Sbjct  284  YLFGAAYDAIDIVIHPQSIIHSMVETADSSVLAQLGWPDMRLPILYTMSWPARVPCSEQT  343

Query  9    WPR  1
            WPR
Sbjct  344  WPR  346



>ref|WP_007354673.1| MULTISPECIES: 1-deoxy-D-xylulose 5-phosphate reductoisomerase 
[Kamptonema]
 emb|CBN55450.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [ [[Oscillatoria] 
sp. PCC 6506]
Length=396

 Score =   411 bits (1057),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 204/280 (73%), Positives = 242/280 (86%), Gaps = 0/280 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++VA+ P+++R+V LAAG NVTLLA Q++ F+P++V+I D   
Sbjct  2    KAITLLGSTGSIGTQTLDIVAQYPDQFRIVGLAAGRNVTLLAKQIRQFRPEIVAISDVDK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + ELKEA++DLD +P ++ GE G++EVA++ D   VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPELKEAIADLDPQPILLAGETGIVEVAKYGDAQAVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP V PL  KH VK+LPADSEHSAIFQC+QGLP+G LRRIILTASGGAFR
Sbjct  122  LANKETLIAGGPVVNPLIAKHGVKLLPADSEHSAIFQCLQGLPKGGLRRIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVEKL + KV DALKHP WSMG+KITVDSATL NKGLEVIEAHYLFG DYD I+IVIH
Sbjct  182  DWPVEKLSEVKVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHYLFGMDYDGIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIY  281



>ref|WP_023075619.1| 1-deoxy-d-xylulose 5-phosphate reductoisomerase [Leptolyngbya 
sp. Heron Island J]
 gb|ESA33502.1| 1-deoxy-d-xylulose 5-phosphate reductoisomerase [Leptolyngbya 
sp. Heron Island J]
Length=398

 Score =   410 bits (1053),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 201/280 (72%), Positives = 246/280 (88%), Gaps = 0/280 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L+++  +P+K+R+V +AAG NVTLLA QV+ FKP++V+I DES 
Sbjct  2    KAITLLGSTGSIGTQTLDIIEHHPDKFRLVGIAAGRNVTLLAEQVRQFKPEIVAICDESK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + ELKEA++D+D +P+I+ G++G++EVAR+ +   VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LAELKEAIADVDPQPQILAGDDGIVEVARYGNAEAVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH VK+LPADSEHSAIFQC+QGLPEG LRRIILTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLVEKHGVKLLPADSEHSAIFQCMQGLPEGGLRRIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVEKLK   V DA+KHP WSMG+KITVDSAT+ NKGLEVIEAHYLFG DYD+I+ +IH
Sbjct  182  DWPVEKLKHVTVADAVKHPNWSMGRKITVDSATMMNKGLEVIEAHYLFGLDYDHIDTLIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
            PQSIIHS++ETQD+S+LAQLG PD RLPLLY +SWP+RI+
Sbjct  242  PQSIIHSLIETQDTSMLAQLGWPDMRLPLLYAVSWPERIF  281



>ref|WP_006517324.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Leptolyngbya 
sp. PCC 7375]
 gb|EKV02953.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Leptolyngbya 
sp. PCC 7375]
Length=398

 Score =   409 bits (1052),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 200/282 (71%), Positives = 244/282 (87%), Gaps = 0/282 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++V  +P+K+R+V +AAG NVTLLA QV+ FKP++V+I D + 
Sbjct  2    KAITLLGSTGSIGTQTLDIVEHHPDKFRLVGIAAGRNVTLLAEQVRQFKPEIVAIHDANK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + ELK A++D+D +P+I+ G EG++EVAR+ D   VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LAELKAAIADVDPQPQILAGAEGIVEVARYGDAEAVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH VK+LPADSEHSAIFQC+QGLPEG LRRIILTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLVEKHGVKLLPADSEHSAIFQCLQGLPEGGLRRIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVE+LKD  V DA+KHP WSMG+KITVDSAT+ NKGLEVIEAHYLFG DYD+++ +IH
Sbjct  182  DWPVERLKDVTVADAVKHPNWSMGRKITVDSATMMNKGLEVIEAHYLFGMDYDHVDTLIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCS  19
            PQSIIHS++ETQD+S+LAQLG PD RLPLLY +SWP+RI+  
Sbjct  242  PQSIIHSLIETQDTSMLAQLGWPDMRLPLLYAISWPERIFTD  283



>gb|ACT21081.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Dunaliella salina]
Length=436

 Score =   411 bits (1056),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/303 (68%), Positives = 253/303 (83%), Gaps = 1/303 (0%)
 Frame = -3

Query  909  GRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQV  730
            GR    E + +  GPK  S++GSTGS+GTQ LE++AE+P+K+++ A+AAGSNV LLA Q+
Sbjct  23   GRVAVPELKPS-SGPKSFSLLGSTGSIGTQTLEIMAEHPDKFQLTAMAAGSNVDLLAKQI  81

Query  729  KTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAG  550
            + F+PKLV+I+D S V  LKE + D+ ++PEI+ G+EG +EVARH +  +VVTGIVGCAG
Sbjct  82   RQFQPKLVAIKDASEVPLLKELIKDVPQQPEILVGDEGAVEVARHSEADSVVTGIVGCAG  141

Query  549  LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEG  370
            L PTVAAI+A K+I LANKETLIAGGPFVLPLA ++ V ILPADSEHSAIFQC+QG+P+ 
Sbjct  142  LLPTVAAIKAKKEICLANKETLIAGGPFVLPLAKEYGVNILPADSEHSAIFQCLQGVPDK  201

Query  369  ALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAH  190
             LRRIILTASGGAFRDWPVEKLK+  V  A+ HP WSMGKKIT DSATL NKGLEVIEAH
Sbjct  202  GLRRIILTASGGAFRDWPVEKLKEVTVEQAITHPNWSMGKKITTDSATLMNKGLEVIEAH  261

Query  189  YLFGTDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEIT  10
            YLFG +YD+IEIV+HPQSIIHSMVETQDSSV+AQLG PD +LP++YT+SWP+R+   + T
Sbjct  262  YLFGAEYDDIEIVVHPQSIIHSMVETQDSSVIAQLGWPDMKLPIMYTMSWPERVPVQDAT  321

Query  9    WPR  1
            WPR
Sbjct  322  WPR  324



>ref|WP_009456040.1| MULTISPECIES: 1-deoxy-D-xylulose 5-phosphate reductoisomerase 
[Fischerella]
 gb|EHC16070.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Fischerella 
sp. JSC-11]
Length=398

 Score =   408 bits (1049),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 201/288 (70%), Positives = 242/288 (84%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++VA NP+K+R+V LAAG+NV LLA Q++ F+P + +I  E  
Sbjct  2    KAITLVGSTGSIGTQTLDIVANNPDKFRIVGLAAGNNVELLAAQIRQFRPSIAAICAEEK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            +  LKEA++DLD +P ++ G+ G++EVAR+ D  TVVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPALKEAIADLDPQPILMAGDAGIVEVARYGDAQTVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH +K+LPADSEHSAIFQC+QG+P+G LR+IILTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLIEKHGIKLLPADSEHSAIFQCLQGVPQGGLRKIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWP EKL +  V DALKHP WSMG+KITVDSATL NKGLEVIEAH+LFG DY++IEIVIH
Sbjct  182  DWPTEKLAEVTVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHFLFGLDYEDIEIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY     W R
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIYTD---WER  286



>ref|WP_007310195.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Crocosphaera 
watsonii]
 gb|EHJ13461.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Crocosphaera 
watsonii WH 0003]
 emb|CCQ55122.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Crocosphaera 
watsonii WH 0005]
 emb|CCQ66457.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Crocosphaera 
watsonii WH 0402]
Length=398

 Score =   408 bits (1049),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 208/281 (74%), Positives = 240/281 (85%), Gaps = 0/281 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K ISI+GSTGS+GTQ L++V + PE+++VV LA  SNV LLA QV+ F+P++V+IRDE+ 
Sbjct  2    KKISILGSTGSIGTQTLDIVNQYPEQFQVVGLATRSNVDLLATQVQQFRPEIVAIRDENK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            +  LK+A++ LD  P I+ GEEG+IEVARH D  +VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LGTLKDAIATLDYSPIILAGEEGVIEVARHGDAESVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH VK+LPADSEHSAIFQC+QG+PE  LRRIILTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLVEKHGVKLLPADSEHSAIFQCLQGVPEDGLRRIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVEKLK   V DALKHP WSMG+KITVDSATL NKGLEVIEAH+LFG DY NI+IVIH
Sbjct  182  DWPVEKLKYVTVQDALKHPNWSMGQKITVDSATLMNKGLEVIEAHFLFGMDYKNIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYC  22
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY 
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIYT  282



>ref|WP_015214585.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Anabaena cylindrica]
 ref|YP_007156860.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Anabaena cylindrica 
PCC 7122]
 gb|AFZ57950.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Anabaena cylindrica 
PCC 7122]
Length=398

 Score =   407 bits (1047),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 203/288 (70%), Positives = 242/288 (84%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++V+E+P+K+R+V LAAG NV L A Q++ F+P++ +I     
Sbjct  2    KAITLLGSTGSIGTQTLDIVSEHPDKFRIVGLAAGRNVDLFAAQIRQFRPQIAAISAAEK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + ELKEA+ DL+ +P ++ GE G+IEVAR+ D  TVVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPELKEAIKDLNPQPILLAGEAGVIEVARYGDAQTVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAG P VLPL  KH VK+LPADSEHSAIFQC+QG+P+  LR+I+LTASGGAFR
Sbjct  122  LANKETLIAGAPVVLPLVKKHGVKLLPADSEHSAIFQCLQGVPKDGLRKILLTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVEKL + KV DALKHP WSMG+KITVDSATL NKGLEVIEAHYLFG DYDNIEIVIH
Sbjct  182  DWPVEKLAEVKVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHYLFGVDYDNIEIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY +   W R
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIYTN---WER  286



>ref|WP_008319237.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Leptolyngbya 
sp. PCC 6406]
Length=396

 Score =   407 bits (1046),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 199/280 (71%), Positives = 243/280 (87%), Gaps = 0/280 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++V  +P+++R+V +AAG NV LLA QV+ F+P++V+IRDE  
Sbjct  2    KAITLLGSTGSIGTQTLDIVQSHPDQFRLVGIAAGRNVALLAQQVRQFRPEIVAIRDERC  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            +++L+ A++DLD +P+I+ GE G++EVAR+ D   VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LEDLRAAIADLDPQPQIVAGEVGIVEVARYGDAEAVVTGIVGCAGLLPTLAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH VK+LPADSEHSAIFQC+QG+P G LRRI+LTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLVEKHGVKLLPADSEHSAIFQCLQGVPAGGLRRILLTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVE+L +  V DALKHP WSMG+KITVDSATL NKGLEVIEAHYLFG DYD+I+IVIH
Sbjct  182  DWPVERLPEVTVADALKHPNWSMGQKITVDSATLMNKGLEVIEAHYLFGVDYDHIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
            PQSIIHS++E QD+S+LAQLG PD RLPLLY LSWP+RIY
Sbjct  242  PQSIIHSLIEVQDTSMLAQLGWPDMRLPLLYALSWPERIY  281



>ref|WP_027840920.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mastigocoleus 
testarum]
Length=398

 Score =   407 bits (1045),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 206/288 (72%), Positives = 239/288 (83%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ LE+VA+NPEK+R+V +AAG NV +LA Q+K FKP + +I  E  
Sbjct  2    KAITLLGSTGSIGTQTLEIVAQNPEKFRIVGIAAGRNVEMLAAQIKQFKPIIAAIFAEEK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + ELKEA+ D+D +P ++ G EG+IEVARH D  TVVTGIVGCAGL PTVAAIEAGKDIA
Sbjct  62   LPELKEAIKDVDPQPILLAGNEGVIEVARHGDAETVVTGIVGCAGLLPTVAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH VK+LPADSEHSAIFQC+QG+PEG LR+I+LTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLVAKHGVKLLPADSEHSAIFQCLQGVPEGGLRKILLTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DW  EKL    V DALKHP WSMG+KITVDSATL NKGLEVIEAH+LFG DY NI+IVIH
Sbjct  182  DWETEKLAQVTVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHFLFGLDYSNIQIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LS+P+RIY     W R
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSFPERIYTE---WER  286



>ref|WP_016865179.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Fischerella 
muscicola]
Length=398

 Score =   407 bits (1045),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 200/288 (69%), Positives = 242/288 (84%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++VA NP+K+R+V LAAG+NV LLA Q++ F+P + +I  E  
Sbjct  2    KAITLLGSTGSIGTQTLDIVANNPDKFRIVGLAAGNNVELLAAQIRQFRPSIAAICAEEK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            +  LKEA++DLD +P ++ G+ G++EVAR+ D  TVVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPALKEAIADLDPQPILMAGDAGIVEVARYGDAQTVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH +K+LPADSEHSAIFQC+QG+P+G LR+I+LTASGGAFR
Sbjct  122  LANKETLIAGGPIVLPLIEKHGIKLLPADSEHSAIFQCLQGVPQGGLRKILLTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWP EKL +  V DALKHP WSMG+KITVDSATL NKGLEVIEAH+LFG DY++IEIVIH
Sbjct  182  DWPTEKLAEVTVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHFLFGLDYEDIEIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY     W R
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIYTD---WER  286



>ref|WP_015185775.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Microcoleus 
sp. PCC 7113]
 ref|YP_007125052.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Microcoleus 
sp. PCC 7113]
 gb|AFZ21646.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Microcoleus 
sp. PCC 7113]
Length=403

 Score =   407 bits (1045),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 201/280 (72%), Positives = 240/280 (86%), Gaps = 0/280 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++V + P+++R+V LAAG NV +LA Q++ F+P++V+I  E  
Sbjct  2    KAINLLGSTGSIGTQTLDIVTQYPDQFRIVGLAAGRNVEMLASQIRQFRPEIVAICVEEK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + ELKEA+ DLD +P ++ GE G+ EVAR+ D   VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPELKEAIKDLDPQPILLAGEAGVAEVARYGDADIVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH VK+LPADSEHSAIFQC+QG+P+G LRRI+LTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLIEKHGVKLLPADSEHSAIFQCLQGVPKGGLRRILLTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVEKL +AKV DALKHP WSMG+KIT+DSATL NKGLEVIEAH+LFG DYD I+IVIH
Sbjct  182  DWPVEKLPEAKVTDALKHPNWSMGRKITIDSATLMNKGLEVIEAHFLFGMDYDRIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWPDRIY
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPDRIY  281



>ref|WP_006511828.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Xenococcus sp. 
PCC 7305]
 gb|ELS01056.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Xenococcus sp. 
PCC 7305]
Length=396

 Score =   406 bits (1044),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 199/280 (71%), Positives = 237/280 (85%), Gaps = 0/280 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+I+GSTGS+GTQ L++V  NP+K+RVV LAAG N+TLL  Q++ F+P++V+I DE  
Sbjct  8    KAITILGSTGSIGTQTLDIVTHNPDKFRVVGLAAGRNITLLVKQIRKFQPEIVAISDEEK  67

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + EL++A++DL   P+I+ G  G+ EVAR+ D  TVVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  68   LSELRDAIADLINPPKILVGATGIAEVARYGDAETVVTGIVGCAGLLPTIAAIEAGKDIA  127

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP +LPL  KH VK+LPADSEHSAIFQC+QG+PEG LRRI+LTASGG+FR
Sbjct  128  LANKETLIAGGPVILPLVAKHGVKLLPADSEHSAIFQCLQGVPEGGLRRIVLTASGGSFR  187

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            D P EKL    V DALKHP WSMG+KIT+DSATL NKGLEVIEAHYLFG DYDNI+IVIH
Sbjct  188  DLPAEKLATVTVQDALKHPNWSMGQKITIDSATLMNKGLEVIEAHYLFGMDYDNIDIVIH  247

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
            PQSIIHS++E QD+S+LAQLG PD RLPLLY LSWP+RIY
Sbjct  248  PQSIIHSLIEVQDTSMLAQLGWPDMRLPLLYALSWPERIY  287



>ref|WP_017311607.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Fischerella 
sp. PCC 9339]
Length=398

 Score =   406 bits (1043),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 200/288 (69%), Positives = 241/288 (84%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++VA NP+K+R+V LAAG+NV LLA Q++ F+P + +I  E  
Sbjct  2    KTITLLGSTGSIGTQTLDIVANNPDKFRIVGLAAGNNVELLASQIRQFRPSIAAIYAEEK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            +  LKEA++DLD +P ++ G+ G++EVAR+ D  TVVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPALKEAIADLDPQPILLAGDSGIVEVARYGDAQTVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH +K+LPADSEHSAIFQC+QG+P+G LR+I+LTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLIEKHGIKLLPADSEHSAIFQCLQGVPKGGLRKILLTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWP EKL +  V DALKHP WSMG+KITVDSATL NKGLEVIEAH+LFG DY +IEIVIH
Sbjct  182  DWPTEKLAEVTVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHFLFGLDYKDIEIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY     W R
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIYTD---WER  286



>ref|WP_015203328.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Crinalium epipsammum]
 ref|YP_007142724.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Crinalium epipsammum 
PCC 9333]
 gb|AFZ13214.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Crinalium epipsammum 
PCC 9333]
Length=393

 Score =   405 bits (1041),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 202/288 (70%), Positives = 246/288 (85%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++V++NP+++RVV LAAGSNVT+LA Q++ F+P++V+I DE  
Sbjct  2    KAITLLGSTGSIGTQTLDIVSQNPDQFRVVGLAAGSNVTMLAQQIRQFQPEIVAICDEDK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + ELKEA++DL+ +P I+ GE G+IEVAR+ D  TVVTGIVGCAGL PT+AAI+AGKDIA
Sbjct  62   LAELKEAIADLNPQPIIVAGEAGVIEVARYGDAQTVVTGIVGCAGLLPTIAAIKAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAG P VLPL  ++ VK+LPADSEHSAIFQC+QG+P G LRRI+LTASGGAFR
Sbjct  122  LANKETLIAGAPVVLPLIEEYGVKLLPADSEHSAIFQCLQGVPAGGLRRILLTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            D PVEKL   KV DALKHP WSMG+KITVDSATL NKGLEVIEAHYLFG DYDNI+IVIH
Sbjct  182  DLPVEKLAQVKVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHYLFGVDYDNIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG  D RLP+LY +S+P+RIY +   W R
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWADMRLPILYAMSYPERIYTN---WER  286



>ref|WP_026719879.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Fischerella 
sp. PCC 9431]
Length=398

 Score =   405 bits (1041),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 200/288 (69%), Positives = 242/288 (84%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++VA NP+K+R+V LAAG+NV LLA Q++ F+P + +I  E  
Sbjct  2    KTITLLGSTGSIGTQTLDIVANNPDKFRIVGLAAGNNVELLAAQIRQFRPSIAAICAEEK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            +  LKEA++DLD +P ++ G+ G++EVAR+ D  TVVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPALKEAIADLDPQPILLAGDAGIVEVARYGDAETVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH +K+LPADSEHSAIFQC+QG+P+G LR+IILTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLIEKHGIKLLPADSEHSAIFQCLQGVPKGGLRKIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWP EKL +  V DALKHP WSMG+KITVDSATL NKGLEVIEAH+LFG DY +IEIVIH
Sbjct  182  DWPTEKLAEVTVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHFLFGLDYKDIEIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG PD RLPLLY +SWP+RIY +   W R
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYAISWPERIYTN---WER  286



>ref|WP_012161212.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Acaryochloris 
marina]
 ref|YP_001514926.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Acaryochloris 
marina MBIC11017]
 sp|B0CD21.1|DXR_ACAM1 RecName: Full=1-deoxy-D-xylulose 5-phosphate reductoisomerase; 
Short=DXP reductoisomerase; AltName: Full=1-deoxyxylulose-5-phosphate 
reductoisomerase; AltName: Full=2-C-methyl-D-erythritol 
4-phosphate synthase [Acaryochloris marina MBIC11017]
 gb|ABW25612.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Acaryochloris 
marina MBIC11017]
Length=401

 Score =   405 bits (1041),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 196/279 (70%), Positives = 244/279 (87%), Gaps = 0/279 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++VA+ P+++R+V +AAG N+ LL+ Q++ F+P++V+I D + 
Sbjct  2    KAITLLGSTGSIGTQTLDIVAQYPDQFRIVGMAAGRNIELLSQQIRQFRPEIVAIADPNQ  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + +LK+A++D+D +P+++ GE G++EVA + D  +VVTGIVGCAGL PT+AAI+AGKDIA
Sbjct  62   LSDLKDAIADVDPQPQLLAGEAGVVEVAAYGDAESVVTGIVGCAGLLPTIAAIKAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH VK+LPADSEHSAIFQC+QG+PEG LRRIILTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLVEKHGVKLLPADSEHSAIFQCLQGVPEGGLRRIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVEKL +  V DALKHP WSMGKKITVDSATL NKGLEVIEAHYLFG DYD+I+IVIH
Sbjct  182  DWPVEKLPEVTVADALKHPNWSMGKKITVDSATLMNKGLEVIEAHYLFGVDYDHIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRI  28
            PQSIIHS++E QD+SVLAQLG PD RLPLLY+LSWP+RI
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYSLSWPERI  280



>gb|ACU24603.1| unknown [Glycine max]
Length=308

 Score =   401 bits (1031),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 233/310 (75%), Positives = 259/310 (84%), Gaps = 10/310 (3%)
 Frame = -3

Query  1101  MALNFISCAEPKAFSFFQFQTsksnynlsslkLQGGVAMRRKD----GGMRVKCSSqaaa  934
             MALN  S AE K+  F          N  + K  GG A +RK+     G RV CS    A
Sbjct  2     MALNISSPAEVKSIFF----ADSFKSNCLTAKFSGGFAFKRKERRAASGGRVYCS--VQA  55

Query  933   aqpqpawPGRAVAEESRKTWDGPKPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSN  754
               P PAWPGRAV E+ RKTWDGPKPISI+GSTGS+GTQ L++VAENP+K++VVALAAGSN
Sbjct  56    TPPPPAWPGRAVPEQGRKTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFKVVALAAGSN  115

Query  753   VTLLAHQVKTFKPKLVSIRDESLVDELKEALSDLDekpeiipgeegliEVARHPDIVTVV  574
             VTLLA QVK FKP+LV++R+ESL+ EL+EAL D++EKPEIIPGE+G+IEVARHPD V+VV
Sbjct  116   VTLLADQVKRFKPQLVAVRNESLIAELEEALHDVEEKPEIIPGEQGIIEVARHPDAVSVV  175

Query  573   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQ  394
             TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA KHNVKILPADSEHSAIFQ
Sbjct  176   TGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAQKHNVKILPADSEHSAIFQ  235

Query  393   CIQGLPEGALRRIILTASGGAFRDWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNK  214
             CIQGLPEGALRR+ILTASGGAFRDWPV+KLKD KV DALKHP W+MGKKITVDSATLFNK
Sbjct  236   CIQGLPEGALRRVILTASGGAFRDWPVDKLKDVKVADALKHPNWNMGKKITVDSATLFNK  295

Query  213   GLEVIEAHYL  184
             GLEVIEA  L
Sbjct  296   GLEVIEALLL  305



>ref|WP_009546877.1| MULTISPECIES: 1-deoxy-D-xylulose 5-phosphate reductoisomerase 
[Cyanothece]
 ref|YP_001803540.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Cyanothece sp. 
ATCC 51142]
 sp|B1WNP5.1|DXR_CYAA5 RecName: Full=1-deoxy-D-xylulose 5-phosphate reductoisomerase; 
Short=DXP reductoisomerase; AltName: Full=1-deoxyxylulose-5-phosphate 
reductoisomerase; AltName: Full=2-C-methyl-D-erythritol 
4-phosphate synthase [Cyanothece sp. ATCC 51142]
 gb|ACB51474.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Cyanothece sp. 
ATCC 51142]
Length=398

 Score =   405 bits (1040),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 202/280 (72%), Positives = 240/280 (86%), Gaps = 0/280 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K IS++GSTGS+GTQ L++V + P++++VV LA  SNV LLA QV+ F+P++V+I DES 
Sbjct  2    KKISLLGSTGSIGTQTLDIVNQYPDQFQVVGLATRSNVELLATQVQQFRPEIVAICDESK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            +  LK+A++ +D  P I+ GE+G+ EVARH D  +VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LGSLKDAIASMDYSPLILAGEQGVAEVARHGDAESVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH VK+LPADSEHSAIFQC+QG+P+G LRRIILTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLIEKHGVKLLPADSEHSAIFQCLQGVPDGGLRRIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVE+LK   V DALKHP WSMG+KITVDSATL NKGLEVIEAH+LFG DY+NI+IVIH
Sbjct  182  DWPVEQLKYVTVQDALKHPNWSMGQKITVDSATLMNKGLEVIEAHFLFGMDYENIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY
Sbjct  242  PQSIIHSLIEVQDTSVLAQLGWPDMRLPLLYALSWPERIY  281



>ref|WP_017652891.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Microchaete 
sp. PCC 7126]
Length=398

 Score =   405 bits (1040),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 202/288 (70%), Positives = 240/288 (83%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++VA+ P+++R+V LAAGSNV LLA Q++ F+P + +I  E  
Sbjct  2    KAITLVGSTGSIGTQTLDIVAQYPDQFRIVGLAAGSNVELLASQIRQFRPSIAAIWSEEK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + +L+ A+ DLD +P ++ GE G+IEVAR+ D  TVVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPQLQAAIKDLDPQPILLAGEAGVIEVARYGDAQTVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH VK+LPADSEHSAIFQC+QG+P+G LR+I+LTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLVEKHGVKLLPADSEHSAIFQCLQGVPQGGLRKILLTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DW V KL +  V DALKHP WSMG+KITVDSATL NKGLEVIEAH+LFG DYDNIEIVIH
Sbjct  182  DWDVSKLAEVTVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHFLFGLDYDNIEIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWPDRIY     W R
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPDRIYTD---WER  286



>ref|WP_017299578.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nodosilinea 
nodulosa]
Length=397

 Score =   404 bits (1039),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 199/280 (71%), Positives = 241/280 (86%), Gaps = 0/280 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L+++  +P+++R+V +AAG+NV LLA QV+ FKP++V+I +   
Sbjct  2    KAITLLGSTGSIGTQTLDILEHHPDQFRLVGIAAGNNVELLAQQVRQFKPEVVAICNPEK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            +DEL++AL+ LD  P+++ G++G++EVAR+ D   VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LDELRDALAGLDPMPQLLAGDDGVVEVARYGDAEAVVTGIVGCAGLLPTLAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH VK+LPADSEHSAIFQC+QG+PEG LRRI+LTASGGAFR
Sbjct  122  LANKETLIAGGPAVLPLVEKHGVKLLPADSEHSAIFQCLQGVPEGGLRRILLTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWP EKL    V DALKHP WSMG+KITVDSATL NKGLEVIEAHYLFG DYD+I+IVIH
Sbjct  182  DWPTEKLAQVTVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHYLFGMDYDHIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWPDRIY
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPDRIY  281



>ref|WP_007304873.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Crocosphaera 
watsonii]
 gb|EAM51359.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Crocosphaera 
watsonii WH 8501]
 emb|CCQ49456.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Crocosphaera 
watsonii WH 8502]
Length=398

 Score =   404 bits (1039),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 207/281 (74%), Positives = 239/281 (85%), Gaps = 0/281 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K ISI+GSTGS+GTQ L++V + PE+++VV LA  SNV LLA QV+ F+P++V+IRDE+ 
Sbjct  2    KKISILGSTGSIGTQTLDIVNQYPEQFQVVGLATRSNVDLLATQVQQFRPEIVAIRDENK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            +  LK+A++ LD  P I+ GEEG+IEVARH D  +VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LGTLKDAIATLDYSPIILAGEEGVIEVARHGDAESVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH VK+LPADSEHSAIFQC+QG+PE  LRRIILTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLVEKHGVKLLPADSEHSAIFQCLQGVPEDGLRRIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DW VEKLK   V DALKHP WSMG+KITVDSATL NKGLEVIEAH+LFG DY NI+IVIH
Sbjct  182  DWRVEKLKYVTVQDALKHPNWSMGQKITVDSATLMNKGLEVIEAHFLFGMDYKNIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYC  22
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY 
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIYT  282



>ref|WP_010481168.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Acaryochloris 
sp. CCMEE 5410]
Length=401

 Score =   404 bits (1039),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 196/279 (70%), Positives = 244/279 (87%), Gaps = 0/279 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++VA+ P+++R+V +AAG N+ LL+ Q++ F+P++V+I D + 
Sbjct  2    KAITLLGSTGSIGTQTLDIVAQYPDQFRIVGMAAGRNIELLSQQIRQFRPEIVAIADPNQ  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + +LK+A++D+D +P+++ GE G++EVA + D  +VVTGIVGCAGL PT+AAI+AGKDIA
Sbjct  62   LADLKDAIADVDPQPQLLAGEAGVVEVAAYGDAESVVTGIVGCAGLLPTIAAIKAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH VK+LPADSEHSAIFQC+QG+PEG LRRIILTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLVEKHGVKLLPADSEHSAIFQCLQGVPEGGLRRIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVEKL +  V DALKHP WSMGKKITVDSATL NKGLEVIEAHYLFG DYD+I+IVIH
Sbjct  182  DWPVEKLPEVTVADALKHPNWSMGKKITVDSATLMNKGLEVIEAHYLFGVDYDHIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRI  28
            PQSIIHS++E QD+SVLAQLG PD RLPLLY+LSWP+RI
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYSLSWPERI  280



>ref|WP_039204531.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Aphanizomenon 
flos-aquae]
 gb|KHG39396.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Aphanizomenon 
flos-aquae 2012/KM/D3]
Length=398

 Score =   404 bits (1038),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 200/288 (69%), Positives = 242/288 (84%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++V+E+P+K+R+V LAAG NV L A Q++ F+P++ +I     
Sbjct  2    KAITLLGSTGSIGTQTLDIVSEHPDKFRIVGLAAGRNVELFAAQIRQFRPQIAAISAAEK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + ELKEA+ DL+ +P ++ GE G+IEVAR+ D  TVVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPELKEAIKDLNPQPILLAGEAGVIEVARYGDSQTVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKET+IAG P VLPL  KH VK+LPADSEHSAIFQC+QG+P+  LR+I+LTASGGAFR
Sbjct  122  LANKETIIAGAPVVLPLVEKHGVKLLPADSEHSAIFQCLQGVPKDGLRKILLTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVEKL + KV DA+KHP WSMG+KITVDSATL NKGLEVIEAHYLFG DYDNIEIVIH
Sbjct  182  DWPVEKLPEVKVADAIKHPNWSMGRKITVDSATLMNKGLEVIEAHYLFGVDYDNIEIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+R+Y +   W R
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERVYTN---WER  286



>ref|WP_016950625.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Anabaena sp. 
PCC 7108]
Length=398

 Score =   404 bits (1037),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 200/288 (69%), Positives = 242/288 (84%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++VAE+P+K+R+V LAAG NV L A Q++ F+P++ +I     
Sbjct  2    KAITLLGSTGSIGTQTLDIVAEHPDKFRIVGLAAGRNVELFAAQIRQFRPQIAAISAADK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + ELKEA+ DL+ +P ++ GE G+IEVAR+ D  +VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPELKEAIKDLNPQPILLAGEAGVIEVARYGDAQSVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKET+IAG P VLPL  KH VK+LPADSEHSAIFQC+QG+P+  L++I+LTASGGAFR
Sbjct  122  LANKETIIAGAPVVLPLVEKHGVKLLPADSEHSAIFQCLQGVPKDGLKKILLTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVEKL + KV DA+KHP WSMG+KITVDSATL NKGLEVIEAHYLFG DYDNIEIVIH
Sbjct  182  DWPVEKLPEVKVADAIKHPNWSMGRKITVDSATLMNKGLEVIEAHYLFGVDYDNIEIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY +   W R
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIYTN---WER  286



>ref|WP_028091655.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Dolichospermum 
circinale]
Length=398

 Score =   404 bits (1037),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 202/288 (70%), Positives = 242/288 (84%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++V+E+P+K+R+V LAAG NV L A Q++ F+P++ +I     
Sbjct  2    KAITLLGSTGSIGTQTLDIVSEHPDKFRIVGLAAGRNVELFAAQIRQFRPEIAAISAADK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + ELKEA+ DL+ +P ++ GE+G+IEVAR+ D  TVVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPELKEAIKDLNPQPILLAGEQGVIEVARYGDSQTVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAG P VLPL  KH VK+LPADSEHSAIFQC+QG+P+  LR+I+LTASGGAFR
Sbjct  122  LANKETLIAGAPVVLPLVEKHGVKLLPADSEHSAIFQCLQGVPKDGLRKILLTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVEKL   KV DALKHP WSMG+KITVDSATL NKGLEVIEAHYLFG DY+NIEIVIH
Sbjct  182  DWPVEKLATVKVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHYLFGVDYNNIEIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY +   W R
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIYTN---WER  286



>ref|WP_015171312.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Geitlerinema 
sp. PCC 7407]
 ref|YP_007108797.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Geitlerinema 
sp. PCC 7407]
 gb|AFY65745.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Geitlerinema 
sp. PCC 7407]
Length=398

 Score =   404 bits (1037),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 200/282 (71%), Positives = 244/282 (87%), Gaps = 0/282 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++V+E+P+++RVV +AAG NV +LA Q++ F+P++V+I D+  
Sbjct  2    KAITLLGSTGSIGTQTLDIVSEHPDQFRVVGMAAGRNVAMLAQQIRQFRPEIVAIWDKDK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + ELK A++DL+ +P ++ GEEG+IEVAR+ D   VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPELKAAIADLEPQPIVLAGEEGVIEVARYGDSEAVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  K+ VK+LPADSEHSAIFQC+QG+P+G LRRIILTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLIEKYGVKLLPADSEHSAIFQCLQGVPQGGLRRIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVEKL +  V DALKHP WSMG+KITVDSATL NKGLEVIEAHYLFG DYD+I+IVIH
Sbjct  182  DWPVEKLAEVTVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHYLFGMDYDHIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCS  19
            PQSIIHS++E QD+SVLAQLG PD RLPLLY +SWP+RI  S
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYAMSWPERIATS  283



>ref|WP_028085119.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Dolichospermum 
circinale]
Length=398

 Score =   403 bits (1036),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 202/288 (70%), Positives = 241/288 (84%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++V E+P+K+R+V LAAG NV L A Q++ F+P++ +I     
Sbjct  2    KAITLLGSTGSIGTQTLDIVCEHPDKFRIVGLAAGRNVELFAAQIRQFRPEIAAISAADK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + ELKEA+ DL+ +P ++ GE+G+IEVAR+ D  TVVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPELKEAIKDLNPQPILLAGEQGVIEVARYGDSQTVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAG P VLPL  KH VK+LPADSEHSAIFQC+QG+P+  LR+I+LTASGGAFR
Sbjct  122  LANKETLIAGAPVVLPLVEKHQVKLLPADSEHSAIFQCLQGVPKDGLRKILLTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVEKL   KV DALKHP WSMG+KITVDSATL NKGLEVIEAHYLFG DY+NIEIVIH
Sbjct  182  DWPVEKLATVKVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHYLFGVDYNNIEIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY +   W R
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIYTN---WER  286



>ref|WP_009787067.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lyngbya sp. 
PCC 8106]
 gb|EAW34352.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lyngbya sp. 
PCC 8106]
Length=394

 Score =   403 bits (1036),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 198/282 (70%), Positives = 243/282 (86%), Gaps = 0/282 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++V ++P+K+R+V LAA  NVTLLA Q++TF+P++ +I DES 
Sbjct  2    KAITLLGSTGSIGTQTLDIVNDHPDKFRIVGLAARRNVTLLAEQIRTFRPQIAAICDESK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + ELK A+++LD +P ++ GE G++EVAR+ D   VVTGIVGCAGL PT+AAI+AGKDIA
Sbjct  62   LPELKAAIANLDPQPILLAGESGVVEVARYGDSEAVVTGIVGCAGLLPTLAAIKAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP V PL  ++ VK+LPADSEHSAIFQC+QG+PE  LRRIILTASGGAFR
Sbjct  122  LANKETLIAGGPVVNPLIQEYGVKLLPADSEHSAIFQCLQGVPEKGLRRIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVEKL D KV DA+KHP WSMG+KITVDSAT+ NKGLEVIEAH+LFG DYDNI+IVIH
Sbjct  182  DWPVEKLADVKVADAIKHPNWSMGRKITVDSATMMNKGLEVIEAHFLFGLDYDNIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCS  19
            PQSIIHS++E QD+SVLAQLG PD RLPLLY +SWP+RIY +
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYAMSWPERIYTN  283



>ref|WP_015111122.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nostoc sp. PCC 
7107]
 ref|YP_007048030.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nostoc sp. PCC 
7107]
 gb|AFY40880.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nostoc sp. PCC 
7107]
Length=398

 Score =   403 bits (1036),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 201/288 (70%), Positives = 239/288 (83%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++VA+ P+K+R+V LAAG+NV +LA Q++ F+P + +I  E  
Sbjct  2    KAITLLGSTGSIGTQTLDIVAQYPDKFRIVGLAAGNNVEMLAEQIRQFRPSIAAIAAEDK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            +  L+ A+ DLD +P ++ G+ G+IEVAR+ D  TVVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPALQAAIQDLDPQPILLAGKAGVIEVARYGDAETVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH VK+LPADSEHSAIFQC+QG+P+  LR+I+LTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLVEKHGVKLLPADSEHSAIFQCLQGVPQDGLRKILLTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVEKL +  V DALKHP WSMGKKITVDSATL NKGLEVIEAH+LFG DYD IEIVIH
Sbjct  182  DWPVEKLPEVTVADALKHPNWSMGKKITVDSATLMNKGLEVIEAHFLFGLDYDKIEIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWPDRIY     W R
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPDRIYTD---WER  286



>ref|WP_021835260.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Crocosphaera 
watsonii]
 emb|CCQ61327.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Crocosphaera 
watsonii WH 0401]
Length=398

 Score =   403 bits (1036),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 206/281 (73%), Positives = 239/281 (85%), Gaps = 0/281 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K ISI+GSTGS+GTQ L++V + PE+++VV LA  SNV LLA QV+ F+P++V+IRDE+ 
Sbjct  2    KKISILGSTGSIGTQTLDIVNQYPEQFQVVGLATRSNVDLLATQVQQFRPEIVAIRDENK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            +  +K+A++ LD  P I+ GEEG+IEVARH D  +VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LGTVKDAIATLDYSPIILAGEEGVIEVARHGDAESVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH VK+LPADSEHSAIFQC+QG+PE  LRRIILTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLVEKHGVKLLPADSEHSAIFQCLQGVPEDGLRRIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DW VEKLK   V DALKHP WSMG+KITVDSATL NKGLEVIEAH+LFG DY NI+IVIH
Sbjct  182  DWRVEKLKYVTVQDALKHPNWSMGQKITVDSATLMNKGLEVIEAHFLFGMDYKNIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYC  22
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY 
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIYT  282



>ref|WP_016860920.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Fischerella 
muscicola]
Length=398

 Score =   403 bits (1036),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 199/288 (69%), Positives = 241/288 (84%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++VA NP+K+R+V LAAG+NV LLA Q++ F+P + +I  E  
Sbjct  2    KTITLLGSTGSIGTQTLDIVANNPDKFRIVGLAAGNNVELLAAQIRQFRPSIAAICAEEK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            +  LKEA++DLD +P ++ G+ G++EVAR+ D  TVVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPALKEAIADLDYQPILLAGDAGIVEVARYGDAETVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  K+ +K+LPADSEHSAIFQC+QG+P+G LR+I+LTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLIEKYGIKLLPADSEHSAIFQCLQGVPKGGLRKILLTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWP EKL +  V DALKHP WSMG+KITVDSATL NKGLEVIEAH+LFG DY +IEIVIH
Sbjct  182  DWPTEKLAEVTVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHFLFGLDYKDIEIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY     W R
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIYTD---WER  286



>ref|WP_015078139.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Anabaena sp. 
90]
 ref|YP_006994788.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Anabaena sp. 
90]
 gb|AFW92975.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Anabaena sp. 
90]
Length=398

 Score =   403 bits (1035),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 200/288 (69%), Positives = 242/288 (84%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++V+E+P+K+R+V L+AG NV L A Q++ F+P++ +I     
Sbjct  2    KAITLLGSTGSIGTQTLDIVSEHPDKFRIVGLSAGRNVELFAAQIRQFRPQIAAISAAEK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + ELKEA+ DL+ +P ++ GE G+IEVAR+ D  TVVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPELKEAIKDLNPQPILLAGEAGVIEVARYGDSQTVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKET+IAG P VLPL  KH VK+LPADSEHSAIFQC+QG+P+  LR+I+LTASGGAFR
Sbjct  122  LANKETIIAGAPVVLPLVKKHGVKLLPADSEHSAIFQCLQGVPKDGLRKILLTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVEKL + KV DA+KHP WSMG+KITVDSATL NKGLEVIEAHYLFG DYDNIEIVIH
Sbjct  182  DWPVEKLPEVKVADAIKHPNWSMGRKITVDSATLMNKGLEVIEAHYLFGVDYDNIEIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY +   W R
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIYTN---WER  286



>ref|WP_009633806.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Synechocystis 
sp. PCC 7509]
Length=393

 Score =   402 bits (1034),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/280 (73%), Positives = 239/280 (85%), Gaps = 0/280 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++VA+NP+ + +V LAAG NV +LA Q++ F+PK+V+I DE+ 
Sbjct  2    KAITLLGSTGSIGTQTLDIVAQNPDLFEIVGLAAGRNVEMLAAQIRQFRPKIVAICDETK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + +LKEA++ LD KP ++ GE G+IEVAR+ +  TVVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPQLKEAIALLDYKPILLAGEAGVIEVARYGEAQTVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAG P VLPL  KHNVK+LPADSEHSAIFQC+Q +PEG LRRIILTASGGAFR
Sbjct  122  LANKETLIAGAPVVLPLVKKHNVKLLPADSEHSAIFQCLQAVPEGGLRRIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            D PVEKL   KV DALKHP WSMG+KIT+DSATL NKGLEVIEAHYLFG DYD IEIVIH
Sbjct  182  DLPVEKLATVKVADALKHPNWSMGRKITIDSATLMNKGLEVIEAHYLFGLDYDRIEIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
            PQSIIHS++E QD+SVLAQLG  D RLPLLY LS+PDRIY
Sbjct  242  PQSIIHSLIEVQDTSVLAQLGWADMRLPLLYALSYPDRIY  281



>ref|WP_015210302.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Cylindrospermum 
stagnale]
 ref|YP_007149747.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Cylindrospermum 
stagnale PCC 7417]
 gb|AFZ27067.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Cylindrospermum 
stagnale PCC 7417]
Length=398

 Score =   402 bits (1034),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 200/288 (69%), Positives = 239/288 (83%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++VA  P+++R+V LAAGSNV + A Q++ F+P++ +I     
Sbjct  2    KAITLVGSTGSIGTQTLDIVAHYPDQFRIVGLAAGSNVEMFASQIRQFRPQIAAIFAADK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            +  LKEA+ DLD +P ++ G  G+IEVAR+ D  TVVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPALKEAIIDLDPQPILLAGVTGVIEVARYGDAETVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH VK+LPADSEHSAIFQC+QG+P+G LRRI+LTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLVAKHGVKLLPADSEHSAIFQCLQGVPKGGLRRILLTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DW VEKL +  V DA+KHP WSMG+KITVDSATL NKGLEVIEAHYLFG DYDNI+IVIH
Sbjct  182  DWDVEKLAEVTVADAIKHPNWSMGRKITVDSATLMNKGLEVIEAHYLFGLDYDNIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG PD RLPLLY +SWPDRIY +   W R
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYAMSWPDRIYTN---WER  286



>ref|WP_027402501.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Aphanizomenon 
flos-aquae]
Length=398

 Score =   402 bits (1034),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 199/288 (69%), Positives = 241/288 (84%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++V+E+P+K+R+V L AG NV L A Q++ F+P++ +I     
Sbjct  2    KAITLLGSTGSIGTQTLDIVSEHPDKFRIVGLTAGRNVELFAAQIRQFRPQIAAISAAEK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + ELKEA+ DL+ +P ++ GE G+IEVAR+ D  TVVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPELKEAIKDLNPQPILLAGEAGVIEVARYGDSQTVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKET+IAG P VLPL  KH VK+LPADSEHSAIFQC+QG+P+  LR+I+LTASGGAFR
Sbjct  122  LANKETIIAGAPVVLPLVEKHGVKLLPADSEHSAIFQCLQGVPKDGLRKILLTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVEKL + KV DA+KHP WSMG+KITVDSATL NKGLEVIEAHYLFG DYDNIEIVIH
Sbjct  182  DWPVEKLPEVKVADAIKHPNWSMGRKITVDSATLMNKGLEVIEAHYLFGVDYDNIEIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+R+Y +   W R
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERVYTN---WER  286



>ref|WP_011610275.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Trichodesmium 
erythraeum]
 ref|YP_720352.2| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Trichodesmium 
erythraeum IMS101]
Length=541

 Score =   407 bits (1047),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 200/281 (71%), Positives = 237/281 (84%), Gaps = 0/281 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            KPI+I+GSTGS+GTQ L +VA NP K+RV+ LAAGSNV +LA QV+ F P++V+I D+S 
Sbjct  2    KPITILGSTGSIGTQTLNIVAHNPNKFRVIGLAAGSNVEILAQQVRQFCPQIVAINDKSK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
              EL+EA++DL  +P ++  ++G+I+VAR+ +   VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   FRELQEAIADLQPQPILVADQDGVIQVARYGESEVVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIA GP V PL  K+ VK+LPADSEHSAIFQC+QGLP   LRRIILTASGGAFR
Sbjct  122  LANKETLIAAGPVVNPLIEKYRVKLLPADSEHSAIFQCLQGLPLEGLRRIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWP+EKL   KV DA+KHP WSMGKKITVDSAT+ NKGLEVIEAHYLFG +YDNI+IVIH
Sbjct  182  DWPIEKLSKVKVADAIKHPNWSMGKKITVDSATMMNKGLEVIEAHYLFGLNYDNIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYC  22
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY 
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIYT  282



>ref|WP_023067885.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lyngbya aestuarii]
 gb|ERT05858.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lyngbya aestuarii 
BL J]
Length=394

 Score =   402 bits (1033),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 197/280 (70%), Positives = 243/280 (87%), Gaps = 0/280 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++V ++P+K+R+V LAA  NVTLLA Q++TF+P++ +I DE+ 
Sbjct  2    KAITLLGSTGSIGTQTLDIVNDHPDKFRIVGLAARRNVTLLAEQIRTFRPQIAAICDETK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + ELK A+++LD +P ++ GE G++EVAR+ D  TVVTGIVGCAGL PT+AAI+AGKDIA
Sbjct  62   LPELKAAIANLDPQPILLAGESGVVEVARYGDSETVVTGIVGCAGLLPTLAAIKAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP V PL  ++ VK+LPADSEHSAIFQC+QG+PE  LRRIILTASGGAFR
Sbjct  122  LANKETLIAGGPVVNPLIQEYGVKLLPADSEHSAIFQCLQGVPEKGLRRIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVEKL + KV DA+KHP WSMG+KITVDSAT+ NKGLEVIEAH+LFG DYDNI+IVIH
Sbjct  182  DWPVEKLAEVKVADAIKHPNWSMGRKITVDSATMMNKGLEVIEAHFLFGLDYDNIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
            PQSIIHS++E QD+SVLAQLG PD RLPLLY +SWP+RIY
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYAMSWPERIY  281



>ref|WP_039726023.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lyngbya confervoides]
 gb|KIF14299.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Aphanocapsa 
montana BDHKU210001]
 gb|KIF39233.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lyngbya confervoides 
BDU141951]
Length=396

 Score =   402 bits (1033),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 199/280 (71%), Positives = 240/280 (86%), Gaps = 0/280 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L+++  +PE +R+V +AAG+NV LLA QV+ FKP++V+I + S 
Sbjct  2    KAITLLGSTGSIGTQTLDILESHPEDFRLVGIAAGNNVELLAQQVRQFKPEIVAICNASK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + +L+ AL+DLD +P I+ G++G++EVAR+ D   VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPDLQAALADLDPQPIILAGDDGVVEVARYGDAEAVVTGIVGCAGLLPTLAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH VK+LPADSEHSAIFQC+QG+P G LRRIILTASGGAFR
Sbjct  122  LANKETLIAGGPAVLPLVEKHGVKLLPADSEHSAIFQCLQGVPNGGLRRIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPV+KL    V DALKHP WSMG+KITVDSATL NKGLEVIEAHYLFG DYD+I+IVIH
Sbjct  182  DWPVDKLPQVTVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHYLFGQDYDDIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
            PQSIIHS++E QD+SVLAQLG PD RLPLLY +SWPDR+Y
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYAISWPDRVY  281



>gb|ABG49879.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Trichodesmium 
erythraeum IMS101]
Length=559

 Score =   407 bits (1047),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 200/281 (71%), Positives = 237/281 (84%), Gaps = 0/281 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            KPI+I+GSTGS+GTQ L +VA NP K+RV+ LAAGSNV +LA QV+ F P++V+I D+S 
Sbjct  20   KPITILGSTGSIGTQTLNIVAHNPNKFRVIGLAAGSNVEILAQQVRQFCPQIVAINDKSK  79

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
              EL+EA++DL  +P ++  ++G+I+VAR+ +   VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  80   FRELQEAIADLQPQPILVADQDGVIQVARYGESEVVVTGIVGCAGLLPTIAAIEAGKDIA  139

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIA GP V PL  K+ VK+LPADSEHSAIFQC+QGLP   LRRIILTASGGAFR
Sbjct  140  LANKETLIAAGPVVNPLIEKYRVKLLPADSEHSAIFQCLQGLPLEGLRRIILTASGGAFR  199

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWP+EKL   KV DA+KHP WSMGKKITVDSAT+ NKGLEVIEAHYLFG +YDNI+IVIH
Sbjct  200  DWPIEKLSKVKVADAIKHPNWSMGKKITVDSATMMNKGLEVIEAHYLFGLNYDNIDIVIH  259

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYC  22
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY 
Sbjct  260  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIYT  300



>ref|WP_013190135.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Trichormus azollae]
 ref|YP_003720239.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase ['Nostoc azollae' 
0708]
 gb|ADI63116.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase ['Nostoc azollae' 
0708]
Length=398

 Score =   402 bits (1033),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 199/288 (69%), Positives = 245/288 (85%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++V+E+P+K+R+V LAAG NV L A Q++ F+P++V+I     
Sbjct  2    KAITLLGSTGSIGTQTLDIVSEHPDKFRIVGLAAGRNVELFAAQIRQFRPQIVAISAADK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + EL+EA+  ++ +P ++ GEEG+IEVAR+ D+ TVVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPELREAIKHVNPQPILLAGEEGVIEVARYGDVETVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAG P VLPL  K+ VK+LPADSEHSAIFQC+QG+P+G LR+I+LTASGGAFR
Sbjct  122  LANKETLIAGAPVVLPLVEKYGVKLLPADSEHSAIFQCLQGVPKGGLRKILLTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVEKL + KV DALKHP WSMG+KITVDSATL NKGLEVIEAHYLFG DYD+IEIVIH
Sbjct  182  DWPVEKLPEVKVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHYLFGVDYDDIEIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+S+LAQLG PD RLPLLY LSWP+R+Y +   W R
Sbjct  242  PQSIIHSLIELQDTSILAQLGWPDMRLPLLYALSWPERVYTN---WER  286



>ref|WP_017315308.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mastigocladopsis 
repens]
Length=398

 Score =   402 bits (1032),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 202/288 (70%), Positives = 240/288 (83%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++VA+ PE++R+V LAAG+NV LLA Q++ F+P + +I  E  
Sbjct  2    KAITLLGSTGSIGTQTLDIVAQYPEQFRIVGLAAGNNVELLASQIRQFRPTIAAICTEEK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            +  LKEA+ D+  +P ++ GE G+IEVAR+ D  TVVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPALKEAIKDVTPQPILLAGEAGVIEVARYGDAETVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  K+ VK+LPADSEHSAIFQC+QG+P G LRRI+LTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLIEKYGVKLLPADSEHSAIFQCLQGVPSGGLRRILLTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DW VEKL +  V DALKHP WSMG+KITVDSATL NKGLEVIEAH+LFG DY+NIEIVIH
Sbjct  182  DWTVEKLAEVTVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHFLFGLDYENIEIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWPDRIY +   W R
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPDRIYTN---WER  286



>ref|WP_012412204.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nostoc punctiforme]
 ref|YP_001869204.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nostoc punctiforme 
PCC 73102]
 sp|B2ITX3.1|DXR_NOSP7 RecName: Full=1-deoxy-D-xylulose 5-phosphate reductoisomerase; 
Short=DXP reductoisomerase; AltName: Full=1-deoxyxylulose-5-phosphate 
reductoisomerase; AltName: Full=2-C-methyl-D-erythritol 
4-phosphate synthase [Nostoc punctiforme PCC 73102]
 gb|ACC84261.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nostoc punctiforme 
PCC 73102]
Length=398

 Score =   402 bits (1032),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 201/288 (70%), Positives = 239/288 (83%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++V + P+++R+V LAAG+NV +LA Q++ F+PK+ +I  E  
Sbjct  2    KAITLVGSTGSIGTQTLDIVTQYPDQFRIVGLAAGNNVEMLAAQIRQFRPKIAAICSEDK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            +  LKEA+ DLD +P ++ GE G+IEVAR+ D  TVVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPALKEAIIDLDPQPILLAGEAGVIEVARYGDAQTVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAG P VLPL  KH VK+LPADSEHSAIFQC+QG+P+  LR+I+LTASGGAFR
Sbjct  122  LANKETLIAGAPVVLPLVEKHGVKLLPADSEHSAIFQCLQGVPKSGLRKILLTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DW VE+L D  V DALKHP WSMG+KITVDSATL NKGLEVIEAH+LFG DYDNIEIVIH
Sbjct  182  DWDVERLADVTVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHFLFGLDYDNIEIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWPDRIY     W R
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPDRIYTD---WER  286



>ref|WP_006617252.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Arthrospira 
platensis]
 gb|KDR54004.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Arthrospira 
platensis str. Paraca]
Length=396

 Score =   401 bits (1031),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 197/280 (70%), Positives = 240/280 (86%), Gaps = 0/280 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++VA++P+K+++V LA GSNVTLLA QV+ F+P++V+I D++ 
Sbjct  2    KAITLLGSTGSIGTQTLDIVADHPDKFKIVGLATGSNVTLLAQQVRQFRPEIVAICDQNK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + EL+EA++DLD +P I  GE G++EVAR+ D   VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LWELREAIADLDPQPIIEAGESGIVEVARYGDSEAVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP V P+  K+ VK+LPADSEHSAIFQC+QG+P G LRRIILTASGGAFR
Sbjct  122  LANKETLIAGGPVVNPMIEKYGVKLLPADSEHSAIFQCLQGVPSGGLRRIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVE+L +  V DA  HP WSMG+KITVDSAT+ NKGLEVIEAH+LFG DYD I+IVIH
Sbjct  182  DWPVERLTEVTVADATTHPNWSMGRKITVDSATMMNKGLEVIEAHFLFGLDYDQIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIY  281



>ref|WP_008273954.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Cyanothece sp. 
CCY0110]
 gb|EAZ92810.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Cyanothece sp. 
CCY0110]
Length=398

 Score =   401 bits (1030),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 203/280 (73%), Positives = 237/280 (85%), Gaps = 0/280 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K ISI+GSTGS+GTQ L++V + P++++VV LA  SNV LLA QVK F+P++V+I D+S 
Sbjct  2    KKISILGSTGSIGTQTLDIVEQYPDQFQVVGLATRSNVELLAKQVKQFRPEIVAICDQSK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            +  LK+A++ +D  P I+ GEEG+ EVARH D  +VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LGSLKDAIATMDYSPIILAGEEGVTEVARHGDAESVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH VK+LPADSEHSAIFQC+QG+P   LRRIILTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLIEKHGVKLLPADSEHSAIFQCLQGVPSDGLRRIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVE+LK   V DALKHP WSMG+KITVDSATL NKGLEVIEAH+LFG DY NI+IVIH
Sbjct  182  DWPVEQLKYVTVQDALKHPNWSMGQKITVDSATLMNKGLEVIEAHFLFGMDYKNIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIY  281



>ref|WP_019501430.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudanabaena 
sp. PCC 6802]
Length=387

 Score =   400 bits (1029),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 199/288 (69%), Positives = 239/288 (83%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            KPI+++GSTGS+GTQ L++VA+ P+++RVV LAAG NV LLA Q++ F+P++V+I D S 
Sbjct  2    KPITLLGSTGSIGTQTLDIVAQYPDRFRVVGLAAGGNVALLAEQIRKFQPEIVAIADPSK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            +++LKEA++ L  +P ++ G EG+  VA + D  TVVTGIVGCAGL PTVAAIEAGKDIA
Sbjct  62   LNDLKEAIAGLTTQPMLLAGSEGIQTVAAYGDAQTVVTGIVGCAGLLPTVAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIA G  V+PL  +H VK+LPADSEHSAIFQC+QG+PEG LRRI+LTASGG+FR
Sbjct  122  LANKETLIAAGSVVIPLIKQHGVKLLPADSEHSAIFQCLQGVPEGGLRRILLTASGGSFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            D PVEKL    V DALKHP WSMG+KIT+DSATL NKGLEVIEAHYLFG DY+ IEIVIH
Sbjct  182  DLPVEKLSSVTVADALKHPNWSMGRKITIDSATLMNKGLEVIEAHYLFGLDYEQIEIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QDSSVLAQLGLPD RLPLLY LS+P+RIY     W R
Sbjct  242  PQSIIHSLIELQDSSVLAQLGLPDMRLPLLYALSYPERIYTD---WQR  286



>ref|WP_014276615.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Arthrospira 
platensis]
 ref|YP_005071187.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Arthrospira 
platensis NIES-39]
 dbj|BAI92649.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Arthrospira 
platensis NIES-39]
Length=396

 Score =   400 bits (1028),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 197/280 (70%), Positives = 239/280 (85%), Gaps = 0/280 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++VA +P+K+++V LA GSNVTLLA QV+ F+P++V+I D++ 
Sbjct  2    KAITLLGSTGSIGTQTLDIVAHHPDKFKIVGLATGSNVTLLAQQVRQFRPEIVAICDQNK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + EL+EA++DLD +P I  GE G++EVAR+ D   VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LWELREAIADLDPQPIIEAGESGIVEVARYGDSEAVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP V P+  K+ VK+LPADSEHSAIFQC+QG+P G LRRIILTASGGAFR
Sbjct  122  LANKETLIAGGPVVNPMIEKYGVKLLPADSEHSAIFQCLQGVPSGGLRRIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVE+L +  V DA  HP WSMG+KITVDSAT+ NKGLEVIEAH+LFG DYD I+IVIH
Sbjct  182  DWPVERLTEVTVADATTHPNWSMGRKITVDSATMMNKGLEVIEAHFLFGLDYDQIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIY  281



>ref|WP_015223384.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Cyanobacterium 
stanieri]
 ref|YP_007165717.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Cyanobacterium 
stanieri PCC 7202]
 gb|AFZ48068.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Cyanobacterium 
stanieri PCC 7202]
Length=389

 Score =   400 bits (1028),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 198/282 (70%), Positives = 241/282 (85%), Gaps = 0/282 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K ISI+GSTGS+GTQ L++V ENPE++RV+ LAAGSN+TLLA Q++ F+P++V+IR+E  
Sbjct  2    KSISILGSTGSIGTQTLDIVRENPEQFRVIGLAAGSNLTLLAQQIQEFRPEIVAIRNEDN  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            +  LKE L++LD +P ++ G +G+ EVAR+    +VVTGIVGCAGL PT+AAI+AGKDIA
Sbjct  62   LPSLKELLTNLDYQPILVGGSDGICEVARYGSAQSVVTGIVGCAGLLPTIAAIKAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  ++ VK+LPADSEHSAIFQC+QG+P+G LR+IILTASGG+FR
Sbjct  122  LANKETLIAGGPVVLPLVEEYGVKLLPADSEHSAIFQCLQGVPDGGLRKIILTASGGSFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            D PVEKL    V DALKHP WSMG+KIT+DSATL NKGLEVIEAHYLFG DYD+I+IVIH
Sbjct  182  DLPVEKLASVTVQDALKHPNWSMGQKITIDSATLMNKGLEVIEAHYLFGMDYDDIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCS  19
            PQSIIHSMVE QD+SVLAQLG  D RLPLLY LS+PDR+Y +
Sbjct  242  PQSIIHSMVELQDTSVLAQLGWADMRLPLLYALSYPDRLYTN  283



>ref|WP_015133881.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Leptolyngbya 
sp. PCC 7376]
 ref|YP_007070945.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Leptolyngbya 
sp. PCC 7376]
 gb|AFY38111.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Leptolyngbya 
sp. PCC 7376]
Length=392

 Score =   400 bits (1027),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 201/280 (72%), Positives = 236/280 (84%), Gaps = 1/280 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K ISI+GSTGS+GTQ L++V  +PEK+RVV LAAG N+ LLA QV  F+P++V+  DESL
Sbjct  5    KAISILGSTGSIGTQTLDIVRSHPEKFRVVGLAAGRNIELLAAQVAEFQPEIVATHDESL  64

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + +LKE + D   + ++I G+E + E+AR+ D  +VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  65   LPKLKELIKDF-PQVQVIAGKEAIAEIARYGDSESVVTGIVGCAGLLPTIAAIEAGKDIA  123

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH VK+LPADSEHSAIFQC+QG+PEG LRRIILTASGGAFR
Sbjct  124  LANKETLIAGGPVVLPLIEKHGVKLLPADSEHSAIFQCLQGVPEGGLRRIILTASGGAFR  183

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            D PVEKL    V DALKHP WSMG+KIT+DSATL NKGLEVIEAHYLFG DYD+I+IV+H
Sbjct  184  DLPVEKLASVTVKDALKHPNWSMGQKITIDSATLMNKGLEVIEAHYLFGKDYDDIDIVVH  243

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LS+PDRIY
Sbjct  244  PQSIIHSLIEVQDTSVLAQLGWPDMRLPLLYALSYPDRIY  283



>ref|WP_015160708.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chamaesiphon 
minutus]
 ref|YP_007098109.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chamaesiphon 
minutus PCC 6605]
 gb|AFY94582.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chamaesiphon 
minutus PCC 6605]
Length=390

 Score =   400 bits (1027),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 197/279 (71%), Positives = 236/279 (85%), Gaps = 0/279 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++V  NP+K+R+V LAAGSNV +LA QV+ F+P++V+I +E+ 
Sbjct  2    KAITLLGSTGSIGTQTLDIVEHNPDKFRIVGLAAGSNVEMLARQVRQFRPEIVAIGNEAK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + ELK+ LSDLD +P I+ G +G IEVA + D  +VVTGIVGCAGL PT+AAI AGKDIA
Sbjct  62   LAELKDTLSDLDYRPIIVAGAQGTIEVAGYGDAQSVVTGIVGCAGLLPTIAAITAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH V++LPADSEHSAIFQC+QG+P G LRRIILTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLVEKHGVQLLPADSEHSAIFQCLQGVPAGGLRRIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            D P EKL    + DALKHP WSMG+KIT+DSATL NKGLEVIEAHYLFG DYD+I+IV+H
Sbjct  182  DLPAEKLASVTIADALKHPNWSMGQKITIDSATLMNKGLEVIEAHYLFGLDYDDIDIVVH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRI  28
            PQSIIHS++E QD+SVLAQLG PD RLPLLY +SWPDRI
Sbjct  242  PQSIIHSLIEVQDTSVLAQLGWPDMRLPLLYAMSWPDRI  280



>ref|WP_022607671.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rubidibacter 
lacunae]
 gb|ERN41017.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rubidibacter 
lacunae KORDI 51-2]
Length=402

 Score =   400 bits (1028),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 191/280 (68%), Positives = 240/280 (86%), Gaps = 0/280 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            KPI+I+GSTGS+GTQ L++V++ P+++RVV L+AG NV LLA Q++ F+P++ +      
Sbjct  2    KPITIVGSTGSIGTQTLDIVSQYPDRFRVVGLSAGRNVELLARQIRQFRPEIAATCYPEK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + EL+EA++DLD  P+++ GE G++EVAR+ D  +VVTGIVGCAGL PT++AI+AGKDIA
Sbjct  62   LPELREAIADLDNPPQLLAGETGVVEVARYGDAQSVVTGIVGCAGLLPTISAIQAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  ++ VK+LPADSEHSAIFQC+QG+P+G LRRI+LTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLVQQYGVKLLPADSEHSAIFQCLQGVPDGGLRRIVLTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DW VE+L  A + DALKHP WSMG+KIT+DSAT+ NKGLEVIEAHYLFG DYD I+IVIH
Sbjct  182  DWSVERLASATIADALKHPNWSMGRKITIDSATMMNKGLEVIEAHYLFGLDYDRIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
            PQSIIHS++E QD+S+LAQLGLPD RLPLLY LSWPDR+Y
Sbjct  242  PQSIIHSLIELQDTSMLAQLGLPDMRLPLLYALSWPDRLY  281



>ref|WP_015142023.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pleurocapsa 
minor]
 ref|YP_007079272.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pleurocapsa 
sp. PCC 7327]
 gb|AFY75715.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pleurocapsa 
sp. PCC 7327]
Length=397

 Score =   399 bits (1026),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 193/280 (69%), Positives = 240/280 (86%), Gaps = 0/280 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++ A+ P ++++V LAAGSN+ +L+ Q++ F+P++V++RD++ 
Sbjct  2    KKITVLGSTGSIGTQTLDIAAQYPNQFQIVGLAAGSNIEMLSEQIRQFRPEIVAVRDKTK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
               LK A++ LD  P ++ GEEG++EVAR+ D  +VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   FSALKNAVASLDYSPILLAGEEGVVEVARYGDSESVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  K+ +K+LPADSEHSAIFQC++G+P+G LRRIILTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLVEKYGIKLLPADSEHSAIFQCLEGVPKGGLRRIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            D+PVEKL    V DALKHP WSMGKKIT+DSATL NKGLEVIEAH+LFG DYDNI+IVIH
Sbjct  182  DYPVEKLASVTVQDALKHPNWSMGKKITIDSATLMNKGLEVIEAHFLFGIDYDNIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
            PQSI+HS++E QD+SVLAQLG PD RLPLLY LSWPDRIY
Sbjct  242  PQSIVHSLIELQDTSVLAQLGWPDMRLPLLYALSWPDRIY  281



>ref|WP_026731568.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Fischerella 
sp. PCC 9605]
Length=398

 Score =   399 bits (1026),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 196/288 (68%), Positives = 240/288 (83%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++VA+NP+K+R+V LAAG+N+ LLA Q++ F+P + +I  E  
Sbjct  2    KAITLLGSTGSIGTQTLDIVAQNPDKFRIVGLAAGNNIELLAAQIRQFRPSIAAICSEEK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            +  L++ ++DLD +P ++ G+ G++EVAR+ D  TVVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPALRDLIADLDPQPILMAGDAGVVEVARYGDAQTVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  K+ +K+LPADSEHSAIFQC+QG+P+G LRRI+LTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLIEKYGIKLLPADSEHSAIFQCLQGVPQGGLRRILLTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWP EKL +  V DALKHP WSMGKKITVDSATL NKGLEVIEAH+LF  DY +IEIVIH
Sbjct  182  DWPTEKLAEVTVADALKHPNWSMGKKITVDSATLMNKGLEVIEAHFLFDLDYQDIEIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY     W R
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIYTE---WER  286



>ref|WP_006196388.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nodularia spumigena]
 gb|EAW45380.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nodularia spumigena 
CCY9414]
Length=410

 Score =   400 bits (1027),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 199/288 (69%), Positives = 239/288 (83%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++V + P+++R+V LAAGSNV +LA Q++ F+P + +I  E  
Sbjct  10   KAITLVGSTGSIGTQTLDIVTQYPDQFRIVGLAAGSNVEILAAQIRQFRPSIAAISAEEK  69

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + EL+EA+ DLD +P ++ G  G+IEVAR+ D  TVVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  70   LPELQEAIKDLDPQPILLAGISGVIEVARYGDAETVVTGIVGCAGLLPTIAAIEAGKDIA  129

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH VK+LPADSEHSAIFQC+QG+P+G LRRI+LTASGGAFR
Sbjct  130  LANKETLIAGGPVVLPLVEKHGVKLLPADSEHSAIFQCLQGIPKGGLRRILLTASGGAFR  189

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DW VEKL +  V DALKHP WSMG+KITVDSATL NKGLEVIEAH+LFG DY +I+IVIH
Sbjct  190  DWDVEKLAEVTVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHFLFGLDYPDIDIVIH  249

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY     W R
Sbjct  250  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIYTD---WER  294



>gb|AHJ27390.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nodularia spumigena 
CCY9414]
Length=415

 Score =   400 bits (1027),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 199/288 (69%), Positives = 239/288 (83%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++V + P+++R+V LAAGSNV +LA Q++ F+P + +I  E  
Sbjct  15   KAITLVGSTGSIGTQTLDIVTQYPDQFRIVGLAAGSNVEILAAQIRQFRPSIAAISAEEK  74

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + EL+EA+ DLD +P ++ G  G+IEVAR+ D  TVVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  75   LPELQEAIKDLDPQPILLAGISGVIEVARYGDAETVVTGIVGCAGLLPTIAAIEAGKDIA  134

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH VK+LPADSEHSAIFQC+QG+P+G LRRI+LTASGGAFR
Sbjct  135  LANKETLIAGGPVVLPLVEKHGVKLLPADSEHSAIFQCLQGIPKGGLRRILLTASGGAFR  194

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DW VEKL +  V DALKHP WSMG+KITVDSATL NKGLEVIEAH+LFG DY +I+IVIH
Sbjct  195  DWDVEKLAEVTVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHFLFGLDYPDIDIVIH  254

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY     W R
Sbjct  255  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIYTD---WER  299



>ref|WP_017303762.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Spirulina subsalsa]
Length=396

 Score =   399 bits (1025),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 196/280 (70%), Positives = 242/280 (86%), Gaps = 0/280 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+I+GSTGS+GTQ L++V + PE++RVV LAAG NV LLA QV+ ++P++V+I++ES 
Sbjct  2    KAITILGSTGSIGTQTLDIVQQYPEQFRVVGLAAGRNVELLAEQVRQYRPEIVAIQEESK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            ++EL+EA++ LD  P ++ G+EG++EVAR+ D  +VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LEELQEAIATLDYTPIVLSGQEGVVEVARYGDAESVVTGIVGCAGLLPTLAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH +K+LPADSEHSAIFQC+QG+PEG LR+IILTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLVEKHQIKLLPADSEHSAIFQCLQGVPEGGLRKIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            D PVE+L    V DALKHP WSMG+KIT+DSATL NKGLEVIEAHYLFG +YD+I+IVIH
Sbjct  182  DLPVEQLAQVTVADALKHPNWSMGRKITIDSATLMNKGLEVIEAHYLFGVNYDDIQIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
            PQSIIHS++E QD+SVLAQLG  D RLPLLY LS+P+RI+
Sbjct  242  PQSIIHSLIEVQDTSVLAQLGWADMRLPLLYALSYPERIH  281



>ref|WP_015147522.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Oscillatoria 
acuminata]
 ref|YP_007084792.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Oscillatoria 
acuminata PCC 6304]
 gb|AFY80872.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Oscillatoria 
acuminata PCC 6304]
Length=431

 Score =   400 bits (1028),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 201/288 (70%), Positives = 240/288 (83%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++V  +P+++R+V LAA  NV LLA Q++ F+P++V+I  E  
Sbjct  22   KAITLLGSTGSIGTQTLDIVEHHPDRFRIVGLAARGNVELLAQQIRQFRPEIVAICLEDK  81

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + EL+ A++DLD +P ++ GE+G++EVAR+ D   VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  82   LPELRAAIADLDPQPILLAGEKGVVEVARYGDAEAVVTGIVGCAGLLPTIAAIEAGKDIA  141

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP V PL  KH VK+LPADSEHSAIFQC+QG+P G LRRIILTASGGAFR
Sbjct  142  LANKETLIAGGPVVNPLIEKHGVKLLPADSEHSAIFQCLQGVPPGGLRRIILTASGGAFR  201

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVEKL   KV DALKHP WSMG+KITVDSATL NKGLEVIEAHYLFG DYD+I+IVIH
Sbjct  202  DWPVEKLATVKVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHYLFGMDYDDIDIVIH  261

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY     W R
Sbjct  262  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIYTE---WER  306



>ref|WP_008180769.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Moorea producens]
 gb|EGJ33853.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Moorea producens 
3L]
Length=418

 Score =   399 bits (1026),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 197/280 (70%), Positives = 237/280 (85%), Gaps = 0/280 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++V + PE++++V LAAG NV +LA Q++ F+P + +IRD+  
Sbjct  17   KKITLLGSTGSIGTQTLDIVNQYPEQFQLVGLAAGRNVEMLAAQIRQFRPMIAAIRDQER  76

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + ELK A++DLD +P ++ GE G++EVAR+ D   VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  77   LPELKAAIADLDPQPILLGGEAGVVEVARYGDAEAVVTGIVGCAGLLPTIAAIEAGKDIA  136

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH +K+LPADSEHSAIFQC+QG+P G LRRIILTASGGAFR
Sbjct  137  LANKETLIAGGPVVLPLVEKHGIKLLPADSEHSAIFQCLQGVPAGGLRRIILTASGGAFR  196

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DW V+KL   KV DALKHP WSMG+KITVDSATL NKGLEVIEAH+LFG DYD+I+IVIH
Sbjct  197  DWSVDKLASVKVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHFLFGMDYDHIDIVIH  256

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP RIY
Sbjct  257  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPQRIY  296



>ref|WP_015129138.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Calothrix sp. 
PCC 7507]
 ref|YP_007066161.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Calothrix sp. 
PCC 7507]
 gb|AFY33327.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Calothrix sp. 
PCC 7507]
Length=398

 Score =   399 bits (1024),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 202/288 (70%), Positives = 238/288 (83%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++VA+ PE++R+V LAAGSNV LLA Q++ F+P + +I  E  
Sbjct  2    KAITLVGSTGSIGTQTLDIVAQYPEQFRIVGLAAGSNVELLAAQIRQFRPSIAAIWSEEK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            +  L+ A+ DLD +P ++ GE G+IEVAR+ D  TVVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPALQAAIKDLDPQPILLAGEGGVIEVARYGDAQTVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  K+ VKILPADSEHSAIFQC+QG+P+G LR+I+LTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLIEKYGVKILPADSEHSAIFQCLQGVPKGGLRKILLTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DW V KL +  V DALKHP WSMG+KITVDSATL NKGLEVIEAH+LFG DYD IEIVIH
Sbjct  182  DWDVAKLAEVTVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHFLFGLDYDKIEIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWPDRIY     W R
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPDRIYTD---WER  286



>ref|WP_030007587.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Synechococcus 
sp. NKBG042902]
Length=392

 Score =   399 bits (1024),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 199/280 (71%), Positives = 236/280 (84%), Gaps = 0/280 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K ISI+GSTGS+GTQ L++V  +P+K+RVV +AAG N+ LLA QV+ F P++V+   ESL
Sbjct  5    KAISILGSTGSIGTQTLDIVRSHPDKFRVVGMAAGRNIQLLAEQVREFHPEIVATSQESL  64

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + ELK  L DL+ +P+II G+  + EVAR+ D  +VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  65   LPELKSLLKDLNYQPQIIAGKAAIAEVARYGDAESVVTGIVGCAGLLPTIAAIEAGKDIA  124

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH VK+LPADSEHSAIFQC+QG+PEG L+RIILTASGGAFR
Sbjct  125  LANKETLIAGGPVVLPLIEKHGVKLLPADSEHSAIFQCLQGVPEGGLKRIILTASGGAFR  184

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            D PVEKL    V DALKHP WSMG+KIT+DSATL NKGLEVIEAHYLFG DYD+I+IV+H
Sbjct  185  DLPVEKLATVTVKDALKHPNWSMGQKITIDSATLMNKGLEVIEAHYLFGKDYDDIDIVVH  244

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LS+P+RI+
Sbjct  245  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSYPERIH  284



>ref|WP_017320504.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [cyanobacterium 
PCC 7702]
Length=398

 Score =   399 bits (1024),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 198/288 (69%), Positives = 240/288 (83%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++VA+ P+++R+V LA G+NV LLA Q++ F+P + +I  E  
Sbjct  2    KAITLVGSTGSIGTQTLDIVAQYPDRFRIVGLATGNNVELLASQIRQFRPTIAAICSEEK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            +  L+E ++ +D +P ++ GE G+IEVAR+ D  TVVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPLLQELIAQVDPQPILLAGEAGVIEVARYGDAQTVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH +K+LPADSEHSAIFQC+QG+P+G LRRI+LTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLVEKHKIKLLPADSEHSAIFQCLQGVPKGGLRRILLTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVEKL  A V DALKHP W MG+KITVDSATL NKGLEVIEAH+LFG DYD+IEIVIH
Sbjct  182  DWPVEKLAQATVADALKHPNWLMGRKITVDSATLMNKGLEVIEAHFLFGLDYDDIEIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWPDRI+ +   W R
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPDRIHTN---WER  286



>ref|WP_017719772.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Oscillatoria 
sp. PCC 10802]
Length=413

 Score =   399 bits (1024),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 195/280 (70%), Positives = 239/280 (85%), Gaps = 0/280 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++VA+ P+++R+V LAAG NV +LA Q++ F+P + +I DE  
Sbjct  2    KAITLLGSTGSIGTQTLDIVAQYPDQFRIVGLAAGRNVEMLAQQIRQFRPAIAAISDERK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + ELKEA+ D+D +P ++ GE G+IEVA++ D   VVTGIVGCAGL PT+AAI+AGKDIA
Sbjct  62   LPELKEAVRDIDPQPILLGGEAGIIEVAQYGDAEAVVTGIVGCAGLLPTIAAIKAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP V+PL  +H VK+LPADSEHSAIFQC+QG+P+G LRRI+LTASGGAFR
Sbjct  122  LANKETLIAGGPAVMPLVEQHGVKLLPADSEHSAIFQCLQGVPKGGLRRILLTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPV+KL +  V DALKHP WSMG+KITVDSATL NKGLEVIEAH+LFG DYD I+IVIH
Sbjct  182  DWPVDKLPEVTVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHFLFGLDYDRIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIY  281



>ref|WP_035986731.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Leptolyngbya 
sp. KIOST-1]
Length=397

 Score =   398 bits (1022),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 197/280 (70%), Positives = 238/280 (85%), Gaps = 0/280 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L+++  +P+++R+V +AAG+NV LLA QV+ FKP++V+I +   
Sbjct  2    KAITLLGSTGSIGTQTLDILEHHPDQFRLVGIAAGNNVDLLAQQVRQFKPEVVAICNPDK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + +L+ AL+ LD  P+I+ G++G++EVAR+ D   VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LGDLRAALAGLDPMPQILAGDDGVVEVARYGDAEAVVTGIVGCAGLLPTLAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH VK+LPADSEHSAIFQC+QG+P G LRRI+LTASGGAFR
Sbjct  122  LANKETLIAGGPAVLPLVEKHGVKLLPADSEHSAIFQCLQGVPAGGLRRILLTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWP E+L    V DALKHP WSMG+KITVDSATL NKGLEVIEAHYLFG DYDNI+IVIH
Sbjct  182  DWPTERLAQVTVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHYLFGMDYDNIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWPDRIY
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPDRIY  281



>ref|WP_016872446.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chlorogloeopsis 
fritschii]
Length=398

 Score =   398 bits (1022),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 198/288 (69%), Positives = 239/288 (83%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++VA+ P+++R+V LA G+NV LLA Q++ F+P + +I  E  
Sbjct  2    KAITLLGSTGSIGTQTLDIVAQYPDQFRIVGLATGNNVELLASQIRQFRPTIAAICLEEK  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            +  L+E ++D+D +P ++ GE G+IEVAR+ D  TVVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPVLRELIADVDPQPILLAGEAGVIEVARYGDAQTVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH +K+LPADSEHSAIFQC+QG+P+G LR+I+LTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLVEKHGIKLLPADSEHSAIFQCLQGVPKGGLRKILLTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DW  EKL +  V DALKHP WSMG+KITVDSATL NKGLEVIEAH+LFG DYDNIEIVIH
Sbjct  182  DWATEKLAEVTVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHFLFGLDYDNIEIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWPDRIY     W R
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPDRIYTD---WER  286



>ref|WP_008206915.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Microcystis 
sp. T1-4]
 emb|CCI34462.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Microcystis 
sp. T1-4]
Length=390

 Score =   397 bits (1021),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 197/280 (70%), Positives = 239/280 (85%), Gaps = 0/280 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K ISI+GSTGS+GTQ L++V ++P+K++VV LA G+N+ LL+ Q++ F+P++V+I +ES 
Sbjct  2    KKISILGSTGSIGTQTLDIVTDHPDKFQVVGLATGNNIQLLSEQIRQFRPQIVAINNESQ  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            +++LK  +SDLD  P I+ G+EG+IEVAR+ D  +VVTGIVGCAGL PT+AAI AGKDIA
Sbjct  62   LEDLKSLISDLDYTPIILAGKEGVIEVARYGDSESVVTGIVGCAGLLPTIAAITAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH VK+LPADSEHSAIFQC+QG+P G L++IILTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLVEKHRVKLLPADSEHSAIFQCLQGVPTGGLKKIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            D PVEKL    V DALKHP WSMG+KIT+DSATL NKGLEVIEAHYLFG DY+ I+IVIH
Sbjct  182  DLPVEKLSQVTVADALKHPNWSMGRKITIDSATLMNKGLEVIEAHYLFGVDYNAIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIY  281



>ref|WP_024969036.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Microcystis 
aeruginosa]
Length=390

 Score =   397 bits (1021),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 197/280 (70%), Positives = 239/280 (85%), Gaps = 0/280 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K ISI+GSTGS+GTQ L++V ++P+K++VV LA G+N+ LL+ Q++ F+P++V+I +ES 
Sbjct  2    KKISILGSTGSIGTQTLDIVTDHPDKFQVVGLATGNNIQLLSEQIRQFRPQIVAINNESQ  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            +++LK  +SDLD  P I+ G+EG+IEVAR+ D  +VVTGIVGCAGL PT+AAI AGKDIA
Sbjct  62   LEDLKSLISDLDYTPIILAGKEGVIEVARYGDSESVVTGIVGCAGLLPTIAAITAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH VK+LPADSEHSAIFQC+QG+P G L++IILTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLVEKHRVKLLPADSEHSAIFQCLQGVPTGGLKKIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            D PVEKL    V DALKHP WSMG+KIT+DSATL NKGLEVIEAHYLFG DY+ I+IVIH
Sbjct  182  DLPVEKLPQVTVADALKHPNWSMGRKITIDSATLMNKGLEVIEAHYLFGVDYNAIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIY  281



>ref|WP_002773162.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Microcystis 
aeruginosa]
 emb|CCI09705.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Microcystis 
aeruginosa PCC 7941]
Length=390

 Score =   397 bits (1021),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 197/280 (70%), Positives = 239/280 (85%), Gaps = 0/280 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K ISI+GSTGS+GTQ L++V ++P+K++VV LA G+N+ LL+ Q++ F+P++V+I +ES 
Sbjct  2    KKISILGSTGSIGTQTLDIVTDHPDKFQVVGLATGNNIQLLSEQIRQFRPQIVAINNESQ  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            +++LK  +SDLD  P I+ G+EG+IEVAR+ D  +VVTGIVGCAGL PT+AAI AGKDIA
Sbjct  62   LEDLKSLISDLDYTPIILAGKEGVIEVARYGDSESVVTGIVGCAGLLPTIAAITAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH VK+LPADSEHSAIFQC+QG+P G L++IILTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLVEKHRVKLLPADSEHSAIFQCLQGVPTGGLKKIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            D PVEKL    V DALKHP WSMG+KIT+DSATL NKGLEVIEAHYLFG DY+ I+IVIH
Sbjct  182  DLPVEKLPQVTVADALKHPNWSMGRKITIDSATLMNKGLEVIEAHYLFGVDYNAIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIY  281



>ref|WP_026785741.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Planktothrix 
rubescens]
Length=394

 Score =   397 bits (1021),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 197/288 (68%), Positives = 240/288 (83%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++VAE PE++R+V L AGSN+ LLA Q++ F P +V+I +   
Sbjct  2    KAITLLGSTGSIGTQTLDIVAEYPEQFRIVGLTAGSNINLLAQQIRAFNPSIVAISNPDQ  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + ELK  ++D++ +P ++ GEEG+IEVAR+ D   VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPELKALITDINPQPILLAGEEGIIEVARYGDSEAVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP V PL  KH VK+LPADSEHSAIFQC+QG+P+  LRRIILTASGGAFR
Sbjct  122  LANKETLIAGGPVVNPLIKKHGVKLLPADSEHSAIFQCLQGVPQAGLRRIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVEKLK+  V DA+ HP WSMGKKITVDSAT+ NKGLEVIEAH+LFG DY++IEIVIH
Sbjct  182  DWPVEKLKEVTVADAITHPNWSMGKKITVDSATMMNKGLEVIEAHFLFGLDYNDIEIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG PD RLP+LY +SWP+RIY +   W R
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPILYAMSWPERIYTN---WQR  286



>ref|WP_027255459.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Planktothrix 
agardhii]
Length=394

 Score =   397 bits (1021),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 197/288 (68%), Positives = 240/288 (83%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++VAE PE++R+V L AGSN+ LLA Q++ F P +V+I +   
Sbjct  2    KAITLLGSTGSIGTQTLDIVAEYPEQFRIVGLTAGSNINLLAQQIRAFNPSIVAISNPDQ  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + ELK  ++D++ +P ++ GEEG+IEVAR+ D   VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPELKALITDINPQPILLAGEEGIIEVARYGDSEAVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP V PL  KH VK+LPADSEHSAIFQC+QG+P+  LRRIILTASGGAFR
Sbjct  122  LANKETLIAGGPVVNPLIKKHGVKLLPADSEHSAIFQCLQGVPQAGLRRIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVEKLK+  V DA+ HP WSMGKKITVDSAT+ NKGLEVIEAH+LFG DY++IEIVIH
Sbjct  182  DWPVEKLKEVTVADAITHPNWSMGKKITVDSATMMNKGLEVIEAHFLFGLDYNDIEIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG PD RLP+LY +SWP+RIY +   W R
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPILYAMSWPERIYTN---WQR  286



>ref|WP_016515763.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Microcystis 
aeruginosa]
 gb|EPF20986.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Microcystis 
aeruginosa SPC777]
 gb|EPF21684.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Microcystis 
aeruginosa SPC777]
Length=390

 Score =   397 bits (1020),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 197/280 (70%), Positives = 239/280 (85%), Gaps = 0/280 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K ISI+GSTGS+GTQ L++V ++P+K++VV LA G+N+ LL+ Q++ F+P++V+I +ES 
Sbjct  2    KKISILGSTGSIGTQTLDIVTDHPDKFQVVGLATGNNIQLLSEQIRQFRPQIVAINNESQ  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            +++LK  +SDLD  P I+ G+EG+IEVAR+ D  +VVTGIVGCAGL PT+AAI AGKDIA
Sbjct  62   LEDLKSLISDLDYTPIILAGKEGVIEVARYGDSESVVTGIVGCAGLLPTIAAITAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH VK+LPADSEHSAIFQC+QG+P G L++IILTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLVEKHRVKLLPADSEHSAIFQCLQGVPTGGLKKIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            D PVEKL    V DALKHP WSMG+KIT+DSATL NKGLEVIEAHYLFG DY+ I+IVIH
Sbjct  182  DLPVEKLPQVTVADALKHPNWSMGRKITIDSATLMNKGLEVIEAHYLFGVDYNAIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIY  281



>ref|WP_002733165.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Microcystis 
aeruginosa]
 gb|ELP56321.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Microcystis 
aeruginosa TAIHU98]
Length=390

 Score =   397 bits (1020),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 197/280 (70%), Positives = 239/280 (85%), Gaps = 0/280 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K ISI+GSTGS+GTQ L++V ++P+K++VV LA G+N+ LL+ Q++ F+P++V+I +ES 
Sbjct  2    KKISILGSTGSIGTQTLDIVTDHPDKFQVVGLATGNNIQLLSEQIRQFRPQIVAINNESQ  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            +++LK  +SDLD  P I+ G+EG+IEVAR+ D  +VVTGIVGCAGL PT+AAI AGKDIA
Sbjct  62   LEDLKSLISDLDYTPIILAGKEGVIEVARYGDSESVVTGIVGCAGLLPTIAAITAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH VK+LPADSEHSAIFQC+QG+P G L++IILTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLVEKHRVKLLPADSEHSAIFQCLQGVPTGGLKKIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            D PVEKL    V DALKHP WSMG+KIT+DSATL NKGLEVIEAHYLFG DY+ I+IVIH
Sbjct  182  DLPVEKLPQVTVADALKHPNWSMGRKITIDSATLMNKGLEVIEAHYLFGVDYNAIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIY  281



>dbj|GAL94569.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Microcystis 
aeruginosa NIES-44]
Length=390

 Score =   397 bits (1020),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 197/280 (70%), Positives = 239/280 (85%), Gaps = 0/280 (0%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K ISI+GSTGS+GTQ L++V ++P+K++VV LA G+N+ LL+ Q++ F+P++V+I +ES 
Sbjct  2    KKISILGSTGSIGTQTLDIVTDHPDKFQVVGLATGNNIQLLSEQIRQFRPQIVAINNESQ  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            +++LK  +SDLD  P I+ G+EG+IEVAR+ D  +VVTGIVGCAGL PT+AAI AGKDIA
Sbjct  62   LEDLKSLISDLDYTPIILAGKEGVIEVARYGDSESVVTGIVGCAGLLPTIAAITAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP VLPL  KH VK+LPADSEHSAIFQC+QG+P G L++IILTASGGAFR
Sbjct  122  LANKETLIAGGPVVLPLVEKHRVKLLPADSEHSAIFQCLQGVPTGGLKKIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            D PVEKL    V DALKHP WSMG+KIT+DSATL NKGLEVIEAHYLFG DY+ I+IVIH
Sbjct  182  DLPVEKLPQVTVADALKHPNWSMGRKITIDSATLMNKGLEVIEAHYLFGVDYNAIDIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIY  25
            PQSIIHS++E QD+SVLAQLG PD RLPLLY LSWP+RIY
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIY  281



>ref|WP_026795561.1| MULTISPECIES: 1-deoxy-D-xylulose 5-phosphate reductoisomerase 
[Planktothrix]
Length=394

 Score =   397 bits (1020),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 197/288 (68%), Positives = 240/288 (83%), Gaps = 3/288 (1%)
 Frame = -3

Query  864  KPISIIGSTGSVGTQCLEVVAENPEKYRVVALAAGSNVTLLAHQVKTFKPKLVSIRDESL  685
            K I+++GSTGS+GTQ L++VAE PE++R+V L AGSN+ LLA Q++ F P +V+I +   
Sbjct  2    KAITLLGSTGSIGTQTLDIVAEYPEQFRIVGLTAGSNINLLAQQIRAFNPSIVAISNPDQ  61

Query  684  VDELKEALSDLDekpeiipgeegliEVARHPDIVTVVTGIVGCAGLKPTVAAIEAGKDIA  505
            + ELK  ++D++ +P ++ GEEG+IEVAR+ D   VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct  62   LPELKALITDINPQPILLAGEEGIIEVARYGDSEAVVTGIVGCAGLLPTIAAIEAGKDIA  121

Query  504  LANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR  325
            LANKETLIAGGP V PL  KH VK+LPADSEHSAIFQC+QG+P+  LRRIILTASGGAFR
Sbjct  122  LANKETLIAGGPVVNPLIKKHGVKLLPADSEHSAIFQCLQGVPQAGLRRIILTASGGAFR  181

Query  324  DWPVEKLKDAKVGDALKHPIWSMGKKITVDSATLFNKGLEVIEAHYLFGTDYDNIEIVIH  145
            DWPVEKLK+  V DA+ HP WSMGKKITVDSAT+ NKGLEVIEAH+LFG DY++IEIVIH
Sbjct  182  DWPVEKLKEVTVADAITHPNWSMGKKITVDSATMMNKGLEVIEAHFLFGLDYNDIEIVIH  241

Query  144  PQSIIHSMVETQDSSVLAQLGLPDFRLPLLYTLSWPDRIYCSEITWPR  1
            PQSIIHS++E QD+SVLAQLG PD RLP+LY +SWP+RIY +   W R
Sbjct  242  PQSIIHSLIELQDTSVLAQLGWPDMRLPILYAMSWPERIYTN---WQR  286



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2881079744160