BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18997_g3_i1 len=1758 path=[3461:0-567 4029:568-591 4053:592-595
4057:596-643 2174:644-1542 3073:1543-1566 4979:1567-1757]

Length=1758
                                                                      Score     E

ref|XP_009800559.1|  PREDICTED: serine carboxypeptidase-like 31 i...    727   0.0      
ref|XP_009591367.1|  PREDICTED: serine carboxypeptidase-like 31 i...    726   0.0      
emb|CDO99599.1|  unnamed protein product                                717   0.0      
ref|XP_006347176.1|  PREDICTED: serine carboxypeptidase-like 31-like    709   0.0      
ref|XP_009800560.1|  PREDICTED: serine carboxypeptidase-like 31 i...    706   0.0      
ref|XP_009591368.1|  PREDICTED: serine carboxypeptidase-like 31 i...    706   0.0      
ref|XP_010316720.1|  PREDICTED: serine carboxypeptidase-like 31         706   0.0      
gb|EYU27945.1|  hypothetical protein MIMGU_mgv1a005674mg                698   0.0      
ref|XP_008224993.1|  PREDICTED: serine carboxypeptidase-like 31         694   0.0      
ref|XP_010645362.1|  PREDICTED: serine carboxypeptidase-like 31         691   0.0      
ref|XP_011047847.1|  PREDICTED: serine carboxypeptidase-like 31         690   0.0      
emb|CBI18754.3|  unnamed protein product                                691   0.0      
ref|XP_011096266.1|  PREDICTED: serine carboxypeptidase-like 31         690   0.0      
ref|XP_010278297.1|  PREDICTED: serine carboxypeptidase-like 31         690   0.0      
ref|XP_009379538.1|  PREDICTED: serine carboxypeptidase-like 31         690   0.0      
ref|XP_002521402.1|  serine carboxypeptidase, putative                  687   0.0      Ricinus communis
ref|XP_008371321.1|  PREDICTED: serine carboxypeptidase-like 31         687   0.0      
ref|XP_007025718.1|  Serine carboxypeptidase-like 31                    686   0.0      
ref|XP_003543072.1|  PREDICTED: serine carboxypeptidase-like 31-l...    685   0.0      
ref|XP_003547136.1|  PREDICTED: serine carboxypeptidase-like 31-like    684   0.0      
ref|XP_007148207.1|  hypothetical protein PHAVU_006G189100g             682   0.0      
ref|XP_007212080.1|  hypothetical protein PRUPE_ppa005035mg             682   0.0      
ref|XP_008383787.1|  PREDICTED: serine carboxypeptidase-like 31         681   0.0      
ref|XP_007159282.1|  hypothetical protein PHAVU_002G224800g             681   0.0      
ref|XP_010107053.1|  Serine carboxypeptidase-like 31                    679   0.0      
ref|XP_006449285.1|  hypothetical protein CICLE_v10015093mg             678   0.0      
emb|CAN82217.1|  hypothetical protein VITISV_020424                     677   0.0      Vitis vinifera
ref|XP_006467848.1|  PREDICTED: serine carboxypeptidase-like 31-like    677   0.0      
gb|KDP20920.1|  hypothetical protein JCGZ_21391                         676   0.0      
ref|XP_006583804.1|  PREDICTED: serine carboxypeptidase-like 31-l...    674   0.0      
ref|XP_003529304.1|  PREDICTED: serine carboxypeptidase-like 31-l...    675   0.0      
ref|XP_010686577.1|  PREDICTED: serine carboxypeptidase-like 31         674   0.0      
ref|XP_003542771.1|  PREDICTED: serine carboxypeptidase-like 31-like    674   0.0      
ref|XP_003543073.1|  PREDICTED: serine carboxypeptidase-like 31-l...    672   0.0      
ref|XP_003593500.1|  Serine carboxypeptidase-like protein               671   0.0      
gb|KEH31128.1|  serine carboxypeptidase-like protein                    669   0.0      
ref|XP_004293521.1|  PREDICTED: serine carboxypeptidase-like 31-like    667   0.0      
gb|AFK42926.1|  unknown                                                 667   0.0      
ref|XP_010533891.1|  PREDICTED: serine carboxypeptidase-like 31 i...    665   0.0      
ref|XP_011027907.1|  PREDICTED: serine carboxypeptidase-like 31         664   0.0      
ref|XP_008442230.1|  PREDICTED: serine carboxypeptidase-like 31         664   0.0      
ref|XP_004146591.1|  PREDICTED: serine carboxypeptidase-like 31-like    661   0.0      
ref|XP_002317229.2|  serine carboxypeptidase S10 family protein         660   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010052354.1|  PREDICTED: serine carboxypeptidase-like 31         659   0.0      
ref|XP_010533892.1|  PREDICTED: serine carboxypeptidase-like 31 i...    657   0.0      
ref|XP_002305011.2|  hypothetical protein POPTR_0004s03800g             646   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004505005.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    637   0.0      
ref|XP_010475997.1|  PREDICTED: serine carboxypeptidase-like 31         630   0.0      
ref|XP_010458486.1|  PREDICTED: serine carboxypeptidase-like 31         629   0.0      
emb|CDY20978.1|  BnaA08g25470D                                          622   0.0      
ref|XP_006303174.1|  hypothetical protein CARUB_v10008980mg             622   0.0      
ref|XP_009123830.1|  PREDICTED: serine carboxypeptidase-like 31         622   0.0      
ref|XP_006417392.1|  hypothetical protein EUTSA_v10007471mg             622   0.0      
gb|AIC80775.1|  serine carboxypeptidase                                 621   0.0      
ref|XP_002892617.1|  hypothetical protein ARALYDRAFT_471242             619   0.0      
emb|CDY20588.1|  BnaC08g14700D                                          619   0.0      
ref|NP_172575.2|  serine carboxypeptidase-like 31                       618   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_001184957.1|  serine carboxypeptidase-like 31                    618   0.0      
ref|XP_007159281.1|  hypothetical protein PHAVU_002G224800g             613   0.0      
emb|CDX97930.1|  BnaA06g06810D                                          617   0.0      
ref|XP_003593501.1|  Serine carboxypeptidase-like protein               615   0.0      
ref|XP_009148441.1|  PREDICTED: serine carboxypeptidase-like 31         615   0.0      
ref|XP_006301500.1|  hypothetical protein CARUB_v10021926mg             608   0.0      
emb|CDY19338.1|  BnaC05g08470D                                          608   0.0      
ref|XP_006392053.1|  hypothetical protein EUTSA_v10023955mg             605   0.0      
ref|XP_010473313.1|  PREDICTED: serine carboxypeptidase-like 32         600   0.0      
gb|AAB65475.1|  Serine carboxypeptidase isolog; 30227-33069             600   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010431670.1|  PREDICTED: serine carboxypeptidase-like 32         599   0.0      
ref|XP_010473314.1|  PREDICTED: serine carboxypeptidase-like 32         597   0.0      
ref|XP_009104389.1|  PREDICTED: serine carboxypeptidase-like 32         595   0.0      
ref|NP_176308.2|  serine carboxypeptidase-like 32                       595   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010533893.1|  PREDICTED: serine carboxypeptidase-like 31 i...    594   0.0      
ref|NP_193246.2|  serine carboxypeptidase-like 30                       595   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010418062.1|  PREDICTED: serine carboxypeptidase-like 32         593   0.0      
ref|XP_006301480.1|  hypothetical protein CARUB_v10021903mg             593   0.0      
ref|XP_002886559.1|  serine carboxypeptidase S10 family protein         591   0.0      
ref|XP_006392051.1|  hypothetical protein EUTSA_v10023439mg             591   0.0      
gb|KFK40732.1|  hypothetical protein AALP_AA2G034000                    589   0.0      
emb|CDY56791.1|  BnaA01g36020D                                          587   0.0      
ref|XP_006392050.1|  hypothetical protein EUTSA_v10023439mg             585   0.0      
gb|KDP20921.1|  hypothetical protein JCGZ_21392                         584   0.0      
ref|XP_006282819.1|  hypothetical protein CARUB_v10006611mg             583   0.0      
ref|XP_004167595.1|  PREDICTED: serine carboxypeptidase-like 31-like    574   0.0      
ref|XP_010495900.1|  PREDICTED: putative serine carboxypeptidase-...    576   0.0      
emb|CDY03789.1|  BnaC01g29060D                                          575   0.0      
gb|AAB71481.1|  similar to serine carboxypeptidases                     570   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006303173.1|  hypothetical protein CARUB_v10008980mg             569   0.0      
ref|XP_006417391.1|  hypothetical protein EUTSA_v10007471mg             568   0.0      
emb|CAB10289.1|  hydroxynitrile lyase like protein                      506   6e-172   Arabidopsis thaliana [mouse-ear cress]
gb|ABR16028.1|  unknown                                                 483   1e-161   Picea sitchensis
ref|XP_007043281.1|  Serine carboxypeptidase-like 34 isoform 1          479   3e-160   
ref|XP_010546241.1|  PREDICTED: serine carboxypeptidase-like 34 i...    474   4e-158   
ref|XP_010054359.1|  PREDICTED: serine carboxypeptidase-like 31         466   1e-157   
ref|XP_010546240.1|  PREDICTED: serine carboxypeptidase-like 34 i...    471   5e-157   
ref|XP_006437579.1|  hypothetical protein CICLE_v10031415mg             469   2e-156   
ref|XP_008806723.1|  PREDICTED: serine carboxypeptidase-like 33 i...    469   3e-156   
ref|XP_008806724.1|  PREDICTED: serine carboxypeptidase-like 33 i...    468   4e-156   
ref|XP_006484538.1|  PREDICTED: serine carboxypeptidase-like 35-like    468   6e-156   
ref|XP_004508115.1|  PREDICTED: serine carboxypeptidase-like 33-like    466   2e-155   
gb|KHN02864.1|  Serine carboxypeptidase-like 33                         466   6e-155   
ref|XP_003529505.1|  PREDICTED: serine carboxypeptidase-like 33-l...    466   6e-155   
ref|XP_010031922.1|  PREDICTED: serine carboxypeptidase-like 34         466   7e-155   
ref|XP_010914643.1|  PREDICTED: serine carboxypeptidase-like 33         465   9e-155   
ref|XP_003550568.2|  PREDICTED: serine carboxypeptidase-like 33-like    464   4e-154   
ref|XP_007154418.1|  hypothetical protein PHAVU_003G118000g             463   6e-154   
ref|XP_003537768.1|  PREDICTED: serine carboxypeptidase-like 34-like    462   9e-154   
ref|XP_008801741.1|  PREDICTED: serine carboxypeptidase-like 33 i...    462   1e-153   
ref|XP_004505704.1|  PREDICTED: serine carboxypeptidase-like 34-like    462   1e-153   
gb|KEH32355.1|  serine carboxypeptidase-like protein                    462   2e-153   
ref|XP_010501423.1|  PREDICTED: serine carboxypeptidase-like 31         466   4e-153   
ref|XP_002316057.2|  serine carboxypeptidase S10 family protein         461   5e-153   Populus trichocarpa [western balsam poplar]
gb|KHN03262.1|  Serine carboxypeptidase-like 33                         460   5e-153   
ref|XP_010274883.1|  PREDICTED: serine carboxypeptidase-like 35         460   7e-153   
ref|XP_006484531.1|  PREDICTED: serine carboxypeptidase-like 34-like    461   8e-153   
ref|XP_006437593.1|  hypothetical protein CICLE_v10031313mg             461   1e-152   
ref|XP_010933286.1|  PREDICTED: serine carboxypeptidase-like 35         459   2e-152   
ref|XP_008797239.1|  PREDICTED: serine carboxypeptidase-like 34         462   2e-152   
gb|KFK27639.1|  hypothetical protein AALP_AA8G409500                    459   2e-152   
ref|XP_010931783.1|  PREDICTED: serine carboxypeptidase-like 33 i...    457   1e-151   
gb|KEH32356.1|  serine carboxypeptidase-like protein                    457   2e-151   
ref|XP_010935543.1|  PREDICTED: serine carboxypeptidase-like 34         456   2e-151   
ref|XP_011075284.1|  PREDICTED: serine carboxypeptidase-like 34         456   3e-151   
ref|XP_008677402.1|  PREDICTED: lysosomal protective protein isof...    456   6e-151   
ref|XP_004977092.1|  PREDICTED: serine carboxypeptidase-like 33-l...    455   6e-151   
ref|XP_004977091.1|  PREDICTED: serine carboxypeptidase-like 33-l...    456   8e-151   
ref|XP_011010904.1|  PREDICTED: serine carboxypeptidase-like 33         455   9e-151   
ref|XP_006287580.1|  hypothetical protein CARUB_v10000790mg             455   1e-150   
ref|XP_007223035.1|  hypothetical protein PRUPE_ppa005368mg             454   1e-150   
ref|XP_010671807.1|  PREDICTED: serine carboxypeptidase-like 33         454   2e-150   
ref|XP_004135953.1|  PREDICTED: serine carboxypeptidase-like 34-like    454   2e-150   
ref|XP_009397583.1|  PREDICTED: serine carboxypeptidase-like 34 i...    454   2e-150   
ref|XP_011022036.1|  PREDICTED: serine carboxypeptidase-like 34         454   3e-150   
ref|XP_010493441.1|  PREDICTED: serine carboxypeptidase-like 34         454   3e-150   
ref|XP_003607259.1|  Serine carboxypeptidase-like protein               453   3e-150   
ref|XP_007043286.1|  Serine carboxypeptidase-like 35                    455   4e-150   
gb|KEH30582.1|  serine carboxypeptidase-like protein                    452   4e-150   
ref|XP_010274881.1|  PREDICTED: serine carboxypeptidase-like 34         453   4e-150   
ref|XP_009413121.1|  PREDICTED: serine carboxypeptidase-like 34         453   4e-150   
ref|XP_010421120.1|  PREDICTED: serine carboxypeptidase-like 34         454   5e-150   
ref|XP_002872043.1|  SCPL34                                             453   6e-150   
ref|NP_001152245.1|  lysosomal protective protein precursor             452   1e-149   Zea mays [maize]
ref|XP_010454603.1|  PREDICTED: serine carboxypeptidase-like 34         452   2e-149   
ref|XP_004968682.1|  PREDICTED: serine carboxypeptidase-like 33-l...    451   2e-149   
ref|XP_004968683.1|  PREDICTED: serine carboxypeptidase-like 33-l...    451   2e-149   
ref|NP_001047514.1|  Os02g0634700                                       451   2e-149   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004968684.1|  PREDICTED: serine carboxypeptidase-like 33-l...    451   2e-149   
gb|EYU33331.1|  hypothetical protein MIMGU_mgv1a025174mg                451   2e-149   
ref|XP_010688684.1|  PREDICTED: serine carboxypeptidase-like 34         452   2e-149   
ref|XP_010648555.1|  PREDICTED: serine carboxypeptidase-like 35         451   2e-149   
ref|NP_851062.2|  serine carboxypeptidase-like 34                       452   3e-149   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009631140.1|  PREDICTED: serine carboxypeptidase 24-like         450   4e-149   
gb|EEC73659.1|  hypothetical protein OsI_08191                          451   5e-149   Oryza sativa Indica Group [Indian rice]
ref|XP_006590795.1|  PREDICTED: serine carboxypeptidase-like 34-like    450   7e-149   
ref|XP_009385955.1|  PREDICTED: serine carboxypeptidase-like 35         450   7e-149   
ref|XP_009397584.1|  PREDICTED: serine carboxypeptidase-like 34 i...    450   8e-149   
ref|XP_009765689.1|  PREDICTED: serine carboxypeptidase-like 33 i...    450   8e-149   
ref|XP_008812782.1|  PREDICTED: serine carboxypeptidase-like 34         450   8e-149   
gb|KHG12023.1|  Serine carboxypeptidase-like 35                         449   1e-148   
emb|CDY35007.1|  BnaA01g27270D                                          449   2e-148   
ref|XP_008221066.1|  PREDICTED: serine carboxypeptidase-like 34         449   2e-148   
ref|XP_008643435.1|  PREDICTED: hypothetical protein isoform X1         449   2e-148   
ref|XP_010231680.1|  PREDICTED: serine carboxypeptidase-like 33         448   3e-148   
ref|XP_009792407.1|  PREDICTED: serine carboxypeptidase 24-like         448   3e-148   
ref|XP_008643436.1|  PREDICTED: hypothetical protein isoform X2         448   3e-148   
emb|CDP18632.1|  unnamed protein product                                449   3e-148   
ref|XP_009590151.1|  PREDICTED: serine carboxypeptidase-like 33 i...    448   3e-148   
ref|XP_010918382.1|  PREDICTED: serine carboxypeptidase-like 34 i...    448   4e-148   
ref|XP_009114428.1|  PREDICTED: serine carboxypeptidase-like 33         448   4e-148   
ref|XP_002452495.1|  hypothetical protein SORBIDRAFT_04g026900          447   5e-148   Sorghum bicolor [broomcorn]
ref|XP_009765688.1|  PREDICTED: serine carboxypeptidase-like 33 i...    448   5e-148   
ref|XP_002310649.2|  hypothetical protein POPTR_0007s07690g             447   8e-148   Populus trichocarpa [western balsam poplar]
ref|XP_009590149.1|  PREDICTED: serine carboxypeptidase-like 33 i...    447   8e-148   
ref|XP_002280311.1|  PREDICTED: serine carboxypeptidase-like 33 i...    447   8e-148   Vitis vinifera
ref|XP_010491452.1|  PREDICTED: serine carboxypeptidase-like 35         447   1e-147   
ref|XP_009130122.1|  PREDICTED: serine carboxypeptidase-like 34         447   1e-147   
emb|CBI27154.3|  unnamed protein product                                446   1e-147   
ref|XP_008461360.1|  PREDICTED: serine carboxypeptidase-like 34         447   1e-147   
emb|CDY46950.1|  BnaA02g32960D                                          447   1e-147   
ref|NP_001054710.1|  Os05g0158500                                       447   1e-147   Oryza sativa Japonica Group [Japonica rice]
gb|AEO37080.1|  grain size 5                                            446   2e-147   
ref|XP_004953203.1|  PREDICTED: serine carboxypeptidase-like 34-like    446   2e-147   
ref|XP_002278314.1|  PREDICTED: serine carboxypeptidase-like 35         446   2e-147   Vitis vinifera
ref|XP_002520355.1|  serine carboxypeptidase, putative                  449   2e-147   Ricinus communis
ref|XP_010112534.1|  Serine carboxypeptidase-like 34                    446   2e-147   
emb|CDP10248.1|  unnamed protein product                                445   3e-147   
ref|XP_010688683.1|  PREDICTED: serine carboxypeptidase-like 34         446   3e-147   
ref|XP_009401001.1|  PREDICTED: serine carboxypeptidase-like 34         445   3e-147   
ref|XP_006847849.1|  hypothetical protein AMTR_s00029p00064790          446   4e-147   
ref|XP_006644137.1|  PREDICTED: serine carboxypeptidase-like 33-like    446   4e-147   
ref|XP_002308408.1|  BRI1 SUPPRESSOR 1 family protein                   445   4e-147   Populus trichocarpa [western balsam poplar]
ref|XP_008797238.1|  PREDICTED: serine carboxypeptidase-like 35         446   4e-147   
ref|XP_004146676.1|  PREDICTED: serine carboxypeptidase 24-like         445   5e-147   
ref|XP_002452974.1|  hypothetical protein SORBIDRAFT_04g035810          446   5e-147   Sorghum bicolor [broomcorn]
ref|NP_001136802.1|  hypothetical protein precursor                     445   5e-147   Zea mays [maize]
ref|XP_004161865.1|  PREDICTED: serine carboxypeptidase 24-like         445   5e-147   
gb|KDO75846.1|  hypothetical protein CISIN_1g0117382mg                  439   6e-147   
ref|XP_010108549.1|  Serine carboxypeptidase 24                         446   6e-147   
ref|XP_003572740.1|  PREDICTED: serine carboxypeptidase-like 34         445   7e-147   
ref|XP_002871313.1|  hypothetical protein ARALYDRAFT_908774             445   7e-147   
ref|NP_196443.1|  serine carboxypeptidase-like 35                       445   8e-147   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006406756.1|  hypothetical protein EUTSA_v10020640mg             444   9e-147   
ref|XP_002275684.1|  PREDICTED: serine carboxypeptidase 24 isofor...    444   1e-146   Vitis vinifera
gb|AFW80678.1|  hypothetical protein ZEAMMB73_449683                    446   1e-146   
ref|XP_011006772.1|  PREDICTED: serine carboxypeptidase-like 35         444   1e-146   
ref|XP_010548637.1|  PREDICTED: serine carboxypeptidase 24              444   1e-146   
gb|EEC78565.1|  hypothetical protein OsI_18545                          444   2e-146   Oryza sativa Indica Group [Indian rice]
gb|ABF70080.1|  serine carboxypeptidase (carboxypeptidase D), put...    444   2e-146   Musa acuminata [banana]
ref|XP_006394590.1|  hypothetical protein EUTSA_v10004057mg             444   2e-146   
ref|XP_007011905.1|  Alpha/beta-Hydrolases superfamily protein          443   2e-146   
ref|XP_006453596.1|  hypothetical protein CICLE_v10008182mg             443   2e-146   
gb|KHG14577.1|  Serine carboxypeptidase 24 -like protein                443   2e-146   
ref|XP_008796482.1|  PREDICTED: serine carboxypeptidase-like 34         444   2e-146   
ref|XP_011079399.1|  PREDICTED: serine carboxypeptidase 24              442   3e-146   
ref|XP_010522153.1|  PREDICTED: serine carboxypeptidase-like 35         442   4e-146   
ref|XP_008443849.1|  PREDICTED: serine carboxypeptidase 24-like i...    442   5e-146   
ref|XP_008361910.1|  PREDICTED: serine carboxypeptidase-like 34         442   5e-146   
ref|XP_009393156.1|  PREDICTED: serine carboxypeptidase-like 33         441   7e-146   
ref|XP_004231499.1|  PREDICTED: serine carboxypeptidase-like 34         442   7e-146   
emb|CDX81089.1|  BnaC03g03430D                                          442   8e-146   
ref|XP_002885191.1|  hypothetical protein ARALYDRAFT_479190             442   8e-146   
ref|XP_006474013.1|  PREDICTED: serine carboxypeptidase 24-like         442   8e-146   
ref|XP_004954211.1|  PREDICTED: serine carboxypeptidase 24-like         442   1e-145   
ref|XP_011022271.1|  PREDICTED: serine carboxypeptidase-like 34         441   1e-145   
ref|XP_006354981.1|  PREDICTED: serine carboxypeptidase-like 34-like    441   1e-145   
gb|KFK25190.1|  hypothetical protein AALP_AA8G078600                    442   1e-145   
ref|XP_010910285.1|  PREDICTED: serine carboxypeptidase-like 35         441   2e-145   
ref|XP_010270860.1|  PREDICTED: serine carboxypeptidase-like 33         441   2e-145   
ref|NP_188343.1|  protein serine carboxypeptidase-like 33               441   2e-145   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002529402.1|  serine carboxypeptidase, putative                  441   2e-145   Ricinus communis
ref|XP_011018040.1|  PREDICTED: serine carboxypeptidase 24-like i...    440   3e-145   
dbj|BAA94996.1|  serine carboxypeptidase II-like protein                440   4e-145   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003580170.1|  PREDICTED: serine carboxypeptidase-like 35         441   4e-145   
ref|XP_006287630.1|  hypothetical protein CARUB_v10000841mg             441   4e-145   
ref|XP_009351733.1|  PREDICTED: serine carboxypeptidase-like 34         440   4e-145   
ref|NP_001042932.1|  Os01g0332500                                       441   5e-145   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042933.1|  Os01g0332800                                       440   5e-145   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006285794.1|  hypothetical protein CARUB_v10007268mg             439   5e-145   
gb|EEC70559.1|  hypothetical protein OsI_01719                          440   6e-145   Oryza sativa Indica Group [Indian rice]
ref|XP_006644136.1|  PREDICTED: serine carboxypeptidase-like 33-like    441   7e-145   
ref|XP_007204505.1|  hypothetical protein PRUPE_ppa019210mg             438   7e-145   
emb|CDY40802.1|  BnaC02g41710D                                          441   8e-145   
ref|XP_010505106.1|  PREDICTED: serine carboxypeptidase-like 33         439   1e-144   
ref|XP_011033395.1|  PREDICTED: serine carboxypeptidase 24-like         438   1e-144   
ref|XP_003565735.2|  PREDICTED: serine carboxypeptidase-like 33         439   2e-144   
ref|XP_010432963.1|  PREDICTED: serine carboxypeptidase 24 isofor...    438   2e-144   
ref|XP_004297735.1|  PREDICTED: serine carboxypeptidase-like 34-like    439   2e-144   
ref|XP_010447693.1|  PREDICTED: serine carboxypeptidase 24-like         438   2e-144   
ref|XP_004288721.1|  PREDICTED: serine carboxypeptidase 24-like         437   2e-144   
emb|CAE05642.2|  OSJNBa0038O10.8                                        439   2e-144   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002457777.1|  hypothetical protein SORBIDRAFT_03g013470          439   2e-144   Sorghum bicolor [broomcorn]
ref|XP_010273635.1|  PREDICTED: serine carboxypeptidase 24-like         437   2e-144   
ref|XP_010265559.1|  PREDICTED: serine carboxypeptidase 24-like i...    437   3e-144   
emb|CAH67892.1|  OSIGBa0153E02-OSIGBa0093I20.21                         439   3e-144   Oryza sativa [red rice]
emb|CBI29056.3|  unnamed protein product                                438   3e-144   
ref|XP_006412682.1|  hypothetical protein EUTSA_v10025119mg             437   3e-144   
ref|XP_010655923.1|  PREDICTED: serine carboxypeptidase-like 34         439   3e-144   
ref|XP_008243007.1|  PREDICTED: serine carboxypeptidase 24              437   3e-144   
dbj|BAJ87282.1|  predicted protein                                      438   3e-144   
ref|XP_007131612.1|  hypothetical protein PHAVU_011G027900g             437   4e-144   
ref|XP_003567651.1|  PREDICTED: serine carboxypeptidase-like 33         437   5e-144   
ref|XP_011100722.1|  PREDICTED: serine carboxypeptidase-like 33         437   5e-144   
ref|XP_009131050.1|  PREDICTED: serine carboxypeptidase-like 35         437   7e-144   
ref|XP_010024824.1|  PREDICTED: serine carboxypeptidase-like 33 i...    438   8e-144   
ref|XP_009399563.1|  PREDICTED: serine carboxypeptidase 24-like         436   9e-144   
ref|XP_006841474.1|  hypothetical protein AMTR_s00003p00105430          437   1e-143   
emb|CDY39224.1|  BnaA03g50360D                                          436   1e-143   
ref|XP_002869369.1|  hypothetical protein ARALYDRAFT_491690             436   2e-143   
ref|XP_010480427.1|  PREDICTED: serine carboxypeptidase-like 31         431   2e-143   
gb|AFK37459.1|  unknown                                                 436   2e-143   
ref|XP_006297573.1|  hypothetical protein CARUB_v10013596mg             436   3e-143   
ref|XP_009137947.1|  PREDICTED: serine carboxypeptidase 24              435   4e-143   
dbj|BAJ99451.1|  predicted protein                                      435   4e-143   
ref|XP_007222814.1|  hypothetical protein PRUPE_ppa004242mg             436   5e-143   
ref|XP_010047069.1|  PREDICTED: serine carboxypeptidase 24-like         434   5e-143   
ref|XP_006343642.1|  PREDICTED: serine carboxypeptidase 24-like         434   5e-143   
ref|XP_008394313.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    434   1e-142   
dbj|BAJ86918.1|  predicted protein                                      434   2e-142   
ref|XP_009351730.1|  PREDICTED: serine carboxypeptidase-like 35         434   2e-142   
ref|XP_008340442.1|  PREDICTED: serine carboxypeptidase-like 35         434   2e-142   
gb|EYU39414.1|  hypothetical protein MIMGU_mgv1a005505mg                433   2e-142   
dbj|BAJ85578.1|  predicted protein                                      434   2e-142   
gb|KFK29637.1|  hypothetical protein AALP_AA7G159500                    432   2e-142   
ref|XP_004242603.2|  PREDICTED: serine carboxypeptidase 24 isofor...    433   3e-142   
ref|XP_008443850.1|  PREDICTED: serine carboxypeptidase 24-like i...    432   3e-142   
dbj|BAK04916.1|  predicted protein                                      434   4e-142   
ref|XP_009358427.1|  PREDICTED: serine carboxypeptidase 24              432   4e-142   
emb|CDM82405.1|  unnamed protein product                                433   5e-142   
ref|XP_003549539.1|  PREDICTED: serine carboxypeptidase 24-like         431   6e-142   
emb|CDX78329.1|  BnaA03g02410D                                          432   7e-142   
ref|XP_010024823.1|  PREDICTED: serine carboxypeptidase-like 33 i...    433   7e-142   
ref|XP_009420309.1|  PREDICTED: serine carboxypeptidase 24-like         431   7e-142   
dbj|BAJ92218.1|  predicted protein                                      433   9e-142   
gb|ACN34686.1|  unknown                                                 432   9e-142   
gb|AAK44013.1|AF370198_1  putative serine carboxypeptidase II           431   1e-141   
ref|XP_007131622.1|  hypothetical protein PHAVU_011G028600g             430   2e-141   
ref|XP_007035881.1|  Serine carboxypeptidase-like 33                    431   2e-141   
gb|ACN33679.1|  unknown                                                 432   2e-141   
ref|XP_008461843.1|  PREDICTED: serine carboxypeptidase-like 35         431   2e-141   
ref|XP_009398853.1|  PREDICTED: serine carboxypeptidase-like 35         431   3e-141   
ref|NP_194790.1|  serine carboxypeptidase 24                            430   3e-141   
ref|XP_002448207.1|  hypothetical protein SORBIDRAFT_06g023100          431   4e-141   
ref|XP_010112533.1|  Serine carboxypeptidase-like 34                    430   4e-141   
ref|XP_002440645.1|  hypothetical protein SORBIDRAFT_09g004510          430   5e-141   
ref|NP_001148579.1|  LOC100282195 precursor                             430   6e-141   
ref|XP_010423119.1|  PREDICTED: serine carboxypeptidase-like 35         429   6e-141   
ref|XP_010024821.1|  PREDICTED: serine carboxypeptidase-like 33 i...    431   7e-141   
ref|XP_010024819.1|  PREDICTED: serine carboxypeptidase-like 33 i...    430   9e-141   
gb|AGV54700.1|  serine carboxypeptidase-like 35                         428   1e-140   
ref|XP_003579400.1|  PREDICTED: serine carboxypeptidase-like 34         429   2e-140   
ref|XP_003540633.1|  PREDICTED: serine carboxypeptidase-like 35-like    428   2e-140   
gb|KHN05457.1|  Serine carboxypeptidase-like 35                         427   3e-140   
ref|XP_010067002.1|  PREDICTED: serine carboxypeptidase-like 35         427   3e-140   
gb|KHF99089.1|  Serine carboxypeptidase-like 33                         427   4e-140   
ref|XP_003570294.1|  PREDICTED: serine carboxypeptidase 24              427   6e-140   
emb|CDX69961.1|  BnaA10g23100D                                          427   8e-140   
ref|XP_009122435.1|  PREDICTED: serine carboxypeptidase-like 35 i...    426   1e-139   
gb|EAY87844.1|  hypothetical protein OsI_09265                          426   1e-139   
ref|XP_003519151.1|  PREDICTED: serine carboxypeptidase 24-like i...    425   2e-139   
ref|XP_004164132.1|  PREDICTED: serine carboxypeptidase-like 35-like    426   3e-139   
emb|CDY21527.1|  BnaC09g47650D                                          426   3e-139   
ref|XP_006845845.1|  hypothetical protein AMTR_s00154p00033550          425   3e-139   
ref|NP_001048377.1|  Os02g0794500                                       425   3e-139   
ref|XP_009122437.1|  PREDICTED: serine carboxypeptidase-like 35         425   4e-139   
gb|KCW61333.1|  hypothetical protein EUGRSUZ_H04077                     426   7e-139   
ref|XP_002878712.1|  hypothetical protein ARALYDRAFT_320208             424   8e-139   
emb|CDP02317.1|  unnamed protein product                                424   9e-139   
gb|AAG13597.1|AC051633_13  putative serine carboxypeptidase             422   1e-138   
ref|XP_006294162.1|  hypothetical protein CARUB_v10023155mg             423   2e-138   
gb|KCW51318.1|  hypothetical protein EUGRSUZ_J00874                     422   2e-138   
ref|XP_009596929.1|  PREDICTED: serine carboxypeptidase-like 25         422   2e-138   
sp|O82229.2|SCP23_ARATH  RecName: Full=Putative serine carboxypep...    422   3e-138   
gb|AAG46107.1|AC073166_5  putative serine carboxypeptidase              423   3e-138   
ref|XP_002307165.1|  hypothetical protein POPTR_0005s09440g             422   3e-138   
gb|KHN42831.1|  Serine carboxypeptidase 24                              422   4e-138   
ref|XP_004976291.1|  PREDICTED: serine carboxypeptidase-like 35-like    423   5e-138   
ref|XP_011083949.1|  PREDICTED: serine carboxypeptidase 24-like i...    421   6e-138   
ref|XP_006655013.1|  PREDICTED: serine carboxypeptidase-like 33-like    422   6e-138   
ref|XP_010931784.1|  PREDICTED: serine carboxypeptidase-like 33 i...    420   8e-138   
ref|XP_009378094.1|  PREDICTED: serine carboxypeptidase-like 27         421   8e-138   
ref|XP_004986851.1|  PREDICTED: serine carboxypeptidase-like 34-like    421   8e-138   
ref|XP_009117259.1|  PREDICTED: serine carboxypeptidase-like 22         421   8e-138   
ref|XP_006338367.1|  PREDICTED: serine carboxypeptidase-like 25-like    421   1e-137   
gb|KFK32686.1|  hypothetical protein AALP_AA6G275800                    421   1e-137   
ref|XP_008221064.1|  PREDICTED: serine carboxypeptidase-like 35         423   1e-137   
ref|XP_002280058.1|  PREDICTED: serine carboxypeptidase-like 25         421   1e-137   
emb|CBI21207.3|  unnamed protein product                                421   2e-137   
emb|CDX72256.1|  BnaC07g42780D                                          428   2e-137   
ref|XP_004164131.1|  PREDICTED: serine carboxypeptidase-like 35-like    421   2e-137   
ref|XP_004149734.1|  PREDICTED: serine carboxypeptidase-like 35-like    421   2e-137   
ref|XP_004968686.1|  PREDICTED: serine carboxypeptidase-like 33-l...    421   2e-137   
ref|NP_001150705.1|  LOC100284338 precursor                             421   2e-137   
ref|XP_008443851.1|  PREDICTED: serine carboxypeptidase 24-like i...    420   2e-137   
ref|XP_006662015.1|  PREDICTED: serine carboxypeptidase-like 34-like    420   3e-137   
ref|XP_010669644.1|  PREDICTED: serine carboxypeptidase-like 27         419   3e-137   
ref|XP_002315292.2|  serine carboxypeptidase S10 family protein         419   3e-137   
ref|XP_008668508.1|  PREDICTED: uncharacterized protein LOC100384...    421   3e-137   
ref|XP_009771074.1|  PREDICTED: serine carboxypeptidase-like 25         419   4e-137   
gb|AAC63669.1|  putative serine carboxypeptidase II                     418   4e-137   
ref|XP_004232164.1|  PREDICTED: serine carboxypeptidase-like 25         419   4e-137   
gb|KHG25905.1|  Serine carboxypeptidase-like 27                         419   5e-137   
ref|XP_011031767.1|  PREDICTED: serine carboxypeptidase-like 27         419   5e-137   
ref|NP_179978.2|  serine carboxypeptidase-like 22                       419   6e-137   
ref|XP_011098746.1|  PREDICTED: serine carboxypeptidase-like 25         419   6e-137   
emb|CDX69962.1|  BnaA10g23110D                                          419   7e-137   
ref|XP_002312024.1|  serine carboxypeptidase S10 family protein         418   9e-137   
ref|XP_006349848.1|  PREDICTED: serine carboxypeptidase-like 33-like    418   2e-136   
ref|XP_010429355.1|  PREDICTED: putative serine carboxypeptidase-...    417   2e-136   
ref|XP_003560572.1|  PREDICTED: serine carboxypeptidase-like 34         419   2e-136   
ref|XP_010089631.1|  Serine carboxypeptidase-like 25                    418   2e-136   
ref|XP_007216267.1|  hypothetical protein PRUPE_ppa017321mg             417   3e-136   
gb|KFK25189.1|  hypothetical protein AALP_AA8G078500                    416   3e-136   
gb|KEH21654.1|  serine carboxypeptidase-like protein                    417   4e-136   
ref|XP_010551814.1|  PREDICTED: serine carboxypeptidase-like 25 i...    416   5e-136   
ref|XP_009365880.1|  PREDICTED: serine carboxypeptidase-like 25         417   6e-136   
ref|XP_006408447.1|  hypothetical protein EUTSA_v10020652mg             416   7e-136   
ref|XP_010551812.1|  PREDICTED: serine carboxypeptidase-like 25 i...    416   7e-136   
ref|XP_009141519.1|  PREDICTED: serine carboxypeptidase-like 26         415   7e-136   
ref|XP_006296368.1|  hypothetical protein CARUB_v10025540mg             414   8e-136   
ref|XP_008357779.1|  PREDICTED: serine carboxypeptidase-like 25 i...    416   8e-136   
gb|KDP25725.1|  hypothetical protein JCGZ_23946                         416   8e-136   
gb|KHG16869.1|  Serine carboxypeptidase-like 25                         416   9e-136   
ref|XP_010485446.1|  PREDICTED: serine carboxypeptidase-like 25         416   9e-136   
ref|XP_011040963.1|  PREDICTED: serine carboxypeptidase-like 27         415   1e-135   
ref|XP_010549997.1|  PREDICTED: serine carboxypeptidase-like 25         416   1e-135   
ref|XP_008368824.1|  PREDICTED: serine carboxypeptidase-like 27         415   2e-135   
emb|CDY32091.1|  BnaC04g44750D                                          414   2e-135   
ref|XP_010942075.1|  PREDICTED: serine carboxypeptidase 24 isofor...    416   2e-135   
ref|XP_009592854.1|  PREDICTED: serine carboxypeptidase-like 27         414   2e-135   
ref|XP_008243035.1|  PREDICTED: serine carboxypeptidase II-2            415   2e-135   
ref|XP_010920885.1|  PREDICTED: serine carboxypeptidase-like 27         416   3e-135   
gb|EYU44197.1|  hypothetical protein MIMGU_mgv1a005600mg                415   3e-135   
ref|XP_010032541.1|  PREDICTED: serine carboxypeptidase-like 25         416   4e-135   
ref|XP_008233341.1|  PREDICTED: serine carboxypeptidase-like 27         414   4e-135   
ref|XP_006845380.1|  hypothetical protein AMTR_s00019p00043630          414   4e-135   
ref|XP_010264739.1|  PREDICTED: serine carboxypeptidase-like 27         414   4e-135   
ref|XP_010429353.1|  PREDICTED: serine carboxypeptidase-like 22         414   5e-135   
ref|XP_011076996.1|  PREDICTED: serine carboxypeptidase-like 27         414   6e-135   
emb|CDY40438.1|  BnaA04g20790D                                          413   6e-135   
ref|XP_007202013.1|  hypothetical protein PRUPE_ppa005192mg             414   6e-135   
ref|XP_010417140.1|  PREDICTED: serine carboxypeptidase-like 22         413   8e-135   
ref|XP_006410747.1|  hypothetical protein EUTSA_v10016650mg             413   8e-135   
ref|XP_006850617.1|  hypothetical protein AMTR_s00034p00161680          413   9e-135   
ref|XP_004967063.1|  PREDICTED: serine carboxypeptidase-like 34-like    414   1e-134   
ref|XP_010472396.1|  PREDICTED: serine carboxypeptidase-like 22         413   1e-134   
ref|XP_007143689.1|  hypothetical protein PHAVU_007G093300g             412   1e-134   
ref|XP_006436271.1|  hypothetical protein CICLE_v10031497mg             412   1e-134   
ref|XP_010253608.1|  PREDICTED: serine carboxypeptidase-like 27         412   2e-134   
gb|KDO48447.1|  hypothetical protein CISIN_1g012819mg                   412   2e-134   
ref|XP_009802382.1|  PREDICTED: serine carboxypeptidase-like 27         412   2e-134   
ref|XP_009410601.1|  PREDICTED: serine carboxypeptidase-like 27 i...    412   2e-134   
ref|XP_003556225.1|  PREDICTED: serine carboxypeptidase-like 27-l...    412   3e-134   
ref|XP_008460255.1|  PREDICTED: serine carboxypeptidase-like 25 i...    412   3e-134   
ref|XP_009410600.1|  PREDICTED: serine carboxypeptidase-like 27 i...    412   3e-134   
ref|XP_004304228.1|  PREDICTED: serine carboxypeptidase-like 25-like    412   4e-134   
ref|XP_007032748.1|  Serine carboxypeptidase-like 25 isoform 1          414   4e-134   
ref|XP_006657371.1|  PREDICTED: serine carboxypeptidase-like 34-like    412   4e-134   
ref|XP_006648863.1|  PREDICTED: serine carboxypeptidase-like 34-like    410   5e-134   
gb|KHG08205.1|  Serine carboxypeptidase-like 27                         411   5e-134   
ref|XP_004137284.1|  PREDICTED: serine carboxypeptidase-like 25-like    411   5e-134   
ref|XP_006589433.1|  PREDICTED: serine carboxypeptidase-like 27-like    411   5e-134   
ref|XP_004252933.1|  PREDICTED: serine carboxypeptidase-like 33         412   5e-134   
ref|XP_010463602.1|  PREDICTED: serine carboxypeptidase-like 25         411   6e-134   
ref|XP_008381976.1|  PREDICTED: serine carboxypeptidase-like 27         410   7e-134   
ref|XP_010445019.1|  PREDICTED: serine carboxypeptidase-like 25         411   8e-134   
ref|XP_007043284.1|  Serine carboxypeptidase-like 34, putative          411   9e-134   
ref|XP_009386999.1|  PREDICTED: serine carboxypeptidase-like 27         411   1e-133   
ref|XP_010670278.1|  PREDICTED: serine carboxypeptidase-like 25         410   1e-133   
ref|XP_009147382.1|  PREDICTED: serine carboxypeptidase-like 25         410   1e-133   
gb|KDP27243.1|  hypothetical protein JCGZ_19942                         410   1e-133   
emb|CDO99730.1|  unnamed protein product                                410   1e-133   
ref|XP_009333715.1|  PREDICTED: serine carboxypeptidase-like 27         410   1e-133   
ref|XP_006431295.1|  hypothetical protein CICLE_v10011605mg             411   1e-133   
gb|AAC63668.1|  putative serine carboxypeptidase II                     410   1e-133   
ref|XP_010547376.1|  PREDICTED: serine carboxypeptidase-like 27         410   2e-133   
ref|XP_011009401.1|  PREDICTED: serine carboxypeptidase-like 25 i...    410   2e-133   
ref|XP_007139483.1|  hypothetical protein PHAVU_008G033300g             410   2e-133   
ref|XP_002528403.1|  serine carboxypeptidase, putative                  410   2e-133   
gb|EMT07569.1|  Serine carboxypeptidase-like 34                         410   3e-133   
ref|XP_006482747.1|  PREDICTED: serine carboxypeptidase-like 25-l...    410   3e-133   
ref|XP_006297594.1|  hypothetical protein CARUB_v10013616mg             410   3e-133   
ref|XP_006350225.1|  PREDICTED: serine carboxypeptidase-like 27-like    409   3e-133   
ref|XP_007032749.1|  Serine carboxypeptidase-like 25 isoform 2          409   3e-133   
ref|XP_006653612.1|  PREDICTED: serine carboxypeptidase-like 35-like    410   3e-133   
ref|NP_186860.1|  serine carboxypeptidase-like 25                       409   3e-133   
gb|AAM65698.1|  putative serine carboxypeptidase II                     409   4e-133   
ref|XP_010260044.1|  PREDICTED: serine carboxypeptidase-like 25 i...    409   4e-133   
gb|KHN41581.1|  Serine carboxypeptidase-like 25                         409   4e-133   
ref|XP_009414289.1|  PREDICTED: serine carboxypeptidase-like 27         409   4e-133   
gb|KFK39055.1|  hypothetical protein AALP_AA3G195000                    408   4e-133   
gb|EYU33073.1|  hypothetical protein MIMGU_mgv1a022493mg                406   5e-133   
ref|XP_008446902.1|  PREDICTED: serine carboxypeptidase-like 27         408   7e-133   
ref|XP_008663967.1|  PREDICTED: serine carboxypeptidase-like 34         409   7e-133   
ref|XP_003552566.1|  PREDICTED: serine carboxypeptidase-like 25-l...    408   8e-133   
ref|XP_010323186.1|  PREDICTED: serine carboxypeptidase 24 isofor...    409   9e-133   
ref|NP_001078615.1|  serine carboxypeptidase-like 34                    408   1e-132   
gb|KHN17121.1|  Serine carboxypeptidase-like 27                         407   1e-132   
gb|KFK36474.1|  hypothetical protein AALP_AA4G129400                    407   1e-132   
gb|AFW73854.1|  hypothetical protein ZEAMMB73_784908                    409   1e-132   
ref|XP_003591950.1|  Serine carboxypeptidase-like protein               407   2e-132   
ref|XP_008654490.1|  PREDICTED: hypothetical protein isoform X1         407   2e-132   
ref|XP_002962760.1|  serine carboxypeptidase-like enzyme                408   2e-132   
ref|XP_008357780.1|  PREDICTED: serine carboxypeptidase-like 25 i...    407   2e-132   
ref|XP_002457308.1|  hypothetical protein SORBIDRAFT_03g005370          407   2e-132   
ref|XP_006841720.1|  hypothetical protein AMTR_s00003p00256450          404   3e-132   
emb|CDY43258.1|  BnaC05g48510D                                          407   3e-132   
ref|XP_002274699.1|  PREDICTED: serine carboxypeptidase-like 28         407   3e-132   
emb|CBI31484.3|  unnamed protein product                                407   3e-132   
gb|KHN13554.1|  Serine carboxypeptidase-like 25                         407   3e-132   
ref|XP_004496292.1|  PREDICTED: serine carboxypeptidase-like 27-l...    407   3e-132   
ref|XP_004489523.1|  PREDICTED: serine carboxypeptidase-like 25-like    407   3e-132   
gb|ACA61621.1|  hypothetical protein AP7_B10.1                          406   3e-132   
ref|XP_002306020.2|  serine carboxypeptidase S10 family protein         407   3e-132   
ref|XP_003591947.1|  Serine carboxypeptidase-like protein               406   4e-132   
gb|EYU34325.1|  hypothetical protein MIMGU_mgv1a005646mg                407   4e-132   
ref|XP_003548016.1|  PREDICTED: serine carboxypeptidase-like 27-like    407   5e-132   
gb|KFK37671.1|  hypothetical protein AALP_AA3G013500                    406   5e-132   
gb|EPS67928.1|  hypothetical protein M569_06845                         406   5e-132   
ref|XP_004142401.1|  PREDICTED: serine carboxypeptidase-like 27-like    405   6e-132   
ref|XP_004236634.1|  PREDICTED: serine carboxypeptidase-like 27         405   6e-132   
ref|XP_002884303.1|  hypothetical protein ARALYDRAFT_477440             406   6e-132   
ref|XP_010669643.1|  PREDICTED: serine carboxypeptidase-like 28         406   9e-132   
ref|XP_002881414.1|  hypothetical protein ARALYDRAFT_482550             405   9e-132   
ref|XP_011000079.1|  PREDICTED: serine carboxypeptidase-like 25         405   1e-131   
ref|NP_179979.4|  serine carboxypeptidase-like 23                       404   1e-131   
ref|XP_010067792.1|  PREDICTED: serine carboxypeptidase-like 40         406   1e-131   
ref|XP_002324116.2|  serine carboxypeptidase S10 family protein         405   1e-131   
ref|XP_011079368.1|  PREDICTED: serine carboxypeptidase II-2            405   1e-131   
ref|XP_010908844.1|  PREDICTED: serine carboxypeptidase-like 27         405   2e-131   
ref|XP_004287151.1|  PREDICTED: serine carboxypeptidase-like 29-l...    405   2e-131   
ref|XP_010937832.1|  PREDICTED: serine carboxypeptidase-like 27         404   2e-131   
ref|XP_003530438.1|  PREDICTED: serine carboxypeptidase-like 25-l...    404   3e-131   
ref|NP_181121.1|  serine carboxypeptidase-like 26                       403   5e-131   
ref|XP_002275081.1|  PREDICTED: serine carboxypeptidase II-2            404   5e-131   
ref|XP_004502015.1|  PREDICTED: serine carboxypeptidase-like 40-like    404   6e-131   
ref|XP_007146042.1|  hypothetical protein PHAVU_006G007800g             404   7e-131   
ref|XP_004968264.1|  PREDICTED: serine carboxypeptidase-like 27-like    403   8e-131   
ref|XP_002962533.1|  serine carboxypeptidase-like enzyme                404   8e-131   
ref|XP_006845388.1|  hypothetical protein AMTR_s00019p00053910          403   9e-131   
ref|XP_003566409.1|  PREDICTED: serine carboxypeptidase II-1            403   1e-130   
ref|XP_002457307.1|  hypothetical protein SORBIDRAFT_03g005360          403   1e-130   



>ref|XP_009800559.1| PREDICTED: serine carboxypeptidase-like 31 isoform X1 [Nicotiana 
sylvestris]
Length=474

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/431 (80%), Positives = 377/431 (87%), Gaps = 4/431 (1%)
 Frame = +1

Query  127   HSLSSNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPD  306
             H LS+NK +SD S  S+DLV +LPGQP VNF+HYAG+VTVNENNGR LFYW YE S  P+
Sbjct  27    HQLSNNK-KSDSSLGSQDLVTDLPGQPSVNFRHYAGHVTVNENNGRALFYWFYECSVSPE  85

Query  307   EKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVG  486
             +KPLVLWLNGGPGCSS+GYGATQEIGPFLVDSD   LT+NPYSWNKEANLLFLESP+GVG
Sbjct  86    DKPLVLWLNGGPGCSSVGYGATQEIGPFLVDSDGFGLTLNPYSWNKEANLLFLESPIGVG  145

Query  487   FSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEII  666
             FSYSNTS DY NLGDDF AND Y FLH WFLKFPSY+ RAFYIAGESYAGKYVPELAE+I
Sbjct  146   FSYSNTSGDYHNLGDDFTANDTYTFLHNWFLKFPSYRKRAFYIAGESYAGKYVPELAEVI  205

Query  667   VDRNKDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSND  846
             VD+NKD SLFIDLRGILLGNPET D +DW+G+VDYAWSHAVISDETH+ I  SCDFNS+D
Sbjct  206   VDKNKDSSLFIDLRGILLGNPETCDAEDWKGLVDYAWSHAVISDETHKIISDSCDFNSDD  265

Query  847   TWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGY  1026
             TWSNQ CSQAV+E+LKQYKEIDIYSLYTSVCI     S   +  +F + SKMMPRIM GY
Sbjct  266   TWSNQTCSQAVDEVLKQYKEIDIYSLYTSVCIRDTASSQQQTQVLFDSKSKMMPRIMGGY  325

Query  1027  DPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAA  1206
             DPCLDDY  S+YNR DVQKALHV   HHL++W ICNMS+F  WSDSKESVLPIY KLI A
Sbjct  326   DPCLDDYTASFYNRPDVQKALHV---HHLKNWSICNMSIFGNWSDSKESVLPIYHKLIDA  382

Query  1207  GIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFR  1386
             G++IWVYSGDTDGRVPVLSTRYS+S LGLPITR+WRPWYHQKQVGGWVQEY+GLTFATFR
Sbjct  383   GLKIWVYSGDTDGRVPVLSTRYSLSALGLPITRKWRPWYHQKQVGGWVQEYKGLTFATFR  442

Query  1387  GAGHAVPTFKP  1419
             GAGHAVPTFKP
Sbjct  443   GAGHAVPTFKP  453



>ref|XP_009591367.1| PREDICTED: serine carboxypeptidase-like 31 isoform X1 [Nicotiana 
tomentosiformis]
Length=481

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/431 (79%), Positives = 375/431 (87%), Gaps = 3/431 (1%)
 Frame = +1

Query  127   HSLSSNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPD  306
             H LS+NK+      + +DLV +LPGQP VNF+HYAG+VTVNENNGR LFYW YE S  P+
Sbjct  33    HQLSNNKKSDSSLGSDQDLVTDLPGQPSVNFRHYAGHVTVNENNGRALFYWFYECSIAPE  92

Query  307   EKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVG  486
             +KPLVLWLNGGPGCSS+GYGATQEIGPFLVDSD   LT+NPYSWNKEANLLFLESP+GVG
Sbjct  93    DKPLVLWLNGGPGCSSVGYGATQEIGPFLVDSDGFGLTLNPYSWNKEANLLFLESPIGVG  152

Query  487   FSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEII  666
             FSYSNTS DY NLGDDF AND Y FLH WFLKFPSY+ RAFYIAGESYAGKYVPELAE+I
Sbjct  153   FSYSNTSGDYHNLGDDFTANDTYTFLHNWFLKFPSYRKRAFYIAGESYAGKYVPELAEVI  212

Query  667   VDRNKDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSND  846
             VD+NKD SLFIDL+GILLGNPET D +DW+G+VDYAWSHAVISDETH+TI  SCDFNS+D
Sbjct  213   VDKNKDSSLFIDLKGILLGNPETCDAEDWKGLVDYAWSHAVISDETHKTISDSCDFNSDD  272

Query  847   TWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGY  1026
             TWSNQ CSQAV+E+LKQYKEIDIYSLYTSVCI     S   +  +F + SKMMPRIM GY
Sbjct  273   TWSNQTCSQAVDEVLKQYKEIDIYSLYTSVCIRDTASSQQQTQVIFDSKSKMMPRIMGGY  332

Query  1027  DPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAA  1206
             DPCLDDY  SYYNR DVQKALHV   HHL++W ICNMS+F  WSDSKESVLPIY KLI A
Sbjct  333   DPCLDDYTASYYNRPDVQKALHV---HHLKNWSICNMSIFGNWSDSKESVLPIYHKLIDA  389

Query  1207  GIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFR  1386
             G++IWVYSGDTDGRVPVLSTRYS+S LGLPITR+WRPWYHQKQVGGWVQEY+GLTFATFR
Sbjct  390   GLKIWVYSGDTDGRVPVLSTRYSLSALGLPITRKWRPWYHQKQVGGWVQEYKGLTFATFR  449

Query  1387  GAGHAVPTFKP  1419
             GAGHAVPTFKP
Sbjct  450   GAGHAVPTFKP  460



>emb|CDO99599.1| unnamed protein product [Coffea canephora]
Length=473

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/417 (80%), Positives = 373/417 (89%), Gaps = 1/417 (0%)
 Frame = +1

Query  172   SEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCS  351
             +EDLVANLPGQP+VNF+HYAGYVTVNE NGR LFYW YE+S+LPDEKPLVLWLNGGPGCS
Sbjct  37    TEDLVANLPGQPMVNFRHYAGYVTVNEQNGRALFYWFYEASALPDEKPLVLWLNGGPGCS  96

Query  352   SIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             S+GYGATQEIGPFLVD+D  +L  NPYSWN EANLLFLESPVGVGFSYSNTSTDY N+GD
Sbjct  97    SVGYGATQEIGPFLVDTDGHALKFNPYSWNTEANLLFLESPVGVGFSYSNTSTDYDNIGD  156

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSLFIDLRG  711
             DF A DAY FLH+WFLKFPSY+ R FYIAGESYAGKYVPELAE+I D NK+ SLFIDL G
Sbjct  157   DFTAQDAYIFLHKWFLKFPSYRKRTFYIAGESYAGKYVPELAELIHDENKNSSLFIDLGG  216

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELL  891
             ILLGNPET D +DW+G+VDYAWSHAVISDETH+ I  SCDF SNDTWSN+ CSQAV+E+L
Sbjct  217   ILLGNPETCDAEDWKGLVDYAWSHAVISDETHKIIKESCDFYSNDTWSNEACSQAVDEVL  276

Query  892   KQYKEIDIYSLYTSVCIDSLTGSGDNSTPV-FKTTSKMMPRIMAGYDPCLDDYAKSYYNR  1068
             KQYKEIDIYSLYTS+CI + T S D S  V F++TSK+MPRI+ GYDPCLDDYA+ YYNR
Sbjct  277   KQYKEIDIYSLYTSICIGNSTNSEDKSMQVMFRSTSKLMPRIIGGYDPCLDDYARYYYNR  336

Query  1069  LDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGR  1248
              DVQKALHVS G  LR W ICNM++F+GWSDSKES+LPIYKKLIA+G+RIWVYSGDTDGR
Sbjct  337   ADVQKALHVSDGQRLRGWSICNMTIFNGWSDSKESMLPIYKKLIASGLRIWVYSGDTDGR  396

Query  1249  VPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             VPVLSTRYS+S++GL ITR WRPWYHQKQVGGW+QEYEG+TFATFRGAGHAVP FKP
Sbjct  397   VPVLSTRYSLSSIGLRITRAWRPWYHQKQVGGWLQEYEGVTFATFRGAGHAVPIFKP  453



>ref|XP_006347176.1| PREDICTED: serine carboxypeptidase-like 31-like [Solanum tuberosum]
Length=488

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/436 (78%), Positives = 375/436 (86%), Gaps = 5/436 (1%)
 Frame = +1

Query  127   HSLSSNKEQSDQSWA---SEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSS  297
             H LS+N +    SW    +EDLV NLPGQP VNFKHYAG+VTVNE NGR LFYW YE S 
Sbjct  32    HELSNNNKPDSSSWDNSYTEDLVTNLPGQPSVNFKHYAGHVTVNEKNGRALFYWFYECSI  91

Query  298   LPDEKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPV  477
              P +KPLVLWLNGGPGCSS+GYGATQEIGPFLVD D   L +NPYSWNKEANLLFLESP+
Sbjct  92    DPQDKPLVLWLNGGPGCSSVGYGATQEIGPFLVDVDGFGLQLNPYSWNKEANLLFLESPI  151

Query  478   GVGFSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELA  657
             GVGFSYSNTS DY N+GDDF AND Y FLH+W LKFPSYK R FYIAGESYAGKYVPELA
Sbjct  152   GVGFSYSNTSDDYHNIGDDFTANDTYTFLHKWLLKFPSYKKRPFYIAGESYAGKYVPELA  211

Query  658   EIIVDRNKDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFN  837
             E+IVD+NKDPSLFIDLRGILLGNPET D +DW+G+VDYAWSHAVISDETH+TI  +C+F+
Sbjct  212   EVIVDKNKDPSLFIDLRGILLGNPETCDAEDWKGLVDYAWSHAVISDETHKTISDTCNFH  271

Query  838   SNDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCI-DSLTGSGDNSTPVFKTTSKMMPRI  1014
             S+DTWSNQ CS+AV+E+LKQYKEIDIYSLYTSVCI D+ T     +  +F T SKMMPRI
Sbjct  272   SDDTWSNQTCSEAVDEVLKQYKEIDIYSLYTSVCIRDTATTQQQTTQVLFDTKSKMMPRI  331

Query  1015  MAGYDPCLDDYAKSYYNRLDVQKALHV-SSGHHLRDWRICNMSVFDGWSDSKESVLPIYK  1191
             M GYDPCLDDY  SYYNRLDVQKALHV S G HL++W ICNM++F  WSDSKESVLPIY 
Sbjct  332   MGGYDPCLDDYTSSYYNRLDVQKALHVISDGQHLKNWSICNMTIFGNWSDSKESVLPIYH  391

Query  1192  KLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLT  1371
             KLI AG++IWVYSGDTDGRVPVLSTRYS+S LGLPIT +WRPWYHQKQVGGWV+EY+GLT
Sbjct  392   KLINAGLKIWVYSGDTDGRVPVLSTRYSLSALGLPITTKWRPWYHQKQVGGWVEEYKGLT  451

Query  1372  FATFRGAGHAVPTFKP  1419
             FATFRGAGHAVPTFKP
Sbjct  452   FATFRGAGHAVPTFKP  467



>ref|XP_009800560.1| PREDICTED: serine carboxypeptidase-like 31 isoform X2 [Nicotiana 
sylvestris]
Length=467

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/431 (78%), Positives = 370/431 (86%), Gaps = 11/431 (3%)
 Frame = +1

Query  127   HSLSSNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPD  306
             H LS+NK +SD S  S+DLV +LPGQP VNF+HYAG+VTVNENNGR LFYW YE S  P+
Sbjct  27    HQLSNNK-KSDSSLGSQDLVTDLPGQPSVNFRHYAGHVTVNENNGRALFYWFYECSVSPE  85

Query  307   EKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVG  486
             +KPLVLWLNGGPGCSS+GYGATQEIGPFLVDSD   LT+NPYSWNKE       SP+GVG
Sbjct  86    DKPLVLWLNGGPGCSSVGYGATQEIGPFLVDSDGFGLTLNPYSWNKE-------SPIGVG  138

Query  487   FSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEII  666
             FSYSNTS DY NLGDDF AND Y FLH WFLKFPSY+ RAFYIAGESYAGKYVPELAE+I
Sbjct  139   FSYSNTSGDYHNLGDDFTANDTYTFLHNWFLKFPSYRKRAFYIAGESYAGKYVPELAEVI  198

Query  667   VDRNKDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSND  846
             VD+NKD SLFIDLRGILLGNPET D +DW+G+VDYAWSHAVISDETH+ I  SCDFNS+D
Sbjct  199   VDKNKDSSLFIDLRGILLGNPETCDAEDWKGLVDYAWSHAVISDETHKIISDSCDFNSDD  258

Query  847   TWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGY  1026
             TWSNQ CSQAV+E+LKQYKEIDIYSLYTSVCI     S   +  +F + SKMMPRIM GY
Sbjct  259   TWSNQTCSQAVDEVLKQYKEIDIYSLYTSVCIRDTASSQQQTQVLFDSKSKMMPRIMGGY  318

Query  1027  DPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAA  1206
             DPCLDDY  S+YNR DVQKALHV   HHL++W ICNMS+F  WSDSKESVLPIY KLI A
Sbjct  319   DPCLDDYTASFYNRPDVQKALHV---HHLKNWSICNMSIFGNWSDSKESVLPIYHKLIDA  375

Query  1207  GIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFR  1386
             G++IWVYSGDTDGRVPVLSTRYS+S LGLPITR+WRPWYHQKQVGGWVQEY+GLTFATFR
Sbjct  376   GLKIWVYSGDTDGRVPVLSTRYSLSALGLPITRKWRPWYHQKQVGGWVQEYKGLTFATFR  435

Query  1387  GAGHAVPTFKP  1419
             GAGHAVPTFKP
Sbjct  436   GAGHAVPTFKP  446



>ref|XP_009591368.1| PREDICTED: serine carboxypeptidase-like 31 isoform X2 [Nicotiana 
tomentosiformis]
Length=474

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/431 (77%), Positives = 368/431 (85%), Gaps = 10/431 (2%)
 Frame = +1

Query  127   HSLSSNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPD  306
             H LS+NK+      + +DLV +LPGQP VNF+HYAG+VTVNENNGR LFYW YE S  P+
Sbjct  33    HQLSNNKKSDSSLGSDQDLVTDLPGQPSVNFRHYAGHVTVNENNGRALFYWFYECSIAPE  92

Query  307   EKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVG  486
             +KPLVLWLNGGPGCSS+GYGATQEIGPFLVDSD   LT+NPYSWNKE       SP+GVG
Sbjct  93    DKPLVLWLNGGPGCSSVGYGATQEIGPFLVDSDGFGLTLNPYSWNKE-------SPIGVG  145

Query  487   FSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEII  666
             FSYSNTS DY NLGDDF AND Y FLH WFLKFPSY+ RAFYIAGESYAGKYVPELAE+I
Sbjct  146   FSYSNTSGDYHNLGDDFTANDTYTFLHNWFLKFPSYRKRAFYIAGESYAGKYVPELAEVI  205

Query  667   VDRNKDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSND  846
             VD+NKD SLFIDL+GILLGNPET D +DW+G+VDYAWSHAVISDETH+TI  SCDFNS+D
Sbjct  206   VDKNKDSSLFIDLKGILLGNPETCDAEDWKGLVDYAWSHAVISDETHKTISDSCDFNSDD  265

Query  847   TWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGY  1026
             TWSNQ CSQAV+E+LKQYKEIDIYSLYTSVCI     S   +  +F + SKMMPRIM GY
Sbjct  266   TWSNQTCSQAVDEVLKQYKEIDIYSLYTSVCIRDTASSQQQTQVIFDSKSKMMPRIMGGY  325

Query  1027  DPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAA  1206
             DPCLDDY  SYYNR DVQKALHV   HHL++W ICNMS+F  WSDSKESVLPIY KLI A
Sbjct  326   DPCLDDYTASYYNRPDVQKALHV---HHLKNWSICNMSIFGNWSDSKESVLPIYHKLIDA  382

Query  1207  GIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFR  1386
             G++IWVYSGDTDGRVPVLSTRYS+S LGLPITR+WRPWYHQKQVGGWVQEY+GLTFATFR
Sbjct  383   GLKIWVYSGDTDGRVPVLSTRYSLSALGLPITRKWRPWYHQKQVGGWVQEYKGLTFATFR  442

Query  1387  GAGHAVPTFKP  1419
             GAGHAVPTFKP
Sbjct  443   GAGHAVPTFKP  453



>ref|XP_010316720.1| PREDICTED: serine carboxypeptidase-like 31 [Solanum lycopersicum]
Length=486

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/436 (77%), Positives = 376/436 (86%), Gaps = 5/436 (1%)
 Frame = +1

Query  127   HSLSSNKEQSDQSWA---SEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSS  297
             H LS+N +    S     +EDLV NLPGQP VNFKHYAG+VTVNEN GR LFYW YE S 
Sbjct  30    HELSNNNKPDSSSRVGSYTEDLVTNLPGQPSVNFKHYAGHVTVNENKGRALFYWFYECSI  89

Query  298   LPDEKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPV  477
              P +KPLVLWLNGGPGCSS+GYGATQEIGPFLVD D   L +NPYSWNKEANLLFLESP+
Sbjct  90    DPQDKPLVLWLNGGPGCSSVGYGATQEIGPFLVDFDGFGLKLNPYSWNKEANLLFLESPI  149

Query  478   GVGFSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELA  657
             GVGFSYSNTS DY N+GDDF AND Y FLH+W LKFPSYK R FYIAGESYAGKYVPELA
Sbjct  150   GVGFSYSNTSGDYYNIGDDFTANDTYTFLHKWLLKFPSYKKRPFYIAGESYAGKYVPELA  209

Query  658   EIIVDRNKDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFN  837
             E+IVD+NKDPSLFIDL+GILLGNPET D +DW+G+VDYAWSHAVISDETH+TI  +C+F+
Sbjct  210   EVIVDKNKDPSLFIDLKGILLGNPETCDAEDWKGLVDYAWSHAVISDETHKTISDTCNFH  269

Query  838   SNDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCI-DSLTGSGDNSTPVFKTTSKMMPRI  1014
             S+DTWSNQ CS+AV+E+LKQYKEIDIYSLYTSVCI D+ T     +  +F T SKMMPRI
Sbjct  270   SDDTWSNQTCSEAVDEVLKQYKEIDIYSLYTSVCIRDTATSQQQTTQVLFDTKSKMMPRI  329

Query  1015  MAGYDPCLDDYAKSYYNRLDVQKALHV-SSGHHLRDWRICNMSVFDGWSDSKESVLPIYK  1191
             M GYDPCLDDY  SY+NRLDVQKALHV S G HL++W ICNM++FD WSDSKESVLPIY+
Sbjct  330   MGGYDPCLDDYTSSYFNRLDVQKALHVISDGQHLKNWSICNMTIFDNWSDSKESVLPIYR  389

Query  1192  KLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLT  1371
             KLI AG++IWVYSGDTDGRVPVLSTRYS+S LGLPIT +WRPWYHQKQVGGWV+EY+GLT
Sbjct  390   KLINAGLKIWVYSGDTDGRVPVLSTRYSLSALGLPITTKWRPWYHQKQVGGWVEEYKGLT  449

Query  1372  FATFRGAGHAVPTFKP  1419
             FATFRGAGHAVPTFKP
Sbjct  450   FATFRGAGHAVPTFKP  465



>gb|EYU27945.1| hypothetical protein MIMGU_mgv1a005674mg [Erythranthe guttata]
Length=475

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/435 (77%), Positives = 376/435 (86%), Gaps = 6/435 (1%)
 Frame = +1

Query  121   ARHSLSSNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSL  300
             AR+   SN+++SD     EDLV  LPGQP VNF+HYAG+VTV+E NGR LFYW YE++SL
Sbjct  25    ARYWHWSNEKKSD----FEDLVTGLPGQPSVNFRHYAGFVTVDEKNGRSLFYWFYEATSL  80

Query  301   PDEKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVG  480
             PDEKPLVLWLNGGPGCSS+GYGATQEIGPFLVD++   L  N ++WN EANLLFLESP+G
Sbjct  81    PDEKPLVLWLNGGPGCSSVGYGATQEIGPFLVDANGHGLKFNSFAWNTEANLLFLESPIG  140

Query  481   VGFSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAE  660
             VGFSYSNTS DY NLGDDF ANDAY FLH+WFLKFPSY+TR FYIAGESYAGKYVPELAE
Sbjct  141   VGFSYSNTSGDYDNLGDDFTANDAYVFLHKWFLKFPSYRTRTFYIAGESYAGKYVPELAE  200

Query  661   IIVDRNKDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNS  840
             +I D+N +PSLFIDLRGILLGNPET D +DW+GMVDYAWSHAV+SDETH+TI+ SC+F +
Sbjct  201   VIHDKNNNPSLFIDLRGILLGNPETYDAEDWKGMVDYAWSHAVVSDETHKTIVQSCNFYN  260

Query  841   NDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVF--KTTSKMMPRI  1014
             +DTWSN DC+  V ELL QYKEIDIYSLYTSVCI + + S D S+ +   K +SKMMPR+
Sbjct  261   DDTWSNTDCTSGVEELLSQYKEIDIYSLYTSVCIFNSSSSQDKSSTLVRAKGSSKMMPRV  320

Query  1015  MAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKK  1194
             M GYDPCLDDYAKSYYNR DVQKALHV  G  LR+W ICNM+VFDGWSDSK SVLPIYKK
Sbjct  321   MGGYDPCLDDYAKSYYNRPDVQKALHVGDGTSLRNWTICNMTVFDGWSDSKGSVLPIYKK  380

Query  1195  LIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTF  1374
             LIAAG+RIWVYSGDTDGRVPVLSTRYS+S+LGLPI + WRPWYHQKQVGGWVQEY GLTF
Sbjct  381   LIAAGLRIWVYSGDTDGRVPVLSTRYSLSSLGLPIKKAWRPWYHQKQVGGWVQEYYGLTF  440

Query  1375  ATFRGAGHAVPTFKP  1419
             ATFRGAGHAVP FKP
Sbjct  441   ATFRGAGHAVPIFKP  455



>ref|XP_008224993.1| PREDICTED: serine carboxypeptidase-like 31 [Prunus mume]
Length=484

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/428 (75%), Positives = 365/428 (85%), Gaps = 1/428 (0%)
 Frame = +1

Query  139   SNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPL  318
             SN E+   S  ++DLV NLPGQP V+FKHYAGYVTVN+ NGR LFYW YE+++ PD KPL
Sbjct  32    SNSEKLINSLGTQDLVTNLPGQPAVDFKHYAGYVTVNQTNGRALFYWFYEAATNPDAKPL  91

Query  319   VLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYS  498
             VLWLNGGPGCSS+GYGATQEIGPF+VD+D   +  N YSWNKEAN+LFLESPVGVGFSYS
Sbjct  92    VLWLNGGPGCSSVGYGATQEIGPFIVDTDGHGIRFNNYSWNKEANMLFLESPVGVGFSYS  151

Query  499   NTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRN  678
             NT++DY NLGD F ANDAY FLH+WFLKFPSY+TR FYIAGESYAGKYVPELAE+I D+N
Sbjct  152   NTTSDYVNLGDVFTANDAYTFLHKWFLKFPSYRTRTFYIAGESYAGKYVPELAEVIYDKN  211

Query  679   KDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSN  858
             KDPSL IDL+GILLGNPETSD +DW+G+VDYAWSHAV+SDETH+ I  SCDF+ NDTWSN
Sbjct  212   KDPSLHIDLKGILLGNPETSDAEDWRGLVDYAWSHAVVSDETHKIIRESCDFDRNDTWSN  271

Query  859   QDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPV-FKTTSKMMPRIMAGYDPC  1035
             +DC+ AV+E+LKQYKEIDIYSLYTSVCI     S D S  V  K TS MMPRIM GYDPC
Sbjct  272   KDCTLAVDEVLKQYKEIDIYSLYTSVCIGDTASSDDGSMQVMMKRTSTMMPRIMGGYDPC  331

Query  1036  LDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIR  1215
             LD+Y K++YNR +VQKALHVS G  L++W ICN  +F+ W+ SK SVLP+YKKLIAAG+R
Sbjct  332   LDEYTKTFYNRPEVQKALHVSDGFRLKNWSICNNKIFEDWAYSKPSVLPVYKKLIAAGLR  391

Query  1216  IWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAG  1395
             IWVYSGDTDGRVPVLSTRYS+S LGLPI + WRPWYHQKQV GW QEYEGLTFATFRGAG
Sbjct  392   IWVYSGDTDGRVPVLSTRYSLSALGLPINKAWRPWYHQKQVSGWFQEYEGLTFATFRGAG  451

Query  1396  HAVPTFKP  1419
             HAVP FKP
Sbjct  452   HAVPCFKP  459



>ref|XP_010645362.1| PREDICTED: serine carboxypeptidase-like 31 [Vitis vinifera]
Length=481

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/433 (74%), Positives = 363/433 (84%), Gaps = 1/433 (0%)
 Frame = +1

Query  124   RHSLSSNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLP  303
             RHS     ++   S  +EDLV +LPGQP V+F+HYAGYVTVNE NGR LFYW YE+++ P
Sbjct  29    RHSRQWTNDKGLNSLGNEDLVTDLPGQPAVDFRHYAGYVTVNEENGRALFYWFYEATTQP  88

Query  304   DEKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGV  483
             +EKPLVLWLNGGPGCSS+GYGATQEIGPF+VD+D   L  NPYSWN+EAN+LFLESPVGV
Sbjct  89    NEKPLVLWLNGGPGCSSVGYGATQEIGPFIVDTDGHGLKFNPYSWNREANMLFLESPVGV  148

Query  484   GFSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEI  663
             GFSYSNT++DY  LGDDF AND YAFLH+WFLKFPSY+ R FYIAGESYAGKYVPELAE+
Sbjct  149   GFSYSNTTSDYEKLGDDFTANDNYAFLHKWFLKFPSYRKRIFYIAGESYAGKYVPELAEV  208

Query  664   IVDRNKDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSN  843
             I D+NKDPSLFIDLRGILLGNPET D  DW+G+VDYAWSHAV+SDETH+ I  +CDF S 
Sbjct  209   IYDKNKDPSLFIDLRGILLGNPETCDADDWRGLVDYAWSHAVVSDETHKIIRENCDFYSE  268

Query  844   DTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPV-FKTTSKMMPRIMA  1020
             D WSN +CS AV E+L QYK IDIYSLYTSVC  +   S DNS  V FK TS+MMPRIM 
Sbjct  269   DPWSNDNCSDAVGEVLDQYKRIDIYSLYTSVCTKTSKRSDDNSMQVLFKRTSRMMPRIMG  328

Query  1021  GYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLI  1200
             GYDPCLDDYAK++YNR DVQKALHVS GH +++W ICN  +F  WS S+ SVLPIY+KLI
Sbjct  329   GYDPCLDDYAKAFYNRADVQKALHVSDGHRVKNWSICNADIFGNWSQSQPSVLPIYRKLI  388

Query  1201  AAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFAT  1380
             A G+RIWVYSGDTDGRVPVLSTRY +STL LPITR WRPWYHQ+QV GW QEY+GLTFAT
Sbjct  389   AGGLRIWVYSGDTDGRVPVLSTRYCLSTLKLPITRAWRPWYHQQQVSGWFQEYKGLTFAT  448

Query  1381  FRGAGHAVPTFKP  1419
             FRGAGHAVP FKP
Sbjct  449   FRGAGHAVPVFKP  461



>ref|XP_011047847.1| PREDICTED: serine carboxypeptidase-like 31 [Populus euphratica]
Length=475

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/425 (76%), Positives = 365/425 (86%), Gaps = 1/425 (0%)
 Frame = +1

Query  148   EQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLW  327
             + S Q    E LV NLPGQP VNFKHYAGY+TVNE NGR LFYW YE+++ PDEK LVLW
Sbjct  31    QLSGQPLVDEHLVTNLPGQPDVNFKHYAGYLTVNEQNGRALFYWFYEATTHPDEKALVLW  90

Query  328   LNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTS  507
             LNGGPGCSS+GYGATQEIGPF+VD++   L  NPYSWN EAN+LFLESPVGVGFSYSNT+
Sbjct  91    LNGGPGCSSVGYGATQEIGPFIVDTNGHGLKYNPYSWNTEANMLFLESPVGVGFSYSNTT  150

Query  508   TDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDP  687
             +DY  LGD+F ANDAYAFLH+WFL FPSY++RAFYIAGESYAGKYVPELAE+I D+N D 
Sbjct  151   SDYNILGDEFTANDAYAFLHKWFLLFPSYRSRAFYIAGESYAGKYVPELAELINDKNNDT  210

Query  688   SLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDC  867
             SL+IDL GILLGNPETSD  DW+GMVDYAWSHAVISDETH+ I  SC+F+SNDTWSN DC
Sbjct  211   SLYIDLNGILLGNPETSDADDWRGMVDYAWSHAVISDETHKIIRQSCNFDSNDTWSNDDC  270

Query  868   SQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPV-FKTTSKMMPRIMAGYDPCLDD  1044
             ++AV+ELLKQYKEIDIYSLYTSVCI     S D  T + F+ +SKMMPRIM GYDPCLD+
Sbjct  271   AEAVDELLKQYKEIDIYSLYTSVCIGDSASSDDKFTQIMFRRSSKMMPRIMGGYDPCLDE  330

Query  1045  YAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWV  1224
             YAK++YNR DVQKALHVS GHHL++W ICN  +F  W +S+ SVLPIYKKLI AG+RIWV
Sbjct  331   YAKAFYNRPDVQKALHVSDGHHLKNWSICNAKIFVEWLESRPSVLPIYKKLITAGLRIWV  390

Query  1225  YSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAV  1404
             YSGDTDGRVPVLSTRYS+S+LGLPIT+ WRPWYHQK+V GW QEYEGLTFATFRGAGHAV
Sbjct  391   YSGDTDGRVPVLSTRYSLSSLGLPITKAWRPWYHQKEVSGWFQEYEGLTFATFRGAGHAV  450

Query  1405  PTFKP  1419
             P FKP
Sbjct  451   PVFKP  455



>emb|CBI18754.3| unnamed protein product [Vitis vinifera]
Length=500

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/433 (74%), Positives = 363/433 (84%), Gaps = 1/433 (0%)
 Frame = +1

Query  124   RHSLSSNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLP  303
             RHS     ++   S  +EDLV +LPGQP V+F+HYAGYVTVNE NGR LFYW YE+++ P
Sbjct  48    RHSRQWTNDKGLNSLGNEDLVTDLPGQPAVDFRHYAGYVTVNEENGRALFYWFYEATTQP  107

Query  304   DEKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGV  483
             +EKPLVLWLNGGPGCSS+GYGATQEIGPF+VD+D   L  NPYSWN+EAN+LFLESPVGV
Sbjct  108   NEKPLVLWLNGGPGCSSVGYGATQEIGPFIVDTDGHGLKFNPYSWNREANMLFLESPVGV  167

Query  484   GFSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEI  663
             GFSYSNT++DY  LGDDF AND YAFLH+WFLKFPSY+ R FYIAGESYAGKYVPELAE+
Sbjct  168   GFSYSNTTSDYEKLGDDFTANDNYAFLHKWFLKFPSYRKRIFYIAGESYAGKYVPELAEV  227

Query  664   IVDRNKDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSN  843
             I D+NKDPSLFIDLRGILLGNPET D  DW+G+VDYAWSHAV+SDETH+ I  +CDF S 
Sbjct  228   IYDKNKDPSLFIDLRGILLGNPETCDADDWRGLVDYAWSHAVVSDETHKIIRENCDFYSE  287

Query  844   DTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPV-FKTTSKMMPRIMA  1020
             D WSN +CS AV E+L QYK IDIYSLYTSVC  +   S DNS  V FK TS+MMPRIM 
Sbjct  288   DPWSNDNCSDAVGEVLDQYKRIDIYSLYTSVCTKTSKRSDDNSMQVLFKRTSRMMPRIMG  347

Query  1021  GYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLI  1200
             GYDPCLDDYAK++YNR DVQKALHVS GH +++W ICN  +F  WS S+ SVLPIY+KLI
Sbjct  348   GYDPCLDDYAKAFYNRADVQKALHVSDGHRVKNWSICNADIFGNWSQSQPSVLPIYRKLI  407

Query  1201  AAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFAT  1380
             A G+RIWVYSGDTDGRVPVLSTRY +STL LPITR WRPWYHQ+QV GW QEY+GLTFAT
Sbjct  408   AGGLRIWVYSGDTDGRVPVLSTRYCLSTLKLPITRAWRPWYHQQQVSGWFQEYKGLTFAT  467

Query  1381  FRGAGHAVPTFKP  1419
             FRGAGHAVP FKP
Sbjct  468   FRGAGHAVPVFKP  480



>ref|XP_011096266.1| PREDICTED: serine carboxypeptidase-like 31 [Sesamum indicum]
Length=476

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/434 (74%), Positives = 374/434 (86%), Gaps = 2/434 (0%)
 Frame = +1

Query  121   ARHSLSSNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSL  300
             AR+   SN+++S+   A+EDLV +LPGQP V+F+HYAGYVTVNE NGR LFYW YE+++L
Sbjct  23    ARYWHWSNEKKSNFE-AAEDLVTSLPGQPRVSFRHYAGYVTVNEKNGRALFYWFYEATTL  81

Query  301   PDEKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVG  480
              D+KPLVLWLNGGPGCSS+GYGATQEIGPFLVD D   L  N +SWN EANLLFLESP+G
Sbjct  82    ADQKPLVLWLNGGPGCSSVGYGATQEIGPFLVDLDGRGLKFNSFSWNTEANLLFLESPIG  141

Query  481   VGFSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAE  660
             VGFSY+NTS DY  LGDDF ANDAY FLH+WFLKFPSY+TR FYIAGESYAGKYVPELAE
Sbjct  142   VGFSYTNTSGDYDGLGDDFTANDAYGFLHKWFLKFPSYRTRIFYIAGESYAGKYVPELAE  201

Query  661   IIVDRNKDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNS  840
             II D+NKDPSLFIDLRGILLGNPET D +DW+G+VDYAWSHA++SDETH+TII +CDF S
Sbjct  202   IIHDKNKDPSLFIDLRGILLGNPETHDAEDWRGIVDYAWSHAIVSDETHKTIIRTCDFYS  261

Query  841   NDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPV-FKTTSKMMPRIM  1017
             +D W+N DC+ AV EL KQYKEID+YSLYT++C  + + S D ST    +++S MMPR+M
Sbjct  262   DDPWNNTDCNTAVEELFKQYKEIDMYSLYTTLCQSNSSASADMSTLFRARSSSNMMPRLM  321

Query  1018  AGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKL  1197
              GYDPCL+ YA +YYNRLDVQKALHV+ G  LR+W ICNM++F GWSDS+ SVLPIYKKL
Sbjct  322   GGYDPCLEHYANTYYNRLDVQKALHVADGTSLRNWTICNMTIFYGWSDSRTSVLPIYKKL  381

Query  1198  IAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFA  1377
             IAAG+RIWVYSGDTDGRVPVLSTRYS+S+LGLPI + WRPWYHQKQVGGW+QEY GLTFA
Sbjct  382   IAAGLRIWVYSGDTDGRVPVLSTRYSLSSLGLPIKKAWRPWYHQKQVGGWIQEYYGLTFA  441

Query  1378  TFRGAGHAVPTFKP  1419
             TFRGAGH VPTFKP
Sbjct  442   TFRGAGHDVPTFKP  455



>ref|XP_010278297.1| PREDICTED: serine carboxypeptidase-like 31 [Nelumbo nucifera]
Length=482

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/419 (77%), Positives = 365/419 (87%), Gaps = 2/419 (0%)
 Frame = +1

Query  169   ASEDLVANLPGQPI-VNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPG  345
             AS+DLV +LPGQP  V F+HYAGYVTVNE NGR LFYW YE+S  PDEKPLVLWLNGGPG
Sbjct  39    ASQDLVTDLPGQPADVGFRHYAGYVTVNEKNGRALFYWFYEASVRPDEKPLVLWLNGGPG  98

Query  346   CSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANL  525
             CSS+GYGATQEIGPF+VD+D   + +NPYSWNKEAN+LFLESPVGVGFSYSNT+TDY  L
Sbjct  99    CSSVGYGATQEIGPFIVDTDGRGIKLNPYSWNKEANMLFLESPVGVGFSYSNTTTDYKIL  158

Query  526   GDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSLFIDL  705
             GDDF A D +AFLHEWFLKFPSY+ R+FYIAGESYAGKYVPELAE+I D NKDP L+IDL
Sbjct  159   GDDFTAKDTFAFLHEWFLKFPSYRRRSFYIAGESYAGKYVPELAELIYDMNKDPHLYIDL  218

Query  706   RGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNE  885
             +G LLGNPETSD  DW+G+VDYAWSHAV+SDETH+ I  +CDF+SN+TWSN +CSQAV+E
Sbjct  219   KGFLLGNPETSDADDWRGLVDYAWSHAVVSDETHKIIKETCDFDSNNTWSNDNCSQAVDE  278

Query  886   LLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPV-FKTTSKMMPRIMAGYDPCLDDYAKSYY  1062
             +LKQY+EIDIYSLYTSVC +  TGS DNS  V FK  SKMMPRIM GYDPCLD YA+++Y
Sbjct  279   VLKQYREIDIYSLYTSVCKNISTGSDDNSVQVMFKPMSKMMPRIMGGYDPCLDKYAENFY  338

Query  1063  NRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTD  1242
             NR DVQKALHVS GH L++W ICN  +F GWSDSK SVLPIYKKLI AG+RIWVYSGDTD
Sbjct  339   NRPDVQKALHVSDGHILKNWSICNNDIFIGWSDSKPSVLPIYKKLIGAGLRIWVYSGDTD  398

Query  1243  GRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             GRVPVLSTRYS+ +LGLPITR WRPWYH+K+V GW QEY+GLTFATFRGAGHAVP FKP
Sbjct  399   GRVPVLSTRYSLISLGLPITRAWRPWYHEKEVSGWFQEYKGLTFATFRGAGHAVPVFKP  457



>ref|XP_009379538.1| PREDICTED: serine carboxypeptidase-like 31 [Pyrus x bretschneideri]
Length=480

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/434 (74%), Positives = 368/434 (85%), Gaps = 1/434 (0%)
 Frame = +1

Query  121   ARHSLSSNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSL  300
              R   +S ++ ++ S  ++DLV NLPGQP  +FKHYAGYVTVNE NGR LFYW YE++S 
Sbjct  26    GRTKRASTEKLNNNSLGTQDLVTNLPGQPAADFKHYAGYVTVNETNGRALFYWFYEAASN  85

Query  301   PDEKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVG  480
             PD KPLVLWLNGGPGCSS+GYGATQEIGPF+VD+D S +  N YSWNKEAN+LFLESPVG
Sbjct  86    PDGKPLVLWLNGGPGCSSVGYGATQEIGPFIVDTDGSGIKSNNYSWNKEANMLFLESPVG  145

Query  481   VGFSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAE  660
             VGFSYSNT++DY NLGD+F ANDAY FLH+W+LKFP+Y+TR FYI+GESYAGKYVPELAE
Sbjct  146   VGFSYSNTTSDYDNLGDEFTANDAYNFLHKWYLKFPTYRTRTFYISGESYAGKYVPELAE  205

Query  661   IIVDRNKDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNS  840
             +I D+N DPSL IDL+GILLGNPETSD  DW+G+VDYAWSHAVISDETH+ I  SCDF+ 
Sbjct  206   LIYDKNNDPSLHIDLKGILLGNPETSDADDWRGLVDYAWSHAVISDETHKIIRESCDFDR  265

Query  841   NDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPV-FKTTSKMMPRIM  1017
             NDTWSN+DC+ AV+E+LKQYKEIDIYSLYTSVCI     S D S  V  K TS MMPRIM
Sbjct  266   NDTWSNKDCTLAVDEVLKQYKEIDIYSLYTSVCIGDTASSTDGSMQVMMKRTSTMMPRIM  325

Query  1018  AGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKL  1197
              GYDPCLD Y+K++YNR DVQKALHVS G  L++W ICN  +F+ W+ SK SVLPIYKKL
Sbjct  326   GGYDPCLDGYSKTFYNRPDVQKALHVSDGVRLKNWTICNEKIFEDWAYSKPSVLPIYKKL  385

Query  1198  IAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFA  1377
             IAAG+RIWVYSGDTDGRVPVLSTRYS+S LGLPIT+ WRPWYH+KQV GW QEYEGLTFA
Sbjct  386   IAAGLRIWVYSGDTDGRVPVLSTRYSLSALGLPITKAWRPWYHEKQVSGWFQEYEGLTFA  445

Query  1378  TFRGAGHAVPTFKP  1419
             TFRGAGHAVP FKP
Sbjct  446   TFRGAGHAVPCFKP  459



>ref|XP_002521402.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF40892.1| serine carboxypeptidase, putative [Ricinus communis]
Length=478

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/421 (76%), Positives = 360/421 (86%), Gaps = 1/421 (0%)
 Frame = +1

Query  160   QSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGG  339
              S  +E LV NLPGQP V+F+ YAGYVTVNE NGR LFYW YE+++ PDEKPLVLWLNGG
Sbjct  38    NSLENEHLVTNLPGQPAVDFRQYAGYVTVNEKNGRALFYWFYEATTHPDEKPLVLWLNGG  97

Query  340   PGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYA  519
             PGCSS+GYGATQEIGPFLVD+D   L  NPYSWNKEAN+LFLESPVGVGFSYSNT++DY+
Sbjct  98    PGCSSVGYGATQEIGPFLVDNDGHGLKYNPYSWNKEANMLFLESPVGVGFSYSNTTSDYS  157

Query  520   NLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSLFI  699
              LGDDF ANDAYAFLH+WFLKFPSY+ RAFYIAGESYAGKYVPELAE+I D+N DP L I
Sbjct  158   VLGDDFTANDAYAFLHKWFLKFPSYRMRAFYIAGESYAGKYVPELAELIHDKNTDPFLHI  217

Query  700   DLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAV  879
             DLRGIL+GNPETSD +DW GMVD+AWSHAVISDETH+ I  SC+FNSNDTW+N DC+++V
Sbjct  218   DLRGILMGNPETSDAEDWAGMVDFAWSHAVISDETHKIIRKSCNFNSNDTWNNDDCNRSV  277

Query  880   NELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPV-FKTTSKMMPRIMAGYDPCLDDYAKS  1056
              EL +QY EIDIYSLYTSVCI     S D S  + F  TS MMPRIM GYDPCLD YA++
Sbjct  278   EELFRQYNEIDIYSLYTSVCIGDSASSDDKSMQIKFMRTSTMMPRIMGGYDPCLDAYARA  337

Query  1057  YYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGD  1236
             +YN  DVQKALHVS GH L++W ICN  +FDGW DSK+SVLPIYKKLI+AG+RIWVYSGD
Sbjct  338   FYNGPDVQKALHVSDGHWLKNWSICNDKIFDGWKDSKQSVLPIYKKLISAGLRIWVYSGD  397

Query  1237  TDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFK  1416
             TDGRVPVLSTRYS++ LGLPIT+ WRPWYHQKQV GW QEYEGL FATFRGAGHAVP FK
Sbjct  398   TDGRVPVLSTRYSLAALGLPITKAWRPWYHQKQVSGWFQEYEGLLFATFRGAGHAVPIFK  457

Query  1417  P  1419
             P
Sbjct  458   P  458



>ref|XP_008371321.1| PREDICTED: serine carboxypeptidase-like 31 [Malus domestica]
Length=480

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/434 (74%), Positives = 367/434 (85%), Gaps = 1/434 (0%)
 Frame = +1

Query  121   ARHSLSSNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSL  300
              R   +S ++ ++ S  ++DLV NLPGQP  +FKHYAGYVTVNE NGR LFYW YE++S 
Sbjct  26    GRTKRASTEKLNNNSLGTQDLVTNLPGQPAADFKHYAGYVTVNETNGRALFYWFYEAASN  85

Query  301   PDEKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVG  480
             PD KPLVLWLNGGPGCSS+GYGATQEIGPF+VD+D S +  N YSWNKEAN+LFLESPVG
Sbjct  86    PDGKPLVLWLNGGPGCSSVGYGATQEIGPFIVDTDGSGIKSNNYSWNKEANMLFLESPVG  145

Query  481   VGFSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAE  660
             VGFSYSNT+ DY NLGD+F ANDAY FLH+W+LKFP+Y+TR FYI+GESYAGKYVPELAE
Sbjct  146   VGFSYSNTTRDYDNLGDEFTANDAYNFLHKWYLKFPTYRTRTFYISGESYAGKYVPELAE  205

Query  661   IIVDRNKDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNS  840
             +I D+N +PSL ID++GILLGNPETSD  DW+G+VDYAWSHAVISDETH+ I  SCDF+ 
Sbjct  206   LIYDKNNNPSLHIDIKGILLGNPETSDADDWRGLVDYAWSHAVISDETHKIIRESCDFDR  265

Query  841   NDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPV-FKTTSKMMPRIM  1017
             NDTWSN+DC+ AV+E+LKQYKEIDIYSLYTSVCI     S D S  V  K TS MMPRIM
Sbjct  266   NDTWSNKDCTLAVDEVLKQYKEIDIYSLYTSVCIGDTASSTDGSMQVMMKRTSTMMPRIM  325

Query  1018  AGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKL  1197
              GYDPCLD Y+K++YNR DVQKALHVS G  L++W ICN  +F+ W+ SK SVLPIYKKL
Sbjct  326   GGYDPCLDGYSKTFYNRPDVQKALHVSDGVRLKNWTICNKKIFEDWAYSKPSVLPIYKKL  385

Query  1198  IAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFA  1377
             IAAG+RIWVYSGDTDGRVPVLSTRYS+S LGLPIT+ WRPWYH+KQV GW QEYEGLTFA
Sbjct  386   IAAGLRIWVYSGDTDGRVPVLSTRYSLSALGLPITKAWRPWYHEKQVSGWFQEYEGLTFA  445

Query  1378  TFRGAGHAVPTFKP  1419
             TFRGAGHAVP FKP
Sbjct  446   TFRGAGHAVPCFKP  459



>ref|XP_007025718.1| Serine carboxypeptidase-like 31 [Theobroma cacao]
 gb|EOY28340.1| Serine carboxypeptidase-like 31 [Theobroma cacao]
Length=483

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/429 (75%), Positives = 363/429 (85%), Gaps = 4/429 (1%)
 Frame = +1

Query  139   SNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPL  318
             S KE S  S  ++DLV NLPGQP V+F+HYAGYVTVN+ NGR LFYW YE+ S PDEKPL
Sbjct  37    SKKELS--SLGNDDLVTNLPGQPAVDFRHYAGYVTVNQKNGRALFYWFYEAMSHPDEKPL  94

Query  319   VLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYS  498
             VLWLNGGPGCSS+GYGATQEIGPF+VD+D   +  N +SWNKEAN+LFLESPVGVGFSYS
Sbjct  95    VLWLNGGPGCSSVGYGATQEIGPFIVDTDGRGIKFNNFSWNKEANMLFLESPVGVGFSYS  154

Query  499   NTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRN  678
             NTSTDY  LGD+F AND+Y FLH+WFLKFPSY+ R FYIAGESYAGKYVPELAE+I D N
Sbjct  155   NTSTDYDKLGDEFTANDSYNFLHQWFLKFPSYRNRTFYIAGESYAGKYVPELAELINDNN  214

Query  679   KDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSN  858
             KDPSL I+L+GILLGNPET   +DW+G++DYAWSHAV+SDETH+ I  +CDF SND WSN
Sbjct  215   KDPSLRIELKGILLGNPETDGPEDWKGLMDYAWSHAVVSDETHKIISENCDFYSNDPWSN  274

Query  859   QDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNS--TPVFKTTSKMMPRIMAGYDP  1032
             +DC+QAV+E+ KQYKEIDIYSLYTSVCI    GS D S    + K  S MMPRI+ GYDP
Sbjct  275   EDCNQAVDEVFKQYKEIDIYSLYTSVCIGDTAGSDDKSLLQVMMKRKSNMMPRILGGYDP  334

Query  1033  CLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGI  1212
             CLD+YAK++YNRLDVQKALHVS G HLR+W ICN  +FD WSDSK SVLPIYKKLIAAG+
Sbjct  335   CLDNYAKAFYNRLDVQKALHVSDGQHLRNWSICNHKIFDDWSDSKRSVLPIYKKLIAAGV  394

Query  1213  RIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGA  1392
             RIWVYSGDTDGRVPVLSTRYS+ TLGLPI   WRPWYHQKQV GW QEY+GLTFATFRGA
Sbjct  395   RIWVYSGDTDGRVPVLSTRYSLKTLGLPIIMAWRPWYHQKQVSGWFQEYKGLTFATFRGA  454

Query  1393  GHAVPTFKP  1419
             GHAVP FKP
Sbjct  455   GHAVPCFKP  463



>ref|XP_003543072.1| PREDICTED: serine carboxypeptidase-like 31-like isoform 1 [Glycine 
max]
 gb|KHN08562.1| Serine carboxypeptidase-like 31 [Glycine soja]
Length=478

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/415 (77%), Positives = 359/415 (87%), Gaps = 1/415 (0%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             DLV NLPGQP V+F+HYAGYVTVNE NGR LFYW YE+ + P +KPLVLWLNGGPGCSS+
Sbjct  44    DLVTNLPGQPPVDFQHYAGYVTVNETNGRALFYWFYEAMTKPQDKPLVLWLNGGPGCSSV  103

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYGATQEIGPFLVD+D   L  N +SWNKEAN+LFLESPVGVGFSYSNT+++YA LGDDF
Sbjct  104   GYGATQEIGPFLVDTDGKGLKFNNFSWNKEANILFLESPVGVGFSYSNTTSEYARLGDDF  163

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSLFIDLRGIL  717
              ANDAY FLH WFLKFPSY TR FYIAGESYAGKYVPELAE+I DRNKDPSL IDL+GIL
Sbjct  164   TANDAYTFLHNWFLKFPSYITRTFYIAGESYAGKYVPELAELIHDRNKDPSLHIDLKGIL  223

Query  718   LGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELLKQ  897
             LGNPETSD +DW GMVDYAWSHAVISDET++TI ASC+FNS+D WSN+DC+Q V+E LKQ
Sbjct  224   LGNPETSDAEDWSGMVDYAWSHAVISDETYKTIKASCEFNSSDPWSNKDCTQGVDETLKQ  283

Query  898   YKEIDIYSLYTSVCIDSLTGSGDNSTP-VFKTTSKMMPRIMAGYDPCLDDYAKSYYNRLD  1074
             Y EIDIYSLYTSVC  S   S D S   V   +SKMMPRIM GYDPCLD+YAK++YNR D
Sbjct  284   YNEIDIYSLYTSVCFASTARSNDQSKKMVMNRSSKMMPRIMGGYDPCLDNYAKTFYNRPD  343

Query  1075  VQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGRVP  1254
             VQKALH S G++LR+W ICN ++F GW+ SK SV+PIYKKLI+AG+RIWVYSGDTDGRVP
Sbjct  344   VQKALHASDGYNLRNWSICNENIFKGWAQSKPSVIPIYKKLISAGLRIWVYSGDTDGRVP  403

Query  1255  VLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             VLSTRYS+S LGLPIT+ WRPWYH+K+V GW QEYEGLTFATFRGAGHAVP FKP
Sbjct  404   VLSTRYSLSILGLPITKRWRPWYHEKEVSGWYQEYEGLTFATFRGAGHAVPCFKP  458



>ref|XP_003547136.1| PREDICTED: serine carboxypeptidase-like 31-like [Glycine max]
Length=482

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/414 (77%), Positives = 359/414 (87%), Gaps = 1/414 (0%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             DLV NLPGQP V+F+HYAGYVTVNE NGR LFYW YE+ + P++K LVLWLNGGPGCSS+
Sbjct  48    DLVTNLPGQPPVDFQHYAGYVTVNETNGRTLFYWFYEAMTKPEDKALVLWLNGGPGCSSV  107

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYGATQEIGPFLVD+D   L  N +SWNKEAN+LFLESPVGVGFSYSNT+++YA LGDDF
Sbjct  108   GYGATQEIGPFLVDTDGRGLKFNNFSWNKEANMLFLESPVGVGFSYSNTTSEYAQLGDDF  167

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSLFIDLRGIL  717
              ANDAY FLH WFLKFPSY+TR FYIAGESYAGKYVPELAE+I DRNKDPSL I+L+GIL
Sbjct  168   TANDAYTFLHNWFLKFPSYRTRTFYIAGESYAGKYVPELAELIHDRNKDPSLHINLKGIL  227

Query  718   LGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELLKQ  897
             LGNPETSD +DW GMVDYAWSHAVISDET++TI ASCDFNS+D WSN DC+Q V+E LKQ
Sbjct  228   LGNPETSDAEDWSGMVDYAWSHAVISDETYKTIKASCDFNSSDPWSNNDCTQGVDETLKQ  287

Query  898   YKEIDIYSLYTSVCIDSLTGSGDNSTP-VFKTTSKMMPRIMAGYDPCLDDYAKSYYNRLD  1074
             Y EIDIYSLYTSVC  S   S D S   V   +SKMMPRIM GYDPCLDDYAK++YNR D
Sbjct  288   YNEIDIYSLYTSVCFASTARSNDQSMQMVMSRSSKMMPRIMGGYDPCLDDYAKTFYNRPD  347

Query  1075  VQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGRVP  1254
             VQKALHVS G++L++W ICN ++F GW+ SK SV+PIYKKLI+AG+RIWVYSGDTDGRVP
Sbjct  348   VQKALHVSDGYNLKNWSICNENIFKGWAQSKPSVIPIYKKLISAGLRIWVYSGDTDGRVP  407

Query  1255  VLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFK  1416
             VLSTRYS+S LGLPIT+ WRPWYH+K+V GW QEYEGLTFATFRGAGHAVP FK
Sbjct  408   VLSTRYSLSILGLPITKRWRPWYHEKEVSGWYQEYEGLTFATFRGAGHAVPCFK  461



>ref|XP_007148207.1| hypothetical protein PHAVU_006G189100g [Phaseolus vulgaris]
 gb|ESW20201.1| hypothetical protein PHAVU_006G189100g [Phaseolus vulgaris]
Length=472

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/415 (76%), Positives = 358/415 (86%), Gaps = 1/415 (0%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             DLV NLPGQP V+F+HYAGYVTVN+ NGR LFYW +E+ + P  KPLVLWLNGGPGCSS+
Sbjct  38    DLVTNLPGQPPVDFQHYAGYVTVNQTNGRALFYWFFEAITKPQHKPLVLWLNGGPGCSSV  97

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYGATQEIGPFLVD+D  SL  N +SWNKEAN+LFLESPVGVGFSYSNT+++YA LGDDF
Sbjct  98    GYGATQEIGPFLVDTDGKSLMFNNFSWNKEANMLFLESPVGVGFSYSNTTSEYAQLGDDF  157

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSLFIDLRGIL  717
              ANDAY FLH WFLKFPSY+TR FYIAGESYAGKYVPELAE+I DRNKDPSL IDL+GIL
Sbjct  158   TANDAYTFLHNWFLKFPSYRTRTFYIAGESYAGKYVPELAELIQDRNKDPSLHIDLKGIL  217

Query  718   LGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELLKQ  897
             LGNPETSD +DW GMVDYAWSHAVISDET++TI ASCDFNS+D WSN+DCS+ V+E+LKQ
Sbjct  218   LGNPETSDAEDWSGMVDYAWSHAVISDETYKTIKASCDFNSSDPWSNKDCSEGVDEVLKQ  277

Query  898   YKEIDIYSLYTSVCIDSLTGSGDNSTP-VFKTTSKMMPRIMAGYDPCLDDYAKSYYNRLD  1074
             Y EIDIYSLYTSVC  S   S   S   V   +SKMMPRIM GYDPCLDDYAK++YN+ D
Sbjct  278   YNEIDIYSLYTSVCFASTARSNYQSMQMVMLRSSKMMPRIMGGYDPCLDDYAKTFYNKPD  337

Query  1075  VQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGRVP  1254
             VQKALH S GH+LR+W ICN ++F GW  SK SV+PIY KLI+AG+RIW+YSGDTDGRVP
Sbjct  338   VQKALHASDGHNLRNWSICNDNIFKGWKQSKTSVIPIYNKLISAGLRIWIYSGDTDGRVP  397

Query  1255  VLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             VLSTRYS+S L LPIT++WRPWYH+K+V GW QEYEGLTFATFRGAGHAVP FKP
Sbjct  398   VLSTRYSLSILDLPITKKWRPWYHEKEVSGWYQEYEGLTFATFRGAGHAVPCFKP  452



>ref|XP_007212080.1| hypothetical protein PRUPE_ppa005035mg [Prunus persica]
 gb|EMJ13279.1| hypothetical protein PRUPE_ppa005035mg [Prunus persica]
Length=480

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/428 (74%), Positives = 362/428 (85%), Gaps = 1/428 (0%)
 Frame = +1

Query  139   SNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPL  318
             SN E+      ++DLV NLPGQP V+FKHYAGYVTVN+ NGR LFYW YE+++ PD KPL
Sbjct  32    SNSEKLINLLGTQDLVTNLPGQPAVDFKHYAGYVTVNQTNGRALFYWFYEAATNPDAKPL  91

Query  319   VLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYS  498
             VLWLNGGPGCSS+GYGATQEIGPF+VD+D   +  N YSWNKEAN+LFLESPVGVGFSYS
Sbjct  92    VLWLNGGPGCSSVGYGATQEIGPFIVDTDGHGIRFNNYSWNKEANMLFLESPVGVGFSYS  151

Query  499   NTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRN  678
             NT++DY NLGD F ANDAY FLH+WFLKFPSY+TR FYIAGESYAGKYVPELAE+I D+N
Sbjct  152   NTTSDYENLGDVFTANDAYNFLHKWFLKFPSYRTRTFYIAGESYAGKYVPELAEVIYDKN  211

Query  679   KDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSN  858
             KD SL IDL+GILLGNPETSD +DW+G+VDYAWSHAV+SDETH+ I  SCDF+ NDTWSN
Sbjct  212   KDTSLHIDLKGILLGNPETSDAEDWRGLVDYAWSHAVVSDETHKIIRESCDFDRNDTWSN  271

Query  859   QDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPV-FKTTSKMMPRIMAGYDPC  1035
             ++C+ AV+E+LKQYKEIDIYSLYTSVCI     S D S  V  K TS MMPRIM GYDPC
Sbjct  272   KNCTLAVDEVLKQYKEIDIYSLYTSVCIGDTASSDDGSMQVMMKRTSTMMPRIMGGYDPC  331

Query  1036  LDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIR  1215
             LD+Y K++YNR +VQKALHVS G  L++W ICN  +F+ W+ SK SVLPIYKKLIAAG+R
Sbjct  332   LDEYTKTFYNRPEVQKALHVSDGVRLKNWSICNNKIFEDWAYSKPSVLPIYKKLIAAGLR  391

Query  1216  IWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAG  1395
             IWVYSGDTDGRVPVLSTRYS+S LGLPI + W PWYHQKQV GW QEY+GLTFATFRGAG
Sbjct  392   IWVYSGDTDGRVPVLSTRYSLSALGLPINKAWSPWYHQKQVSGWFQEYKGLTFATFRGAG  451

Query  1396  HAVPTFKP  1419
             HAVP FKP
Sbjct  452   HAVPCFKP  459



>ref|XP_008383787.1| PREDICTED: serine carboxypeptidase-like 31 [Malus domestica]
Length=476

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/426 (75%), Positives = 360/426 (85%), Gaps = 1/426 (0%)
 Frame = +1

Query  145   KEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVL  324
             +  +++   ++DLV NLPGQP  +FKHYAGYVTVNE NGR LFYW YE++S PD KPLVL
Sbjct  30    RSSTEKRMRTQDLVTNLPGQPAADFKHYAGYVTVNETNGRALFYWFYEAASNPDGKPLVL  89

Query  325   WLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNT  504
             WLNGGPGCSS+GYGATQEIGPFLVD+D   +  N YSWNKEAN+LFLESPVGVGFSYSNT
Sbjct  90    WLNGGPGCSSVGYGATQEIGPFLVDTDGHGIKSNNYSWNKEANMLFLESPVGVGFSYSNT  149

Query  505   STDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKD  684
             ++DY NLGD F ANDAY FLH+W+LKFPSY+ R FYI+GESYAGKYVPELAE+I D+N +
Sbjct  150   TSDYDNLGDGFTANDAYNFLHKWYLKFPSYRRRTFYISGESYAGKYVPELAELIYDKNNN  209

Query  685   PSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQD  864
             PSL IDL+GILLGNPETSD  DW+G+VDYAWSHAVISDETH+ I  SCDF+ NDTWSN+D
Sbjct  210   PSLHIDLKGILLGNPETSDADDWRGLVDYAWSHAVISDETHKVIGESCDFDRNDTWSNKD  269

Query  865   CSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPV-FKTTSKMMPRIMAGYDPCLD  1041
             C+ AV ELLKQY EIDIYSLYTSVCI     S D S  V  K TS MMPRIM GYDPCLD
Sbjct  270   CTLAVEELLKQYGEIDIYSLYTSVCIGDTASSNDGSMHVMMKRTSTMMPRIMGGYDPCLD  329

Query  1042  DYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIW  1221
             +Y+K++YNR DVQKALHVS G  L++W ICN  +FD W+ +K SVLPIYKKLIAAG+RIW
Sbjct  330   EYSKTFYNRPDVQKALHVSDGVRLKNWSICNKKIFDDWAYTKPSVLPIYKKLIAAGLRIW  389

Query  1222  VYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHA  1401
             VYSGDTDGRVPVLSTRYS+S LGLPIT+ WRPWYH+KQV GW QEYEGLTFATFRGAGHA
Sbjct  390   VYSGDTDGRVPVLSTRYSLSALGLPITKAWRPWYHEKQVSGWFQEYEGLTFATFRGAGHA  449

Query  1402  VPTFKP  1419
             VP FKP
Sbjct  450   VPCFKP  455



>ref|XP_007159282.1| hypothetical protein PHAVU_002G224800g [Phaseolus vulgaris]
 gb|ESW31276.1| hypothetical protein PHAVU_002G224800g [Phaseolus vulgaris]
Length=489

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/433 (73%), Positives = 364/433 (84%), Gaps = 1/433 (0%)
 Frame = +1

Query  124   RHSLSSNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLP  303
             RHS      ++  S  + DLV NLPGQP VNF+HYAGYVTVNE NGR LFYW YE+ + P
Sbjct  37    RHSQYWGGGRTLSSGYNGDLVTNLPGQPKVNFQHYAGYVTVNETNGRALFYWFYEAMNKP  96

Query  304   DEKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGV  483
             +EKPLVLWLNGGPGCSS+GYGATQEIGPFLVD+D   L  N +SWN+EA++LFLESPVGV
Sbjct  97    EEKPLVLWLNGGPGCSSVGYGATQEIGPFLVDTDGQGLKFNNFSWNREASMLFLESPVGV  156

Query  484   GFSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEI  663
             GFSYSNTS+DY  LGDD  ANDAY+FL  WF KFPSY+TR FYIAGESYAGKYVPELAE+
Sbjct  157   GFSYSNTSSDYDQLGDDLTANDAYSFLRNWFQKFPSYRTRPFYIAGESYAGKYVPELAEL  216

Query  664   IVDRNKDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSN  843
             I DRNKDPSL+IDL+GILLGNPETSD +DW G+VDYAWSHAVISDETH+ I  SCDFNS+
Sbjct  217   IHDRNKDPSLYIDLKGILLGNPETSDAEDWMGLVDYAWSHAVISDETHKIIKTSCDFNSS  276

Query  844   DTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPV-FKTTSKMMPRIMA  1020
             D W NQDCSQAV+E+LKQY EIDIYSLYTSVC  S   S D S     K TSKMMPR++ 
Sbjct  277   DPWRNQDCSQAVDEVLKQYNEIDIYSLYTSVCFASTARSDDQSMQTSMKLTSKMMPRMLG  336

Query  1021  GYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLI  1200
             GYDPCLDDYAK++YN+ DVQKALH S GH+L++W ICN  +F+ W+DSK SV+PIYKKLI
Sbjct  337   GYDPCLDDYAKAFYNKPDVQKALHASDGHNLKNWSICNNKIFNDWADSKPSVIPIYKKLI  396

Query  1201  AAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFAT  1380
             +AG+RIWVYSGDTDGRVPVLSTRYS+S+L LP+T+ WRPWYH+ +V GW +EYEGLTFAT
Sbjct  397   SAGLRIWVYSGDTDGRVPVLSTRYSLSSLALPVTKSWRPWYHENEVSGWFEEYEGLTFAT  456

Query  1381  FRGAGHAVPTFKP  1419
             FRGAGHAVP FKP
Sbjct  457   FRGAGHAVPCFKP  469



>ref|XP_010107053.1| Serine carboxypeptidase-like 31 [Morus notabilis]
 gb|EXC53894.1| Serine carboxypeptidase-like 31 [Morus notabilis]
Length=482

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/417 (77%), Positives = 362/417 (87%), Gaps = 2/417 (0%)
 Frame = +1

Query  175   EDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             + LV NLPGQP V F+HYAGYVTV++ +GR LFYW YE++S PDEKPLVLWLNGGPGCSS
Sbjct  46    DHLVTNLPGQPQVEFRHYAGYVTVDQTHGRALFYWFYEATSRPDEKPLVLWLNGGPGCSS  105

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             +GYGATQEIGPF+VD+D   L  NP SWN EAN+LFLESP+GVGFSYSNTSTDY NLGDD
Sbjct  106   VGYGATQEIGPFIVDTDGHGLKYNPSSWNTEANMLFLESPIGVGFSYSNTSTDYDNLGDD  165

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSLFIDLRGI  714
             F ANDAY FL +WFLKFPSY+ R+FYIAGESYAGKYVPELAE++ D+NKDPSL ID++GI
Sbjct  166   FTANDAYTFLQKWFLKFPSYRNRSFYIAGESYAGKYVPELAELVHDKNKDPSLHIDIKGI  225

Query  715   LLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELLK  894
             LLGNPETSD +DW+G+VDYAWSHAVISDETH+ I  +CDFNSN+TW N  C+QAV+E+LK
Sbjct  226   LLGNPETSDAEDWKGLVDYAWSHAVISDETHKIIKENCDFNSNNTWDNDQCNQAVDEVLK  285

Query  895   QYKEIDIYSLYTSVCIDSLTGSGDNSTPV-FKTTSKMMPRIMAG-YDPCLDDYAKSYYNR  1068
             QYKEIDIYSLYTSVCI     S D+S  V  K +S MMPRIM G YDPCLD+YAK++YNR
Sbjct  286   QYKEIDIYSLYTSVCIADSASSEDSSFQVMMKRSSTMMPRIMGGYYDPCLDEYAKAFYNR  345

Query  1069  LDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGR  1248
             LDVQKALHV+ G HLR+W ICN  +F  WSDSK SVLPIYKKLIAAG+RIWVYSGDTDGR
Sbjct  346   LDVQKALHVNDGLHLRNWSICNFKIFREWSDSKPSVLPIYKKLIAAGLRIWVYSGDTDGR  405

Query  1249  VPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             VPVLSTRYS+S+LGLPIT+ WRPWYHQKQV GW QEYEGLTFATFRGAGHAVP FKP
Sbjct  406   VPVLSTRYSLSSLGLPITKAWRPWYHQKQVSGWFQEYEGLTFATFRGAGHAVPCFKP  462



>ref|XP_006449285.1| hypothetical protein CICLE_v10015093mg [Citrus clementina]
 gb|ESR62525.1| hypothetical protein CICLE_v10015093mg [Citrus clementina]
Length=478

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/416 (75%), Positives = 359/416 (86%), Gaps = 3/416 (1%)
 Frame = +1

Query  172   SEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCS  351
             +EDLV NLPGQP V+F+HYAGYVTVNE+NGR LFYW YE+ + P EKPLVLWLNGGPGCS
Sbjct  45    NEDLVTNLPGQPNVDFRHYAGYVTVNEHNGRALFYWFYEAMTRPQEKPLVLWLNGGPGCS  104

Query  352   SIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             S+GYGATQEIGPFLVD+D   L  NPY+WNKEAN+LFLESP+GVGFSYSNT+ DY  LGD
Sbjct  105   SVGYGATQEIGPFLVDTDGRGLQFNPYAWNKEANMLFLESPIGVGFSYSNTTNDYEMLGD  164

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSLFIDLRG  711
             DF AND+Y FLH+WFLKFPSY+ R FYIAGESYAG+Y+PELAE+I DRNKDPSL+IDL+G
Sbjct  165   DFTANDSYTFLHKWFLKFPSYRRRTFYIAGESYAGRYIPELAELIHDRNKDPSLYIDLKG  224

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELL  891
             ILLGNPETS  +DWQG+VDYAWSHAV+SDETH+ I+ +CDFNS+D WS+ +CS AV E+L
Sbjct  225   ILLGNPETSTAEDWQGLVDYAWSHAVVSDETHKIILRTCDFNSSDPWSSDECSDAVAEVL  284

Query  892   KQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSYYNRL  1071
             KQYKEIDIYS+YTSVC    + S ++S  + K TSKMMPRIM GYDPCLD+YAK++YNRL
Sbjct  285   KQYKEIDIYSIYTSVCS---SNSLESSQLMMKRTSKMMPRIMGGYDPCLDNYAKAFYNRL  341

Query  1072  DVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGRV  1251
             DVQKALHVS GH LR+W ICN ++++GW   K SVLPIY KLI AG+RIW+YSGDTDGRV
Sbjct  342   DVQKALHVSDGHLLRNWSICNTTMYEGWPQPKPSVLPIYTKLIEAGLRIWIYSGDTDGRV  401

Query  1252  PVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             PVLSTRY + +LGL IT+ WRPWYHQKQVGGWVQEY GLTF T RGAGHAVP FKP
Sbjct  402   PVLSTRYCLDSLGLSITKSWRPWYHQKQVGGWVQEYAGLTFVTVRGAGHAVPVFKP  457



>emb|CAN82217.1| hypothetical protein VITISV_020424 [Vitis vinifera]
Length=492

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/444 (72%), Positives = 361/444 (81%), Gaps = 12/444 (3%)
 Frame = +1

Query  124   RHSLSSNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLP  303
             RHS     ++   S  +EDLV +LPGQP V+F+HYAGYVTVNE NGR LFYW YE+++ P
Sbjct  29    RHSRQWTNDKGLNSLGNEDLVTDLPGQPAVDFRHYAGYVTVNEENGRALFYWFYEATTQP  88

Query  304   DEKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGV  483
             +EKPLVLWLNGGPGCSS+GYGATQEIGPF+VD+D   L  NPYSWN+EAN+LFLESPVGV
Sbjct  89    NEKPLVLWLNGGPGCSSVGYGATQEIGPFIVDTDGHGLKFNPYSWNREANMLFLESPVGV  148

Query  484   GFSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEI  663
             GFSYSNT++DY  LGDDF AND YAFLH+WFLKFPSY+ R FYIAGESYAGKYVPELA +
Sbjct  149   GFSYSNTTSDYEKLGDDFTANDNYAFLHKWFLKFPSYRKRIFYIAGESYAGKYVPELAXV  208

Query  664   IVDRNKDPSLFIDLRGIL-----------LGNPETSDVQDWQGMVDYAWSHAVISDETHR  810
             I D+NKDPSLFIDLRGIL           LGNPET D  DW+G+VDYAWSHAV+SDETH+
Sbjct  209   IYDKNKDPSLFIDLRGILQSIYGYFVEAQLGNPETCDADDWRGLVDYAWSHAVVSDETHK  268

Query  811   TIIASCDFNSNDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPV-FK  987
              I  +CDF S D WSN +CS AV E+L QYK IDIYSLYTSVC  +   S D S  V FK
Sbjct  269   IIRENCDFYSEDPWSNDNCSDAVGEVLDQYKRIDIYSLYTSVCTKTSKRSDDYSMQVLFK  328

Query  988   TTSKMMPRIMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSK  1167
              TS+MMPRIM GYDPCLDDYAK++YNR DVQKALHVS GH +++W ICN  +F  WS S+
Sbjct  329   RTSRMMPRIMGGYDPCLDDYAKAFYNRADVQKALHVSDGHRVKNWSICNADIFGNWSQSQ  388

Query  1168  ESVLPIYKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGW  1347
              SVLPIY+KLIA G+RIWVYSGDTDGRVPVLSTRY +STL LPITR WRPWYHQ+QV GW
Sbjct  389   PSVLPIYRKLIAGGLRIWVYSGDTDGRVPVLSTRYCLSTLKLPITRAWRPWYHQQQVSGW  448

Query  1348  VQEYEGLTFATFRGAGHAVPTFKP  1419
              QEY+GLTFATFRGAGHAVP FKP
Sbjct  449   FQEYKGLTFATFRGAGHAVPVFKP  472



>ref|XP_006467848.1| PREDICTED: serine carboxypeptidase-like 31-like [Citrus sinensis]
Length=478

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/416 (75%), Positives = 359/416 (86%), Gaps = 3/416 (1%)
 Frame = +1

Query  172   SEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCS  351
             +EDLV NLPGQP V+F+HYAGYVTVNE+NGR LFYW YE+ + P EKPLVLWLNGGPGCS
Sbjct  45    NEDLVTNLPGQPNVDFRHYAGYVTVNEHNGRALFYWFYEAMTRPQEKPLVLWLNGGPGCS  104

Query  352   SIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             S+GYGATQEIGPFLVD+D   L  NPY+WNKEAN+LFLESP+GVGFSYSNT+ DY  LGD
Sbjct  105   SVGYGATQEIGPFLVDTDGRGLQFNPYAWNKEANMLFLESPIGVGFSYSNTTNDYEMLGD  164

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSLFIDLRG  711
             DF AND+Y FLH+WFLKFPSY+ R FYIAGESYAG+Y+PEL E+I DRNKDPSL+IDL+G
Sbjct  165   DFTANDSYTFLHKWFLKFPSYRRRTFYIAGESYAGRYIPELTELIHDRNKDPSLYIDLKG  224

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELL  891
             ILLGNPETS  +DWQG+VDYAWSHAV+SDETH+ I+ +CDFNS+D WS+ +CS AV E+L
Sbjct  225   ILLGNPETSTAEDWQGLVDYAWSHAVVSDETHKIILRTCDFNSSDPWSSDECSDAVAEVL  284

Query  892   KQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSYYNRL  1071
             KQYKEIDIYS+YTSVC    + S ++S  + K TSKMMPRIM GYDPCLD+YAK++YNRL
Sbjct  285   KQYKEIDIYSIYTSVCS---SNSLESSQLLMKRTSKMMPRIMGGYDPCLDNYAKAFYNRL  341

Query  1072  DVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGRV  1251
             DVQKALHVS GH LR+W ICN ++++GW   K SVLPIY KLI AG+RIW+YSGDTDGRV
Sbjct  342   DVQKALHVSDGHLLRNWSICNTTMYEGWPQPKPSVLPIYTKLIEAGLRIWIYSGDTDGRV  401

Query  1252  PVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             PVLSTRY +++LGL IT+ WRPWYHQKQVGGWVQEY GLTF T RGAGHAVP FKP
Sbjct  402   PVLSTRYCLNSLGLSITKSWRPWYHQKQVGGWVQEYAGLTFVTVRGAGHAVPVFKP  457



>gb|KDP20920.1| hypothetical protein JCGZ_21391 [Jatropha curcas]
Length=481

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/436 (74%), Positives = 363/436 (83%), Gaps = 4/436 (1%)
 Frame = +1

Query  121   ARHSLSSNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSL  300
             ARH     ++Q   S  ++ LV NLPGQP V+F+HYAGYVTVNE NGR LFYW YE+++ 
Sbjct  27    ARHQPLDGQKQF-HSLENDHLVTNLPGQPDVDFRHYAGYVTVNEKNGRALFYWFYEATTH  85

Query  301   PDEKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVG  480
             PDEKPLVLWLNGGPGCSS+GYGATQEIGPFLVD D   L  NPYSWN EAN+LFLESPVG
Sbjct  86    PDEKPLVLWLNGGPGCSSVGYGATQEIGPFLVDDDGRGLKYNPYSWNTEANILFLESPVG  145

Query  481   VGFSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAE  660
             VGFSYSNT+TDY  LGD F ANDAYAFLH+WFLKFPSY+TRAFYIAGESYAGKY+PELAE
Sbjct  146   VGFSYSNTTTDYNGLGDGFTANDAYAFLHKWFLKFPSYRTRAFYIAGESYAGKYIPELAE  205

Query  661   IIVDRNKDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNS  840
             +I D+NKD  L IDLRGILLGNPETS  +DW G+VDYAWSHAVISDET++ I  SCDFNS
Sbjct  206   LIHDKNKDSLLHIDLRGILLGNPETSYAEDWVGLVDYAWSHAVISDETYKIIKQSCDFNS  265

Query  841   NDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPV-FK--TTSKMMPR  1011
             +D WSN DC QA+NEL +QYKEIDI+S+YT VCI     S D    V FK  +T+ M+PR
Sbjct  266   DDPWSNGDCDQAINELFRQYKEIDIFSIYTPVCISGSANSDDKYMQVMFKRSSTTTMIPR  325

Query  1012  IMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYK  1191
             IM GYDPCLDDY +S+YNR DVQKALHV  GH  ++W ICN  +FD WSDS+ SVLPIYK
Sbjct  326   IMGGYDPCLDDYTRSFYNRPDVQKALHVGDGHWSKNWSICNHKIFDEWSDSRRSVLPIYK  385

Query  1192  KLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLT  1371
             KLIAAG+RIWVYSGDTDGRVPVLSTRYS+++LGLPIT+ WRPWYHQKQV GW QEYEGL 
Sbjct  386   KLIAAGLRIWVYSGDTDGRVPVLSTRYSLASLGLPITKAWRPWYHQKQVSGWYQEYEGLM  445

Query  1372  FATFRGAGHAVPTFKP  1419
             +ATFRGAGHAVP+FKP
Sbjct  446   YATFRGAGHAVPSFKP  461



>ref|XP_006583804.1| PREDICTED: serine carboxypeptidase-like 31-like isoform X2 [Glycine 
max]
Length=460

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/415 (75%), Positives = 353/415 (85%), Gaps = 1/415 (0%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             DLV NLPGQP VNF+HYAGYVTVNE NGR LFYW YE+ + P+EKPLVLWLNGGPGCSS+
Sbjct  26    DLVTNLPGQPGVNFQHYAGYVTVNETNGRALFYWFYEAITKPEEKPLVLWLNGGPGCSSV  85

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYGATQEIGPFLVD+D   L  N +SWN+EAN+LFLESPVGVGFSYSNTS+DY  LGD+ 
Sbjct  86    GYGATQEIGPFLVDTDGQGLKFNNFSWNREANMLFLESPVGVGFSYSNTSSDYDQLGDEL  145

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSLFIDLRGIL  717
              ANDAY+FLH WF KFPSY+ R FYIAGESYAGKYVPELAE+I DRNKDPSL+IDL+GIL
Sbjct  146   TANDAYSFLHNWFQKFPSYRIRTFYIAGESYAGKYVPELAELIHDRNKDPSLYIDLKGIL  205

Query  718   LGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELLKQ  897
             LGNPETSD +DW G+VDYAWSHAVISDETH+TI  SCDFNS D W N+DCSQAV+E+LKQ
Sbjct  206   LGNPETSDAEDWMGLVDYAWSHAVISDETHQTIKTSCDFNSTDPWRNKDCSQAVDEVLKQ  265

Query  898   YKEIDIYSLYTSVCIDSLTGSGDNSTPV-FKTTSKMMPRIMAGYDPCLDDYAKSYYNRLD  1074
             Y EIDIYSLYTSVC  S   S D S     K +SKMMPR++ GYDPCLD YAK++YN+ D
Sbjct  266   YNEIDIYSLYTSVCFASTASSDDQSMQTSMKRSSKMMPRMLGGYDPCLDGYAKAFYNKPD  325

Query  1075  VQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGRVP  1254
             VQKALH S GH+L+ W ICN  +F+ W+DSK SV+PIYKKLI+AG+RIWVYSGDTDGRVP
Sbjct  326   VQKALHASDGHNLKKWSICNDKIFNDWADSKPSVIPIYKKLISAGLRIWVYSGDTDGRVP  385

Query  1255  VLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             VLSTRYS+S L LPIT+ WRPWYH  +V GW +EYEGLTFATFRGAGHAVP FKP
Sbjct  386   VLSTRYSLSPLALPITKSWRPWYHDNEVSGWFEEYEGLTFATFRGAGHAVPCFKP  440



>ref|XP_003529304.1| PREDICTED: serine carboxypeptidase-like 31-like isoform X1 [Glycine 
max]
 gb|KHN07298.1| Serine carboxypeptidase-like 31 [Glycine soja]
Length=486

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/415 (75%), Positives = 353/415 (85%), Gaps = 1/415 (0%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             DLV NLPGQP VNF+HYAGYVTVNE NGR LFYW YE+ + P+EKPLVLWLNGGPGCSS+
Sbjct  52    DLVTNLPGQPGVNFQHYAGYVTVNETNGRALFYWFYEAITKPEEKPLVLWLNGGPGCSSV  111

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYGATQEIGPFLVD+D   L  N +SWN+EAN+LFLESPVGVGFSYSNTS+DY  LGD+ 
Sbjct  112   GYGATQEIGPFLVDTDGQGLKFNNFSWNREANMLFLESPVGVGFSYSNTSSDYDQLGDEL  171

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSLFIDLRGIL  717
              ANDAY+FLH WF KFPSY+ R FYIAGESYAGKYVPELAE+I DRNKDPSL+IDL+GIL
Sbjct  172   TANDAYSFLHNWFQKFPSYRIRTFYIAGESYAGKYVPELAELIHDRNKDPSLYIDLKGIL  231

Query  718   LGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELLKQ  897
             LGNPETSD +DW G+VDYAWSHAVISDETH+TI  SCDFNS D W N+DCSQAV+E+LKQ
Sbjct  232   LGNPETSDAEDWMGLVDYAWSHAVISDETHQTIKTSCDFNSTDPWRNKDCSQAVDEVLKQ  291

Query  898   YKEIDIYSLYTSVCIDSLTGSGDNSTPV-FKTTSKMMPRIMAGYDPCLDDYAKSYYNRLD  1074
             Y EIDIYSLYTSVC  S   S D S     K +SKMMPR++ GYDPCLD YAK++YN+ D
Sbjct  292   YNEIDIYSLYTSVCFASTASSDDQSMQTSMKRSSKMMPRMLGGYDPCLDGYAKAFYNKPD  351

Query  1075  VQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGRVP  1254
             VQKALH S GH+L+ W ICN  +F+ W+DSK SV+PIYKKLI+AG+RIWVYSGDTDGRVP
Sbjct  352   VQKALHASDGHNLKKWSICNDKIFNDWADSKPSVIPIYKKLISAGLRIWVYSGDTDGRVP  411

Query  1255  VLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             VLSTRYS+S L LPIT+ WRPWYH  +V GW +EYEGLTFATFRGAGHAVP FKP
Sbjct  412   VLSTRYSLSPLALPITKSWRPWYHDNEVSGWFEEYEGLTFATFRGAGHAVPCFKP  466



>ref|XP_010686577.1| PREDICTED: serine carboxypeptidase-like 31 [Beta vulgaris subsp. 
vulgaris]
Length=483

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/435 (71%), Positives = 370/435 (85%), Gaps = 2/435 (0%)
 Frame = +1

Query  121   ARHSLSS-NKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSS  297
             +RH ++  N  + + S      VA+LPGQP VNF+HYAGYV VN+ NGR +FYW YE+SS
Sbjct  29    SRHRINPYNVNKEENSLEKNHHVADLPGQPAVNFQHYAGYVNVNQKNGRFMFYWFYEASS  88

Query  298   LPDEKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPV  477
              PDEKPLVLWLNGGPGCSS+GYGATQEIGPFLVD++  SL +NP++WNK AN+LFLESPV
Sbjct  89    QPDEKPLVLWLNGGPGCSSVGYGATQEIGPFLVDTNGLSLKLNPFAWNKVANMLFLESPV  148

Query  478   GVGFSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELA  657
             GVGFSY+ TS+DY N+GDDF ANDAY FL +WF+KFP+Y+ R FYIAGESYAGKYVPELA
Sbjct  149   GVGFSYTQTSSDYDNIGDDFTANDAYEFLQKWFVKFPTYRNRTFYIAGESYAGKYVPELA  208

Query  658   EIIVDRNKDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFN  837
             E+I D+NK PSL+IDL+GIL+GNPETSD  DW+G+VDYAWSHAV+SDETH+ I  +CDF+
Sbjct  209   ELIHDKNKGPSLYIDLKGILMGNPETSDADDWRGLVDYAWSHAVVSDETHKIIGDTCDFD  268

Query  838   SNDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVC-IDSLTGSGDNSTPVFKTTSKMMPRI  1014
             S +TWSN +C+Q V+E+LKQYKEIDIYSLYTS+C I+S   +  +   +FK +SKMMPRI
Sbjct  269   SENTWSNLECTQGVDEVLKQYKEIDIYSLYTSLCTINSTNHTSGSMEVMFKASSKMMPRI  328

Query  1015  MAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKK  1194
             M GYDPCLDDYA++YYNR DVQKALHVS G  L++W ICN+++F  W+DSK SVLPIYKK
Sbjct  329   MGGYDPCLDDYARTYYNRPDVQKALHVSDGVQLKNWSICNLTIFSNWADSKPSVLPIYKK  388

Query  1195  LIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTF  1374
             LI AG+RIWVYSGDTDGRVPVLSTRYS++ LGLPIT+ WRPWYH+KQV GW QEYEG+TF
Sbjct  389   LIGAGLRIWVYSGDTDGRVPVLSTRYSLNALGLPITKPWRPWYHEKQVSGWYQEYEGVTF  448

Query  1375  ATFRGAGHAVPTFKP  1419
             ATFRGAGHAVP FKP
Sbjct  449   ATFRGAGHAVPIFKP  463



>ref|XP_003542771.1| PREDICTED: serine carboxypeptidase-like 31-like [Glycine max]
 gb|KHN46326.1| Serine carboxypeptidase-like 31 [Glycine soja]
Length=493

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/415 (75%), Positives = 353/415 (85%), Gaps = 1/415 (0%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             DLV NLPGQP VNF+HYAGYVTVNE NGR LFYW YE+ + P EKPLVLWLNGGPGCSS+
Sbjct  59    DLVTNLPGQPRVNFQHYAGYVTVNETNGRALFYWFYEAITQPKEKPLVLWLNGGPGCSSV  118

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYGATQEIGPFLVD+D   L  N +SWNKEAN+LFLESPVGVGFSYSNTS+DY  LGD+ 
Sbjct  119   GYGATQEIGPFLVDTDGQGLKFNNFSWNKEANMLFLESPVGVGFSYSNTSSDYDQLGDEL  178

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSLFIDLRGIL  717
              ANDAY+FLH WF KFPSY+ R FYIAGESYAGKYVPELAE+I DRNKDPSL+IDL+GIL
Sbjct  179   TANDAYSFLHNWFQKFPSYRGRTFYIAGESYAGKYVPELAELIHDRNKDPSLYIDLKGIL  238

Query  718   LGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELLKQ  897
             LGNPETSD +DW G+VDYAWSHAVISDETH+TI  SCDFNS D W N+DCSQAV+E+LKQ
Sbjct  239   LGNPETSDAEDWMGLVDYAWSHAVISDETHQTIKTSCDFNSTDPWHNEDCSQAVDEVLKQ  298

Query  898   YKEIDIYSLYTSVCIDSLTGSGDNSTPV-FKTTSKMMPRIMAGYDPCLDDYAKSYYNRLD  1074
             Y EIDIYSLYTSVC  S   S D S     K +SKMMPR++ GYDPCLD YAK++YN+ D
Sbjct  299   YNEIDIYSLYTSVCFASTASSNDQSMQTSTKRSSKMMPRMLGGYDPCLDGYAKAFYNKPD  358

Query  1075  VQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGRVP  1254
             VQKALH S GH+L+ W ICN  +F+ W+DSK SV+PIYKKLI+AG+RIWVYSGDTDGRVP
Sbjct  359   VQKALHASDGHNLKKWSICNDKIFNDWADSKPSVIPIYKKLISAGLRIWVYSGDTDGRVP  418

Query  1255  VLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             VLSTRYS+S+L LPIT+ WRPWYH  +V GW +EY+GLTFATFRGAGHAVP FKP
Sbjct  419   VLSTRYSLSSLALPITKSWRPWYHDNEVSGWFEEYKGLTFATFRGAGHAVPCFKP  473



>ref|XP_003543073.1| PREDICTED: serine carboxypeptidase-like 31-like isoform 2 [Glycine 
max]
Length=472

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/414 (76%), Positives = 354/414 (86%), Gaps = 5/414 (1%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             DLV NLPGQP V+F+HYAGYVTVNE NGR LFYW YE+ + P +KPLVLWLNGGPGCSS+
Sbjct  44    DLVTNLPGQPPVDFQHYAGYVTVNETNGRALFYWFYEAMTKPQDKPLVLWLNGGPGCSSV  103

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYGATQEIGPFLVD+D   L  N +SWNKEAN+LFLESPVGVGFSYSNT+++YA LGDDF
Sbjct  104   GYGATQEIGPFLVDTDGKGLKFNNFSWNKEANILFLESPVGVGFSYSNTTSEYARLGDDF  163

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSLFIDLRGIL  717
              ANDAY FLH WFLKFPSY TR FYIAGESYAGKYVPELAE+I DRNKDPSL IDL+GIL
Sbjct  164   TANDAYTFLHNWFLKFPSYITRTFYIAGESYAGKYVPELAELIHDRNKDPSLHIDLKGIL  223

Query  718   LGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELLKQ  897
             LGNPETSD +DW GMVDYAWSHAVISDET++TI ASC+FNS+D WSN+DC+Q V+E LKQ
Sbjct  224   LGNPETSDAEDWSGMVDYAWSHAVISDETYKTIKASCEFNSSDPWSNKDCTQGVDETLKQ  283

Query  898   YKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSYYNRLDV  1077
             Y EIDIYSLYTSVC  S   S D+           MPRIM GYDPCLD+YAK++YNR DV
Sbjct  284   YNEIDIYSLYTSVCFASTARSNDHC-----GFGLQMPRIMGGYDPCLDNYAKTFYNRPDV  338

Query  1078  QKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGRVPV  1257
             QKALH S G++LR+W ICN ++F GW+ SK SV+PIYKKLI+AG+RIWVYSGDTDGRVPV
Sbjct  339   QKALHASDGYNLRNWSICNENIFKGWAQSKPSVIPIYKKLISAGLRIWVYSGDTDGRVPV  398

Query  1258  LSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             LSTRYS+S LGLPIT+ WRPWYH+K+V GW QEYEGLTFATFRGAGHAVP FKP
Sbjct  399   LSTRYSLSILGLPITKRWRPWYHEKEVSGWYQEYEGLTFATFRGAGHAVPCFKP  452



>ref|XP_003593500.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES63751.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=468

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/430 (73%), Positives = 363/430 (84%), Gaps = 1/430 (0%)
 Frame = +1

Query  133   LSSNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEK  312
             + S+K++      ++DLV NLPGQP V F+HYAGYVTVNE NGR LFYW +E+ + P++K
Sbjct  19    IVSSKDRKLSYGDNDDLVTNLPGQPPVYFQHYAGYVTVNETNGRALFYWFFEAITKPEDK  78

Query  313   PLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFS  492
             PLVLWLNGGPGCSS+GYGATQEIGPFLVD+D   L  N +SWNKEAN+LFLESPVGVGFS
Sbjct  79    PLVLWLNGGPGCSSVGYGATQEIGPFLVDTDGKGLKFNNFSWNKEANMLFLESPVGVGFS  138

Query  493   YSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVD  672
             YSNT+++YA LGDDFAANDAY FLH WFLK+PSY+TRAFYIAGESYAGKYVPELAE+I+D
Sbjct  139   YSNTTSEYAQLGDDFAANDAYTFLHNWFLKYPSYRTRAFYIAGESYAGKYVPELAELIID  198

Query  673   RNKDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTW  852
             RN DPSL IDL+GILLGNPETS  +DW GMVDYAWSHAVISDET++TI  SCDFN +D W
Sbjct  199   RNNDPSLHIDLKGILLGNPETSYAEDWLGMVDYAWSHAVISDETYKTIRRSCDFNCSDPW  258

Query  853   SNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTP-VFKTTSKMMPRIMAGYD  1029
              N++C+  V+E+LKQY EIDIYSLYTSVC  S   S D S   V K +S M+PRIM GYD
Sbjct  259   KNEECTHGVDEVLKQYNEIDIYSLYTSVCFASTARSNDQSMKMVMKHSSLMIPRIMGGYD  318

Query  1030  PCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAG  1209
             PCLDDYAK++YN+ DVQKALH S GH LR+W ICN  +F GW  +K+SV+PIYKKLI+AG
Sbjct  319   PCLDDYAKAFYNKPDVQKALHASDGHSLRNWSICNNDIFTGWKQTKQSVIPIYKKLISAG  378

Query  1210  IRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRG  1389
             +RIW+YSGDTDGRVPVLSTRYS+S L LPIT++W PWYH+K+V GW QEYEGLTFATFRG
Sbjct  379   LRIWLYSGDTDGRVPVLSTRYSLSILDLPITKQWSPWYHEKEVSGWYQEYEGLTFATFRG  438

Query  1390  AGHAVPTFKP  1419
             AGHAVP FKP
Sbjct  439   AGHAVPCFKP  448



>gb|KEH31128.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=488

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/417 (74%), Positives = 357/417 (86%), Gaps = 3/417 (1%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             DLV +LPGQP V+F+HYAGYVTVN+ NGR LFYW YE+ + P+EKPLVLWLNGGPGCSS+
Sbjct  52    DLVTHLPGQPQVDFQHYAGYVTVNKTNGRALFYWFYEAMAKPEEKPLVLWLNGGPGCSSV  111

Query  358   GYGATQEIGPFLVDS--DESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             GYGATQEIGPFLVD+  D   L  N +SWNKEAN+LFLESPVGVGFSYSNT++DY  LGD
Sbjct  112   GYGATQEIGPFLVDNNNDGQGLKFNNFSWNKEANMLFLESPVGVGFSYSNTTSDYQQLGD  171

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSLFIDLRG  711
             DF ANDAY FLH WFLKFPSY+++ FYIAGESYAGKYVPELAE+I DRNKDPSL+IDL+G
Sbjct  172   DFTANDAYNFLHNWFLKFPSYRSKTFYIAGESYAGKYVPELAELIHDRNKDPSLYIDLKG  231

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELL  891
             ILLGNPETSD +DW G+VDYAWSHAVISDETH+TI  SCDFNS+D W N+DC QAV+E+L
Sbjct  232   ILLGNPETSDAEDWMGLVDYAWSHAVISDETHKTIKTSCDFNSSDPWKNEDCDQAVDEVL  291

Query  892   KQYKEIDIYSLYTSVCIDSLTGSGDNSTPV-FKTTSKMMPRIMAGYDPCLDDYAKSYYNR  1068
             KQY EIDIYSLYTSVC  S   S  +S     K +SKMMPR+M GYDPCLDDYAK++YNR
Sbjct  292   KQYNEIDIYSLYTSVCFASTARSNGHSMQTSTKRSSKMMPRMMGGYDPCLDDYAKAFYNR  351

Query  1069  LDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGR  1248
              DVQKALH S GH+L++W ICN  +F  W+DSK +V+PIYKKLI+AG+RIWVYSGDTDGR
Sbjct  352   PDVQKALHASDGHNLKNWSICNNKIFTDWADSKPTVIPIYKKLISAGLRIWVYSGDTDGR  411

Query  1249  VPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             VPVLSTRYS+STL LP+T+ W PWYH+ +V GW +EY+GLTFATFRGAGHAVP FKP
Sbjct  412   VPVLSTRYSLSTLALPVTKPWSPWYHENEVSGWYEEYQGLTFATFRGAGHAVPCFKP  468



>ref|XP_004293521.1| PREDICTED: serine carboxypeptidase-like 31-like [Fragaria vesca 
subsp. vesca]
Length=475

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/430 (74%), Positives = 364/430 (85%), Gaps = 3/430 (1%)
 Frame = +1

Query  136   SSNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKP  315
             +  K+    + AS+DLV NLPGQP V+F+HYAGYV VNE NGR LFYW YE+++ PD KP
Sbjct  27    ARKKQPLINTLASQDLVTNLPGQPAVDFQHYAGYVNVNETNGRALFYWFYEAATNPDLKP  86

Query  316   LVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSY  495
             LVLWLNGGPGCSS+GYGATQEIGPF+V +D   L  N YSWN+EANLLFLESPVGVGFSY
Sbjct  87    LVLWLNGGPGCSSVGYGATQEIGPFIVGTDGHGLRFNNYSWNQEANLLFLESPVGVGFSY  146

Query  496   SNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDR  675
             SNT+TDY NLGD F ANDAYAFLH+WFLKFPSY+TR FYIAGESYAGKYVPELAE+I D+
Sbjct  147   SNTTTDYDNLGDAFTANDAYAFLHKWFLKFPSYRTRTFYIAGESYAGKYVPELAELINDK  206

Query  676   NKDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWS  855
             N DPS  IDL+GILLGNPETSD +DW+G+VDYAWSHAV+SDETH+ I  +CDF+  DTWS
Sbjct  207   NTDPSQHIDLKGILLGNPETSDAEDWRGLVDYAWSHAVVSDETHKIIRENCDFDG-DTWS  265

Query  856   NQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPV--FKTTSKMMPRIMAGYD  1029
             N++CSQAV+E+LKQYKEIDIYSLYTSVCI     S D S  V   K TS MMPRIM GYD
Sbjct  266   NKNCSQAVDEVLKQYKEIDIYSLYTSVCIGDTANSDDASMQVMMMKKTSTMMPRIMGGYD  325

Query  1030  PCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAG  1209
             PCLDDY+K +YNR DVQKALHVS+G  L++W IC++ +F+ W+DSK S+LPIYKKLIAAG
Sbjct  326   PCLDDYSKKFYNRADVQKALHVSNGLPLKNWSICSVKIFNNWTDSKPSILPIYKKLIAAG  385

Query  1210  IRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRG  1389
             +RIWVYSGDTDGRVPVLSTRYS+  LGLPIT+ W PWYHQKQV GW QEYEGLTFATFRG
Sbjct  386   MRIWVYSGDTDGRVPVLSTRYSLGALGLPITKAWTPWYHQKQVSGWFQEYEGLTFATFRG  445

Query  1390  AGHAVPTFKP  1419
             AGHAVP FKP
Sbjct  446   AGHAVPCFKP  455



>gb|AFK42926.1| unknown [Medicago truncatula]
Length=488

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/417 (74%), Positives = 357/417 (86%), Gaps = 3/417 (1%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             DLV +LPGQP V+F+HYAGYVTVN+ NGR LFYW YE+ + P+EKPLVLWLNGGPGCSS+
Sbjct  52    DLVTHLPGQPQVDFQHYAGYVTVNKTNGRALFYWFYEAMAKPEEKPLVLWLNGGPGCSSV  111

Query  358   GYGATQEIGPFLVDS--DESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             GYGATQEIGPFLVD+  D   L  N +SWNKEAN+LFLESPVGVGFSYSNT++DY  LGD
Sbjct  112   GYGATQEIGPFLVDNNNDGQGLKFNNFSWNKEANMLFLESPVGVGFSYSNTTSDYQQLGD  171

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSLFIDLRG  711
             DF ANDAY FLH WFLKFPSY+++ FYIAGESYAGKYVPELAE+I DRNKDPSL+IDL+G
Sbjct  172   DFTANDAYNFLHNWFLKFPSYRSKTFYIAGESYAGKYVPELAELIHDRNKDPSLYIDLKG  231

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELL  891
             ILLGNPETSD +DW G+VDYAWSHAVISDETH+TI  SCDFNS+D W N+DC QAV+E+L
Sbjct  232   ILLGNPETSDAEDWMGLVDYAWSHAVISDETHKTIKTSCDFNSSDPWKNEDCDQAVDEVL  291

Query  892   KQYKEIDIYSLYTSVCIDSLTGSGDNSTPV-FKTTSKMMPRIMAGYDPCLDDYAKSYYNR  1068
             KQY EIDIYSLYTSVC  S   S  +S     K +SKMMPR+M GYDPCLDDYAK++Y+R
Sbjct  292   KQYNEIDIYSLYTSVCFASTARSNGHSMQTSTKRSSKMMPRMMGGYDPCLDDYAKAFYSR  351

Query  1069  LDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGR  1248
              DVQKALH S GH+L++W ICN  +F  W+DSK +V+PIYKKLI+AG+RIWVYSGDTDGR
Sbjct  352   PDVQKALHASDGHNLKNWSICNNKIFTDWADSKPTVIPIYKKLISAGLRIWVYSGDTDGR  411

Query  1249  VPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             VPVLSTRYS+STL LP+T+ W PWYH+ +V GW +EY+GLTFATFRGAGHAVP FKP
Sbjct  412   VPVLSTRYSLSTLALPVTKPWSPWYHENEVSGWYEEYQGLTFATFRGAGHAVPCFKP  468



>ref|XP_010533891.1| PREDICTED: serine carboxypeptidase-like 31 isoform X1 [Tarenaya 
hassleriana]
Length=479

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/419 (75%), Positives = 355/419 (85%), Gaps = 2/419 (0%)
 Frame = +1

Query  169   ASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGC  348
             A+ DLV NLPGQP V FKHY+GYVTVNE+NGR LFYW +E+  LP++KPLVLWLNGGPGC
Sbjct  41    ANGDLVTNLPGQPDVQFKHYSGYVTVNESNGRALFYWFFEAMDLPNDKPLVLWLNGGPGC  100

Query  349   SSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLG  528
             SS+GYGATQEIGPFLVD+  + L  NPY+WNKEAN+LFLESPVGVGFSYSNT++DY NLG
Sbjct  101   SSVGYGATQEIGPFLVDTTGNGLKFNPYAWNKEANMLFLESPVGVGFSYSNTTSDYKNLG  160

Query  529   DDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVD-RNKDPSLFIDL  705
             DDF ANDAY FLH+WF +FPSYK R FYIAGESYAGKYVPELAE+I D  NK+PSL IDL
Sbjct  161   DDFTANDAYVFLHKWFERFPSYKKRTFYIAGESYAGKYVPELAEVIYDNNNKNPSLRIDL  220

Query  706   RGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNE  885
             +GILLGNPETSD +DW+G VDYAWSHAVISDETHR I  +C+F+S+DTWSN +C+ AV E
Sbjct  221   QGILLGNPETSDAEDWRGWVDYAWSHAVISDETHRVISRTCNFSSDDTWSNDECNLAVEE  280

Query  886   LLKQYKEIDIYSLYTSVCI-DSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSYY  1062
             +LKQY EIDIYSLYTSVCI DS       +    K +SKMMPR+M GYDPCLDDYA+ YY
Sbjct  281   VLKQYHEIDIYSLYTSVCIGDSARSDVKAAQFQIKRSSKMMPRLMGGYDPCLDDYARVYY  340

Query  1063  NRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTD  1242
             NR DVQKALH S G +LR+W ICNM +F  WSDSK SVLPIY+KLIA G+RIWVYSGDTD
Sbjct  341   NRPDVQKALHASDGVNLRNWSICNMEIFSNWSDSKPSVLPIYEKLIAGGLRIWVYSGDTD  400

Query  1243  GRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             GRVPVL+TRYS+S L LPI   WRPWYH+KQV GWVQEY+GLTFATFRGAGHAVP FKP
Sbjct  401   GRVPVLATRYSLSALELPIKAAWRPWYHEKQVSGWVQEYQGLTFATFRGAGHAVPCFKP  459



>ref|XP_011027907.1| PREDICTED: serine carboxypeptidase-like 31 [Populus euphratica]
Length=472

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/423 (73%), Positives = 357/423 (84%), Gaps = 1/423 (0%)
 Frame = +1

Query  154   SDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLN  333
             + Q    E LV NLPGQP VNFKHYAGY+TVNE NGR LFYW YE+++ PDEK LVLWLN
Sbjct  30    ASQPLGCEHLVTNLPGQPDVNFKHYAGYLTVNEQNGRALFYWFYEATTHPDEKALVLWLN  89

Query  334   GGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTD  513
             GGPGCSS+GYGATQEIGPF+VD++   L  NPYSWN EAN+LFLESPVGVGFSYSNT+ D
Sbjct  90    GGPGCSSVGYGATQEIGPFIVDTNGHGLKYNPYSWNTEANMLFLESPVGVGFSYSNTTND  149

Query  514   YANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL  693
             Y  +GD+F AND+YAFL +WFL FPSY+ RAFYIAGESYAGKYVPELAE+I+D+N DPSL
Sbjct  150   YHIIGDEFTANDSYAFLQKWFLMFPSYRKRAFYIAGESYAGKYVPELAELIIDKNNDPSL  209

Query  694   FIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQ  873
             +IDL+ ILLGNPETSD +DW+GMVDYAWSHAVISDETH+ I  SC+F+SN TWSN DC++
Sbjct  210   YIDLKAILLGNPETSDAEDWRGMVDYAWSHAVISDETHKIIRESCNFDSNYTWSNGDCTE  269

Query  874   AVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPV-FKTTSKMMPRIMAGYDPCLDDYA  1050
             +V+EL+KQYKEIDI+SLYTSVC+     S D    + F+ +SK MPRIM GYDPC D+YA
Sbjct  270   SVDELIKQYKEIDIFSLYTSVCMGDSASSDDRFKQIMFRPSSKKMPRIMGGYDPCRDEYA  329

Query  1051  KSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYS  1230
             K++YNR +VQKALHVS GH L++W ICN  +F+ W DSK SVLPIYKKLIA G++IWVYS
Sbjct  330   KAFYNRREVQKALHVSDGHVLKNWSICNKKIFEEWLDSKTSVLPIYKKLIARGLKIWVYS  389

Query  1231  GDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPT  1410
             GDTDG V VLSTRYS+S+LGL IT+ WRPWYHQKQV GW QEYEGLTFATFRGAGHAVP 
Sbjct  390   GDTDGGVSVLSTRYSLSSLGLQITKAWRPWYHQKQVSGWFQEYEGLTFATFRGAGHAVPI  449

Query  1411  FKP  1419
             FKP
Sbjct  450   FKP  452



>ref|XP_008442230.1| PREDICTED: serine carboxypeptidase-like 31 [Cucumis melo]
Length=489

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/417 (73%), Positives = 355/417 (85%), Gaps = 2/417 (0%)
 Frame = +1

Query  175   EDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             EDLV NLPGQP V F+H+AGYV V++++GR LFYW YE++S P +KPLVLWLNGGPGCSS
Sbjct  53    EDLVTNLPGQPPVGFRHFAGYVNVHQSHGRALFYWFYEAASSPHQKPLVLWLNGGPGCSS  112

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             +GYGATQEIGPF+VD+D + L +N YSWNKEAN+LFLESP+GVGFSYSNTS DY NLGD+
Sbjct  113   VGYGATQEIGPFIVDNDANGLKLNDYSWNKEANMLFLESPIGVGFSYSNTSNDYDNLGDE  172

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSLFIDLRGI  714
             F ANDAY FL +WFLKFPSY+   FYIAGESYAGKYVPELAE+I D+NKD S  I+L G+
Sbjct  173   FTANDAYNFLQKWFLKFPSYRNHTFYIAGESYAGKYVPELAELIHDKNKDSSFHINLHGV  232

Query  715   LLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELLK  894
             LLGNPETSD  DW+GMVDYAWSHAVISDETH+ I  SCDFNSNDTWSN +CS+AV+ELL 
Sbjct  233   LLGNPETSDSDDWRGMVDYAWSHAVISDETHKIIRESCDFNSNDTWSNNNCSEAVDELLS  292

Query  895   QYKEIDIYSLYTSVCIDSLTGSGDNS--TPVFKTTSKMMPRIMAGYDPCLDDYAKSYYNR  1068
             QYK+IDIYSLYTS+CI +   +  NS  T   K ++ MMPR+M GYDPCLD YAK++YNR
Sbjct  293   QYKQIDIYSLYTSLCIANSASAEGNSVQTLTIKRSTTMMPRMMGGYDPCLDGYAKTFYNR  352

Query  1069  LDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGR  1248
              DVQ+ALHVS GH LR+W ICN ++F+ W DSK S++PIY+KLI AG+R+W+YSGDTDGR
Sbjct  353   QDVQQALHVSDGHQLRNWSICNNTIFENWYDSKPSIIPIYEKLIGAGLRVWIYSGDTDGR  412

Query  1249  VPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             VPVLSTRYS+ +L LPIT+ WRPWYHQKQV GW QEYEGLTFATFRGAGHAVP FKP
Sbjct  413   VPVLSTRYSLKSLSLPITKAWRPWYHQKQVSGWYQEYEGLTFATFRGAGHAVPCFKP  469



>ref|XP_004146591.1| PREDICTED: serine carboxypeptidase-like 31-like [Cucumis sativus]
 gb|KGN64645.1| Serine carboxypeptidase [Cucumis sativus]
Length=485

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/418 (73%), Positives = 356/418 (85%), Gaps = 3/418 (1%)
 Frame = +1

Query  175   EDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             EDLV NLPGQP V F+H+AGYVTV++++GR LFYW YE++S P +KPLVLWLNGGPGCSS
Sbjct  48    EDLVTNLPGQPSVGFRHFAGYVTVHQSHGRALFYWFYEAASSPHQKPLVLWLNGGPGCSS  107

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             +GYGATQEIGPF+VD+D + L +N YSWNKEAN+LFLESP+GVGFSYSNTS DY NLGD+
Sbjct  108   VGYGATQEIGPFIVDNDANGLKLNDYSWNKEANMLFLESPIGVGFSYSNTSNDYDNLGDE  167

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSLFIDLRGI  714
             F ANDAY FL +WFLKFPSY+   FYIAGESYAGKYVPELAE+I D+NKD S  I+L G+
Sbjct  168   FTANDAYNFLQKWFLKFPSYRNHTFYIAGESYAGKYVPELAELIHDKNKDSSFHINLHGV  227

Query  715   LLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELLK  894
             LLGNPETSD  DW+GMVDYAWSHAVISDETH+ I  SCDFNSNDTWSN +CS+AV+ELL 
Sbjct  228   LLGNPETSDSDDWRGMVDYAWSHAVISDETHKIIRESCDFNSNDTWSNDNCSEAVDELLS  287

Query  895   QYKEIDIYSLYTSVCIDSLTGSGDNS--TPVFKTTSKMMPRIMAGYDPCLDDYAKSYYNR  1068
             QYK+IDIYSLYTS+CI +   +  NS  T   K ++ MMPR+M GYDPCLD YAK++YNR
Sbjct  288   QYKQIDIYSLYTSLCIANSASAEGNSVQTLTIKRSTTMMPRMMGGYDPCLDGYAKTFYNR  347

Query  1069  LDVQKALHV-SSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDG  1245
              DVQ+ALHV S GH L++W ICN ++FD W DSK S++PIY+KLI AG+R+W+YSGDTDG
Sbjct  348   RDVQQALHVISDGHQLKNWSICNNTIFDSWYDSKPSIIPIYEKLIGAGLRVWIYSGDTDG  407

Query  1246  RVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             RVPVLSTRYS+ +L LPIT+ WRPWYHQKQV GW QEYEGLTFATFRGAGHAVP FKP
Sbjct  408   RVPVLSTRYSLKSLSLPITKAWRPWYHQKQVSGWYQEYEGLTFATFRGAGHAVPCFKP  465



>ref|XP_002317229.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE97841.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=451

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/424 (73%), Positives = 351/424 (83%), Gaps = 23/424 (5%)
 Frame = +1

Query  148   EQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLW  327
             + S Q    E LV NLPGQP VNFKHYAGY+TVNE NGR LFYW YE+++ PD KPLVLW
Sbjct  31    QLSGQPLVDEHLVTNLPGQPDVNFKHYAGYLTVNEQNGRALFYWFYEATTHPDNKPLVLW  90

Query  328   LNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTS  507
             LNGGPGCSS+GYGATQEIGPF+VD++   L  NPYSWN EAN+LFLESPVGVGFSYSNT+
Sbjct  91    LNGGPGCSSVGYGATQEIGPFIVDTNGDGLKYNPYSWNTEANMLFLESPVGVGFSYSNTT  150

Query  508   TDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDP  687
             +DY  LGD+F AND YAFLH+WFL FPSY++RAFYIAGESYAGKYVPELAE+I D+N D 
Sbjct  151   SDYNILGDEFTANDTYAFLHKWFLLFPSYRSRAFYIAGESYAGKYVPELAELINDKNNDT  210

Query  688   SLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDC  867
             SL+IDL GILLGNPETSD +DW+GMVDYAWSHAVISDETH+ I  SC+F+SNDTWSN DC
Sbjct  211   SLYIDLNGILLGNPETSDAEDWRGMVDYAWSHAVISDETHKIIRQSCNFDSNDTWSNDDC  270

Query  868   SQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDY  1047
             ++AV+ELLKQYKEIDIYSLYTS                       MPRIM GYDPCLD+Y
Sbjct  271   AEAVDELLKQYKEIDIYSLYTS-----------------------MPRIMGGYDPCLDEY  307

Query  1048  AKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVY  1227
             AK++YNR DVQKALHVS GHHL++W ICN  +F  W + + SVLPIYKKLI AG+RIWVY
Sbjct  308   AKAFYNRPDVQKALHVSDGHHLKNWSICNTKIFVEWLEPRPSVLPIYKKLITAGLRIWVY  367

Query  1228  SGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVP  1407
             SGDTDGRVPVLSTRYS+S+LGLPIT+ WRPWYHQK+V GW QEYEGLTFATFRGAGHAVP
Sbjct  368   SGDTDGRVPVLSTRYSLSSLGLPITKAWRPWYHQKEVSGWFQEYEGLTFATFRGAGHAVP  427

Query  1408  TFKP  1419
              FKP
Sbjct  428   LFKP  431



>ref|XP_010052354.1| PREDICTED: serine carboxypeptidase-like 31 [Eucalyptus grandis]
 gb|KCW76306.1| hypothetical protein EUGRSUZ_D00682 [Eucalyptus grandis]
Length=488

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/417 (74%), Positives = 351/417 (84%), Gaps = 2/417 (0%)
 Frame = +1

Query  175   EDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYES-SSLPDEKPLVLWLNGGPGCS  351
             E LV +LPGQP VNF+H+AGYV V+E NGR LFYW YE+ +S P+EKPLVLWLNGGPGCS
Sbjct  52    EHLVTDLPGQPPVNFRHFAGYVPVDETNGRALFYWFYEADASSPEEKPLVLWLNGGPGCS  111

Query  352   SIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             S+GYGATQEIGPF+VD++   L  NPY+WNKEAN+LFLESPVGVGFSYSN+  DY  LGD
Sbjct  112   SVGYGATQEIGPFIVDANGHGLKSNPYAWNKEANMLFLESPVGVGFSYSNSINDYDILGD  171

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSLFIDLRG  711
             DF AND+Y+ LH WF KFPSY+TR FYIAGESYAGKYVPELAE+I D+NKDPSL I+L+G
Sbjct  172   DFTANDSYSVLHAWFTKFPSYRTRDFYIAGESYAGKYVPELAELIHDKNKDPSLHINLKG  231

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELL  891
             ILLGNPETSD  DW G+VDYAWSHAVISDETH  I  +CDF SN+TWSN +C +AV ELL
Sbjct  232   ILLGNPETSDADDWMGLVDYAWSHAVISDETHGVIRKTCDFASNNTWSNNECCEAVEELL  291

Query  892   KQYKEIDIYSLYTSVCI-DSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSYYNR  1068
              QY +ID+YSLYT  CI DS +    +   + K +S+MMPRIM GYDPCLD YA+++YNR
Sbjct  292   HQYNQIDMYSLYTPTCIGDSASSDNKSYQVMMKRSSRMMPRIMGGYDPCLDKYAQAFYNR  351

Query  1069  LDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGR  1248
              DVQKALHVS GHHL++W ICN  +F  W DSK SV+PIYKKLIAAG+RIWVYSGDTDGR
Sbjct  352   PDVQKALHVSDGHHLKNWSICNFKIFHDWKDSKPSVIPIYKKLIAAGLRIWVYSGDTDGR  411

Query  1249  VPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             VPVLSTRYS+S+LGLPIT+ WRPWYHQKQV GW QEYEGLTFATFRGAGHAVP FKP
Sbjct  412   VPVLSTRYSLSSLGLPITKAWRPWYHQKQVSGWYQEYEGLTFATFRGAGHAVPVFKP  468



>ref|XP_010533892.1| PREDICTED: serine carboxypeptidase-like 31 isoform X2 [Tarenaya 
hassleriana]
Length=478

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/419 (75%), Positives = 354/419 (84%), Gaps = 3/419 (1%)
 Frame = +1

Query  169   ASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGC  348
             A+ DLV NLPGQP V FKHY+GYVTVNE+NGR LFYW +E+  LP++KPLVLWLNGGPGC
Sbjct  41    ANGDLVTNLPGQPDVQFKHYSGYVTVNESNGRALFYWFFEAMDLPNDKPLVLWLNGGPGC  100

Query  349   SSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLG  528
             SS+GYGATQEIGPFLVD+  + L  NPY+WNK AN+LFLESPVGVGFSYSNT++DY NLG
Sbjct  101   SSVGYGATQEIGPFLVDTTGNGLKFNPYAWNK-ANMLFLESPVGVGFSYSNTTSDYKNLG  159

Query  529   DDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRN-KDPSLFIDL  705
             DDF ANDAY FLH+WF +FPSYK R FYIAGESYAGKYVPELAE+I D N K+PSL IDL
Sbjct  160   DDFTANDAYVFLHKWFERFPSYKKRTFYIAGESYAGKYVPELAEVIYDNNNKNPSLRIDL  219

Query  706   RGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNE  885
             +GILLGNPETSD +DW+G VDYAWSHAVISDETHR I  +C+F+S+DTWSN +C+ AV E
Sbjct  220   QGILLGNPETSDAEDWRGWVDYAWSHAVISDETHRVISRTCNFSSDDTWSNDECNLAVEE  279

Query  886   LLKQYKEIDIYSLYTSVCI-DSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSYY  1062
             +LKQY EIDIYSLYTSVCI DS       +    K +SKMMPR+M GYDPCLDDYA+ YY
Sbjct  280   VLKQYHEIDIYSLYTSVCIGDSARSDVKAAQFQIKRSSKMMPRLMGGYDPCLDDYARVYY  339

Query  1063  NRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTD  1242
             NR DVQKALH S G +LR+W ICNM +F  WSDSK SVLPIY+KLIA G+RIWVYSGDTD
Sbjct  340   NRPDVQKALHASDGVNLRNWSICNMEIFSNWSDSKPSVLPIYEKLIAGGLRIWVYSGDTD  399

Query  1243  GRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             GRVPVL+TRYS+S L LPI   WRPWYH+KQV GWVQEY+GLTFATFRGAGHAVP FKP
Sbjct  400   GRVPVLATRYSLSALELPIKAAWRPWYHEKQVSGWVQEYQGLTFATFRGAGHAVPCFKP  458



>ref|XP_002305011.2| hypothetical protein POPTR_0004s03800g [Populus trichocarpa]
 gb|EEE85522.2| hypothetical protein POPTR_0004s03800g [Populus trichocarpa]
Length=448

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/420 (72%), Positives = 345/420 (82%), Gaps = 23/420 (5%)
 Frame = +1

Query  160   QSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGG  339
             Q    E LV NLPGQP VNFKHYAGYVTVNE NGR LFYW YE+++ PDEKPLVLWLNGG
Sbjct  32    QPLGGEHLVTNLPGQPDVNFKHYAGYVTVNEQNGRALFYWFYEATTHPDEKPLVLWLNGG  91

Query  340   PGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYA  519
             PGCSS+G GATQEIGPF+VD++   L  NPYSWN EAN+LFLESPVGVGFSYSN + DY 
Sbjct  92    PGCSSVGQGATQEIGPFIVDTNGHGLKYNPYSWNTEANMLFLESPVGVGFSYSNKTNDYH  151

Query  520   NLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSLFI  699
              +GD+F AND+YAFL +WFL FPSY+ RAFYIAGESYAGKYVPELAE+I+D+N DPSL+I
Sbjct  152   IIGDEFTANDSYAFLQKWFLMFPSYRKRAFYIAGESYAGKYVPELAELIIDKNNDPSLYI  211

Query  700   DLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAV  879
             DL+ ILLGNPETSD +DW+GMVDYAWSHAVISDETH+ I  SC+F+SNDTWSN DC+++V
Sbjct  212   DLKAILLGNPETSDAEDWRGMVDYAWSHAVISDETHKIIRESCNFDSNDTWSNDDCTESV  271

Query  880   NELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSY  1059
             +EL+KQYKEIDI+SLYTS                       MPRIM GYDPC DDYAK++
Sbjct  272   DELIKQYKEIDIFSLYTS-----------------------MPRIMGGYDPCRDDYAKAF  308

Query  1060  YNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDT  1239
             YNR DVQKALHVS GH L++W ICN  +F+ W DSK SVLPIYKKLIA G++IWVYSGDT
Sbjct  309   YNRPDVQKALHVSDGHVLKNWSICNKKIFEEWPDSKTSVLPIYKKLIARGLKIWVYSGDT  368

Query  1240  DGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             DG V VLSTRYS+S+LGL IT+ WRPWYHQKQV GW QEYEGLTFATFRGAGHAVP FKP
Sbjct  369   DGGVSVLSTRYSLSSLGLQITKAWRPWYHQKQVSGWFQEYEGLTFATFRGAGHAVPIFKP  428



>ref|XP_004505005.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
31-like [Cicer arietinum]
Length=487

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/450 (69%), Positives = 353/450 (78%), Gaps = 33/450 (7%)
 Frame = +1

Query  124   RHSLSSNKEQSDQSWAS-EDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSL  300
             RH LS  + +   S  +  DLV NLPGQP VNF+HYAGYVTVNE NGR LFYW YE+ + 
Sbjct  31    RHYLSGGERKLRSSGDNGSDLVTNLPGQPQVNFQHYAGYVTVNETNGRALFYWFYEAITK  90

Query  301   PDEKPLVLWLNG-------------GPGCSSIGYGATQEIGPFLVDS--DESSLTVNPYS  435
              ++KPLVLWLNG             GPGCSS+GYGATQEIGPFLVD+  D   L  N +S
Sbjct  91    SEDKPLVLWLNGVFCPKVTRXFVVSGPGCSSVGYGATQEIGPFLVDNNNDGQGLKFNNFS  150

Query  436   WNKEANLLFLESPVGVGFSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYI  615
             WNKEAN+LFLESPVGVGFSYSNT+TDY  LGDDF ANDAY+FLH WFLKFPSY+T+ FYI
Sbjct  151   WNKEANMLFLESPVGVGFSYSNTTTDYQQLGDDFTANDAYSFLHNWFLKFPSYRTKTFYI  210

Query  616   AGESYAGKYVPELAEIIVDRNKDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVIS  795
             AGESYAGKYVPELAE+I D NKDPSL+IDL+GILLGNPETSD +DW G+VDYAWSHAVIS
Sbjct  211   AGESYAGKYVPELAELIHDSNKDPSLYIDLKGILLGNPETSDAEDWMGLVDYAWSHAVIS  270

Query  796   DETHRTIIASCDFNSNDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGS-GDNS  972
             DETH+TI  SCDFNS++ W N+DC QAV+E+LKQY EIDIYSLYTSVC  S   S GD S
Sbjct  271   DETHKTIKTSCDFNSSNPWQNEDCDQAVDEVLKQYNEIDIYSLYTSVCFASTARSNGDQS  330

Query  973   TPV-FKTTSKMMPRIMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFD  1149
                  K +SKMMPR+M GYDPCLDDYAK++YNR DVQKALH S GH+L++W ICN  +FD
Sbjct  331   VQTSTKRSSKMMPRMMGGYDPCLDDYAKAFYNRPDVQKALHASDGHNLKNWSICNNKIFD  390

Query  1150  GWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQ  1329
              W               AAG+RIWVYSGDTDGRVPVLSTRYS+STL LP+T+ WRPWYH+
Sbjct  391   DW---------------AAGLRIWVYSGDTDGRVPVLSTRYSLSTLALPVTKPWRPWYHE  435

Query  1330  KQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
              +V GW +EYEGLTFATFRGAGHAVP FKP
Sbjct  436   NEVSGWYEEYEGLTFATFRGAGHAVPCFKP  465



>ref|XP_010475997.1| PREDICTED: serine carboxypeptidase-like 31 [Camelina sativa]
Length=489

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/423 (70%), Positives = 346/423 (82%), Gaps = 8/423 (2%)
 Frame = +1

Query  175   EDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             +DLV NLPGQP V+F+HYAGYV V+E+NGR +FYW +E+  LP EKPLVLWLNGGPGCSS
Sbjct  47    QDLVTNLPGQPDVSFRHYAGYVPVDESNGRAMFYWFFEAMDLPKEKPLVLWLNGGPGCSS  106

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             +GYGATQEIGPFLVD++ + L  NPY+WNKEAN+LFLESPVGVGFSYSNTS+DY  LGDD
Sbjct  107   VGYGATQEIGPFLVDTNGNGLNFNPYAWNKEANMLFLESPVGVGFSYSNTSSDYQKLGDD  166

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDP---SLFIDL  705
             F A DAY FL  WF KFP +K   FYIAGESYAGKYVPELAE++ D N      SL I+L
Sbjct  167   FTARDAYTFLCNWFEKFPEHKESTFYIAGESYAGKYVPELAEVVYDNNNKKNGSSLHINL  226

Query  706   RGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNE  885
             +GILLGNPETSD +DW+G VDYAWSHAVISDETHR I  +C+F+S++TWSN +C++AV E
Sbjct  227   KGILLGNPETSDAEDWRGWVDYAWSHAVISDETHRIITRTCNFSSDNTWSNDECNEAVAE  286

Query  886   LLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTS-----KMMPRIMAGYDPCLDDYA  1050
             +LKQY EIDIYS+YTSVCI     S    + +FKT S     +M PR+M GYDPCLDDYA
Sbjct  287   VLKQYHEIDIYSIYTSVCIGDSARSSYFDSALFKTNSHISSKRMPPRLMGGYDPCLDDYA  346

Query  1051  KSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYS  1230
             + +YNR DVQK+LH S G +L++W ICNM +F+ W+ SK SVLPIY+KLIA G+RIWVYS
Sbjct  347   RVFYNRADVQKSLHASDGVNLKNWSICNMEIFNNWTGSKPSVLPIYEKLIAGGLRIWVYS  406

Query  1231  GDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPT  1410
             GDTDGRVPVL+TRYS+S L LPI   WRPWYH+KQV GW+QEYEGLTFATFRGAGHAVP 
Sbjct  407   GDTDGRVPVLATRYSLSALELPIKTAWRPWYHEKQVSGWLQEYEGLTFATFRGAGHAVPC  466

Query  1411  FKP  1419
             FKP
Sbjct  467   FKP  469



>ref|XP_010458486.1| PREDICTED: serine carboxypeptidase-like 31 [Camelina sativa]
Length=488

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/422 (70%), Positives = 347/422 (82%), Gaps = 7/422 (2%)
 Frame = +1

Query  175   EDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             +DLV +LPGQP V+F+HYAGYV V+E+NGR +FYW +E+  LP EKPLVLWLNGGPGCSS
Sbjct  47    QDLVTDLPGQPDVSFRHYAGYVPVDESNGRAMFYWFFEAMDLPKEKPLVLWLNGGPGCSS  106

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             +GYGATQEIGPFLVD++ + L  NPY+WNKEAN+LFLESPVGVGFSYSNTS+DY  LGDD
Sbjct  107   VGYGATQEIGPFLVDTNGNGLNFNPYAWNKEANMLFLESPVGVGFSYSNTSSDYQKLGDD  166

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRN--KDPSLFIDLR  708
             F A DAY FL  WF KFP +K   FYIAGESYAGKYVPELAE++ D N  K+ S  I+L+
Sbjct  167   FTARDAYTFLCNWFEKFPEHKESTFYIAGESYAGKYVPELAEVVYDNNNKKNGSSLINLK  226

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             GILLGNPETSD +DW+G VDYAWSHAVISDETHR I  +C+F+S++TWSN +C++AV E+
Sbjct  227   GILLGNPETSDAEDWRGWVDYAWSHAVISDETHRIITRTCNFSSDNTWSNDECNEAVAEV  286

Query  889   LKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTS-----KMMPRIMAGYDPCLDDYAK  1053
             LKQY EIDIYS+YTSVCI     S    + +FKT S     +M PR+M GYDPCLDDYA+
Sbjct  287   LKQYHEIDIYSIYTSVCIGDSARSSYFDSALFKTNSRISSKRMPPRLMGGYDPCLDDYAR  346

Query  1054  SYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSG  1233
              +YNR DVQK+LH S G +L++W ICNM +F+ W+ SK SVLPIY+KLIA G+RIWVYSG
Sbjct  347   VFYNRADVQKSLHASDGVNLKNWSICNMEIFNNWTGSKPSVLPIYEKLIAGGLRIWVYSG  406

Query  1234  DTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTF  1413
             DTDGRVPVL+TRYS+S L LPI   WRPWYH+KQV GW+QEYEGLTFATFRGAGHAVP F
Sbjct  407   DTDGRVPVLATRYSLSALELPIKTAWRPWYHEKQVSGWLQEYEGLTFATFRGAGHAVPCF  466

Query  1414  KP  1419
             KP
Sbjct  467   KP  468



>emb|CDY20978.1| BnaA08g25470D [Brassica napus]
Length=487

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/440 (67%), Positives = 349/440 (79%), Gaps = 8/440 (2%)
 Frame = +1

Query  124   RHSLSSNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLP  303
             R   S++ +Q       +DLV NLPGQP V+FKHYAGYV V+E+NGR +FYW +E+  LP
Sbjct  28    RQHRSNSPKQRSLLANEQDLVTNLPGQPHVSFKHYAGYVPVDESNGRAMFYWFFEAMDLP  87

Query  304   DEKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGV  483
              EKPLVLWLNGGPGCSS+GYGATQEIGPFLVD+ E+ LT NPY+WNKEAN+LFLESPVGV
Sbjct  88    KEKPLVLWLNGGPGCSSVGYGATQEIGPFLVDTKENGLTFNPYAWNKEANMLFLESPVGV  147

Query  484   GFSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEI  663
             GFSYSNT++DY  L DDF   DA+ FL  WF KFP +K   FYIAGESYAGKYVPELAE+
Sbjct  148   GFSYSNTTSDYQKLDDDFTGRDAFTFLCNWFEKFPEHKGNTFYIAGESYAGKYVPELAEV  207

Query  664   IVDRNKD---PSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDF  834
             + D NK     SL I+L+GILLGNPETSD +DW+G VDYAWSHAVISDETHR I  +C+F
Sbjct  208   VYDNNKKNSSSSLHINLKGILLGNPETSDAEDWRGWVDYAWSHAVISDETHRIITRTCNF  267

Query  835   NSNDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKT-----TSK  999
             +S++TWS+ +CS+AV E+ KQY EIDIYSLYTSVCI     S    +  FKT     + +
Sbjct  268   SSDNTWSDDECSEAVAEVQKQYDEIDIYSLYTSVCIGDSARSSYLDSAQFKTNAHISSKR  327

Query  1000  MMPRIMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVL  1179
             + PR + GYDPCLDDYA ++YNR DVQKALH S G +L++W+ICNM +F  W+  K SVL
Sbjct  328   VPPRRLGGYDPCLDDYASTFYNRADVQKALHASDGVNLKNWKICNMEIFHNWTYLKPSVL  387

Query  1180  PIYKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEY  1359
             PIY+KLIA G+RIWVYSGDTDGRVPVL+TRYS+S L LPI   WRPWYH+KQV GW+QEY
Sbjct  388   PIYEKLIAGGLRIWVYSGDTDGRVPVLATRYSLSALELPIKTAWRPWYHEKQVSGWLQEY  447

Query  1360  EGLTFATFRGAGHAVPTFKP  1419
             EGLTFATFRGAGHAVP+FKP
Sbjct  448   EGLTFATFRGAGHAVPSFKP  467



>ref|XP_006303174.1| hypothetical protein CARUB_v10008980mg [Capsella rubella]
 gb|EOA36072.1| hypothetical protein CARUB_v10008980mg [Capsella rubella]
Length=486

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/425 (69%), Positives = 346/425 (81%), Gaps = 8/425 (2%)
 Frame = +1

Query  169   ASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGC  348
             + +DLV +LPGQP V+F+HYAGYV V+++NGR +FYW +E+  LP EKPLVLWLNGGPGC
Sbjct  42    SEQDLVTDLPGQPDVSFRHYAGYVPVDKSNGRAMFYWFFEAMDLPKEKPLVLWLNGGPGC  101

Query  349   SSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLG  528
             SS+GYGATQEIGPFLVD++   L  NPY+WNKEAN+LFLESPVGVGFSYSNTS+DY  LG
Sbjct  102   SSVGYGATQEIGPFLVDTNGHGLNFNPYAWNKEANMLFLESPVGVGFSYSNTSSDYQKLG  161

Query  529   DDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDP---SLFI  699
             DDF A DAY FL  WF KFP +K   FYIAGESYAGKYVPELAE++ D N +    SL I
Sbjct  162   DDFTARDAYTFLCNWFEKFPEHKGNTFYIAGESYAGKYVPELAEVVYDNNNNKNGSSLHI  221

Query  700   DLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAV  879
             +L+GILLGNPETSD +DW+G VDYAWSHAVISDETHR I  +C+F+S++TWSN +C++AV
Sbjct  222   NLKGILLGNPETSDAEDWRGWVDYAWSHAVISDETHRIITRTCNFSSDNTWSNDECNEAV  281

Query  880   NELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTS-----KMMPRIMAGYDPCLDD  1044
              E+LKQY EIDIYS+YTSVCI   + S    +  FKT S     +M PR+M GYDPCLDD
Sbjct  282   AEVLKQYHEIDIYSIYTSVCIGDSSRSSYFDSSQFKTNSRISSKRMPPRLMGGYDPCLDD  341

Query  1045  YAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWV  1224
             YA+ +YNR DVQK+LH S G +L++W ICNM +F+ W+ SK SVLPIY+KLIA G+R WV
Sbjct  342   YARVFYNRADVQKSLHASDGVNLKNWSICNMEIFNNWTGSKPSVLPIYEKLIAGGLRTWV  401

Query  1225  YSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAV  1404
             YSGDTDGRVPVL+TRYS+S L LPI   WRPWYH+KQV GW+QEYEGLTFATFRGAGHAV
Sbjct  402   YSGDTDGRVPVLATRYSLSALELPIKTAWRPWYHEKQVSGWLQEYEGLTFATFRGAGHAV  461

Query  1405  PTFKP  1419
             P FKP
Sbjct  462   PCFKP  466



>ref|XP_009123830.1| PREDICTED: serine carboxypeptidase-like 31 [Brassica rapa]
Length=486

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/439 (67%), Positives = 350/439 (80%), Gaps = 7/439 (2%)
 Frame = +1

Query  124   RHSLSSNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLP  303
             R   S++ +Q       +DLV NLPGQP V+FKHYAGYV V+E+NGR +FYW +E+  LP
Sbjct  28    RQHRSNSPKQRSLLANEQDLVTNLPGQPHVSFKHYAGYVPVDESNGRAMFYWFFEAMDLP  87

Query  304   DEKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGV  483
              EKPLVLWLNGGPGCSS+GYGATQEIGPFLVD+ E+ LT NPY+WNKEAN+LFLESPVGV
Sbjct  88    KEKPLVLWLNGGPGCSSVGYGATQEIGPFLVDTKENGLTFNPYAWNKEANMLFLESPVGV  147

Query  484   GFSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEI  663
             GFSYSNT++DY  L DDF A DA+ FL  WF KFP +K   FYIAGESYAGKYVP LAE+
Sbjct  148   GFSYSNTTSDYQKLDDDFTARDAFTFLCNWFEKFPEHKGNTFYIAGESYAGKYVPVLAEV  207

Query  664   IVDRNKD--PSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFN  837
             + D NK+   SL I+L+GILLGNPETSD +DW+G VDYAWSHAVISDETHR I  +C+F+
Sbjct  208   VYDNNKNSSSSLHINLKGILLGNPETSDAEDWRGWVDYAWSHAVISDETHRIITRTCNFS  267

Query  838   SNDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKM-----  1002
             S++TWS+ +CS+AV E+ KQY EIDIYSLYTSVCI     S    +  FKT S +     
Sbjct  268   SDNTWSDDECSEAVAEVQKQYDEIDIYSLYTSVCIGDSARSSYLDSAQFKTNSHIGSKTV  327

Query  1003  MPRIMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLP  1182
              PR + GYDPCLDDYA+++YNR DVQK+LH S G +L++W+ICNM +F  W+  K SVLP
Sbjct  328   PPRRLGGYDPCLDDYARTFYNRADVQKSLHASDGVNLKNWKICNMEIFHNWTYLKPSVLP  387

Query  1183  IYKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYE  1362
             IY+KLIA G+RIWVYSGDTDGRVPVL+TRYS+S L LPI   WRPWYH+KQV GW+QEYE
Sbjct  388   IYEKLIAGGLRIWVYSGDTDGRVPVLATRYSLSALELPIKTAWRPWYHEKQVSGWLQEYE  447

Query  1363  GLTFATFRGAGHAVPTFKP  1419
             GLTFATFRGAGHAVP+FKP
Sbjct  448   GLTFATFRGAGHAVPSFKP  466



>ref|XP_006417392.1| hypothetical protein EUTSA_v10007471mg [Eutrema salsugineum]
 gb|ESQ35745.1| hypothetical protein EUTSA_v10007471mg [Eutrema salsugineum]
Length=492

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/442 (67%), Positives = 357/442 (81%), Gaps = 11/442 (2%)
 Frame = +1

Query  124   RHSLSSNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLP  303
             +H   S K++S  +    DLV +LPGQP V+FKHYAGYV V+++NGR +FYW +E+  LP
Sbjct  32    QHRFDSPKDRSLLA-NERDLVTDLPGQPDVSFKHYAGYVPVDKSNGRAMFYWFFEAMDLP  90

Query  304   DEKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGV  483
              EKPLVLWLNGGPGCSS+GYGATQEIGPFLVD++E+ L  NPY+WNKEAN+LFLESPVGV
Sbjct  91    KEKPLVLWLNGGPGCSSVGYGATQEIGPFLVDTNENGLKFNPYAWNKEANMLFLESPVGV  150

Query  484   GFSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEI  663
             GFSYSNT++DY  L DDF A DAY FL  WF +FP +K   FYIAGESYAGKYVPELAE+
Sbjct  151   GFSYSNTTSDYHKLDDDFTARDAYTFLCNWFERFPEHKGNTFYIAGESYAGKYVPELAEV  210

Query  664   IVD---RNKDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDF  834
             + D   +N   SL I+L+GILLGNPETSD +DW+G VDYAWSHAVISDETHR I  +C+F
Sbjct  211   VYDNNNKNNGSSLKINLKGILLGNPETSDAEDWRGWVDYAWSHAVISDETHRIISRTCNF  270

Query  835   NSNDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCI-DSLTGSGDNSTPVFKTTS-----  996
             +S++TWS+++CS AV E+ KQY EIDIYSLYTSVCI DS + S  +ST  FKT S     
Sbjct  271   SSDNTWSDEECSGAVAEVQKQYDEIDIYSLYTSVCIGDSASSSYLDSTKFFKTDSHISSS  330

Query  997   -KMMPRIMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKES  1173
              ++ PR + GYDPCLDDYA+++YNR DVQK+LH S G HL++W+ICNM +F  W+  K S
Sbjct  331   KRVPPRRLGGYDPCLDDYARTFYNRADVQKSLHASDGVHLKNWKICNMEIFHNWTYLKPS  390

Query  1174  VLPIYKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQ  1353
             VLPIY+KLIA G+RIWVYSGDTDGRVPVL+TRYS+S L LPI   WRPWYH+KQV GW+Q
Sbjct  391   VLPIYEKLIAGGLRIWVYSGDTDGRVPVLATRYSLSALELPIKTAWRPWYHEKQVSGWLQ  450

Query  1354  EYEGLTFATFRGAGHAVPTFKP  1419
             EYEGLTFATFRGAGHAVP+FKP
Sbjct  451   EYEGLTFATFRGAGHAVPSFKP  472



>gb|AIC80775.1| serine carboxypeptidase [Cicer arietinum]
Length=482

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/437 (69%), Positives = 343/437 (78%), Gaps = 23/437 (5%)
 Frame = +1

Query  124   RHSLSSNKEQSDQSWAS-EDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSL  300
             RH LS  + +   S  +  DLV NLPGQP VNF+HYAGYVTVNE NGR LFYW YE+ + 
Sbjct  42    RHYLSGGERKLRSSGDNGSDLVTNLPGQPQVNFQHYAGYVTVNETNGRALFYWFYEAITK  101

Query  301   PDEKPLVLWLNGGPGCSSIGYGATQEIGPFLVDS--DESSLTVNPYSWNKEANLLFLESP  474
              ++KPLVLWLNGGPGCSS+GYGATQEIGPFLVD+  D   L  N +SWNKEAN+LFLESP
Sbjct  102   SEDKPLVLWLNGGPGCSSVGYGATQEIGPFLVDNNNDGQGLKFNNFSWNKEANMLFLESP  161

Query  475   VGVGFSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPEL  654
             VGVGFSYSNT+TDY  LGDDF ANDAY+FLH WFLKFPSY+T+ FYIAGESYAGKYVPEL
Sbjct  162   VGVGFSYSNTTTDYQQLGDDFTANDAYSFLHNWFLKFPSYRTKTFYIAGESYAGKYVPEL  221

Query  655   AEIIVDRNKDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDF  834
             AE+I D NKDPSL+IDL+GILLGNPETSD +DW G+VDYAWSHAVISDETH+TI  SCDF
Sbjct  222   AELIHDSNKDPSLYIDLKGILLGNPETSDAEDWMGLVDYAWSHAVISDETHKTIKTSCDF  281

Query  835   NSNDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGS-GDNSTPV-FKTTSKMMP  1008
             NS++ W N+DC QAV+E+LKQY EIDIYSLYTSVC  S   S GD S     K +SKMMP
Sbjct  282   NSSNPWQNEDCDQAVDEVLKQYNEIDIYSLYTSVCFASTARSNGDQSVQTSTKRSSKMMP  341

Query  1009  RIMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIY  1188
             R+M GYDPCLDDYAK++YNR DVQKALH S GH+L++W ICN  +FD W+          
Sbjct  342   RMMGGYDPCLDDYAKAFYNRPDVQKALHASDGHNLKNWSICNNKIFDDWAQQDLGF----  397

Query  1189  KKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGL  1368
                           G TDGRVPVLSTRYS+STL LP+T+ WRPWYH+ +V GW +EYEGL
Sbjct  398   --------------GFTDGRVPVLSTRYSLSTLALPVTKPWRPWYHENEVSGWYEEYEGL  443

Query  1369  TFATFRGAGHAVPTFKP  1419
             TFATFRGAGHAVP FKP
Sbjct  444   TFATFRGAGHAVPCFKP  460



>ref|XP_002892617.1| hypothetical protein ARALYDRAFT_471242 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68876.1| hypothetical protein ARALYDRAFT_471242 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/425 (69%), Positives = 343/425 (81%), Gaps = 10/425 (2%)
 Frame = +1

Query  175   EDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             +DLV +LPGQP VNF+HYAGYV V+E+NGR +FYW +E+  LP EKPLVLWLNGGPGCSS
Sbjct  48    QDLVTDLPGQPDVNFRHYAGYVPVDESNGRAMFYWFFEAMDLPKEKPLVLWLNGGPGCSS  107

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             +GYGATQEIGPFLVD++ + L  NPY+WNKEAN+LFLESPVGVGFSYSNTS+DY  LGDD
Sbjct  108   VGYGATQEIGPFLVDTNGNGLNFNPYAWNKEANMLFLESPVGVGFSYSNTSSDYQKLGDD  167

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKD-----PSLFI  699
             F A DAY FL  WF KFP +K   FYIAGESYAGKYVPELAE++ D N +      S  I
Sbjct  168   FTARDAYIFLCNWFEKFPEHKESTFYIAGESYAGKYVPELAEVVYDNNNNNKKNGSSFHI  227

Query  700   DLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAV  879
             +L+GILLGNPETSD +DW+G VDYAWSHAVISDETHR I  +C+F+S +TWSN +C++AV
Sbjct  228   NLKGILLGNPETSDAEDWRGWVDYAWSHAVISDETHRIITRTCNFSSENTWSNDECNEAV  287

Query  880   NELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTS-----KMMPRIMAGYDPCLDD  1044
              E+LKQY EIDIYS+YTSVCI     S    +  FKT S     +M PR+M GYDPCLDD
Sbjct  288   AEVLKQYHEIDIYSIYTSVCIGDSARSSYFDSVQFKTNSRISSKRMPPRLMGGYDPCLDD  347

Query  1045  YAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWV  1224
             YA+ +YNR DVQK+LH S G +L++W ICNM +F+ W+ S  SVLPIY+KLIA G+RIWV
Sbjct  348   YARVFYNRADVQKSLHASDGVNLKNWSICNMEIFNNWTGSNPSVLPIYEKLIAGGLRIWV  407

Query  1225  YSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAV  1404
             YSGDTDGRVPVL+TRYS+S L LPI   WRPWYH+KQV GW+QEYEGLTFATFRGAGHAV
Sbjct  408   YSGDTDGRVPVLATRYSLSALELPIKTAWRPWYHEKQVSGWLQEYEGLTFATFRGAGHAV  467

Query  1405  PTFKP  1419
             P FKP
Sbjct  468   PCFKP  472



>emb|CDY20588.1| BnaC08g14700D [Brassica napus]
Length=487

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/440 (67%), Positives = 350/440 (80%), Gaps = 8/440 (2%)
 Frame = +1

Query  124   RHSLSSNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLP  303
             R   S++ +Q       +DLV NLPGQP V+FKHYAGYV V+E+NGR +FYW +E+  LP
Sbjct  28    RQHRSNSPKQRSLLANEQDLVTNLPGQPHVSFKHYAGYVPVDESNGRAMFYWFFEAMDLP  87

Query  304   DEKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGV  483
              EKPLVLWLNGGPGCSS+GYGATQEIGPFLVD+ E+ LT NPY+WNK+AN+LFLESPVGV
Sbjct  88    KEKPLVLWLNGGPGCSSVGYGATQEIGPFLVDTKENGLTFNPYAWNKKANMLFLESPVGV  147

Query  484   GFSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEI  663
             GFSYSNT++DY  L DDF   DA+ FL  WF KFP +K   FYIAGESYAGKYVPELAE+
Sbjct  148   GFSYSNTTSDYQKLDDDFTGRDAFTFLCNWFEKFPEHKGNTFYIAGESYAGKYVPELAEV  207

Query  664   IVDRNKD---PSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDF  834
             + D NK     SL I+L+GILLGNPETSD +DW+G VDYAWSHAVISDETHR I  +C+F
Sbjct  208   VYDNNKKNSSSSLHINLKGILLGNPETSDAEDWRGWVDYAWSHAVISDETHRIITRTCNF  267

Query  835   NSNDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTS-----K  999
             +S++TWS+ +CS+AV E+ KQY EIDIYSLYTSVCI     S    +  FK+ S     +
Sbjct  268   SSDNTWSDDECSEAVAEVQKQYDEIDIYSLYTSVCIGDPARSYYLDSAQFKSNSHISSKR  327

Query  1000  MMPRIMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVL  1179
             + PR + GYDPCLDDYA+++YNR DVQK+LH S G +L++W+ICNM +F  W+  K SVL
Sbjct  328   VPPRRLGGYDPCLDDYARTFYNRADVQKSLHASDGVNLKNWKICNMGIFHNWTYLKPSVL  387

Query  1180  PIYKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEY  1359
             PIY+KLIA G+RIWVYSGDTDGRVPVL+TRYS+S L LPI   WRPWYH+KQV GW+QEY
Sbjct  388   PIYEKLIAGGLRIWVYSGDTDGRVPVLATRYSLSALELPIKTAWRPWYHEKQVSGWLQEY  447

Query  1360  EGLTFATFRGAGHAVPTFKP  1419
             EGLTFATFRGAGHAVP+FKP
Sbjct  448   EGLTFATFRGAGHAVPSFKP  467



>ref|NP_172575.2| serine carboxypeptidase-like 31 [Arabidopsis thaliana]
 sp|O04084.2|SCP31_ARATH RecName: Full=Serine carboxypeptidase-like 31; Flags: Precursor 
[Arabidopsis thaliana]
 gb|ABO38794.1| At1g11080 [Arabidopsis thaliana]
 gb|AEE28680.1| serine carboxypeptidase-like 31 [Arabidopsis thaliana]
Length=492

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/425 (68%), Positives = 342/425 (80%), Gaps = 10/425 (2%)
 Frame = +1

Query  175   EDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             +DLV  LPGQP V+F+HYAGYV V+E+NGR +FYW +E+  LP EKPLVLWLNGGPGCSS
Sbjct  48    QDLVTGLPGQPDVSFRHYAGYVPVDESNGRAMFYWFFEAMDLPKEKPLVLWLNGGPGCSS  107

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             +GYGATQEIGPFLVD++ + L  NPY+WNKEAN+LFLESPVGVGFSYSNTS+DY  LGDD
Sbjct  108   VGYGATQEIGPFLVDTNGNGLNFNPYAWNKEANMLFLESPVGVGFSYSNTSSDYQKLGDD  167

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVD-----RNKDPSLFI  699
             F A DAY FL  WF KFP +K   FYIAGESYAGKYVPELAE++ D     +    S  I
Sbjct  168   FTARDAYTFLCNWFEKFPEHKENTFYIAGESYAGKYVPELAEVVYDNNNNNKKNGSSFHI  227

Query  700   DLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAV  879
             +L+GILLGNPETSD +DW+G VDYAWSHAVISDETHR I  +C+F+S++TWSN +C++AV
Sbjct  228   NLKGILLGNPETSDAEDWRGWVDYAWSHAVISDETHRIITRTCNFSSDNTWSNDECNEAV  287

Query  880   NELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTS-----KMMPRIMAGYDPCLDD  1044
              E+LKQY EIDIYS+YTSVCI     S    +  FKT S     +M PR+M GYDPCLDD
Sbjct  288   AEVLKQYHEIDIYSIYTSVCIGDSARSSYFDSAQFKTNSRISSKRMPPRLMGGYDPCLDD  347

Query  1045  YAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWV  1224
             YA+ +YNR DVQK+LH S G +L++W ICNM +F+ W+ S  SVLPIY+KLIA G+RIWV
Sbjct  348   YARVFYNRADVQKSLHASDGVNLKNWSICNMEIFNNWTGSNPSVLPIYEKLIAGGLRIWV  407

Query  1225  YSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAV  1404
             YSGDTDGRVPVL+TRYS++ L LPI   WRPWYH+KQV GW+QEYEGLTFATFRGAGHAV
Sbjct  408   YSGDTDGRVPVLATRYSLNALELPIKTAWRPWYHEKQVSGWLQEYEGLTFATFRGAGHAV  467

Query  1405  PTFKP  1419
             P FKP
Sbjct  468   PCFKP  472



>ref|NP_001184957.1| serine carboxypeptidase-like 31 [Arabidopsis thaliana]
 gb|AEE28681.1| serine carboxypeptidase-like 31 [Arabidopsis thaliana]
Length=495

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/425 (68%), Positives = 342/425 (80%), Gaps = 10/425 (2%)
 Frame = +1

Query  175   EDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             +DLV  LPGQP V+F+HYAGYV V+E+NGR +FYW +E+  LP EKPLVLWLNGGPGCSS
Sbjct  48    QDLVTGLPGQPDVSFRHYAGYVPVDESNGRAMFYWFFEAMDLPKEKPLVLWLNGGPGCSS  107

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             +GYGATQEIGPFLVD++ + L  NPY+WNKEAN+LFLESPVGVGFSYSNTS+DY  LGDD
Sbjct  108   VGYGATQEIGPFLVDTNGNGLNFNPYAWNKEANMLFLESPVGVGFSYSNTSSDYQKLGDD  167

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVD-----RNKDPSLFI  699
             F A DAY FL  WF KFP +K   FYIAGESYAGKYVPELAE++ D     +    S  I
Sbjct  168   FTARDAYTFLCNWFEKFPEHKENTFYIAGESYAGKYVPELAEVVYDNNNNNKKNGSSFHI  227

Query  700   DLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAV  879
             +L+GILLGNPETSD +DW+G VDYAWSHAVISDETHR I  +C+F+S++TWSN +C++AV
Sbjct  228   NLKGILLGNPETSDAEDWRGWVDYAWSHAVISDETHRIITRTCNFSSDNTWSNDECNEAV  287

Query  880   NELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTS-----KMMPRIMAGYDPCLDD  1044
              E+LKQY EIDIYS+YTSVCI     S    +  FKT S     +M PR+M GYDPCLDD
Sbjct  288   AEVLKQYHEIDIYSIYTSVCIGDSARSSYFDSAQFKTNSRISSKRMPPRLMGGYDPCLDD  347

Query  1045  YAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWV  1224
             YA+ +YNR DVQK+LH S G +L++W ICNM +F+ W+ S  SVLPIY+KLIA G+RIWV
Sbjct  348   YARVFYNRADVQKSLHASDGVNLKNWSICNMEIFNNWTGSNPSVLPIYEKLIAGGLRIWV  407

Query  1225  YSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAV  1404
             YSGDTDGRVPVL+TRYS++ L LPI   WRPWYH+KQV GW+QEYEGLTFATFRGAGHAV
Sbjct  408   YSGDTDGRVPVLATRYSLNALELPIKTAWRPWYHEKQVSGWLQEYEGLTFATFRGAGHAV  467

Query  1405  PTFKP  1419
             P FKP
Sbjct  468   PCFKP  472



>ref|XP_007159281.1| hypothetical protein PHAVU_002G224800g [Phaseolus vulgaris]
 gb|ESW31275.1| hypothetical protein PHAVU_002G224800g [Phaseolus vulgaris]
Length=397

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/374 (76%), Positives = 323/374 (86%), Gaps = 1/374 (0%)
 Frame = +1

Query  301   PDEKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVG  480
             P+EKPLVLWLNGGPGCSS+GYGATQEIGPFLVD+D   L  N +SWN+EA++LFLESPVG
Sbjct  4     PEEKPLVLWLNGGPGCSSVGYGATQEIGPFLVDTDGQGLKFNNFSWNREASMLFLESPVG  63

Query  481   VGFSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAE  660
             VGFSYSNTS+DY  LGDD  ANDAY+FL  WF KFPSY+TR FYIAGESYAGKYVPELAE
Sbjct  64    VGFSYSNTSSDYDQLGDDLTANDAYSFLRNWFQKFPSYRTRPFYIAGESYAGKYVPELAE  123

Query  661   IIVDRNKDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNS  840
             +I DRNKDPSL+IDL+GILLGNPETSD +DW G+VDYAWSHAVISDETH+ I  SCDFNS
Sbjct  124   LIHDRNKDPSLYIDLKGILLGNPETSDAEDWMGLVDYAWSHAVISDETHKIIKTSCDFNS  183

Query  841   NDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPV-FKTTSKMMPRIM  1017
             +D W NQDCSQAV+E+LKQY EIDIYSLYTSVC  S   S D S     K TSKMMPR++
Sbjct  184   SDPWRNQDCSQAVDEVLKQYNEIDIYSLYTSVCFASTARSDDQSMQTSMKLTSKMMPRML  243

Query  1018  AGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKL  1197
              GYDPCLDDYAK++YN+ DVQKALH S GH+L++W ICN  +F+ W+DSK SV+PIYKKL
Sbjct  244   GGYDPCLDDYAKAFYNKPDVQKALHASDGHNLKNWSICNNKIFNDWADSKPSVIPIYKKL  303

Query  1198  IAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFA  1377
             I+AG+RIWVYSGDTDGRVPVLSTRYS+S+L LP+T+ WRPWYH+ +V GW +EYEGLTFA
Sbjct  304   ISAGLRIWVYSGDTDGRVPVLSTRYSLSSLALPVTKSWRPWYHENEVSGWFEEYEGLTFA  363

Query  1378  TFRGAGHAVPTFKP  1419
             TFRGAGHAVP FKP
Sbjct  364   TFRGAGHAVPCFKP  377



>emb|CDX97930.1| BnaA06g06810D [Brassica napus]
Length=490

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/440 (67%), Positives = 352/440 (80%), Gaps = 9/440 (2%)
 Frame = +1

Query  124   RHSLSSNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLP  303
             +H   S K++S  +   +DLV +LPGQP V+F+HYAGYV V+E+NGR +FYW +E+  LP
Sbjct  32    QHRFDSPKQKSLLA-NEQDLVTDLPGQPDVSFRHYAGYVPVDESNGRAMFYWFFEAMDLP  90

Query  304   DEKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGV  483
              EKPLVLWLNGGPGCSS+GYGATQEIGPFLVD++E+ L  NPY+WNKEAN+LFLESPVGV
Sbjct  91    KEKPLVLWLNGGPGCSSVGYGATQEIGPFLVDANENGLKFNPYAWNKEANMLFLESPVGV  150

Query  484   GFSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEI  663
             GFSYSNT++DY  L DDF   DA++FL  WF KFP +K   FYIAGESYAGKYVPELAE+
Sbjct  151   GFSYSNTTSDYQKLDDDFTGRDAFSFLCNWFEKFPEHKGNTFYIAGESYAGKYVPELAEV  210

Query  664   IVD---RNKDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDF  834
             + D   +N   SL I+L+GILLGNPETSD  DW+G VDYAWSHAVISDETHR I  +C+F
Sbjct  211   VYDNNNKNNGSSLHINLKGILLGNPETSDADDWRGWVDYAWSHAVISDETHRIITRTCNF  270

Query  835   NSNDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTS-----K  999
             +S++TWS+ +CS+AV+E+ KQY EIDIYSLYTSVCI     S    +  FKT S     +
Sbjct  271   SSDNTWSDDECSEAVDEVQKQYDEIDIYSLYTSVCIGDSARSSYLDSKQFKTNSHTSSKR  330

Query  1000  MMPRIMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVL  1179
             + PR + GYDPCLDDYA+ +YNR DVQK+LH S G +L+DWRICNM +F  W+  K SVL
Sbjct  331   VPPRRLGGYDPCLDDYARIFYNRGDVQKSLHASDGVNLKDWRICNMDIFHNWTYIKPSVL  390

Query  1180  PIYKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEY  1359
             PIY+KLIA G+RIWVYSGDTDGRVPVL+TRYS+S L LPI   WRPWYH+KQV GW+QEY
Sbjct  391   PIYEKLIAGGLRIWVYSGDTDGRVPVLATRYSLSALELPIKTAWRPWYHEKQVSGWLQEY  450

Query  1360  EGLTFATFRGAGHAVPTFKP  1419
             EGLTFATFRGAGHAVP+FKP
Sbjct  451   EGLTFATFRGAGHAVPSFKP  470



>ref|XP_003593501.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES63752.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=476

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/418 (68%), Positives = 341/418 (82%), Gaps = 5/418 (1%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             DLV NLPGQP  +FKHYAGYV VNE NGR LFYW +E+ + P+EKPL+LWLNGGPGCSS+
Sbjct  40    DLVTNLPGQPQADFKHYAGYVIVNETNGRSLFYWFFEAVTKPEEKPLLLWLNGGPGCSSV  99

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYGATQEIGPFLVD+D   L  N +SWN+EANLLFLESPVGVGFSYSNT+++Y  LGDDF
Sbjct  100   GYGATQEIGPFLVDTDGKGLKFNNFSWNREANLLFLESPVGVGFSYSNTTSEYKQLGDDF  159

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSLFIDLRGIL  717
              AND Y FLH+WFLKFPSY+TRA YI GESY G +VP+LAE+I+DRNKDPSL IDL+GIL
Sbjct  160   TANDTYTFLHKWFLKFPSYRTRALYIGGESYGGHFVPQLAEVILDRNKDPSLHIDLKGIL  219

Query  718   LGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQD--CSQAVNELL  891
             +GNPETS  +DW GM+DYAWSHAVISDETH+ +  +C+F S++   ++D  C++ ++E+ 
Sbjct  220   VGNPETSYAEDWWGMIDYAWSHAVISDETHKLLKTNCEFKSSEDILSKDDVCNKGLDEMF  279

Query  892   KQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSK--MMPRIMAGYDPCLDDYAKSYYN  1065
             KQY EIDIYSLYT  C+ +  G       V K +S   M+P++M GYDPCLDDYAK +YN
Sbjct  280   KQYNEIDIYSLYTPTCLAN-KGISKPMQKVMKRSSNKDMIPKVMGGYDPCLDDYAKIFYN  338

Query  1066  RLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDG  1245
             R DVQKALH S GH+L++W ICN  +F  W+ SK S++PIYKKLI  G+RIW+YSGDTDG
Sbjct  339   RPDVQKALHASDGHNLKNWSICNDDIFHDWAQSKRSIIPIYKKLIPTGLRIWLYSGDTDG  398

Query  1246  RVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             RVPVLSTRYSI+ LGLPIT+ W PWY++KQV GW QEY+GLTFATFRGAGH VPTFKP
Sbjct  399   RVPVLSTRYSINLLGLPITKPWSPWYNEKQVSGWYQEYKGLTFATFRGAGHDVPTFKP  456



>ref|XP_009148441.1| PREDICTED: serine carboxypeptidase-like 31 [Brassica rapa]
Length=490

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/440 (67%), Positives = 352/440 (80%), Gaps = 9/440 (2%)
 Frame = +1

Query  124   RHSLSSNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLP  303
             +H   S K++S  +   +DLV +LPGQP V+F+HYAGYV V+E+NGR +FYW +E+  LP
Sbjct  32    QHRFDSPKQKSLLA-NEQDLVTDLPGQPDVSFRHYAGYVPVDESNGRAMFYWFFEAMDLP  90

Query  304   DEKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGV  483
              EKPLVLWLNGGPGCSS+GYGATQEIGPFLVD++E+ L  NPY+WNKEAN+LFLESPVGV
Sbjct  91    KEKPLVLWLNGGPGCSSVGYGATQEIGPFLVDANENGLKFNPYAWNKEANMLFLESPVGV  150

Query  484   GFSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEI  663
             GFSYSNT++DY  L DDF A DA++FL  WF KFP +K   FYIAGESYAGKYVPELAE+
Sbjct  151   GFSYSNTTSDYQKLDDDFTARDAFSFLCNWFEKFPEHKGNTFYIAGESYAGKYVPELAEV  210

Query  664   IVD---RNKDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDF  834
             + D   +N   SL I+L+GILLGNPETSD  DW+G VDYAWSHAVISDETHR I  +C+F
Sbjct  211   VYDNNNKNNGSSLHINLKGILLGNPETSDADDWRGWVDYAWSHAVISDETHRIITRTCNF  270

Query  835   NSNDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTS-----K  999
             +S++TWS+ +CS+AV+E+ KQY EIDIYSLYTSVCI     S    +  FKT S     +
Sbjct  271   SSDNTWSDDECSEAVDEVQKQYDEIDIYSLYTSVCIGDSARSSYLDSKQFKTNSHTSSKR  330

Query  1000  MMPRIMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVL  1179
             + PR + GYDPCLDDYA+ +YNR DVQK+LH S G +L+DWRICNM +F  W+  K SVL
Sbjct  331   VPPRRLGGYDPCLDDYARIFYNRADVQKSLHASDGVNLKDWRICNMDIFHNWTYIKPSVL  390

Query  1180  PIYKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEY  1359
             PIY+KLIA G+RIWVYSGDTDGRVPVL+TRYS+S L L I   WRPWYH+KQV GW+QEY
Sbjct  391   PIYEKLIAGGLRIWVYSGDTDGRVPVLATRYSLSALELLIKTAWRPWYHEKQVSGWLQEY  450

Query  1360  EGLTFATFRGAGHAVPTFKP  1419
             EGLTFATFRGAGHAVP+FKP
Sbjct  451   EGLTFATFRGAGHAVPSFKP  470



>ref|XP_006301500.1| hypothetical protein CARUB_v10021926mg [Capsella rubella]
 gb|EOA34398.1| hypothetical protein CARUB_v10021926mg [Capsella rubella]
Length=462

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/426 (68%), Positives = 340/426 (80%), Gaps = 8/426 (2%)
 Frame = +1

Query  154   SDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLN  333
             SD   A  DLV +LPGQ  VNF+HYAGYV V+  NGR LFYW +E+ SLP++KPLVLWLN
Sbjct  21    SDSQDAMRDLVTDLPGQSSVNFRHYAGYVPVDRKNGRALFYWFFEAMSLPNQKPLVLWLN  80

Query  334   GGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTD  513
             GGPGCSS+GYGA QEIGPFLVD+  +SL  NPY+WN EAN+LFLESPVGVGFSYSNT+TD
Sbjct  81    GGPGCSSVGYGAIQEIGPFLVDNKGNSLKFNPYAWNHEANILFLESPVGVGFSYSNTTTD  140

Query  514   YANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKD-PS  690
             Y  +GDDF A DAYAF+ +W  +FP+Y+   FYIAGESYAGKY+PELAE++ D+NKD  S
Sbjct  141   YKKIGDDFTARDAYAFIQKWLERFPAYRGNDFYIAGESYAGKYIPELAEVVYDKNKDNSS  200

Query  691   LFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCS  870
               I L+GILLGNPETSD +DW+G VDYAWSHAVISDET+  I  +C+F+SN TW  ++C 
Sbjct  201   RHIKLKGILLGNPETSDAEDWKGYVDYAWSHAVISDETYGVISRTCNFSSNTTWDVRECK  260

Query  871   QAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKT---TSKMMPRIMAGYDPCLD  1041
             + V+E++KQY +ID YSLYT  CI S T    NST  FKT    SKMMPR+M GYDPCLD
Sbjct  261   EGVDEIVKQYHQIDQYSLYTPPCIKSSTL---NSTG-FKTNLANSKMMPRMMGGYDPCLD  316

Query  1042  DYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIW  1221
             DY++ ++NR DVQKALH S G HL++W ICN  +FD W+DSK SVLPIYKKLIA GIRIW
Sbjct  317   DYSRVFFNRADVQKALHASDGIHLKNWSICNDDIFDNWADSKPSVLPIYKKLIAGGIRIW  376

Query  1222  VYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHA  1401
             VYSGDTDGRVPVL TRY I+ L LPI   WRPWYH+KQV GW QEYEGLTFATF+G GH 
Sbjct  377   VYSGDTDGRVPVLGTRYCINKLELPIKTTWRPWYHEKQVSGWFQEYEGLTFATFKGVGHD  436

Query  1402  VPTFKP  1419
             VP+FKP
Sbjct  437   VPSFKP  442



>emb|CDY19338.1| BnaC05g08470D [Brassica napus]
Length=489

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/440 (67%), Positives = 348/440 (79%), Gaps = 10/440 (2%)
 Frame = +1

Query  124   RHSLSSNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLP  303
             +H   S K +S  +    DLV +LPGQP V+F+HYAGYV V+E+NGR +FYW +E+  LP
Sbjct  32    QHRFDSPKHKSLLA-NERDLVTDLPGQPDVSFRHYAGYVPVDESNGRAMFYWFFEAMDLP  90

Query  304   DEKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGV  483
              EKPLVLWLNGGPGCSS+GYGATQEIGPFLVD++E+ L  NPY+WNK AN+LFLESPVGV
Sbjct  91    KEKPLVLWLNGGPGCSSVGYGATQEIGPFLVDANENGLKFNPYAWNK-ANMLFLESPVGV  149

Query  484   GFSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEI  663
             GFSYSNT++DY  L DDF   DA+ FL  WF KFP +K   FYIAGESYAGKYVPELAE+
Sbjct  150   GFSYSNTTSDYQKLDDDFTGRDAFNFLCNWFEKFPEHKGNTFYIAGESYAGKYVPELAEV  209

Query  664   IVD---RNKDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDF  834
             + D   +N   SL I+L+GILLGNPETSD  DW+G VDYAWSHAVISDETHR I  +C+F
Sbjct  210   VYDNNNKNNGSSLHINLKGILLGNPETSDADDWRGWVDYAWSHAVISDETHRIITRTCNF  269

Query  835   NSNDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTS-----K  999
             +S++TWS+ +CS+AV+E+ KQY EIDIYSLYTSVCI     S    +  FKT S     +
Sbjct  270   SSDNTWSDDECSEAVDEVQKQYDEIDIYSLYTSVCIGDSARSSYLDSKKFKTNSHTSSKR  329

Query  1000  MMPRIMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVL  1179
             + PR + GYDPCLDDYA+ +YNR DVQK+LH S G +L+DWRICNM +F  W+  K SVL
Sbjct  330   VPPRRLGGYDPCLDDYARIFYNRADVQKSLHASDGVNLKDWRICNMDIFHNWTYIKPSVL  389

Query  1180  PIYKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEY  1359
             PIY+KLIA G+RIWVYSGDTDGRVPVL+TRYS+S L LPI   WRPWYH+KQV GW+QEY
Sbjct  390   PIYEKLIAGGLRIWVYSGDTDGRVPVLATRYSLSALELPIKTAWRPWYHEKQVSGWLQEY  449

Query  1360  EGLTFATFRGAGHAVPTFKP  1419
             EGLTFATFRGAGHAVP+FKP
Sbjct  450   EGLTFATFRGAGHAVPSFKP  469



>ref|XP_006392053.1| hypothetical protein EUTSA_v10023955mg [Eutrema salsugineum]
 gb|ESQ29339.1| hypothetical protein EUTSA_v10023955mg [Eutrema salsugineum]
Length=470

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/427 (67%), Positives = 337/427 (79%), Gaps = 5/427 (1%)
 Frame = +1

Query  154   SDQSWASEDLVANLPGQP-IVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWL  330
             SD S A  DLV +LPGQ   ++ +HYAGYV VN+ NGR +FYW +E+ SLP++KPLVLWL
Sbjct  24    SDSSEAMRDLVTDLPGQSGTMSIRHYAGYVPVNKTNGRAMFYWFFEAMSLPNQKPLVLWL  83

Query  331   NGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTST  510
             NGGPGCSS+GYGATQEIGPFLVD+  +S+  NPY+WNKEAN+LFLESPVGVGFSYSNTS+
Sbjct  84    NGGPGCSSVGYGATQEIGPFLVDNKGNSIKFNPYAWNKEANMLFLESPVGVGFSYSNTSS  143

Query  511   DYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKD-P  687
             DY  LGDDF A D YAF+ +W  +FP+Y+   FYIAGESYAGKY+PELAEII D+N D  
Sbjct  144   DYKELGDDFTARDTYAFIQKWLQRFPAYRENHFYIAGESYAGKYIPELAEIIFDKNNDNS  203

Query  688   SLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDC  867
             SL I L+GILLGNPE S+ +DW+G VDYAWSHAVISDET+  I  SC+F+SN  W  ++C
Sbjct  204   SLHIKLKGILLGNPEISEAEDWEGWVDYAWSHAVISDETYGVIKRSCNFSSNTIWDVKEC  263

Query  868   SQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTT---SKMMPRIMAGYDPCL  1038
                V+E+LKQY +ID YSLYT  CI + T +    +  FKT+   SKMMPRIM GYDPCL
Sbjct  264   KDGVDEVLKQYHKIDQYSLYTPTCIGNSTLASSVDSTRFKTSLANSKMMPRIMGGYDPCL  323

Query  1039  DDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRI  1218
             DDY + +YNR DVQKALH S G HL++W ICN  +F  W+DSK SVLPIYKKLIA G RI
Sbjct  324   DDYTRVFYNRADVQKALHASDGIHLKNWNICNDDIFHNWADSKPSVLPIYKKLIAGGFRI  383

Query  1219  WVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGH  1398
             WVYSGDTDGR PVL TRY I+ L LPI   WRPWYH+KQV GW+QEYEGLTFATF+GAGH
Sbjct  384   WVYSGDTDGRAPVLGTRYCINKLELPIKTSWRPWYHEKQVSGWLQEYEGLTFATFKGAGH  443

Query  1399  AVPTFKP  1419
              VP+FKP
Sbjct  444   DVPSFKP  450



>ref|XP_010473313.1| PREDICTED: serine carboxypeptidase-like 32 [Camelina sativa]
Length=450

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/426 (65%), Positives = 337/426 (79%), Gaps = 4/426 (1%)
 Frame = +1

Query  154   SDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLN  333
             SD   A  DLV +LPGQ  V+FKHYAGYV V++ NGR +FYW +E+  LP++KPLVLWLN
Sbjct  5     SDNQEAMRDLVTDLPGQSSVSFKHYAGYVPVDKKNGRAMFYWFFEAMRLPNQKPLVLWLN  64

Query  334   GGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTD  513
             GGPGCSS+GYGA QEIGPFLVD+  +SL  NP++WN  AN+LFLESPVGVGFSYSNT+TD
Sbjct  65    GGPGCSSVGYGAIQEIGPFLVDNKGNSLKFNPHAWNHVANILFLESPVGVGFSYSNTTTD  124

Query  514   YANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKD-PS  690
             Y  +GDDF A DAYAF+ +W  +FP+Y+   FYIAGESYAGKY+PELAE++ D+N D  S
Sbjct  125   YKKIGDDFTARDAYAFIQKWLERFPAYRENDFYIAGESYAGKYIPELAEVVYDKNIDNSS  184

Query  691   LFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCS  870
               I L+GILLGNPETS+ +DW+G VDYAWSHAVISDET+  I  +C+F+SN TW  ++C 
Sbjct  185   RHIKLKGILLGNPETSEAEDWKGYVDYAWSHAVISDETYGVISRTCNFSSNTTWDVKECK  244

Query  871   QAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKT---TSKMMPRIMAGYDPCLD  1041
             + V+E++KQY +ID YSLYT  CI + T +    +  FKT    SKM+PR+M GYDPCLD
Sbjct  245   EGVDEIIKQYHQIDQYSLYTPTCIKNSTLNSSVDSTRFKTNLANSKMIPRLMGGYDPCLD  304

Query  1042  DYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIW  1221
             DY++ ++NR DVQKALH S G HL++W ICN  +FD W+DSK SVLPIYKKLIA GIRIW
Sbjct  305   DYSRIFFNRADVQKALHASDGVHLKNWSICNDDMFDNWADSKPSVLPIYKKLIAGGIRIW  364

Query  1222  VYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHA  1401
             VY GDTDGRVPVL TRY I+ L LPI   WRPWYH+KQV GW QEYEGLTFATF+GAGH 
Sbjct  365   VYXGDTDGRVPVLGTRYCINKLELPIKTTWRPWYHEKQVSGWFQEYEGLTFATFKGAGHD  424

Query  1402  VPTFKP  1419
             VP+FKP
Sbjct  425   VPSFKP  430



>gb|AAB65475.1| Serine carboxypeptidase isolog; 30227-33069 [Arabidopsis thaliana]
Length=465

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/420 (67%), Positives = 332/420 (79%), Gaps = 27/420 (6%)
 Frame = +1

Query  175   EDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             +DLV  LPGQP V+F+HYAGYV V+E+NGR +FYW +E+  LP EKPLVLWLNGGPGCSS
Sbjct  48    QDLVTGLPGQPDVSFRHYAGYVPVDESNGRAMFYWFFEAMDLPKEKPLVLWLNGGPGCSS  107

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             +GYGATQEIGPFLVD++ + L  NPY+WNKEAN+LFLESPVGVGFSYSNTS+DY  LGDD
Sbjct  108   VGYGATQEIGPFLVDTNGNGLNFNPYAWNKEANMLFLESPVGVGFSYSNTSSDYQKLGDD  167

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVD-----RNKDPSLFI  699
             F A DAY FL  WF KFP +K   FYIAGESYAGKYVPELAE++ D     +    S  I
Sbjct  168   FTARDAYTFLCNWFEKFPEHKENTFYIAGESYAGKYVPELAEVVYDNNNNNKKNGSSFHI  227

Query  700   DLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAV  879
             +L+GILLGNPETSD +DW+G VDYAWSHAVISDETHR I  +C+F+S++TWSN +C++AV
Sbjct  228   NLKGILLGNPETSDAEDWRGWVDYAWSHAVISDETHRIITRTCNFSSDNTWSNDECNEAV  287

Query  880   NELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSY  1059
              E+LKQY EIDIYS+YTS                      M PR+M GYDPCLDDYA+ +
Sbjct  288   AEVLKQYHEIDIYSIYTS----------------------MPPRLMGGYDPCLDDYARVF  325

Query  1060  YNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDT  1239
             YNR DVQK+LH S G +L++W ICNM +F+ W+ S  SVLPIY+KLIA G+RIWVYSGDT
Sbjct  326   YNRADVQKSLHASDGVNLKNWSICNMEIFNNWTGSNPSVLPIYEKLIAGGLRIWVYSGDT  385

Query  1240  DGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             DGRVPVL+TRYS++ L LPI   WRPWYH+KQV GW+QEYEGLTFATFRGAGHAVP FKP
Sbjct  386   DGRVPVLATRYSLNALELPIKTAWRPWYHEKQVSGWLQEYEGLTFATFRGAGHAVPCFKP  445



>ref|XP_010431670.1| PREDICTED: serine carboxypeptidase-like 32 [Camelina sativa]
Length=460

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/429 (67%), Positives = 339/429 (79%), Gaps = 14/429 (3%)
 Frame = +1

Query  154   SDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLN  333
             SD S A  DLV N PGQP V+F+HYAGYVTV+E +GR LFYW +E+ + P+ KPL+LWLN
Sbjct  19    SDTSEAMRDLVTNFPGQPKVSFRHYAGYVTVDEPSGRALFYWFFEAMTYPNVKPLLLWLN  78

Query  334   GGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTD  513
             GGPGCSS+GYGATQEIGPFLVD+  +S+  NPY+WNKEAN+LFLESP GVGFSYSNTS+D
Sbjct  79    GGPGCSSVGYGATQEIGPFLVDNKGNSVKSNPYAWNKEANVLFLESPAGVGFSYSNTSSD  138

Query  514   YANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDP--  687
             Y  LGDDF A D YAFL +WF++FP+YK   FYIAGESYAGKYVPELAE+I D+NK+   
Sbjct  139   YRKLGDDFTARDTYAFLQKWFVRFPAYKENLFYIAGESYAGKYVPELAEVIYDKNKEHND  198

Query  688   --SLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQ  861
               SL I+L+GILLGNP TS V+DW G VDYAWSHAVISDET+R I  SC+FNSN TW  +
Sbjct  199   NLSLHINLKGILLGNPLTSYVEDWTGWVDYAWSHAVISDETYRVIKRSCNFNSNTTWDVK  258

Query  862   DCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFK-TTSKMMPRIMAGYDPCL  1038
             DC + V+E+LKQYKEID +SLYT  CI        +S+ ++    SK +PR+  G+DPCL
Sbjct  259   DCKEGVDEILKQYKEIDQFSLYTPTCI-------HHSSKLYSYANSKTIPRLFDGFDPCL  311

Query  1039  DDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFD--GWSDSKESVLPIYKKLIAAGI  1212
             DDYAK +YNR DVQKALH + G H ++W ICN  + +   W+DSK SVLPIYKKLIA G 
Sbjct  312   DDYAKVFYNRADVQKALHATDGVHPKNWTICNADILNNWNWTDSKPSVLPIYKKLIAGGF  371

Query  1213  RIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGA  1392
             R+WVYSGDTDGRVPVLSTRY I+ L LPI   WRPWYH+KQV GW QEYEGLTFATF+GA
Sbjct  372   RVWVYSGDTDGRVPVLSTRYCINKLELPIKTAWRPWYHEKQVSGWFQEYEGLTFATFKGA  431

Query  1393  GHAVPTFKP  1419
             GH VP+FKP
Sbjct  432   GHDVPSFKP  440



>ref|XP_010473314.1| PREDICTED: serine carboxypeptidase-like 32 [Camelina sativa]
Length=465

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/430 (67%), Positives = 341/430 (79%), Gaps = 15/430 (3%)
 Frame = +1

Query  154   SDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYES-SSLPDEKPLVLWL  330
             SD S A  DLV N PGQP V+F+HYAGYVTV+E +GR LFYW +E+ ++ P+ KPL+LWL
Sbjct  21    SDTSEAKRDLVTNFPGQPKVSFRHYAGYVTVDEPSGRALFYWFFEAMTNYPNVKPLLLWL  80

Query  331   NGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTST  510
             NGGPGCSS+GYGATQEIGPFLVD+  +S+  NPY+WNKEAN+LFLESP GVGFSYSNTS+
Sbjct  81    NGGPGCSSVGYGATQEIGPFLVDNKGNSVKSNPYAWNKEANVLFLESPAGVGFSYSNTSS  140

Query  511   DYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDP-  687
             DY  LGDDF A D YAFL +WF++FP+YK   FYIAGESYAGKYVPELAE+I D+NK+  
Sbjct  141   DYRKLGDDFTARDTYAFLLKWFVRFPAYKENLFYIAGESYAGKYVPELAEVIYDKNKEHD  200

Query  688   ---SLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSN  858
                SL I+L+GILLGNP TS V+DW G VDYAWSHAVISDET+R I  SC+FNSN TW  
Sbjct  201   DNLSLHINLKGILLGNPLTSYVEDWTGWVDYAWSHAVISDETYRVIKRSCNFNSNTTWDV  260

Query  859   QDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFK-TTSKMMPRIMAGYDPC  1035
             +DC + V+E+LKQYKEID +SLYT  CI        +S+ ++    SK +PR+  G+DPC
Sbjct  261   KDCKEGVDEILKQYKEIDQFSLYTPTCI-------HHSSKLYSYANSKTIPRLFDGFDPC  313

Query  1036  LDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFD--GWSDSKESVLPIYKKLIAAG  1209
             LDDYAK +YNR DVQKALH + G H ++W ICN  + +   W+DSK SVLPIYKKLIA G
Sbjct  314   LDDYAKVFYNRADVQKALHATDGVHPKNWTICNADILNNWNWTDSKPSVLPIYKKLIAGG  373

Query  1210  IRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRG  1389
             IR+WVYSGDTDGRVPVLSTRY I+ L LPI   WRPWYH+KQV GW QEYEGLTFATFRG
Sbjct  374   IRVWVYSGDTDGRVPVLSTRYCINKLELPIKTAWRPWYHEKQVSGWFQEYEGLTFATFRG  433

Query  1390  AGHAVPTFKP  1419
             AGH VP+FKP
Sbjct  434   AGHDVPSFKP  443



>ref|XP_009104389.1| PREDICTED: serine carboxypeptidase-like 32 [Brassica rapa]
Length=469

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/426 (65%), Positives = 336/426 (79%), Gaps = 4/426 (1%)
 Frame = +1

Query  154   SDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLN  333
             SD   A  DLV +LPGQ  V+F+HYAGYV V++ +GR +FYW +E+ SLP++KPLVLWLN
Sbjct  24    SDSPEAMRDLVTDLPGQSGVSFRHYAGYVPVDKKHGRAMFYWFFEAMSLPNQKPLVLWLN  83

Query  334   GGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTD  513
             GGPGCSS+GYGATQEIGPFLVD+  +SL  NPY+WN EAN+LFLESPVGVGFSYSNTS+D
Sbjct  84    GGPGCSSVGYGATQEIGPFLVDNKGNSLQFNPYAWNHEANILFLESPVGVGFSYSNTSSD  143

Query  514   YANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDR-NKDPS  690
             Y  +GD+F A DAY+F+  W  +FP+Y+   FYIAGESYAGKY+PELAE++ D+ N++ S
Sbjct  144   YKKIGDEFTARDAYSFIQNWLERFPAYRENNFYIAGESYAGKYIPELAEVVYDKNNENSS  203

Query  691   LFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCS  870
             L I L+GILLGNPETS+ +DW G VDYAWSHAVISDE +  I  +C+F+SN TW  ++C 
Sbjct  204   LHIKLKGILLGNPETSEAEDWDGWVDYAWSHAVISDEMYGVIKRNCNFSSNTTWDVKECK  263

Query  871   QAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKT---TSKMMPRIMAGYDPCLD  1041
               V+E++KQY +ID YSLYT  C  + T S    +  F+T    SKMMPR+M GYDPCLD
Sbjct  264   DNVDEVVKQYHKIDQYSLYTPTCNGNSTPSSSLDSTRFRTNLRNSKMMPRMMGGYDPCLD  323

Query  1042  DYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIW  1221
             DY K +YNR DVQKALH S G HL++W ICN  +FD W+DSK SVLPIYKKLIA G RIW
Sbjct  324   DYTKVFYNRADVQKALHASDGIHLKNWSICNDDIFDNWTDSKPSVLPIYKKLIAGGFRIW  383

Query  1222  VYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHA  1401
             VYSGDTDGRVPVL TRY I+ L LPI   WRPWYH+KQV GW+QEYEGLTF TF+GAGH 
Sbjct  384   VYSGDTDGRVPVLGTRYCINKLVLPIKTSWRPWYHEKQVSGWLQEYEGLTFGTFKGAGHD  443

Query  1402  VPTFKP  1419
             VP+FKP
Sbjct  444   VPSFKP  449



>ref|NP_176308.2| serine carboxypeptidase-like 32 [Arabidopsis thaliana]
 sp|Q4PSY2.1|SCP32_ARATH RecName: Full=Serine carboxypeptidase-like 32; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAY78661.1| serine carboxypeptidase S10 family protein [Arabidopsis thaliana]
 gb|AEE33785.1| serine carboxypeptidase-like 32 [Arabidopsis thaliana]
Length=463

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/427 (67%), Positives = 338/427 (79%), Gaps = 10/427 (2%)
 Frame = +1

Query  154   SDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLN  333
             SD   A  DLV N PGQP V+F+HYAGYVTVN  +GR LFYW +E+ + P+ KPLVLWLN
Sbjct  22    SDSPEAMRDLVTNFPGQPKVSFRHYAGYVTVNIISGRALFYWFFEAMTHPNVKPLVLWLN  81

Query  334   GGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTD  513
             GGPGCSS+GYGATQEIGPFLVD+  +SL  NPY+WNKEAN+LFLESP GVGFSYSNTS+D
Sbjct  82    GGPGCSSVGYGATQEIGPFLVDNKGNSLKFNPYAWNKEANILFLESPAGVGFSYSNTSSD  141

Query  514   YANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDP--  687
             Y  LGDDF A D+Y FL +WFL+FP+YK + F+IAGESYAGKYVPELAE+I D+NKD   
Sbjct  142   YRKLGDDFTARDSYTFLQKWFLRFPAYKEKDFFIAGESYAGKYVPELAEVIYDKNKDNEN  201

Query  688   -SLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQD  864
              SL I+L+GILLGNP TS  +DW G VDYAW+HAV+SDET+R I  SC+F+S+ TW  +D
Sbjct  202   LSLHINLKGILLGNPLTSYAEDWTGWVDYAWNHAVVSDETYRVIKQSCNFSSDTTWDVKD  261

Query  865   CSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDD  1044
             C + V+E+LKQYKEID +SLYT +C+     S  +S   +KTT   +PR+  G+DPCLDD
Sbjct  262   CKEGVDEILKQYKEIDQFSLYTPICMHH--SSKVDSYANYKTT---IPRLFDGFDPCLDD  316

Query  1045  YAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFD--GWSDSKESVLPIYKKLIAAGIRI  1218
             YAK +YNR DVQKALH + G HL++W ICN  + +   W+DSK SVLPIYKKLIA G R+
Sbjct  317   YAKVFYNRADVQKALHATDGVHLKNWTICNDDILNHWNWTDSKRSVLPIYKKLIAGGFRV  376

Query  1219  WVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGH  1398
             WVYSGDTDGRVPVLSTRY I+ L LPI   WRPWYH+ QV GW QEYEGLTFATFRGAGH
Sbjct  377   WVYSGDTDGRVPVLSTRYCINKLELPIKTAWRPWYHETQVSGWFQEYEGLTFATFRGAGH  436

Query  1399  AVPTFKP  1419
              VP+FKP
Sbjct  437   DVPSFKP  443



>ref|XP_010533893.1| PREDICTED: serine carboxypeptidase-like 31 isoform X3 [Tarenaya 
hassleriana]
Length=448

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/419 (69%), Positives = 328/419 (78%), Gaps = 33/419 (8%)
 Frame = +1

Query  169   ASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGC  348
             A+ DLV NLPGQP V FKHY+GYVTVNE+NGR LFYW +E+  LP++KPLVLWLNGGPGC
Sbjct  41    ANGDLVTNLPGQPDVQFKHYSGYVTVNESNGRALFYWFFEAMDLPNDKPLVLWLNGGPGC  100

Query  349   SSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLG  528
             SS+GYGATQEIGPFLVD+  + L  NPY+WNKEAN+LFLESPVGVGFSYSNT++DY NLG
Sbjct  101   SSVGYGATQEIGPFLVDTTGNGLKFNPYAWNKEANMLFLESPVGVGFSYSNTTSDYKNLG  160

Query  529   DDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRN-KDPSLFIDL  705
             DDF                                GKYVPELAE+I D N K+PSL IDL
Sbjct  161   DDFT-------------------------------GKYVPELAEVIYDNNNKNPSLRIDL  189

Query  706   RGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNE  885
             +GILLGNPETSD +DW+G VDYAWSHAVISDETHR I  +C+F+S+DTWSN +C+ AV E
Sbjct  190   QGILLGNPETSDAEDWRGWVDYAWSHAVISDETHRVISRTCNFSSDDTWSNDECNLAVEE  249

Query  886   LLKQYKEIDIYSLYTSVCI-DSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSYY  1062
             +LKQY EIDIYSLYTSVCI DS       +    K +SKMMPR+M GYDPCLDDYA+ YY
Sbjct  250   VLKQYHEIDIYSLYTSVCIGDSARSDVKAAQFQIKRSSKMMPRLMGGYDPCLDDYARVYY  309

Query  1063  NRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTD  1242
             NR DVQKALH S G +LR+W ICNM +F  WSDSK SVLPIY+KLIA G+RIWVYSGDTD
Sbjct  310   NRPDVQKALHASDGVNLRNWSICNMEIFSNWSDSKPSVLPIYEKLIAGGLRIWVYSGDTD  369

Query  1243  GRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             GRVPVL+TRYS+S L LPI   WRPWYH+KQV GWVQEY+GLTFATFRGAGHAVP FKP
Sbjct  370   GRVPVLATRYSLSALELPIKAAWRPWYHEKQVSGWVQEYQGLTFATFRGAGHAVPCFKP  428



>ref|NP_193246.2| serine carboxypeptidase-like 30 [Arabidopsis thaliana]
 sp|O23364.2|SCP30_ARATH RecName: Full=Putative serine carboxypeptidase-like 30; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AEE83556.1| serine carboxypeptidase-like 30 [Arabidopsis thaliana]
Length=488

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/422 (67%), Positives = 330/422 (78%), Gaps = 8/422 (2%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             DLV NLPGQP V+FKHYAGYV V+++NGR LFYW +E+  LP EKPLVLWLNGGPGCSS+
Sbjct  43    DLVTNLPGQPDVSFKHYAGYVPVDKSNGRALFYWFFEAMDLPKEKPLVLWLNGGPGCSSV  102

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYGATQEIGPFL D++E  L  NPY+WNKE N+LFLESPVGVGFSYSNTS+DY NL D F
Sbjct  103   GYGATQEIGPFLADTNEKGLIFNPYAWNKEVNMLFLESPVGVGFSYSNTSSDYLNLDDHF  162

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVD---RNKDPSLFIDLR  708
             A  DAY FL  WF KFP +K   FYIAGESYAG YVPELAE++ D   +N D SL I+L+
Sbjct  163   AKKDAYTFLCNWFEKFPEHKGNEFYIAGESYAGIYVPELAELVYDNNEKNNDLSLHINLK  222

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G LLGNP+ S+  DW+G VDYAWSHAVISDETHR I   C+F+S+D W+N  C++A+ E+
Sbjct  223   GFLLGNPDISNPDDWRGWVDYAWSHAVISDETHRNINRLCNFSSDDVWNNDKCNEAIAEV  282

Query  889   LKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKT-----TSKMMPRIMAGYDPCLDDYAK  1053
              KQY EIDIYSLYTS C      S   ++  FKT     + +M PR +AGYDPCLDDY K
Sbjct  283   DKQYNEIDIYSLYTSACKGDSAKSSYFASAQFKTNYHISSKRMPPRRLAGYDPCLDDYVK  342

Query  1054  SYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSG  1233
              YYNR DVQKALH S G +L++W ICNM +F  W+   +SVLPIY+KLIA G+RIWVYSG
Sbjct  343   VYYNRADVQKALHASDGVNLKNWSICNMEIFHNWTYVVQSVLPIYQKLIAGGLRIWVYSG  402

Query  1234  DTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTF  1413
             DTDG +PVL TRYS++ LGLPI   WRPWYH+KQV GWVQEY+GLTFATFRGAGH VP+F
Sbjct  403   DTDGCIPVLGTRYSLNALGLPIKTAWRPWYHEKQVSGWVQEYDGLTFATFRGAGHTVPSF  462

Query  1414  KP  1419
             KP
Sbjct  463   KP  464



>ref|XP_010418062.1| PREDICTED: serine carboxypeptidase-like 32 [Camelina sativa]
Length=464

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/429 (66%), Positives = 336/429 (78%), Gaps = 14/429 (3%)
 Frame = +1

Query  154   SDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLN  333
             SD S A  DLV N PGQP V+F+HYAGYVTV+E +GR LFYW +E+ + P+ KPL+LWLN
Sbjct  21    SDTSEAMRDLVTNFPGQPKVSFRHYAGYVTVDEPSGRALFYWFFEAMTYPNMKPLLLWLN  80

Query  334   GGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTD  513
             GGPGCSS+GYGATQEIGPFLVD+  +S+  NPY+WNKEAN+LFLESP GVGFSYSNTS+D
Sbjct  81    GGPGCSSVGYGATQEIGPFLVDNKGNSVKSNPYAWNKEANVLFLESPAGVGFSYSNTSSD  140

Query  514   YANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDP--  687
             Y  LGDDF A D YAFL +W ++FP+YK   FYIAGESYAGKYVPELAE+I D+NK+   
Sbjct  141   YRKLGDDFTARDTYAFLQKWLVRFPAYKENLFYIAGESYAGKYVPELAEVIYDKNKEHND  200

Query  688   --SLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQ  861
               SL I+L+GILLGNP TS V+DW G VDYAWSHAVISDET+R I  SC+FNSN TW  +
Sbjct  201   NLSLHINLKGILLGNPLTSYVEDWTGWVDYAWSHAVISDETYRVIKRSCNFNSNTTWDVK  260

Query  862   DCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFK-TTSKMMPRIMAGYDPCL  1038
             DC + V+E+LKQYKEID +SLYT  CI        +S+ ++    SK +PR+  G+DPCL
Sbjct  261   DCKEGVDEILKQYKEIDQFSLYTPTCI-------HHSSKLYSYANSKTIPRLFDGFDPCL  313

Query  1039  DDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFD--GWSDSKESVLPIYKKLIAAGI  1212
             DDYAK +YNR DVQKALH + G H ++W ICN  + +   W+DSK SVLPIYKKLIA G 
Sbjct  314   DDYAKVFYNRADVQKALHATDGVHPKNWTICNADILNNWNWTDSKPSVLPIYKKLIAGGF  373

Query  1213  RIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGA  1392
             R+WVYSGD DGRVPVLSTRY I+ L L I   WRPWYH+KQV GW QEYEGLTFATFRGA
Sbjct  374   RVWVYSGDADGRVPVLSTRYCINKLELQIKTTWRPWYHEKQVSGWFQEYEGLTFATFRGA  433

Query  1393  GHAVPTFKP  1419
             GH VP+FKP
Sbjct  434   GHDVPSFKP  442



>ref|XP_006301480.1| hypothetical protein CARUB_v10021903mg [Capsella rubella]
 gb|EOA34378.1| hypothetical protein CARUB_v10021903mg [Capsella rubella]
Length=464

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/428 (66%), Positives = 335/428 (78%), Gaps = 12/428 (3%)
 Frame = +1

Query  154   SDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLN  333
             SD   A  DLV N PGQPIV+F+HYAGYVTVNE NGR LFYW +E+ + P+ KPLVLWLN
Sbjct  21    SDSPEAMIDLVTNFPGQPIVSFRHYAGYVTVNEPNGRALFYWFFEAMTHPNVKPLVLWLN  80

Query  334   GGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTD  513
             GGPGCSS+GYGATQEIGPFLVD+  +++  NPY+WNKEAN+LFLESP GVGFSYSNTS+D
Sbjct  81    GGPGCSSVGYGATQEIGPFLVDNKGNNIKSNPYAWNKEANVLFLESPAGVGFSYSNTSSD  140

Query  514   YANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDP--  687
             Y  LGDDF + D+YAFL +WF++FP+YK   F+IAGESYAGKY+PELAE+I D+NK+   
Sbjct  141   YRKLGDDFTSRDSYAFLQKWFVRFPAYKENKFFIAGESYAGKYIPELAEVIYDKNKEHKD  200

Query  688   --SLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQ  861
               SL I+L GILLGNP TS  +DW G VDYAWSHAVISDET+R I  SC+F S+ TW  +
Sbjct  201   NLSLHINLMGILLGNPLTSYAEDWTGWVDYAWSHAVISDETYRVIKRSCNFTSDTTWEVK  260

Query  862   DCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLD  1041
             DC   V+E+LKQYKEID +SLYT +C+        +S       SK +PR+  G+DPC+D
Sbjct  261   DCKDGVDEILKQYKEIDQFSLYTPICMHH------SSKLDSYANSKTIPRLFDGFDPCMD  314

Query  1042  DYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFD--GWSDSKESVLPIYKKLIAAGIR  1215
             DYAK +YNR DVQKALHVS G HL++W ICN  + +   W+DSK SVLPIYKKLIA G R
Sbjct  315   DYAKVFYNRADVQKALHVSDGVHLKNWTICNGDILNHWNWTDSKPSVLPIYKKLIAGGFR  374

Query  1216  IWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAG  1395
             +WVYSGDTDGRVPVLSTRY I+ L L I   WRPWYH+KQV GW QEYEGLTFATFRGAG
Sbjct  375   VWVYSGDTDGRVPVLSTRYCINKLELQIKTAWRPWYHEKQVSGWFQEYEGLTFATFRGAG  434

Query  1396  HAVPTFKP  1419
             H VP+FKP
Sbjct  435   HDVPSFKP  442



>ref|XP_002886559.1| serine carboxypeptidase S10 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH62818.1| serine carboxypeptidase S10 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=463

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/428 (66%), Positives = 332/428 (78%), Gaps = 12/428 (3%)
 Frame = +1

Query  154   SDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLN  333
             SD   A  DLV N PGQP V+F+HYAGYVTVNE NGR LFYW +E+ +  + KPLVLWLN
Sbjct  22    SDSPEAMRDLVTNFPGQPKVSFRHYAGYVTVNETNGRALFYWFFEAMTHSNVKPLVLWLN  81

Query  334   GGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTD  513
             GGPGCSS+GYGATQEIGPFLVD++ + L  NPY+WNKEAN+LFLESP GVGFSY+NTS+D
Sbjct  82    GGPGCSSVGYGATQEIGPFLVDNEGNDLKFNPYAWNKEANVLFLESPAGVGFSYTNTSSD  141

Query  514   YANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDP--  687
             Y  LGDDF A D+Y FL +WFL+FP+YK   F+IAGESYAGKYVPELAE+I D+NK+   
Sbjct  142   YRKLGDDFTARDSYIFLQKWFLRFPAYKENNFFIAGESYAGKYVPELAEVIYDKNKEHND  201

Query  688   --SLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQ  861
               SL I+L+GILLGNP TS  +DW G VDYAWSHAVISDE +R I  SC+F+SN TW  +
Sbjct  202   NLSLHINLKGILLGNPLTSYAEDWTGWVDYAWSHAVISDEIYRVIERSCNFSSNTTWDIK  261

Query  862   DCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLD  1041
             DC   V+E+LKQYKEID +SLYT VC+        +S       SKM+PR+  G+D CLD
Sbjct  262   DCKDGVDEILKQYKEIDQFSLYTPVCMHH------SSKVDSYVNSKMIPRLFDGFDTCLD  315

Query  1042  DYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFD--GWSDSKESVLPIYKKLIAAGIR  1215
             DY K +YNR DVQKALH + G HL++W ICN  + +   W+DSK SVLPIYKKLIA G R
Sbjct  316   DYTKVFYNRADVQKALHATDGVHLKNWTICNADILNHWNWTDSKRSVLPIYKKLIAGGYR  375

Query  1216  IWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAG  1395
             +WVYSGDTDGRVPVLSTRY I+ L LPI   WRPWYH+KQV GW QEYEGLTFATF+GAG
Sbjct  376   VWVYSGDTDGRVPVLSTRYCINKLELPIKTTWRPWYHEKQVSGWFQEYEGLTFATFKGAG  435

Query  1396  HAVPTFKP  1419
             H VP+FKP
Sbjct  436   HDVPSFKP  443



>ref|XP_006392051.1| hypothetical protein EUTSA_v10023439mg [Eutrema salsugineum]
 gb|ESQ29337.1| hypothetical protein EUTSA_v10023439mg [Eutrema salsugineum]
Length=468

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/428 (67%), Positives = 338/428 (79%), Gaps = 12/428 (3%)
 Frame = +1

Query  154   SDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLN  333
             SD   A  DLV N PGQP V+F+HYAGYVTV+E NGR LFYW +E+ + P+ KPL+LWLN
Sbjct  21    SDSPEAMRDLVTNFPGQPKVSFRHYAGYVTVSEINGRALFYWFFEAMNQPNVKPLLLWLN  80

Query  334   GGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTD  513
             GGPGCSS+GYG TQEIGPFLVD++  ++  NPY+WNKEANLLFLESPVGVGFSYSNTS+D
Sbjct  81    GGPGCSSVGYGTTQEIGPFLVDNEGHTIKFNPYAWNKEANLLFLESPVGVGFSYSNTSSD  140

Query  514   YANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDP--  687
             Y  LGDDF A D+YAFL +WF +FP+YK   F+IAGESYAGKYVPELAE+I D+NK+   
Sbjct  141   YGKLGDDFTARDSYAFLQKWFERFPAYKGNEFFIAGESYAGKYVPELAEVIYDKNKEDKN  200

Query  688   --SLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQ  861
               SL I+L+GILLGNP TS  +DW G VDYAWSHAVISDET+RTI  SC+F+SN TW   
Sbjct  201   NLSLHINLKGILLGNPLTSFAEDWTGWVDYAWSHAVISDETYRTIKRSCNFSSNTTWEVT  260

Query  862   DCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLD  1041
             +C+  VNE+LKQYKEID +SLYT +CI     S  +S P    +SK +PR+  G+DPCLD
Sbjct  261   ECNDGVNEVLKQYKEIDQFSLYTPMCIHH--SSKLDSYP----SSKTIPRLFDGFDPCLD  314

Query  1042  DYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFD--GWSDSKESVLPIYKKLIAAGIR  1215
             DYA+ +YNR DVQK+LH + G HL++W ICN  +F    W+DSK SVLPIYKKLIA   R
Sbjct  315   DYARVFYNRADVQKSLHATDGVHLKNWTICNHDIFSHWNWTDSKPSVLPIYKKLIAGRFR  374

Query  1216  IWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAG  1395
             +WVYSGDTDGRVPVLSTRY I+ L LPI   WRPWY++KQV GW QEYEGLTFATF+GAG
Sbjct  375   VWVYSGDTDGRVPVLSTRYWINKLELPIKTTWRPWYNEKQVSGWFQEYEGLTFATFKGAG  434

Query  1396  HAVPTFKP  1419
             H VP+FKP
Sbjct  435   HDVPSFKP  442



>gb|KFK40732.1| hypothetical protein AALP_AA2G034000 [Arabis alpina]
Length=462

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/421 (65%), Positives = 335/421 (80%), Gaps = 4/421 (1%)
 Frame = +1

Query  169   ASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGC  348
             A  DLV +LPGQ  V+F+H+AGYV V++ NGR +FYW +E+ S P++KPLVLWLNGGPGC
Sbjct  25    AMRDLVTDLPGQSHVSFRHFAGYVPVDKTNGRAMFYWFFEAMSYPNKKPLVLWLNGGPGC  84

Query  349   SSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLG  528
             SS+GYGATQEIGPFLVD+  +S+T NPY+WN EAN+LFLESPVGVGFSYSNT++DY  +G
Sbjct  85    SSVGYGATQEIGPFLVDNKGNSVTFNPYAWNHEANILFLESPVGVGFSYSNTTSDYKKIG  144

Query  529   DDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNK-DPSLFIDL  705
             DDF A D YAF+ +W  +FP+Y+   FYIAGESYAGKY+PELAE++ DRN  + S  I L
Sbjct  145   DDFTARDTYAFILKWLERFPAYRDTDFYIAGESYAGKYIPELAEVVYDRNNVNSSPHIKL  204

Query  706   RGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNE  885
             +GI+LGNPETS+ +DW+G VDYAWSHAVISDET+  I   C+FNS+ TW  ++C  AV+E
Sbjct  205   KGIMLGNPETSEAEDWKGWVDYAWSHAVISDETYGVISKFCNFNSSTTWDVKECKDAVDE  264

Query  886   LLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKT---TSKMMPRIMAGYDPCLDDYAKS  1056
             +LKQY +ID YSLYT  CI + + +    +  FKT    SKMMPR+M GYD CLDDY + 
Sbjct  265   VLKQYNKIDQYSLYTPTCIKNSSVNSFVDSTRFKTNFANSKMMPRLMGGYDSCLDDYTRV  324

Query  1057  YYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGD  1236
             +YNR DVQKALH S G  L++W ICN  +FD W+D+K SVLP+YKKLIA G+RIWVYSGD
Sbjct  325   FYNRADVQKALHASDGIQLKNWTICNDDIFDNWADTKPSVLPLYKKLIAGGLRIWVYSGD  384

Query  1237  TDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFK  1416
             TDGRVPVL TRY I+ L LPI   WRPWYH+KQV GW+QEYEGLTFATF+GAGH VP+FK
Sbjct  385   TDGRVPVLGTRYCINKLQLPIKTAWRPWYHKKQVSGWLQEYEGLTFATFKGAGHDVPSFK  444

Query  1417  P  1419
             P
Sbjct  445   P  445



>emb|CDY56791.1| BnaA01g36020D [Brassica napus]
Length=470

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/427 (65%), Positives = 333/427 (78%), Gaps = 5/427 (1%)
 Frame = +1

Query  154   SDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLN  333
             SD   A  DLV +LPGQ  V F+HYAGYV V++ +GR +FYW +E+ SLP++KPLVLWLN
Sbjct  24    SDSPEAMRDLVTDLPGQSGVRFRHYAGYVPVDKKHGRAMFYWFFEAMSLPNQKPLVLWLN  83

Query  334   GG-PGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTST  510
             GG PGCSS+GYGATQEIGPFLVD+  +SL  NPY+WN EAN+LFLESPVGVGFSYSNTS+
Sbjct  84    GGRPGCSSVGYGATQEIGPFLVDNKGNSLQFNPYAWNHEANILFLESPVGVGFSYSNTSS  143

Query  511   DYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRN-KDP  687
             DY  +GD+F A DAY+F+  W  +FP+Y+   FYIAGESYAGKY+PELAE++ D+N ++ 
Sbjct  144   DYKKIGDEFTARDAYSFIQNWLERFPAYRENNFYIAGESYAGKYIPELAEVVYDKNNENS  203

Query  688   SLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDC  867
             SL I L+GILLGNPETS+ +DW G VDYAWSHAVISDE +  I  +C+F+S  TW  ++C
Sbjct  204   SLHIKLKGILLGNPETSEAEDWDGWVDYAWSHAVISDEMYGVIKRNCNFSSKTTWDVKEC  263

Query  868   SQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTT---SKMMPRIMAGYDPCL  1038
                V+E++KQY +ID YSLYT  C  + T S    +  F+T    SKMMPR+M GYDPCL
Sbjct  264   KDNVDEVVKQYHKIDQYSLYTPTCNGNSTPSSSLDSTRFRTNLRNSKMMPRMMGGYDPCL  323

Query  1039  DDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRI  1218
             DDY K +YNR DVQKALH S G HL++W ICN  +FD W+DSK SVLPIYKKLIA G RI
Sbjct  324   DDYTKVFYNRADVQKALHASDGIHLKNWSICNDDIFDNWTDSKPSVLPIYKKLIAGGFRI  383

Query  1219  WVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGH  1398
             WVYSGDTDGRVPVL TRY I+ L LPI   W PWYH+KQV GW+QEYEGLTF TF+GAGH
Sbjct  384   WVYSGDTDGRVPVLGTRYCINKLALPIKTSWTPWYHEKQVSGWLQEYEGLTFGTFKGAGH  443

Query  1399  AVPTFKP  1419
              VP+FKP
Sbjct  444   DVPSFKP  450



>ref|XP_006392050.1| hypothetical protein EUTSA_v10023439mg [Eutrema salsugineum]
 gb|ESQ29336.1| hypothetical protein EUTSA_v10023439mg [Eutrema salsugineum]
Length=470

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/430 (66%), Positives = 338/430 (79%), Gaps = 14/430 (3%)
 Frame = +1

Query  154   SDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLN  333
             SD   A  DLV N PGQP V+F+HYAGYVTV+E NGR LFYW +E+ + P+ KPL+LWLN
Sbjct  21    SDSPEAMRDLVTNFPGQPKVSFRHYAGYVTVSEINGRALFYWFFEAMNQPNVKPLLLWLN  80

Query  334   GGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTD  513
             GGPGCSS+GYG TQEIGPFLVD++  ++  NPY+WNKEANLLFLESPVGVGFSYSNTS+D
Sbjct  81    GGPGCSSVGYGTTQEIGPFLVDNEGHTIKFNPYAWNKEANLLFLESPVGVGFSYSNTSSD  140

Query  514   YANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDP--  687
             Y  LGDDF A D+YAFL +WF +FP+YK   F+IAGESYAGKYVPELAE+I D+NK+   
Sbjct  141   YGKLGDDFTARDSYAFLQKWFERFPAYKGNEFFIAGESYAGKYVPELAEVIYDKNKEDKN  200

Query  688   --SLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQ  861
               SL I+L+GILLGNP TS  +DW G VDYAWSHAVISDET+RTI  SC+F+SN TW   
Sbjct  201   NLSLHINLKGILLGNPLTSFAEDWTGWVDYAWSHAVISDETYRTIKRSCNFSSNTTWEVT  260

Query  862   DCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLD  1041
             +C+  VNE+LKQYKEID +SLYT +CI     S  +S P    +SK +PR+  G+DPCLD
Sbjct  261   ECNDGVNEVLKQYKEIDQFSLYTPMCIHH--SSKLDSYP----SSKTIPRLFDGFDPCLD  314

Query  1042  DYAKSYYNRLDVQKALHVSSGHHLRDWRICNMS--VFD--GWSDSKESVLPIYKKLIAAG  1209
             DYA+ +YNR DVQK+LH + G HL++W IC  S  +F    W+DSK SVLPIYKKLIA  
Sbjct  315   DYARVFYNRADVQKSLHATDGVHLKNWTICKNSHDIFSHWNWTDSKPSVLPIYKKLIAGR  374

Query  1210  IRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRG  1389
              R+WVYSGDTDGRVPVLSTRY I+ L LPI   WRPWY++KQV GW QEYEGLTFATF+G
Sbjct  375   FRVWVYSGDTDGRVPVLSTRYWINKLELPIKTTWRPWYNEKQVSGWFQEYEGLTFATFKG  434

Query  1390  AGHAVPTFKP  1419
             AGH VP+FKP
Sbjct  435   AGHDVPSFKP  444



>gb|KDP20921.1| hypothetical protein JCGZ_21392 [Jatropha curcas]
Length=454

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/420 (68%), Positives = 322/420 (77%), Gaps = 38/420 (9%)
 Frame = +1

Query  172   SEDLVANLPGQPI-VNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGC  348
             ++ LV NLPGQP  VNF HYAGYVTVNE NGR LFYW +E+++ PDEKPL+LWLNGGPG 
Sbjct  43    NDHLVTNLPGQPAGVNFSHYAGYVTVNEKNGRALFYWFFEATTRPDEKPLMLWLNGGPGS  102

Query  349   SSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLG  528
             SS+GYG TQEIGPFLVDSD   L  NPYSWN                             
Sbjct  103   SSVGYGPTQEIGPFLVDSD--GLKYNPYSWN-----------------------------  131

Query  529   DDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSLFIDLR  708
                 AND+YAFLH+WF+KF SY+ R  YIAGESYAGKY+PELA++I D NKDPSL IDLR
Sbjct  132   ---TANDSYAFLHKWFVKFSSYRNRTLYIAGESYAGKYIPELAQLIQDNNKDPSLHIDLR  188

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             GIL+GNPETSD +DW G+VDYAWSHA+ISDETH+ I  SCDF +NDTWSN+DCSQ+V+E+
Sbjct  189   GILMGNPETSDPEDWAGIVDYAWSHAIISDETHKIIKQSCDFYNNDTWSNRDCSQSVDEI  248

Query  889   LKQYKEIDIYSLYTSVCIDSLTGSGDNSTPV-FKTTSK--MMPRIMAGYDPCLDDYAKSY  1059
              KQY EIDIYSLY+  C  +   S      V FK TSK  MMPR M GYDPCLDDYA+S+
Sbjct  249   FKQYNEIDIYSLYSPTCTRNSASSDVKHMQVSFKRTSKSKMMPRFMGGYDPCLDDYARSF  308

Query  1060  YNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDT  1239
             YNR DVQKALH   GH L++W ICN ++F  W DSK SVLPIYKKLIAAGIRIWVYSGDT
Sbjct  309   YNRPDVQKALHCGDGHLLKNWSICNDTIFKEWKDSKPSVLPIYKKLIAAGIRIWVYSGDT  368

Query  1240  DGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             DGRVPVLSTRYSI++LGL +T+ WRPWYHQKQVGGW QEYEGLTFATFRGAGH VPTF+P
Sbjct  369   DGRVPVLSTRYSIASLGLNVTKAWRPWYHQKQVGGWYQEYEGLTFATFRGAGHDVPTFQP  428



>ref|XP_006282819.1| hypothetical protein CARUB_v10006611mg [Capsella rubella]
 gb|EOA15717.1| hypothetical protein CARUB_v10006611mg [Capsella rubella]
Length=492

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/439 (64%), Positives = 336/439 (77%), Gaps = 10/439 (2%)
 Frame = +1

Query  133   LSSNKEQSDQSWASE-DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDE  309
             +S  ++    S A E DLV +LPGQP V+FKHYAGYV V+++N R LFYW +E+  LP E
Sbjct  27    VSCGRQHHRSSLAKEADLVTDLPGQPDVSFKHYAGYVPVDKSNTRALFYWFFEAMDLPKE  86

Query  310   KPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGF  489
             KPLVLWLNGGPGCSS+GYGATQEIGPFL D+++  L  NPY+WNKE N+LFLESPVGVGF
Sbjct  87    KPLVLWLNGGPGCSSVGYGATQEIGPFLADTNQKGLISNPYAWNKEVNMLFLESPVGVGF  146

Query  490   SYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIV  669
             SYSNTS+DY NL D F   DAY FL  WF +FP ++   FYIAGESYAG YVP+LAE++ 
Sbjct  147   SYSNTSSDYQNLNDHFTKKDAYTFLCNWFKRFPEHRGNEFYIAGESYAGIYVPQLAEVVY  206

Query  670   D---RNKDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNS  840
             D   +N D SL+I+L+G LLGNP+ S+  DW+G VDYAWSHAVISDETHR I   C+F+S
Sbjct  207   DNNIKNNDSSLYINLKGFLLGNPDISNPDDWRGWVDYAWSHAVISDETHRNINKLCNFSS  266

Query  841   NDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCI-DSLTGSGDNSTPVFKTT----SKMM  1005
             ++ W N++C++A+ E+ KQY EIDIYS+YTS C   S   S   ++  FKT     SK M
Sbjct  267   DNVWQNKECNEAIAEVDKQYNEIDIYSIYTSACKGGSSAQSSYFASAQFKTNYHIKSKRM  326

Query  1006  P-RIMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLP  1182
             P R + GYDPCLDDY K YYNR DVQKALH S G +L++W ICNM VF  W+    SVLP
Sbjct  327   PRRRLGGYDPCLDDYVKIYYNRADVQKALHASDGVNLKNWTICNMEVFHNWTYLVTSVLP  386

Query  1183  IYKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYE  1362
             IY+KLIA G+RIWVYSGDTDG VPVL TRYS++ LGLPI   WRPWYH+KQV GWVQEYE
Sbjct  387   IYEKLIAGGLRIWVYSGDTDGCVPVLGTRYSLNALGLPIKSAWRPWYHEKQVSGWVQEYE  446

Query  1363  GLTFATFRGAGHAVPTFKP  1419
             GLTFATFRGAGH VP+FKP
Sbjct  447   GLTFATFRGAGHTVPSFKP  465



>ref|XP_004167595.1| PREDICTED: serine carboxypeptidase-like 31-like, partial [Cucumis 
sativus]
Length=383

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/363 (73%), Positives = 308/363 (85%), Gaps = 3/363 (1%)
 Frame = +1

Query  340   PGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYA  519
             PGCSS+GYGATQEIGPF+VD+D + L +N YSWNKEAN+LFLESP+GVGFSYSNTS DY 
Sbjct  1     PGCSSVGYGATQEIGPFIVDNDANGLKLNDYSWNKEANMLFLESPIGVGFSYSNTSNDYD  60

Query  520   NLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSLFI  699
             NLGD+F ANDAY FL +WFLKFPSY+   FYIAGESYAGKYVPELAE+I D+NKD S  I
Sbjct  61    NLGDEFTANDAYNFLQKWFLKFPSYRNHTFYIAGESYAGKYVPELAELIHDKNKDSSFHI  120

Query  700   DLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAV  879
             +L G+LLGNPETSD  DW+GMVDYAWSHAVISDETH+ I  SCDFNSNDTWSN +CS+AV
Sbjct  121   NLHGVLLGNPETSDSDDWRGMVDYAWSHAVISDETHKIIRESCDFNSNDTWSNDNCSEAV  180

Query  880   NELLKQYKEIDIYSLYTSVCIDSLTGSGDNS--TPVFKTTSKMMPRIMAGYDPCLDDYAK  1053
             +ELL QYK+IDIYSLYTS+CI +   +  NS  T   K ++ MMPR+M GYDPCLD YAK
Sbjct  181   DELLSQYKQIDIYSLYTSLCIANSASAEGNSVQTLTIKRSTTMMPRMMGGYDPCLDGYAK  240

Query  1054  SYYNRLDVQKALHV-SSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYS  1230
             ++YNR DVQ+ALHV S GH L++W ICN ++FD W DSK S++PIY+KLI AG+R+W+YS
Sbjct  241   TFYNRRDVQQALHVISDGHQLKNWSICNNTIFDSWYDSKPSIIPIYEKLIGAGLRVWIYS  300

Query  1231  GDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPT  1410
             GDTDGRVPVLSTRYS+ +L LPIT+ WRPWYHQKQV GW QEYEGLTFATFRGAGHAVP 
Sbjct  301   GDTDGRVPVLSTRYSLKSLSLPITKAWRPWYHQKQVSGWYQEYEGLTFATFRGAGHAVPC  360

Query  1411  FKP  1419
             FKP
Sbjct  361   FKP  363



>ref|XP_010495900.1| PREDICTED: putative serine carboxypeptidase-like 30 [Camelina 
sativa]
Length=488

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/434 (64%), Positives = 332/434 (76%), Gaps = 9/434 (2%)
 Frame = +1

Query  133   LSSNKEQSDQSWASE-DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDE  309
             +S  ++     +A E DLV +LPGQP V+F+HYAGYV V+++NGR LF+W +E+  LP E
Sbjct  24    VSCARQHHKSLFAKEADLVTDLPGQPDVSFRHYAGYVPVDKSNGRALFFWFFEAMDLPKE  83

Query  310   KPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGF  489
             KPLVLWLNGGPGCSS+GYGATQEIGPFL D++E  L  NPY+WNKE N+LFLESPVG+GF
Sbjct  84    KPLVLWLNGGPGCSSVGYGATQEIGPFLADTNEKGLKFNPYAWNKEVNMLFLESPVGIGF  143

Query  490   SYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIV  669
             SYSNT++DY NL D F   DAY FL  WF +FP ++   FYIAGESYAG YVP+LAE++ 
Sbjct  144   SYSNTTSDYLNLDDHFTKKDAYTFLCNWFKRFPEHRGNEFYIAGESYAGIYVPQLAEVVY  203

Query  670   DRNK---DPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNS  840
             D NK   D SL I+L+G LLGNP+TS+  DW+G VDYAWSHAVISDE HR I   C+F+S
Sbjct  204   DNNKKNNDLSLHINLKGFLLGNPDTSNPDDWRGWVDYAWSHAVISDEAHRNINKLCNFSS  263

Query  841   NDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTT----SKMMP  1008
             +D WSN +C++A+ E+ KQY EIDIYS+YTS C      S   ++  FKT     SK MP
Sbjct  264   DDVWSNVECNEAMAEVDKQYNEIDIYSIYTSACKGVSAESSYLASAQFKTNYHIKSKRMP  323

Query  1009  -RIMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPI  1185
              R + GYDPCLDDY K YYNR DVQKALH S G +L++W ICNM +F  W+    SVLPI
Sbjct  324   RRRLGGYDPCLDDYVKIYYNRADVQKALHASDGVNLKNWTICNMEIFHNWTYLVTSVLPI  383

Query  1186  YKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEG  1365
             Y KLIA G++IWVYSGDTDG VPVL TRYS++TLGLPI + WRPWYH+KQV GWVQEYEG
Sbjct  384   YDKLIAGGLKIWVYSGDTDGCVPVLGTRYSLNTLGLPIKKAWRPWYHEKQVSGWVQEYEG  443

Query  1366  LTFATFRGAGHAVP  1407
             LTFATFRGAGH VP
Sbjct  444   LTFATFRGAGHTVP  457



>emb|CDY03789.1| BnaC01g29060D [Brassica napus]
Length=501

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/458 (61%), Positives = 335/458 (73%), Gaps = 36/458 (8%)
 Frame = +1

Query  154   SDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLN  333
             SD   A  DLV +LPGQ  V+F+HYAGYV V++ +GR +FYW +E+ SLP++KPLVLWLN
Sbjct  24    SDSPEAMRDLVTDLPGQSGVSFRHYAGYVPVDKKHGRAMFYWFFEAMSLPNQKPLVLWLN  83

Query  334   GG-PGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTST  510
             GG PGCSS+GYGATQEIGPFLVD+  +SL  NPY+WN EAN+LFLESPVGVGFSYSNTS+
Sbjct  84    GGRPGCSSVGYGATQEIGPFLVDNKGNSLQFNPYAWNHEANILFLESPVGVGFSYSNTSS  143

Query  511   DYANLGDDF-------------------------------AANDAYAFLHEWFLKFPSYK  597
             DY  +GD+F                               AA DAY+F+  W  +FP+Y+
Sbjct  144   DYKKIGDEFTARDAYSFIQKWLERFPAYRENDFYIAGESYAARDAYSFIQNWLERFPAYR  203

Query  598   TRAFYIAGESYAGKYVPELAEIIVDRN-KDPSLFIDLRGILLGNPETSDVQDWQGMVDYA  774
                FYIAGESYAGKY+PELAE++ D N ++ SL I L+GILLGNPETS+ +DW G VDYA
Sbjct  204   ENNFYIAGESYAGKYIPELAEVVYDNNNRNSSLHIKLKGILLGNPETSEAEDWDGWVDYA  263

Query  775   WSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLT  954
             WSHAVISDE +  I  +C+F+S  TW  ++C   V+E++KQY +ID YSLYT  C  + T
Sbjct  264   WSHAVISDEMYGVIKRNCNFSSKTTWDVKECKDNVDEVVKQYHKIDQYSLYTPTCNGNST  323

Query  955   GSGDNSTPVFKTT---SKMMPRIMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWR  1125
              S    +  F+T    SKMMPR+M GYDPCLDDY K +YNR DVQKALH S G HL++W 
Sbjct  324   PSSSLDSTRFRTNLRNSKMMPRMMGGYDPCLDDYTKVFYNRADVQKALHASDGIHLKNWS  383

Query  1126  ICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITR  1305
             ICN  +FD W+DSK SVLPIYKKLIA G RIWVYSGDTDGRVPVL TRY I+ L LPI  
Sbjct  384   ICNDDIFDNWTDSKPSVLPIYKKLIAGGFRIWVYSGDTDGRVPVLGTRYCINKLALPIKT  443

Query  1306  EWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
              WRPWYH+KQV GW+QEYEGLTF TF+GAGH VP+FKP
Sbjct  444   SWRPWYHEKQVSGWLQEYEGLTFGTFKGAGHDVPSFKP  481



>gb|AAB71481.1| similar to serine carboxypeptidases [Arabidopsis thaliana]
Length=470

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/440 (64%), Positives = 334/440 (76%), Gaps = 29/440 (7%)
 Frame = +1

Query  154   SDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLN  333
             SD   A  DLV N PGQP V+F+HYAGYVTVN  +GR LFYW +E+ + P+ KPLVLWLN
Sbjct  22    SDSPEAMRDLVTNFPGQPKVSFRHYAGYVTVNIISGRALFYWFFEAMTHPNVKPLVLWLN  81

Query  334   GGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTD  513
             GGPGCSS+GYGATQEIGPFLVD+  +SL  NPY+WNKEAN+LFLESP GVGFSYSNTS+D
Sbjct  82    GGPGCSSVGYGATQEIGPFLVDNKGNSLKFNPYAWNKEANILFLESPAGVGFSYSNTSSD  141

Query  514   YANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDP--  687
             Y  LGDDF A D+Y FL +WFL+FP+YK + F+IAGESYAGKYVPELAE+I D+NKD   
Sbjct  142   YRKLGDDFTARDSYTFLQKWFLRFPAYKEKDFFIAGESYAGKYVPELAEVIYDKNKDNEN  201

Query  688   -SLFIDLRGIL-------------LGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIAS  825
              SL I+L+GIL             LGNP TS  +DW G VDYAW+HAV+SDET+R I  S
Sbjct  202   LSLHINLKGILVLNTFDLNFKDIFLGNPLTSYAEDWTGWVDYAWNHAVVSDETYRVIKQS  261

Query  826   CDFNSNDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMM  1005
             C+F+S+ TW  +DC + V+E+LKQYKEID +SLYT +C+     S  +S   +KTT   +
Sbjct  262   CNFSSDTTWDVKDCKEGVDEILKQYKEIDQFSLYTPICMHH--SSKVDSYANYKTT---I  316

Query  1006  PRIMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFD--GWSDSKESVL  1179
             PR+  G+DPCLDDYAK +YNR DVQKALH + G HL++W ICN  + +   W+DSK SVL
Sbjct  317   PRLFDGFDPCLDDYAKVFYNRADVQKALHATDGVHLKNWTICNDDILNHWNWTDSKRSVL  376

Query  1180  PIYKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEY  1359
             PIYKKLIA G R+WVYSGDTDGRVPVLSTRY I+ L LPI   WRPWYH+       QEY
Sbjct  377   PIYKKLIAGGFRVWVYSGDTDGRVPVLSTRYCINKLELPIKTAWRPWYHE------TQEY  430

Query  1360  EGLTFATFRGAGHAVPTFKP  1419
             EGLTFATFRGAGH VP+FKP
Sbjct  431   EGLTFATFRGAGHDVPSFKP  450



>ref|XP_006303173.1| hypothetical protein CARUB_v10008980mg [Capsella rubella]
 gb|EOA36071.1| hypothetical protein CARUB_v10008980mg [Capsella rubella]
Length=445

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/398 (67%), Positives = 321/398 (81%), Gaps = 8/398 (2%)
 Frame = +1

Query  169   ASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGC  348
             + +DLV +LPGQP V+F+HYAGYV V+++NGR +FYW +E+  LP EKPLVLWLNGGPGC
Sbjct  42    SEQDLVTDLPGQPDVSFRHYAGYVPVDKSNGRAMFYWFFEAMDLPKEKPLVLWLNGGPGC  101

Query  349   SSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLG  528
             SS+GYGATQEIGPFLVD++   L  NPY+WNKEAN+LFLESPVGVGFSYSNTS+DY  LG
Sbjct  102   SSVGYGATQEIGPFLVDTNGHGLNFNPYAWNKEANMLFLESPVGVGFSYSNTSSDYQKLG  161

Query  529   DDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDP---SLFI  699
             DDF A DAY FL  WF KFP +K   FYIAGESYAGKYVPELAE++ D N +    SL I
Sbjct  162   DDFTARDAYTFLCNWFEKFPEHKGNTFYIAGESYAGKYVPELAEVVYDNNNNKNGSSLHI  221

Query  700   DLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAV  879
             +L+GILLGNPETSD +DW+G VDYAWSHAVISDETHR I  +C+F+S++TWSN +C++AV
Sbjct  222   NLKGILLGNPETSDAEDWRGWVDYAWSHAVISDETHRIITRTCNFSSDNTWSNDECNEAV  281

Query  880   NELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTS-----KMMPRIMAGYDPCLDD  1044
              E+LKQY EIDIYS+YTSVCI   + S    +  FKT S     +M PR+M GYDPCLDD
Sbjct  282   AEVLKQYHEIDIYSIYTSVCIGDSSRSSYFDSSQFKTNSRISSKRMPPRLMGGYDPCLDD  341

Query  1045  YAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWV  1224
             YA+ +YNR DVQK+LH S G +L++W ICNM +F+ W+ SK SVLPIY+KLIA G+R WV
Sbjct  342   YARVFYNRADVQKSLHASDGVNLKNWSICNMEIFNNWTGSKPSVLPIYEKLIAGGLRTWV  401

Query  1225  YSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQV  1338
             YSGDTDGRVPVL+TRYS+S L LPI   WRPWYH+KQV
Sbjct  402   YSGDTDGRVPVLATRYSLSALELPIKTAWRPWYHEKQV  439



>ref|XP_006417391.1| hypothetical protein EUTSA_v10007471mg [Eutrema salsugineum]
 gb|ESQ35744.1| hypothetical protein EUTSA_v10007471mg [Eutrema salsugineum]
Length=456

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/415 (66%), Positives = 331/415 (80%), Gaps = 11/415 (3%)
 Frame = +1

Query  124   RHSLSSNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLP  303
             +H   S K++S  +    DLV +LPGQP V+FKHYAGYV V+++NGR +FYW +E+  LP
Sbjct  32    QHRFDSPKDRSLLA-NERDLVTDLPGQPDVSFKHYAGYVPVDKSNGRAMFYWFFEAMDLP  90

Query  304   DEKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGV  483
              EKPLVLWLNGGPGCSS+GYGATQEIGPFLVD++E+ L  NPY+WNKEAN+LFLESPVGV
Sbjct  91    KEKPLVLWLNGGPGCSSVGYGATQEIGPFLVDTNENGLKFNPYAWNKEANMLFLESPVGV  150

Query  484   GFSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEI  663
             GFSYSNT++DY  L DDF A DAY FL  WF +FP +K   FYIAGESYAGKYVPELAE+
Sbjct  151   GFSYSNTTSDYHKLDDDFTARDAYTFLCNWFERFPEHKGNTFYIAGESYAGKYVPELAEV  210

Query  664   IVD---RNKDPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDF  834
             + D   +N   SL I+L+GILLGNPETSD +DW+G VDYAWSHAVISDETHR I  +C+F
Sbjct  211   VYDNNNKNNGSSLKINLKGILLGNPETSDAEDWRGWVDYAWSHAVISDETHRIISRTCNF  270

Query  835   NSNDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCI-DSLTGSGDNSTPVFKTTS-----  996
             +S++TWS+++CS AV E+ KQY EIDIYSLYTSVCI DS + S  +ST  FKT S     
Sbjct  271   SSDNTWSDEECSGAVAEVQKQYDEIDIYSLYTSVCIGDSASSSYLDSTKFFKTDSHISSS  330

Query  997   -KMMPRIMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKES  1173
              ++ PR + GYDPCLDDYA+++YNR DVQK+LH S G HL++W+ICNM +F  W+  K S
Sbjct  331   KRVPPRRLGGYDPCLDDYARTFYNRADVQKSLHASDGVHLKNWKICNMEIFHNWTYLKPS  390

Query  1174  VLPIYKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQV  1338
             VLPIY+KLIA G+RIWVYSGDTDGRVPVL+TRYS+S L LPI   WRPWYH+KQV
Sbjct  391   VLPIYEKLIAGGLRIWVYSGDTDGRVPVLATRYSLSALELPIKTAWRPWYHEKQV  445



>emb|CAB10289.1| hydroxynitrile lyase like protein [Arabidopsis thaliana]
 emb|CAB78552.1| hydroxynitrile lyase like protein [Arabidopsis thaliana]
Length=407

 Score =   506 bits (1303),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 241/367 (66%), Positives = 283/367 (77%), Gaps = 8/367 (2%)
 Frame = +1

Query  343   GCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYAN  522
             GCSS+GYGATQEIGPFL D++E  L  NPY+WNKE N+LFLESPVGVGFSYSNTS+DY N
Sbjct  17    GCSSVGYGATQEIGPFLADTNEKGLIFNPYAWNKEVNMLFLESPVGVGFSYSNTSSDYLN  76

Query  523   LGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVD---RNKDPSL  693
             L D FA  DAY FL  WF KFP +K   FYIAGESYAG YVPELAE++ D   +N D SL
Sbjct  77    LDDHFAKKDAYTFLCNWFEKFPEHKGNEFYIAGESYAGIYVPELAELVYDNNEKNNDLSL  136

Query  694   FIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQ  873
              I+L+G LLGNP+ S+  DW+G VDYAWSHAVISDETHR I   C+F+S+D W+N  C++
Sbjct  137   HINLKGFLLGNPDISNPDDWRGWVDYAWSHAVISDETHRNINRLCNFSSDDVWNNDKCNE  196

Query  874   AVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKT-----TSKMMPRIMAGYDPCL  1038
             A+ E+ KQY EIDIYSLYTS C      S   ++  FKT     + +M PR +AGYDPCL
Sbjct  197   AIAEVDKQYNEIDIYSLYTSACKGDSAKSSYFASAQFKTNYHISSKRMPPRRLAGYDPCL  256

Query  1039  DDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRI  1218
             DDY K YYNR DVQKALH S G +L++W ICNM +F  W+   +SVLPIY+KLIA G+RI
Sbjct  257   DDYVKVYYNRADVQKALHASDGVNLKNWSICNMEIFHNWTYVVQSVLPIYQKLIAGGLRI  316

Query  1219  WVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGH  1398
             WVYSGDTDG +PVL TRYS++ LGLPI   WRPWYH+KQV GWVQEY+GLTFATFRGAGH
Sbjct  317   WVYSGDTDGCIPVLGTRYSLNALGLPIKTAWRPWYHEKQVSGWVQEYDGLTFATFRGAGH  376

Query  1399  AVPTFKP  1419
              VP+FKP
Sbjct  377   TVPSFKP  383



>gb|ABR16028.1| unknown [Picea sitchensis]
Length=479

 Score =   483 bits (1242),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 230/436 (53%), Positives = 304/436 (70%), Gaps = 9/436 (2%)
 Frame = +1

Query  133   LSSNKEQSDQSWASE-DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDE  309
             L  N +  D   A + D V NLPGQP  +F HYAGY+TVNE++GR LFYW +E+     +
Sbjct  26    LVVNGDHKDGLTAQQADRVYNLPGQPKASFAHYAGYITVNESHGRALFYWFFEAEDKSSK  85

Query  310   KPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGF  489
             KPLVLWLNGGPGCSS+GYGA QE+GPF V ++ + L++N YSWNKEANLLFLESPVGVGF
Sbjct  86    KPLVLWLNGGPGCSSVGYGAAQELGPFQVKTNGTGLSLNTYSWNKEANLLFLESPVGVGF  145

Query  490   SYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIV  669
             SY+NTS+D   L D F A D+Y FL  WF +FP YKT  FYI GESYAG YVP+LAE++ 
Sbjct  146   SYTNTSSDLLELNDQFTAEDSYEFLLRWFKRFPQYKTHDFYIGGESYAGHYVPQLAELVY  205

Query  670   DRNKDPSLF--IDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSN  843
             DR+++ S +  I+ +G ++GNPET +  DWQG+VDYAW+HA+ISD+ +  I + C+F   
Sbjct  206   DRSQNKSKYPSINFKGFIVGNPETDEFHDWQGIVDYAWTHAIISDQKYNLIKSICNFKLF  265

Query  844   DTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIM--  1017
             + W++ DC+QAV+ +   Y EIDIY++Y   C+++          +  + +K+  R +  
Sbjct  266   N-WTD-DCTQAVSSVFADYSEIDIYNIYAPRCLENSNSGVRTRDKLTDSKNKVSRRTLGF  323

Query  1018  --AGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYK  1191
                GYDPC + Y   Y+NR DVQ+ALH +       W  CN SVF+ + D+  S+LPIY 
Sbjct  324   LYGGYDPCFEVYTNEYFNRPDVQEALHANVTKIPFKWGACNNSVFETYIDTVFSILPIYT  383

Query  1192  KLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLT  1371
             KLI  G+RIWVYSGD DGRVPV +T+Y+I+ L LPI ++W PW+H +QV GW  +Y+GLT
Sbjct  384   KLIKGGLRIWVYSGDIDGRVPVTATKYTINALHLPIKQQWHPWFHDRQVAGWFIQYQGLT  443

Query  1372  FATFRGAGHAVPTFKP  1419
               TFRGAGH VP  KP
Sbjct  444   HLTFRGAGHLVPLNKP  459



>ref|XP_007043281.1| Serine carboxypeptidase-like 34 isoform 1 [Theobroma cacao]
 gb|EOX99112.1| Serine carboxypeptidase-like 34 isoform 1 [Theobroma cacao]
Length=487

 Score =   479 bits (1234),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 233/439 (53%), Positives = 299/439 (68%), Gaps = 13/439 (3%)
 Frame = +1

Query  133   LSSNKEQSDQSWASE--DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPD  306
              S+  E S +  A +  D V  LPGQP V FKHYAGYVTVNE++GR LFYW +E+SS P+
Sbjct  31    FSNGTELSQEVLARQEADRVTKLPGQPPVEFKHYAGYVTVNESHGRALFYWFFEASSKPE  90

Query  307   EKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVG  486
             +KPL+LWLNGGPGCSS+GYG  +E+GPF   +D  +L +NP+ WNK ANLLF+ESP GVG
Sbjct  91    KKPLLLWLNGGPGCSSVGYGEAEELGPFFPQNDTKTLKLNPHRWNKAANLLFVESPFGVG  150

Query  487   FSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEII  666
             FSY+NTS D+  LGD   A D+YAFL  WF +FP +K+  FYI+GESYAG YVP+LAE+I
Sbjct  151   FSYTNTSNDFNTLGDAITAKDSYAFLINWFKRFPQFKSHDFYISGESYAGHYVPQLAEVI  210

Query  667   VDRNKDPSL--FIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNS  840
              D NK  S    I+L+G  +GN    DV + +GM++YAW HAVISD  +  II+ C+F+ 
Sbjct  211   FDSNKKASKEDHINLKGFAIGNALLDDVTNSRGMIEYAWDHAVISDRVYDNIISKCNFSV  270

Query  841   NDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRI--  1014
              +   + DC+ A +E    Y+ ID+YSLYT  C+DS + S      +   + +M+ +   
Sbjct  271   EEL--SDDCNDAFDEYYAVYRLIDMYSLYTPTCVDSNSSSSRQRHLIKGISPQMLSKFDG  328

Query  1015  ----MAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLP  1182
                 +AGYDPC+ DY + Y NR DVQ ALHV+       W  C+ ++   W+DS  S+LP
Sbjct  329   WHKRLAGYDPCISDYTEVYLNRPDVQAALHVNVTKKSHKWTHCSNAILI-WNDSPASMLP  387

Query  1183  IYKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYE  1362
               KKL A GIRIWVYSGDTDGRVPV +TRY++  LGL   +EW  WY  KQVGGW  EY+
Sbjct  388   TIKKLAAGGIRIWVYSGDTDGRVPVTATRYALKKLGLKTVKEWTAWYTSKQVGGWTIEYD  447

Query  1363  GLTFATFRGAGHAVPTFKP  1419
             GLTF T RGAGH VP+FKP
Sbjct  448   GLTFVTIRGAGHEVPSFKP  466



>ref|XP_010546241.1| PREDICTED: serine carboxypeptidase-like 34 isoform X2 [Tarenaya 
hassleriana]
Length=491

 Score =   474 bits (1220),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 230/422 (55%), Positives = 288/422 (68%), Gaps = 10/422 (2%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D+V  LPGQP V F+HY+GYVTVNE  GR LFYW +E++  P  KPL+LWLNGGPGCSSI
Sbjct  51    DIVRGLPGQPPVKFRHYSGYVTVNETRGRALFYWFFEATRHPSRKPLLLWLNGGPGCSSI  110

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYGA++E+GPF    D+ +L  N YSWNK ANLLFLESPVGVGFSY+NTS+D   LGD  
Sbjct  111   GYGASEELGPFFPQKDQPNLKFNRYSWNKAANLLFLESPVGVGFSYTNTSSDIGELGDTV  170

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLRG  711
              A D+Y FL  WF +FP YK+  FYIAGESYAG YVP+LAE+I + NK+      I+L+G
Sbjct  171   TARDSYNFLVNWFKRFPQYKSHDFYIAGESYAGHYVPQLAELIYEENKNAPKKDVINLKG  230

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELL  891
             +++GN    D  D +GM+DYAW HAVISD  +  +   CDF   D   +++CS A++E  
Sbjct  231   LMIGNALLDDETDQKGMIDYAWDHAVISDGLYERVKKGCDFR-QDQRPSKECSNALDEYF  289

Query  892   KQYKEIDIYSLYTSVCIDSLTGSGDNST------PVFKTTSKMMPRIMAGYDPCLDDYAK  1053
             + YK ID+YSLYT  C+ + + + +         P+F +      R+ AGYDPC  DY  
Sbjct  290   EVYKIIDMYSLYTPTCVSNDSSARNLPALRGLFRPLFVSQHGGWRRMAAGYDPCASDYTS  349

Query  1054  SYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSG  1233
              Y NR DVQKALH +       W  C+ SV   W D+  S+LP  +KL+ AG+R WV+SG
Sbjct  350   KYMNRPDVQKALHANVTKISYPWSHCS-SVVSFWGDAPASILPTLRKLVEAGLRTWVFSG  408

Query  1234  DTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTF  1413
             DTDGR+PV STRYS+  LGL I ++W PWY + QVGGW  EYEGLTF T RGAGH VPTF
Sbjct  409   DTDGRIPVTSTRYSLKKLGLKIVQDWTPWYSKLQVGGWTVEYEGLTFVTVRGAGHEVPTF  468

Query  1414  KP  1419
             KP
Sbjct  469   KP  470



>ref|XP_010054359.1| PREDICTED: serine carboxypeptidase-like 31 [Eucalyptus grandis]
Length=319

 Score =   466 bits (1200),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 213/294 (72%), Positives = 247/294 (84%), Gaps = 1/294 (0%)
 Frame = +1

Query  541   ANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSLFIDLRGILL  720
             AN++Y+ LH WF KFPSY+TR F+IAGESYAGKYVPELAE+I D+NKDPSL I+L+GILL
Sbjct  6     ANNSYSVLHAWFTKFPSYRTRDFHIAGESYAGKYVPELAELIHDKNKDPSLHINLKGILL  65

Query  721   GNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELLKQY  900
             GNPETS+  DW G+VDYAWSHAVISDETH+ I  +CDF SN+TWSN +C +AV ELL QY
Sbjct  66    GNPETSNADDWMGLVDYAWSHAVISDETHKVIRKTCDFASNNTWSNNECCEAVEELLHQY  125

Query  901   KEIDIYSLYTSVCI-DSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSYYNRLDV  1077
              +ID+YSLYT  CI DS +    +   + K +S+MMPRIM GYDPCLD YA+++YNR DV
Sbjct  126   NQIDMYSLYTPTCIGDSASSDNKSYQVMMKRSSRMMPRIMGGYDPCLDKYAQAFYNRPDV  185

Query  1078  QKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGRVPV  1257
             QKALHVS GHHL++W ICN  +F  W DSK SV+PIYKKLIA G+RIWVYSGDTDGRVPV
Sbjct  186   QKALHVSDGHHLKNWSICNFKIFHDWKDSKPSVIPIYKKLIATGLRIWVYSGDTDGRVPV  245

Query  1258  LSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             LSTRYS+S+LGLPIT+ WRPWYHQKQV GW QEYEGLTFATFRGAGHAVP FKP
Sbjct  246   LSTRYSLSSLGLPITKAWRPWYHQKQVSGWYQEYEGLTFATFRGAGHAVPVFKP  299



>ref|XP_010546240.1| PREDICTED: serine carboxypeptidase-like 34 isoform X1 [Tarenaya 
hassleriana]
Length=492

 Score =   471 bits (1213),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 230/425 (54%), Positives = 287/425 (68%), Gaps = 15/425 (4%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D+V  LPGQP V F+HY+GYVTVNE  GR LFYW +E++  P  KPL+LWLNGGPGCSSI
Sbjct  51    DIVRGLPGQPPVKFRHYSGYVTVNETRGRALFYWFFEATRHPSRKPLLLWLNGGPGCSSI  110

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYGA++E+GPF    D+ +L  N YSWNK ANLLFLESPVGVGFSY+NTS+D   LGD  
Sbjct  111   GYGASEELGPFFPQKDQPNLKFNRYSWNKAANLLFLESPVGVGFSYTNTSSDIGELGDTV  170

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLRG  711
              A D+Y FL  WF +FP YK+  FYIAGESYAG YVP+LAE+I + NK+      I+L+G
Sbjct  171   TARDSYNFLVNWFKRFPQYKSHDFYIAGESYAGHYVPQLAELIYEENKNAPKKDVINLKG  230

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELL  891
             +++GN    D  D +GM+DYAW HAVISD  +  +   CDF   D   +++CS A++E  
Sbjct  231   LMIGNALLDDETDQKGMIDYAWDHAVISDGLYERVKKGCDFR-QDQRPSKECSNALDEYF  289

Query  892   KQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMM---------PRIMAGYDPCLDD  1044
             + YK ID+YSLYT  C+ +   S   + P  +   + +          R+ AGYDPC  D
Sbjct  290   EVYKIIDMYSLYTPTCVSN--DSSARNLPALRGLFRPLFVSQHQGGWRRMAAGYDPCASD  347

Query  1045  YAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWV  1224
             Y   Y NR DVQKALH +       W  C+ SV   W D+  S+LP  +KL+ AG+R WV
Sbjct  348   YTSKYMNRPDVQKALHANVTKISYPWSHCS-SVVSFWGDAPASILPTLRKLVEAGLRTWV  406

Query  1225  YSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAV  1404
             +SGDTDGR+PV STRYS+  LGL I ++W PWY + QVGGW  EYEGLTF T RGAGH V
Sbjct  407   FSGDTDGRIPVTSTRYSLKKLGLKIVQDWTPWYSKLQVGGWTVEYEGLTFVTVRGAGHEV  466

Query  1405  PTFKP  1419
             PTFKP
Sbjct  467   PTFKP  471



>ref|XP_006437579.1| hypothetical protein CICLE_v10031415mg [Citrus clementina]
 gb|ESR50819.1| hypothetical protein CICLE_v10031415mg [Citrus clementina]
Length=474

 Score =   469 bits (1208),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 232/425 (55%), Positives = 291/425 (68%), Gaps = 13/425 (3%)
 Frame = +1

Query  169   ASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGC  348
             A  D V +LPGQP V FKHYAGYV +  N+ + LFYW +E+      KPLVLWLNGGPGC
Sbjct  34    ADADRVRDLPGQPKVEFKHYAGYVKLRPNDHKALFYWFFEAQKGVSSKPLVLWLNGGPGC  93

Query  349   SSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLG  528
             SSI YGA QE+GPFLV  + S L  N YSWNK AN+LFLE+PVGVGFSY+N S D   LG
Sbjct  94    SSIAYGAAQELGPFLVGGNGSRLKFNKYSWNKAANMLFLEAPVGVGFSYTNNSEDLHKLG  153

Query  529   DDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRN----KDPSLF  696
             D   AND+YAFL  WF +FP++K+  FYIAGESYAG YVP+LAE+I +RN    KD   F
Sbjct  154   DQVTANDSYAFLIGWFKRFPNFKSHDFYIAGESYAGHYVPQLAELIHERNIRAGKDS--F  211

Query  697   IDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQA  876
             I+L+G ++GN   +D  D +G+VDYAWSHA+ISD+ ++ I   CDF  +   SN  C+  
Sbjct  212   INLKGFMIGNAVINDPTDTKGLVDYAWSHAIISDKLYKDISKECDFGQSMIRSN--CNDH  269

Query  877   VNELLKQYKEIDIYSLYTSVCIDSLTGSGDNS---TPVFKTTSKMMPRIMAGYDPCLDDY  1047
             +   ++ Y EIDIYS+Y+ VC+DSL G   +     P   T   +  R+ +GYDPC +DY
Sbjct  270   IRGFVEAYAEIDIYSIYSPVCLDSLDGKAPSKLMVAPHLLTQHDLWHRLPSGYDPCAEDY  329

Query  1048  AKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVY  1227
                ++NR DVQ+ALH +       +  C+  V   W+DS E+VLPI +KL+ AG+RIWVY
Sbjct  330   VMKFFNREDVQRALHANITKLSYPYTTCS-GVISKWNDSAETVLPIIQKLLNAGLRIWVY  388

Query  1228  SGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYE-GLTFATFRGAGHAV  1404
             SGDTDGRVPV STRYSI+ +GL I  EWR W+H+ QV GWV+ YE GLT  T RGAGH V
Sbjct  389   SGDTDGRVPVTSTRYSINKMGLKIKEEWRAWFHKHQVAGWVETYEKGLTLVTVRGAGHQV  448

Query  1405  PTFKP  1419
             P F P
Sbjct  449   PAFAP  453



>ref|XP_008806723.1| PREDICTED: serine carboxypeptidase-like 33 isoform X1 [Phoenix 
dactylifera]
Length=475

 Score =   469 bits (1206),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 227/438 (52%), Positives = 299/438 (68%), Gaps = 17/438 (4%)
 Frame = +1

Query  136   SSNKEQSDQSWASEDLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYESSSLPDEK  312
             S  +E+  Q     D V NLPGQP   +  H++GY+TVN  NGR LFYW +E+ + P ++
Sbjct  25    SLQEEELYQDEQESDRVYNLPGQPKSPSLSHFSGYITVNRENGRALFYWFFEAQTEPSKR  84

Query  313   PLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFS  492
             PL+LWLNGGPGCSSIGYGA  E+GP  V    + L  N Y+WNKEANLLFLESP+GVGFS
Sbjct  85    PLLLWLNGGPGCSSIGYGAAVELGPLRVKRHGTGLEFNKYAWNKEANLLFLESPIGVGFS  144

Query  493   YSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVD  672
             Y+NT +D   L D F A DAY+FL  WF  FP Y+ + FYI+GESYAG YVP+LAE++ D
Sbjct  145   YTNTPSDLNKLEDGFVAEDAYSFLLNWFRMFPQYQAQDFYISGESYAGHYVPQLAELVYD  204

Query  673   RNKDPS--LFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSND  846
             RNKD     +I+L+G ++GNPET D  D +G+V+YAWSH V+SD  +R +   CDF   +
Sbjct  205   RNKDRKNYPYINLKGFIVGNPETDDYYDSKGLVEYAWSHTVVSDRAYRLVNKVCDFRLFN  264

Query  847   TWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMP------  1008
              W++ +CS A+N +  QYK+IDIY++Y   C          S+  ++T +KM        
Sbjct  265   -WTH-ECSNAMNMVFDQYKDIDIYNIYAPKC-----NLAQASSSTYETNAKMQRSFLRKL  317

Query  1009  RIMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLR-DWRICNMSVFDGWSDSKESVLPI  1185
             R+ +GYDPC  +YA+ Y+N+ DVQK+LH   G  +   W++CN S+ + ++ +  SVLPI
Sbjct  318   RMYSGYDPCFSNYAEEYFNKPDVQKSLHAHVGGKINGTWQVCNDSILNAYNFTVSSVLPI  377

Query  1186  YKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEG  1365
             Y KLI AG+RIWVYSGDTDGRVPV+ TRY + +LGLP+  +W+PWYH  QVGG   EY+G
Sbjct  378   YSKLIKAGLRIWVYSGDTDGRVPVIGTRYCVESLGLPLKSQWQPWYHNSQVGGRFVEYQG  437

Query  1366  LTFATFRGAGHAVPTFKP  1419
             LT AT RGAGH VP   P
Sbjct  438   LTMATVRGAGHLVPLSMP  455



>ref|XP_008806724.1| PREDICTED: serine carboxypeptidase-like 33 isoform X2 [Phoenix 
dactylifera]
Length=473

 Score =   468 bits (1205),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 225/432 (52%), Positives = 298/432 (69%), Gaps = 7/432 (2%)
 Frame = +1

Query  136   SSNKEQSDQSWASEDLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYESSSLPDEK  312
             S  +E+  Q     D V NLPGQP   +  H++GY+TVN  NGR LFYW +E+ + P ++
Sbjct  25    SLQEEELYQDEQESDRVYNLPGQPKSPSLSHFSGYITVNRENGRALFYWFFEAQTEPSKR  84

Query  313   PLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFS  492
             PL+LWLNGGPGCSSIGYGA  E+GP  V    + L  N Y+WNKEANLLFLESP+GVGFS
Sbjct  85    PLLLWLNGGPGCSSIGYGAAVELGPLRVKRHGTGLEFNKYAWNKEANLLFLESPIGVGFS  144

Query  493   YSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVD  672
             Y+NT +D   L D F A DAY+FL  WF  FP Y+ + FYI+GESYAG YVP+LAE++ D
Sbjct  145   YTNTPSDLNKLEDGFVAEDAYSFLLNWFRMFPQYQAQDFYISGESYAGHYVPQLAELVYD  204

Query  673   RNKDPS--LFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSND  846
             RNKD     +I+L+G ++GNPET D  D +G+V+YAWSH V+SD  +R +   CDF   +
Sbjct  205   RNKDRKNYPYINLKGFIVGNPETDDYYDSKGLVEYAWSHTVVSDRAYRLVNKVCDFRLFN  264

Query  847   TWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGY  1026
              W++ +CS A+N +  QYK+IDIY++Y   C  +   S    T   ++  + + R+ +GY
Sbjct  265   -WTH-ECSNAMNMVFDQYKDIDIYNIYAPKCNLAQASSSTYETNAKRSFLRKL-RMYSGY  321

Query  1027  DPCLDDYAKSYYNRLDVQKALHVSSGHHLR-DWRICNMSVFDGWSDSKESVLPIYKKLIA  1203
             DPC  +YA+ Y+N+ DVQK+LH   G  +   W++CN S+ + ++ +  SVLPIY KLI 
Sbjct  322   DPCFSNYAEEYFNKPDVQKSLHAHVGGKINGTWQVCNDSILNAYNFTVSSVLPIYSKLIK  381

Query  1204  AGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATF  1383
             AG+RIWVYSGDTDGRVPV+ TRY + +LGLP+  +W+PWYH  QVGG   EY+GLT AT 
Sbjct  382   AGLRIWVYSGDTDGRVPVIGTRYCVESLGLPLKSQWQPWYHNSQVGGRFVEYQGLTMATV  441

Query  1384  RGAGHAVPTFKP  1419
             RGAGH VP   P
Sbjct  442   RGAGHLVPLSMP  453



>ref|XP_006484538.1| PREDICTED: serine carboxypeptidase-like 35-like [Citrus sinensis]
Length=474

 Score =   468 bits (1204),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 232/425 (55%), Positives = 290/425 (68%), Gaps = 13/425 (3%)
 Frame = +1

Query  169   ASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGC  348
             A  D V +LPGQP V FKHYAGYV +  N+ + LFYW +E+      KPLVLWLNGGPGC
Sbjct  34    ADADRVRDLPGQPKVEFKHYAGYVKLRPNDHKALFYWFFEAQKGVSSKPLVLWLNGGPGC  93

Query  349   SSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLG  528
             SSI YGA QE+GPFLV  + S L  N YSWNK AN+LFLE+PVGVGFSY+N S D   LG
Sbjct  94    SSIAYGAAQELGPFLVGGNGSRLKFNKYSWNKAANMLFLEAPVGVGFSYTNNSEDLHKLG  153

Query  529   DDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRN----KDPSLF  696
             D   AND+YAFL  WF +FP++K+  FYIAGESYAG YVP+LAE+I +RN    KD   F
Sbjct  154   DQVTANDSYAFLIGWFKRFPNFKSHDFYIAGESYAGHYVPQLAELIHERNIRAGKDS--F  211

Query  697   IDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQA  876
             I+L+G ++GN   +D  D +G+VDYAWSHA+ISD+ ++ I   CDF  +   SN  C+  
Sbjct  212   INLKGFMIGNAVINDPTDTKGLVDYAWSHAIISDKLYKDISKECDFGQSMIRSN--CNDH  269

Query  877   VNELLKQYKEIDIYSLYTSVCIDSLTGSGDNS---TPVFKTTSKMMPRIMAGYDPCLDDY  1047
             +   ++ Y EIDIYS+Y+ VC+DSL G         P   T   +  R+ +GYDPC +DY
Sbjct  270   IRGFVEAYAEIDIYSIYSPVCLDSLDGKAPPKLMVAPHLLTQHDLWHRLPSGYDPCAEDY  329

Query  1048  AKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVY  1227
                ++NR DVQ+ALH +       +  C+  V   W+DS E+VLPI +KL+ AG+RIWVY
Sbjct  330   VMKFFNREDVQRALHANITKLSYPYTTCS-GVISKWNDSAETVLPIIQKLLNAGLRIWVY  388

Query  1228  SGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYE-GLTFATFRGAGHAV  1404
             SGDTDGRVPV STRYSI+ +GL I  EWR W+H+ QV GWV+ YE GLT  T RGAGH V
Sbjct  389   SGDTDGRVPVTSTRYSINKMGLKIKEEWRAWFHKHQVAGWVETYEKGLTLVTVRGAGHQV  448

Query  1405  PTFKP  1419
             P F P
Sbjct  449   PAFAP  453



>ref|XP_004508115.1| PREDICTED: serine carboxypeptidase-like 33-like [Cicer arietinum]
Length=475

 Score =   466 bits (1200),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 224/425 (53%), Positives = 291/425 (68%), Gaps = 13/425 (3%)
 Frame = +1

Query  178   DLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             D + NLPGQP   +  H++GY+TVN+ +GR LFYW +E+ S P  KPL+LWLNGGPGCSS
Sbjct  33    DRITNLPGQPSTPSVSHFSGYITVNQEHGRALFYWFFEAQSEPSNKPLLLWLNGGPGCSS  92

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             IGYGA  EIGP LV+ +   L  N YSWN+EANLLF+ESPVGVGFSY+NTS+D   L D 
Sbjct  93    IGYGAVVEIGPLLVNKNGEGLNFNSYSWNQEANLLFVESPVGVGFSYTNTSSDLTILEDH  152

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLR  708
             F A DAY FL  W  +FP +K+R FYIAGESYAG Y+P+LAE+I DRNKD +   FI+L+
Sbjct  153   FVAEDAYNFLVNWLQRFPQFKSRDFYIAGESYAGHYIPQLAELIFDRNKDRNSYPFINLK  212

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G ++GNPET D  D++G+++YAWSHAVISD+ +      CDF  +  WS++ C+Q +++L
Sbjct  213   GFIVGNPETEDYYDYKGLLEYAWSHAVISDQQYEKAKQVCDFKQS-LWSDE-CNQVMSQL  270

Query  889   LKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSK-----MMPRIMAGYDPCLDDYAK  1053
                Y EIDIY++Y   C  + T S  ++ P   T  K        RI  GYDPC   Y +
Sbjct  271   FHDYSEIDIYNIYAPACRLNKTSSVTSNVPESLTKVKNDYKLKRMRIFGGYDPCYSKYVE  330

Query  1054  SYYNRLDVQKALHVSSGHHLRD---WRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWV  1224
              ++NR+DVQ + H ++         W++CN S+   ++ S  SVLPIY KLI  G++IW+
Sbjct  331   EFFNRVDVQSSFHANNNKRENGNIAWKVCNDSILGTYNFSVFSVLPIYTKLIKGGLKIWI  390

Query  1225  YSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAV  1404
             YSGD DGR+PV+ TRY +  LGLP+   WRPWYH  QVGG + EYEGLT+ T RGAGH V
Sbjct  391   YSGDADGRLPVIGTRYCVEALGLPLKSTWRPWYHHNQVGGRIVEYEGLTYVTVRGAGHLV  450

Query  1405  PTFKP  1419
             P  KP
Sbjct  451   PLNKP  455



>gb|KHN02864.1| Serine carboxypeptidase-like 33 [Glycine soja]
Length=477

 Score =   466 bits (1198),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 222/427 (52%), Positives = 296/427 (69%), Gaps = 15/427 (4%)
 Frame = +1

Query  178   DLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             D + +LPGQP   +  H++GY+TVNEN+GR LFYW +E+ S P +KPL+LWLNGGPGCSS
Sbjct  33    DRIIDLPGQPSSPSVSHFSGYITVNENHGRELFYWFFEAQSEPSKKPLLLWLNGGPGCSS  92

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             +GYGA  EIGP +V+ +   L  N YSWN+EANLLF+ESPVGVGFSY+NTS+D   L D+
Sbjct  93    VGYGAVVEIGPLIVNKNGEGLHFNTYSWNQEANLLFVESPVGVGFSYTNTSSDLTILEDN  152

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLR  708
             F A DAY FL  W  +FP +K+R F+I+GESY G Y+P+LAE+I DRNKD S   FI+L+
Sbjct  153   FVAKDAYNFLVNWLQRFPQFKSRDFFISGESYGGHYIPQLAELIFDRNKDGSKYPFINLK  212

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G ++GNP+T D  D++G+++YAWSHAVISD+ +      CDF   + WSN+ C++A+NE+
Sbjct  213   GFIVGNPKTDDYYDYKGLLEYAWSHAVISDQQYDKAKQLCDFKQFE-WSNE-CNKAMNEV  270

Query  889   LKQYKEIDIYSLYTSVCI----DSLTGSGDNSTPVFKTTSK-----MMPRIMAGYDPCLD  1041
              + Y EIDIY++Y   C+     S+   GD++ P   T  +        RI  GYDPC  
Sbjct  271   FQDYLEIDIYNIYAPACLLNSTSSIADDGDSNGPESLTKERNDYRLKRMRIFGGYDPCYS  330

Query  1042  DYAKSYYNRLDVQKALHVSSGHHLR-DWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRI  1218
             +YA+ Y+NR DVQ + H  +       W++CN S+   ++ S  SVLP+Y KLI  G++I
Sbjct  331   NYAEEYFNRKDVQSSFHADTKRDTNVAWKVCNNSILRTYNFSVFSVLPVYTKLIKGGLKI  390

Query  1219  WVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGH  1398
             W+YSGD DGR+PV+ TRY +  LGLP+   WR WYH  QVGG + EYEGLT+ T RGAGH
Sbjct  391   WIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTWYHDNQVGGRIVEYEGLTYVTVRGAGH  450

Query  1399  AVPTFKP  1419
              VP  KP
Sbjct  451   LVPLNKP  457



>ref|XP_003529505.1| PREDICTED: serine carboxypeptidase-like 33-like isoformX1 [Glycine 
max]
Length=481

 Score =   466 bits (1198),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 222/427 (52%), Positives = 296/427 (69%), Gaps = 15/427 (4%)
 Frame = +1

Query  178   DLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             D + +LPGQP   +  H++GY+TVNEN+GR LFYW +E+ S P +KPL+LWLNGGPGCSS
Sbjct  37    DRIIDLPGQPSSPSVSHFSGYITVNENHGRELFYWFFEAQSEPSKKPLLLWLNGGPGCSS  96

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             +GYGA  EIGP +V+ +   L  N YSWN+EANLLF+ESPVGVGFSY+NTS+D   L D+
Sbjct  97    VGYGAVVEIGPLIVNKNGEGLHFNTYSWNQEANLLFVESPVGVGFSYTNTSSDLTILEDN  156

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLR  708
             F A DAY FL  W  +FP +K+R F+I+GESY G Y+P+LAE+I DRNKD S   FI+L+
Sbjct  157   FVAKDAYNFLVNWLQRFPQFKSRDFFISGESYGGHYIPQLAELIFDRNKDGSKYPFINLK  216

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G ++GNP+T D  D++G+++YAWSHAVISD+ +      CDF   + WSN+ C++A+NE+
Sbjct  217   GFIVGNPKTDDYYDYKGLLEYAWSHAVISDQQYDKAKQLCDFKQFE-WSNE-CNKAMNEV  274

Query  889   LKQYKEIDIYSLYTSVCI----DSLTGSGDNSTPVFKTTSK-----MMPRIMAGYDPCLD  1041
              + Y EIDIY++Y   C+     S+   GD++ P   T  +        RI  GYDPC  
Sbjct  275   FQDYLEIDIYNIYAPACLLNSTSSIADDGDSNGPESLTKERNDYRLKRMRIFGGYDPCYS  334

Query  1042  DYAKSYYNRLDVQKALHVSSGHHLR-DWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRI  1218
             +YA+ Y+NR DVQ + H  +       W++CN S+   ++ S  SVLP+Y KLI  G++I
Sbjct  335   NYAEEYFNRKDVQSSFHADTKRDTNVAWKVCNNSILRTYNFSVFSVLPVYTKLIKGGLKI  394

Query  1219  WVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGH  1398
             W+YSGD DGR+PV+ TRY +  LGLP+   WR WYH  QVGG + EYEGLT+ T RGAGH
Sbjct  395   WIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTWYHDNQVGGRIVEYEGLTYVTVRGAGH  454

Query  1399  AVPTFKP  1419
              VP  KP
Sbjct  455   LVPLNKP  461



>ref|XP_010031922.1| PREDICTED: serine carboxypeptidase-like 34 [Eucalyptus grandis]
 gb|KCW51317.1| hypothetical protein EUGRSUZ_J00874 [Eucalyptus grandis]
Length=485

 Score =   466 bits (1198),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 229/444 (52%), Positives = 302/444 (68%), Gaps = 21/444 (5%)
 Frame = +1

Query  133   LSSNKEQSDQSWASE---DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLP  303
             ++S+      +WASE   D V  LPGQP V FK YAGYVTVNE +GR LFYW +E++  P
Sbjct  27    VASSLPSGTANWASEQEADRVYRLPGQPDVKFKQYAGYVTVNETHGRALFYWFFEATDKP  86

Query  304   DEKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGV  483
              +KPL+LWLNGGPGCSSIGYG ++E+GPF    D+  L  N Y+WNK ANLLF+ESPVGV
Sbjct  87    QDKPLLLWLNGGPGCSSIGYGQSEELGPFFPQKDQPKLKFNRYTWNKAANLLFVESPVGV  146

Query  484   GFSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEI  663
             GFSY+NTS+D   LGD   A D+Y FL  WF +FP +K+  FY+AGESYAG YVP+L+E+
Sbjct  147   GFSYTNTSSDIGQLGDTITAQDSYVFLVNWFRRFPQFKSHDFYLAGESYAGHYVPQLSEL  206

Query  664   IVDRNKDPSL--FIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFN  837
             I+D NK  S   +I+L+G+++GN    D  D +GM+DYAW HAV+SD  +  I A+C+F+
Sbjct  207   ILDNNKKLSKEDYINLKGLMIGNALLDDDTDQRGMIDYAWDHAVVSDRLYHDIKATCNFS  266

Query  838   SNDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIM  1017
               +  S  DC+  +N+    Y+ ID+YSLY S C++S   S     PV      + PR++
Sbjct  267   QENLTS--DCTSNLNKYFAVYRIIDMYSLYVSKCVNS-NFSSTRQRPVIDGV--IAPRLL  321

Query  1018  ----------AGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSK  1167
                       AGYDPC  DY + Y+NR DVQ+ALH +  +    W  C+ ++   WSD+ 
Sbjct  322   SKFAGWHKRPAGYDPCASDYTEVYFNRPDVQEALHANVTNIPYPWTHCSNNI-SFWSDAP  380

Query  1168  ESVLPIYKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGW  1347
              S+LPI +KLI  G+R+WVYSGDTDGR+PV STRY+++ LGL I ++W PWY+ +QVGGW
Sbjct  381   ASILPIIRKLIQGGLRVWVYSGDTDGRIPVTSTRYTLNKLGLDIVQDWTPWYNYQQVGGW  440

Query  1348  VQEYEGLTFATFRGAGHAVPTFKP  1419
               EY+GLTF T R AGH VPTF P
Sbjct  441   TVEYDGLTFVTVRAAGHQVPTFAP  464



>ref|XP_010914643.1| PREDICTED: serine carboxypeptidase-like 33 [Elaeis guineensis]
Length=473

 Score =   465 bits (1196),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 221/434 (51%), Positives = 301/434 (69%), Gaps = 6/434 (1%)
 Frame = +1

Query  130   SLSSNKEQSDQSWASEDLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYESSSLPD  306
             S+ + +E+  Q+    D V +LPGQP   +  H++GY+TVN+ NGR LFYW +E+ + P 
Sbjct  22    SIKTLQEEPHQNDQESDRVFDLPGQPKSPSLFHFSGYITVNKKNGRALFYWFFEAQTEPS  81

Query  307   EKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVG  486
             ++PL+LWLNGGPGCSSIGYGA  E+GP  V    + L  N Y+WNKEAN+LFLESPVGVG
Sbjct  82    KRPLLLWLNGGPGCSSIGYGAAVELGPLRVKRYGTGLEFNKYAWNKEANMLFLESPVGVG  141

Query  487   FSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEII  666
             FSY+NTS+D   L D F A DAY+FL  W  +FP Y+   FYI+GESYAG YVP+LAE++
Sbjct  142   FSYTNTSSDLTKLDDGFVAEDAYSFLVNWLRRFPQYQAHDFYISGESYAGHYVPQLAELV  201

Query  667   VDRNKDPSL--FIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNS  840
              +RNKD     +I+ +G ++GNPET +  D +G+V+YAWSHAV+SD+ +R +   CDF  
Sbjct  202   YERNKDRKSYPYINFKGFIVGNPETDNYYDAKGLVEYAWSHAVVSDQVYRLVNRVCDFKL  261

Query  841   NDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMA  1020
             ++ W+N +C+ A+N +  QYK+IDIY++Y   C  + T S  N     K +     R+ +
Sbjct  262   SN-WTN-ECNNAMNIVFDQYKDIDIYNIYAPKCTLAQTSSSFNHETNVKMSFLGRRRMYS  319

Query  1021  GYDPCLDDYAKSYYNRLDVQKALHVSSGHHLR-DWRICNMSVFDGWSDSKESVLPIYKKL  1197
             GYDPC   YA+ Y+N+ DVQ++LH   G  +   W++CN S+ + ++++  SVLPIY KL
Sbjct  320   GYDPCFSTYAEEYFNKPDVQQSLHALVGGKVNGKWQVCNDSILNTYNNTVFSVLPIYSKL  379

Query  1198  IAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFA  1377
             I AG+RIWVYSGD DGRVPV+ +RY +  L LP+  +W+PWYH KQVGG   EY+GLT  
Sbjct  380   IKAGLRIWVYSGDADGRVPVIGSRYCVEALRLPLKSKWQPWYHNKQVGGRFVEYQGLTMV  439

Query  1378  TFRGAGHAVPTFKP  1419
             T RGAGH VP  KP
Sbjct  440   TVRGAGHLVPLNKP  453



>ref|XP_003550568.2| PREDICTED: serine carboxypeptidase-like 33-like [Glycine max]
Length=482

 Score =   464 bits (1193),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 222/427 (52%), Positives = 293/427 (69%), Gaps = 15/427 (4%)
 Frame = +1

Query  178   DLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             D + +LPGQP   +  H++GY+TVNEN+GR LFYW +E+ S P +KPL+LWLNGGPGCSS
Sbjct  37    DRIIDLPGQPSSPSVSHFSGYITVNENHGRALFYWFFEAQSEPSKKPLLLWLNGGPGCSS  96

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             IGYG   EIGP +V+ +   L  N +SWN+EANLLF+ESPVGVGFSY+NTS+D   L D+
Sbjct  97    IGYGGVVEIGPLIVNKNGEGLHFNTHSWNQEANLLFVESPVGVGFSYTNTSSDLTKLEDN  156

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLR  708
             F A DAY FL  W  +FP +K+R F+I+GESY G Y+P+LAE+I DRNKD S   FI+L+
Sbjct  157   FVAEDAYIFLVNWLQRFPQFKSRDFFISGESYGGHYIPQLAELIFDRNKDGSKYPFINLK  216

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G ++GNPET D  D++G+++YAWSHAVISD+ +      CDF   D WSN+ C++A+NE+
Sbjct  217   GFIVGNPETDDYYDYKGLLEYAWSHAVISDQQYDKAKQVCDFKQFD-WSNE-CNKAMNEV  274

Query  889   LKQYKEIDIYSLYTSVCI--------DSLTGSGDNSTPVFKTTSKMMP-RIMAGYDPCLD  1041
              + Y EIDIY++Y   C+        D   G+G  S    +   ++   RI  GYDPC  
Sbjct  275   FQDYSEIDIYNIYAPSCLLNSTSSIADDSNGNGPESFTKERNDYRLKRMRIFGGYDPCYS  334

Query  1042  DYAKSYYNRLDVQKALHVSSGHHLR-DWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRI  1218
             +Y + Y+NR DVQ + H  +       W++CN S+   ++ S  SVLP+Y KLI  G++I
Sbjct  335   NYVEEYFNRKDVQSSFHADTKRDTNVAWKVCNNSILRTYNFSVFSVLPVYTKLIKGGLKI  394

Query  1219  WVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGH  1398
             W+YSGD DGRVPV+ TRY +  LGLP+   WR WYH  QVGG + EYEGLT+ T RGAGH
Sbjct  395   WIYSGDADGRVPVIGTRYCVEALGLPLKSRWRTWYHDNQVGGRIVEYEGLTYVTVRGAGH  454

Query  1399  AVPTFKP  1419
              VP  KP
Sbjct  455   LVPLNKP  461



>ref|XP_007154418.1| hypothetical protein PHAVU_003G118000g [Phaseolus vulgaris]
 gb|ESW26412.1| hypothetical protein PHAVU_003G118000g [Phaseolus vulgaris]
Length=496

 Score =   463 bits (1192),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 224/427 (52%), Positives = 295/427 (69%), Gaps = 16/427 (4%)
 Frame = +1

Query  178   DLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             D + +LPGQP   +  H++GY+TVNEN+GR LFYW +E+ S P +KPL+LWLNGGPGCSS
Sbjct  53    DRIIDLPGQPSSPSLSHFSGYITVNENHGRALFYWFFEAQSEPSKKPLLLWLNGGPGCSS  112

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             IGYGA  EIGP +V+ +   L  N YSWN+EANLLF+ESPVGVGFSY+NTS+D   L D+
Sbjct  113   IGYGAVVEIGPLIVNKNGEGLLFNKYSWNQEANLLFVESPVGVGFSYTNTSSDTI-LEDN  171

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLR  708
             F A DAY FL  W  +FP +K+R F+I+GESY G Y+P+LAE+I DRNKD ++  FI+L+
Sbjct  172   FVAEDAYNFLVNWLERFPQFKSRDFFISGESYGGHYIPQLAELIFDRNKDSNIYPFINLK  231

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G ++GNPET D  D++G+++YAWSHAVISD+ +      CDF   + WSN+ C++A+NE+
Sbjct  232   GFIVGNPETDDYYDYKGLLEYAWSHAVISDQQYEKAKQVCDFKQFE-WSNE-CNRAMNEV  289

Query  889   LKQYKEIDIYSLYTSVC-IDSLTGSGDNS--------TPVFKTTSKMMPRIMAGYDPCLD  1041
                Y EIDIY++Y   C ++S +   D S        T V     +   RI  GYDPC  
Sbjct  290   FHDYSEIDIYNIYAPRCPLNSTSSIADESNSIGHELFTKVRNDHRERRMRIFGGYDPCFS  349

Query  1042  DYAKSYYNRLDVQKALHVSSGHHLR-DWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRI  1218
             +YA+ Y+NR DVQ + H  +       W++CN S+   ++ S  SVLPIY KLI  G++I
Sbjct  350   NYAEEYFNRKDVQSSFHADTKRATNVAWKVCNNSILRAYNFSVFSVLPIYTKLIKGGLKI  409

Query  1219  WVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGH  1398
             W+YSGD DGRVPV+ TRY +  LGLP+   W+ WYH  QVGG + EYEGLT+ T RGAGH
Sbjct  410   WIYSGDADGRVPVIGTRYCVEALGLPLKSRWQTWYHDNQVGGRIVEYEGLTYVTVRGAGH  469

Query  1399  AVPTFKP  1419
              VP  KP
Sbjct  470   LVPLNKP  476



>ref|XP_003537768.1| PREDICTED: serine carboxypeptidase-like 34-like [Glycine max]
 gb|KHN32296.1| Serine carboxypeptidase-like 34 [Glycine soja]
Length=466

 Score =   462 bits (1188),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 226/431 (52%), Positives = 288/431 (67%), Gaps = 5/431 (1%)
 Frame = +1

Query  136   SSNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKP  315
             S  KE    S    D V  LPGQP V FK Y+GY+TVNE +GR LFYW +E++  P+EKP
Sbjct  17    SFTKEALGVSEQEADRVHGLPGQPPVKFKQYSGYITVNETHGRALFYWFFEATHKPEEKP  76

Query  316   LVLWLNGGPGCSSIGYGATQEIGPFL-VDSDESSLTVNPYSWNKEANLLFLESPVGVGFS  492
             L+LWLNGGPGCSSIGYG  +E+GPF   DS +  L +NPYSWN  ANLLFLESPVGVGFS
Sbjct  77    LLLWLNGGPGCSSIGYGEAEELGPFFPQDSSQPKLKLNPYSWNNAANLLFLESPVGVGFS  136

Query  493   YSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVD  672
             Y+NTS+D + LGD   A D++ F+ +WF +FP +++  FYI+GESYAG YVP+L+E+I D
Sbjct  137   YTNTSSDISELGDTITAKDSHTFIIKWFRRFPQFRSHEFYISGESYAGHYVPQLSELIFD  196

Query  673   RNKDP--SLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSND  846
              N++P    +I+ +G L+GN    D  D +GM+DYAW HAVISD  +  I   CDF+   
Sbjct  197   NNRNPVEKDYINFKGFLIGNALLDDETDQKGMIDYAWDHAVISDGVYHNITTICDFSLPI  256

Query  847   TWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGY  1026
                  +C+  +N+    YK ID+YSLYT  C  + + +   +   F        R  AGY
Sbjct  257   LNQTNECNVELNKYFAVYKIIDMYSLYTPRCFSNTSSTRKEALQSFSKIDGWH-RKSAGY  315

Query  1027  DPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAA  1206
             DPC  DY ++Y NR +VQKALH +       W  C+ ++   W+DS +S+LP+ KKLIA 
Sbjct  316   DPCASDYTEAYLNRPEVQKALHANVTKIPYPWTHCSDNI-TFWNDSPQSMLPVIKKLIAG  374

Query  1207  GIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFR  1386
             GIRIWVYSGDTDGR+PV STRY++  LGL I  +W PWY  KQVGGW   Y+GLTF T R
Sbjct  375   GIRIWVYSGDTDGRIPVTSTRYTLRKLGLGIVEDWTPWYTSKQVGGWTIAYDGLTFVTIR  434

Query  1387  GAGHAVPTFKP  1419
             GAGH VPTF P
Sbjct  435   GAGHQVPTFTP  445



>ref|XP_008801741.1| PREDICTED: serine carboxypeptidase-like 33 isoform X1 [Phoenix 
dactylifera]
Length=470

 Score =   462 bits (1188),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 226/438 (52%), Positives = 298/438 (68%), Gaps = 15/438 (3%)
 Frame = +1

Query  130   SLSSNKEQSDQSWASEDLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYESSSLPD  306
             S+   +E+  Q+    D V NLPGQP   +  H++GY+TV+  NGR LFYW +E+ + P 
Sbjct  20    SIKPLQEEVHQNDQESDRVFNLPGQPRSPSLSHFSGYITVSRENGRALFYWFFEAQTEPS  79

Query  307   EKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVG  486
             ++PL+LWLNGGPGCSSIGYGA  E+GP  V      L  N Y+WNKEANLLFLESPVGVG
Sbjct  80    KRPLLLWLNGGPGCSSIGYGAAVEMGPLRVKRYGRGLEFNKYAWNKEANLLFLESPVGVG  139

Query  487   FSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEII  666
             FSY+NTS+D   L D FAA DAY+FL  W  +FP Y+   FYIAGESYAG YVP+LAE++
Sbjct  140   FSYTNTSSDLTKLDDGFAAEDAYSFLVNWLRRFPQYQAHDFYIAGESYAGHYVPQLAELV  199

Query  667   VDRNKDPS--LFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNS  840
              +RNKD     +I+ +G ++GNPET D  DW+G  +YAWSH V+SD+ +R +   CDF  
Sbjct  200   FERNKDRKNYPYINFKGFIVGNPETDDYYDWKGFAEYAWSHTVVSDQVYRLVNRVCDFKL  259

Query  841   NDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKM----MP  1008
              + W+N+ C+ A+N +  QY +IDIY++Y   C  + T     S+  ++T +KM      
Sbjct  260   LN-WTNK-CNNAMNIVFNQYNDIDIYNIYAPKCSLAQT-----SSFTYETHAKMSFLGRR  312

Query  1009  RIMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLR-DWRICNMSVFDGWSDSKESVLPI  1185
             R+ +GYDPC   YA+ Y+N+ DVQK+LH   G  +   W++CN  V + ++ +  SVLPI
Sbjct  313   RMYSGYDPCFSTYAEEYFNKPDVQKSLHALVGGKVNGKWQVCNNFVSNAYNVTVFSVLPI  372

Query  1186  YKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEG  1365
             Y KLI AG+RIW+YSGDTDGRVP + +RY +  LGLP+   W+PWYH KQVGG   EY+G
Sbjct  373   YSKLIKAGLRIWIYSGDTDGRVPAIGSRYCVEALGLPLKSHWQPWYHNKQVGGRFVEYQG  432

Query  1366  LTFATFRGAGHAVPTFKP  1419
             LT AT RGAGH VP  KP
Sbjct  433   LTMATVRGAGHLVPLNKP  450



>ref|XP_004505704.1| PREDICTED: serine carboxypeptidase-like 34-like [Cicer arietinum]
Length=475

 Score =   462 bits (1188),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 228/438 (52%), Positives = 296/438 (68%), Gaps = 17/438 (4%)
 Frame = +1

Query  142   NKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLV  321
             +KE    +   ED V  LPGQP VNFK YAGYVTVNE +GR LFYW +E+   P +KPL+
Sbjct  22    SKEVLGVTQQEEDRVYELPGQPHVNFKQYAGYVTVNETHGRALFYWFFEAIHQPQQKPLL  81

Query  322   LWLNGGPGCSSIGYGATQEIGPFL-VDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYS  498
             LWLNGGPGCSSIGYG  +E+GPF   +S +  L +NPYSWNK ANLLFLESP GVGFSY+
Sbjct  82    LWLNGGPGCSSIGYGEAEELGPFFPQNSTQPKLKLNPYSWNKAANLLFLESPAGVGFSYT  141

Query  499   NTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRN  678
             NT++D + LGD   A D++ FL  WF +FP +K+  FYIAGESYAG YVP+L+E+I+D N
Sbjct  142   NTTSDISELGDTITAKDSHTFLINWFKRFPQFKSHDFYIAGESYAGHYVPQLSELILDNN  201

Query  679   KDPSL--FIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTW  852
              +PS   +I+ +GI++GN    D  D +GM++YAW HAVISD+ +  I  +C+F+ +   
Sbjct  202   HNPSKEDYINFKGIMIGNALLDDETDQKGMIEYAWDHAVISDDVYYNITTTCNFSISIQS  261

Query  853   SNQDCSQAVNELLKQYKEIDIYSLYTSVCIDS---------LTGSGDNSTPVFKTTSKMM  1005
                +C+  +N+    YK ID+YSLYT +C  +         +T S  +S   F    K +
Sbjct  262   QTNECNTELNKYFDVYKIIDMYSLYTPMCFSNNSNTKREAFVTSSSPHSLSKFDGWHKRL  321

Query  1006  PRIMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPI  1185
                 AGYDPC  DY + Y NR +VQKALH +       W  C+ ++   W+D+  S+LP+
Sbjct  322   ----AGYDPCASDYTELYLNRPEVQKALHANVTKIPYPWTHCSDNI-TFWNDAPASMLPV  376

Query  1186  YKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEG  1365
              KKLIA GIRIWVYSGDTDGR+PV +TRY++  LGLPI ++W PWY  +QVGGW   Y+G
Sbjct  377   LKKLIAGGIRIWVYSGDTDGRIPVTATRYTLRKLGLPIVQDWTPWYTSRQVGGWNIVYDG  436

Query  1366  LTFATFRGAGHAVPTFKP  1419
             LTF T RGAGH VPTF P
Sbjct  437   LTFVTIRGAGHQVPTFTP  454



>gb|KEH32355.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=484

 Score =   462 bits (1189),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 222/426 (52%), Positives = 293/426 (69%), Gaps = 14/426 (3%)
 Frame = +1

Query  178   DLVANLPGQPI-VNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             D + +LPGQP   +  H++GY+ VNE +GR LFYW +E+ S P  KPL+LWLNGGPGCSS
Sbjct  37    DRIIDLPGQPSNPSISHFSGYINVNEEHGRALFYWFFEAQSQPSNKPLLLWLNGGPGCSS  96

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             IGYGA  EIGP LV+ +   L  NPYSWN+EANLLF+ESPVGVGFSY+NTS+D   L D 
Sbjct  97    IGYGAVVEIGPLLVNQNGEGLKFNPYSWNQEANLLFVESPVGVGFSYTNTSSDLTILEDH  156

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSLF--IDLR  708
             F A DAY FL  W  +FP +K+R F+IAGESYAG Y+P+LAE++ DRNKD + +  I+L+
Sbjct  157   FVAEDAYNFLVNWLQRFPQFKSRDFFIAGESYAGHYIPQLAELVFDRNKDRNKYTLINLK  216

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G ++GNPET D  D +G+++YAWSHAVISD+ +      CDF  +  WSN+ C+Q ++E+
Sbjct  217   GFIVGNPETEDYYDNKGLLEYAWSHAVISDQQYEKAKQVCDFKQSQ-WSNE-CNQVMSEV  274

Query  889   LKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKM-------MPRIMAGYDPCLDDY  1047
                Y EIDIY++Y   C  + T S   +  V ++ SK+         RI  GYDPC   Y
Sbjct  275   FHDYSEIDIYNIYAPSCHSNSTSSVTVTNNVPESFSKVKNDYRLKRMRIFGGYDPCYSTY  334

Query  1048  AKSYYNRLDVQKALHVSSGHHLRD--WRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIW  1221
             A+ ++NR+DVQ + H ++     +  W++CN S+   ++ S  SVLPIY KLI  G++IW
Sbjct  335   AEEFFNRIDVQSSFHANNIRENNNIAWKVCNNSILRTYNFSVFSVLPIYTKLIKGGLKIW  394

Query  1222  VYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHA  1401
             +YSGD DGR+PV+ TRY +  LGLP+   WR WYH  QVGG + EYEGLT+ T RGAGH 
Sbjct  395   IYSGDADGRLPVIGTRYCVEALGLPLKSTWRSWYHNNQVGGRIVEYEGLTYVTVRGAGHL  454

Query  1402  VPTFKP  1419
             VP  KP
Sbjct  455   VPLNKP  460



>ref|XP_010501423.1| PREDICTED: serine carboxypeptidase-like 31 [Camelina sativa]
Length=635

 Score =   466 bits (1200),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 220/331 (66%), Positives = 265/331 (80%), Gaps = 8/331 (2%)
 Frame = +1

Query  175   EDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             +DLV +LPGQP V+F+HYAGYV V+E+NGR +FYW +E+  LP EKPLVLWLNGGPGCSS
Sbjct  47    QDLVTDLPGQPDVSFRHYAGYVPVDESNGRAMFYWFFEAMDLPKEKPLVLWLNGGPGCSS  106

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             +GYGATQEIGPFLVD++ + L  NPY+WNKEAN+LFLESPVGVGFSYSNTS+DY  LGDD
Sbjct  107   VGYGATQEIGPFLVDTNGNGLNFNPYAWNKEANMLFLESPVGVGFSYSNTSSDYQKLGDD  166

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDP---SLFIDL  705
             F A DAY+FL  WF KFP +K   FYIAGESYAGKYVPELAE++ D N      SL I+L
Sbjct  167   FTARDAYSFLRNWFEKFPEHKESTFYIAGESYAGKYVPELAEVVYDNNNKKNGSSLHINL  226

Query  706   RGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNE  885
             +GILLGNPETSD +DW+G VDYAWSHAVISDETHR I  +C+F+S++TWSN +C++AV E
Sbjct  227   KGILLGNPETSDAEDWRGWVDYAWSHAVISDETHRIITRTCNFSSDNTWSNDECNEAVAE  286

Query  886   LLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTS-----KMMPRIMAGYDPCLDDYA  1050
             +LKQY EIDIYS+YTSVCI     S    + +FKT S     +M PR+M GYDPCLDDYA
Sbjct  287   VLKQYHEIDIYSIYTSVCIGDSARSSYFDSALFKTNSRISSKRMPPRLMGGYDPCLDDYA  346

Query  1051  KSYYNRLDVQKALHVSSGHHLRDWRICNMSV  1143
             + +YNR DVQK+LH S G +L++W IC  S+
Sbjct  347   RVFYNRADVQKSLHASDGVNLKNWSICKYSL  377


 Score =   356 bits (914),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 164/239 (69%), Positives = 195/239 (82%), Gaps = 5/239 (2%)
 Frame = +1

Query  718   LGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELLKQ  897
             LGNPETSD +DW+G VDYAWSHAVISDETHR I  +C+F+S++TWSN +C++AV E+LKQ
Sbjct  377   LGNPETSDAEDWRGWVDYAWSHAVISDETHRIITRTCNFSSDNTWSNDECNEAVAEVLKQ  436

Query  898   YKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSK-----MMPRIMAGYDPCLDDYAKSYY  1062
             Y EIDIYS+YTSVCI     S    + +FKT S+     M PR+M GYDPCLDDYA+ +Y
Sbjct  437   YHEIDIYSIYTSVCIGDSARSSYFDSALFKTNSRISSKRMPPRLMGGYDPCLDDYARVFY  496

Query  1063  NRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTD  1242
             NR DVQK+LH S G +L++W ICNM +F+ W+ SK SVLPIY+KLIA G+RIWVYSGDTD
Sbjct  497   NRADVQKSLHASDGVNLKNWSICNMEIFNNWTGSKPSVLPIYEKLIAGGLRIWVYSGDTD  556

Query  1243  GRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             GRVPVL+TRYS+S L LPI   WRPWYH+KQV GW+QEYEGLTFATFRGAGHAVP FKP
Sbjct  557   GRVPVLATRYSLSALELPIKTAWRPWYHEKQVSGWLQEYEGLTFATFRGAGHAVPCFKP  615



>ref|XP_002316057.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF02228.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=477

 Score =   461 bits (1185),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 228/438 (52%), Positives = 302/438 (69%), Gaps = 16/438 (4%)
 Frame = +1

Query  130   SLSSNKEQSDQSWASEDLVANLPGQPI-VNFKHYAGYVTVNENNGRRLFYWLYESSSLPD  306
             +L +N E  +      D V NLPGQP   +   ++GYVTVN+ +GR LFYW +E+ S   
Sbjct  28    ALETNPETQES-----DRVINLPGQPSNPSISQFSGYVTVNKEHGRALFYWFFEAQSETS  82

Query  307   EKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVG  486
             +KPL+LWLNGGPGCSSIGYGA  E+GP  V  D + +  N Y+W+KEANLLFLESPVGVG
Sbjct  83    KKPLLLWLNGGPGCSSIGYGAASELGPLRVSKDGAGVYFNEYAWSKEANLLFLESPVGVG  142

Query  487   FSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEII  666
             FSY+NTS+D   L D+F A DAY FL +W  +FP YK+R F+I+GESYAG YVP+LAE++
Sbjct  143   FSYTNTSSDLTLLDDNFVAEDAYTFLVKWLQRFPQYKSRDFFISGESYAGHYVPQLAELV  202

Query  667   VDRNKDPSLF--IDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNS  840
              DRNKD + +  I+L+G ++GNPET+D  D++G+++YAWSHAVISD+ +      CDF  
Sbjct  203   YDRNKDKTKYPLINLKGFIVGNPETNDYYDYKGLLEYAWSHAVISDQIYDKAKQVCDFTV  262

Query  841   NDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLT----GSGDNSTPVFKTTSKMMP  1008
             ++ WS+ DC+ A+N + ++Y EIDIY++Y   C+ + T    GS D+ T V     + + 
Sbjct  263   SN-WSS-DCNDAMNLVFEKYNEIDIYNIYAPTCLINTTSSSIGSNDSLTKVNNYMIRRL-  319

Query  1009  RIMAGYDPCLDDYAKSYYNRLDVQKALHVS-SGHHLRDWRICNMSVFDGWSDSKESVLPI  1185
             RI  GYDPC   Y + Y+NR DVQ +LH   SG+    WR+CN  +   ++ +  SVLPI
Sbjct  320   RIPGGYDPCYSTYTEEYFNRADVQSSLHAKISGNSRGKWRVCNALILYKYNFTVFSVLPI  379

Query  1186  YKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEG  1365
             Y KLI  G++IW+YSGD DGRVPV+ +RY I  LGLP+   WR W+H  QVGG + EYEG
Sbjct  380   YTKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALGLPLKSAWRSWFHNHQVGGRIVEYEG  439

Query  1366  LTFATFRGAGHAVPTFKP  1419
             LTF T RGAGH VP  KP
Sbjct  440   LTFVTVRGAGHLVPLNKP  457



>gb|KHN03262.1| Serine carboxypeptidase-like 33 [Glycine soja]
Length=478

 Score =   460 bits (1184),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 221/427 (52%), Positives = 292/427 (68%), Gaps = 15/427 (4%)
 Frame = +1

Query  178   DLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             D + +LPGQP   +  H++GY+TVNEN+GR LFYW +E+ S P +KPL+LWLNGGPGCSS
Sbjct  33    DRIIDLPGQPSSPSVSHFSGYITVNENHGRALFYWFFEAQSEPSKKPLLLWLNGGPGCSS  92

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             IGYG   EIGP +V+ +   L  N +SWN+EANLLF+ESPVGVGFSY+NTS+D   L D+
Sbjct  93    IGYGGVVEIGPLIVNKNGEGLHFNTHSWNQEANLLFVESPVGVGFSYTNTSSDLTKLEDN  152

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLR  708
             F A DAY FL  W  +FP +K+R F+I+ ESY G Y+P+LAE+I DRNKD S   FI+L+
Sbjct  153   FVAEDAYIFLVNWLQRFPQFKSRDFFISRESYGGHYIPQLAELIFDRNKDGSKYPFINLK  212

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G ++GNPET D  D++G+++YAWSHAVISD+ +      CDF   D WSN+ C++A+NE+
Sbjct  213   GFIVGNPETDDYYDYKGLLEYAWSHAVISDQQYDKAKQVCDFKQFD-WSNE-CNKAMNEV  270

Query  889   LKQYKEIDIYSLYTSVCI--------DSLTGSGDNSTPVFKTTSKMMP-RIMAGYDPCLD  1041
              + Y EIDIY++Y   C+        D   G+G  S    +   ++   RI  GYDPC  
Sbjct  271   FQDYSEIDIYNIYAPSCLLNSTSSIADDSNGNGPESFTKERNDYRLKRMRIFGGYDPCYS  330

Query  1042  DYAKSYYNRLDVQKALHVSSGHHLR-DWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRI  1218
             +Y + Y+NR DVQ + H  +       W++CN S+   ++ S  SVLP+Y KLI  G++I
Sbjct  331   NYVEEYFNRKDVQSSFHADTKRDTNVAWKVCNNSILRTYNFSVFSVLPVYTKLIKGGLKI  390

Query  1219  WVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGH  1398
             W+YSGD DGRVPV+ TRY +  LGLP+   WR WYH  QVGG + EYEGLT+ T RGAGH
Sbjct  391   WIYSGDADGRVPVIGTRYCVEALGLPLKSRWRTWYHDNQVGGRIVEYEGLTYVTVRGAGH  450

Query  1399  AVPTFKP  1419
              VP  KP
Sbjct  451   LVPLNKP  457



>ref|XP_010274883.1| PREDICTED: serine carboxypeptidase-like 35 [Nelumbo nucifera]
Length=484

 Score =   460 bits (1184),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 224/435 (51%), Positives = 293/435 (67%), Gaps = 9/435 (2%)
 Frame = +1

Query  133   LSSNKEQSDQSWASE-DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDE  309
             + S  ++ D+ +  E D V +LPGQP VNF+HYAGY+ +   + + LFYW +E+     E
Sbjct  30    VPSEGKKLDEDFLREADRVTSLPGQPPVNFRHYAGYIKLRPEDDKALFYWFFEAEGGVAE  89

Query  310   KPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGF  489
             KPLVLWLNGGPGCSS+ YGA QE+GPFL+ ++ S L  N +SWNK ANLLF+E+PVGVGF
Sbjct  90    KPLVLWLNGGPGCSSVAYGAAQELGPFLIRNNRSQLIYNRFSWNKVANLLFVEAPVGVGF  149

Query  490   SYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIV  669
             SY+N S D   LGD   AND+YAFL  WF +FP++K+  FYI GESYAG YVP+LAE+I 
Sbjct  150   SYTNRSADLQTLGDQITANDSYAFLLGWFRRFPAFKSHDFYITGESYAGHYVPQLAEVIY  209

Query  670   DRNKDPS--LFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSN  843
             +RNK  S   +I+ +G+++GN   +D  D  G V+YAWSHA+ISDE + TI+  CDF  N
Sbjct  210   ERNKGASKEAYINFKGLMIGNAVINDGTDQVGFVEYAWSHAIISDELYHTILKECDFKHN  269

Query  844   DTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNST--PVFKTTSKMMPRIM  1017
                SN  CS+AV   L+ Y  IDIYS+YT VC+ S           P       +  ++ 
Sbjct  270   KQTSN--CSKAVKGFLQAYSNIDIYSIYTPVCLHSFDRRPRKLVIGPRLFAQHDLWRKLP  327

Query  1018  AGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKL  1197
             +GYDPC +DY + Y+NR DVQ+ALH +       +  C+  V   W+DS +++LPI +KL
Sbjct  328   SGYDPCTEDYTEQYFNREDVQRALHANITRLTYPYTTCS-DVIRKWNDSPDTILPILRKL  386

Query  1198  IAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYE-GLTF  1374
             + AG+R+W+YSGD DGRVPV STRYSI+ +GL I   WR W+H+ QV GWV  YE GLTF
Sbjct  387   LNAGLRVWIYSGDMDGRVPVTSTRYSINEMGLKIREGWRAWFHRHQVAGWVVTYEGGLTF  446

Query  1375  ATFRGAGHAVPTFKP  1419
             AT RGAGH VP   P
Sbjct  447   ATVRGAGHQVPVLAP  461



>ref|XP_006484531.1| PREDICTED: serine carboxypeptidase-like 34-like [Citrus sinensis]
Length=500

 Score =   461 bits (1185),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 231/442 (52%), Positives = 292/442 (66%), Gaps = 16/442 (4%)
 Frame = +1

Query  127   HSLSSNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPD  306
             H LS +     ++    D V  LPGQP V FK YAGYVTVNE++GR LFYW +E+SS P+
Sbjct  43    HKLSRDVSAQQEA----DRVIKLPGQPEVKFKQYAGYVTVNESHGRALFYWFFEASSKPE  98

Query  307   EKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVG  486
             EKPL+LWLNGGPGCSS+GYG  +E+GPFL    +  L +NP+ WNK ANLLF+ESPVGVG
Sbjct  99    EKPLLLWLNGGPGCSSVGYGEAEELGPFLTRKGKPELKLNPHRWNKAANLLFVESPVGVG  158

Query  487   FSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEII  666
             FSY+NTS+D   LGD   A D+YAFL  W  +FP +K+  FYI GESYAG YVP+LAE+I
Sbjct  159   FSYTNTSSDIEKLGDTITAKDSYAFLINWLKRFPQFKSHEFYITGESYAGHYVPQLAEVI  218

Query  667   VDRNKDPSL--FIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFN-  837
              D NK  S    I+L+G  +GN    D  D  GM+DYAW HAVISD  +  I   C+F+ 
Sbjct  219   FDSNKIASQENHINLKGFAVGNALLDDETDQTGMIDYAWDHAVISDRLYHDIKRECNFSI  278

Query  838   SNDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDS-LTGSGDNSTPVFKTTSKMM---  1005
             ++    +++CS A++     YK ID+YSLYT  C++S  T     S P+ +  +  +   
Sbjct  279   AHVDKVSENCSLALDGYFAVYKIIDMYSLYTPDCVNSNFTIKRTRSLPIIRGIAPKLFSK  338

Query  1006  ----PRIMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKES  1173
                  R  AGYDPC  DY + Y NR DVQKALH +  +    W  C+  +   WSD+  S
Sbjct  339   FDGWRRKPAGYDPCASDYTEVYLNRPDVQKALHANVTNIPYPWTHCSDKI-SFWSDAPPS  397

Query  1174  VLPIYKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQ  1353
             +LPI KKLI  G+R+WVYSGDTDGR+PV +TRY++  LGL    EW+PWY +KQVGGW  
Sbjct  398   ILPIIKKLIRGGLRVWVYSGDTDGRIPVTATRYTLRKLGLKTVEEWKPWYAEKQVGGWTI  457

Query  1354  EYEGLTFATFRGAGHAVPTFKP  1419
             EY+GL F T RGAGH VPTF P
Sbjct  458   EYDGLMFVTVRGAGHQVPTFAP  479



>ref|XP_006437593.1| hypothetical protein CICLE_v10031313mg [Citrus clementina]
 gb|ESR50833.1| hypothetical protein CICLE_v10031313mg [Citrus clementina]
Length=500

 Score =   461 bits (1185),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 228/425 (54%), Positives = 286/425 (67%), Gaps = 12/425 (3%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP V FK YAGYVTVNE++GR LFYW +E+SS P+EKPL+LWLNGGPGCSS+
Sbjct  56    DRVIKLPGQPEVKFKQYAGYVTVNESHGRALFYWFFEASSKPEEKPLLLWLNGGPGCSSV  115

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYG  +E+GPFL    +  L +NP+ WNK ANLLF+ESPVGVGFSY+NTS+D   LGD  
Sbjct  116   GYGEAEELGPFLTRKGKPELKLNPHRWNKAANLLFVESPVGVGFSYTNTSSDIEKLGDTI  175

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLRG  711
              A D+YAFL  W  +FP +K+  FYI GESYAG YVP+LAE+I D NK  S    I+L+G
Sbjct  176   TAKDSYAFLINWLKRFPQFKSHEFYITGESYAGHYVPQLAEVIFDSNKIASQENHINLKG  235

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFN-SNDTWSNQDCSQAVNEL  888
               +GN    D  D  GM+DYAW HAVISD  +  I   C+F+ ++    +++CS A++  
Sbjct  236   FAVGNALLDDETDQTGMIDYAWDHAVISDRLYHDIKRECNFSIAHVDKVSENCSLALDGY  295

Query  889   LKQYKEIDIYSLYTSVCIDS-LTGSGDNSTPVFKTTSKMM-------PRIMAGYDPCLDD  1044
                YK ID+YSLYT  C++S  T     S P+ +  +  +        R  AGYDPC  D
Sbjct  296   FAVYKIIDMYSLYTPDCVNSNFTIKRTRSLPIIRGIAPKLFSKFDGWRRKPAGYDPCASD  355

Query  1045  YAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWV  1224
             Y + Y NR DVQKALH +  +    W  C+  +   WSD+  S+LPI KKLI  G+R+WV
Sbjct  356   YTEVYLNRPDVQKALHANVTNIPYPWTHCSDKI-SFWSDAPPSILPIIKKLIRGGLRVWV  414

Query  1225  YSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAV  1404
             YSGDTDGR+PV +TRY++  LGL    EW+PWY +KQVGGW  EY+GL F T RGAGH V
Sbjct  415   YSGDTDGRIPVTATRYTLRKLGLKTVEEWKPWYAEKQVGGWTIEYDGLMFVTVRGAGHQV  474

Query  1405  PTFKP  1419
             PTF P
Sbjct  475   PTFAP  479



>ref|XP_010933286.1| PREDICTED: serine carboxypeptidase-like 35 [Elaeis guineensis]
Length=481

 Score =   459 bits (1182),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 231/435 (53%), Positives = 293/435 (67%), Gaps = 22/435 (5%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             DLV  LPGQP V F+HYAGYV V     + LFYW +E+    ++KPLVLWLNGGPGCSS+
Sbjct  26    DLVTGLPGQPPVEFRHYAGYVMVGRGEKKALFYWFFEAQGRAEKKPLVLWLNGGPGCSSV  85

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
              YGA QE+GPFLV S+  +LT+N YSWNK ANLLFLE+PVGVGFSY+N+S+D   LGD  
Sbjct  86    AYGAAQELGPFLVRSNSPNLTLNAYSWNKVANLLFLEAPVGVGFSYTNSSSDLEELGDRI  145

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPS--LFIDLRG  711
              A D+Y+FL  WF KFP  K+ AFYIAGESYAG YVP+LAE+I + N+  S   +I+ +G
Sbjct  146   TAQDSYSFLLNWFQKFPDLKSHAFYIAGESYAGHYVPQLAELIFEGNEGASKVYYINFKG  205

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQD---CSQAVN  882
             +++GN   +D  D  GMV+YAWSHA+ISDE H  ++  C+    +    +    CS AV 
Sbjct  206   LMIGNAVLNDATDQLGMVEYAWSHAIISDELHSAVLKECNSFKEEGEGGRHSNACSPAVK  265

Query  883   ELLKQYKEIDIYSLYTSVCIDSLTGSGDNS----TPVFKTTSKM---MPRI-MAGYDPCL  1038
               L+ Y +IDIYS+YT VC+ SL+ S   +     P   +  +    M R+  AGYDPC 
Sbjct  266   AFLRSYADIDIYSIYTPVCLSSLSKSSRQTNLVAAPRLFSEHEAWHGMRRVPAAGYDPCT  325

Query  1039  DDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRI  1218
             +DY + Y+NR +VQKALH +  H    +  C+  V   W+DS  +VLPI KK + AG+R+
Sbjct  326   EDYVEKYFNRENVQKALHANLTHLSYPYTSCS-DVIQKWNDSPSTVLPILKKFMNAGLRV  384

Query  1219  WVYSGDTDGRVPVLSTRYSISTLGLPITRE-------WRPWYHQKQVGGWVQEY-EGLTF  1374
             WVYSGDTDGRVPV STRYSI+ +GL   +E       WR WYH++QV GWV EY EGLT 
Sbjct  385   WVYSGDTDGRVPVTSTRYSINAMGLHEKKEKGTKWGGWRAWYHKEQVAGWVVEYEEGLTL  444

Query  1375  ATFRGAGHAVPTFKP  1419
             AT RGAGH VP F P
Sbjct  445   ATVRGAGHQVPLFAP  459



>ref|XP_008797239.1| PREDICTED: serine carboxypeptidase-like 34 [Phoenix dactylifera]
Length=562

 Score =   462 bits (1189),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 228/423 (54%), Positives = 291/423 (69%), Gaps = 12/423 (3%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V +LPGQP V FK YAGYVTVNE++GR LFYW +E++   + KPLVLWLNGGPGCSSI
Sbjct  122   DRVFSLPGQPPVRFKQYAGYVTVNESHGRALFYWFFEATHDVENKPLVLWLNGGPGCSSI  181

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYG  +E+GPFL       L +N YSWNKEANLLFLESPVGVGFSY+NTS+D  +LGD  
Sbjct  182   GYGEAEELGPFLTQKGWPELKLNMYSWNKEANLLFLESPVGVGFSYTNTSSDLQHLGDKI  241

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLRG  711
              A D+Y FL  WF +FP +K+  FYI+GESYAG YVP+LAE I+D NK  S+  +I+L+G
Sbjct  242   TAIDSYKFLVNWFKRFPQFKSHDFYISGESYAGHYVPQLAEKILDENKKASVDDYINLKG  301

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELL  891
             +++GN    +  D +GM+DYAW HAVISD+ ++ +  SC+F++ +   +  C+ A+NE  
Sbjct  302   LIIGNAALDEEADQRGMIDYAWDHAVISDQLYQEVKKSCNFSNENV--SLACNDALNEYF  359

Query  892   KQYKEIDIYSLYTSVCIDSLT-GSGDNSTPVFKTTSKMMPRIMA------GYDPCLDDYA  1050
               Y  ID+YSLY+ VC    T  +      V    SK+  +  A      GYDPC  +Y 
Sbjct  360   AVYDIIDMYSLYSPVCASQNTFATSRKHFDVVGAGSKLFSKYRAWHQKPSGYDPCQSEYT  419

Query  1051  KSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYS  1230
             + Y+NR +VQKALH +      +W  C+  V   W+D   S+LP+ +KLI AG+R+WVYS
Sbjct  420   EVYFNRPEVQKALHANVTGIGYNWTHCS-DVITQWNDQAASLLPVLRKLIGAGLRLWVYS  478

Query  1231  GDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPT  1410
             GDTDGRVPV STRY+++ LGL   +EW PWYH KQVGGW   YEGLTF T RGAGH VPT
Sbjct  479   GDTDGRVPVTSTRYTLNKLGLKTVQEWSPWYHHKQVGGWTIIYEGLTFVTIRGAGHEVPT  538

Query  1411  FKP  1419
             F P
Sbjct  539   FAP  541



>gb|KFK27639.1| hypothetical protein AALP_AA8G409500 [Arabis alpina]
Length=492

 Score =   459 bits (1182),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 223/432 (52%), Positives = 293/432 (68%), Gaps = 21/432 (5%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP V F+ YAGYVTVNE +GR LFYW +E++  P EKPL+LWLNGGPGCSS+
Sbjct  43    DRVKELPGQPPVKFRQYAGYVTVNETHGRALFYWFFEATHNPSEKPLLLWLNGGPGCSSV  102

Query  358   GYGATQEIGPFL-VDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             G+GA++E+GPF   +S + +L +NPYSWN  ANLLFLESPVGVGFSYSNTS D + LGD 
Sbjct  103   GFGASEELGPFFPQNSTKPNLKLNPYSWNNAANLLFLESPVGVGFSYSNTSRDISQLGDT  162

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLR  708
               A D+Y FL  WF +FP YK+R FYIAGESYAG YVP+L+E+I + NK  S   FI+ +
Sbjct  163   VTARDSYNFLVNWFKRFPQYKSREFYIAGESYAGHYVPQLSEVIYNENKIASKNDFINFK  222

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G+++GN    D  D +GM+DYAW HAVISDE ++ +   CDF       +++C  A+++ 
Sbjct  223   GLMIGNALLDDETDQKGMIDYAWDHAVISDELYKKVNQECDFKLAHV--SKECDLALDKY  280

Query  889   LKQYKEIDIYSLYTSVCIDSLTGS-------GDNSTPVFK--------TTSKMMPRIMAG  1023
                YK +D+YSLY+  C+ +   S       G+   P ++        + ++   R+ AG
Sbjct  281   FNVYKILDMYSLYSPNCVPTPKNSSISHSVAGNRHLPAYRGFFRPRLVSNNEGWRRMAAG  340

Query  1024  YDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIA  1203
             YDPC  +Y + Y NR DVQKALH +       W  C+  +   WSD+  S+LP  + L++
Sbjct  341   YDPCASEYTEKYMNRRDVQKALHANVTKLSYPWTHCSDKI-TFWSDAPASMLPTLRTLVS  399

Query  1204  AGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATF  1383
             AG+R+WV+SGDTDGR+PV +TRYS+  LGL   +EW PWY + QVGGW  EY+GLTF T 
Sbjct  400   AGLRVWVFSGDTDGRIPVTATRYSLKKLGLKTVQEWTPWYTKNQVGGWTVEYDGLTFVTL  459

Query  1384  RGAGHAVPTFKP  1419
             RGAGH VPTFKP
Sbjct  460   RGAGHQVPTFKP  471



>ref|XP_010931783.1| PREDICTED: serine carboxypeptidase-like 33 isoform X1 [Elaeis 
guineensis]
Length=472

 Score =   457 bits (1175),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 224/433 (52%), Positives = 298/433 (69%), Gaps = 9/433 (2%)
 Frame = +1

Query  136   SSNKEQSDQSWASEDLVANLPGQPI-VNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEK  312
             S  +E+  Q+    D V  LPGQP   +  H++GY+TVN  NGR LFYW +E+ + P ++
Sbjct  25    SVQEEEQYQNDQESDRVFILPGQPKGPSLSHFSGYITVNRENGRALFYWFFEAQTEPFKR  84

Query  313   PLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFS  492
             PL+LWLNGGPGCSSIGYGA  E+GP  V    + L  N Y+WNKEANLLFLESPVGVGFS
Sbjct  85    PLLLWLNGGPGCSSIGYGAAVELGPLRVKRYGTELEFNRYAWNKEANLLFLESPVGVGFS  144

Query  493   YSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVD  672
             Y+NTS+D   L D F A DAY+FL  W  +FP Y+   FYI+GESYAG YVP+LAE++ D
Sbjct  145   YTNTSSDLDKLEDGFVAEDAYSFLLNWLRRFPQYQAHDFYISGESYAGHYVPQLAELVYD  204

Query  673   RNKDPS--LFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSND  846
             RNKD     +I+L+G ++GNPET+D  D +G+++YAWSH V+SD  +R +   CDF   +
Sbjct  205   RNKDRKNYPYINLKGFIVGNPETNDYYDSKGLLEYAWSHTVVSDRVYRLVNRVCDFRLLN  264

Query  847   TWSNQDCSQAVNELLKQYKEIDIYSLYTSVC-IDSLTGSGDNSTPVFKTTSKMMPRIMAG  1023
              W+N+ C+ A+N +  QYK IDIY++Y   C +D ++ S   +    K++S    RI +G
Sbjct  265   -WTNE-CNNAMNMVFDQYKVIDIYNIYAPKCNLDQVSSSTYETDA--KSSSLRRLRIYSG  320

Query  1024  YDPCLDDYAKSYYNRLDVQKALHVS-SGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLI  1200
             YDPC  +YA+ Y N+ DVQK+LH    G +   W++CN S+ + ++ +  SVL IY KL+
Sbjct  321   YDPCFSNYAEEYLNKPDVQKSLHAHVGGKNNGRWQVCNDSILNTYNFTVSSVLSIYSKLV  380

Query  1201  AAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFAT  1380
              AG+RIW+YSGDTDGRVPV+ TRY +  LGLP+  +W+PWYH  QVGG   EY+GLT  T
Sbjct  381   KAGLRIWLYSGDTDGRVPVIGTRYCVEALGLPLKSQWQPWYHNNQVGGRFVEYQGLTMVT  440

Query  1381  FRGAGHAVPTFKP  1419
              RGAGH VP  KP
Sbjct  441   VRGAGHLVPLSKP  453



>gb|KEH32356.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=482

 Score =   457 bits (1175),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 222/424 (52%), Positives = 292/424 (69%), Gaps = 12/424 (3%)
 Frame = +1

Query  178   DLVANLPGQPI-VNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             D + +LPGQP   +  H++GY+ VNE +GR LFYW +E+ S P  KPL+LWLNGGPGCSS
Sbjct  37    DRIIDLPGQPSNPSISHFSGYINVNEEHGRALFYWFFEAQSQPSNKPLLLWLNGGPGCSS  96

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             IG GA  EIGP LV+ +   L  NPYSW++EANLLF+ESP+GVGFSY+NTS+D   L D 
Sbjct  97    IGGGAVVEIGPLLVNKNGEGLKFNPYSWSQEANLLFVESPIGVGFSYTNTSSDLTILEDH  156

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLR  708
             F A D+Y FL  W  +FP +K+R F++AGESYAG Y+P+LAE+I DRNKD S   FI+L+
Sbjct  157   FVAEDSYNFLVNWLQRFPQFKSRDFFLAGESYAGHYIPQLAELIFDRNKDRSKNPFINLK  216

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G ++GNPET D  D++G+V+YAWSHAVISDE +      CDF     WSN+ C QA+++L
Sbjct  217   GFIVGNPETDDYYDYKGIVEYAWSHAVISDEQYEKAKQVCDF-KQFRWSNE-CFQAMDQL  274

Query  889   LKQYKEIDIYSLYTSVC----IDSLTGSGDNSTPVFKTTSKMMP-RIMAGYDPCLDDYAK  1053
                Y EIDI+++Y   C      + T +G  S    K   +M   R   GYDPC   YA+
Sbjct  275   FHDYSEIDIFNIYAPACRLNSTSTETKNGPESLKKVKNGYRMKRMRSFGGYDPCYSIYAE  334

Query  1054  SYYNRLDVQKALHVSS--GHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVY  1227
              ++NR+DVQ ++H ++  G+   +W+ CN+S+F+ +  S  SVLPIY KLI  G++IW+Y
Sbjct  335   EFFNRVDVQLSIHANNKRGNSKIEWKGCNISIFNTYDISVFSVLPIYTKLIKGGLKIWIY  394

Query  1228  SGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVP  1407
             SGD DGR+PV+ TRY +  LGLP+   WR WY   QVGG + EYEGLT+ T RGAGH VP
Sbjct  395   SGDADGRLPVIGTRYCVEALGLPLKSTWRIWYQHNQVGGRIVEYEGLTYVTVRGAGHLVP  454

Query  1408  TFKP  1419
               KP
Sbjct  455   LNKP  458



>ref|XP_010935543.1| PREDICTED: serine carboxypeptidase-like 34 [Elaeis guineensis]
Length=479

 Score =   456 bits (1174),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 231/435 (53%), Positives = 290/435 (67%), Gaps = 14/435 (3%)
 Frame = +1

Query  142   NKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLV  321
             + E+S Q  A  D+V  LPGQP VNF+ YAGYVTVNE +GR LFYW +E++   D+KP++
Sbjct  29    HHEESSQQLA--DIVDRLPGQPAVNFRQYAGYVTVNETHGRALFYWFFEATEDVDKKPVL  86

Query  322   LWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSN  501
             LWLNGGPGCSSIGYG  +E+GPFL+      L  N  SWNKEANLLFLESPVGVG+SY+N
Sbjct  87    LWLNGGPGCSSIGYGEAEELGPFLMQKGVPELRFNEESWNKEANLLFLESPVGVGYSYTN  146

Query  502   TSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNK  681
             TS+D   LGD+  AND+YAFL  WF +FP +KT  FYIAGESYAG YVP+LAE I D NK
Sbjct  147   TSSDLFVLGDEITANDSYAFLVNWFKRFPQFKTHDFYIAGESYAGHYVPQLAEKIFDANK  206

Query  682   --DPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWS  855
               D   +I+ +G ++GN    D  D +GM+DYAW HAVISD  +  I   C+F  +D   
Sbjct  207   NGDEDNYINFKGFMIGNALLDDDTDQRGMIDYAWDHAVISDRMYHDIKKGCNF--SDPEE  264

Query  856   NQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTS------KMMPRIM  1017
                C   +    + Y  ID+YSLY  VC +    +  +     K +       K+  R +
Sbjct  265   TGTCGDLLEGFFEAYNVIDLYSLYAPVCPEDYNSTSSHQLGKIKGSKFRFSKYKLWHRRL  324

Query  1018  AGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKL  1197
             AGYDPC+ DY+++Y+NR DVQKALH +       W  C+  V   W DS +S+LP  +KL
Sbjct  325   AGYDPCVSDYSETYFNRPDVQKALHANVTKIGYSWTHCS-DVILSWYDSPDSMLPTLRKL  383

Query  1198  IAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQK-QVGGWVQEYEGLTF  1374
             I  GIR+WV+SGDTDGR+PV STRYS++ LGL  T++W PWY  K QVGGW   Y+GLTF
Sbjct  384   IDGGIRVWVFSGDTDGRIPVTSTRYSLNKLGLNTTQDWTPWYTSKPQVGGWTIVYDGLTF  443

Query  1375  ATFRGAGHAVPTFKP  1419
              T RGAGH VPTFKP
Sbjct  444   VTVRGAGHQVPTFKP  458



>ref|XP_011075284.1| PREDICTED: serine carboxypeptidase-like 34 [Sesamum indicum]
Length=485

 Score =   456 bits (1173),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 233/432 (54%), Positives = 291/432 (67%), Gaps = 28/432 (6%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP V FK YAGYVTVN+ +GR LFYW +E+   PD+KPL+LWLNGGPGCSSI
Sbjct  43    DRVGRLPGQPPVRFKQYAGYVTVNQTHGRALFYWFFEAIRNPDKKPLLLWLNGGPGCSSI  102

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYG ++E+GPF     +  L  N  +WNK ANLLFLESPVGVGFSY+NTS+D   LGD  
Sbjct  103   GYGQSEELGPFFPQKGKPELKFNKNTWNKAANLLFLESPVGVGFSYTNTSSDIKQLGDTI  162

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPS--LFIDLRG  711
              A D+Y FL  WF +FP +K+  FYIAGESYAG YVP+LAE++ D+NK  S   +I+L+G
Sbjct  163   TAQDSYNFLIGWFRRFPQFKSHDFYIAGESYAGHYVPQLAEVVTDKNKHASDDDYINLKG  222

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDF-NSNDTWSNQDCSQAVNEL  888
             I++GN    D  D +G++DYAW HAVISD  +  I + C+F N+N T    DC+ A+++ 
Sbjct  223   IMVGNAVLDDETDQKGLIDYAWDHAVISDALYHEIKSKCNFSNANLT---DDCNHALDKY  279

Query  889   LKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKM---MPRI-----------MAGY  1026
                Y+ ID+YSLY   C++S      N T V K  S +   +PR+           +AGY
Sbjct  280   FDVYRIIDMYSLYAPTCVNS------NFTTVSKPLSHVKGAVPRLISNIDGRRRRALAGY  333

Query  1027  DPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAA  1206
             DPC  DY + Y+NR DVQ ALH +       W  C+ S+   W D+  S+LPI KKLIAA
Sbjct  334   DPCASDYTEVYFNRPDVQHALHANVTKIPYPWTHCSDSI-TFWKDAPTSILPIIKKLIAA  392

Query  1207  GIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQK-QVGGWVQEYEGLTFATF  1383
             G R+WV+SGDTDGRVPV +TRYS+  LGL I  +W PWY  K QVGGW  EY+GLTF T 
Sbjct  393   GQRVWVFSGDTDGRVPVTATRYSLRKLGLNIKHDWTPWYTDKQQVGGWTVEYDGLTFVTV  452

Query  1384  RGAGHAVPTFKP  1419
             RGAGH VPTFKP
Sbjct  453   RGAGHEVPTFKP  464



>ref|XP_008677402.1| PREDICTED: lysosomal protective protein isoform X1 [Zea mays]
 gb|ACF88069.1| unknown [Zea mays]
 gb|AFW63102.1| lysosomal protective protein [Zea mays]
Length=485

 Score =   456 bits (1172),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 227/433 (52%), Positives = 285/433 (66%), Gaps = 20/433 (5%)
 Frame = +1

Query  172   SEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCS  351
             + D VA LPGQP V F  YAGYVTVNE +GR LFYW +E+++ PD+KPLVLWLNGGPGCS
Sbjct  34    AADRVAGLPGQPPVGFAQYAGYVTVNETHGRALFYWFFEATASPDKKPLVLWLNGGPGCS  93

Query  352   SIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             SIGYG  +E+GPFLV   +  L  N YSWN EANL+FLESPVGVGFSY+NTS+D   LGD
Sbjct  94    SIGYGEAEELGPFLVQKGKPELRWNNYSWNTEANLMFLESPVGVGFSYTNTSSDLLQLGD  153

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNK--DPSLFIDL  705
                A+DAY FL  WF +FP Y++  FYIAGESYAG YVP+L+E I D N+      +++L
Sbjct  154   KITADDAYKFLLNWFKRFPQYRSHDFYIAGESYAGHYVPQLSEKIFDGNRAGPKESYVNL  213

Query  706   RGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNE  885
             +G+++GN    D  D  GMVDYAW HAVISD  +  + A CDF+  +      C+ A+ E
Sbjct  214   KGLMVGNALMDDETDQTGMVDYAWDHAVISDRVYADVKARCDFSMANV--TDACNAALQE  271

Query  886   LLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKM-----MPRIM----------A  1020
                 Y+ ID+YSLYT VC D   GS  +S+   +   K+      PRI           A
Sbjct  272   YFAVYRLIDMYSLYTPVCTDDPAGSSASSSYDARGHRKVAVHGAAPRIFSKYRGWIMKPA  331

Query  1021  GYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLI  1200
             GYDPC   YA++Y+NR DVQ ALH +      +W  C+  V + W+D+  S LP  +KL+
Sbjct  332   GYDPCTAQYAETYFNRPDVQAALHANVTKIGYNWTHCS-DVINTWNDAAFSTLPTIRKLV  390

Query  1201  AAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFAT  1380
             A G+R+WV+SGDTDGR+PV STR +++ LGL   +EW PWY   QVGGW   YEGLTF T
Sbjct  391   AGGLRVWVFSGDTDGRIPVTSTRLTLNKLGLKTVQEWTPWYDHLQVGGWTIVYEGLTFVT  450

Query  1381  FRGAGHAVPTFKP  1419
              RGAGH VP   P
Sbjct  451   IRGAGHEVPLHAP  463



>ref|XP_004977092.1| PREDICTED: serine carboxypeptidase-like 33-like isoform X2 [Setaria 
italica]
Length=480

 Score =   455 bits (1171),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 221/421 (52%), Positives = 287/421 (68%), Gaps = 9/421 (2%)
 Frame = +1

Query  178   DLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             D VA LPGQP   +   +AGYVTVNE +GR LFYW +E+ + P+EKPL+LWLNGGPGCSS
Sbjct  27    DRVARLPGQPETPSVSQFAGYVTVNERHGRALFYWFFEAQTAPEEKPLLLWLNGGPGCSS  86

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             IGYGA  E+GP  V    + L  N Y+WNKEANLLFLESPVGVGFSY+N S+D   L DD
Sbjct  87    IGYGAASELGPLRVVRQGAGLMFNEYAWNKEANLLFLESPVGVGFSYTNKSSDLDKLNDD  146

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDP--SLFIDLR  708
             F A DAY+FL  W  +FP YK R FYIAGESYAG YVP+LAE++ +RN D     +I+L+
Sbjct  147   FVAEDAYSFLLNWLERFPEYKDRGFYIAGESYAGHYVPQLAELVYERNMDKKGKAYINLK  206

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G + GNP T+D  D +G+ +YAWSHAV+SDE +  I   C+F  N  WS+ DCS A++ +
Sbjct  207   GFIAGNPITNDYYDSKGLAEYAWSHAVVSDEVYDRIKKYCNFK-NSNWSD-DCSAAMDIV  264

Query  889   LKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPR---IMAGYDPCLDDYAKSY  1059
               QY+EIDIY++Y   C+ + T     +   F+   +   R   + +GYDPC   YA+ Y
Sbjct  265   YSQYREIDIYNIYAPKCLLNQTSPSSAAQAFFENDQEHFRRRIHMFSGYDPCYSSYAEDY  324

Query  1060  YNRLDVQKALHVS-SGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGD  1236
             +N+ +VQKA H + SG     W +C+ S+ + ++ S  SVLPIY KLI AG+R+W+YSGD
Sbjct  325   FNKQEVQKAFHANISGLLPGKWHVCSDSILNSYNFSVFSVLPIYSKLIKAGLRVWLYSGD  384

Query  1237  TDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFK  1416
              DGRVPV+ +RY +  LGLP   +W+PWY  KQV G   EY+G++  T RGAGH VP  K
Sbjct  385   ADGRVPVIGSRYCVEALGLPTKTQWQPWYLDKQVAGRFVEYQGMSMVTVRGAGHLVPLNK  444

Query  1417  P  1419
             P
Sbjct  445   P  445



>ref|XP_004977091.1| PREDICTED: serine carboxypeptidase-like 33-like isoform X1 [Setaria 
italica]
Length=502

 Score =   456 bits (1172),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 221/421 (52%), Positives = 287/421 (68%), Gaps = 9/421 (2%)
 Frame = +1

Query  178   DLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             D VA LPGQP   +   +AGYVTVNE +GR LFYW +E+ + P+EKPL+LWLNGGPGCSS
Sbjct  27    DRVARLPGQPETPSVSQFAGYVTVNERHGRALFYWFFEAQTAPEEKPLLLWLNGGPGCSS  86

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             IGYGA  E+GP  V    + L  N Y+WNKEANLLFLESPVGVGFSY+N S+D   L DD
Sbjct  87    IGYGAASELGPLRVVRQGAGLMFNEYAWNKEANLLFLESPVGVGFSYTNKSSDLDKLNDD  146

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDP--SLFIDLR  708
             F A DAY+FL  W  +FP YK R FYIAGESYAG YVP+LAE++ +RN D     +I+L+
Sbjct  147   FVAEDAYSFLLNWLERFPEYKDRGFYIAGESYAGHYVPQLAELVYERNMDKKGKAYINLK  206

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G + GNP T+D  D +G+ +YAWSHAV+SDE +  I   C+F  N  WS+ DCS A++ +
Sbjct  207   GFIAGNPITNDYYDSKGLAEYAWSHAVVSDEVYDRIKKYCNFK-NSNWSD-DCSAAMDIV  264

Query  889   LKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPR---IMAGYDPCLDDYAKSY  1059
               QY+EIDIY++Y   C+ + T     +   F+   +   R   + +GYDPC   YA+ Y
Sbjct  265   YSQYREIDIYNIYAPKCLLNQTSPSSAAQAFFENDQEHFRRRIHMFSGYDPCYSSYAEDY  324

Query  1060  YNRLDVQKALHVS-SGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGD  1236
             +N+ +VQKA H + SG     W +C+ S+ + ++ S  SVLPIY KLI AG+R+W+YSGD
Sbjct  325   FNKQEVQKAFHANISGLLPGKWHVCSDSILNSYNFSVFSVLPIYSKLIKAGLRVWLYSGD  384

Query  1237  TDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFK  1416
              DGRVPV+ +RY +  LGLP   +W+PWY  KQV G   EY+G++  T RGAGH VP  K
Sbjct  385   ADGRVPVIGSRYCVEALGLPTKTQWQPWYLDKQVAGRFVEYQGMSMVTVRGAGHLVPLNK  444

Query  1417  P  1419
             P
Sbjct  445   P  445



>ref|XP_011010904.1| PREDICTED: serine carboxypeptidase-like 33 [Populus euphratica]
Length=477

 Score =   455 bits (1170),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 224/438 (51%), Positives = 302/438 (69%), Gaps = 16/438 (4%)
 Frame = +1

Query  130   SLSSNKEQSDQSWASEDLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYESSSLPD  306
             +L +N E  +      D V NLPGQP   +   ++GYV+VN+ +GR LFYW +E+ S   
Sbjct  28    ALETNPETQES-----DRVINLPGQPSSPSISQFSGYVSVNKEHGRALFYWFFEAQSETS  82

Query  307   EKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVG  486
             +KPL+LWLNGGPGCSSIGYGA  E+GP  V  D + +  N Y+W+KEANLLFLESPVGVG
Sbjct  83    KKPLLLWLNGGPGCSSIGYGAASELGPLRVSKDGAGVYFNEYAWSKEANLLFLESPVGVG  142

Query  487   FSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEII  666
             FSY+NTS+D   L D+F A DAY FL +W  +FP YK+R  +I+GESYAG YVP+LAE++
Sbjct  143   FSYTNTSSDLTILDDNFVAEDAYTFLVKWLQRFPQYKSRDLFISGESYAGHYVPQLAELV  202

Query  667   VDRNKDPSLF--IDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNS  840
              DRNKD + +  I+L+G ++GNPET+D  D++G+++YAWSHAVISD+ +      CDF  
Sbjct  203   YDRNKDKTKYPLINLKGFIVGNPETNDYYDYKGLLEYAWSHAVISDQIYDKAKKVCDFRV  262

Query  841   NDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLT----GSGDNSTPVFKTTSKMMP  1008
             ++ WS+ DC+ A+N + ++Y EIDIY++Y   C+ + T    GS D+ T V     + + 
Sbjct  263   SN-WSS-DCNDAMNLVFEKYNEIDIYNIYAPTCLINTTSSSVGSNDSLTKVNNYMIRRL-  319

Query  1009  RIMAGYDPCLDDYAKSYYNRLDVQKALHVS-SGHHLRDWRICNMSVFDGWSDSKESVLPI  1185
             RI  GYDPC   Y + Y+NR+DVQ +LH   SG+    WR+CN  +   ++ +  SVL I
Sbjct  320   RIPGGYDPCYSTYTEEYFNRVDVQSSLHAKISGNSRGKWRVCNDLILYKYNFTVPSVLSI  379

Query  1186  YKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEG  1365
             Y KLI  G++IW+YSGD DGRVPV+ +RY +  LGLP+T  WR W+H  QVGG + E+EG
Sbjct  380   YTKLIKGGLKIWIYSGDADGRVPVIGSRYCVEALGLPLTSAWRSWFHNHQVGGRIVEFEG  439

Query  1366  LTFATFRGAGHAVPTFKP  1419
             LTF T RGAGH VP  KP
Sbjct  440   LTFVTVRGAGHLVPLNKP  457



>ref|XP_006287580.1| hypothetical protein CARUB_v10000790mg [Capsella rubella]
 gb|EOA20478.1| hypothetical protein CARUB_v10000790mg [Capsella rubella]
Length=499

 Score =   455 bits (1171),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 218/432 (50%), Positives = 297/432 (69%), Gaps = 21/432 (5%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V +LPGQP V F+ YAGYVTVNE +GR LFYW +E++  P +KPL+LWLNGGPGCSS+
Sbjct  50    DRVKDLPGQPPVKFRQYAGYVTVNETHGRALFYWFFEATQNPSKKPLLLWLNGGPGCSSV  109

Query  358   GYGATQEIGPFL-VDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             G+GA++E+GPF   +S E +L +NPYSWNK ANLLFLESPVGVGFSY+NTS D + LGD 
Sbjct  110   GFGASEELGPFFPQNSSEPNLKLNPYSWNKAANLLFLESPVGVGFSYTNTSRDISQLGDT  169

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNK--DPSLFIDLR  708
               A+D+Y FL  WF +FP YK+  FYIAGESYAG YVP+L+E+I ++NK      +I+L+
Sbjct  170   VTASDSYNFLVNWFKRFPQYKSHDFYIAGESYAGHYVPQLSELIYNKNKIAPKKDYINLK  229

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G+++GN    D  D +GM+DYA+ HAVISD  +  +   CDF       +++C+ A++E 
Sbjct  230   GLMIGNALLDDETDQKGMIDYAYDHAVISDALYEKVNQHCDFKQEHV--SKECNGALDEY  287

Query  889   LKQYKEIDIYSLYTSVCI-------DSLTGSGDNSTPVFKTTSKMM--------PRIMAG  1023
                YK +D+YSLY+  C+        S + +G+   P F+   +           R+ AG
Sbjct  288   FDVYKILDMYSLYSPKCVPTSKNSSTSRSVAGNRPLPAFRNVFRPRLISHNEGWKRMAAG  347

Query  1024  YDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIA  1203
             YDPCL  Y + Y NR DVQ+ALH +  +    W  C+ ++   W+D+  S+LP  + L++
Sbjct  348   YDPCLSQYTEKYMNRRDVQEALHANVTNISYPWTHCSEAI-SFWTDAPASMLPTLRTLVS  406

Query  1204  AGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATF  1383
             AG+R+WV+SGDTDGR+PV +TRY++  LGL + ++W PWY + QVGGW  EY+GLTF T 
Sbjct  407   AGLRVWVFSGDTDGRIPVTATRYTLKKLGLKVVQDWTPWYTKLQVGGWTVEYDGLTFVTI  466

Query  1384  RGAGHAVPTFKP  1419
             RGAGH VPTFKP
Sbjct  467   RGAGHQVPTFKP  478



>ref|XP_007223035.1| hypothetical protein PRUPE_ppa005368mg [Prunus persica]
 gb|EMJ24234.1| hypothetical protein PRUPE_ppa005368mg [Prunus persica]
Length=464

 Score =   454 bits (1167),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 221/434 (51%), Positives = 292/434 (67%), Gaps = 14/434 (3%)
 Frame = +1

Query  151   QSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWL  330
             +S Q     D V+ LPGQP V+FKH+AGYVTVN+ +GR LFYW +E+ + P +KPL+LWL
Sbjct  13    KSHQQQQKADRVSGLPGQPPVSFKHFAGYVTVNKTHGRALFYWFFEAINNPQDKPLLLWL  72

Query  331   NGGPGCSSIGYGATQEIGPFLV-DSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTS  507
             NGGPGCSSIGYGAT+E+GPF V +  E  L  NPY+WN  ANLLFLESPVGVGFSY+NTS
Sbjct  73    NGGPGCSSIGYGATEELGPFFVQNGSEPKLKFNPYTWNNAANLLFLESPVGVGFSYTNTS  132

Query  508   TDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDP  687
              D   LGD   A D+Y FL  WF +FP YK+  FYI+GESYAG YVP+L+E+I DRN++ 
Sbjct  133   EDIRQLGDKITAEDSYNFLINWFQRFPQYKSHDFYISGESYAGHYVPQLSELIFDRNQNL  192

Query  688   SL--FIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQ  861
             S   +I+L+G ++GN    D  D +GM+DYAW HAVISD  ++ I   CDF  ++   ++
Sbjct  193   SKENYINLKGFMIGNAAVDDETDQKGMIDYAWDHAVISDRLYQDIKNECDF--SEKMVSR  250

Query  862   DCSQAVNELLKQYKEIDIYSLYTSVCI--DSLTGSGDNSTPVFKTTSKMMPRI------M  1017
              C++ ++E    Y+ ID+YSLYT  C+  +S   +    +   +    +  R+       
Sbjct  251   LCNKLIDEYFDVYEIIDMYSLYTPTCLSNNSSATTATRQSRTIQGAPTLFSRLDVRHKRP  310

Query  1018  AGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKL  1197
             AGYDPC  +Y+  Y NR DVQKALH +       W  C+ ++   W D+  S+LP+  KL
Sbjct  311   AGYDPCASEYSYVYLNRPDVQKALHANVTKIPYPWTHCSDNI-TFWKDAPPSILPVIGKL  369

Query  1198  IAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFA  1377
             +A+G+R+W+YSGDTDGR+PV STRY++  LGL I  +W PWY+ KQVGGW   Y+GL F 
Sbjct  370   VASGLRVWIYSGDTDGRIPVTSTRYALKKLGLKINEDWTPWYNNKQVGGWTVAYDGLMFV  429

Query  1378  TFRGAGHAVPTFKP  1419
             T RGAGH VP F P
Sbjct  430   TIRGAGHQVPEFAP  443



>ref|XP_010671807.1| PREDICTED: serine carboxypeptidase-like 33 [Beta vulgaris subsp. 
vulgaris]
Length=476

 Score =   454 bits (1167),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 220/425 (52%), Positives = 292/425 (69%), Gaps = 12/425 (3%)
 Frame = +1

Query  175   EDLVANLPGQPI-VNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCS  351
             +D + +LPGQP       ++GY+TVN+NNGR +FYW +E+ S P +KPLVLWLNGGPGCS
Sbjct  34    DDRILSLPGQPSNPPISQFSGYITVNQNNGRAIFYWFFEALSNPSDKPLVLWLNGGPGCS  93

Query  352   SIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             SIGYGA  E+GP  VD +   L  N +SW  EANLLF+ESPVGVGFSY+NT++D   L D
Sbjct  94    SIGYGAAVELGPLKVDENGVGLVFNNFSWITEANLLFVESPVGVGFSYTNTTSDLTKLDD  153

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKD--PSLFIDL  705
             +F A DAY+FL  W  ++P +K R FY+AGESYAG YVP+LAE+I DRN +   S+ I+L
Sbjct  154   EFVAEDAYSFLVNWLERYPQFKNRDFYLAGESYAGHYVPQLAELIFDRNTNQTKSMKINL  213

Query  706   RGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNE  885
             +G L+GNPET D  D  G+++YAWSH+VISDE +      CDF +++ WSN+ C  ++N 
Sbjct  214   KGFLVGNPETDDFYDSTGLLEYAWSHSVISDEQYNKTKEVCDFKTSN-WSNE-CVTSMNL  271

Query  886   LLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPR---IMAGYDPCLDDYAKS  1056
             +  +Y+EIDIY++Y  +C+ + T S        K  S  + R      GYDPC  ++A+ 
Sbjct  272   VYGKYREIDIYNIYAPICLSNRTSSSHGYYYANKEGSYRLKRARIFSEGYDPCYSNHAEV  331

Query  1057  YYNRLDVQKALHVSSGHHLRD----WRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWV  1224
             Y+NR DVQ +LH ++     +    W +C+ S+   +  + +SVLPIYKKL+  G++IW+
Sbjct  332   YFNRADVQASLHANANRGNSNTSVKWNVCSDSMLSMYHITVQSVLPIYKKLVQGGLKIWI  391

Query  1225  YSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAV  1404
             YSGD DGRVPV+ TRY +  LGLPI R WR WYHQ QVGG + EYEGLTF T RGAGH V
Sbjct  392   YSGDVDGRVPVIGTRYCVEALGLPIKRPWRSWYHQHQVGGRLVEYEGLTFVTVRGAGHLV  451

Query  1405  PTFKP  1419
             P  KP
Sbjct  452   PLNKP  456



>ref|XP_004135953.1| PREDICTED: serine carboxypeptidase-like 34-like [Cucumis sativus]
 gb|KGN45085.1| hypothetical protein Csa_7G420780 [Cucumis sativus]
Length=479

 Score =   454 bits (1167),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 229/439 (52%), Positives = 290/439 (66%), Gaps = 14/439 (3%)
 Frame = +1

Query  130   SLSSNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDE  309
             SL     + + ++   D V  LPGQP VNFK YAGYV VNE++GR LFYW +E+ + P E
Sbjct  25    SLEYGLTREELAFQDADRVLRLPGQPPVNFKQYAGYVNVNESHGRALFYWFFEAIADPHE  84

Query  310   KPLVLWLNGGPGCSSIGYGATQEIGPFLVDS-DESSLTVNPYSWNKEANLLFLESPVGVG  486
             KPL+LWLNGGPGCSSIGYGA +E+GPF     D+  L  NPYSWN+ ANLLFLESP+GVG
Sbjct  85    KPLLLWLNGGPGCSSIGYGAAEELGPFFPQKGDKPKLKFNPYSWNRAANLLFLESPIGVG  144

Query  487   FSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEII  666
             FSYSN + D   LGD   A D+YAFL  WF +FP +K+  FYIAGESYAG YVP+L+E+I
Sbjct  145   FSYSNNTNDIKELGDTITAKDSYAFLVNWFRRFPQFKSHEFYIAGESYAGHYVPQLSELI  204

Query  667   VDRNKDPSL--FIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNS  840
              D NK  S    I+ +G ++GN    D  D +GM+DYAW HAVISD+ ++ I  +C+F S
Sbjct  205   FDENKKISKKNRINFKGFIIGNALLDDETDQRGMIDYAWDHAVISDKLYKEIKTNCNF-S  263

Query  841   NDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMP----  1008
             N   SN  C  ++++    Y  ID+YSLYT +C++  T  G    P     + + P    
Sbjct  264   NPAPSNS-CDASLDKYFAVYDIIDMYSLYTPMCVEKNTSGG--RKPRRFAINGVAPQNGG  320

Query  1009  --RIMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLP  1182
               R   GYDPC  DY + Y NR DVQKALH +       W  C+ ++   W D+  S+LP
Sbjct  321   WHRRPIGYDPCSSDYTEMYLNRPDVQKALHANVTKIPYPWTHCSDNI-TFWKDAPSSILP  379

Query  1183  IYKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYE  1362
             I KKL+A G+RIWV+SGDTDGR+PV STR +++ LGL I ++W PWY  +QVGGW  EYE
Sbjct  380   IIKKLVAGGLRIWVFSGDTDGRIPVTSTRLTLNKLGLKIKKDWTPWYSHQQVGGWTIEYE  439

Query  1363  GLTFATFRGAGHAVPTFKP  1419
             GL F T RGAGH VP FKP
Sbjct  440   GLMFVTVRGAGHEVPQFKP  458



>ref|XP_009397583.1| PREDICTED: serine carboxypeptidase-like 34 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=478

 Score =   454 bits (1167),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 221/424 (52%), Positives = 283/424 (67%), Gaps = 12/424 (3%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP V+F  YAGYVTVNE++GR LFYW +E++   ++KPL+LWLNGGPGCSSI
Sbjct  36    DRVVRLPGQPPVDFHQYAGYVTVNESHGRALFYWFFEATHDVEKKPLLLWLNGGPGCSSI  95

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYG  +E+GPFL+   +  L  N +SWNKEANLLFLESPVGVGFSY+NTS+D ++LGD  
Sbjct  96    GYGEAEELGPFLMQKGKPELKFNKHSWNKEANLLFLESPVGVGFSYTNTSSDLSSLGDKI  155

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLRG  711
              A D+Y FL  WF +FP +K+  FYIAGESYAG YVP+L+E I D NK  S   +I+ +G
Sbjct  156   TAEDSYIFLLNWFKRFPQFKSHDFYIAGESYAGHYVPQLSEKIFDENKKASKENYINFKG  215

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELL  891
              ++GN    D  D  GMVDYAW HAVISD  +  +  SC+F+  +    + C  A+ E  
Sbjct  216   FIIGNALMDDDTDQTGMVDYAWDHAVISDRVYHDVKKSCNFSEENV--TKACDDALEEYF  273

Query  892   KQYKEIDIYSLYTSVCIDSLTGSG--------DNSTPVFKTTSKMMPRIMAGYDPCLDDY  1047
               Y  ID+YSLY  VC+   T           + ++P   +      +  AGYDPC+  Y
Sbjct  274   AVYDIIDMYSLYAPVCVRPNTSMSWSERSYFVEGASPKLFSKYSGWHQKPAGYDPCVSLY  333

Query  1048  AKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVY  1227
             ++ Y+NR DVQ+ALH +      +W  C+  V   W+D+  SVLP+ +KLI  GIR+WV+
Sbjct  334   SEVYFNREDVQEALHANVTKLGYNWTHCSSDVITRWNDAPASVLPVIRKLIHGGIRVWVF  393

Query  1228  SGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVP  1407
             SGDTDGR+PV STRY++  LGL  TREW PWY  KQVGGW   ++GLTF T RGAGH VP
Sbjct  394   SGDTDGRIPVTSTRYTLHKLGLKTTREWTPWYDHKQVGGWTIIFDGLTFVTVRGAGHQVP  453

Query  1408  TFKP  1419
             TF P
Sbjct  454   TFAP  457



>ref|XP_011022036.1| PREDICTED: serine carboxypeptidase-like 34 [Populus euphratica]
Length=486

 Score =   454 bits (1167),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 227/426 (53%), Positives = 281/426 (66%), Gaps = 18/426 (4%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP V FK YAGYVTVNE++GR LFYW +E+   P+EKPL+LWLNGGPGCSSI
Sbjct  46    DRVIRLPGQPKVTFKQYAGYVTVNESHGRALFYWFFEAIENPEEKPLLLWLNGGPGCSSI  105

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYG  +E+GPF        L  NP++WN  ANLLFLESPVGVGFSYSNT++D   LGD  
Sbjct  106   GYGEAEELGPFFPKRGGQELQFNPHTWNNVANLLFLESPVGVGFSYSNTTSDLKELGDTV  165

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLRG  711
              A D+Y FL  WF +FP +K+  FYI+GESYAG YVP+LAE+I D NK  S    I+L+G
Sbjct  166   TAQDSYIFLVRWFQRFPQFKSHEFYISGESYAGHYVPQLAEVIYDGNKKVSEKDHINLKG  225

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELL  891
              ++GN    D  D +GM+DYAW HAVISD  +  +   C+F+      + DC  A+++  
Sbjct  226   FIIGNALLDDETDQKGMIDYAWDHAVISDRLYHDVKKKCNFSEKH--PSHDCKNALHQYF  283

Query  892   KQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIM----------AGYDPCLD  1041
               Y+ ID+YSLY+  CI+S   S     PV      M P+++          AGYDPC  
Sbjct  284   GVYRIIDMYSLYSPRCINS-NFSEARDRPVIH--GNMAPQLLSKFADWHKRPAGYDPCAS  340

Query  1042  DYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIW  1221
             DY + Y NR  VQ ALH +       W  C+ ++   WSD+ +S+LPI KKLIA GIRIW
Sbjct  341   DYTEIYMNRPAVQAALHANVTKIPYPWTHCSDNI-TFWSDAPQSILPIIKKLIAGGIRIW  399

Query  1222  VYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHA  1401
             VYSGDTDGR+PV +TRY+++ LGL    EW PWYH KQV GW   Y+GLTF T RGAGH 
Sbjct  400   VYSGDTDGRIPVTATRYTLNKLGLNTIEEWTPWYHGKQVAGWTIVYDGLTFVTIRGAGHQ  459

Query  1402  VPTFKP  1419
             VPTFKP
Sbjct  460   VPTFKP  465



>ref|XP_010493441.1| PREDICTED: serine carboxypeptidase-like 34 [Camelina sativa]
Length=501

 Score =   454 bits (1169),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 220/432 (51%), Positives = 298/432 (69%), Gaps = 21/432 (5%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP V F+ YAGYVTVNE +GR LFYW +E++  P +KPL+LWLNGGPGCSS+
Sbjct  52    DRVKELPGQPPVKFRQYAGYVTVNETHGRALFYWFFEATHNPSKKPLLLWLNGGPGCSSV  111

Query  358   GYGATQEIGPFL-VDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             G+GA++E+GPF   +S + +L +NPYSWNK ANLLFLESPVGVGFSYSNTS D + LGD 
Sbjct  112   GFGASEELGPFFPQNSSQPNLKLNPYSWNKAANLLFLESPVGVGFSYSNTSRDISQLGDT  171

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLR  708
               A+D+Y FL  WF +FP YK+  F+IAGESYAG YVP+L+E+I ++NK  S   FI+L+
Sbjct  172   VTASDSYNFLVNWFKRFPQYKSHEFFIAGESYAGHYVPQLSELIYNQNKIASKKDFINLK  231

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G+++GN    D  D +GM+DYA+ HAVISD  +  +   CDF       +++C+ A++E 
Sbjct  232   GLMIGNALLDDETDQKGMIDYAYDHAVISDALYEKVNQHCDFKLEHV--SKECNGALDEY  289

Query  889   LKQYKEIDIYSLYTSVCIDS---------------LTGSGDNSTPVFKTTSKMMPRIMAG  1023
                YK +D+YSLY+  C+ +               L  + +   P   + ++   R+ AG
Sbjct  290   FDVYKILDMYSLYSPKCVPTSTNSSTSHSVAGTRPLPAARNTFRPRLISQNEGWRRMAAG  349

Query  1024  YDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIA  1203
             YDPCL +Y + Y NR DVQ+ALH +  +    W  C+ ++   WSD+  S+LP  +KL++
Sbjct  350   YDPCLSEYTEKYMNRRDVQEALHANVTNIPYPWTHCSDTI-SFWSDAPASMLPTLRKLVS  408

Query  1204  AGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATF  1383
             AG+R+WV+SGDTDGR+PV +TRYS+  LGL I ++W PWY + QVGGW  EY+GLT+ T 
Sbjct  409   AGLRVWVFSGDTDGRIPVTATRYSLKKLGLKIVQDWTPWYTKLQVGGWTVEYDGLTYVTI  468

Query  1384  RGAGHAVPTFKP  1419
             RGAGH VPTFKP
Sbjct  469   RGAGHQVPTFKP  480



>ref|XP_003607259.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES89456.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=467

 Score =   453 bits (1165),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 220/418 (53%), Positives = 284/418 (68%), Gaps = 6/418 (1%)
 Frame = +1

Query  175   EDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             ED V  LPGQP VNFK YAGY+ VNE +GR LFYW +ES   P  KPL+LWLNGGPGCSS
Sbjct  32    EDRVYGLPGQPPVNFKQYAGYINVNETHGRALFYWFFESVDQPQTKPLLLWLNGGPGCSS  91

Query  355   IGYGATQEIGPFL-VDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             IGYG  +E+GPF   +S +  L +NPYSWNK ANLLFLESP GVGFSY+NT++D + LGD
Sbjct  92    IGYGEAEELGPFFPQNSSQPKLKLNPYSWNKAANLLFLESPAGVGFSYTNTTSDISELGD  151

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDL  705
                A D++ FL  WF +FP +K+  FYIAGESYAG YVP+L+E+I+D N + S   +I+ 
Sbjct  152   TITAKDSHTFLINWFKRFPQFKSHDFYIAGESYAGHYVPQLSELILDNNHNSSEEDYINF  211

Query  706   RGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNE  885
             +GI++GN    D  D +GM++YAW HAVISD  +  I   C+F+        +C+  +N+
Sbjct  212   KGIMIGNALLDDETDQKGMIEYAWDHAVISDGLYHNITTICNFSHPIQNQTDECNTELNK  271

Query  886   LLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSYYN  1065
                 YK ID+YSLY  +C  +++    +S    K       + +AGYDPC  DY  +Y N
Sbjct  272   YFDVYKIIDMYSLYAPMCFSNISNVRSHS--FSKLVLDGWHKNLAGYDPCASDYTAAYLN  329

Query  1066  RLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDG  1245
             R +VQKALH +       W  C+ ++   W+D+  S+LP+  KLIAAGIRIWVYSGDTDG
Sbjct  330   RPEVQKALHANVTKISYPWSHCSNNI-TFWNDAPVSMLPVLNKLIAAGIRIWVYSGDTDG  388

Query  1246  RVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             R+PV +TRY++  LGLPI ++W PWY  +QVGGW   Y+GLTF T RGAGH VPTF P
Sbjct  389   RIPVTATRYTLRKLGLPIVQDWTPWYTSRQVGGWNIVYDGLTFVTIRGAGHQVPTFAP  446



>ref|XP_007043286.1| Serine carboxypeptidase-like 35 [Theobroma cacao]
 gb|EOX99117.1| Serine carboxypeptidase-like 35 [Theobroma cacao]
Length=535

 Score =   455 bits (1171),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 227/437 (52%), Positives = 295/437 (68%), Gaps = 18/437 (4%)
 Frame = +1

Query  151   QSDQSWASE-------DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDE  309
             QS Q +  E       D V NLPGQP VNF+HYAGYV +   N + LFYW +E+      
Sbjct  82    QSRQPYGEEEVRQKEVDRVTNLPGQPPVNFRHYAGYVKLRPQNQKALFYWFFEAQDGAAL  141

Query  310   KPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGF  489
             KPLVLWLNGGPGCSS+ YGA QE+GPFLV S  + LT N +SWNK AN+LFLE+PVGVGF
Sbjct  142   KPLVLWLNGGPGCSSVAYGAAQELGPFLVRSKGTRLTFNKFSWNKVANMLFLEAPVGVGF  201

Query  490   SYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIV  669
             SY+N S D   LGD   A D+Y+FL  WF +FP++K+  FYIAGESYAG YVP+LAE+I 
Sbjct  202   SYTNNSEDLRTLGDQITAADSYSFLINWFKRFPNFKSHDFYIAGESYAGHYVPQLAELIY  261

Query  670   DRNKDPSL--FIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSN  843
             ++NK  S   +I+L+G ++GN   +D  D  G+VDYAWSHA+ISD+ +  I   C F  +
Sbjct  262   EKNKGSSKDSYINLKGFMIGNAAINDQTDTLGLVDYAWSHAIISDQLYNKINKDCGFKQS  321

Query  844   DTWSNQ--DCSQAVNELLKQYKEIDIYSLYTSVCIDS--LTGSGDNSTPVFKTTSKMMPR  1011
                SNQ  DC+Q +   ++ Y +IDIYS+YT VC++S   T       P   T   +  +
Sbjct  322   ---SNQTADCAQHLGGFMEAYSDIDIYSIYTPVCLNSPGRTYPKLLVAPRLLTQHDLWHK  378

Query  1012  IMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYK  1191
             + +GYDPC +DY + Y+N+ DVQ ALH +       +  C+ ++ D W+DS ++VLP  +
Sbjct  379   LPSGYDPCTEDYVEKYFNKKDVQTALHANVTKLPYPYTTCSGAIRD-WNDSPDTVLPTIQ  437

Query  1192  KLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYE-GL  1368
             KL+ AG+RIW+YSGDTDGRVPV STRYSI+ +GL +  EWR W+H+ QV GWV+ YE GL
Sbjct  438   KLLKAGLRIWIYSGDTDGRVPVTSTRYSINKMGLKVKEEWRAWFHKSQVAGWVETYEGGL  497

Query  1369  TFATFRGAGHAVPTFKP  1419
             T AT RGAGH VP F P
Sbjct  498   TLATVRGAGHQVPVFAP  514



>gb|KEH30582.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=465

 Score =   452 bits (1164),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 220/418 (53%), Positives = 283/418 (68%), Gaps = 8/418 (2%)
 Frame = +1

Query  175   EDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             ED V  LPGQP VNFK YAGY+ VNE +GR LFYW +ES   P  KPL+LWLNGGPGCSS
Sbjct  32    EDRVYGLPGQPPVNFKQYAGYINVNETHGRALFYWFFESVDQPQTKPLLLWLNGGPGCSS  91

Query  355   IGYGATQEIGPFL-VDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             IGYG  +E+GPF   +S +  L +NPYSWNK ANLLFLESP GVGFSY+NT++D + LGD
Sbjct  92    IGYGEAEELGPFFPQNSSQPKLKLNPYSWNKAANLLFLESPAGVGFSYTNTTSDISELGD  151

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDL  705
                A D++ FL  WF +FP +K+  FYIAGESYAG YVP+L+E+I+D N + S   +I+ 
Sbjct  152   TITAKDSHTFLINWFKRFPQFKSHDFYIAGESYAGHYVPQLSELILDNNHNSSEEDYINF  211

Query  706   RGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNE  885
             +GI++GN    D  D +GM++YAW HAVISD  +  I   C+F+        +C+  +N+
Sbjct  212   KGIMIGNALLDDETDQKGMIEYAWDHAVISDGLYHNITTICNFSHPIQNQTDECNTELNK  271

Query  886   LLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSYYN  1065
                 YK ID+YSLY  +C  +++    +S        K +    AGYDPC  DY  +Y N
Sbjct  272   YFDVYKIIDMYSLYAPMCFSNISNVRSHSFSKLDGWHKNL----AGYDPCASDYTAAYLN  327

Query  1066  RLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDG  1245
             R +VQKALH +       W  C+ ++   W+D+  S+LP+  KLIAAGIRIWVYSGDTDG
Sbjct  328   RPEVQKALHANVTKISYPWSHCSNNI-TFWNDAPVSMLPVLNKLIAAGIRIWVYSGDTDG  386

Query  1246  RVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             R+PV +TRY++  LGLPI ++W PWY  +QVGGW   Y+GLTF T RGAGH VPTF P
Sbjct  387   RIPVTATRYTLRKLGLPIVQDWTPWYTSRQVGGWNIVYDGLTFVTIRGAGHQVPTFAP  444



>ref|XP_010274881.1| PREDICTED: serine carboxypeptidase-like 34 [Nelumbo nucifera]
Length=479

 Score =   453 bits (1165),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 223/421 (53%), Positives = 286/421 (68%), Gaps = 10/421 (2%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP V F+ YAGY+ V+  +G+ LFYW +E++S P +KPL+LWLNGGPGCSS+
Sbjct  41    DKVIRLPGQPPVKFRQYAGYIPVDGIHGKALFYWFFEATSHPQKKPLLLWLNGGPGCSSL  100

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYG  +E+GPFL+      L  N Y+WNK ANLLFLESPVGVGFSYSN S+D   LGD  
Sbjct  101   GYGEAEELGPFLIQKGTPELRFNKYTWNKAANLLFLESPVGVGFSYSNRSSDINELGDTV  160

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLRG  711
              A D+Y FL  WF +FP YK+  FYIAGESYAG YVP+LAE+I D NK  ++  +I+L+G
Sbjct  161   TAKDSYMFLVNWFQRFPQYKSHDFYIAGESYAGHYVPQLAEVIYDANKKSAMENYINLKG  220

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELL  891
              ++GN    D  D  GM+DYAW HAVISD  ++ +   C+F+++D   + +C+ A+NE  
Sbjct  221   FMIGNALLDDDTDQTGMIDYAWDHAVISDRVYQDVKTYCNFSNSD--QSNECNNALNEYF  278

Query  892   KQYKEIDIYSLYTSVCIDSLTGSGDNST---PVFKTTSKMMP--RIMAGYDPCLDDYAKS  1056
               Y  ID+YSLY   C+++ T +           K+ SK  P  +  AGYDPC+  Y++ 
Sbjct  279   AVYDIIDMYSLYAPTCVNTKTTNKQRRRIEGIAPKSFSKFDPWHKKPAGYDPCVSLYSEV  338

Query  1057  YYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGD  1236
             Y+NR DVQ+ALH +  +    W  C+  V   WSD+  S+LPI KKLIA G+RIWVYSGD
Sbjct  339   YFNRRDVQEALHANITNIPYPWTHCS-DVITFWSDAPASILPIIKKLIAGGLRIWVYSGD  397

Query  1237  TDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFK  1416
             TDGR+PV STRY++  LGL  T EW PWY+  QVGGW   Y+GLTF T RGAGH VPTF 
Sbjct  398   TDGRIPVTSTRYTLRKLGLNTTEEWAPWYNNNQVGGWTIIYDGLTFVTLRGAGHQVPTFV  457

Query  1417  P  1419
             P
Sbjct  458   P  458



>ref|XP_009413121.1| PREDICTED: serine carboxypeptidase-like 34 [Musa acuminata subsp. 
malaccensis]
Length=478

 Score =   453 bits (1165),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 221/422 (52%), Positives = 290/422 (69%), Gaps = 13/422 (3%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP V+F+ YAGYVTVNE++GR LFYW +E++   ++KPL+LWLNGGPGCSSI
Sbjct  41    DRVVGLPGQPPVSFRQYAGYVTVNESHGRALFYWFFEATHDVEKKPLLLWLNGGPGCSSI  100

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYGA +E+GPFL+      L  N +SWNKEANLLFLESPVGVGFSY+NTS+D  +LGD  
Sbjct  101   GYGAAEELGPFLMQKGVPQLRFNQHSWNKEANLLFLESPVGVGFSYTNTSSDLQSLGDKI  160

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPS--LFIDLRG  711
              A D+Y FL  W  +FP YK+  FYIAGESYAG YVP+L+E I D NK  S   +I+ +G
Sbjct  161   TAEDSYIFLVNWLKRFPQYKSHDFYIAGESYAGHYVPQLSEKIFDENKKASKETYINFKG  220

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELL  891
              ++GN    D  D  GM+DYAW HAVISD  +  + ++C+F+     + + C+ A+ E  
Sbjct  221   FMIGNALMDDDTDQTGMIDYAWDHAVISDRVYHDVKSNCNFSIEP--ATEACNNALREYF  278

Query  892   KQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIM------AGYDPCLDDYAK  1053
               Y+ ID+YSLY  VC  S+T S   S  +     K+  R        AGYDPC+ DY++
Sbjct  279   AVYRIIDMYSLYAPVCT-SIT-STRKSFQIEGAAPKLFSRYSGWHQKPAGYDPCVSDYSE  336

Query  1054  SYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSG  1233
              Y+NR DVQ+ALH ++     +W  C+  V   W+DS  ++LP+ +KLI  G+R+WV+SG
Sbjct  337   VYFNRPDVQEALHANTTKIGYNWTHCS-EVVTKWNDSPATMLPVIRKLINGGLRVWVFSG  395

Query  1234  DTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTF  1413
             DTDGR+PV STRY+++ LG+   +EW+PWY +KQVGGW   +EGLTF T RGAGH VPTF
Sbjct  396   DTDGRIPVTSTRYTLNKLGMKTIQEWKPWYDRKQVGGWTIVFEGLTFVTVRGAGHQVPTF  455

Query  1414  KP  1419
              P
Sbjct  456   AP  457



>ref|XP_010421120.1| PREDICTED: serine carboxypeptidase-like 34 [Camelina sativa]
Length=502

 Score =   454 bits (1167),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 220/432 (51%), Positives = 299/432 (69%), Gaps = 21/432 (5%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V +LPGQP V F+ YAGYVTVNE +GR LFYW +E++  P +KPL+LWLNGGPGCSS+
Sbjct  53    DRVKDLPGQPPVKFRQYAGYVTVNETHGRALFYWFFEATHNPSKKPLLLWLNGGPGCSSV  112

Query  358   GYGATQEIGPFL-VDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             G+GA++E+GPF   +S + +L +NPYSWNK ANLLFLESPVGVGFSYSNTS D + LGD 
Sbjct  113   GFGASEELGPFFPQNSSQPNLKLNPYSWNKAANLLFLESPVGVGFSYSNTSRDISQLGDT  172

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLR  708
               A+D+Y FL  WF +FP YK+  F+IAGESYAG YVP+L+E+I ++NK  S   FI+L+
Sbjct  173   VTASDSYNFLVNWFKRFPQYKSHDFFIAGESYAGHYVPQLSELIYNQNKIASKKDFINLK  232

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G+++GN    D  D +GM+DYA+ HAVISD  +  +   CDF       +++C+ A++E 
Sbjct  233   GLMIGNALLDDETDQKGMIDYAYDHAVISDALYEKVNQHCDFKLEHV--SKECNGALDEY  290

Query  889   LKQYKEIDIYSLYTSVCIDS---------------LTGSGDNSTPVFKTTSKMMPRIMAG  1023
                YK +D+YSLY+  C+ +               L  + +   P   + ++   R+ AG
Sbjct  291   FDVYKILDMYSLYSPKCVPTSTNSSTSHSVAGTRPLPAARNTFRPRLISQNEGWRRMAAG  350

Query  1024  YDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIA  1203
             YDPCL +Y + Y NR DVQ+ALH +  +    W  C+ ++   WSD+  S+LP  +KL++
Sbjct  351   YDPCLSEYTEKYMNRRDVQEALHANVTNIPYPWTHCSDTI-SFWSDAPASMLPTLRKLVS  409

Query  1204  AGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATF  1383
             AG+R+WV+SGDTDGR+PV +TRYS+  LGL I ++W PWY + QVGGW  EY+GLT+ T 
Sbjct  410   AGLRVWVFSGDTDGRIPVTATRYSLKKLGLKIVQDWTPWYTKLQVGGWTVEYDGLTYVTI  469

Query  1384  RGAGHAVPTFKP  1419
             RGAGH VPTFKP
Sbjct  470   RGAGHQVPTFKP  481



>ref|XP_002872043.1| SCPL34 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48302.1| SCPL34 [Arabidopsis lyrata subsp. lyrata]
Length=500

 Score =   453 bits (1166),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 222/435 (51%), Positives = 295/435 (68%), Gaps = 26/435 (6%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP V F+ YAGYVTVNE +GR LFYW +E++  P +KPL+LWLNGGPGCSSI
Sbjct  50    DRVKELPGQPPVKFRQYAGYVTVNETHGRALFYWFFEATHNPSKKPLLLWLNGGPGCSSI  109

Query  358   GYGATQEIGPFL-VDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             G+GA++E+GPF   +S +  L +NPYSWNK ANLLFLESPVGVGFSY+NTS D   LGD 
Sbjct  110   GFGASEELGPFFPQNSSQPKLKLNPYSWNKAANLLFLESPVGVGFSYTNTSRDINQLGDT  169

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNK--DPSLFIDLR  708
               A D+Y FL  WF +FP YK+  FYIAGESYAG YVP+L+E+I + NK      FI+L+
Sbjct  170   ITARDSYNFLVNWFKRFPQYKSHEFYIAGESYAGHYVPQLSELIYNENKIAPKKDFINLK  229

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G+++GN    D  D +GM++YAW HAVISD  ++ +  +CDF        ++C+ A++E 
Sbjct  230   GLMIGNALLDDETDQKGMIEYAWDHAVISDALYKKVNQNCDFKQKLV--TKECNAALDEY  287

Query  889   LKQYKEIDIYSLYTSVCIDSLTG--------SGDNSTPVFKTTSKMMPRIM---------  1017
                YK +D+YSLY+  C+ + +         +G+   P F+  S + PR++         
Sbjct  288   FDVYKILDMYSLYSPKCVPTTSTNSSTSHSVAGNRPLPAFR--SVLRPRLISHNEGWRRM  345

Query  1018  -AGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKK  1194
              AGYDPC  +Y + Y NR DVQ+ALH +  +    W  C+ +V   WSD+  S+LP  + 
Sbjct  346   AAGYDPCASEYTEKYMNRRDVQEALHANVTNISYPWTHCSDTV-SFWSDAPASMLPTLRT  404

Query  1195  LIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTF  1374
             L++AG+R+WV+SGDTDGR+PV +TRYS+  LGL I ++W PWY + QVGGW  EY+GL F
Sbjct  405   LVSAGLRVWVFSGDTDGRIPVTATRYSLKKLGLKIVQDWTPWYTKLQVGGWTVEYDGLMF  464

Query  1375  ATFRGAGHAVPTFKP  1419
              T RGAGH VPTFKP
Sbjct  465   VTVRGAGHQVPTFKP  479



>ref|NP_001152245.1| lysosomal protective protein precursor [Zea mays]
 gb|ACG46590.1| lysosomal protective protein precursor [Zea mays]
Length=486

 Score =   452 bits (1163),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 225/434 (52%), Positives = 285/434 (66%), Gaps = 21/434 (5%)
 Frame = +1

Query  172   SEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCS  351
             + D VA LPGQP V F  YAGYVTVNE +GR LFYW +E+++ PD+KPLVLWLNGGPGCS
Sbjct  34    AADRVAGLPGQPPVGFAQYAGYVTVNETHGRALFYWFFEATASPDKKPLVLWLNGGPGCS  93

Query  352   SIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             SIGYG  +E+GPFLV   +  L  N YSWN EANL+FLESPVGVGFSY+NTS+D   LGD
Sbjct  94    SIGYGEAEELGPFLVQKGKPELRWNNYSWNTEANLMFLESPVGVGFSYTNTSSDLLQLGD  153

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNK--DPSLFIDL  705
                A+DAY FL  WF +FP Y++  FYIAGESYAG YVP+L+E I D N+      +++L
Sbjct  154   KITADDAYKFLLNWFKRFPQYRSHDFYIAGESYAGHYVPQLSEKIFDGNRAGPKESYVNL  213

Query  706   RGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNE  885
             +G+++GN    D  D  GMVDYAW HAVISD  +  + A CDF+  +      C+ A+ E
Sbjct  214   KGLMVGNALMDDETDQTGMVDYAWDHAVISDRVYADVKARCDFSMANV--TDACNAALQE  271

Query  886   LLKQYKEIDIYSLYTSVCIDSLTGS----------GDNSTPVFKTTSKMMPR----IM--  1017
                 Y+ ID+YSLYT VC D   G+          G     V     ++  +    IM  
Sbjct  272   YFAVYRLIDMYSLYTPVCTDDPAGASALPSSYDARGHRKVAVHGAAPRIFSKYRGWIMKP  331

Query  1018  AGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKL  1197
             AGYDPC  +YA++Y+NR DVQ ALH +      +W  C+  V + W+D+  S LP  +KL
Sbjct  332   AGYDPCTAEYAETYFNRPDVQAALHANVTKIGYNWTHCS-DVINTWNDAAFSTLPTIRKL  390

Query  1198  IAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFA  1377
             +A+G+R+WV+SGDTDGR+PV STR +++ LGL   +EW PWY   QVGGW   YEGLTF 
Sbjct  391   VASGLRVWVFSGDTDGRIPVTSTRLTLNKLGLKTIQEWTPWYDHLQVGGWTVVYEGLTFV  450

Query  1378  TFRGAGHAVPTFKP  1419
             T RGAGH VP   P
Sbjct  451   TIRGAGHEVPLHAP  464



>ref|XP_010454603.1| PREDICTED: serine carboxypeptidase-like 34 [Camelina sativa]
Length=501

 Score =   452 bits (1164),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 219/432 (51%), Positives = 298/432 (69%), Gaps = 21/432 (5%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP V F+ YAGYVTVNE +GR LFYW +E++  P +KPL+LWLNGGPGCSS+
Sbjct  52    DRVKELPGQPPVKFRQYAGYVTVNETHGRALFYWFFEATHNPSKKPLLLWLNGGPGCSSV  111

Query  358   GYGATQEIGPFL-VDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             G+GA++E+GPF   +S + +L +NPYSWNK ANLLFLESPVGVGFSYSNTS D + LGD 
Sbjct  112   GFGASEELGPFFPQNSSQPNLKLNPYSWNKAANLLFLESPVGVGFSYSNTSRDISQLGDT  171

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLR  708
               A+D++ FL  WF +FP YK+  F+IAGESYAG YVP+L+E+I ++NK  S   FI+L+
Sbjct  172   VTASDSHNFLVNWFKRFPQYKSHDFFIAGESYAGHYVPQLSELIYNQNKIASKKDFINLK  231

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G+++GN    D  D +GM+DYA+ HAVISD  +  +   CDF       +++C+ A++E 
Sbjct  232   GLMIGNALLDDETDQKGMIDYAYDHAVISDALYEKVNQHCDFKLEHV--SKECNAALDEY  289

Query  889   LKQYKEIDIYSLYTSVCIDS---------------LTGSGDNSTPVFKTTSKMMPRIMAG  1023
                YK +D+YSLY+  C+ +               L  + +   P   + ++   R+ AG
Sbjct  290   FDVYKILDMYSLYSPKCVPTSTNSSTSHSVAGTRPLPAARNTFRPRLISQNEGWRRMAAG  349

Query  1024  YDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIA  1203
             YDPCL +Y + Y NR DVQ+ALH +  +    W  C+ ++   WSD+  S+LP  +KL++
Sbjct  350   YDPCLSEYTEKYMNRRDVQEALHANVTNIPYPWTHCSDTI-SFWSDAPASMLPTLRKLVS  408

Query  1204  AGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATF  1383
             AG+R+WV+SGDTDGR+PV +TRYS+  LGL I ++W PWY + QVGGW  EY+GLT+ T 
Sbjct  409   AGLRVWVFSGDTDGRIPVTATRYSLKKLGLKIVQDWTPWYTKLQVGGWTVEYDGLTYVTI  468

Query  1384  RGAGHAVPTFKP  1419
             RGAGH VPTFKP
Sbjct  469   RGAGHQVPTFKP  480



>ref|XP_004968682.1| PREDICTED: serine carboxypeptidase-like 33-like isoform X1 [Setaria 
italica]
Length=484

 Score =   451 bits (1161),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 222/437 (51%), Positives = 291/437 (67%), Gaps = 9/437 (2%)
 Frame = +1

Query  127   HSLSSNKEQSDQSWASEDLVANLPGQPI-VNFKHYAGYVTVNENNGRRLFYWLYESSSLP  303
              +L  N E    S    D V  LPGQP       +AGYVTVNE NGR LFYW +E+ + P
Sbjct  31    QTLCCNAEAVGYSEQEGDRVRLLPGQPANPPVSQFAGYVTVNERNGRALFYWFFEAQTSP  90

Query  304   DEKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGV  483
             ++KPL+LWLNGGPGCSS+GYGA  E+GP  V S  + L  N ++WN+EANLLFLESPVGV
Sbjct  91    EKKPLLLWLNGGPGCSSVGYGAASELGPLRVTSHGAGLEFNKFAWNREANLLFLESPVGV  150

Query  484   GFSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEI  663
             GFSY+NT +D A L D F A DAY FL  WF +FP +K R FYI+GESYAG YVP+LAE+
Sbjct  151   GFSYTNTFSDLAKLDDTFVAEDAYNFLVNWFKRFPQFKGREFYISGESYAGHYVPQLAEL  210

Query  664   IVDRNKD-PSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNS  840
             + DRNKD  S +I+L+G ++GNP T D  D +G+ +YAWSH+V+SDE +  I   CDF  
Sbjct  211   VYDRNKDKASTYINLKGFMVGNPLTDDYYDSKGLAEYAWSHSVVSDEVYERIKKVCDFRI  270

Query  841   NDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVC---IDSLTGSGDNSTPVF-KTTSKMMP  1008
             ++ W++ DC +A++ +  QY EIDIY++Y   C     S   +GD    V  +   +   
Sbjct  271   SN-WTD-DCDKAMSTVFSQYHEIDIYNIYAPRCNLPQSSAAVAGDQELAVNDQEHFRRRI  328

Query  1009  RIMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIY  1188
             R+ +GYD C   YA+ Y+N+ DVQ+A H +     R W++C+ S+   ++ S  S+LPIY
Sbjct  329   RMFSGYDACYSSYAEKYFNKADVQRAFHANV-TGTRKWQVCSDSILRSYNFSVLSILPIY  387

Query  1189  KKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGL  1368
              KLI AG+R+W+YSGD DGRVPV+ +RY +  LGLPI  +W+PWY  KQV G   EY G+
Sbjct  388   SKLIKAGLRVWLYSGDADGRVPVIGSRYCVEALGLPIKTQWQPWYLNKQVAGRFVEYHGM  447

Query  1369  TFATFRGAGHAVPTFKP  1419
             T  T RGAGH VP  KP
Sbjct  448   TMVTIRGAGHLVPLNKP  464



>ref|XP_004968683.1| PREDICTED: serine carboxypeptidase-like 33-like isoform X2 [Setaria 
italica]
Length=482

 Score =   451 bits (1161),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 222/437 (51%), Positives = 291/437 (67%), Gaps = 9/437 (2%)
 Frame = +1

Query  127   HSLSSNKEQSDQSWASEDLVANLPGQPI-VNFKHYAGYVTVNENNGRRLFYWLYESSSLP  303
              +L  N E    S    D V  LPGQP       +AGYVTVNE NGR LFYW +E+ + P
Sbjct  29    QTLCCNAEAVGYSEQEGDRVRLLPGQPANPPVSQFAGYVTVNERNGRALFYWFFEAQTSP  88

Query  304   DEKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGV  483
             ++KPL+LWLNGGPGCSS+GYGA  E+GP  V S  + L  N ++WN+EANLLFLESPVGV
Sbjct  89    EKKPLLLWLNGGPGCSSVGYGAASELGPLRVTSHGAGLEFNKFAWNREANLLFLESPVGV  148

Query  484   GFSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEI  663
             GFSY+NT +D A L D F A DAY FL  WF +FP +K R FYI+GESYAG YVP+LAE+
Sbjct  149   GFSYTNTFSDLAKLDDTFVAEDAYNFLVNWFKRFPQFKGREFYISGESYAGHYVPQLAEL  208

Query  664   IVDRNKD-PSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNS  840
             + DRNKD  S +I+L+G ++GNP T D  D +G+ +YAWSH+V+SDE +  I   CDF  
Sbjct  209   VYDRNKDKASTYINLKGFMVGNPLTDDYYDSKGLAEYAWSHSVVSDEVYERIKKVCDFRI  268

Query  841   NDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVC---IDSLTGSGDNSTPVF-KTTSKMMP  1008
             ++ W++ DC +A++ +  QY EIDIY++Y   C     S   +GD    V  +   +   
Sbjct  269   SN-WTD-DCDKAMSTVFSQYHEIDIYNIYAPRCNLPQSSAAVAGDQELAVNDQEHFRRRI  326

Query  1009  RIMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIY  1188
             R+ +GYD C   YA+ Y+N+ DVQ+A H +     R W++C+ S+   ++ S  S+LPIY
Sbjct  327   RMFSGYDACYSSYAEKYFNKADVQRAFHANV-TGTRKWQVCSDSILRSYNFSVLSILPIY  385

Query  1189  KKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGL  1368
              KLI AG+R+W+YSGD DGRVPV+ +RY +  LGLPI  +W+PWY  KQV G   EY G+
Sbjct  386   SKLIKAGLRVWLYSGDADGRVPVIGSRYCVEALGLPIKTQWQPWYLNKQVAGRFVEYHGM  445

Query  1369  TFATFRGAGHAVPTFKP  1419
             T  T RGAGH VP  KP
Sbjct  446   TMVTIRGAGHLVPLNKP  462



>ref|NP_001047514.1| Os02g0634700 [Oryza sativa Japonica Group]
 dbj|BAD25094.1| putative carboxypeptidase D [Oryza sativa Japonica Group]
 dbj|BAD25312.1| putative carboxypeptidase D [Oryza sativa Japonica Group]
 dbj|BAF09428.1| Os02g0634700 [Oryza sativa Japonica Group]
 dbj|BAG96603.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97576.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57434.1| hypothetical protein OsJ_07638 [Oryza sativa Japonica Group]
Length=485

 Score =   451 bits (1161),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 222/424 (52%), Positives = 276/424 (65%), Gaps = 13/424 (3%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP V F  YAGYVTVNE +GR LFYW +E+++  D+KPLVLWLNGGPGCSS+
Sbjct  43    DRVTRLPGQPAVRFAQYAGYVTVNETHGRALFYWFFEATAAADKKPLVLWLNGGPGCSSV  102

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYG  +E+GPFLV   +  L  N YSWNKEANL+FLESPVGVGFSY+NTS+D   LGD  
Sbjct  103   GYGEAEELGPFLVQKGKPELKWNKYSWNKEANLMFLESPVGVGFSYTNTSSDLQQLGDKI  162

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKD--PSLFIDLRG  711
              A+DAY FL  WF +FP YK+  FYIAGESYAG YVP+L+E I D NK      +I+ +G
Sbjct  163   TADDAYIFLLNWFKRFPQYKSHDFYIAGESYAGHYVPQLSEKIFDGNKQGPKENYINFKG  222

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELL  891
              ++GN    D  D  GM+DYAW HAVISD  +  +   C+F+  +      C  A+ E  
Sbjct  223   FMIGNALMDDETDQTGMIDYAWDHAVISDRVYADVKKYCNFSMENV--TDACDSALTEYF  280

Query  892   KQYKEIDIYSLYTSVC--IDSLTGSGDNSTPVFKTTSKMMPRIM------AGYDPCLDDY  1047
               Y+ ID+YSLYT VC  + S    G     V     K+  +        AGYDPC  D+
Sbjct  281   AVYRLIDMYSLYTPVCTEVSSSAAFGQRQVAVHGAAPKIFSKYHGWYMRPAGYDPCTSDH  340

Query  1048  AKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVY  1227
             A+ Y+NR DVQ+ALH +  +   +W  C+  V   W D+  S LPI +KL+A GIR+WV+
Sbjct  341   AEVYFNRADVQEALHANVTNIGYNWTHCS-DVIGKWRDAPFSTLPIIRKLVAGGIRVWVF  399

Query  1228  SGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVP  1407
             SGDTDGR+PV STR +++ LGL   +EW PWY  +QVGGW   YEGLTF T RGAGH VP
Sbjct  400   SGDTDGRIPVTSTRLTLNKLGLKTVQEWTPWYDHQQVGGWTILYEGLTFVTIRGAGHEVP  459

Query  1408  TFKP  1419
                P
Sbjct  460   LHAP  463



>ref|XP_004968684.1| PREDICTED: serine carboxypeptidase-like 33-like isoform X1 [Setaria 
italica]
Length=474

 Score =   451 bits (1160),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 215/422 (51%), Positives = 291/422 (69%), Gaps = 10/422 (2%)
 Frame = +1

Query  178   DLVANLPGQPIVNF-KHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             D +  LPGQP       ++GYVTVNE+NGR LFYW +E+ +LP +KPL+LWLNGGPGCSS
Sbjct  34    DRLGFLPGQPRSPLVSQFSGYVTVNEHNGRALFYWFFEAQTLPAQKPLLLWLNGGPGCSS  93

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             +GYGA  E+GP LV+ + + L  N ++WNKEANLLFLESPVGVGFSY+NT++D  N+ D 
Sbjct  94    VGYGAASELGPLLVNGNGTGLEFNKFAWNKEANLLFLESPVGVGFSYTNTTSDLDNIDDR  153

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNK--DPSLFIDLR  708
             F A D Y FL  WF KFP YK+  FYI+GESYAG YVP+LAE++ D NK  + +  I+L+
Sbjct  154   FVAKDTYTFLVNWFNKFPQYKSHDFYISGESYAGHYVPQLAEVVYDHNKHLEANKQINLK  213

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G ++GN ET+D  D++G+V++AWSH++ISD+ ++ +   CDF  + T    +CS  ++ L
Sbjct  214   GFIVGNAETNDYYDYKGIVEFAWSHSIISDQFYKRVKNVCDFRLSPT--TNECSHVMDLL  271

Query  889   LKQYKEIDIYSLYTSVCI---DSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSY  1059
              K Y EID+Y++Y   C     +++ S DN+            R+ +GYDPC  +Y ++Y
Sbjct  272   FKMYHEIDMYNVYAPKCNTDGSAVSSSFDNTVEKEAKNKAKRLRMYSGYDPCYSNYVEAY  331

Query  1060  YNRLDVQKALHVSSGHHLRD--WRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSG  1233
              NR+DVQK+LH ++   ++D  W +C+  +FD +     SVLPIY KL+  GIRIWVYSG
Sbjct  332   LNRMDVQKSLHANTSGWIKDRRWSLCSDPIFDNYDMEVFSVLPIYSKLVKGGIRIWVYSG  391

Query  1234  DTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTF  1413
             D DGRVP + +RY +  LGLPI  +W+PWY + QV G   EYEGLT AT RGAGH VP  
Sbjct  392   DVDGRVPFIGSRYWVEALGLPIKSQWQPWYFKNQVAGRYVEYEGLTMATVRGAGHTVPQD  451

Query  1414  KP  1419
             KP
Sbjct  452   KP  453



>gb|EYU33331.1| hypothetical protein MIMGU_mgv1a025174mg [Erythranthe guttata]
Length=463

 Score =   451 bits (1159),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 222/418 (53%), Positives = 289/418 (69%), Gaps = 9/418 (2%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP V FK YAGYVTVN  +GR LFYW +E+++ P +KPL+LWLNGGPGCSSI
Sbjct  30    DRVGRLPGQPPVGFKQYAGYVTVNVTHGRALFYWFFEATTNPHQKPLLLWLNGGPGCSSI  89

Query  358   GYGATQEIGPFLVDS-DESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             GYG ++E+GPF      +  L  N  SWNK ANLLF+ESPVGVGFSY+NT++D   LGD 
Sbjct  90    GYGQSEELGPFFPQKGKQPKLKFNSNSWNKAANLLFIESPVGVGFSYTNTTSDIGELGDT  149

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLR  708
               A D+Y FL  WF +FP +K+  F+IAGESYAG YVP+LAE++VD+NK+ +   +I+++
Sbjct  150   ITALDSYNFLLGWFERFPQFKSHDFFIAGESYAGHYVPQLAELVVDKNKNATKDDYINIK  209

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             GI++GN    D  D++G++DYAW HAVISD  +  I  +C+F++ +    ++C  A++E 
Sbjct  210   GIMIGNAVLDDETDFKGLIDYAWDHAVISDALYSQIQKTCNFSTPNFNFTKECDDALDEY  269

Query  889   LKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSYYNR  1068
                Y  ID+YSLY   C+     +  NST   +   +M  R ++GYDPCL +Y + Y NR
Sbjct  270   FSVYYIIDMYSLYAPTCV---VDANTNSTTKPRNGRRMR-RPLSGYDPCLSEYTELYLNR  325

Query  1069  LDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGR  1248
              DVQKALH +       W  C+ ++   W+D+  SVLPI KKLIAA  R+W++SGDTDGR
Sbjct  326   ADVQKALHANVTKIPYPWAHCSDNI-TFWNDAPMSVLPIIKKLIAADQRVWIFSGDTDGR  384

Query  1249  VPVLSTRYSISTLGLPITREWRPWY-HQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             VPV  TRYS+  LGL I  +W PWY + KQVGGW  EYEGLTF T RGAGH VPTFKP
Sbjct  385   VPVTGTRYSLQKLGLTIKNDWTPWYTYNKQVGGWTVEYEGLTFVTVRGAGHEVPTFKP  442



>ref|XP_010688684.1| PREDICTED: serine carboxypeptidase-like 34 [Beta vulgaris subsp. 
vulgaris]
Length=493

 Score =   452 bits (1162),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 222/428 (52%), Positives = 279/428 (65%), Gaps = 17/428 (4%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             DLV  LPGQP V+FKHYAGYV VN ++GR LFYW +E+   P  KP++LWLNGGPGCSS+
Sbjct  48    DLVVGLPGQPAVSFKHYAGYVNVNGSHGRALFYWFFEAVDNPHNKPVLLWLNGGPGCSSV  107

Query  358   GYGATQEIGPFL-VDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             GYG  +E+GPF      + SL +N ++WN+ ANLLFLESP+GVGFSY+NTS+D   LGD 
Sbjct  108   GYGEAEELGPFFPKKGSKPSLKLNKFAWNRAANLLFLESPIGVGFSYTNTSSDINELGDT  167

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLR  708
             F A D+Y FL  WF +FP +K+  FYIAGESYAG YVP+LAE+I D NK      FI+ +
Sbjct  168   FTAKDSYTFLVNWFTRFPQFKSNEFYIAGESYAGHYVPQLAEVIFDSNKKACKENFINFK  227

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G ++GN    D  D  GM+DYAW HAVISD+ +R +   C+F   +   + DC  A++E 
Sbjct  228   GFMIGNALLDDETDQTGMIDYAWDHAVISDKVYRDVKRKCNFKLKNV--SDDCRVALDEY  285

Query  889   LKQYKEIDIYSLYTSVCIDSLTGS-GDNSTPVFKTTSKMMPRIM----------AGYDPC  1035
                Y  ID+YSLYT  C  + T +  +NS     T   + P +           AGYDPC
Sbjct  286   FAVYDLIDMYSLYTPDCAHNFTATVSNNSRRQLPTIKGIAPHLFSKFERWHKRPAGYDPC  345

Query  1036  LDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIR  1215
              D Y   Y NR DVQ ALH +       W  CN ++   W D+  S+LP  KKLIA GIR
Sbjct  346   ADHYTDVYLNRPDVQAALHANVTKIPYAWSHCNDNI-TFWGDAPSSILPTIKKLIAGGIR  404

Query  1216  IWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAG  1395
             IWV+SGDTDGR+PV +TR ++  LGL I ++W PWY +KQVGGW   Y+GL F T RGAG
Sbjct  405   IWVFSGDTDGRIPVSATRLTLRKLGLKINQDWTPWYSKKQVGGWTISYDGLMFVTIRGAG  464

Query  1396  HAVPTFKP  1419
             H VPTFKP
Sbjct  465   HQVPTFKP  472



>ref|XP_010648555.1| PREDICTED: serine carboxypeptidase-like 35 [Vitis vinifera]
 emb|CBI27152.3| unnamed protein product [Vitis vinifera]
Length=476

 Score =   451 bits (1160),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 219/420 (52%), Positives = 291/420 (69%), Gaps = 8/420 (2%)
 Frame = +1

Query  175   EDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             +D V +LPGQP V F+HYAGYV +   + + LFYW +E+     EKPLVLWLNGGPGCSS
Sbjct  39    KDRVKDLPGQPAVEFRHYAGYVKLRPQDEKALFYWFFEAQGGVLEKPLVLWLNGGPGCSS  98

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             I YGA QE+GPFLV S+ + L +N +SWNK AN+LFLE+PVGVGFSY+N STD   LGD 
Sbjct  99    IAYGAAQELGPFLVRSNGTQLILNDFSWNKVANILFLEAPVGVGFSYTNKSTDLLKLGDR  158

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLR  708
               A D++AFL +WF +FPS+K+  FYI GESYAG YVP+LAE+I +RN+  +   +I+L+
Sbjct  159   ITAEDSHAFLVQWFKRFPSFKSHDFYITGESYAGHYVPQLAELIYERNRKSTKDSYINLK  218

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G ++GN   +D  D  G++++AWSHA+ISD+ +  II  CDF  ++      CS  +  L
Sbjct  219   GFMIGNAVINDETDDMGLIEFAWSHAIISDQLYHGIIKECDFIRDN--PTNLCSNHIKGL  276

Query  889   LKQYKEIDIYSLYTSVCIDSLTGSGDN--STPVFKTTSKMMPRIMAGYDPCLDDYAKSYY  1062
             L+ Y +ID+YS+YT VC+ S   +     + P   T   +  ++ +GYDPC +DYA+ Y+
Sbjct  277   LEAYSDIDMYSIYTPVCLSSSKETYRKFVTAPRLFTQHDLWHQLPSGYDPCTEDYAEKYF  336

Query  1063  NRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTD  1242
             NR DVQKALH +       +  C+ +V   W+DS E++LP  +KL+ AG+RIWVY GDTD
Sbjct  337   NREDVQKALHANVTKLPYPYTPCS-NVIRKWNDSAETMLPTIQKLLKAGLRIWVYCGDTD  395

Query  1243  GRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYE-GLTFATFRGAGHAVPTFKP  1419
             GRVPV STRYSI+ +GL I + WR W+H+KQV GWV  YE GLT AT RGAGH VP   P
Sbjct  396   GRVPVTSTRYSINKMGLRIQKGWRAWFHRKQVAGWVVTYEGGLTLATVRGAGHQVPILAP  455



>ref|NP_851062.2| serine carboxypeptidase-like 34 [Arabidopsis thaliana]
 sp|Q0WPR4.2|SCP34_ARATH RecName: Full=Serine carboxypeptidase-like 34; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB11176.1| serine carboxypeptidase II-like protein [Arabidopsis thaliana]
 gb|AED93133.1| serine carboxypeptidase-like 34 [Arabidopsis thaliana]
Length=499

 Score =   452 bits (1162),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 223/434 (51%), Positives = 292/434 (67%), Gaps = 25/434 (6%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP V F+ YAGYVTVNE +GR LFYW +E++  P +KP++LWLNGGPGCSSI
Sbjct  50    DRVKELPGQPPVKFRQYAGYVTVNETHGRALFYWFFEATQNPSKKPVLLWLNGGPGCSSI  109

Query  358   GYGATQEIGPFL-VDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             G+GA +E+GPF   +S +  L +NPYSWNK ANLLFLESPVGVGFSY+NTS D   LGD 
Sbjct  110   GFGAAEELGPFFPQNSSQPKLKLNPYSWNKAANLLFLESPVGVGFSYTNTSRDIKQLGDT  169

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLR  708
               A D+Y FL  WF +FP YK+  FYIAGESYAG YVP+L+E+I   NK  S   FI+L+
Sbjct  170   VTARDSYNFLVNWFKRFPQYKSHDFYIAGESYAGHYVPQLSELIYKENKIASKKDFINLK  229

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G+++GN    D  D +GM++YAW HAVISD  +  +  +CDF        ++C+ A++E 
Sbjct  230   GLMIGNALLDDETDQKGMIEYAWDHAVISDALYEKVNKNCDFKQKLV--TKECNDALDEY  287

Query  889   LKQYKEIDIYSLYTSVCIDSLTG-------SGDNSTPVFKTTSKMMPRIM----------  1017
                YK +D+YSLY   C+ + T        +G+   P F+  S + PR++          
Sbjct  288   FDVYKILDMYSLYAPKCVPTSTNSSTSHSVAGNRPLPAFR--SILRPRLISHNEGWRRMA  345

Query  1018  AGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKL  1197
             AGYDPC  +Y + Y NR DVQ+ALH +  +    W  C+ +V   WSD+  S+LP  + L
Sbjct  346   AGYDPCASEYTEKYMNRKDVQEALHANVTNISYPWTHCSDTV-SFWSDAPASMLPTLRTL  404

Query  1198  IAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFA  1377
             ++AG+R+WV+SGDTDGR+PV +TRYS+  LGL I ++W PWY + QVGGW  EY+GL F 
Sbjct  405   VSAGLRVWVFSGDTDGRIPVTATRYSLKKLGLKIVQDWTPWYTKLQVGGWTVEYDGLMFV  464

Query  1378  TFRGAGHAVPTFKP  1419
             T RGAGH VPTFKP
Sbjct  465   TVRGAGHQVPTFKP  478



>ref|XP_009631140.1| PREDICTED: serine carboxypeptidase 24-like [Nicotiana tomentosiformis]
Length=464

 Score =   450 bits (1158),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 219/416 (53%), Positives = 289/416 (69%), Gaps = 12/416 (3%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D + +LPGQP V F  ++GYVTVNEN+GR LFYWL E+++ P++KPLVLWLNGGPGCSS+
Sbjct  40    DRIISLPGQPPVTFSQFSGYVTVNENHGRALFYWLTEATTQPEKKPLVLWLNGGPGCSSV  99

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
              YGA++EIGPF ++   SSL +N YSWNK AN+LFLESP GVGFSY+NTS+D  + GD  
Sbjct  100   AYGASEEIGPFRINKTGSSLYLNKYSWNKVANILFLESPAGVGFSYTNTSSDLKDSGDKR  159

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKD-PSLFIDLRGI  714
              A DA  FL  W  +FP YK R FYI+GESYAG YVP+LA  IV+ NK  P   I+L+GI
Sbjct  160   TAQDALIFLTRWMSRFPQYKYRDFYISGESYAGHYVPQLAHAIVNYNKKFPHPIINLKGI  219

Query  715   LLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVN-ELL  891
             ++GN  T +  D  G V Y WSH++ISD T++ I+ SC+F S +  S++ C  AV   + 
Sbjct  220   IVGNAVTDNKYDGIGTVTYWWSHSMISDNTYKKIMHSCNFTSEN--SSKQCDNAVTYAVS  277

Query  892   KQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSYYNRL  1071
              ++ +ID YS+YT  C        + +    +  + ++ R ++GYDPC ++YA+ YYNR 
Sbjct  278   HEFGQIDQYSIYTPSC--------NETQKYVRFKNTIIHRKLSGYDPCTENYAEKYYNRA  329

Query  1072  DVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGRV  1251
             DVQ+A+H ++      W  C+  +   W DS +S+LPIYKKL+AAGIRIWV+SGDTD  V
Sbjct  330   DVQRAMHANTTGISYSWTACSDILLKNWKDSDDSMLPIYKKLMAAGIRIWVFSGDTDSVV  389

Query  1252  PVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             PV +TR+S+S L L I   W PWY   QVGGW + Y+GLTFAT RGAGH VP F+P
Sbjct  390   PVTATRFSLSHLNLKIKTPWYPWYSGAQVGGWTEVYDGLTFATVRGAGHEVPLFQP  445



>gb|EEC73659.1| hypothetical protein OsI_08191 [Oryza sativa Indica Group]
Length=485

 Score =   451 bits (1159),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 222/424 (52%), Positives = 276/424 (65%), Gaps = 13/424 (3%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP V F  YAGYVTVNE +GR LFYW +E+++  D+KPLVLWLNGGPGCSS+
Sbjct  43    DRVTRLPGQPAVRFAQYAGYVTVNETHGRALFYWFFEATAGADKKPLVLWLNGGPGCSSV  102

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYG  +E+GPFLV   +  L  N YSWNKEANL+FLESPVGVGFSY+NTS+D   LGD  
Sbjct  103   GYGEAEELGPFLVQKGKPELKWNKYSWNKEANLMFLESPVGVGFSYTNTSSDLQQLGDKI  162

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKD--PSLFIDLRG  711
              A+DAY FL  WF +FP YK+  FYIAGESYAG YVP+L+E I D NK      +I+ +G
Sbjct  163   TADDAYIFLLNWFKRFPQYKSHDFYIAGESYAGHYVPQLSEKIFDGNKQGPKENYINFKG  222

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELL  891
              ++GN    D  D  GM+DYAW HAVISD  +  +   C+F+  +      C  A+ E  
Sbjct  223   FMIGNALMDDETDQTGMIDYAWDHAVISDRVYADVKKYCNFSMENV--TDACDSALTEYF  280

Query  892   KQYKEIDIYSLYTSVC--IDSLTGSGDNSTPVFKTTSKMMPRIM------AGYDPCLDDY  1047
               Y+ ID+YSLYT VC  + S    G     V     K+  +        AGYDPC  D+
Sbjct  281   AVYRLIDMYSLYTPVCTEVSSSAAFGQRQVAVHGAAPKIFSKYHGWYMRPAGYDPCTSDH  340

Query  1048  AKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVY  1227
             A+ Y+NR DVQ+ALH +  +   +W  C+  V   W D+  S LPI +KL+A GIR+WV+
Sbjct  341   AEVYFNRADVQEALHANVTNIGYNWTHCS-DVIGKWRDAPFSTLPIIRKLVAGGIRVWVF  399

Query  1228  SGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVP  1407
             SGDTDGR+PV STR +++ LGL   +EW PWY  +QVGGW   YEGLTF T RGAGH VP
Sbjct  400   SGDTDGRIPVTSTRLTLNKLGLKTVQEWTPWYDHQQVGGWTILYEGLTFVTIRGAGHEVP  459

Query  1408  TFKP  1419
                P
Sbjct  460   LHAP  463



>ref|XP_006590795.1| PREDICTED: serine carboxypeptidase-like 34-like [Glycine max]
Length=473

 Score =   450 bits (1157),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 225/435 (52%), Positives = 288/435 (66%), Gaps = 13/435 (3%)
 Frame = +1

Query  145   KEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVL  324
             KE    S    D V  LPGQP V FK Y+GY+TVNE +GR LFYW  E++  P  KP++L
Sbjct  21    KEALGVSEQEADRVHGLPGQPPVKFKQYSGYITVNETHGRALFYWFIEATHRPKHKPVLL  80

Query  325   WLNGGPGCSSIGYGATQEIGPFL-VDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSN  501
             WLNGGPGCSSIGYG  +E+GPF   DS +  L +NPYSWNK ANLLFLESPVGVGFSY+N
Sbjct  81    WLNGGPGCSSIGYGEAEELGPFFPQDSSQPKLKLNPYSWNKAANLLFLESPVGVGFSYTN  140

Query  502   TSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNK  681
             TS+D + LGD   A D++ F+ +WF +FP +++  FYI+GESYAG YVP+L+E+I D N+
Sbjct  141   TSSDISELGDTITAKDSHTFIVKWFRRFPQFRSNKFYISGESYAGHYVPQLSELIFDNNR  200

Query  682   DPSL--FIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWS  855
             + +   +I+ +G ++GN    D  D +GM+DYAW+HAVISD  +  I   C+F+  D  S
Sbjct  201   NHAKKDYINFKGFMIGNALLDDETDQKGMIDYAWNHAVISDGVYHNITTKCNFSLPD--S  258

Query  856   NQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFK-----TTSKMM--PRI  1014
               DC   +N+    Y  ID+YSLYT  C  +   +      V +     T SK+    R 
Sbjct  259   TDDCIDQLNKYFDVYSIIDMYSLYTPKCFSNNGNTIKKLAHVLRGRAPQTFSKINGWHRK  318

Query  1015  MAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKK  1194
              AGYDPC  DY + Y NR +VQKALH +       W  C+ ++   W+D+ +S+LP+ KK
Sbjct  319   PAGYDPCASDYTEVYLNRPEVQKALHANVTKIPYSWTHCSDTI-TFWNDAPQSMLPVIKK  377

Query  1195  LIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTF  1374
             LIA GIRIWVYSGDTDGR+PV STRY++  LGL I  +W PWY  KQVGGW   Y+GLTF
Sbjct  378   LIAGGIRIWVYSGDTDGRIPVTSTRYTLRKLGLGIVEDWTPWYTSKQVGGWTIAYDGLTF  437

Query  1375  ATFRGAGHAVPTFKP  1419
              T RGAGH VPTF P
Sbjct  438   VTIRGAGHQVPTFTP  452



>ref|XP_009385955.1| PREDICTED: serine carboxypeptidase-like 35 [Musa acuminata subsp. 
malaccensis]
Length=481

 Score =   450 bits (1157),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 228/434 (53%), Positives = 291/434 (67%), Gaps = 23/434 (5%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP V F+HYAGYV V+++    LF+W +E+   P+EKPLVLWLNGGPGCSSI
Sbjct  29    DRVGALPGQPAVEFRHYAGYVRVSDDKA--LFFWFFEAKRRPEEKPLVLWLNGGPGCSSI  86

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
              YGA QE+GPFLV S+  +LT+NPYSWN  ANLLFLESPVGVGFSY+N S D   LGD  
Sbjct  87    AYGAAQELGPFLVKSNSPNLTLNPYSWNNVANLLFLESPVGVGFSYTNRSLDLEELGDRT  146

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLRG  711
              A D++ FL  WF +FP +K    YIAGESYAG YVP+LAE+I + NK  S   F++LRG
Sbjct  147   TAQDSHTFLLNWFKRFPEFKHHDLYIAGESYAGHYVPQLAELIYEGNKKASKDSFVNLRG  206

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSND---TWSNQDCSQAVN  882
              ++GN   +D  D  GMV+YAWSHA+ISDE + T+   CD    +     +++ CS AV 
Sbjct  207   FMIGNAVLNDATDQLGMVEYAWSHAIISDELYSTVRKECDSFKEEGEGGRASKACSPAVR  266

Query  883   ELLKQYKEIDIYSLYTSVCIDSLTGSGDN----STPVFKTTSKM---MPRIMAGYDPCLD  1041
               L+ Y +IDIYS+Y+ +C+ SLT S  +    + P F +  ++   M ++  GYDPC +
Sbjct  267   AFLQAYNDIDIYSIYSPICLSSLTKSSPSRKLVAAPKFFSQHEIWHDMRKMPTGYDPCTE  326

Query  1042  DYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIW  1221
             DY + Y+NR DVQ+ALH +       +  C+  +   W+DS  +VLPI  KL+ AG+R+W
Sbjct  327   DYVEKYFNREDVQRALHANVTRLSYPYSPCS-ELIHNWNDSPSTVLPILMKLMKAGLRVW  385

Query  1222  VYSGDTDGRVPVLSTRYSISTLGLPITRE-------WRPWYHQKQVGGWVQEY-EGLTFA  1377
             VYSGDTDGRVPV STRYSI+ + L    E       WR WYH++QV GWV EY EGLT A
Sbjct  386   VYSGDTDGRVPVTSTRYSINEMRLRPKGEERKRWGGWRAWYHKEQVAGWVVEYEEGLTLA  445

Query  1378  TFRGAGHAVPTFKP  1419
             T RGAGH VP F P
Sbjct  446   TVRGAGHQVPVFAP  459



>ref|XP_009397584.1| PREDICTED: serine carboxypeptidase-like 34 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=477

 Score =   450 bits (1157),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 221/424 (52%), Positives = 283/424 (67%), Gaps = 13/424 (3%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP V+F  YAGYVTVNE++GR LFYW +E++   ++KPL+LWLNGGPGCSSI
Sbjct  36    DRVVRLPGQPPVDFHQYAGYVTVNESHGRALFYWFFEATHDVEKKPLLLWLNGGPGCSSI  95

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYG  +E+GPFL+   +  L  N +SWNKEANLLFLESPVGVGFSY+NTS+D ++LGD  
Sbjct  96    GYGEAEELGPFLMQKGKPELKFNKHSWNKEANLLFLESPVGVGFSYTNTSSDLSSLGDKI  155

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLRG  711
              A D+Y FL  WF +FP +K+  FYIAGESYAG YVP+L+E I D NK  S   +I+ +G
Sbjct  156   TAEDSYIFLLNWFKRFPQFKSHDFYIAGESYAGHYVPQLSEKIFDENKKASKENYINFKG  215

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELL  891
              ++GN    D  D  GMVDYAW HAVISD  +  +  SC+F+  +    + C  A+ E  
Sbjct  216   FIIGNALMDDDTDQTGMVDYAWDHAVISDRVYHDVKKSCNFSEENV--TKACDDALEEYF  273

Query  892   KQYKEIDIYSLYTSVCIDSLTGSG--------DNSTPVFKTTSKMMPRIMAGYDPCLDDY  1047
               Y  ID+YSLY  VC+   T           + ++P   +      +  AGYDPC+  Y
Sbjct  274   AVYDIIDMYSLYAPVCVRPNTSMSWSERSYFVEGASPKLFSKYSGWHQKPAGYDPCVSLY  333

Query  1048  AKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVY  1227
             ++ Y+NR DVQ+ALH +      +W  C+  V   W+D+  SVLP+ +KLI  GIR+WV+
Sbjct  334   SEVYFNREDVQEALHANVTKLGYNWTHCS-DVITRWNDAPASVLPVIRKLIHGGIRVWVF  392

Query  1228  SGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVP  1407
             SGDTDGR+PV STRY++  LGL  TREW PWY  KQVGGW   ++GLTF T RGAGH VP
Sbjct  393   SGDTDGRIPVTSTRYTLHKLGLKTTREWTPWYDHKQVGGWTIIFDGLTFVTVRGAGHQVP  452

Query  1408  TFKP  1419
             TF P
Sbjct  453   TFAP  456



>ref|XP_009765689.1| PREDICTED: serine carboxypeptidase-like 33 isoform X2 [Nicotiana 
sylvestris]
Length=479

 Score =   450 bits (1157),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 222/430 (52%), Positives = 292/430 (68%), Gaps = 17/430 (4%)
 Frame = +1

Query  175   EDLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCS  351
             +D V  LPGQP       ++GY+TVN+ NGR LFYW + S S   +KPL+LWLNGGPGCS
Sbjct  32    DDKVTKLPGQPTTPQVSQFSGYITVNKTNGRALFYWFFPSQSESFKKPLLLWLNGGPGCS  91

Query  352   SIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             S+GYGA  E+GP LV ++ + L  N YSWNKEANLLFLESPVGVGFSY+NTS+D  NL D
Sbjct  92    SVGYGAAVELGPLLVKNNGAGLDFNSYSWNKEANLLFLESPVGVGFSYTNTSSDLTNLDD  151

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDL  705
             DFAA DAY FL  W  +FP +K R F+I+GESYAG YVP+LAE++ +RNKD     +I+L
Sbjct  152   DFAAEDAYNFLVNWLERFPEFKNREFFISGESYAGHYVPQLAELVYNRNKDSKKYPYINL  211

Query  706   RGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNE  885
             +G+++GNPET+D  D++G+++YAWSHAVI D  +      CDFN ++ WS+  C+ A+  
Sbjct  212   KGLIVGNPETNDYYDYKGILEYAWSHAVIYDSQYEKAKQVCDFNLSN-WSDA-CNAAMKV  269

Query  886   LLKQYKEIDIYSLYTSVCIDS----------LTGSGDNSTPVFKTTSKMMPRIMAGYDPC  1035
             +  +Y+EIDIY++Y   C+ +          ++G   +         + M RI  GYDPC
Sbjct  270   VWDKYEEIDIYNIYAPKCLRNTSSSSSASLAVSGHESSKLKALNYGFRRMKRIPGGYDPC  329

Query  1036  LDDYAKSYYNRLDVQKALHVSS-GHHLR-DWRICNMSVFDGWSDSKESVLPIYKKLIAAG  1209
                + + Y+NRLDVQ ALH +S G H R  W+ C+  VF  ++ +  SVLPIYKKLI  G
Sbjct  330   YTAFTEEYFNRLDVQIALHANSEGRHTRVKWQSCSDPVFQKYNYNVFSVLPIYKKLIQGG  389

Query  1210  IRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRG  1389
             ++IW++SGD DGRVPV+ TRY I  L L +  EW  W+H  QV G + EYEGLTF T RG
Sbjct  390   LKIWIFSGDADGRVPVIGTRYCIEALNLTLKSEWHSWFHNHQVAGRIVEYEGLTFVTVRG  449

Query  1390  AGHAVPTFKP  1419
             AGH VP +KP
Sbjct  450   AGHLVPLYKP  459



>ref|XP_008812782.1| PREDICTED: serine carboxypeptidase-like 34 [Phoenix dactylifera]
Length=491

 Score =   450 bits (1158),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 222/430 (52%), Positives = 286/430 (67%), Gaps = 18/430 (4%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V +LPGQP V F+HYAGY+TV+E  G+ LFYW +E++  P +KPL+LWLNGGPGCSS+
Sbjct  43    DRVVHLPGQPPVKFRHYAGYITVDERLGKALFYWFFEATHKPAKKPLLLWLNGGPGCSSV  102

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
              +G  QE+GPFLV      L +N ++WNK ANLLFLE+P GVGFSYSNT++D    GD+ 
Sbjct  103   AFGEAQELGPFLVRKGAPELELNKHAWNKAANLLFLETPAGVGFSYSNTTSDLDVQGDNA  162

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLRG  711
              A  +Y FL  WF KFP YK  AFYIAGESYAG YVP+LA++I D+NK+     +I+L+G
Sbjct  163   TAFSSYTFLVNWFQKFPQYKLNAFYIAGESYAGHYVPQLAKVIFDKNKETPEEDYINLKG  222

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELL  891
              ++GN       D +GMVDYAW HAVISD  +R I+ SC+F S  T+S Q+C+ A ++  
Sbjct  223   FMIGNALLDFETDLRGMVDYAWDHAVISDRVYRNIVTSCNF-SAATFS-QECNDAFSQYY  280

Query  892   KQYKEIDIYSLYTSVC---IDSLTGSGDNSTPVFKTT-----------SKMMPRIMAGYD  1029
               Y  ID+YSLYT  C     + T S +N     K               +M +I AGYD
Sbjct  281   AVYDIIDMYSLYTPRCESGYPNFTASEENLASFSKFVRFSPNLLRSFHEDLMLKIPAGYD  340

Query  1030  PCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAG  1209
             PCL  YA  Y+NR DVQ+ALH +     R W +C+ SV   W+  + S+LP  +KLI  G
Sbjct  341   PCLQTYATEYFNRQDVQEALHANVTKLTRPWSLCSRSVNRAWNKYERSILPTIQKLIDGG  400

Query  1210  IRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRG  1389
             + IWV+SGDTDGR+P+ STRYS++ LGL I  +W PW++ KQVGGW   Y+GLTF T RG
Sbjct  401   VLIWVFSGDTDGRIPITSTRYSLNKLGLEIIEDWSPWFNHKQVGGWTITYDGLTFITVRG  460

Query  1390  AGHAVPTFKP  1419
             AGH VPT  P
Sbjct  461   AGHQVPTTAP  470



>gb|KHG12023.1| Serine carboxypeptidase-like 35 [Gossypium arboreum]
Length=475

 Score =   449 bits (1155),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 219/442 (50%), Positives = 289/442 (65%), Gaps = 19/442 (4%)
 Frame = +1

Query  130   SLSSNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDE  309
             + + +++ S       D V NLPGQP V F+HYAGYV +   + + LFYW +E+      
Sbjct  20    TFTQSRQPSYAEQQETDRVTNLPGQPPVKFRHYAGYVKLRPQDSKALFYWFFEAQDGVSN  79

Query  310   KPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGF  489
             KPLVLWLNGGPGCSS+ YGA QE+GPFL+ S+ + LT N +SWNK AN+LFLE+PVGVGF
Sbjct  80    KPLVLWLNGGPGCSSVAYGAAQELGPFLIRSNGTRLTFNKFSWNKVANILFLEAPVGVGF  139

Query  490   SYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIV  669
             SY+N S D   LGD   A D+Y FL  WF +FP++K+  FYIAGESYAG YVP+LA++I 
Sbjct  140   SYTNNSQDLHKLGDQVTAADSYTFLINWFKRFPNFKSHDFYIAGESYAGHYVPQLAQLIY  199

Query  670   DRNK--DPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSN  843
             D+N+   P  +I+ +G ++GN   ++  D  G+ DYAWSHA+ISD+ +  I   CDF   
Sbjct  200   DKNQGSSPDSYINFKGFMIGNAAINEPTDTLGLFDYAWSHAIISDQLYDKINKECDFKQT  259

Query  844   DTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSK--------  999
             +  + Q C+  +   +  Y  ID+YS+YT VCI +L      + P      +        
Sbjct  260   NNLTVQ-CADHMKGFMDAYANIDMYSIYTPVCIKAL--GTRRTFPKLPVAPRLLSQHGIW  316

Query  1000  -MMPRIMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESV  1176
              M+PR   GYDPC ++Y + Y+NR DVQ ALH +       +  C+  +  GW+DS +SV
Sbjct  317   HMLPR---GYDPCTEEYVEKYFNREDVQSALHANLTKLSYPYTTCSGEI-QGWNDSPDSV  372

Query  1177  LPIYKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQE  1356
             LPI +K + AG+RIW+YSGDTDGRVPV STRYSI  +GL +  EWR W+HQ QVGGWV+ 
Sbjct  373   LPIIQKHLNAGLRIWIYSGDTDGRVPVTSTRYSIKKMGLKVKEEWRAWFHQSQVGGWVEV  432

Query  1357  YE-GLTFATFRGAGHAVPTFKP  1419
             YE GLTFAT RGAGH VP F P
Sbjct  433   YEGGLTFATVRGAGHQVPVFAP  454



>emb|CDY35007.1| BnaA01g27270D [Brassica napus]
Length=474

 Score =   449 bits (1154),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 223/423 (53%), Positives = 291/423 (69%), Gaps = 13/423 (3%)
 Frame = +1

Query  178   DLVANLPGQPI-VNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             D V NLP QP      H++GYV VN+ N R LF+W +E+ S    +PLVLWLNGGPGCSS
Sbjct  36    DKVVNLPEQPSNPKISHFSGYVNVNQENTRALFFWFFEALSEDPTRPLVLWLNGGPGCSS  95

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             IGYGA  E+GPF V  + +SL  N YSW +EAN+LFLESPVGVGFSY+NTS+D  NL D 
Sbjct  96    IGYGAASELGPFRVVENGTSLRFNQYSWVQEANMLFLESPVGVGFSYTNTSSDLDNLNDS  155

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRN--KDPSLFIDLR  708
             F A+DAY F+  WF ++P YK+R F+IAGESYAG Y P+LAE I DRN  K    FI+L+
Sbjct  156   FVADDAYNFMVAWFARYPQYKSRDFFIAGESYAGHYAPQLAEQIYDRNKVKPKESFINLK  215

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G ++GNP T D  D +G+++YAWSHAVISD  + T   +CDF S++ WS + C+ A+N +
Sbjct  216   GFIVGNPLTDDEYDNKGILEYAWSHAVISDNLYDTAKRNCDFKSSN-WS-EPCNVAMNTM  273

Query  889   LKQYKEIDIYSLYTSVCIDSLTGSGD-----NSTPVFKTTSKMMPRIMAGYDPCLDDYAK  1053
              ++YKEIDIY++Y   C  S + +       N +P  K   K + R   GYDPC  DYA+
Sbjct  274   FQKYKEIDIYNIYAPKCTTSNSSAASFLGVFNKSPAMKDWFKRV-RWFEGYDPCYSDYAE  332

Query  1054  SYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSG  1233
              Y+NR+DV+ +LH ++  ++  W++CN S+   +  +  S+LP Y KLI AG++IWVYSG
Sbjct  333   KYFNRVDVRTSLHATT-RNVSRWKVCNDSILQTYQFTVSSMLPTYSKLIKAGLKIWVYSG  391

Query  1234  DTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYE-GLTFATFRGAGHAVPT  1410
             D DGRVPV+ +RY +  LGLP+  EWR W+H  QVGG + EYE GLTF T RGAGH VP 
Sbjct  392   DADGRVPVIGSRYCVEALGLPVKSEWRSWFHNHQVGGRITEYEGGLTFVTVRGAGHLVPL  451

Query  1411  FKP  1419
              KP
Sbjct  452   NKP  454



>ref|XP_008221066.1| PREDICTED: serine carboxypeptidase-like 34 [Prunus mume]
Length=488

 Score =   449 bits (1155),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 219/433 (51%), Positives = 288/433 (67%), Gaps = 14/433 (3%)
 Frame = +1

Query  154   SDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLN  333
             + Q     D V+ LPGQP V+FKH+AGYVTVN+ +GR LFYW +E+ + P +KPL+LWLN
Sbjct  38    AHQQQQKADQVSGLPGQPPVSFKHFAGYVTVNKTHGRALFYWFFEAINNPQDKPLLLWLN  97

Query  334   GGPGCSSIGYGATQEIGPFLVDS-DESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTST  510
             GGPGCSSIGYGAT+E+GPF V    E  L  NPY+WN  ANLLF+ESPVGVGFSY+NTS 
Sbjct  98    GGPGCSSIGYGATEELGPFFVQKGSELKLKFNPYTWNNAANLLFVESPVGVGFSYTNTSE  157

Query  511   DYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPS  690
             D   LGD   A D+Y FL  WF +FP YK+  FY+AGESYAG YVP+L+E+I DRN++ S
Sbjct  158   DIRQLGDKITAEDSYNFLINWFQRFPQYKSHDFYMAGESYAGHYVPQLSELIFDRNQNLS  217

Query  691   L--FIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQD  864
                +I+L+G ++GN    D  D +GM+DYAW HAVISD  ++ I   CDF+      ++ 
Sbjct  218   KENYINLKGFMIGNAVIDDETDQKGMIDYAWDHAVISDRLYQDIKNECDFSEKKL--SRL  275

Query  865   CSQAVNELLKQYKEIDIYSLYTSVCI--DSLTGSGDNSTPVFKTTSKMMPRI------MA  1020
             C++ ++E    Y+ ID+YSLYT  C+  +S   +    +   +    +  R+       A
Sbjct  276   CNKLIDEYFDVYEIIDMYSLYTPTCLSNNSSATTATRQSRTMQGAPTLFSRLDARHKRPA  335

Query  1021  GYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLI  1200
             GYDPC  +Y+  Y NR DVQK LH +       W  C+ ++   W D+  S+LP+  KL+
Sbjct  336   GYDPCASEYSYVYLNRPDVQKVLHANVTKIPYPWTHCSGNI-TFWEDAPPSILPVIGKLV  394

Query  1201  AAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFAT  1380
             A+G+R+W+YSGDTDGRVPV STRY++  LGL I  +W PWY+ KQVGGW   Y+GL F T
Sbjct  395   ASGLRVWIYSGDTDGRVPVTSTRYALKKLGLKINEDWTPWYNNKQVGGWRVAYDGLMFVT  454

Query  1381  FRGAGHAVPTFKP  1419
              RGAGH VP F P
Sbjct  455   IRGAGHQVPEFAP  467



>ref|XP_008643435.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=482

 Score =   449 bits (1154),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 223/427 (52%), Positives = 280/427 (66%), Gaps = 16/427 (4%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D VA LPGQP V F  YAGYVTVNE +GR LFYW +E+++ PD+KPLVLWLNGGPGCSSI
Sbjct  37    DRVAGLPGQPPVGFAQYAGYVTVNETHGRALFYWFFEATASPDKKPLVLWLNGGPGCSSI  96

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYG  +E+GPFLV   +  L  N YSWN EANL+FLESPVGVGFSY+NTS+D   LGD  
Sbjct  97    GYGEAEELGPFLVQKGKPELRWNNYSWNTEANLMFLESPVGVGFSYTNTSSDLLQLGDKI  156

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNK--DPSLFIDLRG  711
              A+DAY FL  WF +FP YK+  FYIAGESYAG YVP+L+E I D N+       ++L+G
Sbjct  157   TADDAYKFLLNWFKRFPQYKSHDFYIAGESYAGHYVPQLSEKIFDGNRAGHKESHVNLKG  216

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELL  891
             +++GN    D  D  GM+DYAW HAVISD  +  + A CDF   +      C  A+ E  
Sbjct  217   LMVGNALMDDETDQTGMIDYAWDHAVISDRVYGDVKARCDFGMANV--TDACDAALQEYF  274

Query  892   KQYKEIDIYSLYTSVCIDSLTGSGDNSTPV---------FKTTSKMMPRIM--AGYDPCL  1038
               Y+ ID+YSLYT VC D  + S   +  V         F    +    IM  AGYDPC 
Sbjct  275   AVYRLIDMYSLYTPVCTDPASSSAPYARKVAVHGAAPGIFSRYVRCRGWIMKPAGYDPCT  334

Query  1039  DDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRI  1218
              +Y++ Y+NR DVQ ALH +      +W  C+ +++  W+D+  S LP+ +KL+A G+R+
Sbjct  335   AEYSEVYFNRPDVQAALHANVTKIGYNWTRCSDAIYT-WNDAAFSTLPVIRKLVAGGLRL  393

Query  1219  WVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGH  1398
             WV+SGDTDGR+PV STR ++  LGL   +EW PWY   QVGGW   YEGLTF T RGAGH
Sbjct  394   WVFSGDTDGRIPVTSTRLTLHKLGLKTVQEWTPWYDHLQVGGWTIVYEGLTFVTIRGAGH  453

Query  1399  AVPTFKP  1419
              VP + P
Sbjct  454   EVPLYAP  460



>ref|XP_010231680.1| PREDICTED: serine carboxypeptidase-like 33 [Brachypodium distachyon]
Length=476

 Score =   448 bits (1153),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 217/438 (50%), Positives = 301/438 (69%), Gaps = 12/438 (3%)
 Frame = +1

Query  130   SLSSNKEQSDQSWASEDLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYESSSLPD  306
             S++++   S++  A  D VA+LPGQP       ++GYVTV+E +GR LFYW +++ + P+
Sbjct  23    SMAASSAGSEEQEA--DRVAHLPGQPESPGVTQFSGYVTVDERHGRALFYWFFQAQASPE  80

Query  307   EKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVG  486
             +KPL LWLNGGPGCSSIGYGA  E+GP  V     +L  N Y+WN+EANLLFLESP  VG
Sbjct  81    QKPLFLWLNGGPGCSSIGYGAASELGPLRVVKQGQALEFNKYAWNQEANLLFLESPAWVG  140

Query  487   FSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEII  666
             FSY+NTS+D + L DDF A D+Y+FL  WF +FP YK R FYI+GESYAG YVP+LA+++
Sbjct  141   FSYTNTSSDLSKLDDDFVAEDSYSFLVNWFKRFPQYKGREFYISGESYAGHYVPQLADLV  200

Query  667   VDRNKDP--SLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNS  840
              +RNKD   +++I+L+G ++GNP T D  D +G+ +YAWSH V+SD+ +  I   CDF +
Sbjct  201   YERNKDKMSNIYINLKGFMVGNPITDDHYDSKGLAEYAWSHTVVSDQVYERINTKCDFKT  260

Query  841   NDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMM----P  1008
             ++ W++ DC+ A+N +  QY+EIDIY++Y   C+  L  S     P F +  +       
Sbjct  261   SN-WTD-DCNAAMNVIFGQYREIDIYNIYAPKCLLDLNSSSSTDRPFFVSNQEAQFGKRR  318

Query  1009  RIMAGYDPCLDDYAKSYYNRLDVQKALHVS-SGHHLRDWRICNMSVFDGWSDSKESVLPI  1185
             RI +GYDPC   YA+ Y+NR ++QKA H + SG     +++C+  + + ++ S  SVLPI
Sbjct  319   RIFSGYDPCYSSYAQDYFNRKELQKAFHANVSGSLPGKYQVCSDPILNSYNFSVFSVLPI  378

Query  1186  YKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEG  1365
             Y KLI AG+RIW+YSGD DGRVPV+ +RY +  LGLPI   W+PWY +KQV G   EY+G
Sbjct  379   YFKLIKAGLRIWLYSGDADGRVPVIGSRYCVEALGLPIKTPWQPWYLEKQVAGRFVEYDG  438

Query  1366  LTFATFRGAGHAVPTFKP  1419
             ++  T RGAGH VP  KP
Sbjct  439   MSMVTVRGAGHLVPLNKP  456



>ref|XP_009792407.1| PREDICTED: serine carboxypeptidase 24-like [Nicotiana sylvestris]
Length=468

 Score =   448 bits (1152),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 221/416 (53%), Positives = 290/416 (70%), Gaps = 8/416 (2%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D + +LPGQP V F  ++GYVTVNEN+GR LFYWL E+++ P++KPLVLWLNGGPGCSS+
Sbjct  40    DRIISLPGQPPVTFSQFSGYVTVNENHGRALFYWLTEATTQPEKKPLVLWLNGGPGCSSV  99

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
              YGA++EIGPF ++   SSL +N YSWNK AN+LFLESP GVGFSY+NTS+D  + GD  
Sbjct  100   AYGASEEIGPFRINKTGSSLYLNKYSWNKVANILFLESPAGVGFSYTNTSSDLKDSGDKR  159

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKD-PSLFIDLRGI  714
              A DA  FL  W  +FP YK R FYI+GESYAG Y P+LA+ IV+ NK  P   I+L+GI
Sbjct  160   TAQDALIFLIRWMSRFPQYKYRDFYISGESYAGHYGPQLAQAIVNYNKKFPHPIINLKGI  219

Query  715   LLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVN-ELL  891
             ++GN  T +  D  G V Y WSH++ISD T++ I+ SC+F S +  S++ C  AV   + 
Sbjct  220   IVGNAVTDNKYDGIGTVTYWWSHSMISDNTYKKIMHSCNFTSEN--SSKQCDNAVTYAVS  277

Query  892   KQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSYYNRL  1071
              ++ +ID YS+YT  C   +  +       FK T  ++ R ++GYDPC ++YA+ YYNR 
Sbjct  278   HEFGQIDQYSIYTPSC--KVEQNETQKYVRFKNT--IIHRKLSGYDPCTENYAEKYYNRA  333

Query  1072  DVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGRV  1251
             DVQKA+H ++      W  C+  +   W DS +S+LPIYKKL+AAG+RIWV+SGDTD  V
Sbjct  334   DVQKAMHANTTGISYSWTACSDILLKNWKDSDDSMLPIYKKLMAAGLRIWVFSGDTDSVV  393

Query  1252  PVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             PV +TR+S+S L L I   W PWY   QVGGW + Y+GLTFAT RGAGH VP F+P
Sbjct  394   PVTATRFSLSHLNLKIKTPWYPWYSGSQVGGWTEVYDGLTFATVRGAGHEVPLFQP  449



>ref|XP_008643436.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 gb|AFW72466.1| hypothetical protein ZEAMMB73_705736 [Zea mays]
Length=479

 Score =   448 bits (1153),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 223/424 (53%), Positives = 279/424 (66%), Gaps = 13/424 (3%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D VA LPGQP V F  YAGYVTVNE +GR LFYW +E+++ PD+KPLVLWLNGGPGCSSI
Sbjct  37    DRVAGLPGQPPVGFAQYAGYVTVNETHGRALFYWFFEATASPDKKPLVLWLNGGPGCSSI  96

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYG  +E+GPFLV   +  L  N YSWN EANL+FLESPVGVGFSY+NTS+D   LGD  
Sbjct  97    GYGEAEELGPFLVQKGKPELRWNNYSWNTEANLMFLESPVGVGFSYTNTSSDLLQLGDKI  156

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNK--DPSLFIDLRG  711
              A+DAY FL  WF +FP YK+  FYIAGESYAG YVP+L+E I D N+       ++L+G
Sbjct  157   TADDAYKFLLNWFKRFPQYKSHDFYIAGESYAGHYVPQLSEKIFDGNRAGHKESHVNLKG  216

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELL  891
             +++GN    D  D  GM+DYAW HAVISD  +  + A CDF   +      C  A+ E  
Sbjct  217   LMVGNALMDDETDQTGMIDYAWDHAVISDRVYGDVKARCDFGMANV--TDACDAALQEYF  274

Query  892   KQYKEIDIYSLYTSVCIDSLTGSGD--NSTPVFKTTSKMMPR----IM--AGYDPCLDDY  1047
               Y+ ID+YSLYT VC D  + S        V      +  R    IM  AGYDPC  +Y
Sbjct  275   AVYRLIDMYSLYTPVCTDPASSSAPYARKVAVHGAAPGIFSRYRGWIMKPAGYDPCTAEY  334

Query  1048  AKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVY  1227
             ++ Y+NR DVQ ALH +      +W  C+ +++  W+D+  S LP+ +KL+A G+R+WV+
Sbjct  335   SEVYFNRPDVQAALHANVTKIGYNWTRCSDAIYT-WNDAAFSTLPVIRKLVAGGLRLWVF  393

Query  1228  SGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVP  1407
             SGDTDGR+PV STR ++  LGL   +EW PWY   QVGGW   YEGLTF T RGAGH VP
Sbjct  394   SGDTDGRIPVTSTRLTLHKLGLKTVQEWTPWYDHLQVGGWTIVYEGLTFVTIRGAGHEVP  453

Query  1408  TFKP  1419
              + P
Sbjct  454   LYAP  457



>emb|CDP18632.1| unnamed protein product [Coffea canephora]
Length=486

 Score =   449 bits (1154),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 221/423 (52%), Positives = 286/423 (68%), Gaps = 12/423 (3%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP V+FK YAGY+TVNE +GR LFYW +E++  P++KPL+LWLNGGPGCSSI
Sbjct  46    DRVVQLPGQPWVHFKQYAGYITVNETHGRALFYWFFEATRNPEKKPLLLWLNGGPGCSSI  105

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYG  +E+GPFL    +  L +N  SWN+ ANLLFLESPVGVGFSY+NTSTD   LGD  
Sbjct  106   GYGEAEELGPFLSQKGKPELKLNKNSWNRVANLLFLESPVGVGFSYTNTSTDIKELGDTI  165

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPS--LFIDLRG  711
              A D+Y FL  WF +FP +K+  FYIAGESYAG YVP+L+E+I D N+  S   +I+ +G
Sbjct  166   TAQDSYIFLVNWFKRFPQFKSHDFYIAGESYAGHYVPQLSELIYDNNEKVSKKTYINFKG  225

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELL  891
             +++GN    D  D +G++DYA+ HAVISD+ +  I   C+F++      +DC+ A+ +  
Sbjct  226   LMVGNALLDDETDQRGLIDYAYDHAVISDQLYNEIKGKCNFSTEHL--PKDCNDALGKYF  283

Query  892   KQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRI------MAGYDPCLDDYAK  1053
               YK ID+YSLY   C+ S + S      V     K+  +I       AGYDPC  DY +
Sbjct  284   DVYKIIDMYSLYAPTCVKSNSTSIRKLPVVRGAAPKLFSQIDGWHRKPAGYDPCASDYTE  343

Query  1054  SYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSG  1233
              Y NR DVQK+LH +       W  C+ ++   WSD+  S+LPI KKLI  G+R+WV+SG
Sbjct  344   LYLNRPDVQKSLHANVTKIPYKWTHCSDNI-TFWSDAPASILPIIKKLIDGGLRVWVFSG  402

Query  1234  DTDGRVPVLSTRYSISTLGLPITREWRPWY-HQKQVGGWVQEYEGLTFATFRGAGHAVPT  1410
             DTDGR+PV STRY++   GL IT++W PWY   KQVGGW  +Y+GLTF T RGAGH VPT
Sbjct  403   DTDGRIPVTSTRYTLKKFGLKITQDWTPWYTFHKQVGGWTVQYDGLTFVTVRGAGHQVPT  462

Query  1411  FKP  1419
             FKP
Sbjct  463   FKP  465



>ref|XP_009590151.1| PREDICTED: serine carboxypeptidase-like 33 isoform X2 [Nicotiana 
tomentosiformis]
Length=478

 Score =   448 bits (1153),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 223/429 (52%), Positives = 292/429 (68%), Gaps = 16/429 (4%)
 Frame = +1

Query  175   EDLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCS  351
             +D V  LPGQP       ++GY+TVN+ NGR LFYW + S S   +KPL+LWLNGGPGCS
Sbjct  32    DDKVTELPGQPTSPQVSQFSGYITVNKTNGRALFYWFFPSQSESSKKPLLLWLNGGPGCS  91

Query  352   SIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             S+GYGA  E+GP LV ++   L  N YSWNKEANLLFLESPVGVGFSY+NTS+D  NL D
Sbjct  92    SVGYGAAVELGPLLVKNNGDGLDFNIYSWNKEANLLFLESPVGVGFSYTNTSSDLTNLDD  151

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDL  705
             +F+A DAY FL  W  +FP +K R F+I+GESYAG YVP+LAE++ +RNKD     +I+L
Sbjct  152   NFSAEDAYNFLVNWLERFPEFKNREFFISGESYAGHYVPQLAELVYNRNKDSKKYPYINL  211

Query  706   RGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNE  885
             +G ++GNPET+D  D++G+++YAWSHAVI D  +      CDF  ++ WS+  C+ A+  
Sbjct  212   KGFIVGNPETNDYYDYKGILEYAWSHAVIYDSEYEKAKQVCDFKLSN-WSDA-CNDAMKV  269

Query  886   LLKQYKEIDIYSLYTSVCIDS-------LTGSGDNSTPV--FKTTSKMMPRIMAGYDPCL  1038
             +  +Y+EIDIY++Y   C+ +       LT SG  S+ +       + M RI  GYDPC 
Sbjct  270   VWDKYEEIDIYNIYAPKCLRNSSSSSASLTVSGHESSKLKALNHAFRRMKRIPGGYDPCY  329

Query  1039  DDYAKSYYNRLDVQKALHVSS-GHHLR-DWRICNMSVFDGWSDSKESVLPIYKKLIAAGI  1212
               + + Y+NRLDVQ ALH +S G H R  W+ C+  VF  ++ +  SVLPIYKKLI  G+
Sbjct  330   TAFTEEYFNRLDVQIALHANSEGRHTRVKWQSCSDPVFQKYNYNVFSVLPIYKKLIQGGL  389

Query  1213  RIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGA  1392
             +IW++SGD DGRVPV+ TRY I  L L +  EW  W+H  QV G + EYEGLTF T RGA
Sbjct  390   KIWIFSGDADGRVPVIGTRYCIEALNLTLKSEWHSWFHNHQVAGRIVEYEGLTFVTVRGA  449

Query  1393  GHAVPTFKP  1419
             GH VP +KP
Sbjct  450   GHLVPLYKP  458



>ref|XP_010918382.1| PREDICTED: serine carboxypeptidase-like 34 isoform X1 [Elaeis 
guineensis]
Length=484

 Score =   448 bits (1153),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 217/426 (51%), Positives = 287/426 (67%), Gaps = 13/426 (3%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP+V+F+ +AGYVTVNE++GR LFYW +E++   ++KPL+LWLNGGPGCSSI
Sbjct  39    DRVVRLPGQPLVSFQQFAGYVTVNESHGRALFYWFFEATHDVEKKPLLLWLNGGPGCSSI  98

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYG  +E+GPFL+      L  N YSWNKEANLLFLESPVGVGFSY+NTS+D   LGD+ 
Sbjct  99    GYGEAEELGPFLMQKGVPELKFNKYSWNKEANLLFLESPVGVGFSYTNTSSDLRQLGDEI  158

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLRG  711
              A DAY FL  WF +FP YK+  FYIAGESY G YVP+LAE I D NK+ +    I+ +G
Sbjct  159   TAIDAYTFLVNWFKRFPQYKSHDFYIAGESYGGHYVPQLAEKIFDENKNLAKEDQINFKG  218

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNS---NDTWSNQDCSQAVN  882
              ++GN    D  D  GM+DYAW HAVISD+ +  +  SC+F+        +++ C+ A+N
Sbjct  219   FMIGNALLDDDTDQTGMIDYAWDHAVISDQVYHDVKKSCNFSEVPVTRAPASKACNNALN  278

Query  883   ELLKQYKEIDIYSLYTSVCIDSLTGSG-------DNSTPVFKTTSKMMPRIMAGYDPCLD  1041
             E    Y  ID+YSLY   C+   T +        + + P   +  +   +  AGYDPC+ 
Sbjct  279   EYFAVYHIIDMYSLYAPDCVHQNTSTFMRKSFWIEGAAPKLFSKYRGWHQKPAGYDPCVS  338

Query  1042  DYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIW  1221
             DY + Y+NR DVQ+ALH +      +W  C+  V   W+DS  ++LP+ +KLI  G+R+W
Sbjct  339   DYTEVYFNRPDVQEALHANVTKMAYNWTHCS-DVITVWNDSPSTMLPVIRKLINGGLRVW  397

Query  1222  VYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHA  1401
             VYSGDTDGR+PV  TRY+++ LGL   ++W+PWY+ +QVGGW   +EGLTF T RGAGH 
Sbjct  398   VYSGDTDGRLPVTGTRYTLNKLGLKTIQKWKPWYNHQQVGGWTIIFEGLTFVTIRGAGHQ  457

Query  1402  VPTFKP  1419
             VPTF P
Sbjct  458   VPTFAP  463



>ref|XP_009114428.1| PREDICTED: serine carboxypeptidase-like 33 [Brassica rapa]
Length=474

 Score =   448 bits (1152),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 223/423 (53%), Positives = 290/423 (69%), Gaps = 13/423 (3%)
 Frame = +1

Query  178   DLVANLPGQPI-VNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             D V NLP QP      H++GYV VN+ N R LF+W +E+ S    +PLVLWLNGGPGCSS
Sbjct  36    DKVVNLPEQPSNPKISHFSGYVNVNQENTRALFFWFFEALSEDPTRPLVLWLNGGPGCSS  95

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             IGYGA  E+GPF V  + +SL  N YSW +EAN+LFLESPVGVGFSY+NTS+D  NL D 
Sbjct  96    IGYGAASELGPFRVVENGTSLRFNQYSWVQEANMLFLESPVGVGFSYTNTSSDLDNLNDS  155

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRN--KDPSLFIDLR  708
             F A+DAY F+  WF ++P YK+R F+IAGESYAG Y P+LAE I DRN  K    FI+L+
Sbjct  156   FVADDAYNFMVAWFARYPQYKSRDFFIAGESYAGHYAPQLAEQIYDRNKVKPKESFINLK  215

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G ++GNP T D  D +G+++YAWSHAVISD  + T   +CDF S++ WS + C+ A+N +
Sbjct  216   GFIVGNPLTDDKYDNKGILEYAWSHAVISDNLYDTAKRNCDFKSSN-WS-EPCNVAMNTM  273

Query  889   LKQYKEIDIYSLYTSVCIDSLTGSGD-----NSTPVFKTTSKMMPRIMAGYDPCLDDYAK  1053
              ++YKEIDIY++Y   C  S + +       N +P  K   K + R   GYDPC  DYA+
Sbjct  274   FQKYKEIDIYNIYAPKCTTSNSSAASFLGVFNKSPAMKDWFKRV-RWFEGYDPCYSDYAE  332

Query  1054  SYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSG  1233
              Y+NR+DV+ +LH ++   +  W++CN S+   +  +  S+LP Y KLI AG++IWVYSG
Sbjct  333   KYFNRVDVRTSLHATT-RGVSRWKVCNDSILQTYQFTVSSMLPTYSKLIKAGLKIWVYSG  391

Query  1234  DTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYE-GLTFATFRGAGHAVPT  1410
             D DGRVPV+ +RY +  LGLP+  EWR W+H  QVGG + EYE GLTF T RGAGH VP 
Sbjct  392   DADGRVPVIGSRYCVEALGLPVKSEWRSWFHNHQVGGRITEYEGGLTFVTVRGAGHLVPL  451

Query  1411  FKP  1419
              KP
Sbjct  452   NKP  454



>ref|XP_002452495.1| hypothetical protein SORBIDRAFT_04g026900 [Sorghum bicolor]
 gb|EES05471.1| hypothetical protein SORBIDRAFT_04g026900 [Sorghum bicolor]
Length=475

 Score =   447 bits (1151),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 224/426 (53%), Positives = 279/426 (65%), Gaps = 15/426 (4%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D VA LPGQP V F  YAGYVTVNE +GR LFYW +E++S PD+KPLVLWLNGGPGCSSI
Sbjct  31    DRVAGLPGQPPVGFAQYAGYVTVNETHGRALFYWFFEATSSPDKKPLVLWLNGGPGCSSI  90

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYG  +E+GPFLV   +  L  N YSWN EANL+FLESPVGVGFSY+NTS+D   LGD  
Sbjct  91    GYGEAEELGPFLVQKGKPELRWNNYSWNTEANLMFLESPVGVGFSYTNTSSDLQQLGDKI  150

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNK--DPSLFIDLRG  711
              A+DAY FL  WF +FP YK+  FYIAGESYAG YVP+L+E I D N+      +I+ +G
Sbjct  151   TADDAYKFLLNWFKRFPQYKSHDFYIAGESYAGHYVPQLSEKIFDGNRAGPKESYINFKG  210

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELL  891
             +++GN    D  D  GM+DYAW HAVISD  +  + A CDF   +      C  A+ E  
Sbjct  211   LMVGNALMDDETDQTGMIDYAWDHAVISDRVYGDVKAKCDFAMVNV--TDACDAALQEYF  268

Query  892   KQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIM----------AGYDPCLD  1041
               Y+ ID+YSLYT VC D  + +  +++          PRI           AGYDPC  
Sbjct  269   AVYRLIDMYSLYTPVCTDPGSSASASASHRKVAVHGAAPRIFSKYRGWIMKPAGYDPCTA  328

Query  1042  DYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIW  1221
             +YA+ Y+NR DVQ ALH +      +W  C+  V   W+D+  S LPI +KL+A G+R+W
Sbjct  329   EYAEVYFNRPDVQAALHANVTKIGYNWTHCS-DVIGTWNDAAFSTLPIIRKLVAGGLRVW  387

Query  1222  VYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHA  1401
             V+SGDTDGR+PV +TR +++ LGL   +EW PWY + QVGGW   YEGLTF T RGAGH 
Sbjct  388   VFSGDTDGRIPVTATRLTLNKLGLKTVQEWTPWYDRLQVGGWTIVYEGLTFVTIRGAGHE  447

Query  1402  VPTFKP  1419
             VP   P
Sbjct  448   VPLHAP  453



>ref|XP_009765688.1| PREDICTED: serine carboxypeptidase-like 33 isoform X1 [Nicotiana 
sylvestris]
Length=481

 Score =   448 bits (1152),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 225/432 (52%), Positives = 294/432 (68%), Gaps = 19/432 (4%)
 Frame = +1

Query  175   EDLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCS  351
             +D V  LPGQP       ++GY+TVN+ NGR LFYW + S S   +KPL+LWLNGGPGCS
Sbjct  32    DDKVTKLPGQPTTPQVSQFSGYITVNKTNGRALFYWFFPSQSESFKKPLLLWLNGGPGCS  91

Query  352   SIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             S+GYGA  E+GP LV ++ + L  N YSWNKEANLLFLESPVGVGFSY+NTS+D  NL D
Sbjct  92    SVGYGAAVELGPLLVKNNGAGLDFNSYSWNKEANLLFLESPVGVGFSYTNTSSDLTNLDD  151

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDL  705
             DFAA DAY FL  W  +FP +K R F+I+GESYAG YVP+LAE++ +RNKD     +I+L
Sbjct  152   DFAAEDAYNFLVNWLERFPEFKNREFFISGESYAGHYVPQLAELVYNRNKDSKKYPYINL  211

Query  706   RGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNE  885
             +G+++GNPET+D  D++G+++YAWSHAVI D  +      CDFN ++ WS+  C+ A+  
Sbjct  212   KGLIVGNPETNDYYDYKGILEYAWSHAVIYDSQYEKAKQVCDFNLSN-WSDA-CNAAMKV  269

Query  886   LLKQYKEIDIYSLYTSVCIDS--------LTGSGDNSTPV----FKTTSKMMPRIMAGYD  1029
             +  +Y+EIDIY++Y   C+ +        L  SG  S+ +         + M RI  GYD
Sbjct  270   VWDKYEEIDIYNIYAPKCLRNTSSSSSASLAVSGHESSKLKLQALNYGFRRMKRIPGGYD  329

Query  1030  PCLDDYAKSYYNRLDVQKALHVSS-GHHLR-DWRICNMSVFDGWSDSKESVLPIYKKLIA  1203
             PC   + + Y+NRLDVQ ALH +S G H R  W+ C+  VF  ++ +  SVLPIYKKLI 
Sbjct  330   PCYTAFTEEYFNRLDVQIALHANSEGRHTRVKWQSCSDPVFQKYNYNVFSVLPIYKKLIQ  389

Query  1204  AGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATF  1383
              G++IW++SGD DGRVPV+ TRY I  L L +  EW  W+H  QV G + EYEGLTF T 
Sbjct  390   GGLKIWIFSGDADGRVPVIGTRYCIEALNLTLKSEWHSWFHNHQVAGRIVEYEGLTFVTV  449

Query  1384  RGAGHAVPTFKP  1419
             RGAGH VP +KP
Sbjct  450   RGAGHLVPLYKP  461



>ref|XP_002310649.2| hypothetical protein POPTR_0007s07690g [Populus trichocarpa]
 gb|EEE91099.2| hypothetical protein POPTR_0007s07690g [Populus trichocarpa]
Length=474

 Score =   447 bits (1150),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 222/434 (51%), Positives = 288/434 (66%), Gaps = 14/434 (3%)
 Frame = +1

Query  145   KEQSDQSWASE--DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPL  318
             +E SD   A    D V NLPGQP V F+HYAGYV +   N R LFYW +E+     +KPL
Sbjct  24    REISDGEEARREADRVTNLPGQPQVRFQHYAGYVKLGPQNQRALFYWFFEAKEDASQKPL  83

Query  319   VLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYS  498
             VLWLNGGPGCSSI YGA QE+GPFLV  + + L +N YSWNK AN+LFLE+PVGVGFSY+
Sbjct  84    VLWLNGGPGCSSIAYGAAQELGPFLVRGNGTQLVLNKYSWNKAANMLFLEAPVGVGFSYT  143

Query  499   NTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRN  678
             N S D   LGD   A+D++ FL  WF +FP++K+  FYIAGESYAG YVP+LAE+I +RN
Sbjct  144   NNSEDLYKLGDKVTADDSHTFLINWFKRFPNFKSHDFYIAGESYAGHYVPQLAELIYERN  203

Query  679   K--DPSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTW  852
             K    S +I+L+G ++GN   +D  D  G+VDYAWSHA+ISD+ +   I  CD   + T 
Sbjct  204   KGATKSSYINLKGFMIGNAVINDETDSAGIVDYAWSHAIISDQLYHN-IKECDHQGSVT-  261

Query  853   SNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPV----FKTTSKMMPRIMA  1020
                +C        + Y +IDIYS+YT VC+   +    +   V          ++ R+ +
Sbjct  262   --NECVVHYRGFAEAYSDIDIYSIYTPVCLSEYSTRISSRLVVAPRLLSKLHDLVHRLPS  319

Query  1021  GYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLI  1200
             GYDPC +DYA+ ++NR DVQKALH +       +  C+ ++   W+DS E++LPI +KL+
Sbjct  320   GYDPCTEDYAEKFFNREDVQKALHANVTKLSYPYTPCSNAI-RKWNDSAETILPIIQKLL  378

Query  1201  AAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYE-GLTFA  1377
              AG+RIW+YSGDTDGRVPV STRYSI  +GL +  EWR W+H+ QV GWV+ YE GL  A
Sbjct  379   NAGLRIWIYSGDTDGRVPVTSTRYSIKKMGLKVNEEWRAWFHKSQVAGWVETYERGLVLA  438

Query  1378  TFRGAGHAVPTFKP  1419
             T RGAGH VP F P
Sbjct  439   TIRGAGHQVPVFAP  452



>ref|XP_009590149.1| PREDICTED: serine carboxypeptidase-like 33 isoform X1 [Nicotiana 
tomentosiformis]
Length=480

 Score =   447 bits (1150),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 223/431 (52%), Positives = 292/431 (68%), Gaps = 18/431 (4%)
 Frame = +1

Query  175   EDLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCS  351
             +D V  LPGQP       ++GY+TVN+ NGR LFYW + S S   +KPL+LWLNGGPGCS
Sbjct  32    DDKVTELPGQPTSPQVSQFSGYITVNKTNGRALFYWFFPSQSESSKKPLLLWLNGGPGCS  91

Query  352   SIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             S+GYGA  E+GP LV ++   L  N YSWNKEANLLFLESPVGVGFSY+NTS+D  NL D
Sbjct  92    SVGYGAAVELGPLLVKNNGDGLDFNIYSWNKEANLLFLESPVGVGFSYTNTSSDLTNLDD  151

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDL  705
             +F+A DAY FL  W  +FP +K R F+I+GESYAG YVP+LAE++ +RNKD     +I+L
Sbjct  152   NFSAEDAYNFLVNWLERFPEFKNREFFISGESYAGHYVPQLAELVYNRNKDSKKYPYINL  211

Query  706   RGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNE  885
             +G ++GNPET+D  D++G+++YAWSHAVI D  +      CDF  ++ WS+  C+ A+  
Sbjct  212   KGFIVGNPETNDYYDYKGILEYAWSHAVIYDSEYEKAKQVCDFKLSN-WSDA-CNDAMKV  269

Query  886   LLKQYKEIDIYSLYTSVCIDS-------LTGSGDNSTPV----FKTTSKMMPRIMAGYDP  1032
             +  +Y+EIDIY++Y   C+ +       LT SG  S+ +         + M RI  GYDP
Sbjct  270   VWDKYEEIDIYNIYAPKCLRNSSSSSASLTVSGHESSKLKLQALNHAFRRMKRIPGGYDP  329

Query  1033  CLDDYAKSYYNRLDVQKALHVSS-GHHLR-DWRICNMSVFDGWSDSKESVLPIYKKLIAA  1206
             C   + + Y+NRLDVQ ALH +S G H R  W+ C+  VF  ++ +  SVLPIYKKLI  
Sbjct  330   CYTAFTEEYFNRLDVQIALHANSEGRHTRVKWQSCSDPVFQKYNYNVFSVLPIYKKLIQG  389

Query  1207  GIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFR  1386
             G++IW++SGD DGRVPV+ TRY I  L L +  EW  W+H  QV G + EYEGLTF T R
Sbjct  390   GLKIWIFSGDADGRVPVIGTRYCIEALNLTLKSEWHSWFHNHQVAGRIVEYEGLTFVTVR  449

Query  1387  GAGHAVPTFKP  1419
             GAGH VP +KP
Sbjct  450   GAGHLVPLYKP  460



>ref|XP_002280311.1| PREDICTED: serine carboxypeptidase-like 33 isoform X1 [Vitis 
vinifera]
 emb|CBI22846.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   447 bits (1149),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 222/423 (52%), Positives = 288/423 (68%), Gaps = 12/423 (3%)
 Frame = +1

Query  160   QSWASEDLVANLPGQPIVN-FKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNG  336
             +S    D + NLPGQP       ++GY+TVN+ +GR LFYW +E+ S P  +PL+LWLNG
Sbjct  36    ESSQENDRIINLPGQPSSPPITQFSGYITVNKAHGRALFYWFFEAQSQPSNRPLLLWLNG  95

Query  337   GPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDY  516
             GPGCSSIGYGA  E+GP  V  +   L  N ++WNKEANLLF+ESPVGVGFSY+NTS+D 
Sbjct  96    GPGCSSIGYGAAVELGPLRVSKNGDGLHFNDFAWNKEANLLFVESPVGVGFSYTNTSSDL  155

Query  517   ANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSLF  696
               L D F A DAY FL  W  +FP YK   F+I+GESYAG YVP+LAE++ DRNKD + +
Sbjct  156   TKLTDGFVAEDAYNFLVNWLKRFPQYKAHDFFISGESYAGHYVPQLAELVYDRNKDRTKY  215

Query  697   --IDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCS  870
               I+L+G ++GNPET+D  D++G+++YAWSHAVISD+ +      CDF   D WS++ C 
Sbjct  216   PLINLKGFIVGNPETNDYYDYKGLLEYAWSHAVISDQLYYKSKQVCDFKVAD-WSSE-CI  273

Query  871   QAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYA  1050
               +N++   Y+EIDIY++Y   C+ + T S   S  +     + M R+  GYDPC   YA
Sbjct  274   TNMNKVFDDYREIDIYNIYAPSCLLNTTSS---SAELNGNGFRRM-RVPGGYDPCFSIYA  329

Query  1051  KSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYS  1230
               Y+NR DV+ ALH ++  H + W +C+ SVF  +  +  SVLPIY KLI AG+RIWVYS
Sbjct  330   AEYFNRPDVKLALHAAT--HTK-WEVCSDSVFHAYHYTVFSVLPIYTKLIKAGLRIWVYS  386

Query  1231  GDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPT  1410
             GDTDGRVP + TRY +  LGLP+   WR WYH  QVGG + EYEGLT+ T RGAGH VP 
Sbjct  387   GDTDGRVPAIGTRYCVEALGLPLKAPWRSWYHHHQVGGRIVEYEGLTYLTVRGAGHLVPL  446

Query  1411  FKP  1419
              KP
Sbjct  447   NKP  449



>ref|XP_010491452.1| PREDICTED: serine carboxypeptidase-like 35 [Camelina sativa]
Length=477

 Score =   447 bits (1149),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 219/431 (51%), Positives = 281/431 (65%), Gaps = 7/431 (2%)
 Frame = +1

Query  145   KEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVN-ENNGRRLFYWLYESSSLPDEKPLV  321
             K  +      +DLV  LPGQP VNFKHYAGYV +  E   + LFYW +E+      +PLV
Sbjct  27    KATASSGRKEDDLVTGLPGQPPVNFKHYAGYVNLGPEQKQKALFYWFFEAQQNSSRRPLV  86

Query  322   LWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSN  501
             LWLNGGPGCSSI YGA QE+GPFLV ++ S+LT N +SWNKEAN+LFLE+PVGVGFSY+N
Sbjct  87    LWLNGGPGCSSIAYGAAQELGPFLVHTNSSNLTYNDFSWNKEANMLFLEAPVGVGFSYTN  146

Query  502   TSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNK  681
              S D   LGD   A D+  FL  WF+KFP +++  FYI+GESYAG YVP+LAE I DRNK
Sbjct  147   NSMDLQKLGDKVTAADSLVFLINWFMKFPEFRSNEFYISGESYAGHYVPQLAEAIYDRNK  206

Query  682   DPSL--FIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWS  855
               +    I+L+G ++GN   ++  D  G+VDYAWSHA+ISDE H  I  SC F    T  
Sbjct  207   KVTKDSHINLKGFMIGNAVINEATDMVGLVDYAWSHAIISDEVHTNIHGSCRFEEETTNK  266

Query  856   NQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDN--STPVFKTTSKMMPRIMAGYD  1029
              + C       +  Y +IDIYS+YT VC+ S +        +P   T+  M   + AGYD
Sbjct  267   TEQCYNNFKGFMDAYSDIDIYSIYTPVCLSSSSTRKPKIVVSPRLLTSDDMWDTLPAGYD  326

Query  1030  PCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAG  1209
             PC + YA++Y+NR DVQ ALH +  +    +  C+  V   W+D+  +++PI +KL+  G
Sbjct  327   PCTEGYAENYFNRKDVQVALHANVTNLPYPYSPCS-DVIRKWNDAPSTMIPIIQKLLTGG  385

Query  1210  IRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYE-GLTFATFR  1386
             +RIW+YSGDTDGRVPV STRYSI  +GL +   WR W+ + QV GWV+ Y  GLTF T R
Sbjct  386   LRIWIYSGDTDGRVPVTSTRYSIKKMGLKVELPWRSWFDKSQVAGWVETYAGGLTFVTVR  445

Query  1387  GAGHAVPTFKP  1419
             GAGH VP F P
Sbjct  446   GAGHQVPAFAP  456



>ref|XP_009130122.1| PREDICTED: serine carboxypeptidase-like 34 [Brassica rapa]
Length=503

 Score =   447 bits (1151),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 221/433 (51%), Positives = 297/433 (69%), Gaps = 22/433 (5%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             DLV  LPGQP V F+ YAGYVTVNE +GR LFYW +E++  P++KPL+LWLNGGPGCSS+
Sbjct  53    DLVKELPGQPPVKFRQYAGYVTVNETHGRALFYWFFEATHNPNKKPLLLWLNGGPGCSSV  112

Query  358   GYGATQEIGPFL-VDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             G+GA++E+GPF   +S + +L +NPYSWNK ANLLFLESPVGVGFSYSNTS D + LGD 
Sbjct  113   GFGASEELGPFFPQNSTQPNLRLNPYSWNKAANLLFLESPVGVGFSYSNTSRDISQLGDT  172

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNK--DPSLFIDLR  708
               A+D+Y FL  WF +FP YK+R FYIAGESYAG YVP+L+E+I ++NK      FI+L+
Sbjct  173   VTASDSYNFLVNWFKRFPQYKSRDFYIAGESYAGHYVPQLSELIYNQNKIAPKKDFINLK  232

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G+++GN    D  D +GM+DYA+ HAVISD  ++ +   CDF       +++C  A++E 
Sbjct  233   GLMIGNALLDDETDQKGMIDYAYDHAVISDGLYQRVNEHCDFRLAHV--SKECDGALDEY  290

Query  889   LKQYKEIDIYSLYTSVCI-----DSLTGSGDNSTPVFKTTSKMMPRIM----------AG  1023
                YK +D+YSLY+  C+      S++ S   S  +        PR++          AG
Sbjct  291   FDVYKILDMYSLYSPRCVPTTENSSISHSVAGSRHLPAARGIFRPRLVSNNEGWRKMAAG  350

Query  1024  YDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIA  1203
             YDPC  DY + Y NR DVQ+ALH +  +    W  C+  +   W+D+  S+LP  + L++
Sbjct  351   YDPCASDYTEKYMNRRDVQEALHANVTNLSYPWTHCSDHI-SFWADAPASMLPTLRTLVS  409

Query  1204  AGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWY-HQKQVGGWVQEYEGLTFAT  1380
             AG+R+WV+SGDTDGR+PV +TRYS+  LGL   ++W PWY +++QVGGW  EY+GL F T
Sbjct  410   AGLRVWVFSGDTDGRIPVTATRYSLKKLGLKTVQDWTPWYTNKQQVGGWTVEYDGLMFVT  469

Query  1381  FRGAGHAVPTFKP  1419
              RGAGH VPTFKP
Sbjct  470   VRGAGHQVPTFKP  482



>emb|CBI27154.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   446 bits (1148),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 218/420 (52%), Positives = 288/420 (69%), Gaps = 8/420 (2%)
 Frame = +1

Query  175   EDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             +D V +LPGQP V F+HYAGYV +   + + LFYW +E+     EKPLVLWLNGGPGCSS
Sbjct  34    KDRVKDLPGQPAVEFRHYAGYVKLRPQDEKALFYWFFEAQGGVLEKPLVLWLNGGPGCSS  93

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             I YGA QE+GPFLV S+ + L +N +SWNK AN+LFLE+PVGVGFSY+N S+D   LGD 
Sbjct  94    IAYGAAQELGPFLVRSNGTKLILNDFSWNKVANILFLEAPVGVGFSYTNKSSDLLKLGDR  153

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPS--LFIDLR  708
               A D++AFL +WF +FPS KT  FYI GESYAG YVP+LAE+I +RNK  S   +I+L+
Sbjct  154   ITAEDSHAFLVQWFKRFPSLKTHDFYITGESYAGHYVPQLAELIYERNKRSSKDFYINLK  213

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G ++GN   +D  D  G++++AWSHA+ISD+ +  I+ +CDF S +      C + V   
Sbjct  214   GFMIGNAVINDETDDMGLIEFAWSHAIISDQIYHGIMKNCDFKSGNL--TNLCIKYVEGF  271

Query  889   LKQYKEIDIYSLYTSVCIDSLTGSGDN--STPVFKTTSKMMPRIMAGYDPCLDDYAKSYY  1062
              + Y +ID+YS+YT VC+ S   +     + P       +  ++ +GYDPC +DYA+ Y+
Sbjct  272   FEAYLDIDVYSIYTPVCLSSSKETYRKLVTAPRLFAQHDLWHQLPSGYDPCTEDYAEKYF  331

Query  1063  NRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTD  1242
             NR DVQKALH +       +  C+  V   W+DS ++VLP  +KL+ AG+RIWVYSGDTD
Sbjct  332   NREDVQKALHANVTKLPYPYTTCS-KVIRRWNDSPDTVLPTIQKLLKAGLRIWVYSGDTD  390

Query  1243  GRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYE-GLTFATFRGAGHAVPTFKP  1419
             GRVPV STRYSI+ +GL I ++WR W+ +KQV GWV  YE GLT AT RGAGH VP   P
Sbjct  391   GRVPVTSTRYSINKMGLRIQQKWRAWFDRKQVAGWVVTYEGGLTLATVRGAGHQVPILAP  450



>ref|XP_008461360.1| PREDICTED: serine carboxypeptidase-like 34 [Cucumis melo]
Length=483

 Score =   447 bits (1149),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 222/423 (52%), Positives = 285/423 (67%), Gaps = 13/423 (3%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP V+FK YAGYV VNE++GR LFYW +E+ + P EKPL+LWLNGGPGCSSI
Sbjct  44    DRVLRLPGQPPVSFKQYAGYVNVNESHGRALFYWFFEAIADPHEKPLLLWLNGGPGCSSI  103

Query  358   GYGATQEIGPFLVDS-DESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             GYGA +E+GPF     D+  L  NPY+WN+ ANLLFLESPVGVGFSYSN + D   LGD 
Sbjct  104   GYGAAEELGPFFPQKGDKPKLKFNPYTWNRAANLLFLESPVGVGFSYSNNTNDINELGDT  163

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLR  708
               A D+YAFL  WF +FP +K+  FYIAGESYAG YVP+L+E+I D NK  S    I+ +
Sbjct  164   ITAKDSYAFLINWFQRFPQFKSHEFYIAGESYAGHYVPQLSELIFDENKKISKKNRINFK  223

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G ++GN    D  D +GM+DYAW HA+ISD+ ++ I  +C+F  N T S+  C  ++++ 
Sbjct  224   GFIIGNALLDDETDQRGMIDYAWDHAIISDKLYKEIKTNCNF-KNPTLSDS-CGNSLDKY  281

Query  889   LKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMA------GYDPCLDDYA  1050
                Y  ID+YSLYT +C++    S     P     + + P+         GYDPC  DY 
Sbjct  282   FDVYDIIDVYSLYTPMCVEK-NSSSTRRKPRRFAINGVAPQNRGWHMRHFGYDPCSSDYT  340

Query  1051  KSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYS  1230
             ++Y+NR DVQKA+H +       W  C+ ++   W D+  S+LPI KKLIA G+RIWV+S
Sbjct  341   ETYFNRPDVQKAMHANVTKIPYPWTHCSDNI-TFWKDAPFSILPIIKKLIAGGLRIWVFS  399

Query  1231  GDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPT  1410
             GDTDGR+PV STR +++ LGL I ++W PWY  +QVGGW  EYEGL F T RGAGH VP 
Sbjct  400   GDTDGRIPVTSTRLTLNKLGLKIKKDWTPWYCHQQVGGWTIEYEGLMFVTVRGAGHEVPQ  459

Query  1411  FKP  1419
             FKP
Sbjct  460   FKP  462



>emb|CDY46950.1| BnaA02g32960D [Brassica napus]
Length=503

 Score =   447 bits (1151),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 221/433 (51%), Positives = 297/433 (69%), Gaps = 22/433 (5%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             DLV  LPGQP V F+ YAGYVTVNE +GR LFYW +E++  P++KPL+LWLNGGPGCSS+
Sbjct  53    DLVKELPGQPPVKFRQYAGYVTVNETHGRALFYWFFEATHNPNKKPLLLWLNGGPGCSSV  112

Query  358   GYGATQEIGPFL-VDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             G+GA++E+GPF   +S + +L +NPYSWNK ANLLFLESPVGVGFSYSNTS D + LGD 
Sbjct  113   GFGASEELGPFFPQNSTQPNLKLNPYSWNKAANLLFLESPVGVGFSYSNTSRDISQLGDT  172

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNK--DPSLFIDLR  708
               A+D+Y FL  WF +FP YK+R FYIAGESYAG YVP+L+E+I ++NK      FI+L+
Sbjct  173   VTASDSYNFLVNWFKRFPQYKSRDFYIAGESYAGHYVPQLSELIYNQNKIAPKKDFINLK  232

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G+++GN    D  D +GM+DYA+ HAVISD  ++ +   CDF       +++C  A++E 
Sbjct  233   GLMIGNALLDDETDQKGMIDYAYDHAVISDGLYQRVNEHCDFRLAHV--SKECDGALDEY  290

Query  889   LKQYKEIDIYSLYTSVCI-----DSLTGSGDNSTPVFKTTSKMMPRIM----------AG  1023
                YK +D+YSLY+  C+      S++ S   S  +        PR++          AG
Sbjct  291   FDVYKILDMYSLYSPRCVPTTENSSVSHSVAGSRHLPAARGIFRPRLVSNNEGWRKMAAG  350

Query  1024  YDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIA  1203
             YDPC  DY + Y NR DVQ+ALH +  +    W  C+  +   W+D+  S+LP  + L++
Sbjct  351   YDPCASDYTEKYMNRRDVQEALHANVTNLSYPWTHCSDHI-SFWADAPASMLPTLRTLVS  409

Query  1204  AGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWY-HQKQVGGWVQEYEGLTFAT  1380
             AG+R+WV+SGDTDGR+PV +TRYS+  LGL   ++W PWY +++QVGGW  EY+GL F T
Sbjct  410   AGLRVWVFSGDTDGRIPVTATRYSLKKLGLKTVQDWTPWYTNKQQVGGWTVEYDGLMFVT  469

Query  1381  FRGAGHAVPTFKP  1419
              RGAGH VPTFKP
Sbjct  470   VRGAGHQVPTFKP  482



>ref|NP_001054710.1| Os05g0158500 [Oryza sativa Japonica Group]
 gb|AAV43913.1| putative serine carboxypeptidase II [Oryza sativa Japonica Group]
 dbj|BAF16624.1| Os05g0158500 [Oryza sativa Japonica Group]
 gb|EEE62407.1| hypothetical protein OsJ_17198 [Oryza sativa Japonica Group]
Length=482

 Score =   447 bits (1149),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 216/423 (51%), Positives = 289/423 (68%), Gaps = 11/423 (3%)
 Frame = +1

Query  178   DLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYES--SSLPDEKPLVLWLNGGPGC  348
             D VA LPGQP       +AGYV V+E +GR LFYW +E+  S  P++KPL+LWLNGGPGC
Sbjct  42    DRVARLPGQPASPAVSQFAGYVGVDERHGRALFYWFFEAQASPAPEKKPLLLWLNGGPGC  101

Query  349   SSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLG  528
             SSIGYGA  E+GP  V    ++L  N Y WNKEANLLFLESPVGVGFSY+NTS+D +NL 
Sbjct  102   SSIGYGAASELGPLRVARQGAALEFNQYGWNKEANLLFLESPVGVGFSYTNTSSDLSNLN  161

Query  529   DDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKD--PSLFID  702
             DDF A DAY+FL  WF +FP YK   FYI+GESYAG YVP+LA+++ +RNKD   S +I+
Sbjct  162   DDFVAEDAYSFLVNWFKRFPQYKDNEFYISGESYAGHYVPQLADLVYERNKDKRASTYIN  221

Query  703   LRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVN  882
             L+G ++GNP T D  D +G+ +YAWSHA++SD+ +  I  +C+F  N  W++ DC+ A+N
Sbjct  222   LKGFIVGNPLTDDYYDSKGLAEYAWSHAIVSDQVYERIKKTCNF-KNSNWTD-DCNAAMN  279

Query  883   ELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMP---RIMAGYDPCLDDYAK  1053
              +  QY +IDIY++Y   C+ + T +       F    +      ++ +GYDPC   YA+
Sbjct  280   IIFSQYNQIDIYNIYAPKCLLNSTSASSPDRAFFANNQEQFRWRIKMFSGYDPCYSSYAE  339

Query  1054  SYYNRLDVQKALHV-SSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYS  1230
              Y+N+ DVQ+A H  +SG     W++C+  + + ++ S  S+LPIY KLI AG+R+W+YS
Sbjct  340   DYFNKHDVQEAFHANASGLLPGKWQVCSDQILNSYNFSVLSILPIYSKLIKAGLRVWLYS  399

Query  1231  GDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPT  1410
             GD DGRVPV+S+RY +  LGLPI  +W+ WY  KQV G   EY G+T  T RGAGH VP 
Sbjct  400   GDADGRVPVISSRYCVEALGLPIKTDWQSWYLDKQVAGRFVEYHGMTMVTVRGAGHLVPL  459

Query  1411  FKP  1419
              KP
Sbjct  460   NKP  462



>gb|AEO37080.1| grain size 5 [Oryza sativa Indica Group]
 gb|AEO37082.1| grain size 5 [Oryza sativa Indica Group]
Length=480

 Score =   446 bits (1148),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 216/423 (51%), Positives = 289/423 (68%), Gaps = 11/423 (3%)
 Frame = +1

Query  178   DLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYES--SSLPDEKPLVLWLNGGPGC  348
             D VA LPGQP       +AGYV V+E +GR LFYW +E+  S  P++KPL+LWLNGGPGC
Sbjct  40    DRVARLPGQPASPAVSQFAGYVGVDERHGRALFYWFFEAQASPAPEKKPLLLWLNGGPGC  99

Query  349   SSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLG  528
             SSIGYGA  E+GP  V    ++L  N Y WNKEANLLFLESPVGVGFSY+NTS+D +NL 
Sbjct  100   SSIGYGAASELGPLRVARQGAALEFNQYGWNKEANLLFLESPVGVGFSYTNTSSDLSNLN  159

Query  529   DDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKD--PSLFID  702
             DDF A DAY+FL  WF +FP YK   FYI+GESYAG YVP+LA+++ +RNKD   S +I+
Sbjct  160   DDFVAEDAYSFLVNWFKRFPQYKDNEFYISGESYAGHYVPQLADLVYERNKDKRASTYIN  219

Query  703   LRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVN  882
             L+G ++GNP T D  D +G+ +YAWSHA++SD+ +  I  +C+F  N  W++ DC+ A+N
Sbjct  220   LKGFIVGNPLTDDYYDSKGLAEYAWSHAIVSDQVYERIKKTCNF-KNSNWTD-DCNAAMN  277

Query  883   ELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMP---RIMAGYDPCLDDYAK  1053
              +  QY +IDIY++Y   C+ + T +       F    +      ++ +GYDPC   YA+
Sbjct  278   IIFSQYNQIDIYNIYAPKCLLNSTSASSPDRAFFANNQEQFRWRIKMFSGYDPCYSSYAE  337

Query  1054  SYYNRLDVQKALHV-SSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYS  1230
              Y+N+ DVQ+A H  +SG     W++C+  + + ++ S  S+LPIY KLI AG+R+W+YS
Sbjct  338   DYFNKHDVQEAFHANASGLLPGKWQVCSDQILNSYNFSVLSILPIYSKLIKAGLRVWLYS  397

Query  1231  GDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPT  1410
             GD DGRVPV+S+RY +  LGLPI  +W+ WY  KQV G   EY G+T  T RGAGH VP 
Sbjct  398   GDADGRVPVISSRYCVEALGLPIKTDWQSWYLDKQVAGRFVEYHGMTMVTVRGAGHLVPL  457

Query  1411  FKP  1419
              KP
Sbjct  458   NKP  460



>ref|XP_004953203.1| PREDICTED: serine carboxypeptidase-like 34-like [Setaria italica]
Length=484

 Score =   446 bits (1148),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 221/421 (52%), Positives = 272/421 (65%), Gaps = 15/421 (4%)
 Frame = +1

Query  193   LPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSIGYGAT  372
             LPGQP V F  YAGYVTVNE +GR LFYW +E+++ PD+KPLVLWLNGGPGCSSIGYG  
Sbjct  45    LPGQPAVGFAQYAGYVTVNETHGRALFYWFFEATAAPDKKPLVLWLNGGPGCSSIGYGEA  104

Query  373   QEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDFAANDA  552
             +E+GPFLV   +  L  N YSWN EANL+FLESPVGVGFSY+NTS+D  NLGD   A+DA
Sbjct  105   EELGPFLVQKGKPELKWNNYSWNTEANLMFLESPVGVGFSYTNTSSDLQNLGDKITADDA  164

Query  553   YAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLRGILLGN  726
             Y FL  WF +FP YK+  FYIAGESYAG YVP+L+E I D NK      +I+ +G+++GN
Sbjct  165   YVFLLNWFKRFPQYKSHDFYIAGESYAGHYVPQLSEKIFDGNKAGPRENYINFKGLMVGN  224

Query  727   PETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELLKQYKE  906
                 D  D  GM+DYAW HAVISD  +  + A C+F+         C  A+ E    Y+ 
Sbjct  225   ALMDDETDQTGMIDYAWDHAVISDRVYGDVKARCNFSMVKV--TGACDAALQEYFAVYRL  282

Query  907   IDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIM----------AGYDPCLDDYAKS  1056
             ID+YSLYT VC D    +               PRI           AGYDPC  +YA+ 
Sbjct  283   IDMYSLYTPVCTDGSGSTASRGGHRKVAVHGAAPRIFSKYRGWIMKPAGYDPCTAEYAEV  342

Query  1057  YYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGD  1236
             Y+NR DVQ ALH +      +W  C+  V   W+D+  S LPI +KLIA G+++WV+SGD
Sbjct  343   YFNRPDVQAALHANVTKIGYNWTHCS-DVISTWNDAAFSTLPIIRKLIAGGLKVWVFSGD  401

Query  1237  TDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFK  1416
             TDGR+PV +TR +++ LGL   +EW PWY   QVGGW   YEGLTF T RGAGH VP   
Sbjct  402   TDGRIPVTATRLTLNKLGLKTVQEWTPWYDHLQVGGWTIVYEGLTFVTIRGAGHEVPMHA  461

Query  1417  P  1419
             P
Sbjct  462   P  462



>ref|XP_002278314.1| PREDICTED: serine carboxypeptidase-like 35 [Vitis vinifera]
Length=474

 Score =   446 bits (1147),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 218/420 (52%), Positives = 288/420 (69%), Gaps = 8/420 (2%)
 Frame = +1

Query  175   EDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             +D V +LPGQP V F+HYAGYV +   + + LFYW +E+     EKPLVLWLNGGPGCSS
Sbjct  37    KDRVKDLPGQPAVEFRHYAGYVKLRPQDEKALFYWFFEAQGGVLEKPLVLWLNGGPGCSS  96

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             I YGA QE+GPFLV S+ + L +N +SWNK AN+LFLE+PVGVGFSY+N S+D   LGD 
Sbjct  97    IAYGAAQELGPFLVRSNGTKLILNDFSWNKVANILFLEAPVGVGFSYTNKSSDLLKLGDR  156

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPS--LFIDLR  708
               A D++AFL +WF +FPS KT  FYI GESYAG YVP+LAE+I +RNK  S   +I+L+
Sbjct  157   ITAEDSHAFLVQWFKRFPSLKTHDFYITGESYAGHYVPQLAELIYERNKRSSKDFYINLK  216

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G ++GN   +D  D  G++++AWSHA+ISD+ +  I+ +CDF S +      C + V   
Sbjct  217   GFMIGNAVINDETDDMGLIEFAWSHAIISDQIYHGIMKNCDFKSGNL--TNLCIKYVEGF  274

Query  889   LKQYKEIDIYSLYTSVCIDSLTGSGDN--STPVFKTTSKMMPRIMAGYDPCLDDYAKSYY  1062
              + Y +ID+YS+YT VC+ S   +     + P       +  ++ +GYDPC +DYA+ Y+
Sbjct  275   FEAYLDIDVYSIYTPVCLSSSKETYRKLVTAPRLFAQHDLWHQLPSGYDPCTEDYAEKYF  334

Query  1063  NRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTD  1242
             NR DVQKALH +       +  C+  V   W+DS ++VLP  +KL+ AG+RIWVYSGDTD
Sbjct  335   NREDVQKALHANVTKLPYPYTTCS-KVIRRWNDSPDTVLPTIQKLLKAGLRIWVYSGDTD  393

Query  1243  GRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYE-GLTFATFRGAGHAVPTFKP  1419
             GRVPV STRYSI+ +GL I ++WR W+ +KQV GWV  YE GLT AT RGAGH VP   P
Sbjct  394   GRVPVTSTRYSINKMGLRIQQKWRAWFDRKQVAGWVVTYEGGLTLATVRGAGHQVPILAP  453



>ref|XP_002520355.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF42021.1| serine carboxypeptidase, putative [Ricinus communis]
Length=572

 Score =   449 bits (1156),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 220/415 (53%), Positives = 280/415 (67%), Gaps = 13/415 (3%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP V+FK YAGYVTVN  +GR LFYW +E+++ P EKPLVLWLNGGPGCSSI
Sbjct  35    DRVIKLPGQPEVSFKQYAGYVTVNVTHGRALFYWFFEATTKPQEKPLVLWLNGGPGCSSI  94

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYG  +E+GPF     +  L +NPYSWNK ANLLF+ESPVGVGFSY+NTS+D   LGD  
Sbjct  95    GYGEAEELGPFFPRKRQPELKLNPYSWNKAANLLFIESPVGVGFSYTNTSSDINELGDTL  154

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDP--SLFIDLRG  711
             AA D+Y FL  WF +FP +K+  FYI+GESYAG YVP+LAE+I D N+       I  +G
Sbjct  155   AAQDSYTFLLNWFQRFPQFKSHDFYISGESYAGHYVPQLAEVIYDNNRKALNKNHISFKG  214

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELL  891
              ++GN    D  D  GM+DYAW HAVISD  +  + + C+F+      +++C+QA+N+  
Sbjct  215   FMIGNALLDDETDQTGMIDYAWDHAVISDRVYHDVKSKCNFSQQR--PSKECNQALNQYF  272

Query  892   KQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMM-------PRIMAGYDPCLDDYA  1050
               YK ID+YSLY   C++S   S     PV +  +  +        R  AGYDPC  DY 
Sbjct  273   DVYKIIDMYSLYAPRCVNS-NFSTTKQLPVIEGIAPQLFSKFEDWRRKPAGYDPCASDYT  331

Query  1051  KSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYS  1230
             + Y NR DVQ+ALH ++      W  C+ ++   W+D+  S+LPI KKLIA GIRIWVYS
Sbjct  332   EMYMNRPDVQEALHANTTKIPYPWTHCSNNI-TFWNDAPASILPIIKKLIAGGIRIWVYS  390

Query  1231  GDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAG  1395
             GD DGR+PV STRY+++ LGL   +EW PWY++KQVGGW  EY+GL F T RGAG
Sbjct  391   GDADGRIPVTSTRYTLNKLGLNTRQEWSPWYYKKQVGGWTIEYDGLMFVTVRGAG  445



>ref|XP_010112534.1| Serine carboxypeptidase-like 34 [Morus notabilis]
 gb|EXC33987.1| Serine carboxypeptidase-like 34 [Morus notabilis]
Length=491

 Score =   446 bits (1148),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 224/437 (51%), Positives = 284/437 (65%), Gaps = 20/437 (5%)
 Frame = +1

Query  160   QSWASEDLVANLPGQPI-VNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNG  336
             Q+    D V  LPGQP  V FKH+AGYVTVNE +GR  FYW +E+   P +KPLVLWLNG
Sbjct  37    QAEQEADRVVGLPGQPSSVKFKHFAGYVTVNETHGRAFFYWFFEAVDKPQDKPLVLWLNG  96

Query  337   GPGCSSIGYGATQEIGPFL-VDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTD  513
             GPGCSSIG+GA +E+GPF   +  +  L  NPY+WN  ANLLFLESPVGVGFSY+NTS+D
Sbjct  97    GPGCSSIGFGAAEELGPFFPQNGGKPKLKFNPYTWNNAANLLFLESPVGVGFSYTNTSSD  156

Query  514   YANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL  693
               NLGD   A D+Y FL  WF +FP YK+  FYIAGESYAG YVP+L+E+I D+NK    
Sbjct  157   ITNLGDTITAQDSYIFLINWFRRFPQYKSHDFYIAGESYAGHYVPQLSEVIFDKNKRAQK  216

Query  694   --FIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDC  867
               +I+L+G ++GN    D  D +GM+DYAW HAVISD  +  I + C+F  +D     DC
Sbjct  217   RNYINLKGFMIGNALLDDETDQKGMIDYAWDHAVISDTLYEGIKSKCNF--SDPNPPNDC  274

Query  868   SQAVNELLKQYKEIDIYSLYTSVCI--DSLTGSGDNSTPVFK---TTSKMMPRIM-----  1017
                +N+    YK ID+YSLYT  CI   + T +     PVF+   T   +  +       
Sbjct  275   DILMNQYFDVYKIIDMYSLYTPTCIINGNSTVTRQQQRPVFQRFGTPKNLFHKYQQQGWH  334

Query  1018  ---AGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIY  1188
                AGYDPC  +Y   Y NR DVQ ALH +       W  C+ ++   W D+  SVLPI 
Sbjct  335   KRSAGYDPCASEYTAVYLNRPDVQAALHANVTKIPYPWTHCSENI-SFWKDAPASVLPII  393

Query  1189  KKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGL  1368
             +KL+  G+R+WVYSGDTDGR+PV +TRY++  LGL IT++W PWY+ ++VGGW  EY+GL
Sbjct  394   RKLVTGGLRVWVYSGDTDGRIPVTATRYTLKKLGLEITQDWTPWYNNEEVGGWTVEYKGL  453

Query  1369  TFATFRGAGHAVPTFKP  1419
              F T RGAGH VP F P
Sbjct  454   VFVTIRGAGHEVPQFAP  470



>emb|CDP10248.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   445 bits (1144),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 215/416 (52%), Positives = 290/416 (70%), Gaps = 7/416 (2%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D +  LPGQP V+F  ++GYV VNE++GR LFYWL E++S P++KPLVLWLNGGPGCSS+
Sbjct  29    DRILELPGQPPVSFSQFSGYVPVNEDHGRALFYWLTEATSSPEKKPLVLWLNGGPGCSSV  88

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
              YGA++EIGPF +    SSL +N +SWN+EAN+LFLESP GVGFSY+NTS+D  + GD  
Sbjct  89    AYGASEEIGPFRISKTASSLYLNKHSWNREANILFLESPAGVGFSYTNTSSDLKDSGDKR  148

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL-FIDLRGI  714
              A DA  FL  W  +FP YK R FYI+GESYAG Y P+LA  IV+ +K  S   I+L+GI
Sbjct  149   TAQDALIFLLRWMSRFPQYKDRDFYISGESYAGHYAPQLALKIVEYSKGASHPIINLKGI  208

Query  715   LLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELLK  894
             ++GN  T +  D  G V Y WSH++ISD T+++I+ SC+F+S    S+Q C  AVN  + 
Sbjct  209   MVGNAVTDNYYDNLGTVSYWWSHSIISDRTYKSILKSCNFSSEK--SSQKCDDAVNYAMN  266

Query  895   -QYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSYYNRL  1071
              ++  ID YS+Y   C  S   + +N+  + +  + ++ R ++GYDPC ++YA+ YYNR 
Sbjct  267   HEFGNIDQYSIYAPACKAS---TANNTVKLLRLKNSLIHRKISGYDPCTENYAEKYYNRP  323

Query  1072  DVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGRV  1251
             DVQKA+H +S     +W  C+  +   W D++ S+LP YKKLIAAG+RIWV+SGDTD  V
Sbjct  324   DVQKAMHANSTAIPYNWTACSDVLIRNWKDTEFSILPTYKKLIAAGLRIWVFSGDTDSVV  383

Query  1252  PVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             PV +TR+S++ L L I  +W PWY   QVGGW + Y GLTFAT RGAGH +P  +P
Sbjct  384   PVTATRFSLNHLNLKIKTKWYPWYVGGQVGGWTEVYRGLTFATIRGAGHEIPLLQP  439



>ref|XP_010688683.1| PREDICTED: serine carboxypeptidase-like 34 [Beta vulgaris subsp. 
vulgaris]
Length=487

 Score =   446 bits (1147),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 218/430 (51%), Positives = 284/430 (66%), Gaps = 21/430 (5%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP V+FK YAGYVTVN ++G+ LFYW +E++  P++KP++LWLNGGPGCSSI
Sbjct  41    DHVVRLPGQPKVSFKQYAGYVTVNASSGKALFYWFFEAAEKPEKKPVLLWLNGGPGCSSI  100

Query  358   GYGATQEIGPFLVDS-DESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             GYG  +E+GPF      +  L +N YSWN+ ANLLFLESPVGVGFSY+NTS+D   LGD 
Sbjct  101   GYGEAEELGPFFPQKGTKPKLKLNKYSWNRAANLLFLESPVGVGFSYTNTSSDINELGDT  160

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLR  708
               A DAY FL  WF +FP +K+  F+++GESYAG YVP+LA++I+D NK  S    I+L+
Sbjct  161   IVAKDAYNFLLNWFRRFPQFKSHNFFLSGESYAGHYVPQLAKVILDNNKMVSKEDRINLK  220

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G ++GN    D  D +GMV YAW HAVISD  +  +  +CDF+  +      C++A+ + 
Sbjct  221   GFMIGNALLDDDTDQRGMVQYAWDHAVISDRVYSDLKKNCDFSKKNL--TTKCNKALTQY  278

Query  889   LKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIM-------------AGYD  1029
               +Y+ IDIYSLY+ +C+++ T S  N+ P       + PR+              AGYD
Sbjct  279   FAEYRLIDIYSLYSPICVENQTESRRNTQP--PVIDGISPRLFSRFEGWLKRPAAGAGYD  336

Query  1030  PCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAG  1209
             PC  DY  +Y NR DVQ ALH +       W  CN ++   WSDS  S+LP  K+LIA G
Sbjct  337   PCASDYTDAYMNRQDVQSALHANVTKLSYPWTHCNNNI-TSWSDSPSSILPTIKELIAEG  395

Query  1210  IRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRG  1389
             +RIW+YSGDTDGR+PV STRY++  LGL   +EW  WY   QVGGW  EY+GL F T RG
Sbjct  396   LRIWIYSGDTDGRIPVTSTRYTLRKLGLKTLQEWTAWYTNSQVGGWTIEYKGLMFVTIRG  455

Query  1390  AGHAVPTFKP  1419
             AGH +PT KP
Sbjct  456   AGHQIPTTKP  465



>ref|XP_009401001.1| PREDICTED: serine carboxypeptidase-like 34 [Musa acuminata subsp. 
malaccensis]
Length=470

 Score =   445 bits (1145),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 224/422 (53%), Positives = 279/422 (66%), Gaps = 14/422 (3%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP V F+ YAGYVT++E  G+ LFYW +E++  P EKPL+LWLNGGPGCSSI
Sbjct  34    DRVVGLPGQPPVGFRQYAGYVTIDEGLGKALFYWFFEATHRPAEKPLLLWLNGGPGCSSI  93

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             G+G  QEIGPFLV  D   L  N Y+WNK ANLLFLE+P GVGFSYSN  TD    GD+ 
Sbjct  94    GFGEAQEIGPFLVKKDVPELEHNEYAWNKAANLLFLEAPAGVGFSYSNI-TDVQ--GDNA  150

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLRG  711
              A  +Y+FL +WF +FP Y+   FYIAGESYAG YVP+LA +I+++N        I+L+G
Sbjct  151   TAFGSYSFLVKWFQRFPQYRLNEFYIAGESYAGHYVPQLANVILEQNMKAKKEDHINLKG  210

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELL  891
             +++GN       D +GMVDYAW HA+ISD  +  I  SC+F++      Q+CS+A+ +  
Sbjct  211   LVIGNAVMDSETDIRGMVDYAWDHALISDRVYHNIKTSCNFSA--VAPTQECSKALQQYY  268

Query  892   KQYKEIDIYSLYTSVC------IDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAK  1053
             + Y+ ID+YSLYT  C        S    G+ S         ++ +I  GYDPCL  YA 
Sbjct  269   QVYQIIDMYSLYTPRCESGYPKFSSSVAQGEESLMSISKFEDLL-KIPMGYDPCLQTYAT  327

Query  1054  SYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSG  1233
              Y+NR DVQKALH +       W +C+ SV   WSDS  SVLPI  KLI AG+R+WV+SG
Sbjct  328   VYFNRPDVQKALHANVTRLSHPWSLCSSSVVRAWSDSDRSVLPIIGKLIDAGLRMWVFSG  387

Query  1234  DTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTF  1413
             DTD RVPV STRY+++ LGL IT +W PWY  KQVGGW   YEGLTF T R AGH VPTF
Sbjct  388   DTDARVPVTSTRYTLNKLGLSITEDWSPWYSHKQVGGWTIIYEGLTFVTVRVAGHQVPTF  447

Query  1414  KP  1419
              P
Sbjct  448   AP  449



>ref|XP_006847849.1| hypothetical protein AMTR_s00029p00064790 [Amborella trichopoda]
 gb|ERN09430.1| hypothetical protein AMTR_s00029p00064790 [Amborella trichopoda]
Length=487

 Score =   446 bits (1147),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 216/431 (50%), Positives = 284/431 (66%), Gaps = 17/431 (4%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP VNF HYAGY+ +++ +G+ LFYW +E+   P+ KPLVLWLNGGPGCSSI
Sbjct  35    DRVIKLPGQPPVNFLHYAGYINIDQFHGKSLFYWFFEAEKKPEMKPLVLWLNGGPGCSSI  94

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             G+G  QE+GPFLV   ++ LT N ++WNKEANLL LESPVGVGFSY+NTS+D   +GD  
Sbjct  95    GFGEAQELGPFLVQKGKAELTFNHHAWNKEANLLLLESPVGVGFSYTNTSSDIQTMGDKV  154

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGE---------SYAGKYVPELAEIIVDRNK--D  684
              A D+Y FL +WF +FP YK+  FYI G+          + G Y P+LAE I D NK   
Sbjct  155   VAQDSYEFLIQWFRRFPQYKSHDFYITGKVMQNKSNGCCFPGHYAPQLAEYIFDHNKMAK  214

Query  685   PSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFN-SNDTWSNQ  861
                 I+L+G ++GN    D  D +GM+DYAW HAVISD+ +  I  +C+F+ +N T   Q
Sbjct  215   KENIINLKGFMIGNALMDDETDQKGMIDYAWDHAVISDKLYDDIKTNCNFSEANQTDHIQ  274

Query  862   DCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSG-----DNSTPVFKTTSKMMPRIMAGY  1026
             +C + + E    Y  ID+YSLYT  CI+  + +      +   P F +      ++ AGY
Sbjct  275   ECIEGMEEYYNVYNIIDMYSLYTPHCIEGNSTTRQLPKLEGVAPKFFSQFLAWHKMPAGY  334

Query  1027  DPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAA  1206
             DPC+ +YA++Y+NR DVQ+ALH +       WR C+      W+D+  S+LP  +KLI +
Sbjct  335   DPCMSNYAEAYFNRQDVQEALHANKTKIPYPWRTCSEQFNGTWTDAPHSMLPTIRKLINS  394

Query  1207  GIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFR  1386
             G+R+WVYSGDTDGR+PV STRY++  LGL IT +W PWY  KQVGGW   Y+GL F T R
Sbjct  395   GLRVWVYSGDTDGRIPVTSTRYTLRKLGLNITVDWAPWYSDKQVGGWTVIYDGLMFVTVR  454

Query  1387  GAGHAVPTFKP  1419
             GAGH VPTFKP
Sbjct  455   GAGHQVPTFKP  465



>ref|XP_006644137.1| PREDICTED: serine carboxypeptidase-like 33-like [Oryza brachyantha]
Length=481

 Score =   446 bits (1146),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 213/423 (50%), Positives = 291/423 (69%), Gaps = 11/423 (3%)
 Frame = +1

Query  178   DLVANLPGQPIVN--FKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCS  351
             D VA LPGQP  +     ++GY+TVN  NGR LFYW +E+ SLP +KPL+LWLNGGPGCS
Sbjct  39    DRVAFLPGQPRSSQQVSQFSGYITVNSQNGRALFYWFFEAQSLPSKKPLLLWLNGGPGCS  98

Query  352   SIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             S+GYGA  E+GP +V+ + + L  N +SWNKEANLLFLESPVGVGFSY+NTS+D  N+ D
Sbjct  99    SVGYGAASELGPLMVNGNGTGLEFNKFSWNKEANLLFLESPVGVGFSYTNTSSDLDNIDD  158

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNK--DPSLFIDL  705
              F A D+Y FL  WF +FP YK   FYI+GESYAG YVP+LA+++ +RNK  +    I+L
Sbjct  159   RFVAEDSYNFLVNWFKRFPQYKNHDFYISGESYAGHYVPQLADVVYERNKHLETDQHINL  218

Query  706   RGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNE  885
             +G ++GN ET D  D++ +V++AWSH+VISD+ ++ + + CDF  +    + +C  A+  
Sbjct  219   KGFIVGNAETDDYYDYKALVEFAWSHSVISDQLYKHVNSVCDFRLSP--RSNECDHAMGS  276

Query  886   LLKQYKEIDIYSLYTSVCI--DSLTGSGDNSTPVFKTTSKMM-PRIMAGYDPCLDDYAKS  1056
             +  QY  IDI+++Y   C    S   S  + T   K   ++   R+ +GYDPC   + + 
Sbjct  277   VYSQYDMIDIFNVYAPKCNSDQSELFSTSDGTAAMKAKKRLKGMRMYSGYDPCYSMHIED  336

Query  1057  YYNRLDVQKALHVSSGHHLRD--WRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYS  1230
             Y N++DVQK+LH ++   ++D  W IC+ S+FD ++ +  SVLPIY KLI AG+R+W+YS
Sbjct  337   YMNKMDVQKSLHANTSGLIKDRRWSICSYSIFDNYNITVFSVLPIYSKLIKAGLRVWMYS  396

Query  1231  GDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPT  1410
             GD DGRVPV+ +RY +  LGLPI  +W+PWY   QV G   EY+GLT AT RGAGHAVP 
Sbjct  397   GDVDGRVPVIGSRYCVEALGLPIKLQWQPWYLNNQVAGRFVEYQGLTMATIRGAGHAVPQ  456

Query  1411  FKP  1419
              KP
Sbjct  457   DKP  459



>ref|XP_002308408.1| BRI1 SUPPRESSOR 1 family protein [Populus trichocarpa]
 gb|EEE91931.1| BRI1 SUPPRESSOR 1 family protein [Populus trichocarpa]
Length=459

 Score =   445 bits (1144),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 221/416 (53%), Positives = 288/416 (69%), Gaps = 11/416 (3%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D ++ LPGQP V F  ++GYVTVNE +GR LFYWL E++++PD+KPLVLWLNGGPGCSS+
Sbjct  34    DRISALPGQPAVTFSQFSGYVTVNEKHGRALFYWLTEATAIPDKKPLVLWLNGGPGCSSV  93

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
              YGA++EIGPF ++    SL +N YSWNKEAN+LFLESP GVGFSY+NTS++  + GD  
Sbjct  94    AYGASEEIGPFRINRTGLSLYMNKYSWNKEANILFLESPAGVGFSYTNTSSNLKDSGDKR  153

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKD-PSLFIDLRGI  714
              A DA  FL  W  +FP YK R FYIAGESYAG YVP+LA+ I D NK  P   I+L+G 
Sbjct  154   TAQDALVFLTRWMSRFPQYKYREFYIAGESYAGHYVPQLAKKIHDYNKAYPHPIINLKGF  213

Query  715   LLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELLK  894
             ++GN  T +  D  G V + W+H++ISD T+R I+ +C+F + DT SNQ C  AV   + 
Sbjct  214   IVGNAVTDNYYDSIGTVAFWWTHSMISDRTYRAILDNCNF-TEDTASNQ-CDDAVTYAMN  271

Query  895   -QYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSYYNRL  1071
              ++ +ID YS+YT  C+        NST   K T  ++ R ++GYDPC + YA+ YYNR 
Sbjct  272   HEFGDIDQYSIYTPSCMQL-----PNSTVRLKNT--LLRRRVSGYDPCTEKYAEKYYNRP  324

Query  1072  DVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGRV  1251
             +VQKA+H +       W  C+  +   W DS+ S+LP+YK LIAAG+RIWV+SGDTD  V
Sbjct  325   EVQKAMHANVTGIPYKWTACSDVLIKNWKDSESSMLPVYKDLIAAGLRIWVFSGDTDSVV  384

Query  1252  PVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             PV +TR+S+S L L +   W PWY   QVGGW + Y+GLTFAT RGAGH VP F+P
Sbjct  385   PVTATRFSLSHLNLTVKTRWYPWYSGDQVGGWTEVYKGLTFATVRGAGHEVPLFQP  440



>ref|XP_008797238.1| PREDICTED: serine carboxypeptidase-like 35 [Phoenix dactylifera]
Length=488

 Score =   446 bits (1146),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 232/449 (52%), Positives = 296/449 (66%), Gaps = 21/449 (5%)
 Frame = +1

Query  133   LSSNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEK  312
             L + +    +S    D V  LPGQP V F+HYAGYV V    G+ LFYW +E+    ++K
Sbjct  17    LEAGRNFGVESRPESDRVTGLPGQPPVEFRHYAGYVMVGRGVGKALFYWFFEAQGRAEKK  76

Query  313   PLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFS  492
             PLVLWLNGGPGCSS+ YGA QE+GPFLV S+ ++LT N YSWNK ANLLFLE+PVGVGFS
Sbjct  77    PLVLWLNGGPGCSSVAYGAAQELGPFLVRSNAANLTFNAYSWNKVANLLFLEAPVGVGFS  136

Query  493   YSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVD  672
             Y+N S+D   LGD   A D+Y+FL  WF KFP  K+  FYIAGESYAG YVP+LAE+I +
Sbjct  137   YTNRSSDLEELGDRITAEDSYSFLLNWFQKFPDLKSHDFYIAGESYAGHYVPQLAELIYE  196

Query  673   RNKDPSL--FIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCD-FNSN  843
              N+  S   +I+ +G+++GN   +D  D  GMV+YAWSHA+ISDE +  ++  C+ F   
Sbjct  197   GNEGASKESYINFKGLMIGNAVLNDATDQLGMVEYAWSHAIISDELYAAVLKECNSFKEE  256

Query  844   --DTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVF--KTTSKM---  1002
               D   +  C+ AV   L+ Y +IDIYS+YT VC+ SL+ S   +  V   +  S++   
Sbjct  257   LGDGRRSNACTPAVKAFLRSYADIDIYSIYTPVCLSSLSKSSRLTKLVAAPRLFSELEAW  316

Query  1003  --MPRIMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESV  1176
               M  + AGYDPC +DY + Y+NR DVQKALH +  H    +  C+  V   WSDS  +V
Sbjct  317   HGMRSMPAGYDPCTEDYVEKYFNREDVQKALHANLTHLSYPYSPCS-EVIQKWSDSPSTV  375

Query  1177  LPIYKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITRE-------WRPWYHQKQ  1335
             LPI KK + AG+R+WVYSGDTDGRVPV STR+SI+ +GL    E       WR WYH++Q
Sbjct  376   LPILKKFMNAGLRVWVYSGDTDGRVPVTSTRHSINAMGLHPKEEKGKRWGGWRAWYHKEQ  435

Query  1336  VGGWVQEY-EGLTFATFRGAGHAVPTFKP  1419
             V GW  EY EGLT AT RGAGH VP F P
Sbjct  436   VAGWAVEYEEGLTLATVRGAGHQVPLFAP  464



>ref|XP_004146676.1| PREDICTED: serine carboxypeptidase 24-like [Cucumis sativus]
 gb|KGN65166.1| hypothetical protein Csa_1G256750 [Cucumis sativus]
Length=478

 Score =   445 bits (1145),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 224/429 (52%), Positives = 294/429 (69%), Gaps = 12/429 (3%)
 Frame = +1

Query  154   SDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLN  333
             S+Q    +D +  LPGQP V F  Y+GYVTVN+  GR LFYWL E++SLP++KPLVLWLN
Sbjct  36    SEQQLQEKDRITFLPGQPTVTFSQYSGYVTVNQQQGRALFYWLTEATSLPEKKPLVLWLN  95

Query  334   GGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTD  513
             GGPGCSSI YGA++EIGPF ++   SSL +N YSWNK++NLLFLESP GVGFSY+NT+++
Sbjct  96    GGPGCSSIAYGASEEIGPFRINKTASSLYLNKYSWNKDSNLLFLESPAGVGFSYTNTTSN  155

Query  514   YANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL  693
               + GD+  A DA  FL +W  +FP YK R FYI+GESYAG YVP+LA+ I+D NK  S 
Sbjct  156   LEDSGDNRTAEDALIFLIQWMSRFPQYKYREFYISGESYAGHYVPQLAKRILDYNKANSQ  215

Query  694   -FIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCS  870
              FI+L+G L+GN  T    D  G V Y WSHA+ISD T+ +I+  C+F S+ T  +Q C 
Sbjct  216   SFINLKGFLVGNAVTDTNYDALGTVTYWWSHAMISDTTYNSILKHCNFTSDKT--SQQCD  273

Query  871   QAVNELLK-QYKEIDIYSLYTSVCI-----DSLTGSGDNSTPVFKTTSKMMPRIMAGYDP  1032
             + V   +  ++  +D YS+YT  C      +S+   G  ST  FK  S ++ R ++GYDP
Sbjct  274   EVVAYAMNHEFGNVDQYSIYTPKCPTIVPNNSVAAVGA-STIRFK--SSLLRRRVSGYDP  330

Query  1033  CLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGI  1212
             C ++YA+ YYN  +VQ A+H +       W  C+  +   W DS+ES+LP YK+LIAAG+
Sbjct  331   CTENYAERYYNLKEVQLAMHANVTGIPYRWTACSDVLIKNWKDSQESMLPTYKELIAAGL  390

Query  1213  RIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGA  1392
             RIWV+SGDTD  VPV +TR+++S L L I   W PWY + QVGGW + YEGLTFAT RGA
Sbjct  391   RIWVFSGDTDSVVPVTATRFALSHLNLHIKTRWYPWYTRGQVGGWTEVYEGLTFATVRGA  450

Query  1393  GHAVPTFKP  1419
             GH VP  +P
Sbjct  451   GHEVPLIQP  459



>ref|XP_002452974.1| hypothetical protein SORBIDRAFT_04g035810 [Sorghum bicolor]
 gb|EES05950.1| hypothetical protein SORBIDRAFT_04g035810 [Sorghum bicolor]
Length=488

 Score =   446 bits (1146),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 222/426 (52%), Positives = 293/426 (69%), Gaps = 10/426 (2%)
 Frame = +1

Query  148   EQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLW  327
             E S ++ A + +VA LPGQP V F  Y+GYVTVN + GR LFYWL E+      KPLVLW
Sbjct  52    EDSSRARAGDRVVA-LPGQPAVAFAQYSGYVTVNRDGGRALFYWLTEAVGDAAAKPLVLW  110

Query  328   LNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTS  507
             LNGGPGCSS+ YGA++EIGPF +  + + L +N YSWN+EANLLFLESP GVGFSY+NT+
Sbjct  111   LNGGPGCSSVAYGASEEIGPFRIKPNGTGLFLNKYSWNREANLLFLESPAGVGFSYTNTT  170

Query  508   TDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNK-D  684
             +D    GD+  A DA  FL  W  +FP Y+ R FYIAGESYAG YVP+LA  IV+ N+  
Sbjct  171   SDLKTTGDERTAQDALQFLISWMSRFPQYRHRDFYIAGESYAGHYVPQLARKIVEYNEAS  230

Query  685   PSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQD  864
             P+ FI+L+GIL+GN  T +  D  G V Y W+HA+ISD T++ I+ SC+F+S++   ++ 
Sbjct  231   PNPFINLKGILVGNAVTDNYYDNIGTVTYWWTHAMISDRTYKAILKSCNFSSSNI--SRF  288

Query  865   CSQAVNELLKQ-YKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLD  1041
             C++A+N  + Q + +ID YS+YT  C      +  ++  V +  + ++ R   GYDPC +
Sbjct  289   CNRAMNYAMNQEFGDIDQYSIYTPSC-----AAARSNATVLRFKNTLIRRRSFGYDPCTE  343

Query  1042  DYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIW  1221
              YA+ YYNRLDVQKA+H ++      W  C+  +   W DS+ S+LP YKKL+ AG+RIW
Sbjct  344   TYAEKYYNRLDVQKAMHANTTGIPYRWTACSDVLIKTWQDSEFSMLPTYKKLMKAGLRIW  403

Query  1222  VYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHA  1401
             V+SGDTD  VPV +TR+SIS LGL I   W PWY   QVGGW + YEGLTFA+ RGAGH 
Sbjct  404   VFSGDTDSVVPVTATRFSISHLGLKIKTRWYPWYSVGQVGGWSEVYEGLTFASVRGAGHE  463

Query  1402  VPTFKP  1419
             VP F+P
Sbjct  464   VPLFQP  469



>ref|NP_001136802.1| hypothetical protein precursor [Zea mays]
 gb|ACF82671.1| unknown [Zea mays]
 gb|AFW80677.1| hypothetical protein ZEAMMB73_449683 [Zea mays]
Length=484

 Score =   445 bits (1145),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 224/432 (52%), Positives = 288/432 (67%), Gaps = 25/432 (6%)
 Frame = +1

Query  178   DLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             D V  LPGQP       ++GYVTVNE +GR LFYW +E+ + P EKPLVLWLNGGPGCSS
Sbjct  39    DRVGLLPGQPRSPAVSQFSGYVTVNERSGRALFYWFFEAQTSPAEKPLVLWLNGGPGCSS  98

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             +GYGA  E+GP LV+S+ + L  N ++WNKEANLLFLESPVGVGFSY+NTS+D  NL D 
Sbjct  99    VGYGAASELGPLLVNSNGTGLEFNKFAWNKEANLLFLESPVGVGFSYTNTSSDLENLDDR  158

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNK--DPSLFIDLR  708
             F AND Y FL  WF +FP Y++  FYI+GESYAG YVP+LAE++ + NK  +    I L+
Sbjct  159   FVANDTYTFLVNWFNRFPQYRSHDFYISGESYAGHYVPQLAEVVYEHNKHLEAKQRIHLK  218

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G + GN ET D  D+ GMV++AWSH VISD+ +  +  +CDF  + T  + +C   ++ L
Sbjct  219   GFIAGNAETDDYYDYTGMVEFAWSHTVISDQLYERVKTACDFRLSPT--STECGHVMDLL  276

Query  889   LKQYKEIDIYSLYTSVCIDSLTGSGDNSTPV-------------FKTTSKMMPRIMAGYD  1029
                Y EIDIY++Y   C      + D S P+              K  SK   R+ +GYD
Sbjct  277   YHTYDEIDIYNVYAPKC-----NTDDGSAPLPSSSSSADDSSASSKQQSKRRLRMYSGYD  331

Query  1030  PCLDDYAKSYYNRLDVQKALHVSSGHHLRD--WRICNMSVFDGWSDSKESVLPIYKKLIA  1203
             PC   Y ++Y+NR+DVQK+LH ++   +RD  W +C+  VFD +     SVLPIY KL+ 
Sbjct  332   PCYSSYVETYFNRMDVQKSLHANTSGRIRDRRWSLCSDPVFDIYDMEVFSVLPIYSKLVK  391

Query  1204  AGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATF  1383
             AG++IWVYSGD DGRVPV+ +RY +  LGLPI  +W+PWY + QV G   EYEGLT AT 
Sbjct  392   AGLKIWVYSGDVDGRVPVIGSRYWVEALGLPIKSQWQPWYLKDQVAGRYVEYEGLTMATV  451

Query  1384  RGAGHAVPTFKP  1419
             RGAGHAVP  KP
Sbjct  452   RGAGHAVPQDKP  463



>ref|XP_004161865.1| PREDICTED: serine carboxypeptidase 24-like [Cucumis sativus]
Length=479

 Score =   445 bits (1145),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 224/429 (52%), Positives = 294/429 (69%), Gaps = 12/429 (3%)
 Frame = +1

Query  154   SDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLN  333
             S+Q    +D +  LPGQP V F  Y+GYVTVN+  GR LFYWL E++SLP++KPLVLWLN
Sbjct  37    SEQQLQEKDRITFLPGQPTVTFSQYSGYVTVNQQQGRALFYWLTEATSLPEKKPLVLWLN  96

Query  334   GGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTD  513
             GGPGCSSI YGA++EIGPF ++   SSL +N YSWNK++NLLFLESP GVGFSY+NT+++
Sbjct  97    GGPGCSSIAYGASEEIGPFRINKTASSLYLNKYSWNKDSNLLFLESPAGVGFSYTNTTSN  156

Query  514   YANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL  693
               + GD+  A DA  FL +W  +FP YK R FYI+GESYAG YVP+LA+ I+D NK  S 
Sbjct  157   LEDSGDNRTAEDALIFLIQWMSRFPQYKYREFYISGESYAGHYVPQLAKRILDYNKANSQ  216

Query  694   -FIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCS  870
              FI+L+G L+GN  T    D  G V Y WSHA+ISD T+ +I+  C+F S+ T  +Q C 
Sbjct  217   SFINLKGFLVGNAVTDTNYDALGTVTYWWSHAMISDTTYNSILKHCNFTSDKT--SQQCD  274

Query  871   QAVNELLK-QYKEIDIYSLYTSVCI-----DSLTGSGDNSTPVFKTTSKMMPRIMAGYDP  1032
             + V   +  ++  +D YS+YT  C      +S+   G  ST  FK  S ++ R ++GYDP
Sbjct  275   EVVAYAMNHEFGNVDQYSIYTPKCPTIVPNNSVAAVGA-STIRFK--SSLLRRRVSGYDP  331

Query  1033  CLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGI  1212
             C ++YA+ YYN  +VQ A+H +       W  C+  +   W DS+ES+LP YK+LIAAG+
Sbjct  332   CTENYAERYYNLKEVQLAMHANVTGIPYRWTACSDVLIKNWKDSQESMLPTYKELIAAGL  391

Query  1213  RIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGA  1392
             RIWV+SGDTD  VPV +TR+++S L L I   W PWY + QVGGW + YEGLTFAT RGA
Sbjct  392   RIWVFSGDTDSVVPVTATRFALSHLNLHIKTRWYPWYTRGQVGGWTEVYEGLTFATVRGA  451

Query  1393  GHAVPTFKP  1419
             GH VP  +P
Sbjct  452   GHEVPLIQP  460



>gb|KDO75846.1| hypothetical protein CISIN_1g0117382mg, partial [Citrus sinensis]
 gb|KDO75847.1| hypothetical protein CISIN_1g0117382mg, partial [Citrus sinensis]
Length=318

 Score =   439 bits (1129),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 203/277 (73%), Positives = 238/277 (86%), Gaps = 3/277 (1%)
 Frame = +1

Query  172   SEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCS  351
             +EDLV NLPGQP V+F+HYAGYVTVNE+NGR LFYW YE+ + P EKPLVLWLNGGPGCS
Sbjct  45    NEDLVTNLPGQPNVDFRHYAGYVTVNEHNGRALFYWFYEAMTRPQEKPLVLWLNGGPGCS  104

Query  352   SIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             S+GYGATQEIGPFLVD+D   L  NPY+WNKEAN+LFLESP+GVGFSYSNT+ DY  LGD
Sbjct  105   SVGYGATQEIGPFLVDTDGRGLQFNPYAWNKEANMLFLESPIGVGFSYSNTTNDYEMLGD  164

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSLFIDLRG  711
             DF AND+Y FLH+WFLKFPSY+ R FYIAGESYAG+Y+PEL E+I DRNKDPSL+IDL+G
Sbjct  165   DFTANDSYTFLHKWFLKFPSYRRRTFYIAGESYAGRYIPELTELIHDRNKDPSLYIDLKG  224

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELL  891
             ILLGNPETS  +DWQG+VDYAWSHAV+SDETH+ I+ +CDFNS+D WS+ +CS AV E+L
Sbjct  225   ILLGNPETSTAEDWQGLVDYAWSHAVVSDETHKIILRTCDFNSSDPWSSDECSDAVAEVL  284

Query  892   KQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKM  1002
             KQYKEIDIYS+YTSVC    + S ++S  + K TSKM
Sbjct  285   KQYKEIDIYSIYTSVCS---SNSLESSQLLMKRTSKM  318



>ref|XP_010108549.1| Serine carboxypeptidase 24 [Morus notabilis]
 gb|EXC19671.1| Serine carboxypeptidase 24 [Morus notabilis]
Length=494

 Score =   446 bits (1146),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 225/435 (52%), Positives = 296/435 (68%), Gaps = 25/435 (6%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D ++ LPGQP V F  ++GYVTVN+ +GR LFYWL E+SSLP++KPLVLWLNGGPGCSS+
Sbjct  45    DRISALPGQPKVAFSQFSGYVTVNQEHGRALFYWLTEASSLPEKKPLVLWLNGGPGCSSV  104

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
              YGA++EIGPF ++   SSL +N YSWN+EANLLFLESP GVGFSY+NTS+D  N GD  
Sbjct  105   AYGASEEIGPFRINITASSLFLNKYSWNREANLLFLESPAGVGFSYTNTSSDLKNSGDKR  164

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPS-LFIDLRG-  711
              A DA  FL  W  +FP YK R FYIAGESYAG YVP+LA+IIVD NK  S   I+L+G 
Sbjct  165   TAQDALIFLLRWMSRFPGYKYREFYIAGESYAGHYVPQLAKIIVDYNKKHSNSIINLKGF  224

Query  712   --------------ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDT  849
                            L+GN  T +  D  G V Y W+H++ISD+T+++I+  C+F+++  
Sbjct  225   IHQFVTTLHGKYPDFLVGNAVTDNYYDSIGTVTYWWTHSMISDQTYKSILNHCNFSADK-  283

Query  850   WSNQDCSQAVNELL-KQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFK---TTSKMMPRIM  1017
              + + C  AV   + +++ +ID YS+Y   C  +L  S +N+T + K     + ++ R +
Sbjct  284   -ATKPCDDAVYYAMNREFGDIDQYSIYAPTCTTTL--SDNNNTNIIKHMRLKNSLLRRRV  340

Query  1018  AGYDPCLDDYAKSYYNRLDVQKALHV-SSGHHLRDWRICNMSVFDGWSDSKESVLPIYKK  1194
             +GYDPC + YA+ YYNR DVQKA+H  ++G     W  C+  +   W DS+ SVLP YK 
Sbjct  341   SGYDPCTESYAEKYYNRKDVQKAMHANTTGSIPYKWTACSDVLIKNWKDSENSVLPTYKF  400

Query  1195  LIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTF  1374
             LI+AG+RIWV+SGDTD  VPV +TR+S+S L L I   W PWY   QVGGW + Y+GLTF
Sbjct  401   LISAGLRIWVFSGDTDSVVPVTATRFSLSHLNLTIKTRWYPWYSGGQVGGWTEVYKGLTF  460

Query  1375  ATFRGAGHAVPTFKP  1419
             AT RGAGH VP F+P
Sbjct  461   ATVRGAGHEVPLFQP  475



>ref|XP_003572740.1| PREDICTED: serine carboxypeptidase-like 34 [Brachypodium distachyon]
Length=482

 Score =   445 bits (1144),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 225/430 (52%), Positives = 280/430 (65%), Gaps = 23/430 (5%)
 Frame = +1

Query  172   SEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCS  351
             + D V +LPGQP V F  YAGYVTVNE +GR LFYW +E+++   EKPLVLWLNGGPGCS
Sbjct  40    AADRVWHLPGQPAVPFSQYAGYVTVNEPHGRALFYWFFEATAGAAEKPLVLWLNGGPGCS  99

Query  352   SIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             SIG+G  +E+GPFLV   +  L  NPYSWNKEANL+FLESPVGVGFSY+NTS+D  NLGD
Sbjct  100   SIGFGEAEELGPFLVQKGKPELKWNPYSWNKEANLMFLESPVGVGFSYTNTSSDLQNLGD  159

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDL  705
                A+DAY FL  WF +FP YK+  FY+ GESYAG YVP+L+E I D N       +I+ 
Sbjct  160   KITADDAYIFLVNWFKRFPQYKSHDFYVTGESYAGHYVPQLSEKIFDGNMQGPRENYINF  219

Query  706   RGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNE  885
             +G ++GN    D  D  GMV YAW HAVISD  +  + A CDF+  +      C  A+++
Sbjct  220   KGFMIGNALMDDETDQTGMVQYAWDHAVISDRVYADVKAHCDFSLENV--TDACDTALDD  277

Query  886   LLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIM------------AGYD  1029
                 Y+ ID+YSLYT VC    T +G +S+P F       P+I             AGYD
Sbjct  278   YFAVYQLIDMYSLYTPVC----TVAGSSSSP-FTGLRGAAPKIFSKYRGWYMKHPAAGYD  332

Query  1030  PCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAG  1209
             PC   Y+  Y+NR DVQ ALH +  H   +W  C+ ++   W+D+  S LPI +KLIA G
Sbjct  333   PCTSVYSGIYFNRPDVQAALHANVTHIAYNWTHCSDAI--KWNDAPFSTLPIIRKLIAGG  390

Query  1210  IRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRG  1389
             IR+WV+SGDTDGR+PV STR +++ LGL   +EW PWY   QVGGW   YEGLTF T RG
Sbjct  391   IRVWVFSGDTDGRIPVTSTRLTLNKLGLKTVQEWTPWYDHLQVGGWTITYEGLTFVTIRG  450

Query  1390  AGHAVPTFKP  1419
             AGH VP   P
Sbjct  451   AGHEVPMHTP  460



>ref|XP_002871313.1| hypothetical protein ARALYDRAFT_908774 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47572.1| hypothetical protein ARALYDRAFT_908774 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score =   445 bits (1144),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 220/423 (52%), Positives = 281/423 (66%), Gaps = 9/423 (2%)
 Frame = +1

Query  175   EDLVANLPGQPIVNFKHYAGYVTVN-ENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCS  351
             +DLV  LPGQP VNFKHYAGYV +  E   + LFYW +E+      +PLVLWLNGGPGCS
Sbjct  37    DDLVTGLPGQPPVNFKHYAGYVNLGPEQKQKALFYWFFEAQQNSSRRPLVLWLNGGPGCS  96

Query  352   SIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             SI YGA QE+GPFLV ++   LT N +SWNKEAN+LFLE+PVGVGFSY+N S D   LGD
Sbjct  97    SIAYGAAQELGPFLVHTNGDKLTYNNFSWNKEANMLFLEAPVGVGFSYTNNSMDLQKLGD  156

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPS-LFIDLR  708
             +  A D+ AFL  WF+KFP +++  FYI+GESYAG YVP+LAE+I DRNK      I+L+
Sbjct  157   EVTAADSLAFLINWFMKFPEFRSNEFYISGESYAGHYVPQLAEVIYDRNKKTKDSRINLK  216

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G ++GN   ++  D  G+VDYAWSHA+ISDE H  I  SC F  + T   + C       
Sbjct  217   GFMIGNAVINEATDMAGLVDYAWSHAIISDEVHTNIHGSCRFEEDTTNKTEQCYNNFKGF  276

Query  889   LKQYKEIDIYSLYTSVCIDSLTGSGDNS-----TPVFKTTSKMMPRIMAGYDPCLDDYAK  1053
             +  Y +IDIYS+YT VC+ SL+ S         +P   T   M  +  AGYDPC + YA+
Sbjct  277   MDAYNDIDIYSIYTPVCLSSLSSSSPRKPKIVVSPRLLTFDDMWVKFPAGYDPCTEGYAE  336

Query  1054  SYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSG  1233
             +Y+NR DVQ ALH +  +    +  C+  V   W+D+  +++P  +KL   G+RIW+YSG
Sbjct  337   NYFNRKDVQVALHANVTNLPYPYSPCS-GVIKRWNDAPSTIIPTIQKLSTGGLRIWIYSG  395

Query  1234  DTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYE-GLTFATFRGAGHAVPT  1410
             DTDGRVPV STRYSI  +GL +   WR W+H+ QV GWV+ Y  GLTF T RGAGH VP+
Sbjct  396   DTDGRVPVTSTRYSIKKMGLKVELPWRSWFHKSQVAGWVETYAGGLTFVTVRGAGHQVPS  455

Query  1411  FKP  1419
             F P
Sbjct  456   FAP  458



>ref|NP_196443.1| serine carboxypeptidase-like 35 [Arabidopsis thaliana]
 sp|Q9LEY1.1|SCP35_ARATH RecName: Full=Serine carboxypeptidase-like 35; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK44059.1|AF370244_1 putative serine-type carboxypeptidase II [Arabidopsis thaliana]
 emb|CAB93727.1| serine-type carboxypeptidase II-like protein [Arabidopsis thaliana]
 gb|AAL33815.1| putative serine-type carboxypeptidase II [Arabidopsis thaliana]
 gb|AED91275.1| serine carboxypeptidase-like 35 [Arabidopsis thaliana]
Length=480

 Score =   445 bits (1144),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 219/424 (52%), Positives = 281/424 (66%), Gaps = 10/424 (2%)
 Frame = +1

Query  175   EDLVANLPGQPIVNFKHYAGYVTVN-ENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCS  351
             +DLV  LPGQP VNFKHYAGYV +  E   + LFYW +E+      +PLVLWLNGGPGCS
Sbjct  37    DDLVTGLPGQPPVNFKHYAGYVNLGPEQKQKALFYWFFEAQQNSSRRPLVLWLNGGPGCS  96

Query  352   SIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             SI YGA QE+GPFLV  +   LT N +SWNKEAN+LFLE+PVGVGFSY+N S D   LGD
Sbjct  97    SIAYGAAQELGPFLVHDNGGKLTYNHFSWNKEANMLFLEAPVGVGFSYTNNSMDLQKLGD  156

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDL  705
             +  A+D+ AFL  WF+KFP +++  FYI+GESYAG YVP+LAE+I DRNK  +    I+L
Sbjct  157   EVTASDSLAFLINWFMKFPEFRSSEFYISGESYAGHYVPQLAEVIYDRNKKVTKDSSINL  216

Query  706   RGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNE  885
             +G ++GN   ++  D  G+VDYAWSHA+ISDE H +I  SC F  + T   + C      
Sbjct  217   KGFMIGNAVINEATDMAGLVDYAWSHAIISDEVHTSIHGSCSFEEDTTNKTEQCYNNFKG  276

Query  886   LLKQYKEIDIYSLYTSVCIDSLTGSGDNS-----TPVFKTTSKMMPRIMAGYDPCLDDYA  1050
              +  Y +IDIYS+YT VC+ SL  S         +P   T   +  +  AGYDPC + YA
Sbjct  277   FMDAYNDIDIYSIYTPVCLSSLLSSSPRKPKIVVSPRLLTFDDLWDKFPAGYDPCTESYA  336

Query  1051  KSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYS  1230
             ++Y+NR DVQ ALH +  +    +  C+  V   WSD+  +++PI +KL+  G+RIW+YS
Sbjct  337   ENYFNRKDVQVALHANVTNLPYPYSPCS-GVIKRWSDAPSTMIPIIQKLLTGGLRIWIYS  395

Query  1231  GDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYE-GLTFATFRGAGHAVP  1407
             GDTDGRVPV STRYSI  +GL +   WR W+H+ QV GWV+ Y  GL F T RGAGH VP
Sbjct  396   GDTDGRVPVTSTRYSIKKMGLKVESPWRSWFHKSQVAGWVETYAGGLNFVTVRGAGHQVP  455

Query  1408  TFKP  1419
                P
Sbjct  456   ALAP  459



>ref|XP_006406756.1| hypothetical protein EUTSA_v10020640mg [Eutrema salsugineum]
 ref|XP_006406794.1| hypothetical protein EUTSA_v10020638mg [Eutrema salsugineum]
 gb|ESQ48209.1| hypothetical protein EUTSA_v10020640mg [Eutrema salsugineum]
 gb|ESQ48247.1| hypothetical protein EUTSA_v10020638mg [Eutrema salsugineum]
Length=477

 Score =   444 bits (1143),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 221/426 (52%), Positives = 290/426 (68%), Gaps = 16/426 (4%)
 Frame = +1

Query  178   DLVANLPGQPI-VNFKHYAGYVTVNENNGRRLFYWLYES-SSLPDEKPLVLWLNGGPGCS  351
             D V NLP QP+     H++GYV+VN+ N R LF+W +E+ S  P  +PLV+WLNGGPGCS
Sbjct  36    DKVVNLPEQPVNPEISHFSGYVSVNQENTRSLFFWFFEALSEAPSIRPLVIWLNGGPGCS  95

Query  352   SIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             SIGYGA  E+GPF +  + +SL  N YSW +EAN+LFLESPVGVGFSY+N+S+D  NL D
Sbjct  96    SIGYGAASELGPFRIVENGTSLRFNQYSWVQEANMLFLESPVGVGFSYTNSSSDLDNLND  155

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRN--KDPSLFIDL  705
              F A DAY FL  WF ++P YK+R F+IAGESYAG Y P+LAE+I DRN  K     I+L
Sbjct  156   GFVAEDAYNFLVSWFARYPQYKSRDFFIAGESYAGHYAPQLAELIYDRNKVKPKDSIINL  215

Query  706   RGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNE  885
             +G ++GNP T D  D +G+++YAWSHAVISD  + T   +CDF S+  WS + C+ A+N 
Sbjct  216   KGFIVGNPLTDDEYDNKGILEYAWSHAVISDSLYDTAKRNCDFKSS-KWS-EPCNVAMNT  273

Query  886   LLKQYKEIDIYSLYTSVCID-------SLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDD  1044
             + ++YKEIDIY++Y   C         S  G+GD   P  K   K + R   GYDPC  D
Sbjct  274   MFEKYKEIDIYNIYAPKCTTNSSSSGASFLGAGDFKPPAIKDWFKRV-RWFEGYDPCYSD  332

Query  1045  YAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWV  1224
             YA+ Y+NR+DV+ +LH ++   +  W++CN S+   +  +  S+LP Y KLI AG++IWV
Sbjct  333   YAEKYFNRVDVRSSLHATT-RAVSRWKVCNASILQTYKFTVSSMLPTYSKLIKAGLKIWV  391

Query  1225  YSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYE-GLTFATFRGAGHA  1401
             YSGD DGRVPV+ +RY +  LGL +  EWR W+H  QVGG + EY+ GLTF T RGAGH 
Sbjct  392   YSGDADGRVPVIGSRYCVEALGLSVKSEWRSWFHNHQVGGRITEYDGGLTFVTVRGAGHL  451

Query  1402  VPTFKP  1419
             VP  KP
Sbjct  452   VPLNKP  457



>ref|XP_002275684.1| PREDICTED: serine carboxypeptidase 24 isoform X1 [Vitis vinifera]
 ref|XP_010656614.1| PREDICTED: serine carboxypeptidase 24 isoform X1 [Vitis vinifera]
 emb|CBI36538.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   444 bits (1142),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 221/418 (53%), Positives = 294/418 (70%), Gaps = 7/418 (2%)
 Frame = +1

Query  172   SEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCS  351
             S D ++ LPGQP V F  ++GYVTVNE++GR LFYWL E+++ P++KPLVLWLNGGPGCS
Sbjct  35    SLDRISALPGQPPVTFSQFSGYVTVNEHHGRALFYWLTEATTYPEKKPLVLWLNGGPGCS  94

Query  352   SIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             S+ YGA++EIGPF +    SSL +N YSWN+ AN+LFLESP GVGFSY+NTS+D  N GD
Sbjct  95    SVAYGASEEIGPFRLYRTGSSLYLNKYSWNRVANILFLESPAGVGFSYTNTSSDLKNSGD  154

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL-FIDLR  708
                A DA  FL  W  +FP YK R FYIAGESYAG YVP+LA+ I D NK  S   I+L+
Sbjct  155   RRTAQDALIFLVRWMSRFPKYKHREFYIAGESYAGHYVPQLAKKIHDYNKASSHPIINLK  214

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G ++GN  T +  D  G V + WSH++ISD ++R+I+  CDF +  T  ++ C +AV+  
Sbjct  215   GFMVGNAVTDNYYDSIGTVAFWWSHSMISDRSYRSIMDHCDFIAERT--SEKCDEAVSYA  272

Query  889   LK-QYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSYYN  1065
             +  ++ +ID YS+YT  C+ +L  S    +P FK +  ++ R ++GYDPC ++YA+ YYN
Sbjct  273   INHEFGDIDQYSIYTPSCM-ALPNSSTIRSPRFKNS--LVRRRVSGYDPCTENYAEKYYN  329

Query  1066  RLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDG  1245
             R DVQKA+H +S      W  C+  +   W+DS+ S+LPIYK+LI AG+RIWV+SGDTD 
Sbjct  330   RPDVQKAMHANSTGIPYKWTACSGVLIKYWNDSEASMLPIYKELIEAGLRIWVFSGDTDA  389

Query  1246  RVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
              VPV +TR+S++ L L +   W PWY   QVGGW + YEGLTFAT RGAGH VP F+P
Sbjct  390   VVPVTATRFSLNHLNLTVKTPWYPWYSGGQVGGWTEVYEGLTFATVRGAGHEVPLFQP  447



>gb|AFW80678.1| hypothetical protein ZEAMMB73_449683 [Zea mays]
Length=512

 Score =   446 bits (1146),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 224/432 (52%), Positives = 288/432 (67%), Gaps = 25/432 (6%)
 Frame = +1

Query  178   DLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             D V  LPGQP       ++GYVTVNE +GR LFYW +E+ + P EKPLVLWLNGGPGCSS
Sbjct  39    DRVGLLPGQPRSPAVSQFSGYVTVNERSGRALFYWFFEAQTSPAEKPLVLWLNGGPGCSS  98

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             +GYGA  E+GP LV+S+ + L  N ++WNKEANLLFLESPVGVGFSY+NTS+D  NL D 
Sbjct  99    VGYGAASELGPLLVNSNGTGLEFNKFAWNKEANLLFLESPVGVGFSYTNTSSDLENLDDR  158

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNK--DPSLFIDLR  708
             F AND Y FL  WF +FP Y++  FYI+GESYAG YVP+LAE++ + NK  +    I L+
Sbjct  159   FVANDTYTFLVNWFNRFPQYRSHDFYISGESYAGHYVPQLAEVVYEHNKHLEAKQRIHLK  218

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G + GN ET D  D+ GMV++AWSH VISD+ +  +  +CDF  + T  + +C   ++ L
Sbjct  219   GFIAGNAETDDYYDYTGMVEFAWSHTVISDQLYERVKTACDFRLSPT--STECGHVMDLL  276

Query  889   LKQYKEIDIYSLYTSVCIDSLTGSGDNSTPV-------------FKTTSKMMPRIMAGYD  1029
                Y EIDIY++Y   C      + D S P+              K  SK   R+ +GYD
Sbjct  277   YHTYDEIDIYNVYAPKC-----NTDDGSAPLPSSSSSADDSSASSKQQSKRRLRMYSGYD  331

Query  1030  PCLDDYAKSYYNRLDVQKALHVSSGHHLRD--WRICNMSVFDGWSDSKESVLPIYKKLIA  1203
             PC   Y ++Y+NR+DVQK+LH ++   +RD  W +C+  VFD +     SVLPIY KL+ 
Sbjct  332   PCYSSYVETYFNRMDVQKSLHANTSGRIRDRRWSLCSDPVFDIYDMEVFSVLPIYSKLVK  391

Query  1204  AGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATF  1383
             AG++IWVYSGD DGRVPV+ +RY +  LGLPI  +W+PWY + QV G   EYEGLT AT 
Sbjct  392   AGLKIWVYSGDVDGRVPVIGSRYWVEALGLPIKSQWQPWYLKDQVAGRYVEYEGLTMATV  451

Query  1384  RGAGHAVPTFKP  1419
             RGAGHAVP  KP
Sbjct  452   RGAGHAVPQDKP  463



>ref|XP_011006772.1| PREDICTED: serine carboxypeptidase-like 35 [Populus euphratica]
Length=474

 Score =   444 bits (1142),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 219/430 (51%), Positives = 290/430 (67%), Gaps = 30/430 (7%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V NLPGQP V F+HYAGYV +   N R LFYW +++     +KPLVLWLNGGPGCSSI
Sbjct  37    DRVTNLPGQPQVRFQHYAGYVKLGPQNQRALFYWFFQAKDDASQKPLVLWLNGGPGCSSI  96

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
              YGA QE+GPFLV  + + L +N +SWNK AN+LFLE+PVGVGFSY+N S D   LGD  
Sbjct  97    AYGAAQELGPFLVRGNGTQLILNKHSWNKAANMLFLEAPVGVGFSYTNNSEDLYKLGDKV  156

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNK--DPSLFIDLRG  711
              A+D++AFL  WF +FP++K+  FYIAGESYAG YVP+LAE+I +RNK    S +I+L+G
Sbjct  157   TADDSHAFLINWFKRFPNFKSHDFYIAGESYAGHYVPQLAELIYERNKGATKSSYINLKG  216

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELL  891
              ++GN   +D  D  G+VDYAWSHA+ISD+ +   I  CD   + T    +C        
Sbjct  217   FMIGNAVINDETDSAGIVDYAWSHAIISDQLYHN-IKECDHQESVT---NECVVHYRGFA  272

Query  892   KQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMM--PRIM-----------AGYDP  1032
             + Y +IDIYS+YT VC+   +          +T+S+++  PR++           +GYDP
Sbjct  273   EAYSDIDIYSIYTPVCLSEYST---------RTSSRLVVAPRLLSKLHDLVHNLPSGYDP  323

Query  1033  CLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGI  1212
             C +DYA+ ++NR DVQKALH +       +  C+ ++   W+DS E++LPI +KL+ AG+
Sbjct  324   CTEDYAEKFFNREDVQKALHANVTKLSYPYTPCSNAI-RKWNDSAETILPIIQKLLNAGL  382

Query  1213  RIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYE-GLTFATFRG  1389
             RIW+YSGDTDGRVPV STRYSI+ +GL +  EWR W+H+ QV GWV+ YE GL  AT RG
Sbjct  383   RIWIYSGDTDGRVPVTSTRYSINKMGLKVNEEWRAWFHKSQVAGWVETYERGLVLATIRG  442

Query  1390  AGHAVPTFKP  1419
             AGH VP F P
Sbjct  443   AGHQVPAFAP  452



>ref|XP_010548637.1| PREDICTED: serine carboxypeptidase 24 [Tarenaya hassleriana]
Length=466

 Score =   444 bits (1141),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 218/418 (52%), Positives = 284/418 (68%), Gaps = 10/418 (2%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D +  LPGQP V F  ++GYVTVNE +GR LFYWL ESSS P  KPL+LWLNGGPGCSSI
Sbjct  35    DRIKELPGQPKVKFSQFSGYVTVNERHGRALFYWLTESSSSPHTKPLLLWLNGGPGCSSI  94

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
              YGA++EIGPF ++   SSL +N +SWN+EANLLFLESP GVGFSY+NTS+D  + GD+ 
Sbjct  95    AYGASEEIGPFRINKTASSLYLNTFSWNREANLLFLESPSGVGFSYTNTSSDLKDTGDER  154

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKD-PSLFIDLRGI  714
              A +   FL +W  +FP YK R FYIAGESYAG YVP+LA+ I D NK      I+L+G 
Sbjct  155   TAQENLIFLIKWMSRFPQYKYRDFYIAGESYAGHYVPQLAKKIHDYNKAFTKPIINLKGF  214

Query  715   LLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELLK  894
             ++GN  T +  D  G V Y W+HA+ISD T+++I++ C+F +    ++  C ++VN  + 
Sbjct  215   MVGNAVTDNHYDSIGTVTYWWTHAMISDRTYKSILSHCNFTAEK--ASDQCDESVNYAMN  272

Query  895   -QYKEIDIYSLYTSVCIDSLTGSGDNSTPVF--KTTSKMMPRIMAGYDPCLDDYAKSYYN  1065
              ++  ID YS+YT  C+       + S P F     + +  R+++GYDPC + YA+ YYN
Sbjct  273   HEFGNIDQYSIYTPTCLS----HHNESKPGFVRMKNTLLRRRLVSGYDPCTESYAEKYYN  328

Query  1066  RLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDG  1245
             R DVQ+A H +       W  C+  +   W DS  SVLPIYK+LI AG+RIWV+SGDTD 
Sbjct  329   RADVQRAFHANLTRIPYKWTACSDVLIKNWRDSDSSVLPIYKELITAGLRIWVFSGDTDS  388

Query  1246  RVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
              VPV +TR+S+S L LP+   W PWY  KQV GW +EY+GLTFAT RGAGH VP F+P
Sbjct  389   VVPVTATRFSLSHLNLPVKTRWYPWYSGKQVAGWTEEYKGLTFATVRGAGHEVPLFQP  446



>gb|EEC78565.1| hypothetical protein OsI_18545 [Oryza sativa Indica Group]
 gb|AEO37081.1| grain size 5 [Oryza sativa Indica Group]
 gb|AEO37083.1| grain size 5 [Oryza sativa Indica Group]
Length=482

 Score =   444 bits (1142),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 215/423 (51%), Positives = 288/423 (68%), Gaps = 11/423 (3%)
 Frame = +1

Query  178   DLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYES--SSLPDEKPLVLWLNGGPGC  348
             D VA LPGQP       +AGYV V+E +GR LFYW +E+  S  P++KPL+LWLNGGPGC
Sbjct  42    DRVARLPGQPASPAVSQFAGYVGVDERHGRALFYWFFEAQASPAPEKKPLLLWLNGGPGC  101

Query  349   SSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLG  528
             SSIGYGA  E+GP  V    ++L    Y WNKEANLLFLESPVGVGFSY+NTS+D +NL 
Sbjct  102   SSIGYGAASELGPLRVARQGAALEFTKYGWNKEANLLFLESPVGVGFSYTNTSSDLSNLN  161

Query  529   DDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKD--PSLFID  702
             DDF A DAY+FL  WF +FP YK   FYI+GESYAG YVP+LA+++ +RNKD   S +I+
Sbjct  162   DDFVAEDAYSFLVNWFKRFPQYKDNEFYISGESYAGHYVPQLADLVYERNKDKRASTYIN  221

Query  703   LRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVN  882
             L+G ++GNP T D  D +G+ +YAWSHA++SD+ +  I  +C+F  N  W++ DC+ A+N
Sbjct  222   LKGFIVGNPLTDDYYDSKGLAEYAWSHAIVSDQVYERIKKTCNF-KNSNWTD-DCNAAMN  279

Query  883   ELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMP---RIMAGYDPCLDDYAK  1053
              +  QY +IDIY++Y   C+ + T +       F    +      ++ +GYDPC   YA+
Sbjct  280   IIFSQYNQIDIYNIYAPKCLLNSTSASSPDRAFFANNQEQFRWRIKMFSGYDPCYSSYAE  339

Query  1054  SYYNRLDVQKALHV-SSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYS  1230
              Y+N+ DVQ+A H  +SG     W++C+  + + ++ S  S+LPIY KLI AG+R+W+YS
Sbjct  340   DYFNKHDVQEAFHANASGLLPGKWQVCSDQILNSYNFSVLSILPIYSKLIKAGLRVWLYS  399

Query  1231  GDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPT  1410
             GD DGRVPV+S+RY +  LGLPI  +W+ WY  KQV G   EY G+T  T RGAGH VP 
Sbjct  400   GDADGRVPVISSRYCVDALGLPIKTDWQSWYLDKQVAGRFVEYHGMTMVTVRGAGHLVPL  459

Query  1411  FKP  1419
              KP
Sbjct  460   NKP  462



>gb|ABF70080.1| serine carboxypeptidase (carboxypeptidase D), putative [Musa 
acuminata]
Length=484

 Score =   444 bits (1142),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 220/428 (51%), Positives = 289/428 (68%), Gaps = 19/428 (4%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP V+F+ YAGYVTVNE++GR LFYW +E++   ++KPL+LWLNGGPGCSSI
Sbjct  41    DRVVGLPGQPPVSFRQYAGYVTVNESHGRALFYWFFEATHDVEKKPLLLWLNGGPGCSSI  100

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNK------EANLLFLESPVGVGFSYSNTSTDYA  519
             GYGA +E+GPFL+      L  N +SWNK      +ANLLFLESPVGVGFSY+NTS+D  
Sbjct  101   GYGAAEELGPFLMQKGVPELRFNQHSWNKGKKPIPKANLLFLESPVGVGFSYTNTSSDLQ  160

Query  520   NLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPS--L  693
             +LGD   A D+Y FL  W  +FP YK+  FYIAGESYAG YVP+L+E I D NK  S   
Sbjct  161   SLGDKITAEDSYIFLVNWLKRFPQYKSHDFYIAGESYAGHYVPQLSEKIFDENKKASKET  220

Query  694   FIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQ  873
             +I+ +G ++GN    D  D  GM+DYAW HAVISD  +  + ++C+F      + + C+ 
Sbjct  221   YINFKGFMIGNALMDDDTDQTGMIDYAWDHAVISDRVYHDVKSNCNFGIEP--ATEACNN  278

Query  874   AVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIM------AGYDPC  1035
             A+ E    Y+ ID+YSLY  VC  S+T S   S  +     K+  R        AGYDPC
Sbjct  279   ALREYFAVYRIIDMYSLYAPVCT-SIT-STRKSFQIEGAAPKLFSRYSGWHQKPAGYDPC  336

Query  1036  LDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIR  1215
             + DY++ Y+NR DVQ+ALH ++     +W  C+  V   W+DS  ++LP+ +KLI  G+R
Sbjct  337   VSDYSEVYFNRPDVQEALHANTTKIGYNWTHCS-EVVTKWNDSPATMLPVIRKLINGGLR  395

Query  1216  IWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAG  1395
             +WV+SGDTDGR+PV STRY+++ LG+   +EW+PWY +KQVGGW   +EGLTF T RGAG
Sbjct  396   VWVFSGDTDGRIPVTSTRYTLNKLGMKTIQEWKPWYDRKQVGGWTIVFEGLTFVTVRGAG  455

Query  1396  HAVPTFKP  1419
             H VPTF P
Sbjct  456   HQVPTFAP  463



>ref|XP_006394590.1| hypothetical protein EUTSA_v10004057mg [Eutrema salsugineum]
 gb|ESQ31876.1| hypothetical protein EUTSA_v10004057mg [Eutrema salsugineum]
Length=500

 Score =   444 bits (1143),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 220/435 (51%), Positives = 294/435 (68%), Gaps = 26/435 (6%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP V F+ YAGYVTVNE +GR LFYW +E++  P++KPL+LWLNGGPGCSS+
Sbjct  50    DRVKELPGQPPVKFRQYAGYVTVNETHGRALFYWFFEATHNPNKKPLLLWLNGGPGCSSV  109

Query  358   GYGATQEIGPFL-VDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             G+GA++E+GPF   +S +  L +NPYSWNK ANLLFLESPVGVGFSYSNTS D + LGD 
Sbjct  110   GFGASEELGPFFPQNSTQPKLKLNPYSWNKAANLLFLESPVGVGFSYSNTSRDISELGDS  169

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLR  708
               A D+Y FL  WF +FP YK+  FYIAGESYAG YVP+L+E + ++NK  S   FI+L+
Sbjct  170   ITAKDSYTFLVNWFKRFPQYKSHDFYIAGESYAGHYVPQLSEFVYNQNKIASKNDFINLK  229

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G+++GN    D  D +GM+DYA+ HAVISD  ++ +   CDF       +++C  A++E 
Sbjct  230   GLMIGNALLDDETDQKGMIDYAYDHAVISDGLYQRVNQHCDFKLEHV--SKECDGALDEY  287

Query  889   LKQYKEIDIYSLYTSVCIDSLTGS-------GDNSTPVFKTTSKMMPRIM----------  1017
                YK +D+YSLY+  C+ S   S       G+   P  +   +  PR++          
Sbjct  288   FDVYKILDMYSLYSPKCVPSTGNSSISQSVAGNRHLPAARGLFR--PRLVSHNEGWRKMA  345

Query  1018  AGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKL  1197
             AGYDPC  +Y + Y NR DVQ+ALH +  +    W  C+  +   WSD+  S+LP  + L
Sbjct  346   AGYDPCASEYTEKYMNRRDVQEALHANVTNIPYPWTHCSDRI-SFWSDAPASMLPTLRTL  404

Query  1198  IAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWY-HQKQVGGWVQEYEGLTF  1374
             ++AG+R+WV+SGDTDGR+PV +TRYS+  LGL   ++W PWY +++QVGGW  EY+GL F
Sbjct  405   VSAGLRVWVFSGDTDGRIPVTATRYSLKKLGLKTVQDWTPWYTNKQQVGGWTVEYDGLMF  464

Query  1375  ATFRGAGHAVPTFKP  1419
              T RGAGH VPTFKP
Sbjct  465   VTVRGAGHQVPTFKP  479



>ref|XP_007011905.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY29524.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=465

 Score =   443 bits (1140),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 218/416 (52%), Positives = 292/416 (70%), Gaps = 8/416 (2%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D +++LPGQP V F  ++GYVTVNE +GR LFYWL E+ ++P++KPLVLWLNGGPGCSS+
Sbjct  37    DRISSLPGQPPVTFSQFSGYVTVNEKHGRALFYWLTEAITVPEKKPLVLWLNGGPGCSSV  96

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
              YGA++EIGPF ++   SS+ +N YSWNKEA++LFLESP GVGFSY+N S++  + GD  
Sbjct  97    AYGASEEIGPFRINKTGSSVYLNKYSWNKEASILFLESPAGVGFSYTNISSNLEDSGDSR  156

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL-FIDLRGI  714
              A DA  FL  W  +FP YK R FYIAGESYAG YVP+LA+ I D NK  S   I+L+G 
Sbjct  157   TAQDALMFLIRWMSRFPQYKHREFYIAGESYAGHYVPQLAKKIHDYNKAYSHPIINLKGF  216

Query  715   LLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELLK  894
             ++GN  T +  D  G V + WSH++ISD T++ I+  C+F +    S+Q C  AV+  + 
Sbjct  217   IVGNAVTDNYYDSIGTVAFWWSHSMISDRTYKAIMKHCNFTAEK--SSQKCDDAVSYAMN  274

Query  895   -QYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSYYNRL  1071
              ++ +ID YS+YT  C+ +LT   +NS    +  + ++ R ++GYDPC ++YA+ YYNR 
Sbjct  275   HEFGDIDQYSIYTPSCL-ALT---NNSARHIRLKNTLLHRRVSGYDPCTENYAEKYYNRP  330

Query  1072  DVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGRV  1251
             DVQKA+H ++      W  C+  +   W DS+ SVLPIYK+LIAAG+RIWV+SGDTD  V
Sbjct  331   DVQKAMHANTTGIPYKWTACSDVLIKNWKDSENSVLPIYKELIAAGLRIWVFSGDTDSVV  390

Query  1252  PVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             PV +TR+S+S L L I   W PWY   QVGGW + Y+GLTFAT RGAGH VP F+P
Sbjct  391   PVTATRFSLSHLNLHIKTPWYPWYSGNQVGGWTEVYQGLTFATVRGAGHEVPLFQP  446



>ref|XP_006453596.1| hypothetical protein CICLE_v10008182mg [Citrus clementina]
 gb|ESR66836.1| hypothetical protein CICLE_v10008182mg [Citrus clementina]
Length=471

 Score =   443 bits (1140),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 215/416 (52%), Positives = 293/416 (70%), Gaps = 8/416 (2%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D ++ LPGQP V F  ++GYVTVNEN+GR LFYWL E++S   +KPLVLWLNGGPGCSS+
Sbjct  37    DRISALPGQPPVTFSQFSGYVTVNENHGRALFYWLTEAASSALKKPLVLWLNGGPGCSSV  96

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
              YGA++EIGPF ++ + SSL +N YSW++EAN+LFLESP GVGFSY+NTS++  + GD+ 
Sbjct  97    AYGASEEIGPFRINRNGSSLYLNKYSWSREANILFLESPAGVGFSYTNTSSNLKDSGDNR  156

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL-FIDLRGI  714
              A DA  FL  W  +FP YK R FYIAGESYAG YVP+LA+ I+D N   S   I+L+G 
Sbjct  157   TAQDALVFLIRWMSRFPQYKYREFYIAGESYAGHYVPQLAKKIIDYNSAYSRPIINLKGF  216

Query  715   LLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELLK  894
             ++GN  T +  D  G V + W+H++ISD+T+R+II  C+F++    S++ C   VN  + 
Sbjct  217   IVGNAVTDNYYDSIGTVTFWWTHSMISDKTYRSIINHCNFSAEK--SSKKCDDTVNYAMN  274

Query  895   -QYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSYYNRL  1071
              ++ +ID YS+YT  CI       +++    +  + ++ R ++GYDPC ++YA+ YYNR 
Sbjct  275   HEFGDIDQYSIYTPSCI----ALPNSTVRPMRLKNTLLRRRVSGYDPCTENYAEKYYNRQ  330

Query  1072  DVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGRV  1251
             +VQKALH +       W  C+  + + W DS++SVLP YK+LIAAG++IWV+SGDTD  V
Sbjct  331   EVQKALHANVTGIPYKWTACSDVLINNWKDSEDSVLPTYKQLIAAGLKIWVFSGDTDSVV  390

Query  1252  PVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             PV +TR+S+S L LPI   W PWY   QVGGW + Y+GLTFAT RGAGH VP F+P
Sbjct  391   PVTATRFSVSHLNLPIKTPWYPWYSGNQVGGWTEVYKGLTFATVRGAGHEVPLFQP  446



>gb|KHG14577.1| Serine carboxypeptidase 24 -like protein [Gossypium arboreum]
Length=465

 Score =   443 bits (1140),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 218/416 (52%), Positives = 293/416 (70%), Gaps = 8/416 (2%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D +++LPGQP V F  ++GYVTVNE +GR LFYW  E++ +P++KPL+LWLNGGPGCSS+
Sbjct  36    DRISSLPGQPPVGFSQFSGYVTVNEKHGRGLFYWFTEATRVPEKKPLLLWLNGGPGCSSV  95

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
              YGA++EIGPF ++   SSL +N YSWN EAN+LFLESP GVGFSY+NTS+D  + GDD 
Sbjct  96    AYGASEEIGPFRINKTGSSLYLNKYSWNMEANILFLESPAGVGFSYTNTSSDLKDSGDDR  155

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPS-LFIDLRGI  714
              A DA  FL  W  +FP+YK R FYIAGESYAG YVP+LA+ I D NK  S   I+L+G 
Sbjct  156   TAQDALIFLTRWMSRFPAYKHREFYIAGESYAGHYVPQLAKKIHDYNKAHSNPIINLKGF  215

Query  715   LLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELLK  894
             ++GN  T +  D  G V + WSH++ISD T+++I+  C+F +    S+  C  AV+  + 
Sbjct  216   MVGNAVTDNYYDSIGTVTFWWSHSMISDRTYKSIMKHCNFTAEK--SSTRCDDAVSYAIN  273

Query  895   -QYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSYYNRL  1071
              ++ +ID YS+YT  C+ +LT   + S    +  + ++ R ++GYDPC ++YA+ YYNR 
Sbjct  274   HEFGDIDQYSIYTPSCL-ALT---NKSARHIRLGNTLLHRQISGYDPCTENYAEKYYNRP  329

Query  1072  DVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGRV  1251
             DVQKA+H ++      W  C+  +   W+DS+ S+LPIYK+LIAAG+RIWV+SGDTD  V
Sbjct  330   DVQKAMHANTTGIPYKWTACSDVLIKNWNDSENSMLPIYKELIAAGLRIWVFSGDTDSVV  389

Query  1252  PVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             PV +TR+S+S L L I   W PWY   QVGGW + YEGLTFAT RGAGH VP F+P
Sbjct  390   PVTATRFSLSHLNLHIKTPWYPWYSGNQVGGWTEVYEGLTFATVRGAGHEVPLFQP  445



>ref|XP_008796482.1| PREDICTED: serine carboxypeptidase-like 34 [Phoenix dactylifera]
Length=483

 Score =   444 bits (1141),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 213/425 (50%), Positives = 288/425 (68%), Gaps = 12/425 (3%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP V+F+ +AGYVTVN+++GR LFYW +E++   ++KPL+LWLNGGPGCSSI
Sbjct  39    DRVDCLPGQPPVSFRQFAGYVTVNQSHGRALFYWFFEATHDVEKKPLLLWLNGGPGCSSI  98

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYG  +E+GPFL+      L  N +SWNKEANLLFLESPVGVGFSY+NTS+D   LGD  
Sbjct  99    GYGEAEELGPFLMQKGVPELKFNKHSWNKEANLLFLESPVGVGFSYTNTSSDLQQLGDKI  158

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLRG  711
              A DAY FL  WF +FP YK+  FYIAGESY G YVP+LAE I D NK+ +    ++ +G
Sbjct  159   TAIDAYTFLVNWFERFPQYKSHDFYIAGESYGGHYVPQLAEKIFDENKNVAEEDRVNFKG  218

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSN---QDCSQAVN  882
              ++GN    D  D  GM+DYAW HAVISD+ +  +  SC+F+      +   + C+ A+N
Sbjct  219   FMIGNALLDDDTDQTGMIDYAWDHAVISDQVYHDVKMSCNFSEVPVIGSPPTKACNDALN  278

Query  883   ELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIM------AGYDPCLDD  1044
             E    Y  ID+YSLY+ +C+ + + S   S  +     K+  +        AGYDPC+  
Sbjct  279   EYFAVYNIIDMYSLYSPICVQNTSSSMRKSFWIEGAAPKLFSKYRGWHQKPAGYDPCVSH  338

Query  1045  YAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWV  1224
             Y++ Y+NR DVQ+ALH +    + +W  C+ ++   W+DS  ++LP+ +KLI  G+R+WV
Sbjct  339   YSEVYFNRRDVQEALHANVTKLVYNWTHCSNAI-TKWNDSPMTMLPVIRKLINGGLRVWV  397

Query  1225  YSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAV  1404
             YSGDTDGR+PV STRY+++ LGL   ++W+PWY+ +QVGGW   +EGLTF T RGAGH V
Sbjct  398   YSGDTDGRIPVTSTRYTLNKLGLKTIQKWKPWYNHQQVGGWTIIFEGLTFVTIRGAGHEV  457

Query  1405  PTFKP  1419
             P F P
Sbjct  458   PEFAP  462



>ref|XP_011079399.1| PREDICTED: serine carboxypeptidase 24 [Sesamum indicum]
Length=462

 Score =   442 bits (1138),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 221/416 (53%), Positives = 285/416 (69%), Gaps = 8/416 (2%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D ++ LPGQP VNF  ++GYVTVNE  GR LFYWL E++S    KPLVLWLNGGPGCSS+
Sbjct  34    DRISALPGQPPVNFSQFSGYVTVNEQQGRALFYWLTEATSNAHTKPLVLWLNGGPGCSSV  93

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
              YGA++EIGPF ++   SSL +N YSWN+ AN+LFLESP GVGFSY+NTS++  + GD  
Sbjct  94    AYGASEEIGPFRINKTGSSLYLNKYSWNRVANILFLESPAGVGFSYTNTSSNLKDSGDKR  153

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVD-RNKDPSLFIDLRGI  714
              A DA  FL  W  +FP Y+ R FYI+GESYAG YVP+LA+ I D  N+     I+L+G 
Sbjct  154   TAQDALVFLIRWMHRFPQYRYRDFYISGESYAGHYVPQLAKKIYDYNNRSSHPIINLKGF  213

Query  715   LLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELLK  894
             ++GN  T +  D  G V Y WSH++ISD+T+++I+ SC+F S +T  +Q C  A+N  + 
Sbjct  214   IVGNAVTDNYYDNIGTVTYWWSHSIISDQTYKSIMTSCNFRSTNT--SQKCDDAINYAMN  271

Query  895   -QYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSYYNRL  1071
              ++ +ID YS+YT  C  S  G   N +P  K T  + PR  +GYDPC ++YA+ YYNR 
Sbjct  272   HEFGKIDQYSIYTPTCNSS--GEKTNRSPRLKNT-LISPR-FSGYDPCTENYAEKYYNRQ  327

Query  1072  DVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGRV  1251
             DVQKALH +S      W  C+  +   W DS+ S+LP YKKLIA G+RIWV+SGDTD  V
Sbjct  328   DVQKALHANSTGIPYKWTACSDVLIRNWKDSEASMLPTYKKLIAGGLRIWVFSGDTDSVV  387

Query  1252  PVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             PV +TR+S+S   L I   W PWY   QVGGW + Y+GLTFAT RGAGH VP F+P
Sbjct  388   PVTATRFSLSHFNLKIKTPWYPWYSGGQVGGWTEVYDGLTFATVRGAGHEVPLFQP  443



>ref|XP_010522153.1| PREDICTED: serine carboxypeptidase-like 35 [Tarenaya hassleriana]
Length=473

 Score =   442 bits (1138),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 219/438 (50%), Positives = 290/438 (66%), Gaps = 11/438 (3%)
 Frame = +1

Query  133   LSSNKEQSDQSW---ASEDLVANLPGQPIVNFKHYAGYVTVNENNGRR-LFYWLYESSSL  300
             ++S++E  ++ W     ED+V  LPGQP V F+HYAGYV +      + LFYW +E+ S 
Sbjct  17    IASSREVKEEEWYGKKEEDVVTGLPGQPAVEFRHYAGYVNLRPLQAHKALFYWFFEAQSN  76

Query  301   PDEKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVG  480
                +PLVLWLNGGPGCSSI YGA QE+GPFLV S+   LT+N YSWNK AN+LFLE+PVG
Sbjct  77    SSHRPLVLWLNGGPGCSSIAYGAAQELGPFLVHSNGDKLTLNKYSWNKAANMLFLEAPVG  136

Query  481   VGFSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAE  660
             VGFSY+N + D   LGD   A D+ +FL  WF +FP +++  FYIAGESYAG YVP+LAE
Sbjct  137   VGFSYTNHTMDLRKLGDQVTAEDSLSFLINWFKRFPEFRSNEFYIAGESYAGHYVPQLAE  196

Query  661   IIVDRNKDPSL--FIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDF  834
             +I DRNK  +   +I+L+G ++GN   ++  D  G+VDYAWSHA+ISD  +  I  SC F
Sbjct  197   LIYDRNKGVAKDSYINLKGFMIGNAVINEATDMAGLVDYAWSHAIISDNLYVNIHNSCKF  256

Query  835   NSNDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDN--STPVFKTTSKMMP  1008
             +  ++  +  C       ++ Y +IDIYS+Y  VC+ S + S      +P    +  +  
Sbjct  257   D-EESIDDVQCWDNFKGFMQAYADIDIYSIYAPVCLSSFSSSRPRFAMSPSLLASHDLSH  315

Query  1009  RIMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIY  1188
             R+  GYDPC +DY + Y+NR DVQ ALH +       +  C+  V  GW D+  +V+PI 
Sbjct  316   RLPTGYDPCTEDYVEKYFNRKDVQAALHANVTSLPYPYSSCS-GVIKGWGDAPSTVIPII  374

Query  1189  KKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEY-EG  1365
             +KL+ AG+RIW+YSGDTDGRVPV STRYSI  +GL +  EWR W+H+ QV GWV+ Y  G
Sbjct  375   RKLLNAGLRIWIYSGDTDGRVPVTSTRYSIKKMGLKVESEWRAWFHKNQVAGWVETYVGG  434

Query  1366  LTFATFRGAGHAVPTFKP  1419
             LTFAT RGAGH VP F P
Sbjct  435   LTFATVRGAGHQVPLFAP  452



>ref|XP_008443849.1| PREDICTED: serine carboxypeptidase 24-like isoform X1 [Cucumis 
melo]
Length=478

 Score =   442 bits (1138),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 222/428 (52%), Positives = 293/428 (68%), Gaps = 12/428 (3%)
 Frame = +1

Query  157   DQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNG  336
             +Q +  +D +  LPGQP V F  Y+GYVTVN+  GR LFYWL E++S P++KPLVLWLNG
Sbjct  37    EQQFQEKDKITFLPGQPAVTFSQYSGYVTVNQQQGRALFYWLTEATSSPEKKPLVLWLNG  96

Query  337   GPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDY  516
             GPGCSSI YGA++EIGPF ++   SSL +N YSWNK++NLLFLESP GVGFSY+NT+++ 
Sbjct  97    GPGCSSIAYGASEEIGPFRINKTASSLYLNKYSWNKDSNLLFLESPAGVGFSYTNTTSNL  156

Query  517   ANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL-  693
              + GD+  A DA  FL +W  +FP YK R FYI+GESYAG YVP+LA+ I+D NK  S  
Sbjct  157   EDSGDNRTAEDALIFLIQWMSRFPHYKYREFYISGESYAGHYVPQLAKKILDYNKANSQS  216

Query  694   FIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQ  873
             FI+L+G L+GN  T    D  G V Y WSHA+ISD T+ +I+  C+F S+ T  +Q C +
Sbjct  217   FINLKGFLVGNAVTDTNYDALGTVTYWWSHAMISDTTYNSILKHCNFTSDKT--SQQCDE  274

Query  874   AVNELLK-QYKEIDIYSLYTSVCI-----DSLTGSGDNSTPVFKTTSKMMPRIMAGYDPC  1035
              V   +  ++  +D YS+YT  C      +S+   G  ST  FK  S ++ R ++GYDPC
Sbjct  275   VVGYAMNHEFGNVDQYSIYTPKCPTIVPNNSVAAVGA-STIRFK--SSLLRRRVSGYDPC  331

Query  1036  LDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIR  1215
              ++YA+ YYN  +VQ A+H +       W  C+  +   W DS+ES+LP YK+LIAAG+R
Sbjct  332   TENYAEKYYNLKEVQLAMHANVTGIPYKWTACSDVLIKNWKDSQESMLPTYKELIAAGLR  391

Query  1216  IWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAG  1395
             IWV+SGDTD  VPV +TR+++S L L I   W PWY + QVGGW + YEGLTFAT RGAG
Sbjct  392   IWVFSGDTDSVVPVTATRFALSHLNLHIKTRWYPWYSRGQVGGWTEVYEGLTFATVRGAG  451

Query  1396  HAVPTFKP  1419
             H VP  +P
Sbjct  452   HEVPLIQP  459



>ref|XP_008361910.1| PREDICTED: serine carboxypeptidase-like 34 [Malus domestica]
Length=478

 Score =   442 bits (1138),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 217/422 (51%), Positives = 283/422 (67%), Gaps = 16/422 (4%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP ++FKHYAGYVTVN  +GR LFYW +E+++ P +KPL+LWLNGGPGCSSI
Sbjct  44    DQVTELPGQPPMSFKHYAGYVTVNHTHGRALFYWFFEATNNPQDKPLLLWLNGGPGCSSI  103

Query  358   GYGATQEIGPFL-VDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             GYGAT+E+GPF   +S E  L  NPY+WN  ANLLFLESPVGVGFSY+NTS D   L D 
Sbjct  104   GYGATEELGPFFPQNSTEPKLKFNPYTWNNAANLLFLESPVGVGFSYTNTSQDIEELDDK  163

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSLFIDLRGI  714
               A D+Y FL  WF +FP YK+  FYI+GESYAG Y P+L+E++ D++K+    I+L+G 
Sbjct  164   ITAEDSYNFLINWFKRFPQYKSHDFYISGESYAGHYAPQLSELVFDKSKENH--INLKGF  221

Query  715   LLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELLK  894
             ++GN    D  D +G++DYAW HAVISD  +  I   CDF+ N +   + C+  + E   
Sbjct  222   MIGNAAIDDESDQKGLIDYAWDHAVISDRLYHDIQKECDFSQNIS---EQCNTLLEEYYN  278

Query  895   QYKEIDIYSLYTSVCIDSLTGSGD-------NSTPVFKTTSKMMPRIMAGYDPCLDDYAK  1053
              Y  ID+YSLYT +C+ + + S           TP   + + +  +  AGYDPC  DY+ 
Sbjct  279   VYNIIDMYSLYTPMCLSNTSSSSSSRQSHTIQGTPTLFSRADVRHKRPAGYDPCTSDYSY  338

Query  1054  SYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSG  1233
              Y NR DVQKALH +       W  CN ++F  W ++  S+LP+  KL+A G+R+W+YSG
Sbjct  339   VYLNRPDVQKALHANVTKISYPWSHCNNNIF--W-NAPPSMLPVIGKLVAGGLRVWIYSG  395

Query  1234  DTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTF  1413
             DTDGR+PV STRY++  LGL I  +W PWY++KQVGGW   Y+GL F T RGAGH VP F
Sbjct  396   DTDGRIPVTSTRYALRKLGLKINEDWTPWYNKKQVGGWRVVYDGLMFVTIRGAGHEVPVF  455

Query  1414  KP  1419
              P
Sbjct  456   AP  457



>ref|XP_009393156.1| PREDICTED: serine carboxypeptidase-like 33 [Musa acuminata subsp. 
malaccensis]
Length=458

 Score =   441 bits (1135),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 217/425 (51%), Positives = 286/425 (67%), Gaps = 17/425 (4%)
 Frame = +1

Query  169   ASEDLVANLPGQPIVN-FKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPG  345
             +  D V +LPGQP      H++GY+TVN  NGR LFYW +E+ +LP ++PL+LWLNGGPG
Sbjct  23    SESDRVLDLPGQPPSPPISHFSGYITVNRENGRALFYWFFEAQTLPSDRPLLLWLNGGPG  82

Query  346   CSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANL  525
             CSSIGYGA  E+GP  V    + L  N Y+WNKEANLLFLESPVGVGFSY+NTS+D   L
Sbjct  83    CSSIGYGAAVELGPLRVKRHGTGLEFNKYAWNKEANLLFLESPVGVGFSYTNTSSDLTKL  142

Query  526   GDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPS--LFI  699
              D F A DAY FL  W  +FP Y++  FYIAGESYAG YVP+LAE++ DRNKD     +I
Sbjct  143   EDGFVAEDAYRFLVNWLRRFPQYQSHDFYIAGESYAGHYVPQLAELLYDRNKDTKNYPYI  202

Query  700   DLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAV  879
             + +G ++GNPET +  D +G+++YAWSH V+SD+ +R     CDF   + W+++ C+ A+
Sbjct  203   NFKGFIVGNPETDEYYDSKGLLEYAWSHTVVSDQVYRLAKRVCDFKLFN-WTDE-CNDAM  260

Query  880   NELLKQYKEIDIYSLYTSVCI-----DSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDD  1044
               +  QYKEIDIY++Y   C       S +   DN+    K +     R  AGYDPC   
Sbjct  261   EMVFNQYKEIDIYNVYAPKCTLPQSSSSSSFDEDNA----KKSLMRRIRRYAGYDPCFST  316

Query  1045  YAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWV  1224
             YA+ Y+NR+DVQ++LH +       W +CN S+   ++ +  SVLPIY KLI AG+RIW+
Sbjct  317   YAEEYFNRVDVQRSLHANVNGR---WSVCNDSILRTYNFTVFSVLPIYSKLIKAGLRIWL  373

Query  1225  YSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAV  1404
             YSGDTDGRVPV+ +RY +  L LP+  +W+PW+H  QVGG   E++GLT  T RGAGH V
Sbjct  374   YSGDTDGRVPVIGSRYCVEALRLPLKSQWQPWFHNHQVGGRFVEHQGLTMVTVRGAGHLV  433

Query  1405  PTFKP  1419
             P  KP
Sbjct  434   PLDKP  438



>ref|XP_004231499.1| PREDICTED: serine carboxypeptidase-like 34 [Solanum lycopersicum]
Length=467

 Score =   442 bits (1136),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 224/429 (52%), Positives = 285/429 (66%), Gaps = 12/429 (3%)
 Frame = +1

Query  142   NKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLV  321
             NK+  ++  A  D V  LPGQP V+FK YAGYVTVNE +GR LFYW +E+++   +KPL+
Sbjct  27    NKQLFEEQEA--DRVIELPGQPPVSFKQYAGYVTVNETHGRALFYWFFEATTNSSKKPLL  84

Query  322   LWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSN  501
             LWLNGGPGCSSIGYG  +E+GPFL   ++  L  N ++WNK ANLLFLESPVGVGFSY+N
Sbjct  85    LWLNGGPGCSSIGYGEAEELGPFLTQKNKPELKFNHFTWNKAANLLFLESPVGVGFSYTN  144

Query  502   TSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNK  681
             TSTD   LGD   A D+Y FL  WF +FP +K+  FYIAGESYAG YVP+LAE I D NK
Sbjct  145   TSTDIKELGDTVTAQDSYKFLVNWFRRFPQFKSHKFYIAGESYAGHYVPQLAEQIFDNNK  204

Query  682   DPSL--FIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWS  855
                    I+ +G ++GN    D  D +GM+DYAW HAVISD  + +I   C+F+      
Sbjct  205   KVKKEDRINFKGFMIGNALIDDETDQKGMIDYAWDHAVISDHLYDSIKRVCNFSLKPV--  262

Query  856   NQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPC  1035
               DC   +N+    YK +D+YSLY   C++S   +  NS     T    + R + GYDPC
Sbjct  263   GDDCDNLLNQYFAVYKILDMYSLYAPNCVNSNFSTLPNS---LSTIDGWLKRPL-GYDPC  318

Query  1036  LDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIR  1215
             L DY ++Y NRLDVQ ALH +       W  C+ ++   WSD+  S++P  KKLI +G+R
Sbjct  319   LSDYTETYMNRLDVQAALHANITKIPYPWTHCSNNI-SFWSDAPFSMVPTIKKLIDSGLR  377

Query  1216  IWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWY-HQKQVGGWVQEYEGLTFATFRGA  1392
             +W+YSGDTDGR+PV STR ++  LGL IT +W PWY + KQVGGW   Y+GL F T RGA
Sbjct  378   VWIYSGDTDGRIPVTSTRLTLKKLGLKITEDWTPWYTNNKQVGGWTVGYDGLYFVTIRGA  437

Query  1393  GHAVPTFKP  1419
             GH VPTFKP
Sbjct  438   GHQVPTFKP  446



>emb|CDX81089.1| BnaC03g03430D [Brassica napus]
Length=481

 Score =   442 bits (1137),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 221/427 (52%), Positives = 285/427 (67%), Gaps = 14/427 (3%)
 Frame = +1

Query  175   EDLVANLPGQPIVNFKHYAGYVTVNENNGRR-LFYWLYESSSLPDEKPLVLWLNGGPGCS  351
             +DLV  LPGQP VNF+HYAGYV +     ++ LFYW +E+      +PLVLWLNGGPGCS
Sbjct  36    DDLVTGLPGQPPVNFRHYAGYVNLGPRQKQKALFYWFFEAQRNSSGRPLVLWLNGGPGCS  95

Query  352   SIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             SI YGA QE+GPFLV S  S+LT N +SWNKEAN+LFLE+PVGVGFSY+N S D   LGD
Sbjct  96    SIAYGAAQELGPFLVRSSGSNLTFNKFSWNKEANMLFLEAPVGVGFSYTNNSMDLHKLGD  155

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDL  705
               +A D+ AFL  WF+KFP Y++  FYIAGESYAG YVP+LA  I DRNK  +    I+L
Sbjct  156   QVSAEDSLAFLINWFMKFPEYRSNEFYIAGESYAGHYVPQLANAIYDRNKKVTRGSHINL  215

Query  706   RGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQ--DCSQAV  879
             +G ++GN   ++  D  G+VDYAWSHA++SDE H  I   C F    T SNQ  +C+   
Sbjct  216   KGFMIGNAVINEETDMAGLVDYAWSHAIVSDEIHSNIHGMCRFEEEQT-SNQTVECTDNF  274

Query  880   NELLKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMP------RIMAGYDPCLD  1041
                ++ Y +IDIYS+YT VC+ S + S     P    + +++        + AGYDPC +
Sbjct  275   KAFMEAYSDIDIYSIYTPVCLSSYSSSFSPRKPKLIVSPRLLTSHDLWDSLPAGYDPCTE  334

Query  1042  DYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIW  1221
              YA++Y+NR DVQ ALH +  +    +  C+  V   W+D+  +V+PI +KL+A G+RIW
Sbjct  335   GYAENYFNRKDVQVALHANVTNLPYPYTPCS-GVIRRWNDAPPTVIPIIQKLLAGGLRIW  393

Query  1222  VYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYE-GLTFATFRGAGH  1398
             +YSGDTDGRVPV STRYSI  +   +   WR W+H+ QV GWV+ Y  GLTFAT RGAGH
Sbjct  394   IYSGDTDGRVPVTSTRYSIKKMRPKVESPWRSWFHKSQVAGWVETYAGGLTFATVRGAGH  453

Query  1399  AVPTFKP  1419
              VP F P
Sbjct  454   QVPVFAP  460



>ref|XP_002885191.1| hypothetical protein ARALYDRAFT_479190 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61450.1| hypothetical protein ARALYDRAFT_479190 [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   442 bits (1137),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 221/426 (52%), Positives = 297/426 (70%), Gaps = 16/426 (4%)
 Frame = +1

Query  178   DLVANLPGQPI-VNFKHYAGYVTVNENNGRRLFYWLYES-SSLPDEKPLVLWLNGGPGCS  351
             D V NLP QP+     H++GY+ VN+ N R LF+W +E+ S  P  +PLVLWLNGGPGCS
Sbjct  37    DKVVNLPQQPLNPKISHFSGYINVNQENTRSLFFWFFEALSESPSTRPLVLWLNGGPGCS  96

Query  352   SIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             SIGYGA  E+GPF V  + +SL+ N YSW +EAN+LFLESPVGVGFSY+N+S+D  NL D
Sbjct  97    SIGYGAASELGPFRVVENGTSLSFNQYSWVQEANILFLESPVGVGFSYTNSSSDLDNLND  156

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRN--KDPSLFIDL  705
              F A DAY F+  WF ++P YK+R F+IAGESYAG Y P+LAE+I DRN  K    FI+L
Sbjct  157   AFVAEDAYNFMVAWFARYPQYKSRDFFIAGESYAGHYAPQLAELIYDRNKVKPKDSFINL  216

Query  706   RGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNE  885
             +G ++GNP T D  D +G+++YAWSHAVISD+ + +   +CDF S++ WS + C+ A+N 
Sbjct  217   KGFIVGNPLTDDEYDNKGILEYAWSHAVISDDLYDSAKRNCDFKSSN-WS-EPCNVAMNT  274

Query  886   LLKQYKEIDIYSLYTSVCI-DSLTGSG------DNSTPVFKTTSKMMPRIMAGYDPCLDD  1044
             +  +YKEIDIY++Y   CI +S +G+       ++ +P  K   K + R   GYDPC  +
Sbjct  275   VFTKYKEIDIYNIYAPKCIANSSSGASYLDSGVNHKSPAVKDWFKRV-RWFEGYDPCYSN  333

Query  1045  YAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWV  1224
             YA+ Y+NR+DV+ +LH ++ +  R W++CN S+   +  +  S+LP Y KLI AG++IWV
Sbjct  334   YAEEYFNRVDVRSSLHATTRNVAR-WKVCNDSILQTYHFTVSSMLPTYSKLIKAGLKIWV  392

Query  1225  YSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYE-GLTFATFRGAGHA  1401
             YSGD DGRVPV+ +RY +  LGL +  EWR W+H  QVGG + EYE GLTF T RGAGH 
Sbjct  393   YSGDADGRVPVIGSRYCVEALGLSVKSEWRSWFHNHQVGGRITEYEGGLTFVTVRGAGHL  452

Query  1402  VPTFKP  1419
             VP  KP
Sbjct  453   VPLNKP  458



>ref|XP_006474013.1| PREDICTED: serine carboxypeptidase 24-like [Citrus sinensis]
Length=471

 Score =   442 bits (1136),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 214/416 (51%), Positives = 293/416 (70%), Gaps = 8/416 (2%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D ++ LPGQP V F  ++GYVTVNEN+GR LFYWL E++S   +KPLVLWLNGGPGCSS+
Sbjct  37    DRISALPGQPPVTFSQFSGYVTVNENHGRALFYWLTEAASSALKKPLVLWLNGGPGCSSV  96

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
              YGA++EIGPF ++ + SSL +N YSW++EAN+LF+ESP GVGFSY+NTS++  + GD+ 
Sbjct  97    AYGASEEIGPFRINRNGSSLYLNKYSWSREANILFVESPAGVGFSYTNTSSNLKDSGDNR  156

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL-FIDLRGI  714
              A DA  FL  W  +FP YK R FYIAGESYAG YVP+LA+ I+D N   S   I+L+G 
Sbjct  157   TAQDALVFLIRWMSRFPQYKYREFYIAGESYAGHYVPQLAKKIIDYNSAYSRPIINLKGF  216

Query  715   LLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELLK  894
             ++GN  T +  D  G V + W+H++ISD+T+R+II  C+F++    S++ C   VN  + 
Sbjct  217   IVGNAVTDNYYDSIGTVTFWWTHSMISDKTYRSIINHCNFSAEK--SSKKCDDTVNYAMN  274

Query  895   -QYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSYYNRL  1071
              ++ +ID YS+YT  CI       +++    +  + ++ R ++GYDPC ++YA+ YYNR 
Sbjct  275   HEFGDIDQYSIYTPSCI----ALPNSTVRPMRLKNTLLRRRVSGYDPCTENYAEKYYNRQ  330

Query  1072  DVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGRV  1251
             +VQKALH +       W  C+  + + W DS++SVLP YK+LIAAG++IWV+SGDTD  V
Sbjct  331   EVQKALHANVTGIPYKWTACSDVLINNWKDSEDSVLPTYKQLIAAGLKIWVFSGDTDSVV  390

Query  1252  PVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             PV +TR+S+S L LPI   W PWY   QVGGW + Y+GLTFAT RGAGH VP F+P
Sbjct  391   PVTATRFSLSHLNLPIKTPWYPWYSGNQVGGWTEVYKGLTFATVRGAGHEVPLFQP  446



>ref|XP_004954211.1| PREDICTED: serine carboxypeptidase 24-like [Setaria italica]
Length=478

 Score =   442 bits (1136),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 220/426 (52%), Positives = 287/426 (67%), Gaps = 9/426 (2%)
 Frame = +1

Query  148   EQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLW  327
             E+ ++     D V  LPGQP V F  Y+GYVTVNE  GR LFYWL E+      KPLVLW
Sbjct  41    EECEERARVGDRVEALPGQPPVAFAQYSGYVTVNEERGRALFYWLTEADGDAASKPLVLW  100

Query  328   LNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTS  507
             LNGGPGCSS+ YGA++EIGPF +  + + L +N YSWN+EANLLFLESP GVGFSY+NT+
Sbjct  101   LNGGPGCSSVAYGASEEIGPFRIKPNGTGLFLNKYSWNREANLLFLESPAGVGFSYTNTT  160

Query  508   TDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNK-D  684
             +D    GD+  A DA  FL  W  +FP Y+ R FYIAGESYAG YVP+LA  IV+ N+  
Sbjct  161   SDLKTTGDERTAQDALQFLISWMSRFPQYRHRDFYIAGESYAGHYVPQLARKIVEYNRAS  220

Query  685   PSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQD  864
             P  FI+L+GIL+GN  T +  D  G V Y W+HA+ISD T++ I+ SC+F+S +   ++ 
Sbjct  221   PYPFINLKGILVGNAVTDNYYDNIGTVTYWWTHAMISDRTYKAILKSCNFSSTNI--SRF  278

Query  865   CSQAVNELLKQ-YKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLD  1041
             C++A+N  + Q + +ID YS+YT  C      +  N+T V +  + ++ R   GYDPC +
Sbjct  279   CNRAMNYAMNQEFGDIDQYSIYTPSC----AAARANAT-VLRFKNTLIRRRSFGYDPCTE  333

Query  1042  DYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIW  1221
              YA+ YYNRLDVQKA+H ++      W  C+  +   W DS+ S+LP YK L+  G+RIW
Sbjct  334   TYAEKYYNRLDVQKAMHANTTRIPYRWTACSDVLIKTWQDSEFSMLPTYKMLMKTGVRIW  393

Query  1222  VYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHA  1401
             V+SGDTD  VPV +TR++IS LGL I   W PWY   QVGGW + YEGLTFA+ RGAGH 
Sbjct  394   VFSGDTDSVVPVTATRFAISHLGLKIKIRWYPWYSAGQVGGWSEVYEGLTFASVRGAGHE  453

Query  1402  VPTFKP  1419
             VP F+P
Sbjct  454   VPLFQP  459



>ref|XP_011022271.1| PREDICTED: serine carboxypeptidase-like 34 [Populus euphratica]
Length=470

 Score =   441 bits (1135),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 217/419 (52%), Positives = 289/419 (69%), Gaps = 11/419 (3%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D +  LPGQP V F+ Y+GYVTV+E  G+ LFYW +E+++ P++KPL+LWLNGGPGCSS+
Sbjct  37    DRILGLPGQPPVKFRQYSGYVTVDETYGKALFYWFFEATNQPEKKPLLLWLNGGPGCSSV  96

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             G+G  QE+GPFLV  +  S+  N Y+WNK ANLLFL+SP GVGFSY+NTS D    GD+ 
Sbjct  97    GFGEAQELGPFLV-KEGPSIVFNNYTWNKAANLLFLDSPAGVGFSYANTSLDVQ--GDNM  153

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPS--LFIDLRG  711
              A DA+ FL  WF +FP YK+  FYIAGESYAG YVP+LAE+I D+NK+ +   +I+L+G
Sbjct  154   TALDAHTFLLNWFKRFPQYKSSEFYIAGESYAGHYVPQLAEVIFDKNKNSTEDTYINLKG  213

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELL  891
              ++GN    D  D +GM+DYAW HA+ISD  + +I  +CDF +N T   ++C  ++ +  
Sbjct  214   FMIGNALLDDETDQKGMIDYAWDHAIISDGVYNSIKRNCDFTTNLT---EECWDSLLKYY  270

Query  892   KQYKEIDIYSLYTSVC-IDSLTGSGDNSTPVFKT--TSKMMPRIMAGYDPCLDDYAKSYY  1062
               YK ID+YSLY+  C +D       N   V K+  T  ++ RI AGYDPC  ++A  Y+
Sbjct  271   NVYKIIDVYSLYSPTCPLDQPFAKSTNMFAVPKSLKTIDILRRIPAGYDPCTMNHATDYF  330

Query  1063  NRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTD  1242
             N   VQ ALH +  +    + +CN  V   W DS  S+LP+ KKLI  GIR+WV+SGDTD
Sbjct  331   NLPYVQAALHANVTNIPGPYVLCNNDVNSAWQDSATSILPVIKKLINGGIRVWVFSGDTD  390

Query  1243  GRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             GRVPV STRY+++ LGL IT +W PWY+ ++VGGW   Y+GLTF T RGAGH VPT+ P
Sbjct  391   GRVPVTSTRYTLNKLGLNITEDWTPWYNHREVGGWTITYDGLTFITVRGAGHQVPTYAP  449



>ref|XP_006354981.1| PREDICTED: serine carboxypeptidase-like 34-like [Solanum tuberosum]
Length=466

 Score =   441 bits (1134),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 222/417 (53%), Positives = 278/417 (67%), Gaps = 10/417 (2%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP V+FK YAGYVTVNE +GR LFYW +E+++   +KPL+LWLNGGPGCSSI
Sbjct  36    DRVMELPGQPPVSFKQYAGYVTVNETHGRALFYWFFEATTNSSKKPLLLWLNGGPGCSSI  95

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
             GYG  +E+GPFL   ++  L +N ++WNK ANLLFLESPVGVGFSY+NTSTD   LGD  
Sbjct  96    GYGEAEELGPFLTQKNKPELKLNHFTWNKAANLLFLESPVGVGFSYTNTSTDIKELGDTI  155

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLRG  711
              A D+Y FL  WF +FP +K+  FYIAGESYAG YVP+LAE I D NK       I+ +G
Sbjct  156   TAQDSYKFLVNWFRRFPQFKSHKFYIAGESYAGHYVPQLAEQIFDNNKKLKKEDRINFKG  215

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELL  891
              ++GN    D  D +GM+DYAW HAVISD  + +I   C+F+        DC   +N+  
Sbjct  216   FMIGNALMDDETDQKGMIDYAWDHAVISDHLYDSIKRVCNFSLKPV--GDDCDNLLNQYF  273

Query  892   KQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSYYNRL  1071
               YK +D+YSLY   C++S   +  NS     T    + R  AGYDPCL DY ++Y NR 
Sbjct  274   AVYKILDMYSLYAPNCVNSNFSTLPNS---LSTIEGWLKR-PAGYDPCLSDYTETYMNRP  329

Query  1072  DVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGRV  1251
             DVQ ALH +       W  C+ ++   W+D+  S+LP  KKLI  G+R+WVYSGDTDGR+
Sbjct  330   DVQAALHANITKIPYPWTHCSNNI-SFWNDAPFSMLPTIKKLIDGGLRVWVYSGDTDGRI  388

Query  1252  PVLSTRYSISTLGLPITREWRPWY-HQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             PV STR ++  LGL IT +W PWY + KQVGGW   Y+GL F T RGAGH VPTFKP
Sbjct  389   PVTSTRLTLRKLGLKITEDWTPWYTNNKQVGGWTVGYDGLYFVTIRGAGHQVPTFKP  445



>gb|KFK25190.1| hypothetical protein AALP_AA8G078600 [Arabis alpina]
Length=482

 Score =   442 bits (1136),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 216/423 (51%), Positives = 285/423 (67%), Gaps = 12/423 (3%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVN-ENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             DLV  LPGQP VNF+HYAGYV++  +   + LFYW +E+      +PLVLWLNGGPGCSS
Sbjct  38    DLVTGLPGQPPVNFRHYAGYVSLGPQQKQKSLFYWFFEAQQNSSRRPLVLWLNGGPGCSS  97

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             I YGA QE+GPFL  +   +LT N +SWNKEAN+LFLE+PVGVGFSY+N S D + LGD 
Sbjct  98    IAYGAAQELGPFLARTKGDNLTFNDFSWNKEANMLFLEAPVGVGFSYTNNSMDLSKLGDQ  157

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPS--LFIDLR  708
               A D+ AFL  WF KFP +++  FYIAGESYAG YVP+LAE+I DRNK  +    I+L+
Sbjct  158   VTAEDSLAFLINWFTKFPEFRSNEFYIAGESYAGHYVPQLAEVIYDRNKKVTGNSRINLK  217

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G ++GN   ++  D  G+VD+AWSHAVISD+ H+ + +SC F    T     C  +V + 
Sbjct  218   GFMIGNAVINEETDMAGLVDFAWSHAVISDDLHKNVHSSCRFEEAQTNKTVQCYNSVKDF  277

Query  889   LKQYKEIDIYSLYTSVCIDSLTGSGDNS-----TPVFKTTSKMMPRI--MAGYDPCLDDY  1047
             ++ Y +IDIYS+YT VC+ S + S         +P   T+ +M   +   +GYDPC + Y
Sbjct  278   MEAYNDIDIYSIYTPVCLSSDSSSSPRKPKLIVSPRLLTSHEMWDSLPSASGYDPCTEVY  337

Query  1048  AKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVY  1227
             A++Y+NR DVQ ALH +       +  C+  V   W+D+  +++P  +KL+  G+RIW+Y
Sbjct  338   AQTYFNRKDVQVALHANVTKLPYPYTPCS-RVIKSWNDAPSTMIPTIQKLLTGGLRIWIY  396

Query  1228  SGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYE-GLTFATFRGAGHAV  1404
             SGDTDGRVPV STRYSI  +GL +   WR W+H+ QV GWV+ Y  GLTFAT RGAGH V
Sbjct  397   SGDTDGRVPVTSTRYSIKKMGLKVELPWRSWFHESQVAGWVETYAGGLTFATVRGAGHQV  456

Query  1405  PTF  1413
             PTF
Sbjct  457   PTF  459



>ref|XP_010910285.1| PREDICTED: serine carboxypeptidase-like 35 [Elaeis guineensis]
Length=477

 Score =   441 bits (1134),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 221/432 (51%), Positives = 285/432 (66%), Gaps = 21/432 (5%)
 Frame = +1

Query  184   VANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSIGY  363
             V  LPGQP V F HYAGYV V   + + LFYW +E+    ++KPLVLWLNGGPGCSS+ Y
Sbjct  25    VVGLPGQPPVEFPHYAGYVRVRREDEKALFYWFFEAEEGAEKKPLVLWLNGGPGCSSVAY  84

Query  364   GATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDFAA  543
             GA QE+GPFL+ S+  +LT+N YSWNK AN+LFLE+P+GVGFSY+N S+D   LGD   A
Sbjct  85    GAAQELGPFLIRSNSPNLTLNAYSWNKVANVLFLEAPIGVGFSYTNRSSDLGELGDRVTA  144

Query  544   NDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL--FIDLRGIL  717
              D+Y+FL  WF  FP  K+  FYIAGESYAG +VP+LAE+I + NK  S    I+ +G++
Sbjct  145   EDSYSFLLNWFQMFPDLKSHDFYIAGESYAGHFVPQLAELIYEGNKRASKHSHINFKGLM  204

Query  718   LGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQ---DCSQAVNEL  888
             +GN   +D  D  GMVDYAWSHA+ISDE H  I   CD    +    Q    C+ AV+ L
Sbjct  205   IGNAVLNDETDQLGMVDYAWSHAIISDELHAAIRRECDLFKEEEEGGQLSNACAPAVDAL  264

Query  889   LKQYKEIDIYSLYTSVCIDSLTGSGD----NSTPVFKTTSKM---MPRIMAGYDPCLDDY  1047
              + Y  IDIY++YT VC+ SL+         + P   +  +    M R+ AG+DPC  +Y
Sbjct  265   FQSYAVIDIYNIYTPVCLSSLSKPSRLTKLVAAPHLFSVHEAWHGMRRLPAGFDPCTGEY  324

Query  1048  AKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVY  1227
              + Y+NR DVQKALH +  H    +  C+  V   W+DS  +VLPI KK + AG+R+WVY
Sbjct  325   IERYFNREDVQKALHANITHLSYPYSGCS-GVIPKWNDSPPTVLPILKKFMNAGLRVWVY  383

Query  1228  SGDTDGRVPVLSTRYSISTLGLPITRE-------WRPWYHQKQVGGWVQEY-EGLTFATF  1383
             SGDTDGR+PV+STRYSI+ +GL   +E       W+PWYH++QV GW+ EY EGLT  T 
Sbjct  384   SGDTDGRIPVMSTRYSINVMGLHAKKEKGKTWGGWQPWYHKEQVAGWMVEYEEGLTLVTV  443

Query  1384  RGAGHAVPTFKP  1419
             RGAGH VP F P
Sbjct  444   RGAGHEVPLFAP  455



>ref|XP_010270860.1| PREDICTED: serine carboxypeptidase-like 33 [Nelumbo nucifera]
Length=478

 Score =   441 bits (1134),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 220/441 (50%), Positives = 292/441 (66%), Gaps = 16/441 (4%)
 Frame = +1

Query  130   SLSSNKEQSDQSWASEDLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYESSSLPD  306
             S+   +  + +     D V NLPGQP   +  H++GY+TV+++ GR LFYW +E+ S P 
Sbjct  23    SIKEAEAAAHRQLQQSDRVINLPGQPSTPSISHFSGYITVDKDRGRALFYWFFEAQSHPS  82

Query  307   EKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVG  486
              KPL+LWLNGGPGCSS+GYGA  E+GP  V S+   L  N ++WN+EANLLF+ESPVGVG
Sbjct  83    NKPLLLWLNGGPGCSSVGYGAATELGPLRVKSNGVGLEFNNFAWNREANLLFVESPVGVG  142

Query  487   FSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEII  666
             FSY+NTS+D   L D F A DAY+FL  W  +FP YKT  F+I+GESYAG YVP+LAE++
Sbjct  143   FSYTNTSSDLTKLDDGFVAEDAYSFLVNWLERFPQYKTHDFFISGESYAGHYVPQLAELV  202

Query  667   VDRNKDPSL-FIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSN  843
              DRN+D    FI+L+G ++GNPET    D +G+++YAWSHAVISD+ +      CDF   
Sbjct  203   HDRNQDRKYPFINLKGFIVGNPETDFFYDSKGLLEYAWSHAVISDQVYERAKKVCDFKLL  262

Query  844   DTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCI--DSLTGSGDNSTPVFKTTSKM-MPRI  1014
             + W N +C  A+N + +QY EIDIY++Y   C+  ++ T S  +S  V +      M RI
Sbjct  263   N-W-NDECIDAMNVVFRQYSEIDIYNIYAPTCLLTNASTTSSHHSNKVNQVEENYGMRRI  320

Query  1015  -----MAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVL  1179
                    GYDPC   Y + Y NR+DVQ +LH ++    + W++CN S+   ++ +  S +
Sbjct  321   RLTLGAEGYDPCYSKYTEVYLNRVDVQSSLHANAK---QTWKVCNESILQTYNFTVFSTM  377

Query  1180  PIYKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEY  1359
             PIY KLI AG+RIWVYSGD DGRVPV+ +RY    LGLP+   WR WYH  QVGG + +Y
Sbjct  378   PIYTKLIKAGLRIWVYSGDADGRVPVIGSRYWTEALGLPLKEPWRSWYHHSQVGGRIVKY  437

Query  1360  E-GLTFATFRGAGHAVPTFKP  1419
             E GLTF T RGAGH VP  KP
Sbjct  438   EGGLTFVTVRGAGHLVPLNKP  458



>ref|NP_188343.1| protein serine carboxypeptidase-like 33 [Arabidopsis thaliana]
 sp|Q9LSM9.2|SCP33_ARATH RecName: Full=Serine carboxypeptidase-like 33; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE75915.1| protein serine carboxypeptidase-like 33 [Arabidopsis thaliana]
Length=478

 Score =   441 bits (1134),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 223/426 (52%), Positives = 293/426 (69%), Gaps = 16/426 (4%)
 Frame = +1

Query  178   DLVANLPGQPI-VNFKHYAGYVTVNENNGRRLFYWLYES-SSLPDEKPLVLWLNGGPGCS  351
             D V NLP QP+     H++GYV VN+ N R LF+W +E+ S  P  +PLVLWLNGGPGCS
Sbjct  37    DKVVNLPEQPLNPKISHFSGYVNVNQENTRSLFFWFFEALSESPSTRPLVLWLNGGPGCS  96

Query  352   SIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             SIGYGA  E+GPF V  + +SL+ N YSW +EAN+LFLESPVGVGFSY+N+S+D  NL D
Sbjct  97    SIGYGAASELGPFRVVENGTSLSFNQYSWVQEANMLFLESPVGVGFSYTNSSSDLENLND  156

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNK--DPSLFIDL  705
              F A DAY F+  WF ++P YK+R F+IAGESYAG Y P+LAE+I DRNK      FI+L
Sbjct  157   AFVAEDAYNFMVAWFARYPQYKSRDFFIAGESYAGHYSPQLAELIYDRNKVQPKDSFINL  216

Query  706   RGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNE  885
             +G ++GNP T D  D +G+++YAWSHAVISD  + +   +CDF S++ WS + C+ A+N 
Sbjct  217   KGFIVGNPLTDDEYDNKGILEYAWSHAVISDHLYDSAKHNCDFKSSN-WS-EPCNVAMNT  274

Query  886   LLKQYKEIDIYSLYTSVCID------SLTGSGDN-STPVFKTTSKMMPRIMAGYDPCLDD  1044
             +  +YKEIDIY++Y   CI       S  G G N  +P  K   K + R   GYDPC  +
Sbjct  275   VFTKYKEIDIYNIYAPKCISNSSSGASYLGFGVNDKSPAVKDWFKRV-RWFEGYDPCYSN  333

Query  1045  YAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWV  1224
             YA+ Y+NR+DV+ +LH ++ +  R W++CN S+   +  +  S+LP Y KLI AG++IWV
Sbjct  334   YAEEYFNRVDVRLSLHATTRNVAR-WKVCNDSILQTYHFTVSSMLPTYSKLIKAGLKIWV  392

Query  1225  YSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYE-GLTFATFRGAGHA  1401
             YSGD DGRVPV+ +RY +  LG+ +  EWR W+H  QVGG + EYE GLTF T RGAGH 
Sbjct  393   YSGDADGRVPVIGSRYCVEALGISVKSEWRSWFHNHQVGGRITEYEGGLTFVTVRGAGHL  452

Query  1402  VPTFKP  1419
             VP  KP
Sbjct  453   VPLNKP  458



>ref|XP_002529402.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF32998.1| serine carboxypeptidase, putative [Ricinus communis]
Length=469

 Score =   441 bits (1133),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 221/429 (52%), Positives = 287/429 (67%), Gaps = 12/429 (3%)
 Frame = +1

Query  139   SNKEQSDQSWASEDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPL  318
             +NKEQ        D ++ LPGQP V F  ++GYVTVNE +GR LFYWL E++S P  KPL
Sbjct  32    ANKEQE------LDRISALPGQPPVTFSQFSGYVTVNEKHGRALFYWLTEATSSPHHKPL  85

Query  319   VLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYS  498
             VLWLNGGPGCSS+ YGA++EIGPF ++   SSL +N YSWN EAN+LFLESP GVGFSY+
Sbjct  86    VLWLNGGPGCSSVAYGASEEIGPFRINRTGSSLYLNKYSWNTEANILFLESPAGVGFSYT  145

Query  499   NTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRN  678
             NTS+D  + GD   A DA  FL  WF +FP YK R F+IAGESYAG YVP+LA+ I D N
Sbjct  146   NTSSDLKDSGDKRTAQDALVFLLRWFSRFPQYKYRDFFIAGESYAGHYVPQLAKKIHDYN  205

Query  679   KDPSL-FIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWS  855
             K  S   I+L+G ++GN  T +  D  G V + WSH++ISD T+R+II +C+F   D  +
Sbjct  206   KGHSHPIINLKGFIVGNAVTDNFYDSIGTVTFWWSHSMISDRTYRSIIDNCNFKE-DNKT  264

Query  856   NQDCSQAVNELLK-QYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDP  1032
             ++ C  AV   +  ++ +ID YS+YT  CI         S    +  + ++ R ++GYDP
Sbjct  265   SEKCDDAVTYAMNHEFGDIDQYSIYTPACIQL---PNKTSVRSLRLKNTLLRRRVSGYDP  321

Query  1033  CLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGI  1212
             C ++YA+ Y+NR  VQKA+H +       W  C+  +   W DS+ SVLPIYK+LIAAG+
Sbjct  322   CTENYAEKYFNRPQVQKAMHANITGIPYKWTACSDVLIKNWKDSEYSVLPIYKELIAAGL  381

Query  1213  RIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGA  1392
             RIWV+SGDTD  VPV +TR+S+S L L +   W PWY   QVGGW + Y GL FAT RGA
Sbjct  382   RIWVFSGDTDSVVPVTATRFSLSHLNLTVKTRWYPWYSGNQVGGWTEVYNGLNFATVRGA  441

Query  1393  GHAVPTFKP  1419
             GH VP F+P
Sbjct  442   GHEVPLFQP  450



>ref|XP_011018040.1| PREDICTED: serine carboxypeptidase 24-like isoform X1 [Populus 
euphratica]
Length=460

 Score =   440 bits (1131),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 216/416 (52%), Positives = 288/416 (69%), Gaps = 11/416 (3%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D +++L GQP V F  ++GYVTVNE +GR LFYWL E+++ PD+KPLVLWLNGGPGCSS+
Sbjct  35    DRISSLLGQPPVTFSQFSGYVTVNEKHGRALFYWLTEATTTPDKKPLVLWLNGGPGCSSV  94

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
              YGA++EIGPF ++   SSL +N YSWN+EAN+LFLESP GVGFSY+NTS++  + GD  
Sbjct  95    AYGASEEIGPFRINRTGSSLYMNKYSWNREANILFLESPAGVGFSYTNTSSNLKDSGDKR  154

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKD-PSLFIDLRGI  714
              A DA  F+  W  +FP YK R FYIAGESYAG YVP+LA+ I D NK  P  FI+L+G 
Sbjct  155   TAQDALVFVIRWMSRFPQYKYREFYIAGESYAGHYVPQLAKKIHDYNKAYPRPFINLKGF  214

Query  715   LLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVN-ELL  891
             ++GN  T    D  G + + W+H++ISD+T+R I+ +C+F  + T  ++ C  AVN  + 
Sbjct  215   IVGNAVTDSYYDSIGTIAFWWTHSMISDQTYRAILDNCNFTDDTT--SKKCDDAVNYAIY  272

Query  892   KQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSYYNRL  1071
              ++  ID YS+YT  C+        NST   K T  +  R ++GYDPC ++YA+ YYNR 
Sbjct  273   HEFGNIDPYSIYTPSCVQL-----PNSTMRLKNT--LFRRRVSGYDPCTENYAEKYYNRP  325

Query  1072  DVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGRV  1251
             +VQ+A+H +       W  C+  +   W DS+ S+LPIYK+LIAAG+RIWV+SGDTD  V
Sbjct  326   EVQEAMHANVTGIPYKWTACSNVLNRNWKDSESSMLPIYKELIAAGLRIWVFSGDTDSVV  385

Query  1252  PVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             PV +TR+ +S L LP+   W PWY   QVGGW + Y+GLTFAT RGAGH VP F+P
Sbjct  386   PVTATRFFLSHLDLPVKTRWYPWYSGDQVGGWTEVYKGLTFATVRGAGHEVPLFQP  441



>dbj|BAA94996.1| serine carboxypeptidase II-like protein [Arabidopsis thaliana]
Length=472

 Score =   440 bits (1132),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 223/426 (52%), Positives = 293/426 (69%), Gaps = 16/426 (4%)
 Frame = +1

Query  178   DLVANLPGQPI-VNFKHYAGYVTVNENNGRRLFYWLYES-SSLPDEKPLVLWLNGGPGCS  351
             D V NLP QP+     H++GYV VN+ N R LF+W +E+ S  P  +PLVLWLNGGPGCS
Sbjct  31    DKVVNLPEQPLNPKISHFSGYVNVNQENTRSLFFWFFEALSESPSTRPLVLWLNGGPGCS  90

Query  352   SIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             SIGYGA  E+GPF V  + +SL+ N YSW +EAN+LFLESPVGVGFSY+N+S+D  NL D
Sbjct  91    SIGYGAASELGPFRVVENGTSLSFNQYSWVQEANMLFLESPVGVGFSYTNSSSDLENLND  150

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNK--DPSLFIDL  705
              F A DAY F+  WF ++P YK+R F+IAGESYAG Y P+LAE+I DRNK      FI+L
Sbjct  151   AFVAEDAYNFMVAWFARYPQYKSRDFFIAGESYAGHYSPQLAELIYDRNKVQPKDSFINL  210

Query  706   RGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNE  885
             +G ++GNP T D  D +G+++YAWSHAVISD  + +   +CDF S++ WS + C+ A+N 
Sbjct  211   KGFIVGNPLTDDEYDNKGILEYAWSHAVISDHLYDSAKHNCDFKSSN-WS-EPCNVAMNT  268

Query  886   LLKQYKEIDIYSLYTSVCID------SLTGSGDN-STPVFKTTSKMMPRIMAGYDPCLDD  1044
             +  +YKEIDIY++Y   CI       S  G G N  +P  K   K + R   GYDPC  +
Sbjct  269   VFTKYKEIDIYNIYAPKCISNSSSGASYLGFGVNDKSPAVKDWFKRV-RWFEGYDPCYSN  327

Query  1045  YAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWV  1224
             YA+ Y+NR+DV+ +LH ++ +  R W++CN S+   +  +  S+LP Y KLI AG++IWV
Sbjct  328   YAEEYFNRVDVRLSLHATTRNVAR-WKVCNDSILQTYHFTVSSMLPTYSKLIKAGLKIWV  386

Query  1225  YSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYE-GLTFATFRGAGHA  1401
             YSGD DGRVPV+ +RY +  LG+ +  EWR W+H  QVGG + EYE GLTF T RGAGH 
Sbjct  387   YSGDADGRVPVIGSRYCVEALGISVKSEWRSWFHNHQVGGRITEYEGGLTFVTVRGAGHL  446

Query  1402  VPTFKP  1419
             VP  KP
Sbjct  447   VPLNKP  452



>ref|XP_003580170.1| PREDICTED: serine carboxypeptidase-like 35 [Brachypodium distachyon]
Length=499

 Score =   441 bits (1134),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 231/463 (50%), Positives = 294/463 (63%), Gaps = 34/463 (7%)
 Frame = +1

Query  130   SLSSNKEQSDQSWASE---DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSL  300
             S++S    +  SW+     DLV  LPGQP+V F HYAGYV V     + LFYW +E+   
Sbjct  16    SIASAGTTTGASWSPRPEADLVTGLPGQPVVGFTHYAGYVDVGTGGDKSLFYWFFEAEKE  75

Query  301   PDEKPLVLWLNGGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVG  480
             PD+KPL+LWLNGGPGCSSI YGA QE+GPFLV S+ ++LT N YSWNK  NLLFLE+PVG
Sbjct  76    PDKKPLLLWLNGGPGCSSIAYGAAQELGPFLVRSNGANLTRNAYSWNKAVNLLFLEAPVG  135

Query  481   VGFSYSNTSTDYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAE  660
             VGFSY+N ++D   LGD   A D+Y+FL  W  KFP +K R FYIAGESYAG YVP+LAE
Sbjct  136   VGFSYTNKTSDLRRLGDRVTAQDSYSFLLNWLNKFPEFKNRDFYIAGESYAGHYVPQLAE  195

Query  661   IIVDRNKDPS--LFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDF  834
             +I + NK  S    I+++G ++GN   +D  D  GMV+YAWSHAVISDE H  +   CD 
Sbjct  196   LIYEGNKAASRGRTINIKGFMIGNAVLNDATDQLGMVEYAWSHAVISDELHAAVTRECDS  255

Query  835   ---NSNDTWSNQDCSQAVNELLKQYKEIDIYSLYTSVCIDSLTGSGDN----------ST  975
                 ++    ++ CS AV   L  + +IDIYS+YT  C+ S + S  +          + 
Sbjct  256   FKEEADGGKPSKACSPAVRAFLGAFDDIDIYSIYTPTCLLSPSSSSSSTTSSPSRLVAAP  315

Query  976   PVFKTTS---KMMPRIMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVF  1146
              VF        M  R+ AGYDPC + Y K Y+NR DVQ+ALH +       +  C+  V 
Sbjct  316   RVFSQHEGWHAMTKRVPAGYDPCTEAYVKGYFNRGDVQRALHANRTGLPYPYSACS-EVI  374

Query  1147  DGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGL-PITRE-----  1308
               W+DS  +VLP+ KKL++AG+R+WVYSGDTDGRVPV STRYSI+ + L P  R+     
Sbjct  375   SKWNDSPATVLPVLKKLMSAGLRVWVYSGDTDGRVPVTSTRYSINAMKLRPRQRKQRAGA  434

Query  1309  -----WRPWYHQKQVGGWVQEY-EGLTFATFRGAGHAVPTFKP  1419
                  WR WYH++QV GW  EY EG+T  T RGAGH VP F P
Sbjct  435   AEWGGWRAWYHRRQVAGWAVEYEEGMTLVTLRGAGHQVPLFAP  477



>ref|XP_006287630.1| hypothetical protein CARUB_v10000841mg [Capsella rubella]
 gb|EOA20528.1| hypothetical protein CARUB_v10000841mg [Capsella rubella]
Length=483

 Score =   441 bits (1133),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 220/424 (52%), Positives = 278/424 (66%), Gaps = 10/424 (2%)
 Frame = +1

Query  175   EDLVANLPGQPIVNFKHYAGYVTVN-ENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCS  351
             +DLV  LPGQ  VNFKHYAGYV +  E   + LFYW +E+      +PLVLWLNGGPGCS
Sbjct  40    DDLVTGLPGQQTVNFKHYAGYVNLGPEQKQKALFYWFFEAQQNSPRRPLVLWLNGGPGCS  99

Query  352   SIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             SI YGA QE+GPFLV ++ ++LT N +SWNKEAN+LFLE+PVGVGFSY+N   D   LGD
Sbjct  100   SIAYGAAQELGPFLVHTNGANLTYNNFSWNKEANMLFLEAPVGVGFSYTNNPMDLQKLGD  159

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPS--LFIDL  705
                A D+  FL  WF+KFP ++T  FYI+GESYAG YVP+LAE I DRNK  +    I+L
Sbjct  160   QVTAADSLVFLINWFMKFPEFRTNDFYISGESYAGHYVPQLAEAIYDRNKKVTKDTQINL  219

Query  706   RGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNE  885
             +G ++GN   ++  D  G+VDYAWSHA+ISDE H  I  SC F    T   Q C      
Sbjct  220   KGFMIGNAVINEATDMAGLVDYAWSHAIISDEVHTNIHGSCRFEEEATNKTQQCYANFKG  279

Query  886   LLKQYKEIDIYSLYTSVCIDSLTGSGDNS-----TPVFKTTSKMMPRIMAGYDPCLDDYA  1050
              +  Y +IDIYS+YT VC+ SL+ S         +P   T+  M   + AGYDPC + YA
Sbjct  280   FMDAYSDIDIYSIYTPVCLSSLSSSSPRKPKIVVSPRLLTSDDMWDTMPAGYDPCTEGYA  339

Query  1051  KSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYS  1230
             + Y+NR DVQ ALH +  +    +  C+  V   W+D+  +V+PI +KL   G+RIW+YS
Sbjct  340   EKYFNRKDVQVALHANVTNIPYPYTPCS-DVIRKWNDAPSTVIPIIQKLSKGGLRIWIYS  398

Query  1231  GDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYE-GLTFATFRGAGHAVP  1407
             GDTDGRVPV STRYSI  +GL +   WR W+H+ QV GWV+ Y  GL+F T RGAGH VP
Sbjct  399   GDTDGRVPVTSTRYSIKKMGLKVESPWRSWFHKSQVAGWVETYAGGLSFVTVRGAGHQVP  458

Query  1408  TFKP  1419
              F P
Sbjct  459   AFAP  462



>ref|XP_009351733.1| PREDICTED: serine carboxypeptidase-like 34 [Pyrus x bretschneideri]
Length=476

 Score =   440 bits (1132),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 218/420 (52%), Positives = 279/420 (66%), Gaps = 15/420 (4%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP V+FKHY GYVTVN  +GR LFYW +E+++ P +KPL+LWLNGGPGCSSI
Sbjct  45    DQVIELPGQPPVSFKHYTGYVTVNHTHGRALFYWFFEATNNPQDKPLLLWLNGGPGCSSI  104

Query  358   GYGATQEIGPFL-VDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             GYGAT+E+GPF   +S +  L  NPY+WN  ANLLFLESPVGVGFSY+NTS D   L D 
Sbjct  105   GYGATEELGPFFPQNSTDPKLKFNPYTWNNAANLLFLESPVGVGFSYTNTSQDIEELDDK  164

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSLFIDLRGI  714
               A D+Y FL  WF +FP YK+  FYI+GESYAG Y P+L+E++ DR+K+    I+L+G 
Sbjct  165   ITAEDSYNFLINWFKRFPQYKSHDFYISGESYAGHYAPQLSELVFDRSKENH--INLKGF  222

Query  715   LLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELLK  894
             ++GN    D  D +G++DYAW HAVISD  +  I   CDF  N +   + C+  + E   
Sbjct  223   MIGNAAIDDESDQKGLIDYAWDHAVISDRLYHDIQKECDFGQNIS---EQCNTLLEEYYN  279

Query  895   QYKEIDIYSLYTSVCIDSLTGSGDNST-----PVFKTTSKMMPRIMAGYDPCLDDYAKSY  1059
              Y   D+YSLYT +C+ + + SG + T      +F  T     R  AGYDPC  DY+  Y
Sbjct  280   VYNITDMYSLYTPMCLSNTSSSGQSHTIQGASTLFSRTDVRHKR-PAGYDPCTSDYSYVY  338

Query  1060  YNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDT  1239
              NR DVQKALH +       W  CN ++F  W ++  S+LP+  KL+A G+R+W+YSGDT
Sbjct  339   LNRPDVQKALHANVTKISYPWSHCNDNIF--W-NAPSSMLPVIGKLVAGGLRVWIYSGDT  395

Query  1240  DGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             DGRVPV STRY++  L L I  +W PWY++KQVGGW   Y+GL F T R AGH VP F P
Sbjct  396   DGRVPVTSTRYALRKLRLKINEDWTPWYNKKQVGGWRVVYDGLMFVTIRAAGHEVPVFAP  455



>ref|NP_001042932.1| Os01g0332500 [Oryza sativa Japonica Group]
 dbj|BAD53500.1| putative serine carboxypeptidase II, CP-MII [Oryza sativa Japonica 
Group]
 dbj|BAF04846.1| Os01g0332500 [Oryza sativa Japonica Group]
Length=500

 Score =   441 bits (1133),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 212/422 (50%), Positives = 286/422 (68%), Gaps = 10/422 (2%)
 Frame = +1

Query  178   DLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             D VA LPGQP       ++GY+TVN  NGR LFYW +E+ +LP +KPL+LWLNGGPGCSS
Sbjct  61    DRVAFLPGQPSSPKVSQFSGYITVNRQNGRALFYWFFEAQALPSQKPLLLWLNGGPGCSS  120

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             +GYGA  E+GP  V  + + L  N ++WNKEANLLFLESPVGVGFSY+NTS+D   L D 
Sbjct  121   VGYGAASELGPLRVSRNGAGLEFNKFAWNKEANLLFLESPVGVGFSYTNTSSDLTKLNDG  180

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKD--PSLFIDLR  708
             F A DAY FL  W  +FP YK   FYI+GESYAG YVP+LA+++ +RNKD   + +I L+
Sbjct  181   FVAEDAYNFLVNWLDRFPQYKDHEFYISGESYAGHYVPQLADLVYERNKDKKANRYIKLK  240

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G ++GNP T D  D +G+V+YAWSHAV+SD  +  +   C+F  ++ W+N DC++A++ +
Sbjct  241   GFIVGNPLTDDQYDSKGLVEYAWSHAVVSDGIYERVKKVCNFKISN-WTN-DCNEAMSSI  298

Query  889   LKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSK----MMPRIMAGYDPCLDDYAKS  1056
              +QY+EIDIY++Y   C  + T          + + +       R+ +GYD C   YA+ 
Sbjct  299   FRQYQEIDIYNIYAPKCNLAQTSRVAAFDHALEASDQEQFSRRIRMFSGYDACYSSYAEK  358

Query  1057  YYNRLDVQKALHVSSGHHL-RDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSG  1233
             Y+N+ DVQKA H ++   L   W++C+ S+   ++ S  SVLPIY KLI AG+RIW+YSG
Sbjct  359   YFNKPDVQKAFHANANGMLPGKWKVCSDSILRSYNFSVLSVLPIYSKLIKAGLRIWLYSG  418

Query  1234  DTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTF  1413
             D DGRVPV+ +RY +  LGL I R+W+PWY  +QV G   EY+G+T  T RGAGH VP  
Sbjct  419   DADGRVPVIGSRYCVEALGLHIKRDWQPWYLNRQVAGRFVEYDGMTMVTIRGAGHLVPLN  478

Query  1414  KP  1419
             KP
Sbjct  479   KP  480



>ref|NP_001042933.1| Os01g0332800 [Oryza sativa Japonica Group]
 dbj|BAD53501.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAF04847.1| Os01g0332800 [Oryza sativa Japonica Group]
 dbj|BAG90446.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE54479.1| hypothetical protein OsJ_01586 [Oryza sativa Japonica Group]
Length=480

 Score =   440 bits (1131),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 211/422 (50%), Positives = 288/422 (68%), Gaps = 10/422 (2%)
 Frame = +1

Query  178   DLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             D VA LPGQP       ++GY+TVN  NGR LFYW +E+ +LP +KPL+LWLNGGPGCSS
Sbjct  39    DRVAFLPGQPRSPQMSQFSGYITVNSQNGRALFYWFFEAQALPSKKPLLLWLNGGPGCSS  98

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             +GYGA  E+GP +V+ + + L  N ++WN EANLLFLESPVGVGFSY+NTS+D  ++ D 
Sbjct  99    VGYGAASELGPLMVNGNGTGLEFNKFAWNNEANLLFLESPVGVGFSYTNTSSDLESIDDR  158

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNK--DPSLFIDLR  708
             F A D Y FL  WF +FP YK   FYI+GESYAG YVP+LA+++ +RNK  + +  I+L+
Sbjct  159   FVAEDTYNFLVNWFKRFPQYKNHDFYISGESYAGHYVPQLADVVYERNKHVETNQHINLK  218

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G ++GN ET D  D++G+V++AWSH+VISD+ ++ +   CDF  +    + +C+  +  +
Sbjct  219   GFIVGNAETDDYYDYKGLVEFAWSHSVISDQLYKHVNNVCDFRLSP--RSNECNHVMGYI  276

Query  889   LKQYKEIDIYSLYTSVCI--DSLTGSGDNSTPVFKTTSKMM-PRIMAGYDPCLDDYAKSY  1059
               QY  IDI+++Y   C   DS   S   ST       ++   R+ +GYDPC   + + Y
Sbjct  277   YDQYDMIDIFNVYAPKCNTDDSSLFSTSYSTADMNAKKRLKGTRMYSGYDPCYSSHIEDY  336

Query  1060  YNRLDVQKALHVSSGHHLRD--WRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSG  1233
              N++DVQK+LH ++   ++D  W IC+ S+FD +  +  SVLPIY KLI AG+RIWVYSG
Sbjct  337   MNKMDVQKSLHANTSGLIKDRKWSICSYSIFDNYDITVFSVLPIYSKLIKAGLRIWVYSG  396

Query  1234  DTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTF  1413
             D DGRVPV+ +RY +  LGLP+  +W+PWY   QV G   EY+GLT AT RGAGHAVP  
Sbjct  397   DVDGRVPVIGSRYCVEALGLPVKSQWQPWYLNNQVAGRFVEYQGLTMATVRGAGHAVPQD  456

Query  1414  KP  1419
             KP
Sbjct  457   KP  458



>ref|XP_006285794.1| hypothetical protein CARUB_v10007268mg [Capsella rubella]
 gb|EOA18692.1| hypothetical protein CARUB_v10007268mg [Capsella rubella]
Length=467

 Score =   439 bits (1130),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 213/418 (51%), Positives = 288/418 (69%), Gaps = 5/418 (1%)
 Frame = +1

Query  175   EDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSL-PDEKPLVLWLNGGPGCS  351
             +D +  LPGQP V F  Y+GYV VNE++GR LFYWL ESSSL P  KPL+LWLNGGPGCS
Sbjct  32    KDRIKALPGQPKVAFSQYSGYVNVNESHGRALFYWLTESSSLSPHTKPLLLWLNGGPGCS  91

Query  352   SIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             SI YGA++EIGPF ++   S+L +N ++WN++ANLLFLESP GVG+SY+NTS+D  + GD
Sbjct  92    SIAYGASEEIGPFRINKTGSNLYLNKFAWNRDANLLFLESPAGVGYSYTNTSSDLNDSGD  151

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL-FIDLR  708
             +  A D   FL +W  KFP YK R FYIAGESYAG YVP+LA+ I D NK  S   I+L+
Sbjct  152   ERTAQDNLIFLIKWLSKFPQYKYRDFYIAGESYAGHYVPQLAKKIHDYNKAFSKPIINLK  211

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G ++GN  T +  D  G V Y W+HA+ISD+T+++I+  C+F       + DC  AVN  
Sbjct  212   GFMVGNAVTDNQYDSIGTVTYWWTHAIISDKTYKSILKYCNFTVEKV--SDDCDTAVNYA  269

Query  889   LK-QYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSYYN  1065
             +  ++ +ID YS+YT +C+ +L    +    V    + +  R+++GYDPC + YA+ Y+N
Sbjct  270   MNHEFGDIDQYSIYTPMCVAALQKKNNTGFFVRMKNTLLRRRLVSGYDPCTESYAEKYFN  329

Query  1066  RLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDG  1245
             R DVQ+A+H +       W  C+  +   W DS +++LPIYK+L A+G+RIW++SGDTD 
Sbjct  330   RRDVQRAMHANVTGIRYKWTACSDILIKKWKDSDKTMLPIYKELAASGMRIWIFSGDTDS  389

Query  1246  RVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
              VPV +TR+S+S L LP+   W PWY   QVGGW + Y+GLTFAT RGAGH VP F+P
Sbjct  390   VVPVTATRFSLSHLNLPVKTRWYPWYSDNQVGGWTEVYQGLTFATVRGAGHEVPLFEP  447



>gb|EEC70559.1| hypothetical protein OsI_01719 [Oryza sativa Indica Group]
Length=480

 Score =   440 bits (1131),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 211/422 (50%), Positives = 288/422 (68%), Gaps = 10/422 (2%)
 Frame = +1

Query  178   DLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             D VA LPGQP       ++GY+TVN  NGR LFYW +E+ +LP +KPL+LWLNGGPGCSS
Sbjct  39    DRVAFLPGQPRSPQMSQFSGYITVNSQNGRALFYWFFEAQALPSKKPLLLWLNGGPGCSS  98

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             +GYGA  E+GP +V+ + + L  N ++WN EANLLFLESPVGVGFSY+NTS+D  ++ D 
Sbjct  99    VGYGAASELGPLMVNGNGTGLEFNKFAWNNEANLLFLESPVGVGFSYTNTSSDLESIDDR  158

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNK--DPSLFIDLR  708
             F A D Y FL  WF +FP YK   FYI+GESYAG YVP+LA+++ +RNK  + +  I+L+
Sbjct  159   FVAEDTYNFLVNWFKRFPQYKNHDFYISGESYAGHYVPQLADVVYERNKHVETNQHINLK  218

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G ++GN ET D  D++G+V++AWSH+VISD+ ++ +   CDF  +    + +C+  +  +
Sbjct  219   GFIVGNAETDDYYDYKGLVEFAWSHSVISDQLYKHVNNVCDFRLSP--RSNECNHVMGYI  276

Query  889   LKQYKEIDIYSLYTSVCI--DSLTGSGDNSTPVFKTTSKMM-PRIMAGYDPCLDDYAKSY  1059
               QY  IDI+++Y   C   DS   S   ST       ++   R+ +GYDPC   + + Y
Sbjct  277   YDQYDMIDIFNVYAPKCNTDDSSLFSTSYSTADMNAKKRLKGTRMYSGYDPCYSSHIEDY  336

Query  1060  YNRLDVQKALHVSSGHHLRD--WRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSG  1233
              N++DVQK+LH ++   ++D  W IC+ S+FD +  +  SVLPIY KLI AG+RIWVYSG
Sbjct  337   MNKMDVQKSLHANTSGLIKDRKWSICSYSIFDNYDITVFSVLPIYSKLIKAGLRIWVYSG  396

Query  1234  DTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTF  1413
             D DGRVPV+ +RY +  LGLP+  +W+PWY   QV G   EY+GLT AT RGAGHAVP  
Sbjct  397   DVDGRVPVIGSRYCVEALGLPVKSQWQPWYLNNQVAGRFVEYQGLTMATVRGAGHAVPQD  456

Query  1414  KP  1419
             KP
Sbjct  457   KP  458



>ref|XP_006644136.1| PREDICTED: serine carboxypeptidase-like 33-like [Oryza brachyantha]
Length=498

 Score =   441 bits (1133),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 211/422 (50%), Positives = 284/422 (67%), Gaps = 10/422 (2%)
 Frame = +1

Query  178   DLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             D VA LPGQP       ++GY+TV+  NGR LFYW +E+ +LP +KPL+LWLNGGPGCSS
Sbjct  59    DRVAFLPGQPRSPQVSQFSGYITVSRQNGRALFYWFFEAQALPSQKPLLLWLNGGPGCSS  118

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             IGYGA  E+GP  V  +   L  N ++WN+EANLLFLESPVGVGFSY+NTS+D   L D 
Sbjct  119   IGYGAASELGPLRVSRNGDGLEFNKFAWNREANLLFLESPVGVGFSYTNTSSDLTKLNDG  178

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKD--PSLFIDLR  708
             F A DAY FL  W  +FP YK R  YI+GESYAG YVP+L +++ + NKD   + +I+L+
Sbjct  179   FVAEDAYNFLVNWLDRFPQYKDRELYISGESYAGHYVPQLVDLVYENNKDKMANRYINLK  238

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G ++GNP T D  D +G+V+YAWSHAV+SD  +  I  +C+F  ++ W++ DC++A+N +
Sbjct  239   GFIVGNPLTDDQYDSKGLVEYAWSHAVVSDAIYERIKKACNFKFSN-WTD-DCNEAMNSI  296

Query  889   LKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSK----MMPRIMAGYDPCLDDYAKS  1056
              +QY++IDIY++Y   C  + T         F+ + +       R+ +GYD C   YA+ 
Sbjct  297   FRQYQDIDIYNIYAPKCNPAQTSKVAAVNHAFEASDQEQFSRRIRMFSGYDACYSSYAEK  356

Query  1057  YYNRLDVQKALHVSSGHHL-RDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSG  1233
             Y+N+ DVQ A H +    L   W++C+ S+   ++ S  SVLPIY KLI AG+RIW+YSG
Sbjct  357   YFNKPDVQTAFHANGNGMLPGKWKVCSESILRSYNFSVLSVLPIYSKLIKAGLRIWLYSG  416

Query  1234  DTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTF  1413
             D DGRVPV+ +RY +  LGLPI REW+PWY  +QV G   EY G+T  T RGAGH VP  
Sbjct  417   DADGRVPVIGSRYCVEALGLPIKREWQPWYLNRQVAGRFVEYHGMTMVTIRGAGHLVPLN  476

Query  1414  KP  1419
             KP
Sbjct  477   KP  478



>ref|XP_007204505.1| hypothetical protein PRUPE_ppa019210mg [Prunus persica]
 gb|EMJ05704.1| hypothetical protein PRUPE_ppa019210mg [Prunus persica]
Length=440

 Score =   438 bits (1127),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 213/417 (51%), Positives = 291/417 (70%), Gaps = 9/417 (2%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSL-PDEKPLVLWLNGGPGCSS  354
             D ++ LPGQP V+F  ++GYVTVNE++GR LFYWL E++++ P  KPLVLWLNGGPGCSS
Sbjct  10    DRISALPGQPPVSFSQFSGYVTVNEHHGRALFYWLTEAATVSPHNKPLVLWLNGGPGCSS  69

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             + YGA++E+GPF +++  SSL +N YSWN+EAN+LFLESP GVGFSY+NTS+D  + GD 
Sbjct  70    VAYGASEELGPFRINTTGSSLYLNKYSWNREANILFLESPAGVGFSYTNTSSDLEDSGDK  129

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL-FIDLRG  711
               A DA  FL +W  +FP YK R FYIAGESYAG YVP+LA  IV  N+  S   I+L+G
Sbjct  130   RTAQDALIFLLKWLSRFPQYKYREFYIAGESYAGHYVPQLAREIVTYNQGNSHSIINLKG  189

Query  712   ILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELL  891
              ++GN  T +  D  G V + WSHA+ISD+T+R+I+  C+F +    ++Q C  AVN  +
Sbjct  190   FIVGNAVTDNYYDSLGTVTFWWSHAMISDQTYRSILNHCNFTAER--ASQQCDAAVNYAM  247

Query  892   KQ-YKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSYYNR  1068
                + +ID YS+YT  C+  L    +N+    +  + ++ R ++GYDPC ++YA+ YYNR
Sbjct  248   NHDFGDIDQYSIYTPFCLTML----NNTNRHLRLKNTLLRRRVSGYDPCTENYAEKYYNR  303

Query  1069  LDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGR  1248
              DVQKA+H +       W  C+  +   W DS++S+LP YK+LI AG++IWV+SGDTD  
Sbjct  304   PDVQKAMHANITRIPYKWTACSDVLIKNWKDSEDSMLPTYKQLIKAGLKIWVFSGDTDSV  363

Query  1249  VPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             VPV +TR++++ L L I   W PWY   QVGGW + Y+GLTFAT RGAGH VP F+P
Sbjct  364   VPVTATRFALNHLNLTIKTPWYPWYTGGQVGGWTEAYDGLTFATVRGAGHEVPLFQP  420



>emb|CDY40802.1| BnaC02g41710D [Brassica napus]
Length=511

 Score =   441 bits (1133),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 222/443 (50%), Positives = 297/443 (67%), Gaps = 34/443 (8%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNG-------  336
             DLV  LPGQP V F+ YAGYVTVNE +GR LFYW +E++  P++KPL+LWLNG       
Sbjct  53    DLVKELPGQPPVKFRQYAGYVTVNETHGRALFYWFFEATHNPNKKPLLLWLNGDTVVIDT  112

Query  337   -GPGCSSIGYGATQEIGPFL-VDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTST  510
              GPGCSS+G+GA++E+GPF   +S + +L +NPYSWNK ANLLFLESPVGVGFSYSNTS 
Sbjct  113   KGPGCSSVGFGASEELGPFFPQNSTQPNLKLNPYSWNKAANLLFLESPVGVGFSYSNTSR  172

Query  511   DYANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNK--D  684
             D + LGD   A+D+Y FL  WF +FP YK+R FYIAGESYAG YVP+L+E+I ++NK   
Sbjct  173   DISQLGDTVTASDSYNFLVNWFKRFPQYKSRDFYIAGESYAGHYVPQLSELIYNQNKIAP  232

Query  685   PSLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQD  864
                FI+L+G+++GN    D  D +GM+DYA+ HAVISD  ++ +   CDF       +++
Sbjct  233   KKDFINLKGLMIGNALLDDETDQKGMIDYAYDHAVISDGLYQRVNEHCDFRLAHV--SKE  290

Query  865   CSQAVNELLKQYKEIDIYSLYTSVCIDSLTGS-------GDNSTPVFKTTSKMMPRIM--  1017
             C  A++E    YK +D+YSLY+  C+ +   S       G    P  +   +  PR++  
Sbjct  291   CDGALDEYFDVYKILDMYSLYSPRCVPTTENSSVSHSIAGSRHLPAARGIFR--PRLVSN  348

Query  1018  --------AGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKES  1173
                     AGYDPC  DY + Y NR DVQ+ALH +  +    W  C+  +   WSD+  S
Sbjct  349   NEGWRKMAAGYDPCASDYTEKYMNRRDVQEALHANVTNLSYPWTHCSDHI-SFWSDAPAS  407

Query  1174  VLPIYKKLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWY-HQKQVGGWV  1350
             +LP  + L++AG+R+WV+SGDTDGR+PV +TRYS+  LGL   ++W PWY +++QVGGW 
Sbjct  408   MLPTLRTLVSAGLRVWVFSGDTDGRIPVTATRYSLKKLGLKTVQDWTPWYTNKQQVGGWT  467

Query  1351  QEYEGLTFATFRGAGHAVPTFKP  1419
              EY+GL F T RGAGH VPTFKP
Sbjct  468   VEYDGLMFVTVRGAGHQVPTFKP  490



>ref|XP_010505106.1| PREDICTED: serine carboxypeptidase-like 33 [Camelina sativa]
Length=478

 Score =   439 bits (1130),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 222/426 (52%), Positives = 293/426 (69%), Gaps = 16/426 (4%)
 Frame = +1

Query  178   DLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYES-SSLPDEKPLVLWLNGGPGCS  351
             D V NLP QP      H++GYV VN+ N R LF+W +E+ S     +PLVLWLNGGPGCS
Sbjct  37    DKVVNLPEQPSTPKVSHFSGYVNVNQENTRSLFFWFFEALSESRSTRPLVLWLNGGPGCS  96

Query  352   SIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             SIGYGA  E+GPF V  + +SL+ N YSW +EAN+LFLESPVGVGFSY+N+S+D  NL D
Sbjct  97    SIGYGAASELGPFRVVENGTSLSFNQYSWVQEANMLFLESPVGVGFSYTNSSSDLDNLND  156

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRN--KDPSLFIDL  705
              F A DAY F+  WF ++P YK+R F+IAGESYAG Y P+LAEII DRN  K    FI+L
Sbjct  157   AFVAEDAYNFMVAWFARYPQYKSRDFFIAGESYAGHYAPQLAEIIYDRNKIKPKDSFINL  216

Query  706   RGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNE  885
             +G ++GNP T D  D +G+++YAWSHAVISD  + +   SCDF S++ WS + C+ A++ 
Sbjct  217   KGFIVGNPLTDDEYDNKGILEYAWSHAVISDNLYDSAKRSCDFKSSN-WS-EPCNVAMST  274

Query  886   LLKQYKEIDIYSLYTSVCIDS-------LTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDD  1044
             + ++YKEIDIY++Y   CI +       L+   +  +P  K   K + R   GYDPC  +
Sbjct  275   VFRKYKEIDIYNIYAPKCISNSSSGASYLSSGANYKSPAVKDWFKRV-RWYEGYDPCYSN  333

Query  1045  YAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWV  1224
             YA+ Y+NR+DVQ +LH ++ +  R W++CN S+   +  +  S+LP Y KLI AG++IWV
Sbjct  334   YAEKYFNRVDVQSSLHATTRNVAR-WKVCNDSILQTYHFTVSSMLPTYSKLIKAGLKIWV  392

Query  1225  YSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYE-GLTFATFRGAGHA  1401
             YSGD DGRVPV+ +RY +  LGLP+  +WR W+H  QVGG + EYE GLTF T RGAGH 
Sbjct  393   YSGDADGRVPVIGSRYCVEALGLPVKSDWRSWFHNHQVGGRITEYEGGLTFVTVRGAGHL  452

Query  1402  VPTFKP  1419
             VP  KP
Sbjct  453   VPLNKP  458



>ref|XP_011033395.1| PREDICTED: serine carboxypeptidase 24-like [Populus euphratica]
Length=459

 Score =   438 bits (1127),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 217/416 (52%), Positives = 287/416 (69%), Gaps = 11/416 (3%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D ++ LPGQP V F  ++GYVTVNE +GR LFYWL E++++P++KPLVLWLNGGPGCSS+
Sbjct  34    DRISALPGQPAVTFSQFSGYVTVNEKHGRALFYWLTEAAAIPNKKPLVLWLNGGPGCSSV  93

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
              YGA++EIGPF ++    SL +N YSWNKEAN+LFLESP GVGFSY+NTS++  + GD  
Sbjct  94    AYGASEEIGPFRINRTGLSLYMNKYSWNKEANILFLESPAGVGFSYTNTSSNLKDSGDKR  153

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKD-PSLFIDLRGI  714
              A DA  FL  W  +FP YK R FYIAGESYAG YVP+LA+ I D NK  P   I+L+G 
Sbjct  154   TAQDALVFLTRWMSRFPQYKYREFYIAGESYAGHYVPQLAKKIHDYNKAYPHPIINLKGF  213

Query  715   LLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELLK  894
             ++GN  T +  D  G V + W+H++ISD T+R I+ +C+F + +T SN+ C   V   + 
Sbjct  214   IVGNAVTDNYYDSIGTVAFWWTHSMISDRTYRAILDNCNF-TEETASNK-CDDVVTYAMN  271

Query  895   -QYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSYYNRL  1071
              ++ +ID YS+YT  C+        NST   K T  ++ R ++GYDPC + YA+ YYNR 
Sbjct  272   HEFGDIDQYSIYTPSCMHL-----PNSTVRLKNT--LLRRRVSGYDPCTEKYAEKYYNRP  324

Query  1072  DVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGRV  1251
             +VQKA+H +       W  C+  +   W DS+ S+LP+YK LIAAG+RIWV+SGDTD  V
Sbjct  325   EVQKAMHANVTGIPYKWTACSDVLIKNWKDSESSMLPVYKDLIAAGLRIWVFSGDTDSVV  384

Query  1252  PVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             PV +TR+S+S L L +   W PWY   QVGGW + Y+GLTFAT RGAGH VP F+P
Sbjct  385   PVTATRFSLSHLNLTVKTRWYPWYSGDQVGGWTEVYKGLTFATVRGAGHEVPLFQP  440



>ref|XP_003565735.2| PREDICTED: serine carboxypeptidase-like 33 [Brachypodium distachyon]
Length=487

 Score =   439 bits (1129),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 214/422 (51%), Positives = 282/422 (67%), Gaps = 10/422 (2%)
 Frame = +1

Query  178   DLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             D VA LPGQ        ++G+VTVN+ NGR LFYW +E+ + P  KPL+LWLNGGPGCSS
Sbjct  48    DRVAFLPGQTRTPRLSQFSGHVTVNKQNGRALFYWFFEAQAQPSHKPLLLWLNGGPGCSS  107

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             +GYGA  E+GP  V    + L  N ++WN EANLLFLESPVGVGFSY+NTS+D  NL D 
Sbjct  108   VGYGAASELGPLRVSRFAAGLEFNKFAWNNEANLLFLESPVGVGFSYTNTSSDLDNLNDG  167

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKD--PSLFIDLR  708
             F A DAY+FL  W  +FP YK R FYI+GESYAG YVP+LA+ + + NKD   S  I+L+
Sbjct  168   FVAEDAYSFLLNWLERFPQYKDRDFYISGESYAGHYVPQLADRVYEGNKDKKASTSINLK  227

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             GI++GNP T D  D +G+ +YAWSHAV+SDE +  I   CDF ++  W+N DC +A+  +
Sbjct  228   GIIVGNPITDDYYDSKGLAEYAWSHAVVSDEVYERIKKVCDFRAS-KWTN-DCDKAMGTI  285

Query  889   LKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTS----KMMPRIMAGYDPCLDDYAKS  1056
              +QY+EIDIY++Y   C  + T          K ++    +   R+ +GYD C   YA+ 
Sbjct  286   FRQYQEIDIYNIYAPKCNVAQTSVASAVDEALKYSNHERFRKRIRMFSGYDACYSSYAQQ  345

Query  1057  YYNRLDVQKALHVSSGHHL-RDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSG  1233
             Y+N+ DVQ+A H +    L   W++C+ S+   ++ S  SVLPIY KLI AG+R+W+YSG
Sbjct  346   YFNKADVQRAFHANGNGMLPGKWQVCSDSILRTYNFSVLSVLPIYSKLIKAGLRVWIYSG  405

Query  1234  DTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTF  1413
             D DGRVPV+ +RY +  LGLPI  +W+PWY  KQV G   EY+G+T  T RGAGH VP  
Sbjct  406   DADGRVPVIGSRYCVEALGLPIKTQWQPWYLNKQVAGRFVEYDGITMVTIRGAGHLVPLN  465

Query  1414  KP  1419
             KP
Sbjct  466   KP  467



>ref|XP_010432963.1| PREDICTED: serine carboxypeptidase 24 isoform X1 [Camelina sativa]
Length=469

 Score =   438 bits (1127),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 217/420 (52%), Positives = 290/420 (69%), Gaps = 8/420 (2%)
 Frame = +1

Query  175   EDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSS-LPDEKPLVLWLNGGPGCS  351
             +D +  LPGQP V F  Y+GYV VNE++GR LFYWL ESSS  P  KPL+LWLNGGPGCS
Sbjct  33    KDRIKALPGQPKVAFSQYSGYVNVNESHGRALFYWLSESSSPSPHTKPLLLWLNGGPGCS  92

Query  352   SIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             SI YGA++EIGPF ++   S+L +N +SWN +ANLLFLESP GVGFSY+NTS+D  + GD
Sbjct  93    SIAYGASEEIGPFRINKTGSNLYLNKFSWNTDANLLFLESPAGVGFSYTNTSSDLNDSGD  152

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL-FIDLR  708
             +  A D+  FL +W  KFP YK R FYIAGESYAG YVP+LA+ I D NK  S   I+L+
Sbjct  153   ERTAQDSLMFLIKWLSKFPQYKYRDFYIAGESYAGHYVPQLAKKIHDYNKAFSKPIINLK  212

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G ++GN  T +  D  G V Y W+HA+ISD+T+++I+  C+F +    ++ DC  AVN  
Sbjct  213   GFMVGNAVTDNQYDSIGTVTYWWTHAIISDKTYKSILKYCNFTAER--ASDDCDTAVNYA  270

Query  889   LK-QYKEIDIYSLYTSVCIDSLTGSGDNSTPVF--KTTSKMMPRIMAGYDPCLDDYAKSY  1059
             +  ++ +ID YS+YT  C+ +     DNST  F     + +  R+++GYDPC + YA+ Y
Sbjct  271   MNHEFGDIDQYSIYTPTCV-AAQQKKDNSTGFFVRMKNTLLRKRLVSGYDPCTESYAEKY  329

Query  1060  YNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDT  1239
             +NR DVQ+A+H +       W  C+  +   W DS +++LPIYK+L A+G+RIW++SGDT
Sbjct  330   FNRRDVQRAMHANVTGIRYKWTACSDVLIKNWKDSDKTMLPIYKELAASGLRIWIFSGDT  389

Query  1240  DGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             D  VPV +TR+S+S L LP+   W PWY   QVGGW + Y+GLTFAT RGAGH VP F+P
Sbjct  390   DSVVPVTATRFSLSHLNLPVKTRWYPWYSDNQVGGWTEVYKGLTFATVRGAGHEVPLFEP  449



>ref|XP_004297735.1| PREDICTED: serine carboxypeptidase-like 34-like [Fragaria vesca 
subsp. vesca]
Length=483

 Score =   439 bits (1129),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 217/433 (50%), Positives = 277/433 (64%), Gaps = 28/433 (6%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D V  LPGQP V F  YAGYVTVNE +GR LFYW +E+   P +KPLVLWLNGGPGCSSI
Sbjct  39    DRVIGLPGQPPVKFDQYAGYVTVNETHGRALFYWFFEAVKTPQDKPLVLWLNGGPGCSSI  98

Query  358   GYGATQEIGPFLVDSD-ESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             GYGA++E+GPF      +  L  NPY+WN  ANLLFLESPVGVGFSY+NT+ D + LGD 
Sbjct  99    GYGASEELGPFFPQKGAKPKLKYNPYTWNNAANLLFLESPVGVGFSYTNTTKDISQLGDT  158

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPS--LFIDLR  708
               A D++ FL  WF +FP YK+  FYI GESY G YVP+L+E++ DRNK+ S   +I+ +
Sbjct  159   ITAEDSHKFLINWFKRFPQYKSHDFYITGESYGGHYVPQLSELVYDRNKNASKETYINFK  218

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G ++GN    D  D +G++DYAW HAVISD  +  I   C+FN  +   ++ C+  ++E 
Sbjct  219   GFMIGNAAIDDETDQKGLIDYAWDHAVISDRLYDDIKKECNFNLQNV--SKVCNNLLDEY  276

Query  889   LKQYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMA----------------  1020
                YK ID+YSLYT  C+D      DN+T    TT +    I                  
Sbjct  277   FDVYKIIDMYSLYTPTCVD------DNNTLSLPTTQQHFRAIEGAPALFSRAEGRGKRPE  330

Query  1021  GYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLI  1200
             GYDPC  DY   Y+N   VQKALH +       W  C+ ++   W D+  S+LP+ +KL+
Sbjct  331   GYDPCASDYTYLYFNNPQVQKALHANVTGIPYPWTHCSDNI-TFWKDAPPSILPVIRKLV  389

Query  1201  AAGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFAT  1380
              AG+R+W+YSGDTDGRVPV STRY++  LGL I ++W PWY+ KQVGGW   Y+GL F T
Sbjct  390   DAGLRVWIYSGDTDGRVPVTSTRYALKKLGLKIKQDWTPWYNSKQVGGWTVAYDGLMFVT  449

Query  1381  FRGAGHAVPTFKP  1419
              RGAGH VP F P
Sbjct  450   IRGAGHEVPMFAP  462



>ref|XP_010447693.1| PREDICTED: serine carboxypeptidase 24-like [Camelina sativa]
Length=467

 Score =   438 bits (1127),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 217/420 (52%), Positives = 290/420 (69%), Gaps = 8/420 (2%)
 Frame = +1

Query  175   EDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSS-LPDEKPLVLWLNGGPGCS  351
             +D +  LPGQP V F  Y+GYV VNE++GR LFYWL ESSS  P  KPL+LWLNGGPGCS
Sbjct  31    KDRIKALPGQPKVAFSQYSGYVKVNESHGRALFYWLTESSSPSPHTKPLLLWLNGGPGCS  90

Query  352   SIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGD  531
             SI YGA++EIGPF ++   S+L +N +SWN +ANLLFLESP GVGFSY+NTS+D  + GD
Sbjct  91    SIAYGASEEIGPFRINKTGSNLYLNKFSWNTDANLLFLESPAGVGFSYTNTSSDLNDSGD  150

Query  532   DFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL-FIDLR  708
             +  A D+  FL +W  KFP YK R FYIAGESYAG YVP+LA+ I D NK  S   I+L+
Sbjct  151   ERTAQDSLMFLIKWLSKFPQYKYRDFYIAGESYAGHYVPQLAKKIHDYNKAFSKPIINLK  210

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNEL  888
             G ++GN  T +  D  G V Y W+HA+ISD+T+++I+  C+F +    ++ DC  AVN  
Sbjct  211   GFMVGNAVTDNQYDSIGTVTYWWTHAIISDKTYKSILKYCNFTAEK--ASDDCDTAVNYA  268

Query  889   LK-QYKEIDIYSLYTSVCIDSLTGSGDNSTPVF--KTTSKMMPRIMAGYDPCLDDYAKSY  1059
             +  ++ +ID YS+YT  C+ +     DNST  F     + +  R+++GYDPC + YA+ Y
Sbjct  269   MNHEFGDIDQYSIYTPTCV-AAQQKKDNSTGFFVRMKNTLLRRRLVSGYDPCTESYAEKY  327

Query  1060  YNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDT  1239
             +NR DVQ+A+H +       W  C+  +   W DS +++LPIYK+L A+G+RIW++SGDT
Sbjct  328   FNRRDVQRAMHANVTGIRYKWTACSDVLIKNWKDSDKTMLPIYKELAASGLRIWIFSGDT  387

Query  1240  DGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             D  VPV +TR+S+S L LP+   W PWY   QVGGW + Y+GLTFAT RGAGH VP F+P
Sbjct  388   DSVVPVTATRFSLSHLNLPVKTRWYPWYSDNQVGGWTEVYKGLTFATVRGAGHEVPLFEP  447



>ref|XP_004288721.1| PREDICTED: serine carboxypeptidase 24-like [Fragaria vesca subsp. 
vesca]
Length=448

 Score =   437 bits (1125),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 214/416 (51%), Positives = 285/416 (69%), Gaps = 10/416 (2%)
 Frame = +1

Query  178   DLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSSI  357
             D +  LPGQP V+F  Y+GYVTVN+ +GR LFYW  E+++ P  KPLVLW NGGPGCSS+
Sbjct  21    DRITALPGQPPVSFSQYSGYVTVNKKHGRALFYWFTEATASPHNKPLVLWFNGGPGCSSV  80

Query  358   GYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDDF  537
              YGA++EIGPF ++   SSL +N YSWN+EAN+LFLESP GVGFSY+NTS D  + GD  
Sbjct  81    AYGASEEIGPFRINRTGSSLYLNKYSWNREANILFLESPAGVGFSYTNTSADLIDSGDKR  140

Query  538   AANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPSL-FIDLRGI  714
              A DA  FL +W  +FP YK R FYI+GESYAG YVP+LA+ IV+ NK  S   I+L+G 
Sbjct  141   TAQDALTFLLQWLSRFPQYKYREFYISGESYAGHYVPQLAKEIVNYNKAHSHPIINLKGF  200

Query  715   LLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDCSQAVNELLK  894
             ++GN  T +  D  G V Y W+H++ISD T+R+I+  C+F ++   S   C  AVN  + 
Sbjct  201   IVGNAVTDNYYDSIGTVAYWWTHSMISDHTYRSILDHCNFTADK--STTQCDDAVNYAMN  258

Query  895   -QYKEIDIYSLYTSVCIDSLTGSGDNSTPVFKTTSKMMPRIMAGYDPCLDDYAKSYYNRL  1071
              ++ +ID YS+YT  C+  +T S  N     +  + ++ R   GYDPC ++YA+ YYNR 
Sbjct  259   YEFGDIDQYSIYTPFCLTQITNSARN----LRLKNTLLCR--RGYDPCSENYAEKYYNRP  312

Query  1072  DVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYKKLIAAGIRIWVYSGDTDGRV  1251
             DVQKA+H +       W  C+ ++   W+DS++S+LP YK+L+AAG++IWV+SGDTD  V
Sbjct  313   DVQKAMHANITKIPYKWTACSDTLIKNWNDSEDSMLPTYKELMAAGLKIWVFSGDTDSVV  372

Query  1252  PVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATFRGAGHAVPTFKP  1419
             PV +TR+S+S L L I   W PWY   QVGGW + Y GLTFAT RGAGH VP F+P
Sbjct  373   PVTATRFSLSHLNLTIKTPWYPWYTGGQVGGWTEVYHGLTFATIRGAGHEVPLFQP  428



>emb|CAE05642.2| OSJNBa0038O10.8 [Oryza sativa Japonica Group]
Length=506

 Score =   439 bits (1130),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 229/453 (51%), Positives = 290/453 (64%), Gaps = 41/453 (9%)
 Frame = +1

Query  175   EDLVANLPGQPIVNFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLNGGPGCSS  354
             EDLVA LPGQP V F+HYAGYV V   NG+ LFYW +E+   P++KPL+LWLNGGPGCSS
Sbjct  35    EDLVAGLPGQPDVRFRHYAGYVGVG--NGKALFYWFFEAEKEPEKKPLLLWLNGGPGCSS  92

Query  355   IGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTDYANLGDD  534
             + YGA QE+GPFLV S   +LT+N YSWNK  NLLFLE+PVGVGFSY+N ++D   LGD 
Sbjct  93    VAYGAAQELGPFLVRSYGENLTLNAYSWNKAVNLLFLEAPVGVGFSYTNRTSDLRRLGDR  152

Query  535   FAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNKDPS--LFIDLR  708
               A D+Y+FL  W  KFP +K R FYIAGESYAG YVP+LAE+I D NK  S    I+++
Sbjct  153   VTAQDSYSFLLNWLNKFPEFKNRDFYIAGESYAGHYVPQLAELIYDGNKGASRDRVINIK  212

Query  709   GILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCD-FNSNDTWS--NQDCSQAV  879
             G ++GN   +D  D  GMV+YAWSHA+ISDE +  +   CD F   +     ++ CS AV
Sbjct  213   GFMIGNAVLNDATDQMGMVEYAWSHAIISDELYSAVRRECDSFKEEEDGGKPSKGCSPAV  272

Query  880   NELLKQYKEIDIYSLYTSVCI----------------DSLTGSGDNSTPVFKTTSKMMPR  1011
                L+ Y +IDIYS+YT  C+                  L  +    +   K   + M R
Sbjct  273   RAFLRAYDDIDIYSIYTPTCLSSSSSSPASASPRRSSPGLVAAPRLFSKHVKEAWRRMQR  332

Query  1012  IMAGYDPCLDDYAKSYYNRLDVQKALHVSSGHHLRDWRICNMSVFDGWSDSKESVLPIYK  1191
             + AGYDPC ++Y K Y+NR DVQ+ALH +       +  C+ ++   W+DS  +VLPI K
Sbjct  333   VPAGYDPCTEEYVKGYFNREDVQRALHANRTGLSYPYSPCSEAI-SKWNDSPSTVLPILK  391

Query  1192  KLIAAGIRIWVYSGDTDGRVPVLSTRYSISTLGL--PITRE--------------WRPWY  1323
             KL+ AG+RIWVYSGDTDGRVPV STRYS++T+ L   + R+              WR WY
Sbjct  392   KLMGAGLRIWVYSGDTDGRVPVTSTRYSLNTMKLRPRLMRKTAGDGAGEESEWGGWRAWY  451

Query  1324  HQKQVGGWVQEY-EGLTFATFRGAGHAVPTFKP  1419
              ++QVGGW  EY EGLT  T RGAGH VP F P
Sbjct  452   DRQQVGGWAVEYEEGLTLVTVRGAGHQVPLFAP  484



>ref|XP_002457777.1| hypothetical protein SORBIDRAFT_03g013470 [Sorghum bicolor]
 gb|EES02897.1| hypothetical protein SORBIDRAFT_03g013470 [Sorghum bicolor]
Length=481

 Score =   439 bits (1128),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 217/432 (50%), Positives = 287/432 (66%), Gaps = 13/432 (3%)
 Frame = +1

Query  157   DQSWASEDLVANLPGQPIV-NFKHYAGYVTVNENNGRRLFYWLYESSSLPDEKPLVLWLN  333
             D+     D V  LPGQP       ++GYVTVNE+NGR LFYW +E+ + P +KPLVLWLN
Sbjct  31    DRRRQEGDRVGFLPGQPRSPAVSQFSGYVTVNEHNGRALFYWFFEAQTSPAQKPLVLWLN  90

Query  334   GGPGCSSIGYGATQEIGPFLVDSDESSLTVNPYSWNKEANLLFLESPVGVGFSYSNTSTD  513
             GGPGCSS+GYGA  E+GP +V+S+ + L  N ++WNKEANLLFLESPVGVGFSY+NTS+D
Sbjct  91    GGPGCSSVGYGAASELGPLVVNSNGTGLEFNKFAWNKEANLLFLESPVGVGFSYTNTSSD  150

Query  514   YANLGDDFAANDAYAFLHEWFLKFPSYKTRAFYIAGESYAGKYVPELAEIIVDRNK--DP  687
               NL D F A D Y FL  WF +FP YK+  FYI+GESYAG YVP+LAE++ + NK  + 
Sbjct  151   LDNLDDRFVAKDTYTFLVNWFNRFPQYKSHDFYISGESYAGHYVPQLAEVVYEHNKHLEA  210

Query  688   SLFIDLRGILLGNPETSDVQDWQGMVDYAWSHAVISDETHRTIIASCDFNSNDTWSNQDC  867
             +  I L+G ++GN ET D  D+ GMV++AWSH+VISD+ +  +   C+F  + T  + +C
Sbjct  211   NQQIHLKGFMVGNAETDDYYDYTGMVEFAWSHSVISDQFYERVKNVCNFKLSPT--STEC  268

Query  868   SQAVNELLKQYKEIDIYSLYTSVC------IDSLTGSGDNSTPVFKTTSKMMPRIMAGYD  1029
                +  L + Y EIDIY++Y   C      + S +          K  SK   R+ +GYD
Sbjct  269   GHVMALLYRTYNEIDIYNVYAPKCNTDGSALSSSSSDSSAVEKEAKNKSKRRLRMYSGYD  328

Query  1030  PCLDDYAKSYYNRLDVQKALHVSSGHHLRD--WRICNMSVFDGWSDSKESVLPIYKKLIA  1203
             PC  +Y ++Y+NR+DVQK+LH ++   ++D  W +C+  +FD +     SVLPIY KL+ 
Sbjct  329   PCYSNYIETYFNRMDVQKSLHANTSGRIKDRTWSLCSDPIFDFYDMEVFSVLPIYSKLVK  388

Query  1204  AGIRIWVYSGDTDGRVPVLSTRYSISTLGLPITREWRPWYHQKQVGGWVQEYEGLTFATF  1383
             AG+RIWVYSGD DGRVP + +RY +  LGLPI  +W+PWY   QV G   EYEGLT  T 
Sbjct  389   AGLRIWVYSGDMDGRVPFIGSRYWVDALGLPIKSQWQPWYLNNQVAGRYVEYEGLTMVTV  448

Query  1384  RGAGHAVPTFKP  1419
             RGAGH VP  KP
Sbjct  449   RGAGHTVPQDKP  460



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5074203830354