BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18996_g2_i2 len=1137 path=[1891:0-54 @1946@!:55-946 2874:947-1136]

Length=1137
                                                                      Score     E

ref|XP_009776550.1|  PREDICTED: inactive receptor-like serine/thr...    174   4e-45   
ref|XP_009632033.1|  PREDICTED: inactive receptor-like serine/thr...    173   9e-45   
ref|XP_006353430.1|  PREDICTED: probable LRR receptor-like serine...    169   3e-43   
ref|XP_011084876.1|  PREDICTED: inactive receptor-like serine/thr...    168   5e-43   
ref|XP_003552837.1|  PREDICTED: probable LRR receptor-like serine...    168   5e-43   
emb|CDP09230.1|  unnamed protein product                                168   7e-43   
ref|XP_004240911.1|  PREDICTED: inactive receptor-like serine/thr...    167   1e-42   
ref|XP_011084875.1|  PREDICTED: inactive receptor-like serine/thr...    167   2e-42   
gb|KHN31298.1|  Putative LRR receptor-like serine/threonine-prote...    167   2e-42   
emb|CDP13981.1|  unnamed protein product                                166   3e-42   
ref|XP_003537493.1|  PREDICTED: probable LRR receptor-like serine...    166   4e-42   
gb|KHN04780.1|  Putative LRR receptor-like serine/threonine-prote...    166   4e-42   
ref|XP_002278392.1|  PREDICTED: inactive receptor-like serine/thr...    160   4e-40   Vitis vinifera
ref|XP_011001758.1|  PREDICTED: inactive receptor-like serine/thr...    159   7e-40   
ref|XP_011001683.1|  PREDICTED: inactive receptor-like serine/thr...    159   8e-40   
ref|XP_006425118.1|  hypothetical protein CICLE_v10027941mg             155   1e-38   
gb|KCW65702.1|  hypothetical protein EUGRSUZ_G03081                     155   2e-38   
ref|XP_010068916.1|  PREDICTED: probable inactive receptor-like p...    155   4e-38   
ref|XP_006425119.1|  hypothetical protein CICLE_v10027941mg             154   4e-38   
ref|XP_007016945.1|  Leucine-rich repeat protein kinase family pr...    154   4e-38   
ref|XP_006488566.1|  PREDICTED: probable LRR receptor-like serine...    154   6e-38   
ref|XP_002273218.1|  PREDICTED: inactive receptor-like serine/thr...    154   6e-38   Vitis vinifera
gb|KDO66979.1|  hypothetical protein CISIN_1g004129mg                   154   6e-38   
ref|XP_004491019.1|  PREDICTED: probable LRR receptor-like serine...    153   7e-38   
ref|XP_004491018.1|  PREDICTED: probable LRR receptor-like serine...    153   7e-38   
ref|XP_010043407.1|  PREDICTED: inactive receptor-like serine/thr...    154   8e-38   
ref|XP_003518434.1|  PREDICTED: probable LRR receptor-like serine...    153   8e-38   
gb|KDO66980.1|  hypothetical protein CISIN_1g004129mg                   154   1e-37   
ref|XP_004168798.1|  PREDICTED: probable LRR receptor-like serine...    153   1e-37   
ref|XP_010264565.1|  PREDICTED: inactive receptor-like serine/thr...    153   1e-37   
ref|XP_003591240.1|  Ser-thr protein kinase                             152   1e-37   
gb|KGN47057.1|  hypothetical protein Csa_6G182110                       153   1e-37   
emb|CBI25442.3|  unnamed protein product                                152   2e-37   
ref|XP_007163571.1|  hypothetical protein PHAVU_001G245300g             152   2e-37   
gb|KDP44721.1|  hypothetical protein JCGZ_01221                         152   2e-37   
ref|XP_010257070.1|  PREDICTED: probable inactive receptor-like p...    152   3e-37   
gb|KHG13760.1|  hypothetical protein F383_16603                         150   4e-37   
ref|XP_002313236.2|  hypothetical protein POPTR_0009s07920g             151   5e-37   Populus trichocarpa [western balsam poplar]
ref|XP_008465269.1|  PREDICTED: inactive receptor-like serine/thr...    151   5e-37   
ref|XP_009369580.1|  PREDICTED: probable inactive receptor-like p...    151   7e-37   
ref|XP_002528330.1|  receptor protein kinase, putative                  149   1e-36   Ricinus communis
ref|XP_004500511.1|  PREDICTED: probable LRR receptor-like serine...    149   2e-36   
ref|XP_003600961.1|  Ser-thr protein kinase                             149   3e-36   
gb|KDP45772.1|  hypothetical protein JCGZ_17379                         149   3e-36   
gb|KHN48581.1|  Putative LRR receptor-like serine/threonine-prote...    148   4e-36   
ref|XP_003544063.1|  PREDICTED: probable LRR receptor-like serine...    148   5e-36   
gb|KHG12930.1|  putative LRR receptor-like serine/threonine-prote...    148   5e-36   
ref|XP_011003691.1|  PREDICTED: probable inactive receptor-like p...    149   5e-36   
ref|XP_002299998.2|  hypothetical protein POPTR_0001s28710g             148   7e-36   Populus trichocarpa [western balsam poplar]
ref|XP_008384755.1|  PREDICTED: probable inactive receptor-like p...    148   9e-36   
ref|XP_006658173.1|  PREDICTED: probable LRR receptor-like serine...    146   1e-35   
ref|XP_006435789.1|  hypothetical protein CICLE_v10030902mg             144   2e-35   
ref|XP_006435787.1|  hypothetical protein CICLE_v10030902mg             145   3e-35   
ref|XP_008221441.1|  PREDICTED: probable inactive receptor-like p...    146   3e-35   
ref|XP_010089528.1|  putative LRR receptor-like serine/threonine-...    146   3e-35   
gb|KDO68889.1|  hypothetical protein CISIN_1g006019mg                   144   4e-35   
gb|KDO68893.1|  hypothetical protein CISIN_1g006019mg                   145   4e-35   
gb|KHG10502.1|  hypothetical protein F383_04578                         145   4e-35   
ref|XP_007204983.1|  hypothetical protein PRUPE_ppa003329mg             145   4e-35   
ref|XP_009354142.1|  PREDICTED: probable inactive receptor-like p...    146   5e-35   
gb|KDO68888.1|  hypothetical protein CISIN_1g006019mg                   144   5e-35   
gb|KHG06445.1|  hypothetical protein F383_32456                         145   7e-35   
ref|XP_011024913.1|  PREDICTED: inactive receptor-like serine/thr...    145   9e-35   
ref|XP_006435788.1|  hypothetical protein CICLE_v10030902mg             144   1e-34   
ref|XP_004294789.1|  PREDICTED: probable LRR receptor-like serine...    144   1e-34   
gb|KDO68887.1|  hypothetical protein CISIN_1g006019mg                   144   1e-34   
ref|XP_008354886.1|  PREDICTED: probable inactive receptor-like p...    144   3e-34   
gb|EEC75039.1|  hypothetical protein OsI_11137                          142   4e-34   Oryza sativa Indica Group [Indian rice]
ref|NP_001049820.1|  Os03g0294800                                       142   4e-34   Oryza sativa Japonica Group [Japonica rice]
gb|AGJ83760.1|  Ser-Thr protein kinase                                  139   4e-34   
gb|KHF97979.1|  hypothetical protein F383_13566                         142   5e-34   
ref|XP_010685929.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    142   7e-34   
tpg|DAA44873.1|  TPA: putative leucine-rich repeat transmembrane ...    139   9e-34   
ref|XP_011076664.1|  PREDICTED: probable inactive receptor-like p...    141   2e-33   
gb|KHN15217.1|  Putative LRR receptor-like serine/threonine-prote...    141   2e-33   
ref|XP_008667291.1|  PREDICTED: uncharacterized LOC100191492 isof...    140   2e-33   
gb|ACN35847.1|  unknown                                                 140   2e-33   Zea mays [maize]
ref|NP_001130396.1|  uncharacterized LOC100191492 precursor             140   2e-33   Zea mays [maize]
ref|XP_004984869.1|  PREDICTED: probable LRR receptor-like serine...    140   2e-33   
gb|ACG28994.1|  ATP binding protein                                     140   2e-33   Zea mays [maize]
ref|XP_008667339.1|  PREDICTED: uncharacterized LOC100191492 isof...    140   2e-33   
ref|XP_008667250.1|  PREDICTED: uncharacterized LOC100191492 isof...    139   2e-33   
emb|CBI15912.3|  unnamed protein product                                137   2e-33   
ref|XP_006591246.1|  PREDICTED: probable LRR receptor-like serine...    141   3e-33   
ref|XP_008794243.1|  PREDICTED: probable LRR receptor-like serine...    139   3e-33   
ref|XP_002315143.2|  hypothetical protein POPTR_0010s19270g             140   3e-33   Populus trichocarpa [western balsam poplar]
ref|XP_010920996.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    139   5e-33   
ref|NP_001060726.1|  Os07g0693000                                       139   5e-33   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ05236.1|  hypothetical protein OsI_27436                          139   5e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_008794242.1|  PREDICTED: probable LRR receptor-like serine...    139   5e-33   
ref|XP_008789160.1|  PREDICTED: inactive receptor-like serine/thr...    140   6e-33   
ref|XP_008794241.1|  PREDICTED: inactive receptor-like serine/thr...    139   6e-33   
ref|XP_007141744.1|  hypothetical protein PHAVU_008G221900g             139   1e-32   
ref|XP_002312175.2|  hypothetical protein POPTR_0008s07210g             138   1e-32   Populus trichocarpa [western balsam poplar]
ref|XP_008811683.1|  PREDICTED: probable LRR receptor-like serine...    137   1e-32   
ref|XP_009402395.1|  PREDICTED: inactive receptor-like serine/thr...    139   1e-32   
ref|XP_003559748.1|  PREDICTED: probable LRR receptor-like serine...    137   2e-32   
gb|EMT17986.1|  Putative LRR receptor-like serine/threonine-prote...    137   2e-32   
ref|XP_006649921.1|  PREDICTED: probable LRR receptor-like serine...    136   3e-32   
ref|XP_010907865.1|  PREDICTED: inactive receptor-like serine/thr...    136   3e-32   
ref|XP_004958793.1|  PREDICTED: probable LRR receptor-like serine...    136   3e-32   
gb|EMS47067.1|  putative LRR receptor-like serine/threonine-prote...    136   3e-32   
ref|XP_003552942.1|  PREDICTED: probable LRR receptor-like serine...    137   4e-32   
gb|KHN02093.1|  Putative LRR receptor-like serine/threonine-prote...    137   4e-32   
ref|XP_007008895.1|  Leucine-rich repeat protein kinase family pr...    135   6e-32   
ref|XP_004307680.1|  PREDICTED: probable LRR receptor-like serine...    136   7e-32   
dbj|BAJ91375.1|  predicted protein                                      134   1e-31   
ref|XP_010937917.1|  PREDICTED: inactive receptor-like serine/thr...    136   1e-31   
ref|XP_006403028.1|  hypothetical protein EUTSA_v10005911mg             134   1e-31   
ref|XP_006403029.1|  hypothetical protein EUTSA_v10005911mg             134   1e-31   
ref|XP_007008894.1|  Leucine-rich repeat protein kinase family pr...    135   3e-31   
dbj|BAK05833.1|  predicted protein                                      133   3e-31   
gb|KEH34374.1|  tyrosine kinase family protein                          133   4e-31   
ref|XP_008454813.1|  PREDICTED: probable inactive receptor-like p...    134   5e-31   
ref|XP_004500296.1|  PREDICTED: probable LRR receptor-like serine...    133   5e-31   
gb|KFK34848.1|  hypothetical protein AALP_AA5G200900                    132   5e-31   
gb|KCW85406.1|  hypothetical protein EUGRSUZ_B02229                     134   6e-31   
gb|EMT14566.1|  Putative LRR receptor-like serine/threonine-prote...    132   7e-31   
ref|XP_011035894.1|  PREDICTED: probable inactive receptor-like p...    133   8e-31   
ref|XP_008233794.1|  PREDICTED: probable inactive receptor-like p...    133   1e-30   
dbj|BAJ86798.1|  predicted protein                                      131   2e-30   
ref|XP_010228737.1|  PREDICTED: probable LRR receptor-like serine...    131   2e-30   
ref|XP_003558141.1|  PREDICTED: probable LRR receptor-like serine...    130   2e-30   
ref|XP_007220635.1|  hypothetical protein PRUPE_ppa002525mg             132   4e-30   
ref|XP_002461269.1|  hypothetical protein SORBIDRAFT_02g043890          128   5e-30   Sorghum bicolor [broomcorn]
ref|XP_004166740.1|  PREDICTED: probable LRR receptor-like serine...    130   6e-30   
ref|XP_010554679.1|  PREDICTED: probable inactive receptor-like p...    129   6e-30   
dbj|BAJ96613.1|  predicted protein                                      130   7e-30   
gb|EMT25492.1|  Putative LRR receptor-like serine/threonine-prote...    129   8e-30   
ref|XP_004148196.1|  PREDICTED: probable LRR receptor-like serine...    130   1e-29   
gb|KHN46130.1|  Putative LRR receptor-like serine/threonine-prote...    130   1e-29   
ref|XP_003518316.1|  PREDICTED: probable LRR receptor-like serine...    130   1e-29   
ref|XP_010529201.1|  PREDICTED: probable LRR receptor-like serine...    130   1e-29   
ref|XP_008374311.1|  PREDICTED: inactive receptor-like serine/thr...    128   1e-29   
gb|EMT01365.1|  Putative LRR receptor-like serine/threonine-prote...    129   2e-29   
emb|CDM83966.1|  unnamed protein product                                129   2e-29   
ref|XP_007142177.1|  hypothetical protein PHAVU_008G258700g             129   2e-29   
ref|XP_010922598.1|  PREDICTED: inactive receptor-like serine/thr...    128   2e-29   
ref|XP_007146810.1|  hypothetical protein PHAVU_006G071600g             129   3e-29   
ref|XP_006655215.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    127   3e-29   
gb|AAO59488.1|  ser-thr protein kinase                                  125   3e-29   Gossypium hirsutum [American cotton]
ref|NP_565925.1|  Protein kinase family protein                         127   4e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294089.1|  hypothetical protein CARUB_v10023083mg             127   4e-29   
ref|XP_008804971.1|  PREDICTED: probable LRR receptor-like serine...    127   4e-29   
ref|XP_006644509.1|  PREDICTED: probable LRR receptor-like serine...    128   4e-29   
gb|AAD25942.1|AF085279_15  hypothetical Ser-Thr protein kinase          127   4e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_973647.1|  Protein kinase family protein                         127   4e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283258.1|  hypothetical protein CARUB_v10004292mg             128   5e-29   
ref|NP_001043843.2|  Os01g0674800                                       125   6e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009792615.1|  PREDICTED: probable LRR receptor-like serine...    128   7e-29   
ref|XP_010439828.1|  PREDICTED: probable LRR receptor-like serine...    128   8e-29   
ref|XP_010449486.1|  PREDICTED: probable LRR receptor-like serine...    127   1e-28   
ref|XP_008804963.1|  PREDICTED: inactive receptor-like serine/thr...    127   1e-28   
emb|CAB37449.1|  putative protein (fragment)                            127   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006292571.1|  hypothetical protein CARUB_v10018806mg             125   1e-28   
ref|NP_193599.3|  putative LRR receptor-like serine/threonine-pro...    127   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010434506.1|  PREDICTED: probable LRR receptor-like serine...    127   1e-28   
emb|CAB78866.1|  putative protein (fragment)                            127   1e-28   Arabidopsis thaliana [mouse-ear cress]
emb|CBI30696.3|  unnamed protein product                                127   2e-28   
ref|XP_002266057.1|  PREDICTED: probable LRR receptor-like serine...    127   2e-28   Vitis vinifera
gb|EMS58575.1|  putative LRR receptor-like serine/threonine-prote...    125   2e-28   
ref|XP_002870030.1|  hypothetical protein ARALYDRAFT_914815             127   2e-28   
ref|XP_010508887.1|  PREDICTED: inactive receptor-like serine/thr...    125   2e-28   
ref|XP_002878058.1|  kinase family protein                              125   2e-28   
gb|KHN40097.1|  Putative LRR receptor-like serine/threonine-prote...    127   2e-28   
ref|XP_003544305.1|  PREDICTED: probable LRR receptor-like serine...    126   2e-28   
gb|EEC71258.1|  hypothetical protein OsI_03238                          126   3e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_010536501.1|  PREDICTED: probable inactive receptor-like p...    124   3e-28   
ref|XP_010427410.1|  PREDICTED: probable inactive receptor-like p...    124   3e-28   
ref|XP_006414074.1|  hypothetical protein EUTSA_v10024616mg             126   3e-28   
gb|AFW77774.1|  putative leucine-rich repeat transmembrane protei...    123   4e-28   
gb|EEE55167.1|  hypothetical protein OsJ_02982                          125   4e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008354162.1|  PREDICTED: inactive receptor-like serine/thr...    125   5e-28   
ref|XP_010517443.1|  PREDICTED: inactive receptor-like serine/thr...    123   5e-28   
ref|XP_010504482.1|  PREDICTED: probable inactive receptor-like p...    124   6e-28   
ref|XP_002881709.1|  kinase family protein                              123   6e-28   
ref|XP_009607758.1|  PREDICTED: probable LRR receptor-like serine...    125   7e-28   
ref|XP_009345286.1|  PREDICTED: probable inactive receptor-like p...    125   9e-28   
ref|XP_010517444.1|  PREDICTED: inactive receptor-like serine/thr...    123   9e-28   
ref|NP_001130369.1|  uncharacterized LOC100191464 precursor             124   1e-27   Zea mays [maize]
ref|XP_004962397.1|  PREDICTED: probable inactive receptor-like p...    123   1e-27   
gb|EEC79039.1|  hypothetical protein OsI_19591                          123   1e-27   Oryza sativa Indica Group [Indian rice]
ref|NP_001055283.2|  Os05g0353500                                       123   2e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010481525.1|  PREDICTED: probable LRR receptor-like serine...    124   2e-27   
ref|XP_010091455.1|  putative LRR receptor-like serine/threonine-...    124   2e-27   
emb|CDY66807.1|  BnaA09g55080D                                          122   2e-27   
ref|XP_009116300.1|  PREDICTED: probable inactive receptor-like p...    122   2e-27   
gb|AAV43879.1|  unknown protein                                         123   2e-27   Oryza sativa Japonica Group [Japonica rice]
ref|NP_191164.1|  protein kinase family protein                         122   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010516201.1|  PREDICTED: probable inactive receptor-like p...    122   2e-27   
ref|XP_003569550.1|  PREDICTED: probable LRR receptor-like serine...    124   2e-27   
ref|XP_004962396.1|  PREDICTED: probable inactive receptor-like p...    123   2e-27   
ref|XP_010505753.1|  PREDICTED: inactive receptor-like serine/thr...    121   2e-27   
ref|XP_010494736.1|  PREDICTED: probable LRR receptor-like serine...    124   2e-27   
emb|CDX72177.1|  BnaC08g26970D                                          122   3e-27   
ref|XP_004961242.1|  PREDICTED: probable LRR receptor-like serine...    121   3e-27   
ref|XP_008654238.1|  PREDICTED: uncharacterized LOC100191464 isof...    124   3e-27   
ref|XP_003579053.1|  PREDICTED: probable LRR receptor-like serine...    121   3e-27   
ref|XP_004150213.1|  PREDICTED: probable LRR receptor-like serine...    123   3e-27   
ref|NP_001147491.1|  ATP binding protein precursor                      122   3e-27   Zea mays [maize]
ref|NP_001056307.1|  Os05g0560300                                       121   3e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010505752.1|  PREDICTED: inactive receptor-like serine/thr...    121   4e-27   
ref|XP_008647786.1|  PREDICTED: ATP binding protein isoform X2          122   4e-27   
gb|AGT15875.1|  hypothetical protein SHCRBa_027_N23_F_10                121   4e-27   
ref|XP_008647785.1|  PREDICTED: ATP binding protein isoform X1          122   4e-27   
ref|XP_011085985.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    123   4e-27   
ref|XP_006467639.1|  PREDICTED: probable LRR receptor-like serine...    122   5e-27   
ref|XP_010538565.1|  PREDICTED: probable LRR receptor-like serine...    122   5e-27   
ref|XP_010538563.1|  PREDICTED: probable LRR receptor-like serine...    122   5e-27   
gb|KDO77873.1|  hypothetical protein CISIN_1g005734mg                   122   5e-27   
gb|KFK36918.1|  hypothetical protein AALP_AA4G189600                    120   5e-27   
ref|XP_006449513.1|  hypothetical protein CICLE_v10014435mg             123   5e-27   
ref|XP_002456124.1|  hypothetical protein SORBIDRAFT_03g030930          119   5e-27   Sorghum bicolor [broomcorn]
ref|XP_006384063.1|  hypothetical protein POPTR_0004s05680g             122   6e-27   
gb|EMT32476.1|  Putative LRR receptor-like serine/threonine-prote...    120   6e-27   
ref|XP_004234089.1|  PREDICTED: probable LRR receptor-like serine...    122   6e-27   
ref|XP_002317415.1|  leucine-rich repeat transmembrane protein ki...    122   6e-27   Populus trichocarpa [western balsam poplar]
gb|ACN30936.1|  unknown                                                 120   6e-27   Zea mays [maize]
gb|EMS63852.1|  putative LRR receptor-like serine/threonine-prote...    120   6e-27   
ref|XP_006280105.1|  hypothetical protein CARUB_v10025993mg             122   6e-27   
dbj|BAK00032.1|  predicted protein                                      120   6e-27   
ref|XP_006654778.1|  PREDICTED: probable LRR receptor-like serine...    120   7e-27   
gb|EAY99002.1|  hypothetical protein OsI_20961                          120   7e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_004978586.1|  PREDICTED: probable LRR receptor-like serine...    120   7e-27   
gb|ABR16832.1|  unknown                                                 122   7e-27   Picea sitchensis
ref|XP_008675203.1|  PREDICTED: probable LRR receptor-like serine...    122   8e-27   
ref|XP_008675205.1|  PREDICTED: probable LRR receptor-like serine...    122   8e-27   
ref|XP_006287483.1|  hypothetical protein CARUB_v10000694mg             120   8e-27   
emb|CDX78881.1|  BnaA01g09480D                                          122   9e-27   
ref|NP_001065935.1|  Os12g0105800                                       118   1e-26   Oryza sativa Japonica Group [Japonica rice]
emb|CDX99448.1|  BnaC01g11040D                                          121   1e-26   
gb|KHN06403.1|  Putative LRR receptor-like serine/threonine-prote...    121   1e-26   
ref|XP_002534282.1|  receptor protein kinase, putative                  121   1e-26   Ricinus communis
ref|XP_008443337.1|  PREDICTED: probable LRR receptor-like serine...    122   1e-26   
ref|XP_007159453.1|  hypothetical protein PHAVU_002G238900g             121   1e-26   
ref|XP_004293957.1|  PREDICTED: probable LRR receptor-like serine...    121   1e-26   
ref|XP_010057112.1|  PREDICTED: probable LRR receptor-like serine...    121   2e-26   
ref|XP_010057111.1|  PREDICTED: probable LRR receptor-like serine...    121   2e-26   
ref|XP_010057110.1|  PREDICTED: probable LRR receptor-like serine...    121   2e-26   
ref|XP_010316819.1|  PREDICTED: probable LRR receptor-like serine...    121   2e-26   
ref|NP_001136868.1|  uncharacterized LOC100217021 precursor             119   2e-26   Zea mays [maize]
ref|XP_010999746.1|  PREDICTED: probable LRR receptor-like serine...    121   2e-26   
ref|XP_009101562.1|  PREDICTED: probable LRR receptor-like serine...    120   2e-26   
ref|XP_009786947.1|  PREDICTED: probable LRR receptor-like serine...    120   3e-26   
emb|CDY58052.1|  BnaA06g40210D                                          120   3e-26   
emb|CDY61466.1|  BnaCnng37840D                                          120   3e-26   
ref|XP_009101558.1|  PREDICTED: probable LRR receptor-like serine...    120   3e-26   
ref|XP_011039429.1|  PREDICTED: probable LRR receptor-like serine...    120   3e-26   
ref|XP_010535361.1|  PREDICTED: probable LRR receptor-like serine...    119   3e-26   
ref|XP_008789371.1|  PREDICTED: probable LRR receptor-like serine...    120   3e-26   
ref|XP_010089700.1|  putative LRR receptor-like serine/threonine-...    120   3e-26   
gb|EAY81984.1|  hypothetical protein OsI_37165                          118   4e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_011039425.1|  PREDICTED: probable LRR receptor-like serine...    120   4e-26   
ref|XP_006362388.1|  PREDICTED: probable LRR receptor-like serine...    120   5e-26   
ref|XP_009132057.1|  PREDICTED: probable LRR receptor-like serine...    119   5e-26   
ref|XP_009764514.1|  PREDICTED: probable LRR receptor-like serine...    120   5e-26   
ref|XP_003629772.1|  Leucine-rich repeat receptor-like protein ki...    120   5e-26   
ref|XP_004504296.1|  PREDICTED: probable LRR receptor-like serine...    120   5e-26   
ref|XP_010274455.1|  PREDICTED: probable LRR receptor-like serine...    119   5e-26   
ref|XP_010274454.1|  PREDICTED: probable LRR receptor-like serine...    120   5e-26   
ref|XP_009128820.1|  PREDICTED: probable LRR receptor-like serine...    119   5e-26   
ref|XP_009764513.1|  PREDICTED: probable LRR receptor-like serine...    119   6e-26   
emb|CDX87762.1|  BnaC02g31870D                                          119   6e-26   
emb|CDY26358.1|  BnaA02g24120D                                          119   6e-26   
ref|XP_010274453.1|  PREDICTED: probable LRR receptor-like serine...    119   6e-26   
emb|CDX76063.1|  BnaA04g03270D                                          117   7e-26   
gb|ABA95610.1|  protein kinase family protein, putative, expressed      117   7e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009139123.1|  PREDICTED: probable inactive receptor-like p...    117   7e-26   
ref|XP_006662649.1|  PREDICTED: probable LRR receptor-like serine...    117   7e-26   
ref|XP_004231550.1|  PREDICTED: probable LRR receptor-like serine...    119   1e-25   
ref|XP_010315618.1|  PREDICTED: probable LRR receptor-like serine...    119   1e-25   
ref|XP_010920234.1|  PREDICTED: probable LRR receptor-like serine...    119   1e-25   
ref|XP_004969518.1|  PREDICTED: probable LRR receptor-like serine...    118   1e-25   
ref|XP_009608359.1|  PREDICTED: probable LRR receptor-like serine...    118   2e-25   
ref|XP_009400002.1|  PREDICTED: probable LRR receptor-like serine...    117   2e-25   
emb|CDY43340.1|  BnaC04g25160D                                          116   2e-25   
gb|EAY81970.1|  hypothetical protein OsI_37147                          116   3e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_006398269.1|  hypothetical protein EUTSA_v10000802mg             117   3e-25   
ref|XP_010915498.1|  PREDICTED: probable LRR receptor-like serine...    117   5e-25   
ref|XP_006411282.1|  hypothetical protein EUTSA_v10016554mg             115   5e-25   
ref|NP_199396.1|  leucine-rich repeat protein kinase family protein     116   6e-25   
dbj|BAB09312.1|  receptor protein kinase-like protein                   116   6e-25   
ref|NP_001190478.1|  leucine-rich repeat protein kinase family pr...    116   7e-25   
sp|C0LGU7.1|Y5458_ARATH  RecName: Full=Probable LRR receptor-like...    116   7e-25   
ref|XP_009613588.1|  PREDICTED: probable LRR receptor-like serine...    116   9e-25   
ref|XP_010276982.1|  PREDICTED: probable LRR receptor-like serine...    116   9e-25   
ref|XP_010276980.1|  PREDICTED: probable LRR receptor-like serine...    116   9e-25   
gb|KHN47999.1|  Putative LRR receptor-like serine/threonine-prote...    115   9e-25   
ref|XP_010276978.1|  PREDICTED: probable LRR receptor-like serine...    116   9e-25   
ref|XP_003532756.1|  PREDICTED: probable LRR receptor-like serine...    115   9e-25   
gb|EPS58414.1|  hypothetical protein M569_16400                         111   1e-24   
ref|XP_006585170.1|  PREDICTED: probable LRR receptor-like serine...    116   1e-24   
ref|XP_009410928.1|  PREDICTED: probable LRR receptor-like serine...    115   1e-24   
ref|XP_011101397.1|  PREDICTED: probable LRR receptor-like serine...    115   2e-24   
ref|XP_011101396.1|  PREDICTED: probable LRR receptor-like serine...    115   2e-24   
gb|KDP21105.1|  hypothetical protein JCGZ_21576                         115   2e-24   
ref|XP_006847392.1|  hypothetical protein AMTR_s00153p00018720          114   2e-24   
ref|XP_006830267.1|  hypothetical protein AMTR_s00130p00117400          115   3e-24   
emb|CDX93203.1|  BnaC04g46930D                                          113   3e-24   
ref|XP_006663713.1|  PREDICTED: probable LRR receptor-like serine...    112   3e-24   
ref|XP_006359106.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    114   4e-24   
ref|XP_009350511.1|  PREDICTED: probable LRR receptor-like serine...    114   4e-24   
ref|XP_007025358.1|  Leucine-rich repeat protein kinase family pr...    114   4e-24   
gb|KEH36609.1|  LRR receptor-like kinase                                114   4e-24   
ref|XP_009350637.1|  PREDICTED: probable LRR receptor-like serine...    114   4e-24   
ref|XP_002871253.1|  leucine-rich repeat family protein                 112   4e-24   
ref|XP_003636791.1|  Protein STRUBBELIG-RECEPTOR FAMILY                 114   4e-24   
ref|XP_009350698.1|  PREDICTED: probable LRR receptor-like serine...    114   5e-24   
ref|XP_009350756.1|  PREDICTED: probable LRR receptor-like serine...    114   5e-24   
ref|XP_006399192.1|  hypothetical protein EUTSA_v10015840mg             112   5e-24   
emb|CBI20183.3|  unnamed protein product                                112   5e-24   
ref|XP_009141880.1|  PREDICTED: inactive receptor-like serine/thr...    112   5e-24   
ref|XP_007213597.1|  hypothetical protein PRUPE_ppa002450mg             113   6e-24   
emb|CDY07072.1|  BnaA04g22430D                                          112   6e-24   
ref|XP_009396517.1|  PREDICTED: probable LRR receptor-like serine...    113   6e-24   
ref|XP_009396515.1|  PREDICTED: probable LRR receptor-like serine...    113   6e-24   
ref|XP_009400001.1|  PREDICTED: probable LRR receptor-like serine...    112   8e-24   
ref|XP_002863450.1|  hypothetical protein ARALYDRAFT_494398             113   9e-24   
ref|XP_008371486.1|  PREDICTED: probable LRR receptor-like serine...    113   9e-24   
ref|XP_008371488.1|  PREDICTED: probable LRR receptor-like serine...    113   1e-23   
ref|XP_009395715.1|  PREDICTED: probable LRR receptor-like serine...    112   1e-23   
ref|XP_008383621.1|  PREDICTED: probable LRR receptor-like serine...    112   1e-23   
ref|XP_008358646.1|  PREDICTED: probable LRR receptor-like serine...    112   1e-23   
ref|XP_008358649.1|  PREDICTED: probable LRR receptor-like serine...    112   1e-23   
ref|XP_008383623.1|  PREDICTED: probable LRR receptor-like serine...    112   1e-23   
ref|XP_008225303.1|  PREDICTED: probable LRR receptor-like serine...    112   1e-23   
ref|XP_008225302.1|  PREDICTED: probable LRR receptor-like serine...    112   1e-23   
ref|XP_006645618.1|  PREDICTED: probable LRR receptor-like serine...    112   2e-23   
ref|XP_010644113.1|  PREDICTED: probable LRR receptor-like serine...    111   3e-23   
ref|XP_010644114.1|  PREDICTED: probable LRR receptor-like serine...    111   3e-23   
ref|XP_008789989.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    111   4e-23   
emb|CAN60298.1|  hypothetical protein VITISV_017762                     110   5e-23   
ref|XP_006399195.1|  hypothetical protein EUTSA_v10013141mg             109   6e-23   
ref|XP_006399194.1|  hypothetical protein EUTSA_v10013141mg             109   7e-23   
ref|NP_196332.1|  leucine-rich repeat protein kinase-like protein       109   7e-23   
ref|XP_007148036.1|  hypothetical protein PHAVU_006G175100g             110   8e-23   
ref|XP_010452667.1|  PREDICTED: probable LRR receptor-like serine...    109   1e-22   
ref|XP_009397143.1|  PREDICTED: inactive receptor-like serine/thr...    109   1e-22   
ref|XP_010686215.1|  PREDICTED: probable LRR receptor-like serine...    108   2e-22   
ref|NP_001042346.1|  Os01g0206800                                       108   3e-22   
gb|AAQ01158.1|  transmembrane kinase                                    108   3e-22   
dbj|BAK00480.1|  predicted protein                                      108   3e-22   
ref|XP_009352760.1|  PREDICTED: probable LRR receptor-like serine...    108   4e-22   
ref|XP_009352758.1|  PREDICTED: probable LRR receptor-like serine...    108   4e-22   
ref|XP_009352759.1|  PREDICTED: probable LRR receptor-like serine...    108   4e-22   
emb|CDO96809.1|  unnamed protein product                                106   1e-21   
gb|KHN28617.1|  Putative LRR receptor-like serine/threonine-prote...    106   1e-21   
ref|XP_010491319.1|  PREDICTED: probable LRR receptor-like serine...    105   2e-21   
gb|KHN08427.1|  Putative LRR receptor-like serine/threonine-prote...    105   2e-21   
emb|CDM82236.1|  unnamed protein product                                105   2e-21   
ref|XP_010491320.1|  PREDICTED: probable LRR receptor-like serine...    105   3e-21   
ref|XP_006595408.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    105   3e-21   
gb|EPS64530.1|  hypothetical protein M569_10249                         103   6e-21   
ref|NP_001186540.1|  receptor-like protein kinase                     99.8    8e-20   
ref|XP_004968589.1|  PREDICTED: probable LRR receptor-like serine...    100   9e-20   
ref|XP_004968588.1|  PREDICTED: probable LRR receptor-like serine...    100   1e-19   
ref|XP_009120368.1|  PREDICTED: probable inactive receptor-like p...  99.0    2e-19   
ref|XP_009120367.1|  PREDICTED: probable inactive receptor-like p...  99.0    2e-19   
ref|XP_002881706.1|  hypothetical protein ARALYDRAFT_903309           98.2    3e-19   
ref|XP_008673395.1|  PREDICTED: receptor-like protein kinase isof...  99.4    3e-19   
ref|XP_010693070.1|  PREDICTED: probable inactive receptor-like p...  99.4    3e-19   
ref|XP_006401069.1|  hypothetical protein EUTSA_v10013281mg           97.8    6e-19   
emb|CDY32975.1|  BnaA10g11810D                                        96.7    1e-18   
gb|EPS58187.1|  hypothetical protein M569_16629                       95.5    1e-18   
ref|XP_001778006.1|  predicted protein                                95.1    2e-18   
emb|CDX99003.1|  BnaC09g48320D                                        96.7    3e-18   
ref|XP_002454969.1|  hypothetical protein SORBIDRAFT_03g002310        95.9    3e-18   
ref|NP_851216.2|  protein kinase family protein                       95.1    4e-18   
ref|XP_001771269.1|  predicted protein                                94.4    4e-18   
ref|NP_200662.3|  protein kinase family protein                       95.1    5e-18   
ref|XP_010423247.1|  PREDICTED: probable LRR receptor-like serine...  95.5    5e-18   
ref|XP_002978263.1|  hypothetical protein SELMODRAFT_108379           92.4    1e-17   
ref|XP_002966306.1|  hypothetical protein SELMODRAFT_86219            92.0    1e-17   
ref|XP_002864580.1|  kinase family protein                            91.3    1e-16   
ref|XP_010042581.1|  PREDICTED: probable inactive receptor-like p...  89.0    1e-16   
ref|XP_009122376.1|  PREDICTED: probable inactive receptor-like p...  90.9    1e-16   
ref|NP_974960.1|  protein kinase family protein                       89.0    2e-16   
ref|NP_001055812.1|  Os05g0471000                                     89.0    6e-16   
gb|EEC79385.1|  hypothetical protein OsI_20299                        89.0    6e-16   
ref|XP_010483453.1|  PREDICTED: probable inactive receptor-like p...  89.0    6e-16   
ref|XP_010483454.1|  PREDICTED: probable inactive receptor-like p...  88.6    6e-16   
ref|XP_010453875.1|  PREDICTED: probable inactive receptor-like p...  89.0    7e-16   
gb|KFK25108.1|  hypothetical protein AALP_AA8G067000                  88.2    1e-15   
ref|XP_001785001.1|  predicted protein                                87.4    1e-15   
ref|XP_006654532.1|  PREDICTED: probable LRR receptor-like serine...  87.8    1e-15   
ref|XP_010453890.1|  PREDICTED: probable inactive receptor-like p...  87.4    2e-15   
gb|ABR16672.1|  unknown                                               87.4    2e-15   
ref|XP_010453883.1|  PREDICTED: probable inactive receptor-like p...  87.4    2e-15   
ref|XP_010453898.1|  PREDICTED: probable inactive receptor-like p...  87.0    2e-15   
emb|CDX70011.1|  BnaA10g23600D                                        87.8    3e-15   
emb|CDY66210.1|  BnaCnng49990D                                        86.7    3e-15   
ref|XP_010443593.1|  PREDICTED: probable inactive receptor-like p...  86.3    5e-15   
ref|XP_010443594.1|  PREDICTED: probable inactive receptor-like p...  86.3    5e-15   
ref|XP_003566156.1|  PREDICTED: probable LRR receptor-like serine...  84.7    2e-14   
ref|XP_004961780.1|  PREDICTED: probable LRR receptor-like serine...  83.2    5e-14   
ref|XP_010907866.1|  PREDICTED: probable LRR receptor-like serine...  82.4    8e-14   
ref|XP_010667642.1|  PREDICTED: probable LRR receptor-like serine...  82.0    1e-13   
gb|KHG00778.1|  hypothetical protein F383_20723                       79.0    2e-12   
ref|XP_001756419.1|  predicted protein                                76.3    4e-12   
gb|EYU43435.1|  hypothetical protein MIMGU_mgv11b015862mg             74.7    6e-12   
ref|XP_001751726.1|  predicted protein                                75.5    8e-12   
gb|EMS57675.1|  putative LRR receptor-like serine/threonine-prote...  75.9    2e-11   
ref|XP_008649736.1|  PREDICTED: probable LRR receptor-like serine...  75.5    2e-11   
ref|XP_008649735.1|  PREDICTED: probable LRR receptor-like serine...  75.5    2e-11   
ref|XP_001776666.1|  predicted protein                                73.9    3e-11   
ref|XP_010453842.1|  PREDICTED: probable inactive receptor-like p...  74.7    3e-11   
ref|XP_010453868.1|  PREDICTED: probable inactive receptor-like p...  74.7    3e-11   
ref|XP_010453850.1|  PREDICTED: probable inactive receptor-like p...  74.7    3e-11   
gb|EMT28984.1|  Putative LRR receptor-like serine/threonine-prote...  73.6    7e-11   
ref|XP_010453859.1|  PREDICTED: probable inactive receptor-like p...  73.2    9e-11   
ref|XP_002441246.1|  hypothetical protein SORBIDRAFT_09g023100        71.2    5e-10   
ref|XP_002442654.1|  hypothetical protein SORBIDRAFT_08g000535        70.1    5e-10   
gb|EMT14158.1|  Putative LRR receptor-like serine/threonine-prote...  71.2    5e-10   
gb|KDO68892.1|  hypothetical protein CISIN_1g006019mg                 68.9    2e-09   
gb|KDP25459.1|  hypothetical protein JCGZ_20615                       67.4    8e-09   
ref|XP_008452023.1|  PREDICTED: probable LRR receptor-like serine...  67.0    1e-08   
ref|XP_010553512.1|  PREDICTED: probable LRR receptor-like serine...  67.0    1e-08   
gb|AES94066.2|  LRR receptor-like kinase                              66.6    1e-08   
gb|KEH27436.1|  LRR receptor-like kinase                              66.2    2e-08   
gb|KEH27435.1|  LRR receptor-like kinase                              66.2    2e-08   
tpg|DAA35288.1|  TPA: putative leucine-rich repeat transmembrane ...  66.2    2e-08   
ref|XP_004165235.1|  PREDICTED: probable LRR receptor-like serine...  66.2    2e-08   
ref|XP_002447347.1|  hypothetical protein SORBIDRAFT_06g033400        66.2    2e-08   
ref|XP_004146526.1|  PREDICTED: probable LRR receptor-like serine...  66.2    2e-08   
ref|XP_003611108.1|  hypothetical protein MTR_5g010440                66.2    2e-08   
gb|KGN53345.1|  hypothetical protein Csa_4G048550                     66.2    2e-08   
ref|XP_003611107.1|  hypothetical protein MTR_5g010440                66.2    2e-08   
ref|XP_008649738.1|  PREDICTED: probable LRR receptor-like serine...  65.9    2e-08   
tpg|DAA35287.1|  TPA: putative leucine-rich repeat transmembrane ...  65.9    2e-08   
tpg|DAA35290.1|  TPA: putative leucine-rich repeat transmembrane ...  66.2    2e-08   
gb|KHN23658.1|  Putative LRR receptor-like serine/threonine-prote...  66.2    2e-08   
tpg|DAA35291.1|  TPA: putative leucine-rich repeat transmembrane ...  65.9    2e-08   
gb|ACR36793.1|  unknown                                               65.5    3e-08   
ref|XP_006580595.1|  PREDICTED: probable LRR receptor-like serine...  65.9    3e-08   
gb|AAF19706.1|AC008047_13  F2K11.19                                   65.9    3e-08   
ref|XP_008649737.1|  PREDICTED: probable LRR receptor-like serine...  65.5    3e-08   
ref|XP_008674177.1|  PREDICTED: probable LRR receptor-like serine...  62.8    3e-08   
ref|XP_010533657.1|  PREDICTED: probable LRR receptor-like serine...  65.5    3e-08   
ref|NP_001185301.1|  putative LRR receptor-like serine/threonine-...  65.5    3e-08   
dbj|BAC42570.1|  putative receptor protein kinase                     65.5    4e-08   
ref|NP_176532.2|  putative LRR receptor-like serine/threonine-pro...  65.5    4e-08   
gb|KHG29278.1|  hypothetical protein F383_14925                       65.5    4e-08   
ref|XP_010533656.1|  PREDICTED: probable LRR receptor-like serine...  65.1    4e-08   
emb|CDP09761.1|  unnamed protein product                              65.1    5e-08   
ref|XP_006301663.1|  hypothetical protein CARUB_v10022112mg           64.7    5e-08   
emb|CDY66427.1|  BnaC06g42300D                                        64.7    6e-08   
ref|XP_009767696.1|  PREDICTED: probable LRR receptor-like serine...  64.7    7e-08   
tpg|DAA35286.1|  TPA: putative leucine-rich repeat transmembrane ...  63.9    7e-08   
ref|XP_010430437.1|  PREDICTED: probable LRR receptor-like serine...  64.3    7e-08   
gb|KHG15272.1|  hypothetical protein F383_06291                       64.3    9e-08   
ref|XP_006584713.1|  PREDICTED: probable LRR receptor-like serine...  63.9    9e-08   
ref|XP_010255428.1|  PREDICTED: probable LRR receptor-like serine...  63.9    1e-07   
ref|XP_010255429.1|  PREDICTED: probable LRR receptor-like serine...  63.9    1e-07   
ref|XP_010934748.1|  PREDICTED: probable LRR receptor-like serine...  63.9    1e-07   
ref|XP_010418360.1|  PREDICTED: probable LRR receptor-like serine...  63.9    1e-07   
ref|XP_007160045.1|  hypothetical protein PHAVU_002G287900g           63.5    1e-07   
gb|EEE61931.1|  hypothetical protein OsJ_16675                        63.5    1e-07   
emb|CAJ86176.1|  H0306F12.6                                           63.5    1e-07   
ref|XP_006573774.1|  PREDICTED: probable LRR receptor-like serine...  63.5    1e-07   
ref|XP_004960019.1|  PREDICTED: probable LRR receptor-like serine...  63.5    1e-07   
gb|EEC78280.1|  hypothetical protein OsI_17977                        63.5    1e-07   
gb|EPS59414.1|  hypothetical protein M569_15393                       63.2    2e-07   
ref|XP_003581459.2|  PREDICTED: probable LRR receptor-like serine...  63.5    2e-07   
ref|XP_006653895.1|  PREDICTED: probable LRR receptor-like serine...  63.2    2e-07   
ref|XP_006652573.1|  PREDICTED: probable LRR receptor-like serine...  63.2    2e-07   
ref|XP_010473580.1|  PREDICTED: probable LRR receptor-like serine...  63.2    2e-07   
ref|XP_010940463.1|  PREDICTED: probable LRR receptor-like serine...  62.8    3e-07   
emb|CDY25495.1|  BnaC09g11200D                                        62.4    3e-07   
ref|XP_004503765.1|  PREDICTED: probable LRR receptor-like serine...  62.4    3e-07   
ref|XP_004503764.1|  PREDICTED: probable LRR receptor-like serine...  62.4    3e-07   
tpg|DAA38311.1|  TPA: hypothetical protein ZEAMMB73_970745            62.8    3e-07   
ref|XP_003579507.2|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  62.0    4e-07   
ref|XP_006391746.1|  hypothetical protein EUTSA_v10023393mg           62.0    4e-07   
ref|XP_008806871.1|  PREDICTED: probable LRR receptor-like serine...  62.0    4e-07   
ref|XP_008806869.1|  PREDICTED: probable LRR receptor-like serine...  62.0    4e-07   
ref|XP_008806866.1|  PREDICTED: probable LRR receptor-like serine...  62.0    4e-07   
ref|XP_008806867.1|  PREDICTED: probable LRR receptor-like serine...  62.0    4e-07   
ref|XP_009627626.1|  PREDICTED: probable LRR receptor-like serine...  62.0    4e-07   
ref|XP_009627625.1|  PREDICTED: probable LRR receptor-like serine...  62.0    4e-07   
gb|KDO76178.1|  hypothetical protein CISIN_1g006178mg                 61.6    4e-07   
ref|XP_002887960.1|  hypothetical protein ARALYDRAFT_475009           62.0    5e-07   
ref|XP_009627628.1|  PREDICTED: probable LRR receptor-like serine...  62.0    5e-07   
gb|KDO76176.1|  hypothetical protein CISIN_1g006178mg                 61.6    5e-07   
ref|XP_008806870.1|  PREDICTED: probable LRR receptor-like serine...  62.0    5e-07   
gb|KHF98098.1|  hypothetical protein F383_12981                       61.6    5e-07   
ref|XP_006439573.1|  hypothetical protein CICLE_v10019211mg           61.6    6e-07   
ref|XP_006476588.1|  PREDICTED: probable LRR receptor-like serine...  61.6    6e-07   
gb|KDO76175.1|  hypothetical protein CISIN_1g006178mg                 61.6    6e-07   
ref|XP_010676484.1|  PREDICTED: probable LRR receptor-like serine...  61.6    6e-07   
gb|KEH21053.1|  LRR receptor-like kinase family protein               61.2    7e-07   
ref|XP_007040190.1|  Leucine-rich repeat protein kinase family pr...  61.2    7e-07   
gb|KEH21055.1|  LRR receptor-like kinase family protein               61.2    8e-07   
ref|XP_003630536.1|  hypothetical protein MTR_8g098510                60.8    8e-07   
gb|KEH21054.1|  LRR receptor-like kinase family protein               60.8    9e-07   
emb|CDY34352.1|  BnaA09g10940D                                        60.8    9e-07   
ref|XP_009587342.1|  PREDICTED: probable LRR receptor-like serine...  60.5    1e-06   
gb|AET05012.2|  LRR receptor-like kinase family protein               60.8    1e-06   
gb|KCW77548.1|  hypothetical protein EUGRSUZ_D01865                   60.8    1e-06   
gb|KFK33028.1|  hypothetical protein AALP_AA6G321000                  60.8    1e-06   
emb|CDX93867.1|  BnaC04g20260D                                        60.8    1e-06   



>ref|XP_009776550.1| PREDICTED: inactive receptor-like serine/threonine-protein kinase 
At2g40270 [Nicotiana sylvestris]
Length=646

 Score =   174 bits (442),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -3

Query  421  IKNSKK-HHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTG  245
            ++NS++ HH+ LI++A +GG +LL +   G +F + NK+AVVKPWATG+SGQLQ+AFVTG
Sbjct  292  LENSRRSHHRALILSAAIGGPILLFILITGAIFFRSNKIAVVKPWATGLSGQLQRAFVTG  351

Query  244  LPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQF  65
            +PKL+RSELE ACEDFSNVIGSSSV TL KGTLSSGVEIAV+   +ESAKDWS+D EAQF
Sbjct  352  VPKLKRSELEAACEDFSNVIGSSSVCTLYKGTLSSGVEIAVISRTVESAKDWSKDMEAQF  411

Query  64   RHKV  53
            R K+
Sbjct  412  RKKI  415



>ref|XP_009632033.1| PREDICTED: inactive receptor-like serine/threonine-protein kinase 
At2g40270 [Nicotiana tomentosiformis]
Length=648

 Score =   173 bits (439),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -3

Query  421  IKNSKK-HHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTG  245
            ++NS++ H ++LI++A +GG +LL V   G +F + NK+AVVKPWATG+SGQLQ+AFVTG
Sbjct  294  LENSRRSHRRVLILSAAIGGPILLFVLITGAIFFRSNKIAVVKPWATGLSGQLQRAFVTG  353

Query  244  LPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQF  65
            +PKL+RSELE ACEDFSNVIGSSSV TL KGTLSSGVEIAV+   +ESAKDWS+D EAQF
Sbjct  354  VPKLKRSELEAACEDFSNVIGSSSVCTLYKGTLSSGVEIAVISRTVESAKDWSKDMEAQF  413

Query  64   RHKV  53
            R K+
Sbjct  414  RKKI  417



>ref|XP_006353430.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like [Solanum tuberosum]
Length=653

 Score =   169 bits (428),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = -3

Query  409  KKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLR  230
            + +H++LI++A +GGSVLLI+   G +  + NKMAVVKPWATG+SGQLQ+AFVTG+PKL+
Sbjct  304  RSNHRVLILSAAIGGSVLLIILITGTIVFRSNKMAVVKPWATGLSGQLQRAFVTGVPKLK  363

Query  229  RSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            RSELE+ACEDFSNVIGSSSV TL KGTLSSGVEIAV+   + S KDWS+D EA +R K+
Sbjct  364  RSELESACEDFSNVIGSSSVCTLYKGTLSSGVEIAVISRTVASTKDWSKDMEAHYRKKI  422



>ref|XP_011084876.1| PREDICTED: inactive receptor-like serine/threonine-protein kinase 
At2g40270 isoform X2 [Sesamum indicum]
Length=586

 Score =   168 bits (425),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 106/130 (82%), Gaps = 2/130 (2%)
 Frame = -3

Query  439  ATPRNEIKNSKKHH-KILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQ  263
            A P+   ++S++HH ++LI++A  GG +LL+V  IGI F Q  K+A VKPWATG+SGQLQ
Sbjct  226  AGPQAPAQHSRRHHNRLLIVSAASGGPLLLLV-IIGIFFWQSGKVATVKPWATGLSGQLQ  284

Query  262  KAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSR  83
            +AFVTG+PKL+RSELE ACEDFSNVIGSSS+ TL KGTLSSGVEIAV  +++ SAKDWS 
Sbjct  285  RAFVTGVPKLKRSELEAACEDFSNVIGSSSLCTLYKGTLSSGVEIAVASISVASAKDWSN  344

Query  82   DQEAQFRHKV  53
             QEAQFR K+
Sbjct  345  SQEAQFRKKI  354



>ref|XP_003552837.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like [Glycine max]
Length=644

 Score =   168 bits (426),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -3

Query  412  SKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKL  233
            S K+H ++I+A V+GG+V L++S IG+  C+ NK+A VKPWATG+SGQLQ AFVTG+PKL
Sbjct  285  SSKNHVVVILAGVMGGAVFLLISIIGLYLCKTNKVATVKPWATGLSGQLQNAFVTGVPKL  344

Query  232  RRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +RSELE ACEDFSNVIG+SS+ T+ KGTLSSGVEIAV  +A  S+KDWS+  EAQFR+K+
Sbjct  345  KRSELEAACEDFSNVIGTSSIGTVYKGTLSSGVEIAVASVAATSSKDWSKTLEAQFRNKI  404



>emb|CDP09230.1| unnamed protein product [Coffea canephora]
Length=691

 Score =   168 bits (426),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 105/128 (82%), Gaps = 2/128 (2%)
 Frame = -3

Query  433  PRNEIKNSKK--HHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQK  260
            P N +KN KK  +H I I++ V+GGSV+++VS + +++C+ NK+  VKPWATG+SGQLQK
Sbjct  320  PTNILKNKKKSNNHTIFILSGVIGGSVIVLVSVLSLLYCRSNKVVTVKPWATGLSGQLQK  379

Query  259  AFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRD  80
            AFVTG+PKL+RSELE ACEDFSN+I S S  T+ KGTLSSGVEIAV   A++SAKDWS++
Sbjct  380  AFVTGVPKLQRSELEAACEDFSNIIASLSDGTVYKGTLSSGVEIAVTSTAVKSAKDWSKN  439

Query  79   QEAQFRHK  56
             EAQFR+K
Sbjct  440  LEAQFRNK  447



>ref|XP_004240911.1| PREDICTED: inactive receptor-like serine/threonine-protein kinase 
At2g40270 [Solanum lycopersicum]
Length=651

 Score =   167 bits (423),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -3

Query  421  IKNSKK-HHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTG  245
            ++N+++ +H++LI++A +GGSVLL++   G +  + NKMAVVKPWATG+SGQLQ+AF+TG
Sbjct  297  VENARRSNHRVLILSAAIGGSVLLLILIAGTIVFRSNKMAVVKPWATGLSGQLQRAFITG  356

Query  244  LPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQF  65
            +PKL+RSELE+ACEDFSNVIGSSSV TL KGTLSSGVEIAV+   + S KDWS+D E  F
Sbjct  357  VPKLKRSELESACEDFSNVIGSSSVCTLYKGTLSSGVEIAVISRTVASTKDWSKDMETHF  416

Query  64   RHKV  53
            R K+
Sbjct  417  RKKI  420



>ref|XP_011084875.1| PREDICTED: inactive receptor-like serine/threonine-protein kinase 
At2g40270 isoform X1 [Sesamum indicum]
Length=661

 Score =   167 bits (423),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 106/130 (82%), Gaps = 2/130 (2%)
 Frame = -3

Query  439  ATPRNEIKNSKKHH-KILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQ  263
            A P+   ++S++HH ++LI++A  GG +LL+V  IGI F Q  K+A VKPWATG+SGQLQ
Sbjct  301  AGPQAPAQHSRRHHNRLLIVSAASGGPLLLLV-IIGIFFWQSGKVATVKPWATGLSGQLQ  359

Query  262  KAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSR  83
            +AFVTG+PKL+RSELE ACEDFSNVIGSSS+ TL KGTLSSGVEIAV  +++ SAKDWS 
Sbjct  360  RAFVTGVPKLKRSELEAACEDFSNVIGSSSLCTLYKGTLSSGVEIAVASISVASAKDWSN  419

Query  82   DQEAQFRHKV  53
             QEAQFR K+
Sbjct  420  SQEAQFRKKI  429



>gb|KHN31298.1| Putative LRR receptor-like serine/threonine-protein kinase MRH1 
[Glycine soja]
Length=644

 Score =   167 bits (422),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -3

Query  412  SKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKL  233
            S K+H ++I+A  +GG+V L++S IG+  C+ NK+A VKPWATG+SGQLQ AFVTG+PKL
Sbjct  285  SSKNHVVVILAGAMGGAVFLLISIIGLYLCKTNKVATVKPWATGLSGQLQNAFVTGVPKL  344

Query  232  RRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +RSELE ACEDFSNVIG+SS+ T+ KGTLSSGVEIAV  +A  S+KDWS+  EAQFR+K+
Sbjct  345  KRSELEAACEDFSNVIGTSSIGTVYKGTLSSGVEIAVASVAATSSKDWSKTLEAQFRNKI  404



>emb|CDP13981.1| unnamed protein product [Coffea canephora]
Length=639

 Score =   166 bits (420),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -3

Query  418  KNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLP  239
            K+   HH +LI+++ +GGS+LL++   GI  C+ +K+AVVKPWATG+SGQLQKAFVTG+P
Sbjct  287  KSRSSHHHVLILSSTIGGSLLLLLLVTGIFICRSSKVAVVKPWATGLSGQLQKAFVTGVP  346

Query  238  KLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRH  59
            KL+RSELETACEDFSNVIGSSS  TL KGTLSSGVEIAV+ +++ SAKDWS++ E QFR 
Sbjct  347  KLKRSELETACEDFSNVIGSSSAGTLYKGTLSSGVEIAVISISVISAKDWSKNMEVQFRK  406

Query  58   KV  53
            K+
Sbjct  407  KI  408



>ref|XP_003537493.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like [Glycine max]
Length=638

 Score =   166 bits (419),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = -3

Query  403  HHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRS  224
            +H ++I+A V+GG V L++S IG+  C+ NK+A VKPWATG+SGQLQKAFVTG+PKL+RS
Sbjct  282  NHLVVILAGVMGGVVFLLISIIGLYLCKTNKVATVKPWATGLSGQLQKAFVTGVPKLKRS  341

Query  223  ELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            ELE ACEDFSNVIG+SS+ T+ KGTLSSGVEIAV  +A  S+KDWS+  EAQFR+K+
Sbjct  342  ELEAACEDFSNVIGTSSIGTVYKGTLSSGVEIAVASVAATSSKDWSKTLEAQFRNKI  398



>gb|KHN04780.1| Putative LRR receptor-like serine/threonine-protein kinase MRH1 
[Glycine soja]
Length=638

 Score =   166 bits (419),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = -3

Query  403  HHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRS  224
            +H ++I+A V+GG V L++S IG+  C+ NK+A VKPWATG+SGQLQKAFVTG+PKL+RS
Sbjct  282  NHLVVILAGVMGGVVFLLISIIGLYLCKTNKVATVKPWATGLSGQLQKAFVTGVPKLKRS  341

Query  223  ELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            ELE ACEDFSNVIG+SS+ T+ KGTLSSGVEIAV  +A  S+KDWS+  EAQFR+K+
Sbjct  342  ELEAACEDFSNVIGTSSIGTVYKGTLSSGVEIAVASVAATSSKDWSKTLEAQFRNKI  398



>ref|XP_002278392.1| PREDICTED: inactive receptor-like serine/threonine-protein kinase 
At2g40270 [Vitis vinifera]
Length=720

 Score =   160 bits (406),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -3

Query  406  KHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRR  227
            KH+ +LI++ VLG S+++ +SA+GI+FC+ +K+  VKPWATG+SGQLQKAFVTG+PKL R
Sbjct  361  KHYTVLILSGVLGSSLVIFISAMGIIFCRSHKVVTVKPWATGLSGQLQKAFVTGVPKLNR  420

Query  226  SELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +ELETACEDFSN+IGS S  T+ KGTLS+GVEIAV   A+ S  DWS++ EAQFR K+
Sbjct  421  AELETACEDFSNIIGSLSDGTVYKGTLSNGVEIAVTSSAVASLGDWSKNLEAQFRKKI  478



>ref|XP_011001758.1| PREDICTED: inactive receptor-like serine/threonine-protein kinase 
At2g40270 isoform X2 [Populus euphratica]
Length=652

 Score =   159 bits (403),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 104/135 (77%), Gaps = 7/135 (5%)
 Frame = -3

Query  442  TATPR--NEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQ  269
            ++ PR  +E   SKKHH  +I   + GG++++++S +GI  C+ NK A VKPWATG+SGQ
Sbjct  278  SSAPRTSSEYSQSKKHHGAIITGTI-GGTLVILISILGIYICKTNK-ASVKPWATGLSGQ  335

Query  268  LQKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLW---LAIESA  98
            LQKAFVTG+PKL+RSELE  CEDFSNVIGSS + TL KGTLSSGVEIAVL    +AI SA
Sbjct  336  LQKAFVTGVPKLKRSELEAGCEDFSNVIGSSPIGTLYKGTLSSGVEIAVLAVASVAITSA  395

Query  97   KDWSRDQEAQFRHKV  53
            KDWS++ E QFR K+
Sbjct  396  KDWSKNLEVQFRQKI  410



>ref|XP_011001683.1| PREDICTED: inactive receptor-like serine/threonine-protein kinase 
At2g40270 isoform X1 [Populus euphratica]
Length=657

 Score =   159 bits (402),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 104/135 (77%), Gaps = 7/135 (5%)
 Frame = -3

Query  442  TATPR--NEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQ  269
            ++ PR  +E   SKKHH  +I   + GG++++++S +GI  C+ NK A VKPWATG+SGQ
Sbjct  283  SSAPRTSSEYSQSKKHHGAIITGTI-GGTLVILISILGIYICKTNK-ASVKPWATGLSGQ  340

Query  268  LQKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLW---LAIESA  98
            LQKAFVTG+PKL+RSELE  CEDFSNVIGSS + TL KGTLSSGVEIAVL    +AI SA
Sbjct  341  LQKAFVTGVPKLKRSELEAGCEDFSNVIGSSPIGTLYKGTLSSGVEIAVLAVASVAITSA  400

Query  97   KDWSRDQEAQFRHKV  53
            KDWS++ E QFR K+
Sbjct  401  KDWSKNLEVQFRQKI  415



>ref|XP_006425118.1| hypothetical protein CICLE_v10027941mg [Citrus clementina]
 ref|XP_006425120.1| hypothetical protein CICLE_v10027941mg [Citrus clementina]
 gb|ESR38358.1| hypothetical protein CICLE_v10027941mg [Citrus clementina]
 gb|ESR38360.1| hypothetical protein CICLE_v10027941mg [Citrus clementina]
Length=589

 Score =   155 bits (393),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 102/133 (77%), Gaps = 3/133 (2%)
 Frame = -3

Query  442  TATPRNEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQ  263
            T +  +E  +  KHH +L++A ++GG  L+++SAIG + C+ +K+  VKPW TG+SGQLQ
Sbjct  215  TPSQVHESLHKSKHHTVLVLAGIIGGLSLILISAIGFLVCRSSKVVTVKPWVTGLSGQLQ  274

Query  262  KAFVTGLPKLRRSELETACEDFSNVIGSSS---VYTLCKGTLSSGVEIAVLWLAIESAKD  92
            KAFVTG+PKL+RSELE ACEDFSN+IGS S   V T+ KGTLSSGVEIAV   +++S  D
Sbjct  275  KAFVTGVPKLKRSELEAACEDFSNIIGSFSDGTVGTVYKGTLSSGVEIAVTSTSVKSRAD  334

Query  91   WSRDQEAQFRHKV  53
            WS++ E+QFR K+
Sbjct  335  WSKNLESQFRKKI  347



>gb|KCW65702.1| hypothetical protein EUGRSUZ_G03081 [Eucalyptus grandis]
Length=650

 Score =   155 bits (392),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 104/136 (76%), Gaps = 7/136 (5%)
 Frame = -3

Query  442  TATPRNEIKN------SKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATG  281
            +A+P  E+ N      +K  H  +I   V+GGS  ++++ +G+  C+ NK+A VKPWATG
Sbjct  272  SASPAPELTNISPPPKAKSSHPAII-GGVVGGSSFVLITILGVYLCKSNKVATVKPWATG  330

Query  280  ISGQLQKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIES  101
            +SGQLQKAFVTG+PKL+R+E+E ACEDFSNV+GSSS+ T+ KGTLSSGVEIAV  +  +S
Sbjct  331  LSGQLQKAFVTGVPKLKRAEVEAACEDFSNVVGSSSIGTIYKGTLSSGVEIAVASVGGKS  390

Query  100  AKDWSRDQEAQFRHKV  53
            AKDWS++ EAQFR+ +
Sbjct  391  AKDWSKNLEAQFRNMI  406



>ref|XP_010068916.1| PREDICTED: probable inactive receptor-like protein kinase At3g56050 
[Eucalyptus grandis]
Length=712

 Score =   155 bits (391),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 104/136 (76%), Gaps = 7/136 (5%)
 Frame = -3

Query  442  TATPRNEIKN------SKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATG  281
            +A+P  E+ N      +K  H  +I   V+GGS  ++++ +G+  C+ NK+A VKPWATG
Sbjct  334  SASPAPELTNISPPPKAKSSHPAII-GGVVGGSSFVLITILGVYLCKSNKVATVKPWATG  392

Query  280  ISGQLQKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIES  101
            +SGQLQKAFVTG+PKL+R+E+E ACEDFSNV+GSSS+ T+ KGTLSSGVEIAV  +  +S
Sbjct  393  LSGQLQKAFVTGVPKLKRAEVEAACEDFSNVVGSSSIGTIYKGTLSSGVEIAVASVGGKS  452

Query  100  AKDWSRDQEAQFRHKV  53
            AKDWS++ EAQFR+ +
Sbjct  453  AKDWSKNLEAQFRNMI  468



>ref|XP_006425119.1| hypothetical protein CICLE_v10027941mg [Citrus clementina]
 gb|ESR38359.1| hypothetical protein CICLE_v10027941mg [Citrus clementina]
Length=685

 Score =   154 bits (390),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 102/133 (77%), Gaps = 3/133 (2%)
 Frame = -3

Query  442  TATPRNEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQ  263
            T +  +E  +  KHH +L++A ++GG  L+++SAIG + C+ +K+  VKPW TG+SGQLQ
Sbjct  311  TPSQVHESLHKSKHHTVLVLAGIIGGLSLILISAIGFLVCRSSKVVTVKPWVTGLSGQLQ  370

Query  262  KAFVTGLPKLRRSELETACEDFSNVIGSSS---VYTLCKGTLSSGVEIAVLWLAIESAKD  92
            KAFVTG+PKL+RSELE ACEDFSN+IGS S   V T+ KGTLSSGVEIAV   +++S  D
Sbjct  371  KAFVTGVPKLKRSELEAACEDFSNIIGSFSDGTVGTVYKGTLSSGVEIAVTSTSVKSRAD  430

Query  91   WSRDQEAQFRHKV  53
            WS++ E+QFR K+
Sbjct  431  WSKNLESQFRKKI  443



>ref|XP_007016945.1| Leucine-rich repeat protein kinase family protein, putative isoform 
1 [Theobroma cacao]
 ref|XP_007016946.1| Leucine-rich repeat protein kinase family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY34564.1| Leucine-rich repeat protein kinase family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY34565.1| Leucine-rich repeat protein kinase family protein, putative isoform 
1 [Theobroma cacao]
Length=700

 Score =   154 bits (390),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = -3

Query  406  KHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRR  227
            KHH +L++ A +GGSV +++S +GIV  + +K+  VKPWATG+SGQLQKAFVTG PKL+R
Sbjct  341  KHHMVLVLVASIGGSVFVLISVLGIVLFRSSKVVTVKPWATGLSGQLQKAFVTGAPKLKR  400

Query  226  SELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            SELE ACEDFSN+IG+ S  T+ KGTLSSGVEIAV   A+ S +DWS++ E QFR K+
Sbjct  401  SELEAACEDFSNIIGTFSDGTVYKGTLSSGVEIAVTSTAVASREDWSKNLETQFRKKI  458



>ref|XP_006488566.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like isoform X1 [Citrus sinensis]
 ref|XP_006488567.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like isoform X2 [Citrus sinensis]
Length=685

 Score =   154 bits (389),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 101/133 (76%), Gaps = 3/133 (2%)
 Frame = -3

Query  442  TATPRNEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQ  263
            T +  +E  +  KHH +L++A ++GG  L+++SAIG   C+ +K+  VKPW TG+SGQLQ
Sbjct  311  TPSQVHESLHKSKHHTVLVLAGIIGGLSLILISAIGFFVCRSSKVVTVKPWVTGLSGQLQ  370

Query  262  KAFVTGLPKLRRSELETACEDFSNVIGSSS---VYTLCKGTLSSGVEIAVLWLAIESAKD  92
            KAFVTG+PKL+RSELE ACEDFSN+IGS S   V T+ KGTLSSGVEIAV   +++S  D
Sbjct  371  KAFVTGVPKLKRSELEAACEDFSNIIGSFSDGTVGTVYKGTLSSGVEIAVTSTSVKSRAD  430

Query  91   WSRDQEAQFRHKV  53
            WS++ E+QFR K+
Sbjct  431  WSKNLESQFRKKI  443



>ref|XP_002273218.1| PREDICTED: inactive receptor-like serine/threonine-protein kinase 
At2g40270 [Vitis vinifera]
Length=654

 Score =   154 bits (388),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = -3

Query  391  LIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELET  212
            L++  V+GGSVL+ +  I I   + NK+A VKPWATG+SGQLQK FVTG+PKL+RSELET
Sbjct  300  LLLVGVIGGSVLVFICIICIYLFRTNKVATVKPWATGLSGQLQKVFVTGVPKLKRSELET  359

Query  211  ACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            ACEDFSNVIGSSS+ T+ KGTLSSGVEIAV   A+ S+KDWS++ E QFR K+
Sbjct  360  ACEDFSNVIGSSSIGTVYKGTLSSGVEIAVTSAAVTSSKDWSKNLEVQFRKKI  412



>gb|KDO66979.1| hypothetical protein CISIN_1g004129mg [Citrus sinensis]
Length=721

 Score =   154 bits (390),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 101/133 (76%), Gaps = 3/133 (2%)
 Frame = -3

Query  442  TATPRNEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQ  263
            T +  +E  +  KHH +L++A ++GG  L+++SAIG   C+ +K+  VKPW TG+SGQLQ
Sbjct  347  TPSQVHESLHKSKHHTVLVLAGIIGGLSLILISAIGFFVCRSSKVVTVKPWVTGLSGQLQ  406

Query  262  KAFVTGLPKLRRSELETACEDFSNVIGSSS---VYTLCKGTLSSGVEIAVLWLAIESAKD  92
            KAFVTG+PKL+RSELE ACEDFSN+IGS S   V T+ KGTLSSGVEIAV   +++S  D
Sbjct  407  KAFVTGVPKLKRSELEAACEDFSNIIGSFSDGTVGTVYKGTLSSGVEIAVTSTSVKSRAD  466

Query  91   WSRDQEAQFRHKV  53
            WS++ E+QFR K+
Sbjct  467  WSKNLESQFRKKI  479



>ref|XP_004491019.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like isoform X2 [Cicer arietinum]
Length=642

 Score =   153 bits (387),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = -3

Query  412  SKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKL  233
            S K +++ I A V+G  V L++S IGI  C+ NK+A+V+PW TGISGQLQKA VTG+PKL
Sbjct  288  SSKKNQVPIFAGVIGCVVFLVISTIGIYLCKTNKVAIVRPWTTGISGQLQKALVTGVPKL  347

Query  232  RRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +R++LE ACEDFSNVIG+S + TL KGTLSSGVEIAV  +++ S+K W++  EAQFR K+
Sbjct  348  KRTDLEAACEDFSNVIGNSPIGTLYKGTLSSGVEIAVASISVTSSKSWTKPLEAQFRKKI  407



>ref|XP_004491018.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like isoform X1 [Cicer arietinum]
Length=642

 Score =   153 bits (387),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = -3

Query  412  SKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKL  233
            S K +++ I A V+G  V L++S IGI  C+ NK+A+V+PW TGISGQLQKA VTG+PKL
Sbjct  288  SSKKNQVPIFAGVIGCVVFLVISTIGIYLCKTNKVAIVRPWTTGISGQLQKALVTGVPKL  347

Query  232  RRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +R++LE ACEDFSNVIG+S + TL KGTLSSGVEIAV  +++ S+K W++  EAQFR K+
Sbjct  348  KRTDLEAACEDFSNVIGNSPIGTLYKGTLSSGVEIAVASISVTSSKSWTKPLEAQFRKKI  407



>ref|XP_010043407.1| PREDICTED: inactive receptor-like serine/threonine-protein kinase 
At2g40270 [Eucalyptus grandis]
Length=721

 Score =   154 bits (389),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = -3

Query  415  NSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPK  236
            +++KH  ++I  AV+ GSV++++SA  + F +RNK+  VKPWATG+SGQLQKAFVTG+PK
Sbjct  350  SNRKHQMVIITTAVIAGSVVILISAAAMFFFRRNKVVTVKPWATGLSGQLQKAFVTGVPK  409

Query  235  LRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHK  56
            L+RSELE ACEDFSN+IG+ S  T  KGTLSSGVEIAV   A  S  +WS+D EAQFR K
Sbjct  410  LQRSELEAACEDFSNIIGTLSDGTAYKGTLSSGVEIAVTSSAAASPDNWSKDLEAQFRKK  469

Query  55   V  53
            +
Sbjct  470  I  470



>ref|XP_003518434.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like [Glycine max]
 gb|KHN38530.1| Putative LRR receptor-like serine/threonine-protein kinase MRH1 
[Glycine soja]
Length=645

 Score =   153 bits (387),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 95/121 (79%), Gaps = 1/121 (1%)
 Frame = -3

Query  415  NSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPK  236
            NS K H   I+  V+GG+V LI S+IGI  C + K+A V+PWATG+SGQLQKAFVTG  K
Sbjct  288  NSPKVHTFPILPGVIGGAVFLIFSSIGIYLC-KTKVANVRPWATGLSGQLQKAFVTGAQK  346

Query  235  LRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHK  56
            LRRS+LE ACEDFSNVIG+S + TL KGTLSSGVEIAV ++ + S+++WS+  EAQFR K
Sbjct  347  LRRSDLEAACEDFSNVIGTSPIGTLYKGTLSSGVEIAVAFVPVTSSRNWSKTLEAQFRSK  406

Query  55   V  53
            +
Sbjct  407  I  407



>gb|KDO66980.1| hypothetical protein CISIN_1g004129mg [Citrus sinensis]
 gb|KDO66981.1| hypothetical protein CISIN_1g004129mg [Citrus sinensis]
Length=772

 Score =   154 bits (390),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 101/133 (76%), Gaps = 3/133 (2%)
 Frame = -3

Query  442  TATPRNEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQ  263
            T +  +E  +  KHH +L++A ++GG  L+++SAIG   C+ +K+  VKPW TG+SGQLQ
Sbjct  398  TPSQVHESLHKSKHHTVLVLAGIIGGLSLILISAIGFFVCRSSKVVTVKPWVTGLSGQLQ  457

Query  262  KAFVTGLPKLRRSELETACEDFSNVIGSSS---VYTLCKGTLSSGVEIAVLWLAIESAKD  92
            KAFVTG+PKL+RSELE ACEDFSN+IGS S   V T+ KGTLSSGVEIAV   +++S  D
Sbjct  458  KAFVTGVPKLKRSELEAACEDFSNIIGSFSDGTVGTVYKGTLSSGVEIAVTSTSVKSRAD  517

Query  91   WSRDQEAQFRHKV  53
            WS++ E+QFR K+
Sbjct  518  WSKNLESQFRKKI  530



>ref|XP_004168798.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like [Cucumis sativus]
Length=657

 Score =   153 bits (386),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -3

Query  415  NSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPK  236
            N  K+HK+LI+  ++ GS+ L+ + +GI+  + +K+  VKPWATG+SGQLQKAFVTG+PK
Sbjct  295  NKNKNHKVLILTGIVAGSLFLLFATVGILMFRSSKVVTVKPWATGLSGQLQKAFVTGVPK  354

Query  235  LRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHK  56
            L+RSELE ACEDFSN+IGS S  T+ KGTLSSGVEIAV   A+ S  DWS+ +E QFR K
Sbjct  355  LKRSELEAACEDFSNIIGSFSDITVYKGTLSSGVEIAVTSTAVTSNADWSKTKEEQFRKK  414

Query  55   V  53
            +
Sbjct  415  I  415



>ref|XP_010264565.1| PREDICTED: inactive receptor-like serine/threonine-protein kinase 
At2g40270 [Nelumbo nucifera]
Length=644

 Score =   153 bits (386),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 98/124 (79%), Gaps = 0/124 (0%)
 Frame = -3

Query  424  EIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTG  245
            ++++S  + K LI       +  L +S IGI++C+RNK+  VKPW+TG+SGQLQKAF+TG
Sbjct  279  QLQSSSGNPKFLIWFGASVAAFFLCLSVIGILYCRRNKVVTVKPWSTGLSGQLQKAFITG  338

Query  244  LPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQF  65
            +PKL+RSELETACEDFSN+I SSS  T+ KGTLSSGVEIAV+ +++ SAKDWS++ E QF
Sbjct  339  VPKLKRSELETACEDFSNIIDSSSEGTMYKGTLSSGVEIAVISISLTSAKDWSKNFECQF  398

Query  64   RHKV  53
            R K+
Sbjct  399  RKKI  402



>ref|XP_003591240.1| Ser-thr protein kinase [Medicago truncatula]
 gb|AES61491.1| LRR receptor-like kinase [Medicago truncatula]
Length=627

 Score =   152 bits (385),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = -3

Query  412  SKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKL  233
            SKK+   +    ++GG+V L++S+IGI  C+ NK+A+V+PW+TGISGQLQKA VTG+PKL
Sbjct  268  SKKNQVPIFAGVIIGGAVFLVISSIGIYLCKTNKLAIVRPWSTGISGQLQKALVTGVPKL  327

Query  232  RRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
             RS+LE ACEDFSNVIG+S + TL KGTLSSGVEIAV  +++  +K W+R  E QFR K+
Sbjct  328  NRSDLEAACEDFSNVIGNSPIGTLYKGTLSSGVEIAVASVSVTLSKSWTRTLETQFRKKI  387



>gb|KGN47057.1| hypothetical protein Csa_6G182110 [Cucumis sativus]
Length=684

 Score =   153 bits (386),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -3

Query  415  NSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPK  236
            N  K+HK+LI+  ++ GS+ L+ + +GI+  + +K+  VKPWATG+SGQLQKAFVTG+PK
Sbjct  322  NKNKNHKVLILTGIVAGSLFLLFATVGILMFRSSKVVTVKPWATGLSGQLQKAFVTGVPK  381

Query  235  LRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHK  56
            L+RSELE ACEDFSN+IGS S  T+ KGTLSSGVEIAV   A+ S  DWS+ +E QFR K
Sbjct  382  LKRSELEAACEDFSNIIGSFSDITVYKGTLSSGVEIAVTSTAVTSNADWSKTKEEQFRKK  441

Query  55   V  53
            +
Sbjct  442  I  442



>emb|CBI25442.3| unnamed protein product [Vitis vinifera]
Length=670

 Score =   152 bits (385),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = -3

Query  391  LIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELET  212
            L++  V+GGSVL+ +  I I   + NK+A VKPWATG+SGQLQK FVTG+PKL+RSELET
Sbjct  329  LLLVGVIGGSVLVFICIICIYLFRTNKVATVKPWATGLSGQLQKVFVTGVPKLKRSELET  388

Query  211  ACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            ACEDFSNVIGSSS+ T+ KGTLSSGVEIAV   A+ S+KDWS++ E QFR K+
Sbjct  389  ACEDFSNVIGSSSIGTVYKGTLSSGVEIAVTSAAVTSSKDWSKNLEVQFRKKI  441



>ref|XP_007163571.1| hypothetical protein PHAVU_001G245300g [Phaseolus vulgaris]
 gb|ESW35565.1| hypothetical protein PHAVU_001G245300g [Phaseolus vulgaris]
Length=643

 Score =   152 bits (385),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = -3

Query  394  ILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELE  215
            + I+A V+GG   +++S IGI   + NK+A VKPWATG+SGQLQKAFVTG+PKL+RSELE
Sbjct  290  VRILAGVIGGFAFVVISIIGIYLWKTNKVATVKPWATGLSGQLQKAFVTGVPKLKRSELE  349

Query  214  TACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
             ACEDFSNVIG+SS+ T+ KGTLSSGVEIAV  +A+  +KDWS+  EAQFR K+
Sbjct  350  AACEDFSNVIGTSSLGTVYKGTLSSGVEIAVASVAVTESKDWSKTLEAQFRKKI  403



>gb|KDP44721.1| hypothetical protein JCGZ_01221 [Jatropha curcas]
Length=670

 Score =   152 bits (384),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 98/131 (75%), Gaps = 3/131 (2%)
 Frame = -3

Query  442  TATP-RNEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQL  266
            T +P +N    S    K+ I+A V+GG+ LL++S I I FC  NK   VKPWATG+SGQL
Sbjct  298  TPSPSKNPGNRSSSTKKVAIIAGVIGGA-LLVISIISISFCTINK-TTVKPWATGLSGQL  355

Query  265  QKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWS  86
            QKAF+ G+PKL+RSELE  CEDFSNVIGSS + TL KGTLSSGVEIAV  +A+ S+KDW 
Sbjct  356  QKAFINGVPKLKRSELEAGCEDFSNVIGSSPIGTLYKGTLSSGVEIAVASIAVASSKDWP  415

Query  85   RDQEAQFRHKV  53
            ++ EAQFR K+
Sbjct  416  KNLEAQFRKKI  426



>ref|XP_010257070.1| PREDICTED: probable inactive receptor-like protein kinase At3g56050 
[Nelumbo nucifera]
 ref|XP_010257071.1| PREDICTED: probable inactive receptor-like protein kinase At3g56050 
[Nelumbo nucifera]
Length=699

 Score =   152 bits (384),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = -3

Query  400  HKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSE  221
            HK L+++A+ G S+  IVS I I +C+ +K+  VKPW+TG+SGQLQKAFVTG+PKL+RSE
Sbjct  346  HKFLVLSAIPGASIFFIVSVIAIFYCRSSKVVTVKPWSTGLSGQLQKAFVTGVPKLKRSE  405

Query  220  LETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            LETACEDFSN+I SS   T+ KGTLSSGVEIAV  +A  SA+DWS++ E QF  K+
Sbjct  406  LETACEDFSNIIDSSIDGTMYKGTLSSGVEIAVTSIAATSARDWSKNFEEQFWKKI  461



>gb|KHG13760.1| hypothetical protein F383_16603 [Gossypium arboreum]
Length=514

 Score =   150 bits (380),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 101/132 (77%), Gaps = 4/132 (3%)
 Frame = -3

Query  439  ATPR---NEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQ  269
            +TPR   NE  +SK HH   I+ A +G S++++VS + I+  + +K+  VKPWATG+SGQ
Sbjct  142  STPRQISNENSDSK-HHIFPILIASIGCSLIVLVSVLSIILFRNSKVVSVKPWATGLSGQ  200

Query  268  LQKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDW  89
            LQKAFVTG+PKL+RSELE ACEDFSNVIG+ S  T+ KGTLSSGVEIAV   AI S +DW
Sbjct  201  LQKAFVTGVPKLKRSELEAACEDFSNVIGTFSDGTVYKGTLSSGVEIAVTSTAISSREDW  260

Query  88   SRDQEAQFRHKV  53
            S++ E QFR+K+
Sbjct  261  SKNLETQFRNKI  272



>ref|XP_002313236.2| hypothetical protein POPTR_0009s07920g [Populus trichocarpa]
 gb|EEE87191.2| hypothetical protein POPTR_0009s07920g [Populus trichocarpa]
Length=677

 Score =   151 bits (382),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = -3

Query  427  NEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVT  248
            N +  SK  H   ++A V+ GS+  ++SAIGI F + +K+  V+PWATG+SGQLQ AFVT
Sbjct  311  NHLGQSKAKHHTALIAGVIAGSMFALISAIGIFFFRSSKVVTVRPWATGLSGQLQNAFVT  370

Query  247  GLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQ  68
            G+PKL+RSELE ACEDFSN+IGS S  T  KGTLSSGVEIAV+  A+ S +DW ++ EAQ
Sbjct  371  GVPKLKRSELEAACEDFSNIIGSFSDGTAYKGTLSSGVEIAVMSTAVRSHEDWLKNLEAQ  430

Query  67   FRHKV  53
            FR K+
Sbjct  431  FRKKI  435



>ref|XP_008465269.1| PREDICTED: inactive receptor-like serine/threonine-protein kinase 
At2g40270 [Cucumis melo]
Length=685

 Score =   151 bits (382),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = -3

Query  415  NSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPK  236
            N  K HK+LI+  ++ GS+ L+ + +GI+  + +K+  VKPWATG+SGQLQKAFVTG+PK
Sbjct  323  NKNKSHKVLILTGIVAGSLFLLFATVGILMFRSSKVVTVKPWATGLSGQLQKAFVTGVPK  382

Query  235  LRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHK  56
            L+RSELE ACEDFSN+IGS S  T+ KGTLSSGVEIAV   A+ S  DWS+ +E QFR K
Sbjct  383  LKRSELEAACEDFSNIIGSFSDITVYKGTLSSGVEIAVTSTAVTSNADWSKTKEEQFRKK  442

Query  55   V  53
            +
Sbjct  443  I  443



>ref|XP_009369580.1| PREDICTED: probable inactive receptor-like protein kinase At3g56050 
[Pyrus x bretschneideri]
Length=717

 Score =   151 bits (382),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = -3

Query  415  NSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPK  236
            ++ +H  ++I A ++GGS+L+ +S +GI+  +  K+  VKPWATG+SGQLQKAFVTG+PK
Sbjct  355  SNSRHRVVMICAGIVGGSLLIFLSVVGIIVARSTKVVTVKPWATGLSGQLQKAFVTGVPK  414

Query  235  LRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHK  56
            L RSELE ACEDFSNVIGS S   + KGTLSSGVEIAV  + +ES+ DW+++ EAQFR K
Sbjct  415  LNRSELEAACEDFSNVIGSLSDGKVYKGTLSSGVEIAVTSITMESSADWTKNLEAQFRKK  474

Query  55   V  53
            +
Sbjct  475  I  475



>ref|XP_002528330.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF34088.1| receptor protein kinase, putative [Ricinus communis]
Length=459

 Score =   149 bits (375),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 100/130 (77%), Gaps = 1/130 (1%)
 Frame = -3

Query  442  TATPRNEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQ  263
            T +P+N  + +    K  I+A  +GGS+LL+++   I FC+ NK A VKPWATG+SGQLQ
Sbjct  90   TPSPQNSPRKNPSSGKAGIIAGAIGGSLLLVIAIASIYFCKINK-ATVKPWATGLSGQLQ  148

Query  262  KAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSR  83
            KAF+ G+PKL+RSELE  CEDFSNVIGSS + T+ KGTLSSGVEIAV+  A+ S+KDWS+
Sbjct  149  KAFINGVPKLKRSELEAGCEDFSNVIGSSPIGTVYKGTLSSGVEIAVVSFAVTSSKDWSK  208

Query  82   DQEAQFRHKV  53
            + E QFR+K+
Sbjct  209  NLEVQFRNKI  218



>ref|XP_004500511.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like [Cicer arietinum]
Length=668

 Score =   149 bits (377),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 97/129 (75%), Gaps = 1/129 (1%)
 Frame = -3

Query  439  ATPRNEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQK  260
            + P ++  +SKK H + I+A V GG+V +I+S I +  C+ NK+A VKPW TG+SGQLQK
Sbjct  300  SIPLSKSNSSKKGH-MPILAGVAGGAVFIIISIIVLYLCKTNKVATVKPWVTGLSGQLQK  358

Query  259  AFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRD  80
            AFVTG+PKL+RSELE ACEDFSNVI +S   T+ KGTLSSGVEIAV  + + S K+WS+ 
Sbjct  359  AFVTGVPKLKRSELEAACEDFSNVIDTSPTGTVYKGTLSSGVEIAVASVTVTSLKNWSKT  418

Query  79   QEAQFRHKV  53
             E QFR K+
Sbjct  419  SEVQFRKKI  427



>ref|XP_003600961.1| Ser-thr protein kinase [Medicago truncatula]
 gb|AES71212.1| LRR receptor-like kinase [Medicago truncatula]
Length=645

 Score =   149 bits (375),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = -3

Query  424  EIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTG  245
            ++K++  +H + I+  ++GG+  +++ +I I   + NK+A VKPWATG+SGQLQKAFVTG
Sbjct  282  QLKSNSNNHHVAIVGGIVGGAAFILILSIVIYLFKTNKVATVKPWATGLSGQLQKAFVTG  341

Query  244  LPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQF  65
            +PKL+RSELE ACEDFSNVIG+S +  + KGTLSSGVEIAV  + + S KDWS+  E QF
Sbjct  342  VPKLKRSELEAACEDFSNVIGTSPIGNIYKGTLSSGVEIAVASVTVTSLKDWSKTSEVQF  401

Query  64   RHKV  53
            R K+
Sbjct  402  RKKI  405



>gb|KDP45772.1| hypothetical protein JCGZ_17379 [Jatropha curcas]
Length=648

 Score =   149 bits (375),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = -3

Query  424  EIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTG  245
            E  +    H+I+++A V+GG +LL +S  G +  + NK+  V+PWATG+SGQLQKAF+TG
Sbjct  293  EDNDFSSRHQIILIAGVIGGCLLLFISVAGAIIYRSNKVVTVRPWATGLSGQLQKAFITG  352

Query  244  LPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQF  65
            +PKL+RSELE ACEDFSN+IG  S  T+ KGTLSSGVEIAV   A+ S K+WS++ EAQF
Sbjct  353  VPKLKRSELEAACEDFSNIIGFFSNGTVYKGTLSSGVEIAVTSTAVISRKEWSKNLEAQF  412

Query  64   RHKV  53
            R KV
Sbjct  413  RKKV  416



>gb|KHN48581.1| Putative LRR receptor-like serine/threonine-protein kinase MRH1 
[Glycine soja]
Length=643

 Score =   148 bits (374),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 94/120 (78%), Gaps = 1/120 (1%)
 Frame = -3

Query  412  SKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKL  233
            S K H + I+A V+GG+V LI S+IGI  C + K+A V+PWA G+SGQLQKAFVTG  KL
Sbjct  287  SSKVHTVPILAGVIGGAVFLIFSSIGIYLC-KTKVANVRPWAMGLSGQLQKAFVTGAQKL  345

Query  232  RRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +RS+LE ACEDFSNVIG+S +  L KGTLS GVEIAV +++I S+K+WS+  EAQFR K+
Sbjct  346  KRSDLEAACEDFSNVIGNSPIGILYKGTLSGGVEIAVAFVSITSSKNWSKTLEAQFRSKI  405



>ref|XP_003544063.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like [Glycine max]
Length=643

 Score =   148 bits (374),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 94/120 (78%), Gaps = 1/120 (1%)
 Frame = -3

Query  412  SKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKL  233
            S K H + I+A V+GG+V LI S+IGI  C + K+A V+PWA G+SGQLQKAFVTG  KL
Sbjct  287  SSKVHTVPILAGVIGGAVFLIFSSIGIYLC-KTKVANVRPWAMGLSGQLQKAFVTGAQKL  345

Query  232  RRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +RS+LE ACEDFSNVIG+S +  L KGTLS GVEIAV +++I S+K+WS+  EAQFR K+
Sbjct  346  KRSDLEAACEDFSNVIGNSPIGILYKGTLSGGVEIAVAFVSITSSKNWSKTLEAQFRSKI  405



>gb|KHG12930.1| putative LRR receptor-like serine/threonine-protein kinase MRH1 
[Gossypium arboreum]
Length=655

 Score =   148 bits (374),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = -3

Query  427  NEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVT  248
            N   NS   H+  I+A  +GG V L++  +     + +K++ VKPW+TG+SGQLQKAFVT
Sbjct  287  NNPINSGSDHRPAILAGAIGGGVFLLILIVIAYLFKTSKLSAVKPWSTGLSGQLQKAFVT  346

Query  247  GLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQ  68
            G+PKL+RSELE ACEDFSNVI SS+V T+ KGTLSSG+EI+V ++ ++ AKDWS++ EAQ
Sbjct  347  GVPKLKRSELEAACEDFSNVISSSTVGTVYKGTLSSGIEISVAYIPVKFAKDWSKNLEAQ  406

Query  67   FRHKV  53
            FR+K+
Sbjct  407  FRNKI  411



>ref|XP_011003691.1| PREDICTED: probable inactive receptor-like protein kinase At3g56050 
[Populus euphratica]
 ref|XP_011003699.1| PREDICTED: probable inactive receptor-like protein kinase At3g56050 
[Populus euphratica]
Length=699

 Score =   149 bits (375),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = -3

Query  427  NEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVT  248
            N +  SK  H   ++A V+ GS+  ++SA GI F + +K+  V+PWATG+SGQLQ AFVT
Sbjct  333  NHLGQSKSKHHTALIAGVIAGSMFALISASGIFFFRSSKVVTVRPWATGLSGQLQNAFVT  392

Query  247  GLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQ  68
            G+PKL+RSELE ACEDFSN+IGS S  T  KGTLSSGVEIAV+  A+ S +DW ++ EAQ
Sbjct  393  GVPKLKRSELEAACEDFSNIIGSFSNGTAYKGTLSSGVEIAVMSTAVRSHEDWLKNLEAQ  452

Query  67   FRHKV  53
            FR K+
Sbjct  453  FRKKI  457



>ref|XP_002299998.2| hypothetical protein POPTR_0001s28710g [Populus trichocarpa]
 gb|EEE84803.2| hypothetical protein POPTR_0001s28710g [Populus trichocarpa]
Length=715

 Score =   148 bits (374),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = -3

Query  427  NEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVT  248
            + +++SK     +++A V+ GS+L ++SA+G    +R+K+  VKPWATG+SGQLQKAFVT
Sbjct  345  SHLEHSKSKTHTVLIAGVIAGSMLALISAVGFFLFRRSKVVTVKPWATGLSGQLQKAFVT  404

Query  247  GLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQ  68
            G+PKL+R ELE ACEDFSN+IG  S  T+ KGTLSSGVEIAV   A++S +DWS++ EAQ
Sbjct  405  GVPKLKRPELEVACEDFSNIIGPFSDGTVYKGTLSSGVEIAVTSTAVKSREDWSKNLEAQ  464

Query  67   FRHKV  53
            FR+K+
Sbjct  465  FRNKI  469



>ref|XP_008384755.1| PREDICTED: probable inactive receptor-like protein kinase At3g56050 
[Malus domestica]
Length=715

 Score =   148 bits (374),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = -3

Query  415  NSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPK  236
            ++ +H  ++I A V+GGS+L+ +S +GI+  +  K+  VKPW TG+SGQLQKAFVTG+PK
Sbjct  353  SNSRHRVVMICAGVVGGSLLIFLSVVGIIVARSTKVVTVKPWVTGLSGQLQKAFVTGVPK  412

Query  235  LRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHK  56
            L RSELE ACEDFSNVIG+ S   + KGTLSSGVEIAV  + +ES+ DW+++ E QFR K
Sbjct  413  LNRSELEAACEDFSNVIGTLSDGNVYKGTLSSGVEIAVTSITMESSADWTKNLETQFRKK  472

Query  55   V  53
            +
Sbjct  473  I  473



>ref|XP_006658173.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like [Oryza brachyantha]
Length=497

 Score =   146 bits (368),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 98/133 (74%), Gaps = 3/133 (2%)
 Frame = -3

Query  442  TATPRNEIKNSKKH--HKILIMAAVLGGSVLLIVSAIG-IVFCQRNKMAVVKPWATGISG  272
            ++ P+ + +N+  H  H       V  GS + +V+AI  I++C+  ++  V+PWATG+SG
Sbjct  126  SSAPQPQAENAPAHPKHSWRNYGLVTAGSAVFLVTAIASIMYCRAKRVGTVRPWATGLSG  185

Query  271  QLQKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKD  92
            QLQ+AFVTG+P L+RSELE ACEDFSN+IGS+S  TL KGTLSSGVEIAVL  +I S KD
Sbjct  186  QLQRAFVTGVPSLKRSELEAACEDFSNIIGSTSSCTLYKGTLSSGVEIAVLSSSIASVKD  245

Query  91   WSRDQEAQFRHKV  53
            WS++ E+QFR K+
Sbjct  246  WSKEWESQFRKKI  258



>ref|XP_006435789.1| hypothetical protein CICLE_v10030902mg [Citrus clementina]
 gb|ESR49029.1| hypothetical protein CICLE_v10030902mg [Citrus clementina]
Length=433

 Score =   144 bits (364),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 97/120 (81%), Gaps = 3/120 (3%)
 Frame = -3

Query  412  SKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKL  233
            S KH  I I+  V+GG++L +V+ +GI  C+ NK++ VKPWATG+SGQLQKAFVTG+PKL
Sbjct  306  SSKH--IAILGGVIGGAIL-VVAIVGIYLCRSNKVSTVKPWATGLSGQLQKAFVTGVPKL  362

Query  232  RRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +RSELE ACEDFSNVIGSS + T+ KGTLS+GVEIAV  +++ SAKDW ++ E QFR KV
Sbjct  363  KRSELEAACEDFSNVIGSSPIGTVYKGTLSNGVEIAVASVSVASAKDWPKNLEVQFRKKV  422



>ref|XP_006435787.1| hypothetical protein CICLE_v10030902mg [Citrus clementina]
 gb|ESR49027.1| hypothetical protein CICLE_v10030902mg [Citrus clementina]
Length=592

 Score =   145 bits (367),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 98/121 (81%), Gaps = 3/121 (2%)
 Frame = -3

Query  415  NSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPK  236
            +S KH  I I+  V+GG++L +V+ +GI  C+ NK++ VKPWATG+SGQLQKAFVTG+PK
Sbjct  233  SSSKH--IAILGGVIGGAIL-VVAIVGIYLCRSNKVSTVKPWATGLSGQLQKAFVTGVPK  289

Query  235  LRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHK  56
            L+RSELE ACEDFSNVIGSS + T+ KGTLS+GVEIAV  +++ SAKDW ++ E QFR K
Sbjct  290  LKRSELEAACEDFSNVIGSSPIGTVYKGTLSNGVEIAVASVSVASAKDWPKNLEVQFRKK  349

Query  55   V  53
            +
Sbjct  350  I  350



>ref|XP_008221441.1| PREDICTED: probable inactive receptor-like protein kinase At3g56050 
[Prunus mume]
Length=715

 Score =   146 bits (369),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = -3

Query  406  KHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRR  227
            +H  ++I A ++GGS+ +++S IGI+  + +K+  VKPW TG+SGQLQKAFV+G+PKL R
Sbjct  356  RHRVVMICAGIVGGSLFILMSVIGIILVRSSKVVTVKPWVTGLSGQLQKAFVSGVPKLNR  415

Query  226  SELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            SELE ACEDFSN+IG+ S   + KGTLSSGVEIAV  + + SA DWS++ EAQFR K+
Sbjct  416  SELEAACEDFSNIIGTFSDGNVYKGTLSSGVEIAVTCITMTSAVDWSKNLEAQFRKKI  473



>ref|XP_010089528.1| putative LRR receptor-like serine/threonine-protein kinase MRH1 
[Morus notabilis]
 gb|EXB37967.1| putative LRR receptor-like serine/threonine-protein kinase MRH1 
[Morus notabilis]
Length=701

 Score =   146 bits (369),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 97/131 (74%), Gaps = 1/131 (1%)
 Frame = -3

Query  442  TATPRNEIKNSKK-HHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQL  266
            + +P    K SKK +H +LI+A  +GG+  ++++A+G+VF + NK+  V+PWATG+SGQL
Sbjct  329  SPSPALTPKGSKKENHLMLILAGSVGGAFFILIAALGVVFFRSNKVVTVRPWATGLSGQL  388

Query  265  QKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWS  86
            QKAFVTG+PKL R E+  ACEDFSN+IGS S  T+ KGTLSSGVEIAV   A  S KDWS
Sbjct  389  QKAFVTGVPKLNRPEIVAACEDFSNIIGSFSDGTVYKGTLSSGVEIAVTSSAAISRKDWS  448

Query  85   RDQEAQFRHKV  53
            +  E QFR K+
Sbjct  449  KSSEEQFRKKI  459



>gb|KDO68889.1| hypothetical protein CISIN_1g006019mg [Citrus sinensis]
 gb|KDO68890.1| hypothetical protein CISIN_1g006019mg [Citrus sinensis]
Length=433

 Score =   144 bits (363),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 97/120 (81%), Gaps = 3/120 (3%)
 Frame = -3

Query  412  SKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKL  233
            S KH  I I+  V+GG++LL V+ +GI  C+ NK++ VKPWATG+SGQLQKAFVTG+PKL
Sbjct  306  SSKH--IAILGGVIGGAILL-VATVGIYLCRCNKVSTVKPWATGLSGQLQKAFVTGVPKL  362

Query  232  RRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +RSELE ACEDFSNVIGSS + T+ KGTLS+GVEIAV  +++ SAKDW ++ E QFR KV
Sbjct  363  KRSELEAACEDFSNVIGSSPIGTVYKGTLSNGVEIAVASVSVASAKDWPKNLEVQFRKKV  422



>gb|KDO68893.1| hypothetical protein CISIN_1g006019mg [Citrus sinensis]
Length=592

 Score =   145 bits (366),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 98/121 (81%), Gaps = 3/121 (2%)
 Frame = -3

Query  415  NSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPK  236
            +S KH  I I+  V+GG++LL V+ +GI  C+ NK++ VKPWATG+SGQLQKAFVTG+PK
Sbjct  233  SSSKH--IAILGGVIGGAILL-VATVGIYLCRCNKVSTVKPWATGLSGQLQKAFVTGVPK  289

Query  235  LRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHK  56
            L+RSELE ACEDFSNVIGSS + T+ KGTLS+GVEIAV  +++ SAKDW ++ E QFR K
Sbjct  290  LKRSELEAACEDFSNVIGSSPIGTVYKGTLSNGVEIAVASVSVASAKDWPKNLEVQFRKK  349

Query  55   V  53
            +
Sbjct  350  I  350



>gb|KHG10502.1| hypothetical protein F383_04578 [Gossypium arboreum]
Length=668

 Score =   145 bits (367),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = -3

Query  418  KNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLP  239
            ++  +HH ++++ A +GGS+ ++V  +GI   + +K+  VKPWATG+SGQL+KAFVTG+P
Sbjct  305  RSDSEHHMVIMLIASIGGSLFVLVLVLGIFLFRSSKVVTVKPWATGLSGQLRKAFVTGVP  364

Query  238  KLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRH  59
            KL+RSELE ACEDFSN+IG+ S  T+ KGTLSSGVEIAV   A+ S +DWS++ E  FR+
Sbjct  365  KLKRSELEAACEDFSNIIGTFSDGTVYKGTLSSGVEIAVTSTAVASREDWSKNLETHFRN  424

Query  58   KV  53
            K+
Sbjct  425  KI  426



>ref|XP_007204983.1| hypothetical protein PRUPE_ppa003329mg [Prunus persica]
 gb|EMJ06182.1| hypothetical protein PRUPE_ppa003329mg [Prunus persica]
Length=584

 Score =   145 bits (365),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = -3

Query  406  KHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRR  227
            +H  ++I A ++G S+ +++S IGI+  + +K+  VKPW TG+SGQLQKAFV+G+PKL R
Sbjct  225  RHRVVMICAGIVGCSLFILMSVIGIILVRSSKVVTVKPWVTGLSGQLQKAFVSGVPKLNR  284

Query  226  SELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            SELE ACEDFSN+IGS S   + KGTLSSGVEIAV  + + SA DWS++ EAQFR K+
Sbjct  285  SELEAACEDFSNIIGSFSDGNVYKGTLSSGVEIAVTCITMTSAVDWSKNLEAQFRKKI  342



>ref|XP_009354142.1| PREDICTED: probable inactive receptor-like protein kinase At3g56050 
[Pyrus x bretschneideri]
Length=714

 Score =   146 bits (368),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 93/122 (76%), Gaps = 1/122 (1%)
 Frame = -3

Query  415  NSKKHHKILIM-AAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLP  239
            NS   H+++I+ A ++GG +L+ +S +GI+  + +K+  VKPWATG+SGQLQKAFVTG+P
Sbjct  351  NSNSRHRVVIICAGIVGGCLLIFLSVVGIIVARSSKVVTVKPWATGLSGQLQKAFVTGVP  410

Query  238  KLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRH  59
            KL RSELE ACEDFSNVIGS S   + KGTLSSGVEIAV  +  ESA  W++  EAQFR 
Sbjct  411  KLNRSELEAACEDFSNVIGSLSDGNVYKGTLSSGVEIAVTSITTESAAGWTKSLEAQFRK  470

Query  58   KV  53
            K+
Sbjct  471  KI  472



>gb|KDO68888.1| hypothetical protein CISIN_1g006019mg [Citrus sinensis]
Length=481

 Score =   144 bits (363),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 97/120 (81%), Gaps = 3/120 (3%)
 Frame = -3

Query  412  SKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKL  233
            S KH  I I+  V+GG++LL V+ +GI  C+ NK++ VKPWATG+SGQLQKAFVTG+PKL
Sbjct  306  SSKH--IAILGGVIGGAILL-VATVGIYLCRCNKVSTVKPWATGLSGQLQKAFVTGVPKL  362

Query  232  RRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +RSELE ACEDFSNVIGSS + T+ KGTLS+GVEIAV  +++ SAKDW ++ E QFR K+
Sbjct  363  KRSELEAACEDFSNVIGSSPIGTVYKGTLSNGVEIAVASVSVASAKDWPKNLEVQFRKKI  422



>gb|KHG06445.1| hypothetical protein F383_32456 [Gossypium arboreum]
Length=631

 Score =   145 bits (365),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 99/131 (76%), Gaps = 7/131 (5%)
 Frame = -3

Query  442  TATPRNEIKNSKKHHKILIMAAVLGGSV-LLIVSAIGIVFCQRNKMAVVKPWATGISGQL  266
            T+ PR     S  H +  I+A  +GG+V LLI+ AI  +F    K++ VKPW TG+SGQL
Sbjct  282  TSRPR-----SSSHSQPAILAGAIGGTVCLLILIAITYIF-NTYKVSTVKPWRTGLSGQL  335

Query  265  QKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWS  86
            QKAFVTG+PKL+RSELE ACEDFSNVI SS++ T+ KGTLS+GVEIAV+   ++SAKDWS
Sbjct  336  QKAFVTGVPKLKRSELEAACEDFSNVIDSSTIGTVYKGTLSNGVEIAVVSFPVKSAKDWS  395

Query  85   RDQEAQFRHKV  53
            ++ E QFR+K+
Sbjct  396  KNLETQFRNKI  406



>ref|XP_011024913.1| PREDICTED: inactive receptor-like serine/threonine-protein kinase 
At2g40270 [Populus euphratica]
Length=706

 Score =   145 bits (366),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 98/128 (77%), Gaps = 1/128 (1%)
 Frame = -3

Query  436  TPRNEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKA  257
            +P +  ++  K+H +LI A V+ GS+  ++S +G    +R+K+  VKPWATG+SGQLQKA
Sbjct  334  SPSHLERSKSKNHTVLI-AGVIAGSMFALISTVGFFLFRRSKVVTVKPWATGLSGQLQKA  392

Query  256  FVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQ  77
            FVTG+PKL+R ELE ACEDFSN+IG  S  T+ KGTLSSGVEIAV   A++S ++WS++ 
Sbjct  393  FVTGVPKLKRPELEVACEDFSNIIGPFSDGTVYKGTLSSGVEIAVTSTAVKSREEWSKNL  452

Query  76   EAQFRHKV  53
            EAQFR+K+
Sbjct  453  EAQFRNKI  460



>ref|XP_006435788.1| hypothetical protein CICLE_v10030902mg [Citrus clementina]
 ref|XP_006486282.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like [Citrus sinensis]
 gb|ESR49028.1| hypothetical protein CICLE_v10030902mg [Citrus clementina]
Length=664

 Score =   144 bits (364),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 98/121 (81%), Gaps = 3/121 (2%)
 Frame = -3

Query  415  NSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPK  236
            +S KH  I I+  V+GG++L +V+ +GI  C+ NK++ VKPWATG+SGQLQKAFVTG+PK
Sbjct  305  SSSKH--IAILGGVIGGAIL-VVAIVGIYLCRSNKVSTVKPWATGLSGQLQKAFVTGVPK  361

Query  235  LRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHK  56
            L+RSELE ACEDFSNVIGSS + T+ KGTLS+GVEIAV  +++ SAKDW ++ E QFR K
Sbjct  362  LKRSELEAACEDFSNVIGSSPIGTVYKGTLSNGVEIAVASVSVASAKDWPKNLEVQFRKK  421

Query  55   V  53
            +
Sbjct  422  I  422



>ref|XP_004294789.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45840-like [Fragaria vesca subsp. vesca]
Length=679

 Score =   144 bits (364),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 94/131 (72%), Gaps = 2/131 (2%)
 Frame = -3

Query  439  ATPRNEIKNSKKHHK--ILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQL  266
            + P   +KNS K     +LI A V+GGS+ +++S IGI+  + +K+  V+PWATG+SGQL
Sbjct  308  SVPAQGVKNSSKSKSRVVLICAVVVGGSIFILLSVIGIMLFRSSKVVTVRPWATGLSGQL  367

Query  265  QKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWS  86
            QKAFVTG+PKL RSEL  ACEDFSN+IG  S   + KGTLSSGVEIAV  +   SA DWS
Sbjct  368  QKAFVTGVPKLNRSELVAACEDFSNIIGCFSDGNIYKGTLSSGVEIAVTCITSTSAGDWS  427

Query  85   RDQEAQFRHKV  53
            +  EAQFR K+
Sbjct  428  KHLEAQFRKKI  438



>gb|KDO68887.1| hypothetical protein CISIN_1g006019mg [Citrus sinensis]
Length=664

 Score =   144 bits (364),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 98/121 (81%), Gaps = 3/121 (2%)
 Frame = -3

Query  415  NSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPK  236
            +S KH  I I+  V+GG++LL V+ +GI  C+ NK++ VKPWATG+SGQLQKAFVTG+PK
Sbjct  305  SSSKH--IAILGGVIGGAILL-VATVGIYLCRCNKVSTVKPWATGLSGQLQKAFVTGVPK  361

Query  235  LRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHK  56
            L+RSELE ACEDFSNVIGSS + T+ KGTLS+GVEIAV  +++ SAKDW ++ E QFR K
Sbjct  362  LKRSELEAACEDFSNVIGSSPIGTVYKGTLSNGVEIAVASVSVASAKDWPKNLEVQFRKK  421

Query  55   V  53
            +
Sbjct  422  I  422



>ref|XP_008354886.1| PREDICTED: probable inactive receptor-like protein kinase At3g56050 
[Malus domestica]
Length=709

 Score =   144 bits (362),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 92/122 (75%), Gaps = 1/122 (1%)
 Frame = -3

Query  415  NSKKHHKILIM-AAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLP  239
            NS   H+++I+ A V+GG +L+ +  +G +  + +K+  VKPWATG+SGQLQKAFVTG+P
Sbjct  346  NSNSRHRVVIICAGVVGGCLLIXLXVVGXIXARSSKVVTVKPWATGLSGQLQKAFVTGVP  405

Query  238  KLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRH  59
            KL RSELE ACEDFSNVIGS S   + KGTLSSGVEIAV  + +ES  +W++  EAQFR 
Sbjct  406  KLNRSELEAACEDFSNVIGSLSDGNVYKGTLSSGVEIAVTSIXMESXABWTKSLEAQFRK  465

Query  58   KV  53
            K+
Sbjct  466  KI  467



>gb|EEC75039.1| hypothetical protein OsI_11137 [Oryza sativa Indica Group]
Length=500

 Score =   142 bits (357),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -3

Query  370  GGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSN  191
            G + LLI+SA G  +C+  KM  V+PWATG+SGQLQKAFVTG+P L+RSELETACEDFSN
Sbjct  158  GIAALLIISAAGAFYCRAKKMGTVRPWATGLSGQLQKAFVTGVPALKRSELETACEDFSN  217

Query  190  VIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +IG +S  TL KGTLSSGVEIAV    + SA DWS++ E+++R K+
Sbjct  218  IIGCTSTCTLYKGTLSSGVEIAVASSLVTSADDWSKECESRYRRKI  263



>ref|NP_001049820.1| Os03g0294800 [Oryza sativa Japonica Group]
 gb|ABF95427.1| ser-thr protein kinase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11734.1| Os03g0294800 [Oryza sativa Japonica Group]
 gb|EEE58871.1| hypothetical protein OsJ_10471 [Oryza sativa Japonica Group]
Length=500

 Score =   142 bits (357),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -3

Query  370  GGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSN  191
            G + LLI+SA G  +C+  KM  V+PWATG+SGQLQKAFVTG+P L+RSELETACEDFSN
Sbjct  158  GIAALLIISAAGAFYCRAKKMGTVRPWATGLSGQLQKAFVTGVPALKRSELETACEDFSN  217

Query  190  VIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +IG +S  TL KGTLSSGVEIAV    + SA DWS++ E+++R K+
Sbjct  218  IIGCTSTCTLYKGTLSSGVEIAVASSLVTSADDWSKECESRYRRKI  263



>gb|AGJ83760.1| Ser-Thr protein kinase, partial [Caragana korshinskii]
Length=330

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = -3

Query  343  AIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGSSSVYT  164
            +IG+  C+ NK+A+V PWATGISGQLQKA VTG+PKL+RS+LE ACEDFSNVIG+S + T
Sbjct  1    SIGMYLCKTNKVAIVTPWATGISGQLQKALVTGVPKLKRSDLEAACEDFSNVIGNSPIGT  60

Query  163  LCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            L KGTLSSGVEIAV  +++ S+K WS+  EAQFR K+
Sbjct  61   LYKGTLSSGVEIAVASVSVTSSKSWSKTLEAQFRKKI  97



>gb|KHF97979.1| hypothetical protein F383_13566 [Gossypium arboreum]
Length=616

 Score =   142 bits (358),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = -3

Query  421  IKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGL  242
            I +SK  H+  I+   +GG   L++  I     +  K++ VKPWATG+SGQLQKAFVTG+
Sbjct  252  IPDSKSSHQAAILVGSIGGGTFLLILIIIAYLLKTCKVSTVKPWATGLSGQLQKAFVTGV  311

Query  241  PKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFR  62
            PKL+RSELE ACEDFSNVIGS+++ T+ KGTLS+GVEIAV+ + +ES KDWS++ E QFR
Sbjct  312  PKLKRSELEAACEDFSNVIGSTTIGTVFKGTLSNGVEIAVVSVPVESTKDWSKNLETQFR  371

Query  61   HKV  53
             K+
Sbjct  372  KKI  374



>ref|XP_010685929.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor-like 
protein kinase At3g56050 [Beta vulgaris subsp. vulgaris]
Length=675

 Score =   142 bits (359),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = -3

Query  397  KILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSEL  218
             ++I  +V G S  LIVS + I+ C+ +K+  VKPWATG+SGQLQKAFV+G+PKL+R+EL
Sbjct  319  NVIIGVSVAGASAFLIVSVVAIIICRSSKVGTVKPWATGLSGQLQKAFVSGVPKLKRAEL  378

Query  217  ETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            E ACEDFSN+IGS +  T+ KGTLSSG+EIAV+  +++S ++WSR  EAQFR K+
Sbjct  379  ELACEDFSNIIGSLNDGTVYKGTLSSGIEIAVVASSVKSPEEWSRKLEAQFRKKI  433



>tpg|DAA44873.1| TPA: putative leucine-rich repeat transmembrane protein kinase 
family protein [Zea mays]
Length=383

 Score =   139 bits (351),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -3

Query  370  GGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSN  191
            G +V L+VSA  I+  +  KM  V+PWATG+SGQLQKAFVTG+P L+RSELETACEDFSN
Sbjct  167  GIAVFLLVSAASILCFRAKKMGTVRPWATGLSGQLQKAFVTGVPSLKRSELETACEDFSN  226

Query  190  VIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +IGS+S   L KGTLSSGVEIAV    + SAKDWS++ E+Q+R K+
Sbjct  227  IIGSTSTCMLYKGTLSSGVEIAVASSLVTSAKDWSKENESQYRKKI  272



>ref|XP_011076664.1| PREDICTED: probable inactive receptor-like protein kinase At3g56050 
[Sesamum indicum]
Length=653

 Score =   141 bits (355),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 100/127 (79%), Gaps = 1/127 (1%)
 Frame = -3

Query  433  PRNEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAF  254
            P     +S++ HKI I++A +GG +LL++  IGI F +  K+A VKPWATG+SGQLQ+AF
Sbjct  297  PNAPTNSSRRTHKI-ILSAAIGGPILLLLLIIGIFFYRSGKVATVKPWATGLSGQLQRAF  355

Query  253  VTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQE  74
            VTG+PKL+RSELE ACEDFSNVIGS S  TL KGTLSSGVEIAV  +A+ S+KDWS + E
Sbjct  356  VTGVPKLKRSELEAACEDFSNVIGSPSFCTLYKGTLSSGVEIAVASIAVASSKDWSSNLE  415

Query  73   AQFRHKV  53
            AQFR K+
Sbjct  416  AQFRKKI  422



>gb|KHN15217.1| Putative LRR receptor-like serine/threonine-protein kinase, partial 
[Glycine soja]
Length=660

 Score =   141 bits (355),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = -3

Query  427  NEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVT  248
            N   ++ K H ++I + V G S L++VSAI     + NK+  VKPWATG+SGQLQKAFV+
Sbjct  290  NAYSSNTKQHTVIIWSTVGGFSFLILVSAIVFACFRSNKVVTVKPWATGLSGQLQKAFVS  349

Query  247  GLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQ  68
            G+P L+R+ELE ACEDFSN+IGS    T+ KGTLSSGVEIAV   A+ S++DWS+  E Q
Sbjct  350  GVPSLKRTELEVACEDFSNIIGSLPEGTIYKGTLSSGVEIAVASSAVTSSQDWSKKMETQ  409

Query  67   FRHKV  53
            FR K+
Sbjct  410  FRKKI  414



>ref|XP_008667291.1| PREDICTED: uncharacterized LOC100191492 isoform X2 [Zea mays]
 tpg|DAA44874.1| TPA: putative leucine-rich repeat transmembrane protein kinase 
family protein [Zea mays]
Length=513

 Score =   140 bits (352),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -3

Query  370  GGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSN  191
            G +V L+VSA  I+  +  KM  V+PWATG+SGQLQKAFVTG+P L+RSELETACEDFSN
Sbjct  170  GIAVFLLVSAASILCFRAKKMGTVRPWATGLSGQLQKAFVTGVPSLKRSELETACEDFSN  229

Query  190  VIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +IGS+S   L KGTLSSGVEIAV    + SAKDWS++ E+Q+R K+
Sbjct  230  IIGSTSTCMLYKGTLSSGVEIAVASSLVTSAKDWSKENESQYRKKI  275



>gb|ACN35847.1| unknown [Zea mays]
Length=511

 Score =   140 bits (352),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -3

Query  370  GGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSN  191
            G +V L+VSA  I+  +  KM  V+PWATG+SGQLQKAFVTG+P L+RSELETACEDFSN
Sbjct  168  GIAVFLLVSAASILCFRAKKMGTVRPWATGLSGQLQKAFVTGVPSLKRSELETACEDFSN  227

Query  190  VIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +IGS+S   L KGTLSSGVEIAV    + SAKDWS++ E+Q+R K+
Sbjct  228  IIGSTSTCMLYKGTLSSGVEIAVASSLVTSAKDWSKENESQYRKKI  273



>ref|NP_001130396.1| uncharacterized LOC100191492 precursor [Zea mays]
 gb|ACF78594.1| unknown [Zea mays]
 tpg|DAA44872.1| TPA: putative leucine-rich repeat transmembrane protein kinase 
family protein [Zea mays]
Length=510

 Score =   140 bits (352),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -3

Query  370  GGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSN  191
            G +V L+VSA  I+  +  KM  V+PWATG+SGQLQKAFVTG+P L+RSELETACEDFSN
Sbjct  167  GIAVFLLVSAASILCFRAKKMGTVRPWATGLSGQLQKAFVTGVPSLKRSELETACEDFSN  226

Query  190  VIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +IGS+S   L KGTLSSGVEIAV    + SAKDWS++ E+Q+R K+
Sbjct  227  IIGSTSTCMLYKGTLSSGVEIAVASSLVTSAKDWSKENESQYRKKI  272



>ref|XP_004984869.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like [Setaria italica]
Length=510

 Score =   140 bits (352),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 89/123 (72%), Gaps = 0/123 (0%)
 Frame = -3

Query  421  IKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGL  242
            + +S KH          G +V ++VSA  ++  +  KM  V+PWATG+SGQLQKAFVTG+
Sbjct  151  VHSSHKHSWTTYGLVAAGIAVFILVSAASVLCFRAKKMGTVRPWATGLSGQLQKAFVTGV  210

Query  241  PKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFR  62
            P L+RSELETACEDFSN+IGS+S   L KGTLSSGVEIAV    + SAKDWS++ E+Q+R
Sbjct  211  PSLQRSELETACEDFSNIIGSTSSCMLYKGTLSSGVEIAVASSLVTSAKDWSKENESQYR  270

Query  61   HKV  53
             K+
Sbjct  271  KKI  273



>gb|ACG28994.1| ATP binding protein [Zea mays]
Length=513

 Score =   140 bits (352),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -3

Query  370  GGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSN  191
            G +V L+VSA  I+  +  KM  V+PWATG+SGQLQKAFVTG+P L+RSELETACEDFSN
Sbjct  170  GIAVFLLVSAASILCFRAKKMGTVRPWATGLSGQLQKAFVTGVPSLKRSELETACEDFSN  229

Query  190  VIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +IGS+S   L KGTLSSGVEIAV    + SAKDWS++ E+Q+R K+
Sbjct  230  IIGSTSTCMLYKGTLSSGVEIAVASSLVTSAKDWSKENESQYRKKI  275



>ref|XP_008667339.1| PREDICTED: uncharacterized LOC100191492 isoform X3 [Zea mays]
 gb|ACF85787.1| unknown [Zea mays]
 tpg|DAA44875.1| TPA: putative leucine-rich repeat transmembrane protein kinase 
family protein [Zea mays]
Length=511

 Score =   140 bits (352),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -3

Query  370  GGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSN  191
            G +V L+VSA  I+  +  KM  V+PWATG+SGQLQKAFVTG+P L+RSELETACEDFSN
Sbjct  168  GIAVFLLVSAASILCFRAKKMGTVRPWATGLSGQLQKAFVTGVPSLKRSELETACEDFSN  227

Query  190  VIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +IGS+S   L KGTLSSGVEIAV    + SAKDWS++ E+Q+R K+
Sbjct  228  IIGSTSTCMLYKGTLSSGVEIAVASSLVTSAKDWSKENESQYRKKI  273



>ref|XP_008667250.1| PREDICTED: uncharacterized LOC100191492 isoform X1 [Zea mays]
 gb|ACN27925.1| unknown [Zea mays]
 tpg|DAA44876.1| TPA: putative leucine-rich repeat transmembrane protein kinase 
family protein [Zea mays]
Length=514

 Score =   139 bits (351),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -3

Query  370  GGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSN  191
            G +V L+VSA  I+  +  KM  V+PWATG+SGQLQKAFVTG+P L+RSELETACEDFSN
Sbjct  171  GIAVFLLVSAASILCFRAKKMGTVRPWATGLSGQLQKAFVTGVPSLKRSELETACEDFSN  230

Query  190  VIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +IGS+S   L KGTLSSGVEIAV    + SAKDWS++ E+Q+R K+
Sbjct  231  IIGSTSTCMLYKGTLSSGVEIAVASSLVTSAKDWSKENESQYRKKI  276



>emb|CBI15912.3| unnamed protein product [Vitis vinifera]
Length=338

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -3

Query  340  IGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTL  161
            +GI+FC+ +K+  VKPWATG+SGQLQKAFVTG+PKL R+ELETACEDFSN+IGS S  T+
Sbjct  1    MGIIFCRSHKVVTVKPWATGLSGQLQKAFVTGVPKLNRAELETACEDFSNIIGSLSDGTV  60

Query  160  CKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
             KGTLS+GVEIAV   A+ S  DWS++ EAQFR K+
Sbjct  61   YKGTLSNGVEIAVTSSAVASLGDWSKNLEAQFRKKI  96



>ref|XP_006591246.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like [Glycine max]
Length=700

 Score =   141 bits (355),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = -3

Query  427  NEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVT  248
            N   ++ K H ++I + V G S L++VSAI     + NK+  VKPWATG+SGQLQKAFV+
Sbjct  330  NAYSSNTKQHTVIIWSTVGGFSFLILVSAIVFACFRSNKVVTVKPWATGLSGQLQKAFVS  389

Query  247  GLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQ  68
            G+P L+R+ELE ACEDFSN+IGS    T+ KGTLSSGVEIAV   A+ S++DWS+  E Q
Sbjct  390  GVPSLKRTELEVACEDFSNIIGSLPEGTIYKGTLSSGVEIAVASSAVTSSQDWSKKMETQ  449

Query  67   FRHKV  53
            FR K+
Sbjct  450  FRKKI  454



>ref|XP_008794243.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 isoform X3 [Phoenix dactylifera]
Length=503

 Score =   139 bits (351),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = -3

Query  391  LIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELET  212
            + M+ V   S LL +SA+  + C+ NK+  VKPWATG+SGQLQKAFVTG+P L+R+ELE 
Sbjct  281  IYMSIVGAVSFLLAISAVYFLCCRDNKVVTVKPWATGLSGQLQKAFVTGVPVLKRAELEA  340

Query  211  ACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            ACEDFSN+IGS S   L KGTLSSGVEIAV+  AI  AKDWS+  E+QFR K+
Sbjct  341  ACEDFSNIIGSLSDCMLYKGTLSSGVEIAVVSSAITCAKDWSKQSESQFRKKI  393



>ref|XP_002315143.2| hypothetical protein POPTR_0010s19270g [Populus trichocarpa]
 gb|EEF01314.2| hypothetical protein POPTR_0010s19270g [Populus trichocarpa]
Length=649

 Score =   140 bits (353),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 101/134 (75%), Gaps = 5/134 (4%)
 Frame = -3

Query  442  TATPRNEIKNS-KKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQL  266
            ++ PR   ++S  K H+  I+A  +GG+++++VS I I  C+ NK++V  PWATG+SGQL
Sbjct  275  SSVPRVAFESSPSKKHQGPIIAGAVGGTLVILVSIISIYICKINKVSV-NPWATGLSGQL  333

Query  265  QKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIE---SAK  95
            QKAFVTG+PKL+RSELE  CEDFSNVIGSS + TL KGTLSSGVEIAVL +A     SAK
Sbjct  334  QKAFVTGVPKLKRSELEAGCEDFSNVIGSSPIGTLYKGTLSSGVEIAVLAVASVAVTSAK  393

Query  94   DWSRDQEAQFRHKV  53
            DWSR  + QFR K+
Sbjct  394  DWSRTLQVQFRQKI  407



>ref|XP_010920996.1| PREDICTED: LOW QUALITY PROTEIN: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 [Elaeis guineensis]
Length=607

 Score =   139 bits (351),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = -3

Query  391  LIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELET  212
            + M+ V   S LL +SA+  + C+ NK+  VKPWATG+SGQLQKAFVTG+P L+R+ELET
Sbjct  255  IYMSIVGAVSFLLAMSAVYFLCCRDNKVVTVKPWATGLSGQLQKAFVTGVPVLKRAELET  314

Query  211  ACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            ACEDFSN++GS S   L KGTLSSGVEIAV+  AI  AKDWS+  E+QFR K+
Sbjct  315  ACEDFSNIVGSISDCMLYKGTLSSGVEIAVVSSAITCAKDWSKQSESQFRKKI  367



>ref|NP_001060726.1| Os07g0693000 [Oryza sativa Japonica Group]
 dbj|BAC75564.1| putative leucine-rich repeat transmembrane protein kinase 1 [Oryza 
sativa Japonica Group]
 dbj|BAF22640.1| Os07g0693000 [Oryza sativa Japonica Group]
 gb|EAZ41183.1| hypothetical protein OsJ_25683 [Oryza sativa Japonica Group]
 dbj|BAG91260.1| unnamed protein product [Oryza sativa Japonica Group]
Length=500

 Score =   139 bits (349),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = -3

Query  370  GGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSN  191
            G +V L+++   +++C+  K+  V+PWATG+SGQLQ+AFVTG+P L+RSELE ACEDFSN
Sbjct  156  GSAVFLVMTIASVIYCRAKKVGTVRPWATGLSGQLQRAFVTGVPSLKRSELEAACEDFSN  215

Query  190  VIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +IGS+S   L KGTLSSGVEIAVL  + ES K+WS++ E+Q+R K+
Sbjct  216  IIGSTSSCMLYKGTLSSGVEIAVLTSSTESGKEWSKECESQYRKKI  261



>gb|EAZ05236.1| hypothetical protein OsI_27436 [Oryza sativa Indica Group]
Length=500

 Score =   139 bits (349),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = -3

Query  370  GGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSN  191
            G +V L+++   +++C+  K+  V+PWATG+SGQLQ+AFVTG+P L+RSELE ACEDFSN
Sbjct  156  GSAVFLVMTIASVIYCRAKKVGTVRPWATGLSGQLQRAFVTGVPSLKRSELEAACEDFSN  215

Query  190  VIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +IGS+S   L KGTLSSGVEIAVL  + ES K+WS++ E+Q+R K+
Sbjct  216  IIGSTSSCMLYKGTLSSGVEIAVLTSSTESGKEWSKECESQYRKKI  261



>ref|XP_008794242.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45840 isoform X2 [Phoenix dactylifera]
Length=593

 Score =   139 bits (350),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = -3

Query  391  LIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELET  212
            + M+ V   S LL +SA+  + C+ NK+  VKPWATG+SGQLQKAFVTG+P L+R+ELE 
Sbjct  241  IYMSIVGAVSFLLAISAVYFLCCRDNKVVTVKPWATGLSGQLQKAFVTGVPVLKRAELEA  300

Query  211  ACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            ACEDFSN+IGS S   L KGTLSSGVEIAV+  AI  AKDWS+  E+QFR K+
Sbjct  301  ACEDFSNIIGSLSDCMLYKGTLSSGVEIAVVSSAITCAKDWSKQSESQFRKKI  353



>ref|XP_008789160.1| PREDICTED: inactive receptor-like serine/threonine-protein kinase 
At2g40270 [Phoenix dactylifera]
Length=709

 Score =   140 bits (353),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = -3

Query  388  IMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETA  209
            I  ++ G    L + A+ ++ C+ NK+  VKPWATG+SGQLQKAFVTG+PKL+R+ELE A
Sbjct  358  IYVSIAGAVSFLAICAVYVLCCRVNKVVTVKPWATGLSGQLQKAFVTGVPKLKRAELEIA  417

Query  208  CEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            CEDFSN+IGS     L KGTLSSGVEIAV+  A+ SAKDWS+  E+QFR K+
Sbjct  418  CEDFSNIIGSLPDCMLYKGTLSSGVEIAVISSAVTSAKDWSKPSESQFRKKI  469



>ref|XP_008794241.1| PREDICTED: inactive receptor-like serine/threonine-protein kinase 
At2g40270 isoform X1 [Phoenix dactylifera]
Length=633

 Score =   139 bits (350),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = -3

Query  391  LIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELET  212
            + M+ V   S LL +SA+  + C+ NK+  VKPWATG+SGQLQKAFVTG+P L+R+ELE 
Sbjct  281  IYMSIVGAVSFLLAISAVYFLCCRDNKVVTVKPWATGLSGQLQKAFVTGVPVLKRAELEA  340

Query  211  ACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            ACEDFSN+IGS S   L KGTLSSGVEIAV+  AI  AKDWS+  E+QFR K+
Sbjct  341  ACEDFSNIIGSLSDCMLYKGTLSSGVEIAVVSSAITCAKDWSKQSESQFRKKI  393



>ref|XP_007141744.1| hypothetical protein PHAVU_008G221900g [Phaseolus vulgaris]
 gb|ESW13738.1| hypothetical protein PHAVU_008G221900g [Phaseolus vulgaris]
Length=631

 Score =   139 bits (349),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 93/129 (72%), Gaps = 4/129 (3%)
 Frame = -3

Query  439  ATPRNEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQK  260
            A  + E   S K H   ++  V+GG+V L+ S+IGI  C + K+A V+PW TG+SGQLQK
Sbjct  272  AQSKTEKSTSPKFH---MLVGVIGGAVFLLFSSIGIYIC-KTKVANVRPWTTGLSGQLQK  327

Query  259  AFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRD  80
            AFVTG  KLRR +LE ACEDFSNVIG+S + TL KGTLSSGVEIAV  + +  +K+WS+ 
Sbjct  328  AFVTGAQKLRRLDLEVACEDFSNVIGTSPIGTLYKGTLSSGVEIAVTSVPVTLSKNWSKT  387

Query  79   QEAQFRHKV  53
             E QFR+K+
Sbjct  388  LEVQFRNKI  396



>ref|XP_002312175.2| hypothetical protein POPTR_0008s07210g [Populus trichocarpa]
 gb|EEE89542.2| hypothetical protein POPTR_0008s07210g [Populus trichocarpa]
Length=564

 Score =   138 bits (347),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 94/117 (80%), Gaps = 4/117 (3%)
 Frame = -3

Query  394  ILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELE  215
            +++ +  +GG++++++S + I  C+ NK A VKPWATG+SGQLQKAFVTG+PKL+RSELE
Sbjct  207  MILSSGAIGGTLVILISILSIYICKTNK-ASVKPWATGLSGQLQKAFVTGVPKLKRSELE  265

Query  214  TACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLW---LAIESAKDWSRDQEAQFRHKV  53
              CEDFSNVIGSS + TL KGTLSSGVEIAVL    +AI SAKDWS++ E QFR K+
Sbjct  266  AGCEDFSNVIGSSPIGTLYKGTLSSGVEIAVLAVASVAITSAKDWSKNLEVQFRQKI  322



>ref|XP_008811683.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 [Phoenix dactylifera]
Length=469

 Score =   137 bits (345),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = -3

Query  406  KHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRR  227
            KH   +I+ ++ G S+LL++SAI +++C+  ++  V PW TG+ GQLQK+F+TG+P LRR
Sbjct  121  KHVTWIILGSIGGASILLVLSAIYLLYCRAKRVVTVMPWTTGLRGQLQKSFLTGVPSLRR  180

Query  226  SELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            SELE ACEDFSN+IGS S  TL KGTLSSGVEIAV    + SAKDW    +A FR K+
Sbjct  181  SELEIACEDFSNIIGSLSDCTLYKGTLSSGVEIAVTSTIVTSAKDWLEQYQAPFRKKI  238



>ref|XP_009402395.1| PREDICTED: inactive receptor-like serine/threonine-protein kinase 
At2g40270 [Musa acuminata subsp. malaccensis]
Length=697

 Score =   139 bits (349),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 92/120 (77%), Gaps = 1/120 (1%)
 Frame = -3

Query  409  KKHHKILIMAAVLGG-SVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKL  233
            KKH ++ +++++ G  S LL +SA+ ++  + NK+  ++PWATG+SGQLQKAFVTG+P L
Sbjct  340  KKHARLWVLSSIAGAVSFLLAISAVYLLCWRANKVVTIRPWATGLSGQLQKAFVTGVPAL  399

Query  232  RRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +RSEL  ACEDFSN+IGS S   L KGTLSSGVEIAV+   ++SAKDWS+  E QFR KV
Sbjct  400  KRSELVAACEDFSNIIGSLSGCMLYKGTLSSGVEIAVISTVVKSAKDWSKQSETQFRKKV  459



>ref|XP_003559748.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 [Brachypodium distachyon]
Length=506

 Score =   137 bits (345),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = -3

Query  370  GGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSN  191
            G +V L+++A  +V+C+  K+  VKPW TG+SGQLQ+AFVTG+P L+RSELE ACEDFSN
Sbjct  170  GSAVFLVMTAAFVVYCRAKKVGTVKPWVTGLSGQLQRAFVTGVPSLKRSELEAACEDFSN  229

Query  190  VIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +IGS++   L KGTLSSGVEIAV+  ++ S KDWS++ E+Q+R K+
Sbjct  230  IIGSTASCMLYKGTLSSGVEIAVVSSSVTSGKDWSKECESQYRKKI  275



>gb|EMT17986.1| Putative LRR receptor-like serine/threonine-protein kinase MRH1 
[Aegilops tauschii]
Length=488

 Score =   137 bits (344),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 87/120 (73%), Gaps = 0/120 (0%)
 Frame = -3

Query  412  SKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKL  233
            S KH         +G +  LI+SA G ++C+  K+  VKPW TG+SGQLQKAFVTG+P L
Sbjct  152  SHKHSWTTYGLVAVGVAAFLIISAAGALYCRAKKVGTVKPWVTGLSGQLQKAFVTGVPAL  211

Query  232  RRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +RSELE+A EDFSN+IGS+S   + KGTLSSGVEIAV    + SAKDWS++ E+Q+R K+
Sbjct  212  KRSELESASEDFSNIIGSTSSCMMYKGTLSSGVEIAVASSLVTSAKDWSKECESQYRKKI  271



>ref|XP_006649921.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like [Oryza brachyantha]
Length=503

 Score =   136 bits (343),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = -3

Query  370  GGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSN  191
            G +  LI+S  G  + +  KM  V+PWATG+SGQLQKAFVTG+P L+RSELETACEDFSN
Sbjct  162  GIAAFLIISVAGAFYFRAKKMGTVRPWATGLSGQLQKAFVTGVPALKRSELETACEDFSN  221

Query  190  VIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +IGS+S  TL KGTLSSGVEIAV    + SA DWS++ E+Q+R K+
Sbjct  222  IIGSTSSCTLYKGTLSSGVEIAVASSLVTSADDWSKECESQYRKKI  267



>ref|XP_010907865.1| PREDICTED: inactive receptor-like serine/threonine-protein kinase 
At2g40270 isoform X1 [Elaeis guineensis]
Length=513

 Score =   136 bits (343),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 86/121 (71%), Gaps = 0/121 (0%)
 Frame = -3

Query  415  NSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPK  236
            +  KH   +I  ++ G S+LL++SAI +++C+  ++  V PW TG+SGQLQK F+TG+P 
Sbjct  162  DHGKHVTWIIFGSIGGASILLVLSAIYLLYCRAKRVVTVMPWTTGLSGQLQKTFLTGIPS  221

Query  235  LRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHK  56
            LRRSELE ACEDFSN+IGS S  TL KGTL SGVEIAV    + SA+DW    EA FR K
Sbjct  222  LRRSELEIACEDFSNIIGSLSDCTLYKGTLPSGVEIAVTSTMVISAQDWLEQYEAHFRKK  281

Query  55   V  53
            +
Sbjct  282  I  282



>ref|XP_004958793.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like [Setaria italica]
Length=506

 Score =   136 bits (343),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 94/122 (77%), Gaps = 4/122 (3%)
 Frame = -3

Query  418  KNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLP  239
            K+S ++++I+      G +V L+++A  +++C+  K+  V+PWATG+SGQLQ+AFVTG+P
Sbjct  148  KHSWRNYRIV----TAGSAVFLVMAAASVMYCRAKKVGSVRPWATGLSGQLQRAFVTGVP  203

Query  238  KLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRH  59
             L+RSEL+ ACEDFSN++GS+S   L KGTLSSGVEIAV+  +I S KDWS++ E+ FR 
Sbjct  204  ALKRSELQAACEDFSNIVGSTSSCMLYKGTLSSGVEIAVVSSSITSVKDWSKECESHFRK  263

Query  58   KV  53
            K+
Sbjct  264  KI  265



>gb|EMS47067.1| putative LRR receptor-like serine/threonine-protein kinase MRH1 
[Triticum urartu]
Length=491

 Score =   136 bits (342),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 86/120 (72%), Gaps = 0/120 (0%)
 Frame = -3

Query  412  SKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKL  233
            S KH          G +  LI+SA G ++C+  K+  VKPW TG+SGQLQKAFVTG+P L
Sbjct  136  SHKHSWTTYGLVAAGVAAFLIISASGALYCRAKKVGTVKPWVTGLSGQLQKAFVTGVPAL  195

Query  232  RRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +RSELE+A EDFSN+IGS+S   + KGTLSSGVEIAV    + SAKDWS++ E+Q+R K+
Sbjct  196  KRSELESASEDFSNIIGSTSSCMMYKGTLSSGVEIAVASSLVTSAKDWSKECESQYRKKI  255



>ref|XP_003552942.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like [Glycine max]
Length=699

 Score =   137 bits (346),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = -3

Query  427  NEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVT  248
            N   ++ K H  +I + V G S L++VSAI  V  + NK+  VKPW TG+SGQLQKAFV+
Sbjct  329  NANSSNPKQHTAIIWSTVGGFSFLILVSAIAFVCFRSNKVVTVKPWTTGLSGQLQKAFVS  388

Query  247  GLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQ  68
            G+P L+R+ELE ACEDFSN+IGS    T+ KGTLSSGVEI V   A+ S+++WS++ E Q
Sbjct  389  GVPSLKRTELEVACEDFSNIIGSLPEGTIYKGTLSSGVEIGVASSAVTSSQNWSKNMETQ  448

Query  67   FRHKV  53
            FR K+
Sbjct  449  FRKKI  453



>gb|KHN02093.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=699

 Score =   137 bits (346),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = -3

Query  427  NEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVT  248
            N   ++ K H  +I + V G S L++VSAI  V  + NK+  VKPW TG+SGQLQKAFV+
Sbjct  329  NANSSNPKQHTAIIWSTVGGFSFLILVSAIAFVCFRSNKVVTVKPWTTGLSGQLQKAFVS  388

Query  247  GLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQ  68
            G+P L+R+ELE ACEDFSN+IGS    T+ KGTLSSGVEI V   A+ S+++WS++ E Q
Sbjct  389  GVPSLKRTELEVACEDFSNIIGSLPEGTIYKGTLSSGVEIGVASSAVTSSQNWSKNMETQ  448

Query  67   FRHKV  53
            FR K+
Sbjct  449  FRKKI  453



>ref|XP_007008895.1| Leucine-rich repeat protein kinase family protein isoform 2, 
partial [Theobroma cacao]
 gb|EOY17705.1| Leucine-rich repeat protein kinase family protein isoform 2, 
partial [Theobroma cacao]
Length=472

 Score =   135 bits (340),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = -3

Query  358  LLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGS  179
             L++  +G    + +K++ VKPWATG+SGQLQKAFVTG+PKL+RSELE ACEDFSNVIGS
Sbjct  319  FLLILIVGTYLFEASKVSTVKPWATGLSGQLQKAFVTGVPKLKRSELEGACEDFSNVIGS  378

Query  178  SSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            S++ T+ KGTLS+GVEIAV  + ++SAKDWS+  E QFR K+
Sbjct  379  STIGTVYKGTLSNGVEIAVASVPVKSAKDWSKPLETQFRKKI  420



>ref|XP_004307680.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45840-like [Fragaria vesca subsp. vesca]
Length=645

 Score =   136 bits (343),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 93/135 (69%), Gaps = 14/135 (10%)
 Frame = -3

Query  418  KNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGL-  242
            K S  HH +LIMA  +GG   L++  +G+ F   NK+A V PWATG+SGQLQKAFVTG+ 
Sbjct  271  KKSSSHH-VLIMAGAIGGGASLVILVVGLYFYGCNKVATVNPWATGLSGQLQKAFVTGIA  329

Query  241  -----------PKLRRSELETACEDFSNVIGSSS-VYTLCKGTLSSGVEIAVLWLAIESA  98
                       P L+RSE++ ACEDFSNVIG+SS + T+ KGTLSSGVEIAV  LA  SA
Sbjct  330  SFKMEKIDLCVPNLKRSEIQAACEDFSNVIGTSSPMGTVYKGTLSSGVEIAVASLATTSA  389

Query  97   KDWSRDQEAQFRHKV  53
             +WS + E QFR+K+
Sbjct  390  SEWSSNLELQFRNKI  404


 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  826  LGWVVLFLVFQNLAFSWSLKDEGLGMLRSKEKVGTDPFQAF  704
            LG VV++L+FQNL+  W L DEGL +LR +E+V +DPF A 
Sbjct  14   LGVVVVWLLFQNLSLCWCLNDEGLALLRFRERVVSDPFGAL  54



>dbj|BAJ91375.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=498

 Score =   134 bits (338),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 89/128 (70%), Gaps = 3/128 (2%)
 Frame = -3

Query  436  TPRNEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKA  257
            TP + +    KH          G +  LI+SA G ++C+  ++  VKPW TG+SGQLQKA
Sbjct  133  TPSHSVH---KHSWTTYGLVAAGVAAFLIISAAGALYCRAKRVGTVKPWVTGLSGQLQKA  189

Query  256  FVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQ  77
            FVTG+P L+RSELE+A EDFSN+IGS+S   + KGTLSSGVEIAV    + SAKDWS++ 
Sbjct  190  FVTGVPALKRSELESASEDFSNIIGSTSSCMMYKGTLSSGVEIAVASSLVTSAKDWSKEC  249

Query  76   EAQFRHKV  53
            E+Q+R K+
Sbjct  250  ESQYRKKI  257



>ref|XP_010937917.1| PREDICTED: inactive receptor-like serine/threonine-protein kinase 
At2g40270 [Elaeis guineensis]
Length=714

 Score =   136 bits (343),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = -3

Query  364  SVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVI  185
            S LL +SA  ++ C+ NK+  VKPWATG+SGQLQKAFVTG+PKL+R+ELETACE FSN+I
Sbjct  371  SFLLAISAAYVLCCRVNKVVTVKPWATGLSGQLQKAFVTGVPKLKRAELETACEGFSNII  430

Query  184  GSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            GS     L KGTLSSGVEIAV+  AI SAK WS+  E+QFR K+
Sbjct  431  GSLPDCMLYKGTLSSGVEIAVISSAITSAKHWSKQSESQFRKKI  474



>ref|XP_006403028.1| hypothetical protein EUTSA_v10005911mg [Eutrema salsugineum]
 gb|ESQ44481.1| hypothetical protein EUTSA_v10005911mg [Eutrema salsugineum]
Length=494

 Score =   134 bits (337),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = -3

Query  421  IKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGL  242
            ++ S K   + IMA  +GG+V L++ AIG+ F +      V PW TG+SGQLQKAFVTG+
Sbjct  131  LRRSSKTSMVPIMAGCIGGAVFLLLLAIGVFFFRSKAGKSVNPWRTGLSGQLQKAFVTGV  190

Query  241  PKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFR  62
            PKL+RSE+E ACEDFSNVIGS  + TL KGTLSSGVEIAV  +A  SAK+W+++ E QFR
Sbjct  191  PKLKRSEIEAACEDFSNVIGSCPIGTLFKGTLSSGVEIAVASVATASAKEWTKNIEMQFR  250

Query  61   HKV  53
             K+
Sbjct  251  KKI  253



>ref|XP_006403029.1| hypothetical protein EUTSA_v10005911mg [Eutrema salsugineum]
 gb|ESQ44482.1| hypothetical protein EUTSA_v10005911mg [Eutrema salsugineum]
Length=498

 Score =   134 bits (337),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = -3

Query  421  IKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGL  242
            ++ S K   + IMA  +GG+V L++ AIG+ F +      V PW TG+SGQLQKAFVTG+
Sbjct  135  LRRSSKTSMVPIMAGCIGGAVFLLLLAIGVFFFRSKAGKSVNPWRTGLSGQLQKAFVTGV  194

Query  241  PKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFR  62
            PKL+RSE+E ACEDFSNVIGS  + TL KGTLSSGVEIAV  +A  SAK+W+++ E QFR
Sbjct  195  PKLKRSEIEAACEDFSNVIGSCPIGTLFKGTLSSGVEIAVASVATASAKEWTKNIEMQFR  254

Query  61   HKV  53
             K+
Sbjct  255  KKI  257



>ref|XP_007008894.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY17704.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=678

 Score =   135 bits (339),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = -3

Query  358  LLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGS  179
             L++  +G    + +K++ VKPWATG+SGQLQKAFVTG+PKL+RSELE ACEDFSNVIGS
Sbjct  319  FLLILIVGTYLFEASKVSTVKPWATGLSGQLQKAFVTGVPKLKRSELEGACEDFSNVIGS  378

Query  178  SSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            S++ T+ KGTLS+GVEIAV  + ++SAKDWS+  E QFR K+
Sbjct  379  STIGTVYKGTLSNGVEIAVASVPVKSAKDWSKPLETQFRKKI  420



>dbj|BAK05833.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=522

 Score =   133 bits (335),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = -3

Query  370  GGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSN  191
            GG+  L+++A   V+C+  K+  V+PW TG+SGQLQ+AFVTG+P L+RSELE ACEDFSN
Sbjct  180  GGAAFLVMTAAFAVYCRAKKVGTVRPWVTGLSGQLQRAFVTGVPSLKRSELEAACEDFSN  239

Query  190  VIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +IGS++   L KGTLSSGVEIAV+   I S  DWS++ E+Q+R K+
Sbjct  240  IIGSTANCMLYKGTLSSGVEIAVVSSLISSKNDWSKECESQYRKKI  285



>gb|KEH34374.1| tyrosine kinase family protein [Medicago truncatula]
Length=533

 Score =   133 bits (335),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = -3

Query  406  KHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRR  227
            KHH ++I + V G S L++VS +  +  + +K+  VKPW TG+SGQL+KAFVTG+P L+R
Sbjct  180  KHHSVVIWSTVGGFSFLVLVSFMVFICFRSSKVVTVKPWTTGLSGQLRKAFVTGIPSLKR  239

Query  226  SELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
             ELE ACEDFSN+IGS    T+ KGTLSSGVEIAV+  A  S+ DWS++ +AQFR K+
Sbjct  240  GELEVACEDFSNIIGSLQDETIYKGTLSSGVEIAVVSSAATSSLDWSKNMQAQFRKKI  297



>ref|XP_008454813.1| PREDICTED: probable inactive receptor-like protein kinase At3g56050 
[Cucumis melo]
Length=683

 Score =   134 bits (338),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = -3

Query  385  MAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETAC  206
            + A +G +V +I  A+GI     NK A VKPWATG+SGQLQKAF+TG+PKL+RSELE +C
Sbjct  333  VGASVGAAVFVIALAVGIYLWTNNK-ATVKPWATGLSGQLQKAFITGVPKLKRSELEVSC  391

Query  205  EDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            EDFSNVIG S +  + KGTLSSGVEIAV  ++++S+KDWS   E QFR K+
Sbjct  392  EDFSNVIGYSPIGPVYKGTLSSGVEIAVNLISVKSSKDWSMALETQFRKKI  442



>ref|XP_004500296.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like isoform X1 [Cicer arietinum]
 ref|XP_004500297.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like isoform X2 [Cicer arietinum]
Length=553

 Score =   133 bits (334),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 92/126 (73%), Gaps = 3/126 (2%)
 Frame = -3

Query  427  NEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRN-KMAVVKPWATGISGQLQKAFV  251
            N  KN K+H   +I+ + +GG  LL++ +  +  C R+ K+  VKPWATG+SGQL+KAFV
Sbjct  193  NTSKNQKQHS--VIVWSTVGGFSLLVLVSFTVFICFRSSKVVTVKPWATGLSGQLRKAFV  250

Query  250  TGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEA  71
            TG+P L+R EL  ACEDFSN+IGS    T+ KGTLSSGVEIAV+  A+ S+KDWS++ + 
Sbjct  251  TGIPSLKRGELVVACEDFSNIIGSLQDETIYKGTLSSGVEIAVVSSAVTSSKDWSKNMQT  310

Query  70   QFRHKV  53
            QFR K+
Sbjct  311  QFRKKI  316



>gb|KFK34848.1| hypothetical protein AALP_AA5G200900 [Arabis alpina]
Length=500

 Score =   132 bits (333),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = -3

Query  394  ILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELE  215
            + ++A+ +G +VL++  A G+ F +      V PW TG+SGQLQKAFVTG+PKL+RSE+E
Sbjct  146  VPLVASCIGAAVLILFLATGVFFFKSKAGKSVNPWRTGLSGQLQKAFVTGVPKLKRSEIE  205

Query  214  TACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
             ACEDFSNVIGS  + TL KGTLSSGVEIAV  +A  SAK+W+ + E QFR K+
Sbjct  206  AACEDFSNVIGSCPIGTLFKGTLSSGVEIAVASVATVSAKEWTNNIEMQFRKKI  259



>gb|KCW85406.1| hypothetical protein EUGRSUZ_B02229 [Eucalyptus grandis]
Length=753

 Score =   134 bits (338),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 95/160 (59%), Gaps = 39/160 (24%)
 Frame = -3

Query  415  NSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTG---  245
            +++KH  ++I  AV+ GSV++++SA  + F +RNK+  VKPWATG+SGQLQKAFVTG   
Sbjct  350  SNRKHQMVIITTAVIAGSVVILISAAAMFFFRRNKVVTVKPWATGLSGQLQKAFVTGSNF  409

Query  244  ------------------------------------LPKLRRSELETACEDFSNVIGSSS  173
                                                +PKL+RSELE ACEDFSN+IG+ S
Sbjct  410  GFHNLRHRKSEGELPPSFTVWHIYRTNFIFQSFHSGVPKLQRSELEAACEDFSNIIGTLS  469

Query  172  VYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
              T  KGTLSSGVEIAV   A  S  +WS+D EAQFR K+
Sbjct  470  DGTAYKGTLSSGVEIAVTSSAAASPDNWSKDLEAQFRKKI  509



>gb|EMT14566.1| Putative LRR receptor-like serine/threonine-protein kinase MRH1 
[Aegilops tauschii]
Length=456

 Score =   132 bits (332),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = -3

Query  370  GGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSN  191
            GG+ LL+++A   V+C+  K+  V+PW TG+SGQLQ+AFVTG+P L+RSELE ACEDFSN
Sbjct  41   GGAALLVMAAAFAVYCRAKKVGTVRPWVTGLSGQLQRAFVTGVPSLKRSELEAACEDFSN  100

Query  190  VIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +IGS++   L KGTLSSGVEIAV+   I S  DWS++ E+ +R K+
Sbjct  101  IIGSTANCMLYKGTLSSGVEIAVVSSLISSKNDWSKECESHYRKKI  146



>ref|XP_011035894.1| PREDICTED: probable inactive receptor-like protein kinase At3g56050 
[Populus euphratica]
Length=648

 Score =   133 bits (335),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 94/127 (74%), Gaps = 5/127 (4%)
 Frame = -3

Query  424  EIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTG  245
            E   SKKH   +I  AV GG++ ++VS I I  C+ NK++V  PWATG+SGQLQKAFVTG
Sbjct  282  ESSPSKKHQGPIIAGAV-GGALAILVSIISIYICKINKVSV-NPWATGLSGQLQKAFVTG  339

Query  244  LPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEI---AVLWLAIESAKDWSRDQE  74
            +PKL+RSELE  CEDFSNVIGSS   TL KGTLSSGVEI   AV  +A+ SAKDWSR  +
Sbjct  340  VPKLKRSELEAGCEDFSNVIGSSPSGTLYKGTLSSGVEIAVLAVASVAVASAKDWSRTLQ  399

Query  73   AQFRHKV  53
             QFR K+
Sbjct  400  VQFRRKI  406



>ref|XP_008233794.1| PREDICTED: probable inactive receptor-like protein kinase At3g56050 
[Prunus mume]
 ref|XP_008233795.1| PREDICTED: probable inactive receptor-like protein kinase At3g56050 
[Prunus mume]
 ref|XP_008233796.1| PREDICTED: probable inactive receptor-like protein kinase At3g56050 
[Prunus mume]
 ref|XP_008233797.1| PREDICTED: probable inactive receptor-like protein kinase At3g56050 
[Prunus mume]
Length=662

 Score =   133 bits (335),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = -3

Query  400  HKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSE  221
            +K+ ++    G +V L +S I +   + NK+A VKPWATG+SGQLQKAFVTG+P L+RSE
Sbjct  305  NKVALLTGGTGVAVSLAISIIVMYLYKSNKVATVKPWATGLSGQLQKAFVTGVPNLKRSE  364

Query  220  LETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            LE ACEDFSNVIGSS + T+ KGTLSSGVEIAV  L   SAK W  + E QFR K+
Sbjct  365  LEAACEDFSNVIGSSPIGTVYKGTLSSGVEIAVASLVGTSAKCWCSNLELQFRKKI  420


 Score = 54.7 bits (130),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  832  GYLGWVVLFLVFQNLAFSWSLKDEGLGMLRSKEKVGTDPFQAF  704
            G LG VV+ L+ QNL+F WSL DEGL +LR +++V +DPF A 
Sbjct  15   GMLGMVVVCLLIQNLSFCWSLNDEGLALLRFRDRVVSDPFGAL  57



>dbj|BAJ86798.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=520

 Score =   131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 82/107 (77%), Gaps = 1/107 (1%)
 Frame = -3

Query  370  GGSVLLIVSAIGIVFCQRN-KMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFS  194
            G S+L+ +SA  +V C R+ K+  V+PWATG+SGQLQKAFVTG+P L+RSEL+ ACEDFS
Sbjct  169  GASLLVAMSAALLVLCYRSSKVVTVRPWATGLSGQLQKAFVTGVPALKRSELQAACEDFS  228

Query  193  NVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            NVIG  S Y + KGTLSSGVEIAV+    +S K+WS+  E QFR K+
Sbjct  229  NVIGCLSDYMMYKGTLSSGVEIAVISTTKKSGKEWSKQCETQFRKKI  275



>ref|XP_010228737.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 isoform X2 [Brachypodium distachyon]
Length=503

 Score =   131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = -3

Query  406  KHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRR  227
            KH          G +  LI+SA    +C+  K+  VKPW TG+SGQLQKAFVTG+P L+R
Sbjct  149  KHSWTTYAFVAAGIAAFLIISAASAFYCRAKKVGTVKPWVTGLSGQLQKAFVTGVPALKR  208

Query  226  SELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            SELETA EDFSN+IGS+S   + KGTLSSGVEIAV    + SAK+WS++ E+Q+R K+
Sbjct  209  SELETASEDFSNIIGSTSSCMMYKGTLSSGVEIAVASSLVTSAKNWSKECESQYRKKI  266



>ref|XP_003558141.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 isoform X1 [Brachypodium distachyon]
Length=504

 Score =   130 bits (328),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = -3

Query  406  KHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRR  227
            KH          G +  LI+SA    +C+  K+  VKPW TG+SGQLQKAFVTG+P L+R
Sbjct  150  KHSWTTYAFVAAGIAAFLIISAASAFYCRAKKVGTVKPWVTGLSGQLQKAFVTGVPALKR  209

Query  226  SELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            SELETA EDFSN+IGS+S   + KGTLSSGVEIAV    + SAK+WS++ E+Q+R K+
Sbjct  210  SELETASEDFSNIIGSTSSCMMYKGTLSSGVEIAVASSLVTSAKNWSKECESQYRKKI  267



>ref|XP_007220635.1| hypothetical protein PRUPE_ppa002525mg [Prunus persica]
 gb|EMJ21834.1| hypothetical protein PRUPE_ppa002525mg [Prunus persica]
Length=662

 Score =   132 bits (331),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 90/126 (71%), Gaps = 3/126 (2%)
 Frame = -3

Query  421  IKNSKKHHKILIMAAVLGGSVLLIVSAIGIV---FCQRNKMAVVKPWATGISGQLQKAFV  251
            + +SK+    L +A + GG+ + +  AI I+     + NK+A VKPWATG+SGQLQKAFV
Sbjct  295  VASSKRFASKLKVALLTGGTGVAVSLAILIIVMYLYKSNKVATVKPWATGLSGQLQKAFV  354

Query  250  TGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEA  71
            TG+P L+RSELE ACEDFSNVIGSS + T+ KGTLSSGVEIAV  L   SAK W  + E 
Sbjct  355  TGVPNLKRSELEAACEDFSNVIGSSPIGTVYKGTLSSGVEIAVASLVETSAKCWCSNLEL  414

Query  70   QFRHKV  53
            QFR K+
Sbjct  415  QFRKKI  420


 Score = 54.7 bits (130),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  832  GYLGWVVLFLVFQNLAFSWSLKDEGLGMLRSKEKVGTDPFQAF  704
            G LG VV+ L+ QNL+F WSL DEGL +LR +++V +DPF A 
Sbjct  15   GMLGMVVVCLLIQNLSFCWSLNDEGLALLRFRDRVVSDPFGAL  57



>ref|XP_002461269.1| hypothetical protein SORBIDRAFT_02g043890 [Sorghum bicolor]
 gb|EER97790.1| hypothetical protein SORBIDRAFT_02g043890 [Sorghum bicolor]
Length=342

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -3

Query  370  GGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSN  191
            G +V ++++A  +++C+  K+  V+PWATG+SGQLQ+AFVTG+P L+RSELE ACEDFSN
Sbjct  174  GSAVFVVMAAASVMYCRVKKVGTVRPWATGLSGQLQRAFVTGVPALKRSELEAACEDFSN  233

Query  190  VIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            ++GS+    L KGTLSSGVEIAV+  ++ S KDWS++ E+ +R K+
Sbjct  234  IVGSTPSCMLYKGTLSSGVEIAVVSSSVTSVKDWSKECESHYRKKI  279



>ref|XP_004166740.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like, partial [Cucumis sativus]
Length=608

 Score =   130 bits (328),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 80/102 (78%), Gaps = 1/102 (1%)
 Frame = -3

Query  358  LLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGS  179
             +I  A+GI     NK A VKPWATG+SGQLQKAFVTG+PKL+RSELE +CEDFSNVIG 
Sbjct  339  FVIALAVGIYLWTNNK-ATVKPWATGLSGQLQKAFVTGVPKLKRSELEVSCEDFSNVIGY  397

Query  178  SSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            S +  + KGTLSSGVEIAV  ++++S+KDWS   EAQFR K+
Sbjct  398  SPIGPVYKGTLSSGVEIAVNIISVKSSKDWSMALEAQFRKKI  439



>ref|XP_010554679.1| PREDICTED: probable inactive receptor-like protein kinase At3g56050 
[Tarenaya hassleriana]
Length=518

 Score =   129 bits (325),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 82/118 (69%), Gaps = 0/118 (0%)
 Frame = -3

Query  406  KHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRR  227
             ++ I I+   +G +V LI+ A G+ F +      V PW TG+SGQLQKAFVTG+PKL+R
Sbjct  160  DNNTIPIVVGCIGAAVFLILLATGVFFFRSKAGKSVNPWRTGLSGQLQKAFVTGVPKLKR  219

Query  226  SELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            SELE ACEDFSNVIGS  + TL KGTLSSGVEIAV  +    +KDW  + E +FR K+
Sbjct  220  SELEAACEDFSNVIGSCPIGTLFKGTLSSGVEIAVASVTAMYSKDWKDNVEMEFRKKI  277



>dbj|BAJ96613.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=562

 Score =   130 bits (326),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 85/120 (71%), Gaps = 0/120 (0%)
 Frame = -3

Query  412  SKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKL  233
            S++  K L    +   ++LL+  A  ++ C+   +A + PW TG+SGQLQKAFVTG+PKL
Sbjct  290  SQRSMKWLYAIVIPSITLLLVFIACMLLLCRNKSVATIGPWKTGLSGQLQKAFVTGVPKL  349

Query  232  RRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            RRSELE ACEDFSN++ S   YT+ KGTLSSGVEIAV+   + S+KDWS+  E +FR K+
Sbjct  350  RRSELEGACEDFSNIVASYPHYTVYKGTLSSGVEIAVVSTVLASSKDWSKHSEGRFRKKI  409



>gb|EMT25492.1| Putative LRR receptor-like serine/threonine-protein kinase MRH1 
[Aegilops tauschii]
Length=536

 Score =   129 bits (325),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 90/126 (71%), Gaps = 2/126 (2%)
 Frame = -3

Query  427  NEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRN-KMAVVKPWATGISGQLQKAFV  251
            +  +++    +I ++A   G  +L+ +SA   + C R+ K+  V+PWATG+SGQLQKAFV
Sbjct  166  DAAEHAPTRRRIYVIAGA-GACLLVAISAALFILCYRSSKVVTVRPWATGLSGQLQKAFV  224

Query  250  TGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEA  71
            TG+P L+RSEL+ ACEDFSNVIG  S Y + KGTLSSGVEIAV+    +S K+WS+  EA
Sbjct  225  TGVPALKRSELQAACEDFSNVIGCLSDYMMYKGTLSSGVEIAVISTTKKSGKEWSKHCEA  284

Query  70   QFRHKV  53
            +FR K+
Sbjct  285  RFRKKI  290



>ref|XP_004148196.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like [Cucumis sativus]
 gb|KGN50680.1| hypothetical protein Csa_5G211530 [Cucumis sativus]
Length=680

 Score =   130 bits (328),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 80/102 (78%), Gaps = 1/102 (1%)
 Frame = -3

Query  358  LLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGS  179
             +I  A+GI     NK A VKPWATG+SGQLQKAFVTG+PKL+RSELE +CEDFSNVIG 
Sbjct  339  FVIALAVGIYLWTNNK-ATVKPWATGLSGQLQKAFVTGVPKLKRSELEVSCEDFSNVIGY  397

Query  178  SSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            S +  + KGTLSSGVEIAV  ++++S+KDWS   EAQFR K+
Sbjct  398  SPIGPVYKGTLSSGVEIAVNIISVKSSKDWSMALEAQFRKKI  439



>gb|KHN46130.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=686

 Score =   130 bits (328),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 89/125 (71%), Gaps = 0/125 (0%)
 Frame = -3

Query  427  NEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVT  248
            N   +++ HH ++I  AV G S+L++VSAI     Q  K+  VKPW+TG+SGQLQKAFV 
Sbjct  320  NTDSSNQIHHSVIIWFAVGGFSLLILVSAIIFACFQSRKVVAVKPWSTGLSGQLQKAFVK  379

Query  247  GLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQ  68
            G+P L+R E+E A E FSN+IGS    T+ KGTLSSGVEIAV   A+ +AK+WS+  EAQ
Sbjct  380  GVPSLKRGEIEAASEYFSNIIGSLPDGTVYKGTLSSGVEIAVASSAVTTAKNWSKSMEAQ  439

Query  67   FRHKV  53
            FR K+
Sbjct  440  FRKKI  444



>ref|XP_003518316.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like [Glycine max]
Length=686

 Score =   130 bits (327),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 89/125 (71%), Gaps = 0/125 (0%)
 Frame = -3

Query  427  NEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVT  248
            N   +++ HH ++I  AV G S+L++VSAI     Q  K+  VKPW+TG+SGQLQKAFV 
Sbjct  320  NTDSSNQIHHSVIIWFAVGGFSLLILVSAIIFACFQSRKVVAVKPWSTGLSGQLQKAFVK  379

Query  247  GLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQ  68
            G+P L+R E+E A E FSN+IGS    T+ KGTLSSGVEIAV   A+ +AK+WS+  EAQ
Sbjct  380  GVPSLKRGEIEAASEYFSNIIGSLPDGTVYKGTLSSGVEIAVASSAVTTAKNWSKSMEAQ  439

Query  67   FRHKV  53
            FR K+
Sbjct  440  FRKKI  444



>ref|XP_010529201.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 [Tarenaya hassleriana]
Length=703

 Score =   130 bits (328),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 87/126 (69%), Gaps = 1/126 (1%)
 Frame = -3

Query  427  NEIKNSKKHHKI-LIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFV  251
            N  ++ KK   I L +  VL G V L++    I+FC++     + PW TG+SGQLQKAF+
Sbjct  334  NPSQDEKKSKNIWLYVIIVLAGFVALLIIIAVILFCRKRAHKTIGPWKTGLSGQLQKAFI  393

Query  250  TGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEA  71
            TG+PKL RSELETACEDFSN+I +   YT+ KGTLSSGVEIAV   AI ++K+W+R  E 
Sbjct  394  TGVPKLNRSELETACEDFSNIIEAFDGYTVYKGTLSSGVEIAVASTAISASKEWTRAMEM  453

Query  70   QFRHKV  53
             FR K+
Sbjct  454  AFRRKI  459



>ref|XP_008374311.1| PREDICTED: inactive receptor-like serine/threonine-protein kinase 
At2g40270 [Malus domestica]
Length=427

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 88/120 (73%), Gaps = 1/120 (1%)
 Frame = -3

Query  409  KKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLR  230
            KKH   +++  + GG+  +I+S I +   + NK+A VKPWATG+SGQLQKAFVTG+P L+
Sbjct  66   KKHKAAILIGGIGGGACFVIISFIFLYLYKTNKVATVKPWATGLSGQLQKAFVTGVPNLK  125

Query  229  RSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKD-WSRDQEAQFRHKV  53
            RSELE ACEDFSNVIGSS + T+ KGTLSSGVEIAV  L   SA   W+ + E QFR K+
Sbjct  126  RSELEAACEDFSNVIGSSPIGTVYKGTLSSGVEIAVASLVEPSANYCWTTNLELQFRKKI  185



>gb|EMT01365.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=649

 Score =   129 bits (325),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  364  SVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVI  185
            ++LLI+ A  ++ C+   +A + PW TG+SGQLQKAFVTG+PKL+RSELE ACEDFSN++
Sbjct  302  ALLLIIIACMLLLCRNKSVATIGPWKTGLSGQLQKAFVTGVPKLQRSELEGACEDFSNIV  361

Query  184  GSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
             +   YT+ KGTLSSGVEIAV+   + S+KDWS+  E +FR K+
Sbjct  362  ATYPYYTVYKGTLSSGVEIAVVSTVLASSKDWSKHSEGRFRKKI  405



>emb|CDM83966.1| unnamed protein product [Triticum aestivum]
Length=652

 Score =   129 bits (325),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  364  SVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVI  185
            ++LLI+ A  ++ C+   +A + PW TG+SGQLQKAFVTG+PKL+RSELE ACEDFSN++
Sbjct  305  ALLLIIIACMLLLCRNKSVATIGPWKTGLSGQLQKAFVTGVPKLQRSELEGACEDFSNIV  364

Query  184  GSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
             S   YT+ KGTLSSGVEIAV+   + S+KDWS+  E +FR K+
Sbjct  365  ASYPHYTVYKGTLSSGVEIAVVSTVLASSKDWSKHSEGRFRKKI  408



>ref|XP_007142177.1| hypothetical protein PHAVU_008G258700g [Phaseolus vulgaris]
 gb|ESW14171.1| hypothetical protein PHAVU_008G258700g [Phaseolus vulgaris]
Length=691

 Score =   129 bits (325),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 86/117 (74%), Gaps = 1/117 (1%)
 Frame = -3

Query  403  HHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRS  224
            HH  +I + V G S+L++VSAI   F  R K+  VKPW+TG+SGQLQKAFV G+P L+R 
Sbjct  334  HHSAIIWSVVGGFSLLILVSAIFACFRSR-KVVTVKPWSTGLSGQLQKAFVKGVPSLKRG  392

Query  223  ELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            E+E ACE FSN+IGS    T+ KGTLSSGVEIAV   A+ +A+ WS+  EAQFR+K+
Sbjct  393  EIEAACEYFSNIIGSLPDGTVYKGTLSSGVEIAVASSAVNTAQKWSKSMEAQFRNKI  449



>ref|XP_010922598.1| PREDICTED: inactive receptor-like serine/threonine-protein kinase 
At2g40270 [Elaeis guineensis]
Length=567

 Score =   128 bits (322),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = -3

Query  379  AVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACED  200
            A+ G S+LL++SA+ ++  + NK+  V PW TG+SGQLQKAFVTG+P LRR ELE ACE 
Sbjct  228  AIGGASLLLVLSAVYLLCYRANKVVTVMPWRTGLSGQLQKAFVTGVPSLRRPELEIACEG  287

Query  199  FSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            FSN++GS S +TL KGTLSSG+EIAV    +  AKDW    EA FR K+
Sbjct  288  FSNIVGSLSDFTLYKGTLSSGIEIAVTSTMVTLAKDWLEQYEAHFRKKI  336



>ref|XP_007146810.1| hypothetical protein PHAVU_006G071600g [Phaseolus vulgaris]
 gb|ESW18804.1| hypothetical protein PHAVU_006G071600g [Phaseolus vulgaris]
Length=678

 Score =   129 bits (324),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 92/128 (72%), Gaps = 0/128 (0%)
 Frame = -3

Query  436  TPRNEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKA  257
            +P +    S  +   +I+ + +G   L++VSAI  +F + NK+  VKPWATG+SGQLQKA
Sbjct  305  SPASSANTSNTNQHNVIIWSTVGCFSLILVSAIVFLFFRSNKVVTVKPWATGLSGQLQKA  364

Query  256  FVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQ  77
            F+TG+P L+R+ELE ACE FSN+IGS    T+ KGTLSSGVEIAV+  A+  +++WS++ 
Sbjct  365  FLTGVPSLKRTELEVACEYFSNIIGSLPDGTIYKGTLSSGVEIAVVSSAVTLSQNWSKNL  424

Query  76   EAQFRHKV  53
            E QFR K+
Sbjct  425  ETQFRKKL  432



>ref|XP_006655215.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor-like 
protein kinase At3g56050-like [Oryza brachyantha]
Length=412

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 81/113 (72%), Gaps = 2/113 (2%)
 Frame = -3

Query  385  MAAVLG-GSVLLIVSAIGIVFCQRN-KMAVVKPWATGISGQLQKAFVTGLPKLRRSELET  212
            M  V G  S LL VS    V C R+ K+  V+PWATG+SGQLQKAFVTG+P L+R+ELE 
Sbjct  107  MPPVQGPSSELLAVSVAAFVLCYRSSKVVTVRPWATGLSGQLQKAFVTGVPALKRAELEA  166

Query  211  ACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            ACEDFSNVIGS   Y + KGTLSSGVEIAV+     S+K+WS+  E QFR K+
Sbjct  167  ACEDFSNVIGSLPEYAMYKGTLSSGVEIAVVSTTKTSSKEWSKRCETQFRKKI  219



>gb|AAO59488.1| ser-thr protein kinase [Gossypium hirsutum]
Length=328

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -3

Query  301  VKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAV  122
            VKPWATG+SGQLQKAFVTG+PKL+RSELE ACEDFSNVIG+ S  T+ KGTLSSGVEIAV
Sbjct  4    VKPWATGLSGQLQKAFVTGVPKLKRSELEAACEDFSNVIGTFSDGTVYKGTLSSGVEIAV  63

Query  121  LWLAIESAKDWSRDQEAQFRHKV  53
               AI S +DWS++ E QFR+K+
Sbjct  64   TSTAISSREDWSKNLETQFRNKI  86



>ref|NP_565925.1| Protein kinase family protein [Arabidopsis thaliana]
 sp|Q9SIZ4.2|Y2027_ARATH RecName: Full=Inactive receptor-like serine/threonine-protein 
kinase At2g40270; Flags: Precursor [Arabidopsis thaliana]
 gb|AAM10326.1| At2g40270/T7M7.15 [Arabidopsis thaliana]
 gb|AAD25662.2| putative protein kinase [Arabidopsis thaliana]
 gb|AAN31113.1| At2g40270/T7M7.15 [Arabidopsis thaliana]
 gb|AEC09805.1| Protein kinase family protein [Arabidopsis thaliana]
Length=489

 Score =   127 bits (319),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 79/127 (62%), Gaps = 6/127 (5%)
 Frame = -3

Query  433  PRNEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAF  254
            PRN       H  + ++   +GG+  L++ A G+ F        V PW TG+SGQLQK F
Sbjct  130  PRN------SHSSVPLVVGCVGGAFFLLLVATGLYFFTSKAGKTVNPWRTGLSGQLQKVF  183

Query  253  VTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQE  74
            VTG+P L+RSE+E ACEDFSNVIGS  +  L KGTLSSGVEIAV   A  +AKDW    E
Sbjct  184  VTGIPVLKRSEIEAACEDFSNVIGSCPIGKLFKGTLSSGVEIAVASFATTTAKDWKDSTE  243

Query  73   AQFRHKV  53
              FR K+
Sbjct  244  IHFRKKI  250



>ref|XP_006294089.1| hypothetical protein CARUB_v10023083mg [Capsella rubella]
 gb|EOA26987.1| hypothetical protein CARUB_v10023083mg [Capsella rubella]
Length=493

 Score =   127 bits (319),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 74/105 (70%), Gaps = 0/105 (0%)
 Frame = -3

Query  367  GSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNV  188
            G+V L++ A G+ F +R     V PW TG+SGQLQK FVTG+P L+RSE+E ACEDFSNV
Sbjct  151  GAVFLLLVATGVYFYRRKSCETVNPWRTGLSGQLQKVFVTGIPVLKRSEIEAACEDFSNV  210

Query  187  IGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            IGS S+  L KGTLSSGVEIAV   A   AKDW  + E  FR K+
Sbjct  211  IGSCSLGKLFKGTLSSGVEIAVASFATTFAKDWKNNTEVHFRKKI  255



>ref|XP_008804971.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 isoform X2 [Phoenix dactylifera]
Length=450

 Score =   127 bits (318),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = -3

Query  406  KHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRR  227
            KH   +I+ ++ G S LL++SA+ ++  + NK+  V PW TG+SGQLQKAFVTG+P LRR
Sbjct  269  KHVTWIILGSIGGASFLLVLSAVCLLCYRANKVVTVMPWRTGLSGQLQKAFVTGVPSLRR  328

Query  226  SELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            SELE ACE FSN++GS S  TL KG LSSG+EIAV    + SAKDW +  EA FR K+
Sbjct  329  SELEIACEGFSNIVGSWSDCTLYKGKLSSGIEIAVTSTMVTSAKDWLQ-YEAHFRKKI  385



>ref|XP_006644509.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45840-like [Oryza brachyantha]
Length=596

 Score =   128 bits (321),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 82/113 (73%), Gaps = 1/113 (1%)
 Frame = -3

Query  388  IMAAVLGGSVLLIVSAIGI-VFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELET  212
            + A V     LL++S + + V C+   +A + PW TG+SGQLQKAFVTG+PKL+RSELE 
Sbjct  239  LYAIVFSSIALLLISIVCLFVLCRNKSVATIGPWKTGLSGQLQKAFVTGVPKLQRSELEG  298

Query  211  ACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            ACEDFSN++ S   YT+ KGTLSSGVEIAV+   I ++KDWS+  E +FR K+
Sbjct  299  ACEDFSNIVASYPHYTVYKGTLSSGVEIAVVSTGIVTSKDWSKHSEGRFRKKI  351



>gb|AAD25942.1|AF085279_15 hypothetical Ser-Thr protein kinase [Arabidopsis thaliana]
Length=485

 Score =   127 bits (318),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 79/127 (62%), Gaps = 6/127 (5%)
 Frame = -3

Query  433  PRNEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAF  254
            PRN       H  + ++   +GG+  L++ A G+ F        V PW TG+SGQLQK F
Sbjct  126  PRN------SHSSVPLVVGCVGGAFFLLLVATGLYFFTSKAGKTVNPWRTGLSGQLQKVF  179

Query  253  VTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQE  74
            VTG+P L+RSE+E ACEDFSNVIGS  +  L KGTLSSGVEIAV   A  +AKDW    E
Sbjct  180  VTGIPVLKRSEIEAACEDFSNVIGSCPIGKLFKGTLSSGVEIAVASFATTTAKDWKDSTE  239

Query  73   AQFRHKV  53
              FR K+
Sbjct  240  IHFRKKI  246



>ref|NP_973647.1| Protein kinase family protein [Arabidopsis thaliana]
 gb|AEC09804.1| Protein kinase family protein [Arabidopsis thaliana]
Length=482

 Score =   127 bits (318),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 79/127 (62%), Gaps = 6/127 (5%)
 Frame = -3

Query  433  PRNEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAF  254
            PRN       H  + ++   +GG+  L++ A G+ F        V PW TG+SGQLQK F
Sbjct  123  PRN------SHSSVPLVVGCVGGAFFLLLVATGLYFFTSKAGKTVNPWRTGLSGQLQKVF  176

Query  253  VTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQE  74
            VTG+P L+RSE+E ACEDFSNVIGS  +  L KGTLSSGVEIAV   A  +AKDW    E
Sbjct  177  VTGIPVLKRSEIEAACEDFSNVIGSCPIGKLFKGTLSSGVEIAVASFATTTAKDWKDSTE  236

Query  73   AQFRHKV  53
              FR K+
Sbjct  237  IHFRKKI  243



>ref|XP_006283258.1| hypothetical protein CARUB_v10004292mg [Capsella rubella]
 gb|EOA16156.1| hypothetical protein CARUB_v10004292mg [Capsella rubella]
Length=676

 Score =   128 bits (322),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 85/127 (67%), Gaps = 0/127 (0%)
 Frame = -3

Query  433  PRNEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAF  254
            P++  +  +  H  L +   +   V L++   GI+FC++  +  + PW TG+SGQLQKAF
Sbjct  306  PQDNKQTKRSKHVWLYVIIAVASFVGLLIILAGILFCRKRAVKSIGPWKTGLSGQLQKAF  365

Query  253  VTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQE  74
            VTG+PKL RSELETACEDFSN+I +   YT+ KGTLSSGVEIAV   AI   K+W+R  E
Sbjct  366  VTGVPKLNRSELETACEDFSNIIETFDGYTVYKGTLSSGVEIAVASTAIPETKEWTRAME  425

Query  73   AQFRHKV  53
              +R K+
Sbjct  426  MAYRRKI  432



>ref|NP_001043843.2| Os01g0674800 [Oryza sativa Japonica Group]
 dbj|BAD73377.1| serine/threonine-specific protein kinase NPK15-like [Oryza sativa 
Japonica Group]
 dbj|BAD73524.1| serine/threonine-specific protein kinase NPK15-like [Oryza sativa 
Japonica Group]
 dbj|BAF05757.2| Os01g0674800 [Oryza sativa Japonica Group]
Length=370

 Score =   125 bits (314),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 81/113 (72%), Gaps = 2/113 (2%)
 Frame = -3

Query  385  MAAVLGGSVLLIVSAIGIVF--CQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELET  212
            + A++  S+ L+   I  +F  C+   +A + PW TG+SGQLQKAFVTG+PKL+RSELE 
Sbjct  13   LYAIVISSIALLFIGIACMFLLCRNKSVATIGPWKTGLSGQLQKAFVTGVPKLQRSELEG  72

Query  211  ACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            ACEDFSN++ S   YT+ KGTLSSGVEIAV+   I + KDWS+  E +FR K+
Sbjct  73   ACEDFSNIVASYPHYTVYKGTLSSGVEIAVVSTVIATNKDWSKHSEGRFRKKI  125



>ref|XP_009792615.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 [Nicotiana sylvestris]
 ref|XP_009792616.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 [Nicotiana sylvestris]
Length=700

 Score =   128 bits (322),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 78/114 (68%), Gaps = 0/114 (0%)
 Frame = -3

Query  385  MAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETAC  206
            +  +LGG  LLI++    + C+      + PW TG+SGQLQKAFVTG+PKL RSELETAC
Sbjct  346  VVGILGGVFLLILAVSVFLICRSRAARTIGPWKTGLSGQLQKAFVTGVPKLNRSELETAC  405

Query  205  EDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV*PF  44
            EDFSN+I S + Y + KGTLSSGVEIAV+   I S KDWS   E  FR K+  F
Sbjct  406  EDFSNIITSGNSYIVHKGTLSSGVEIAVISTTISSVKDWSVHSETAFRKKIDTF  459



>ref|XP_010439828.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 [Camelina sativa]
Length=669

 Score =   128 bits (321),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 91/128 (71%), Gaps = 3/128 (2%)
 Frame = -3

Query  430  RNEIKNSK--KHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKA  257
            +N+ +++K  KH  + ++ AV     LLI+ A GI FC++  +  + PW TG+SGQLQKA
Sbjct  299  KNQPQDNKQSKHVWLYVVIAVASFVGLLIIVA-GIFFCRKRAVKSIGPWKTGLSGQLQKA  357

Query  256  FVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQ  77
            FVTG+PKL R+ELETACEDFSN+I +   YT+ KGTLSSGVEIAV   AI  +K+W+R  
Sbjct  358  FVTGVPKLNRAELETACEDFSNIIEAFDGYTVYKGTLSSGVEIAVASTAIAESKEWTRAM  417

Query  76   EAQFRHKV  53
            E  +R K+
Sbjct  418  EMAYRRKI  425



>ref|XP_010449486.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 [Camelina sativa]
Length=670

 Score =   127 bits (320),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 84/118 (71%), Gaps = 1/118 (1%)
 Frame = -3

Query  406  KHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRR  227
            KH  + ++ AV     LLI+ A GI FC++  +  + PW TG+SGQLQKAFVTG+PKL R
Sbjct  310  KHVWMYVVIAVASFVGLLIIVA-GIFFCRKRAVKSIGPWKTGLSGQLQKAFVTGVPKLNR  368

Query  226  SELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            SELETACEDFSN+I +   YT+ KGTLSSGVEIAV   AI  +K+W+R  E  +R K+
Sbjct  369  SELETACEDFSNIIETFDGYTVYKGTLSSGVEIAVASTAIAESKEWTRAMEMAYRRKI  426



>ref|XP_008804963.1| PREDICTED: inactive receptor-like serine/threonine-protein kinase 
At2g40270 isoform X1 [Phoenix dactylifera]
Length=616

 Score =   127 bits (318),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = -3

Query  406  KHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRR  227
            KH   +I+ ++ G S LL++SA+ ++  + NK+  V PW TG+SGQLQKAFVTG+P LRR
Sbjct  269  KHVTWIILGSIGGASFLLVLSAVCLLCYRANKVVTVMPWRTGLSGQLQKAFVTGVPSLRR  328

Query  226  SELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            SELE ACE FSN++GS S  TL KG LSSG+EIAV    + SAKDW +  EA FR K+
Sbjct  329  SELEIACEGFSNIVGSWSDCTLYKGKLSSGIEIAVTSTMVTSAKDWLQ-YEAHFRKKI  385



>emb|CAB37449.1| putative protein (fragment) [Arabidopsis thaliana]
Length=662

 Score =   127 bits (319),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 86/125 (69%), Gaps = 1/125 (1%)
 Frame = -3

Query  427  NEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVT  248
            N+     KH  + ++ AV     LLI+ A+ I FC++  +  + PW TG+SGQLQKAFVT
Sbjct  287  NKQSKGSKHVWLYVVIAVASFVGLLIIVAV-IFFCRKRAVKSIGPWKTGLSGQLQKAFVT  345

Query  247  GLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQ  68
            G+PKL RSELETACEDFSN+I +   YT+ KGTLSSGVEIAV   AI  +K+W+R  E  
Sbjct  346  GVPKLNRSELETACEDFSNIIETFDGYTVYKGTLSSGVEIAVASTAIAESKEWTRAMEMA  405

Query  67   FRHKV  53
            +R K+
Sbjct  406  YRRKI  410



>ref|XP_006292571.1| hypothetical protein CARUB_v10018806mg [Capsella rubella]
 gb|EOA25469.1| hypothetical protein CARUB_v10018806mg [Capsella rubella]
Length=497

 Score =   125 bits (315),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 90/126 (71%), Gaps = 1/126 (1%)
 Frame = -3

Query  430  RNEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFV  251
            R   KNS  ++ + I+A  LGG+V +++ A G+ F +      V PW TG+SGQLQK F+
Sbjct  132  RGSSKNSS-NNTVPIVAGCLGGAVFILLLATGVFFFKSKAGKSVNPWRTGLSGQLQKVFI  190

Query  250  TGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEA  71
            TG+PKL+RSE+E ACE+FSNVIGS  + TL KGTLSSGVEIAV  +A  SAK+W+ + E 
Sbjct  191  TGVPKLKRSEIEAACEEFSNVIGSCPIGTLFKGTLSSGVEIAVASVATASAKEWTNNIEM  250

Query  70   QFRHKV  53
            QFR K+
Sbjct  251  QFRKKI  256



>ref|NP_193599.3| putative LRR receptor-like serine/threonine-protein kinase MRH1 
[Arabidopsis thaliana]
 sp|C0LGQ4.1|MRH1_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein 
kinase MRH1; AltName: Full=Protein MORPHOGENESIS OF ROOT 
HAIR 1; Flags: Precursor [Arabidopsis thaliana]
 gb|ACN59339.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE84071.1| putative LRR receptor-like serine/threonine-protein kinase MRH1 
[Arabidopsis thaliana]
Length=678

 Score =   127 bits (319),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 86/125 (69%), Gaps = 1/125 (1%)
 Frame = -3

Query  427  NEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVT  248
            N+     KH  + ++ AV     LLI+ A+ I FC++  +  + PW TG+SGQLQKAFVT
Sbjct  311  NKQSKGSKHVWLYVVIAVASFVGLLIIVAV-IFFCRKRAVKSIGPWKTGLSGQLQKAFVT  369

Query  247  GLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQ  68
            G+PKL RSELETACEDFSN+I +   YT+ KGTLSSGVEIAV   AI  +K+W+R  E  
Sbjct  370  GVPKLNRSELETACEDFSNIIETFDGYTVYKGTLSSGVEIAVASTAIAESKEWTRAMEMA  429

Query  67   FRHKV  53
            +R K+
Sbjct  430  YRRKI  434



>ref|XP_010434506.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 [Camelina sativa]
Length=670

 Score =   127 bits (319),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 82/121 (68%), Gaps = 0/121 (0%)
 Frame = -3

Query  415  NSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPK  236
            N +  H  L +   +   V L+V   GI FC++  +  + PW TG+SGQLQKAFVTG+PK
Sbjct  306  NKQSKHVWLYVVIAVASFVGLLVIVAGIFFCRKRAVKSIGPWKTGLSGQLQKAFVTGVPK  365

Query  235  LRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHK  56
            L R+ELETACEDFSN+I +   YT+ KGTLSSGVEIAV   AI  +K+W+R  E  +R K
Sbjct  366  LNRAELETACEDFSNIIEAFDGYTVYKGTLSSGVEIAVASTAIAESKEWTRAMEMAYRRK  425

Query  55   V  53
            +
Sbjct  426  I  426



>emb|CAB78866.1| putative protein (fragment) [Arabidopsis thaliana]
Length=685

 Score =   127 bits (319),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 86/125 (69%), Gaps = 1/125 (1%)
 Frame = -3

Query  427  NEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVT  248
            N+     KH  + ++ AV     LLI+ A+ I FC++  +  + PW TG+SGQLQKAFVT
Sbjct  310  NKQSKGSKHVWLYVVIAVASFVGLLIIVAV-IFFCRKRAVKSIGPWKTGLSGQLQKAFVT  368

Query  247  GLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQ  68
            G+PKL RSELETACEDFSN+I +   YT+ KGTLSSGVEIAV   AI  +K+W+R  E  
Sbjct  369  GVPKLNRSELETACEDFSNIIETFDGYTVYKGTLSSGVEIAVASTAIAESKEWTRAMEMA  428

Query  67   FRHKV  53
            +R K+
Sbjct  429  YRRKI  433



>emb|CBI30696.3| unnamed protein product [Vitis vinifera]
Length=654

 Score =   127 bits (318),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = -3

Query  376  VLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDF  197
            V G ++LLIV+A+ +  C+   +  + PW TG+SGQLQKAFVTG+PKL R+ELETACEDF
Sbjct  302  VPGVALLLIVAAVMLCMCRSRGVTTIGPWTTGLSGQLQKAFVTGVPKLNRTELETACEDF  361

Query  196  SNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            SN+I +    T+ KGTLSSGVEIAV    I S+KDWS+  E  FR K+
Sbjct  362  SNIINTLDDCTVYKGTLSSGVEIAVASTGISSSKDWSKRSEMAFRKKI  409



>ref|XP_002266057.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 [Vitis vinifera]
 ref|XP_010655532.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 [Vitis vinifera]
 ref|XP_010655533.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 [Vitis vinifera]
Length=724

 Score =   127 bits (319),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = -3

Query  376  VLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDF  197
            V G ++LLIV+A+ +  C+   +  + PW TG+SGQLQKAFVTG+PKL R+ELETACEDF
Sbjct  372  VPGVALLLIVAAVMLCMCRSRGVTTIGPWTTGLSGQLQKAFVTGVPKLNRTELETACEDF  431

Query  196  SNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            SN+I +    T+ KGTLSSGVEIAV    I S+KDWS+  E  FR K+
Sbjct  432  SNIINTLDDCTVYKGTLSSGVEIAVASTGISSSKDWSKRSEMAFRKKI  479



>gb|EMS58575.1| putative LRR receptor-like serine/threonine-protein kinase MRH1 
[Triticum urartu]
Length=461

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = -3

Query  331  VFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKG  152
            V+C+  K+  V+PW TG+SGQLQ+AFVTG+P L+RSELE ACEDFSN+IGS++   L KG
Sbjct  132  VYCRAKKVGTVRPWVTGLSGQLQRAFVTGVPSLKRSELEAACEDFSNIIGSTANCMLYKG  191

Query  151  TLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            TLSSGVEIAV+   I S  DWS++ E+Q+R K+
Sbjct  192  TLSSGVEIAVVSSLISSKNDWSKECESQYRKKI  224



>ref|XP_002870030.1| hypothetical protein ARALYDRAFT_914815 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46289.1| hypothetical protein ARALYDRAFT_914815 [Arabidopsis lyrata subsp. 
lyrata]
Length=676

 Score =   127 bits (318),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 86/125 (69%), Gaps = 1/125 (1%)
 Frame = -3

Query  427  NEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVT  248
            N+     KH  + ++ AV     LLI+ A+ I FC++  +  + PW TG+SGQLQKAFVT
Sbjct  309  NKQSKGSKHVWLYVIIAVSSFVGLLIIVAV-IFFCRKRAVKSIGPWKTGLSGQLQKAFVT  367

Query  247  GLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQ  68
            G+PKL RSELETACEDFSN+I +   YT+ KGTLSSGVEIAV   AI  +K+W+R  E  
Sbjct  368  GVPKLNRSELETACEDFSNIIETFDGYTVYKGTLSSGVEIAVASTAIAESKEWTRAMEMA  427

Query  67   FRHKV  53
            +R K+
Sbjct  428  YRRKI  432



>ref|XP_010508887.1| PREDICTED: inactive receptor-like serine/threonine-protein kinase 
At2g40270 [Camelina sativa]
Length=491

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = -3

Query  358  LLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGS  179
            LL++ A G+ F +R     V PW TG+SGQLQ+ FVTG+P L+RSE+E ACEDFSNVIGS
Sbjct  150  LLLLVATGVYFYRRKAGETVNPWRTGLSGQLQRVFVTGVPVLKRSEIEAACEDFSNVIGS  209

Query  178  SSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
             SV  L KGTLSSGVEIAV      SAKDW  + E  FR+K+
Sbjct  210  CSVGKLFKGTLSSGVEIAVASFDTTSAKDWKNNTEVHFRNKI  251



>ref|XP_002878058.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54317.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=499

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 84/114 (74%), Gaps = 0/114 (0%)
 Frame = -3

Query  394  ILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELE  215
            I I+A  +GG+V +++ A G+ F +      V PW TG+SGQLQK F+TG+PKL+RSE+E
Sbjct  145  IPILAGCVGGAVFILLLATGVFFFKSKAGKSVNPWRTGLSGQLQKVFITGVPKLKRSEIE  204

Query  214  TACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
             ACEDFSNVIGS  + TL KGTLSSGVEIAV  +A  SAK+W+ + E QFR K+
Sbjct  205  AACEDFSNVIGSCPIGTLFKGTLSSGVEIAVASVATASAKEWTNNIELQFRKKI  258



>gb|KHN40097.1| Putative LRR receptor-like serine/threonine-protein kinase MRH1 
[Glycine soja]
Length=692

 Score =   127 bits (318),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 89/125 (71%), Gaps = 0/125 (0%)
 Frame = -3

Query  427  NEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVT  248
            N   +++ HH ++I +AV G S+L+++SAI     Q  K+  VKPW+TG+SGQLQKAF+ 
Sbjct  326  NTNSSNQIHHSVIIWSAVGGFSLLILLSAIIFACFQSRKVVAVKPWSTGLSGQLQKAFIK  385

Query  247  GLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQ  68
            G+P L+R E+E A E FSN+IGS     + KGTLSSGVEIAV   A+ +A++WS+  EAQ
Sbjct  386  GVPSLKRGEIEAASEYFSNIIGSLPDGIVYKGTLSSGVEIAVASSAVTTAQNWSKSMEAQ  445

Query  67   FRHKV  53
            FR K+
Sbjct  446  FRKKI  450



>ref|XP_003544305.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like [Glycine max]
Length=692

 Score =   126 bits (317),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 89/125 (71%), Gaps = 0/125 (0%)
 Frame = -3

Query  427  NEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVT  248
            N   +++ HH ++I +AV G S+L+++SAI     Q  K+  VKPW+TG+SGQLQKAF+ 
Sbjct  326  NTNSSNQIHHSVIIWSAVGGFSLLILLSAIIFACFQSRKVVAVKPWSTGLSGQLQKAFIK  385

Query  247  GLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQ  68
            G+P L+R E+E A E FSN+IGS     + KGTLSSGVEIAV   A+ +A++WS+  EAQ
Sbjct  386  GVPSLKRGEIEAASEYFSNIIGSLPDGIVYKGTLSSGVEIAVASSAVTTAQNWSKSMEAQ  445

Query  67   FRHKV  53
            FR K+
Sbjct  446  FRKKI  450



>gb|EEC71258.1| hypothetical protein OsI_03238 [Oryza sativa Indica Group]
Length=647

 Score =   126 bits (316),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 82/113 (73%), Gaps = 2/113 (2%)
 Frame = -3

Query  385  MAAVLGGSVLLIVSAIGIVF--CQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELET  212
            + A++  S+ L++  I  +F  C+   +A + PW TG+SGQLQKAFVTG+PKL+RSELE 
Sbjct  290  LYAIVISSIALLLIGIACMFLLCRNKSVATIGPWKTGLSGQLQKAFVTGVPKLQRSELEG  349

Query  211  ACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            ACEDFSN++ S   YT+ KGTLSSGVEIAV+   I + KDWS+  E +FR K+
Sbjct  350  ACEDFSNIVASYPHYTVYKGTLSSGVEIAVVSTVIATNKDWSKHSEGRFRKKI  402



>ref|XP_010536501.1| PREDICTED: probable inactive receptor-like protein kinase At3g56050 
[Tarenaya hassleriana]
Length=498

 Score =   124 bits (312),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 84/115 (73%), Gaps = 0/115 (0%)
 Frame = -3

Query  397  KILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSEL  218
            KI ++A  +G +V LI+ A G+ F +      V PW TG+SGQLQKAFVTG+P+L++SE+
Sbjct  148  KIPVVAGCIGAAVFLILLASGVFFFRSKAGKSVNPWRTGLSGQLQKAFVTGVPRLKKSEI  207

Query  217  ETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            E ACEDFSNVIGS  + TL KGTLSSGVEIAV  +A  SAKDW  + E +FR K+
Sbjct  208  EAACEDFSNVIGSCPIGTLFKGTLSSGVEIAVASVAASSAKDWKENVEMEFRKKI  262



>ref|XP_010427410.1| PREDICTED: probable inactive receptor-like protein kinase At3g56050 
[Camelina sativa]
Length=499

 Score =   124 bits (312),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = -3

Query  403  HHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRS  224
            ++ + I+A   GG+V +I+ A G+ F +      V PW TG+SGQLQK F+TG+PKL+RS
Sbjct  142  NNTVPIVAGCFGGAVFIILLATGVFFFKTKAGKSVNPWRTGLSGQLQKVFITGIPKLKRS  201

Query  223  ELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            E+E ACEDFSNVIGS  + TL KGTLS+GVEIAV  +A  SAK+W+ + E QFR K+
Sbjct  202  EIEAACEDFSNVIGSCPIGTLFKGTLSTGVEIAVASVATASAKEWTNNIEMQFRKKI  258



>ref|XP_006414074.1| hypothetical protein EUTSA_v10024616mg [Eutrema salsugineum]
 gb|ESQ55527.1| hypothetical protein EUTSA_v10024616mg [Eutrema salsugineum]
Length=665

 Score =   126 bits (316),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 85/125 (68%), Gaps = 1/125 (1%)
 Frame = -3

Query  427  NEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVT  248
            N+     KH  + ++ AV     LL++ A+ I FC+   +  + PW TG+SGQLQKAFVT
Sbjct  300  NKQSKGSKHVWLYVVIAVASFVGLLVIVAV-IFFCRNRAVKSIGPWKTGLSGQLQKAFVT  358

Query  247  GLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQ  68
            G+PKL RSELETACEDFSN+I +   YT+ KGTLSSGVEIAV   AI  +K+W+R  E  
Sbjct  359  GVPKLNRSELETACEDFSNIIEAFDGYTVYKGTLSSGVEIAVASTAISESKEWTRAMEMA  418

Query  67   FRHKV  53
            +R K+
Sbjct  419  YRRKI  423



>gb|AFW77774.1| putative leucine-rich repeat transmembrane protein kinase family 
protein [Zea mays]
Length=366

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 73/92 (79%), Gaps = 1/92 (1%)
 Frame = -3

Query  325  CQRNKMAV-VKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGT  149
            C R+   V V+PWATG+SGQLQKAFVTG+P L+RSELE ACEDFSNVIGS S Y + KGT
Sbjct  238  CYRSSSVVTVRPWATGLSGQLQKAFVTGVPSLKRSELEAACEDFSNVIGSLSDYMVYKGT  297

Query  148  LSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            LS+GVEIAV+     SAK+WS+  E+QFR KV
Sbjct  298  LSTGVEIAVVSTTKNSAKEWSKHCESQFRKKV  329



>gb|EEE55167.1| hypothetical protein OsJ_02982 [Oryza sativa Japonica Group]
Length=647

 Score =   125 bits (315),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 81/113 (72%), Gaps = 2/113 (2%)
 Frame = -3

Query  385  MAAVLGGSVLLIVSAIGIVF--CQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELET  212
            + A++  S+ L+   I  +F  C+   +A + PW TG+SGQLQKAFVTG+PKL+RSELE 
Sbjct  290  LYAIVISSIALLFIGIACMFLLCRNKSVATIGPWKTGLSGQLQKAFVTGVPKLQRSELEG  349

Query  211  ACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            ACEDFSN++ S   YT+ KGTLSSGVEIAV+   I + KDWS+  E +FR K+
Sbjct  350  ACEDFSNIVASYPHYTVYKGTLSSGVEIAVVSTVIATNKDWSKHSEGRFRKKI  402



>ref|XP_008354162.1| PREDICTED: inactive receptor-like serine/threonine-protein kinase 
At2g40270 [Malus domestica]
Length=654

 Score =   125 bits (314),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 87/119 (73%), Gaps = 1/119 (1%)
 Frame = -3

Query  406  KHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRR  227
            KH   +++  + GG+  +I+S I +   + NK+A VKPWATG+SGQLQKAFVTG+P L+R
Sbjct  294  KHKAAILIGGIGGGACFVIISFICLYLYKTNKVATVKPWATGLSGQLQKAFVTGVPNLKR  353

Query  226  SELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKD-WSRDQEAQFRHKV  53
            SELE ACEDFSNVIGSS + T+ KGTLSSGVEIAV  L   SA   W+ + E QFR K+
Sbjct  354  SELEAACEDFSNVIGSSPIGTVYKGTLSSGVEIAVASLVEPSANYCWTTNLELQFRKKI  412



>ref|XP_010517443.1| PREDICTED: inactive receptor-like serine/threonine-protein kinase 
At2g40270 isoform X1 [Camelina sativa]
Length=448

 Score =   123 bits (309),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = -3

Query  358  LLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGS  179
            LL++ A G+ F +R     V PW TG+SGQLQ+ FVTG+P L+RSE+E ACEDFSNVIGS
Sbjct  107  LLLLVATGVYFYRREAGETVNPWRTGLSGQLQRVFVTGVPVLKRSEIEAACEDFSNVIGS  166

Query  178  SSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
             SV  L KGTLSSGVEIAV      S KDW  + E  FR+K+
Sbjct  167  CSVGKLFKGTLSSGVEIAVASFDTTSTKDWKNNTEIHFRNKI  208



>ref|XP_010504482.1| PREDICTED: probable inactive receptor-like protein kinase At3g56050 
[Camelina sativa]
Length=499

 Score =   124 bits (310),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 83/114 (73%), Gaps = 0/114 (0%)
 Frame = -3

Query  394  ILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELE  215
            + I+A   GG+V +I+ A G+ F +      V PW TG+SGQLQK F+TG+PKL+RSE+E
Sbjct  145  VPIVAGCFGGAVFIILLATGVFFFKTKAGKSVNPWRTGLSGQLQKVFITGVPKLKRSEIE  204

Query  214  TACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
             ACEDFSNVIGS  + TL KGTLS+GVEIAV  +A  SAK+W+ + E QFR K+
Sbjct  205  AACEDFSNVIGSCPIGTLFKGTLSTGVEIAVASVATASAKEWTNNIEMQFRKKI  258



>ref|XP_002881709.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57968.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=490

 Score =   123 bits (309),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 84/129 (65%), Gaps = 5/129 (4%)
 Frame = -3

Query  436  TPRNEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMA-VVKPWATGISGQLQK  260
            TPRN   +S     + ++   +GG+  L++   G V+C  +K    V PW TG+SGQLQK
Sbjct  128  TPRNAHSSSVA---VPLVIGCVGGAFFLLLVVTG-VYCFTSKAGKTVNPWRTGLSGQLQK  183

Query  259  AFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRD  80
             FVTG+P L+RSE+E ACEDFSNVIGS  +  L KGTLSSGVEIAV   A  SAKDW  +
Sbjct  184  VFVTGIPVLKRSEIEAACEDFSNVIGSCPIGKLFKGTLSSGVEIAVASFATTSAKDWKDN  243

Query  79   QEAQFRHKV  53
             E  FR K+
Sbjct  244  TEIHFRKKI  252



>ref|XP_009607758.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 [Nicotiana tomentosiformis]
 ref|XP_009607759.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 [Nicotiana tomentosiformis]
Length=700

 Score =   125 bits (314),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 76/114 (67%), Gaps = 0/114 (0%)
 Frame = -3

Query  385  MAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETAC  206
            +  +LGG  LLI++    + C+      + PW TG+SGQLQKAFVTG+PKL RSELETAC
Sbjct  346  VVGILGGVFLLIIAVSVFLICRSRAARTIGPWKTGLSGQLQKAFVTGVPKLNRSELETAC  405

Query  205  EDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV*PF  44
            EDFSN+I S   Y + KGTLSSGVEIAV+   I S  +WS   E  FR K+  F
Sbjct  406  EDFSNIITSGDSYIVYKGTLSSGVEIAVISTTISSLSNWSMHSETAFRKKIDTF  459



>ref|XP_009345286.1| PREDICTED: probable inactive receptor-like protein kinase At3g56050 
[Pyrus x bretschneideri]
Length=667

 Score =   125 bits (313),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 87/119 (73%), Gaps = 1/119 (1%)
 Frame = -3

Query  406  KHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRR  227
            KH   +++  + GG+  +I+S I +   + NK+A VKPWATG+SGQLQKAFVTG+P L+R
Sbjct  307  KHKAAILIGGIGGGACFVIISFIFLYLYKTNKVATVKPWATGLSGQLQKAFVTGVPNLKR  366

Query  226  SELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKD-WSRDQEAQFRHKV  53
            SELE ACEDFSNVIGSS + T+ KGTLSSGVEIAV  L   SA   W+ + E QFR K+
Sbjct  367  SELEVACEDFSNVIGSSPIGTVYKGTLSSGVEIAVASLVEPSANYCWTTNLELQFRKKI  425



>ref|XP_010517444.1| PREDICTED: inactive receptor-like serine/threonine-protein kinase 
At2g40270 isoform X2 [Camelina sativa]
Length=493

 Score =   123 bits (308),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = -3

Query  358  LLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGS  179
            LL++ A G+ F +R     V PW TG+SGQLQ+ FVTG+P L+RSE+E ACEDFSNVIGS
Sbjct  152  LLLLVATGVYFYRREAGETVNPWRTGLSGQLQRVFVTGVPVLKRSEIEAACEDFSNVIGS  211

Query  178  SSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
             SV  L KGTLSSGVEIAV      S KDW  + E  FR+K+
Sbjct  212  CSVGKLFKGTLSSGVEIAVASFDTTSTKDWKNNTEIHFRNKI  253



>ref|NP_001130369.1| uncharacterized LOC100191464 precursor [Zea mays]
 gb|ACF78560.1| unknown [Zea mays]
 gb|AFW83549.1| putative leucine-rich repeat transmembrane protein kinase family 
protein [Zea mays]
Length=653

 Score =   124 bits (312),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 76/103 (74%), Gaps = 0/103 (0%)
 Frame = -3

Query  361  VLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIG  182
            VLLI  A  ++ C+      + PW TG+SGQLQKAFVTG+PKL+RSELE ACEDFSN++ 
Sbjct  306  VLLIGIACMLLLCRTKSGTTIGPWKTGLSGQLQKAFVTGVPKLQRSELEGACEDFSNIVS  365

Query  181  SSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            S   YT+ KGTLSSGVEIAV+   + S+KDWS+  E +FR K+
Sbjct  366  SYPQYTVYKGTLSSGVEIAVVSTMVISSKDWSKHSEGRFRKKI  408



>ref|XP_004962397.1| PREDICTED: probable inactive receptor-like protein kinase At3g56050-like 
isoform X2 [Setaria italica]
Length=540

 Score =   123 bits (309),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 75/100 (75%), Gaps = 1/100 (1%)
 Frame = -3

Query  349  VSAIGIVFCQRN-KMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGSSS  173
            VS    + C R+ K+  V+PWATG+SGQLQKAFVTG+P L+RSELE ACEDFSNVIGS  
Sbjct  204  VSVAVFLLCYRSSKVVTVRPWATGLSGQLQKAFVTGVPSLKRSELELACEDFSNVIGSLP  263

Query  172  VYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
             Y + KGTLSSGVEIAV+     SAK+WS+  E QFR K+
Sbjct  264  DYMVYKGTLSSGVEIAVVSTTKSSAKEWSKHCETQFRKKI  303



>gb|EEC79039.1| hypothetical protein OsI_19591 [Oryza sativa Indica Group]
Length=531

 Score =   123 bits (308),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 81/114 (71%), Gaps = 2/114 (2%)
 Frame = -3

Query  388  IMAAVLGGSVLLIVSAIGIVFCQRNKMAV--VKPWATGISGQLQKAFVTGLPKLRRSELE  215
            ++ A  G SVLL  SA     C R+   V  V+PWATG+SGQLQ+AFVTG+P LRR+ELE
Sbjct  183  VLVAAAGASVLLAASAAAFAACYRSSKVVRSVRPWATGLSGQLQRAFVTGVPALRRAELE  242

Query  214  TACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
             ACEDFSNVIGS   YT+ KGTLSSGVEIAV+     S KDWS+  EA FR K+
Sbjct  243  AACEDFSNVIGSLPEYTMYKGTLSSGVEIAVVSTTKTSPKDWSKKCEAHFRKKI  296



>ref|NP_001055283.2| Os05g0353500 [Oryza sativa Japonica Group]
 dbj|BAF17197.2| Os05g0353500 [Oryza sativa Japonica Group]
Length=545

 Score =   123 bits (308),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 81/114 (71%), Gaps = 2/114 (2%)
 Frame = -3

Query  388  IMAAVLGGSVLLIVSAIGIVFCQRNKMAV--VKPWATGISGQLQKAFVTGLPKLRRSELE  215
            ++ A  G SVLL  SA     C R+   V  V+PWATG+SGQLQ+AFVTG+P LRR+ELE
Sbjct  197  VLVAAAGASVLLAASAAAFAACYRSSKVVRSVRPWATGLSGQLQRAFVTGVPALRRAELE  256

Query  214  TACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
             ACEDFSNVIGS   YT+ KGTLSSGVEIAV+     S KDWS+  EA FR K+
Sbjct  257  AACEDFSNVIGSLPEYTMYKGTLSSGVEIAVVSTTKTSPKDWSKKCEAHFRKKI  310



>ref|XP_010481525.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45840 [Camelina sativa]
Length=696

 Score =   124 bits (311),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 87/132 (66%), Gaps = 3/132 (2%)
 Frame = -3

Query  442  TATPRNEIKNSKKHHKI--LIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQ  269
            T  PRN  + SK    +   ++  V     ++I+ A+ I FC++  +  + PW TG+SGQ
Sbjct  322  TDPPRNFEEKSKGFKDVWLYVIIGVAAFVAMMIIVAV-IFFCRKRAVKSIGPWKTGLSGQ  380

Query  268  LQKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDW  89
            LQKAFVTG+PKL RSELETACEDFSN+I +   YT+ KGTLSSGVEIAV   AI   K+W
Sbjct  381  LQKAFVTGVPKLNRSELETACEDFSNIIEAFDGYTVYKGTLSSGVEIAVASTAILETKEW  440

Query  88   SRDQEAQFRHKV  53
            +R  E  +R ++
Sbjct  441  TRAMEMTYRRRI  452



>ref|XP_010091455.1| putative LRR receptor-like serine/threonine-protein kinase MRH1 
[Morus notabilis]
 gb|EXB44554.1| putative LRR receptor-like serine/threonine-protein kinase MRH1 
[Morus notabilis]
Length=640

 Score =   124 bits (310),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -3

Query  328  FCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGT  149
             C + K+A+VKPWATG+SGQLQKAFV+G+PKL+RSELETACEDFSNVI SSS+ TL KGT
Sbjct  305  LCLKTKVAIVKPWATGLSGQLQKAFVSGVPKLKRSELETACEDFSNVIDSSSIGTLYKGT  364

Query  148  LSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            LSSGVEIAV  +A  SAK+WS + E QF  K+
Sbjct  365  LSSGVEIAVASVAATSAKEWSENLEVQFLKKI  396


 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -3

Query  832  GYLGWVVLFLVFQNLAFSWSLKDEGLGMLRSKEKVGTDPFQAF  704
            G L  V+L L  QNL+  WSL DEGL +LR KE++ +DPF + 
Sbjct  15   GILAMVILCLSLQNLSLCWSLNDEGLALLRFKERITSDPFNSL  57



>emb|CDY66807.1| BnaA09g55080D [Brassica napus]
Length=485

 Score =   122 bits (306),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = -3

Query  382  AAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACE  203
            A  +GG+V L++ A G+ F +      V PW+TG+SGQLQK F+TG+PKL+RSE+E ACE
Sbjct  144  AGCVGGAVFLLLLATGLFFFKSKAGKSVNPWSTGLSGQLQKVFITGVPKLKRSEIEAACE  203

Query  202  DFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            DFSNVIGS  + TL KGTLS+GVEIAV  +A  SAK+W+ + E QFR K+
Sbjct  204  DFSNVIGSCPIGTLFKGTLSTGVEIAVASVATASAKEWTNNIEMQFRKKI  253



>ref|XP_009116300.1| PREDICTED: probable inactive receptor-like protein kinase At3g56050 
[Brassica rapa]
Length=493

 Score =   122 bits (306),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = -3

Query  382  AAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACE  203
            A  +GG+V L++ A G+ F +      V PW+TG+SGQLQK F+TG+PKL+RSE+E ACE
Sbjct  143  AGCVGGAVFLLLLATGLFFFKSKAGKSVNPWSTGLSGQLQKVFITGVPKLKRSEIEAACE  202

Query  202  DFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            DFSNVIGS  + TL KGTLS+GVEIAV  +A  SAK+W+ + E QFR K+
Sbjct  203  DFSNVIGSCPIGTLFKGTLSTGVEIAVASVATASAKEWTNNIEMQFRKKI  252



>gb|AAV43879.1| unknown protein [Oryza sativa Japonica Group]
Length=563

 Score =   123 bits (308),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 74/99 (75%), Gaps = 4/99 (4%)
 Frame = -3

Query  325  CQRNKMAV--VKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKG  152
            C R+   V  V+PWATG+SGQLQ+AFVTG+P LRR+ELE ACEDFSNVIGS   YT+ KG
Sbjct  182  CYRSSKVVRSVRPWATGLSGQLQRAFVTGVPALRRAELEAACEDFSNVIGSLPEYTMYKG  241

Query  151  TLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV*PFVLP  35
            TLSSGVEIAV+     S KDWS+  EA FR KV   +LP
Sbjct  242  TLSSGVEIAVVSTTKTSPKDWSKKCEAHFRKKV--LLLP  278



>ref|NP_191164.1| protein kinase family protein [Arabidopsis thaliana]
 ref|NP_001078300.1| protein kinase family protein [Arabidopsis thaliana]
 sp|Q9LYN6.1|Y3565_ARATH RecName: Full=Probable inactive receptor-like protein kinase 
At3g56050; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB87404.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAK76695.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAM14374.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAM20672.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAN15647.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAN60319.1| unknown [Arabidopsis thaliana]
 gb|AEE79470.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AEE79471.1| protein kinase family protein [Arabidopsis thaliana]
Length=499

 Score =   122 bits (306),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 83/114 (73%), Gaps = 0/114 (0%)
 Frame = -3

Query  394  ILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELE  215
            I I+A  + G+V +++ A G+ F +      V PW TG+SGQLQK F+TG+PKL+RSE+E
Sbjct  145  IPIVAGCIAGAVFILLLATGVFFFKSKAGKSVNPWRTGLSGQLQKVFITGVPKLKRSEIE  204

Query  214  TACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
             ACEDFSNVIGS  + TL KGTLSSGVEIAV  +A  SAK+W+ + E QFR K+
Sbjct  205  AACEDFSNVIGSCPIGTLFKGTLSSGVEIAVASVATASAKEWTNNIEMQFRKKI  258



>ref|XP_010516201.1| PREDICTED: probable inactive receptor-like protein kinase At3g56050 
[Camelina sativa]
Length=500

 Score =   122 bits (306),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 83/114 (73%), Gaps = 0/114 (0%)
 Frame = -3

Query  394  ILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELE  215
            + I+A   GG++ +I+ A G+ F +      V PW TG+SGQLQK F+TG+PKL+RSE+E
Sbjct  146  VPIVAGCFGGALFVILLATGVFFFKTKAGKSVNPWRTGLSGQLQKVFITGVPKLKRSEIE  205

Query  214  TACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
             ACEDFSNVIGS  + TL KGTLS+GVEIAV  +A  SAK+W+ + E QFR K+
Sbjct  206  AACEDFSNVIGSCPIGTLFKGTLSTGVEIAVASVATASAKEWTNNIEMQFRKKI  259



>ref|XP_003569550.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 [Brachypodium distachyon]
 ref|XP_010232135.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 [Brachypodium distachyon]
Length=656

 Score =   124 bits (310),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 84/121 (69%), Gaps = 1/121 (1%)
 Frame = -3

Query  412  SKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNK-MAVVKPWATGISGQLQKAFVTGLPK  236
            SK   K  + A V+    LLI+    ++   RNK +A + PW TG+SGQLQKAFVTG+PK
Sbjct  291  SKPRSKKWLYAIVIPLIALLIIGITCMLCLCRNKSVATIGPWKTGLSGQLQKAFVTGVPK  350

Query  235  LRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHK  56
            L+RSELE ACEDFSN++ S   YT+ KGTLSSGVEIAV+   + S+KDWS+  E  FR K
Sbjct  351  LQRSELEGACEDFSNIVASYPHYTVYKGTLSSGVEIAVVSTVLASSKDWSKHSEGIFRKK  410

Query  55   V  53
            +
Sbjct  411  I  411



>ref|XP_004962396.1| PREDICTED: probable inactive receptor-like protein kinase At3g56050-like 
isoform X1 [Setaria italica]
Length=599

 Score =   123 bits (309),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 75/100 (75%), Gaps = 1/100 (1%)
 Frame = -3

Query  349  VSAIGIVFCQRN-KMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGSSS  173
            VS    + C R+ K+  V+PWATG+SGQLQKAFVTG+P L+RSELE ACEDFSNVIGS  
Sbjct  263  VSVAVFLLCYRSSKVVTVRPWATGLSGQLQKAFVTGVPSLKRSELELACEDFSNVIGSLP  322

Query  172  VYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
             Y + KGTLSSGVEIAV+     SAK+WS+  E QFR K+
Sbjct  323  DYMVYKGTLSSGVEIAVVSTTKSSAKEWSKHCETQFRKKI  362



>ref|XP_010505753.1| PREDICTED: inactive receptor-like serine/threonine-protein kinase 
At2g40270 isoform X2 [Camelina sativa]
Length=448

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 74/105 (70%), Gaps = 1/105 (1%)
 Frame = -3

Query  367  GSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNV  188
             S LL+V A G+ F +R     V PW TG+SGQLQ+ FVTG+P L+RSE+E ACE+FSNV
Sbjct  105  ASFLLLV-ATGVYFYRRKAGETVNPWRTGLSGQLQRVFVTGVPVLKRSEIEAACEEFSNV  163

Query  187  IGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            IGS SV  L KGTLSSGVEIAV      SAKDW  + E  FR+K+
Sbjct  164  IGSCSVGKLFKGTLSSGVEIAVASFDTTSAKDWKNNTEIHFRNKI  208



>ref|XP_010494736.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45840 [Camelina sativa]
 ref|XP_010494737.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45840 [Camelina sativa]
Length=697

 Score =   124 bits (310),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 87/132 (66%), Gaps = 3/132 (2%)
 Frame = -3

Query  442  TATPRNEIKNSKKHHKI--LIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQ  269
            T  PRN  + SK    +   ++  V     ++I+ A+ I FC++  +  + PW TG+SGQ
Sbjct  323  TDPPRNFEEKSKGFKDVWLYVIIGVAAFVAVMIIVAV-IFFCRKRAVKSIGPWKTGLSGQ  381

Query  268  LQKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDW  89
            LQKAFVTG+PKL RSELETACEDFSN+I +   YT+ KGTLSSGVEIAV   AI   K+W
Sbjct  382  LQKAFVTGVPKLNRSELETACEDFSNIIEAFDGYTVYKGTLSSGVEIAVASTAILETKEW  441

Query  88   SRDQEAQFRHKV  53
            +R  E  +R ++
Sbjct  442  TRAMEMTYRRRI  453



>emb|CDX72177.1| BnaC08g26970D [Brassica napus]
Length=492

 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = -3

Query  382  AAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACE  203
            A  +GG+V L++ A G+ F +      V PW+TG+SGQLQK F+TG+PKL+RSE+E ACE
Sbjct  142  AGCVGGAVFLLLLATGVFFFKSKAGKSVNPWSTGLSGQLQKVFITGVPKLKRSEIEAACE  201

Query  202  DFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            DFSNVIGS  + TL KGTLS+GVEIAV  +A  SAK+W+ + E QFR ++
Sbjct  202  DFSNVIGSCPIGTLFKGTLSTGVEIAVASVATASAKEWTNNIEMQFRKRI  251



>ref|XP_004961242.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like [Setaria italica]
Length=469

 Score =   121 bits (304),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 84/113 (74%), Gaps = 2/113 (2%)
 Frame = -3

Query  391  LIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELET  212
            +++ AV  G +LL   A  ++ C+++ +A + PW TG+SGQLQKAFVTG+PKL+ SELE 
Sbjct  112  IVLPAV--GLLLLTGLACWVLPCRKSAVATIGPWKTGLSGQLQKAFVTGVPKLQLSELER  169

Query  211  ACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            ACEDFSN++ S   YT+ KGTLSSGVEIAV+   I S+K+WS+  E+ FR K+
Sbjct  170  ACEDFSNIVASYPHYTVYKGTLSSGVEIAVVSTTITSSKEWSQHSESCFRKKI  222



>ref|XP_008654238.1| PREDICTED: uncharacterized LOC100191464 isoform X1 [Zea mays]
Length=791

 Score =   124 bits (310),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 76/103 (74%), Gaps = 0/103 (0%)
 Frame = -3

Query  361  VLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIG  182
            VLLI  A  ++ C+      + PW TG+SGQLQKAFVTG+PKL+RSELE ACEDFSN++ 
Sbjct  444  VLLIGIACMLLLCRTKSGTTIGPWKTGLSGQLQKAFVTGVPKLQRSELEGACEDFSNIVS  503

Query  181  SSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            S   YT+ KGTLSSGVEIAV+   + S+KDWS+  E +FR K+
Sbjct  504  SYPQYTVYKGTLSSGVEIAVVSTMVISSKDWSKHSEGRFRKKI  546



>ref|XP_003579053.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 [Brachypodium distachyon]
Length=459

 Score =   121 bits (304),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 89/131 (68%), Gaps = 4/131 (3%)
 Frame = -3

Query  439  ATPRNEIKNSKKHHKILIMAA--VLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQL  266
            A P  +  +S  H  + ++ A  VLG  +++I + + ++  +R K   V PWATG+SGQL
Sbjct  95   AQPETKKPSSVPHWAVYVLCASGVLG--LVVIAATVYLLLSRRKKDHTVIPWATGLSGQL  152

Query  265  QKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWS  86
            +KAFVTG+P L R+ELE ACEDFSNVIG+ S   L KGTLSSGVEIAV    ++ A++WS
Sbjct  153  RKAFVTGVPSLGRTELEAACEDFSNVIGTVSDCALYKGTLSSGVEIAVACSPVKCAEEWS  212

Query  85   RDQEAQFRHKV  53
               E QFR+K+
Sbjct  213  ERSEQQFRNKI  223



>ref|XP_004150213.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like [Cucumis sativus]
 ref|XP_004161203.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like [Cucumis sativus]
 gb|KGN65628.1| hypothetical protein Csa_1G470440 [Cucumis sativus]
Length=715

 Score =   123 bits (309),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 87/130 (67%), Gaps = 4/130 (3%)
 Frame = -3

Query  439  ATPRNEIKNSKKHHKILIMAAVLGG-SVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQ  263
             T +N+  NS+   K +I   ++GG S+ +I++ I    C+   +  + PW TG+SGQLQ
Sbjct  342  TTEQNQTDNSRNFWKYVI---IIGGVSLSVILATIIFCMCRSRGVTTIGPWKTGLSGQLQ  398

Query  262  KAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSR  83
            KAF+TG PKL R ELE ACEDFSN+I +    T+ KGTLSSGVEIAV  +++ S+KDWS+
Sbjct  399  KAFITGAPKLNRPELEVACEDFSNIIDTFDCSTIYKGTLSSGVEIAVASVSVTSSKDWSK  458

Query  82   DQEAQFRHKV  53
              E  +R K+
Sbjct  459  SSEQTYRKKI  468



>ref|NP_001147491.1| ATP binding protein precursor [Zea mays]
 gb|ACG27707.1| ATP binding protein [Zea mays]
Length=529

 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 73/92 (79%), Gaps = 1/92 (1%)
 Frame = -3

Query  325  CQRNKMAV-VKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGT  149
            C R+   V V+PWATG+SGQLQKAFVTG+P L+RSELE ACEDFSNVIGS S Y + KGT
Sbjct  201  CYRSSSVVTVRPWATGLSGQLQKAFVTGVPSLKRSELEAACEDFSNVIGSLSDYMVYKGT  260

Query  148  LSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            LS+GVEIAV+     SAK+WS+  E+QFR K+
Sbjct  261  LSTGVEIAVVSTTKNSAKEWSKHCESQFRKKI  292



>ref|NP_001056307.1| Os05g0560300 [Oryza sativa Japonica Group]
 gb|AAU10641.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18221.1| Os05g0560300 [Oryza sativa Japonica Group]
 gb|EEE64672.1| hypothetical protein OsJ_19527 [Oryza sativa Japonica Group]
Length=454

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = -3

Query  394  ILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELE  215
            + I+   + G ++L   A   + C++  +A + PW TG+SGQLQKAFV+G+P+L+R ELE
Sbjct  97   LYIVVIPVAGLIMLAGMAWMFLPCRKKSVATIGPWRTGLSGQLQKAFVSGVPQLQRPELE  156

Query  214  TACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
             ACEDFSN++ S   YT+ KGTLSSGVEIAV+   I+S+KDWS+  E  FR K+
Sbjct  157  RACEDFSNIVASHPYYTVYKGTLSSGVEIAVVSTTIKSSKDWSKHCEDCFRKKI  210



>ref|XP_010505752.1| PREDICTED: inactive receptor-like serine/threonine-protein kinase 
At2g40270 isoform X1 [Camelina sativa]
Length=493

 Score =   121 bits (304),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 74/105 (70%), Gaps = 1/105 (1%)
 Frame = -3

Query  367  GSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNV  188
             S LL+V A G+ F +R     V PW TG+SGQLQ+ FVTG+P L+RSE+E ACE+FSNV
Sbjct  150  ASFLLLV-ATGVYFYRRKAGETVNPWRTGLSGQLQRVFVTGVPVLKRSEIEAACEEFSNV  208

Query  187  IGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            IGS SV  L KGTLSSGVEIAV      SAKDW  + E  FR+K+
Sbjct  209  IGSCSVGKLFKGTLSSGVEIAVASFDTTSAKDWKNNTEIHFRNKI  253



>ref|XP_008647786.1| PREDICTED: ATP binding protein isoform X2 [Zea mays]
Length=566

 Score =   122 bits (306),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 73/92 (79%), Gaps = 1/92 (1%)
 Frame = -3

Query  325  CQRNKMAV-VKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGT  149
            C R+   V V+PWATG+SGQLQKAFVTG+P L+RSELE ACEDFSNVIGS S Y + KGT
Sbjct  238  CYRSSSVVTVRPWATGLSGQLQKAFVTGVPSLKRSELEAACEDFSNVIGSLSDYMVYKGT  297

Query  148  LSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            LS+GVEIAV+     SAK+WS+  E+QFR K+
Sbjct  298  LSTGVEIAVVSTTKNSAKEWSKHCESQFRKKI  329



>gb|AGT15875.1| hypothetical protein SHCRBa_027_N23_F_10 [Saccharum hybrid cultivar 
R570]
Length=465

 Score =   121 bits (303),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = -3

Query  325  CQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTL  146
            C+++ +A + PW TG+SGQLQKAFVTG+PKL+RSELE ACEDFSN++ S   YT+ KGTL
Sbjct  124  CRKSAVATIGPWKTGLSGQLQKAFVTGVPKLQRSELERACEDFSNIVASYPHYTVYKGTL  183

Query  145  SSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            S+GVEIAV+   I S+K+WS   E+ FR K+
Sbjct  184  STGVEIAVVSTMITSSKEWSEHSESCFRRKI  214



>ref|XP_008647785.1| PREDICTED: ATP binding protein isoform X1 [Zea mays]
Length=567

 Score =   122 bits (305),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 73/92 (79%), Gaps = 1/92 (1%)
 Frame = -3

Query  325  CQRNKMAV-VKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGT  149
            C R+   V V+PWATG+SGQLQKAFVTG+P L+RSELE ACEDFSNVIGS S Y + KGT
Sbjct  239  CYRSSSVVTVRPWATGLSGQLQKAFVTGVPSLKRSELEAACEDFSNVIGSLSDYMVYKGT  298

Query  148  LSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            LS+GVEIAV+     SAK+WS+  E+QFR K+
Sbjct  299  LSTGVEIAVVSTTKNSAKEWSKHCESQFRKKI  330



>ref|XP_011085985.1| PREDICTED: LOW QUALITY PROTEIN: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 [Sesamum indicum]
Length=714

 Score =   123 bits (308),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 84/129 (65%), Gaps = 1/129 (1%)
 Frame = -3

Query  436  TPRNEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKA  257
            T +      K  + + ++  +  G  LLI++ + IV C+      + PW TG+SGQLQKA
Sbjct  339  TDKQSSDTGKSGNSVKLIVGLSVGVFLLILAVVIIVICRSRAAKTIAPWKTGLSGQLQKA  398

Query  256  FVTGLPKLRRSELETACEDFSNVIGSSS-VYTLCKGTLSSGVEIAVLWLAIESAKDWSRD  80
            FVTG+PKL R ELETACEDFSN+I +   V T+ KGTLSSGVEIAV   AI S KDWS+ 
Sbjct  399  FVTGVPKLNRDELETACEDFSNIISTDEGVATVYKGTLSSGVEIAVASTAIVSLKDWSKR  458

Query  79   QEAQFRHKV  53
             E  FR+K+
Sbjct  459  SELVFRNKI  467



>ref|XP_006467639.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like [Citrus sinensis]
Length=680

 Score =   122 bits (307),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = -3

Query  358  LLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGS  179
            +LI++A     CQ   +  ++PW TG+SGQLQKAFVTG+PKL R EL+TACEDFSN+I +
Sbjct  334  VLIIAAAAFFTCQTRAVRTIRPWRTGLSGQLQKAFVTGVPKLNRLELDTACEDFSNIIDT  393

Query  178  SSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
             S  T+ KGTLSSGVEIAV   AI S+KDW + QE  +R +V
Sbjct  394  QSGCTIYKGTLSSGVEIAVAATAITSSKDWLKSQEMAYRKQV  435



>ref|XP_010538565.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 isoform X2 [Tarenaya hassleriana]
Length=681

 Score =   122 bits (307),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 90/130 (69%), Gaps = 1/130 (1%)
 Frame = -3

Query  442  TATPRNEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQ  263
            ++ P  + + S+KH  + ++   L   V+++V    IVFC+R     + PW TG+SGQLQ
Sbjct  311  SSNPSQDDRKSEKHVWLYVVTG-LAAFVIILVIVAVIVFCRRRAAKTIGPWKTGLSGQLQ  369

Query  262  KAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSR  83
            KAFVTG+PKL R ELETACEDFSN+I +   YT+ KGTLSSGVEIAV+  AI ++K+W+R
Sbjct  370  KAFVTGVPKLNRHELETACEDFSNIIEAFDGYTVYKGTLSSGVEIAVVSTAISASKEWTR  429

Query  82   DQEAQFRHKV  53
              E  +R K+
Sbjct  430  AMEMAYRRKI  439



>ref|XP_010538563.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010538564.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 isoform X1 [Tarenaya hassleriana]
Length=685

 Score =   122 bits (307),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 90/130 (69%), Gaps = 1/130 (1%)
 Frame = -3

Query  442  TATPRNEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQ  263
            ++ P  + + S+KH  + ++   L   V+++V    IVFC+R     + PW TG+SGQLQ
Sbjct  315  SSNPSQDDRKSEKHVWLYVVTG-LAAFVIILVIVAVIVFCRRRAAKTIGPWKTGLSGQLQ  373

Query  262  KAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSR  83
            KAFVTG+PKL R ELETACEDFSN+I +   YT+ KGTLSSGVEIAV+  AI ++K+W+R
Sbjct  374  KAFVTGVPKLNRHELETACEDFSNIIEAFDGYTVYKGTLSSGVEIAVVSTAISASKEWTR  433

Query  82   DQEAQFRHKV  53
              E  +R K+
Sbjct  434  AMEMAYRRKI  443



>gb|KDO77873.1| hypothetical protein CISIN_1g005734mg [Citrus sinensis]
Length=680

 Score =   122 bits (307),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = -3

Query  358  LLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGS  179
            +LI++A     CQ   +  ++PW TG+SGQLQKAFVTG+PKL R EL+TACEDFSN+I +
Sbjct  334  VLIIAAAAFFTCQTRAVRTIRPWRTGLSGQLQKAFVTGVPKLNRLELDTACEDFSNIIDT  393

Query  178  SSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
             S  T+ KGTLSSGVEIAV   AI S+KDW + QE  +R +V
Sbjct  394  QSGCTIYKGTLSSGVEIAVAATAITSSKDWLKSQEMAYRKQV  435



>gb|KFK36918.1| hypothetical protein AALP_AA4G189600 [Arabis alpina]
Length=482

 Score =   120 bits (302),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 71/102 (70%), Gaps = 0/102 (0%)
 Frame = -3

Query  358  LLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGS  179
             L++   G+V+        V PW TG+SGQLQK FVTG+P L+RSE+E ACEDFSNVIGS
Sbjct  147  FLLLLVTGVVYYTSKAGKSVNPWRTGLSGQLQKVFVTGIPTLKRSEIEAACEDFSNVIGS  206

Query  178  SSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
              +  L KGTLSSGVEIAV  +A  SAKDW  + E QFR K+
Sbjct  207  CPIGKLFKGTLSSGVEIAVASIATTSAKDWKSNTEIQFRKKI  248



>ref|XP_006449513.1| hypothetical protein CICLE_v10014435mg [Citrus clementina]
 gb|ESR62753.1| hypothetical protein CICLE_v10014435mg [Citrus clementina]
Length=713

 Score =   123 bits (308),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = -3

Query  358  LLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGS  179
            +LI++A     CQ   +  ++PW TG+SGQLQKAFVTG+PKL R EL+TACEDFSN+I +
Sbjct  367  VLIIAAAAFFTCQTRAVRTIRPWRTGLSGQLQKAFVTGVPKLNRLELDTACEDFSNIIDT  426

Query  178  SSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
             S  T+ KGTLSSGVEIAV   AI S+KDW + QE  +R +V
Sbjct  427  QSGCTIYKGTLSSGVEIAVAATAITSSKDWLKSQEMAYRKQV  468



>ref|XP_002456124.1| hypothetical protein SORBIDRAFT_03g030930 [Sorghum bicolor]
 gb|EES01244.1| hypothetical protein SORBIDRAFT_03g030930 [Sorghum bicolor]
Length=340

 Score =   119 bits (299),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = -3

Query  334  IVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCK  155
            +  C+      + PW TG+SGQLQKAFVTG+PKL+RSELE ACEDFSN++ +   YT+ K
Sbjct  2    LFLCRAKSGKTIGPWKTGLSGQLQKAFVTGVPKLQRSELEGACEDFSNIVATYPQYTVYK  61

Query  154  GTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            GTLSSGVEIAV+   I S+KDWS+  E +FR K+
Sbjct  62   GTLSSGVEIAVVSTMITSSKDWSKHSEGRFRKKI  95



>ref|XP_006384063.1| hypothetical protein POPTR_0004s05680g [Populus trichocarpa]
 gb|ERP61860.1| hypothetical protein POPTR_0004s05680g [Populus trichocarpa]
Length=712

 Score =   122 bits (307),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 78/103 (76%), Gaps = 1/103 (1%)
 Frame = -3

Query  358  LLIVSAIGIVF-CQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIG  182
            +LI+ A G++F C++  +  + PW TG+SGQLQKAFVTG+PKL RSELETACEDFSN+I 
Sbjct  367  VLIIFAAGLLFRCRKQGVTTIGPWKTGLSGQLQKAFVTGVPKLNRSELETACEDFSNIID  426

Query  181  SSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +   +T  KGTLSSGVEI+V    + S+KDWS++ E  +R K+
Sbjct  427  TFDGFTAYKGTLSSGVEISVASTTVASSKDWSKNAEMAYRKKI  469



>gb|EMT32476.1| Putative LRR receptor-like serine/threonine-protein kinase MRH1 
[Aegilops tauschii]
Length=399

 Score =   120 bits (300),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 82/113 (73%), Gaps = 2/113 (2%)
 Frame = -3

Query  391  LIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELET  212
            L ++  LG  +++I S + ++  +R K   V PWATG+SGQL+KAFVTG+P L R+ELE 
Sbjct  156  LCVSGALG--LVVIASVVYLLVSRRKKDNTVNPWATGLSGQLRKAFVTGVPSLGRAELEA  213

Query  211  ACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            ACE+FSNVIG+ S   L KGTLSSGVEIAV    ++SAK+WS   E QFR+K+
Sbjct  214  ACENFSNVIGTVSDSALYKGTLSSGVEIAVASSPVKSAKEWSDRSEEQFRNKI  266



>ref|XP_004234089.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 [Solanum lycopersicum]
 ref|XP_010317429.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 [Solanum lycopersicum]
Length=720

 Score =   122 bits (307),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 75/108 (69%), Gaps = 0/108 (0%)
 Frame = -3

Query  367  GSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNV  188
            G VLLI+ A   + C+      + PW TG+SGQLQKAFVTG+PKL RSELETACEDFSN+
Sbjct  371  GVVLLILVASVFLICRIRAARTIVPWKTGLSGQLQKAFVTGVPKLNRSELETACEDFSNI  430

Query  187  IGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV*PF  44
            I S + Y + KGTLSSGVEIAV+   I S +DWS   E  FR K+  F
Sbjct  431  ITSGNSYIVYKGTLSSGVEIAVISTTISSLQDWSVHSETAFRKKIDTF  478



>ref|XP_002317415.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE98027.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=659

 Score =   122 bits (306),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 88/129 (68%), Gaps = 6/129 (5%)
 Frame = -3

Query  436  TPRNEIK-NSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQK  260
            TP N    N+  +  I+ +A VLG     IV+   ++ C++  +  + PW TG+SGQLQK
Sbjct  293  TPTNGTSGNTWMYFLIIPIAGVLG-----IVAVGLLLMCRKQVVTTIGPWKTGLSGQLQK  347

Query  259  AFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRD  80
            AFVTG+PKL RSELETACEDFSN+I + + +T  KGTLSSGVEI+V   A+ S+KDWS+ 
Sbjct  348  AFVTGVPKLNRSELETACEDFSNIIDTFNGFTAYKGTLSSGVEISVASTAVTSSKDWSKS  407

Query  79   QEAQFRHKV  53
             E  +R K+
Sbjct  408  AEMAYRKKI  416



>gb|ACN30936.1| unknown [Zea mays]
Length=472

 Score =   120 bits (301),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = -3

Query  325  CQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTL  146
            C+++ +A + PW TG+SGQLQKAFVTG+PKL+RSELE ACEDFSN++ S   YT+ KGTL
Sbjct  133  CRKSAVATIGPWKTGLSGQLQKAFVTGVPKLQRSELERACEDFSNIVASYPHYTVYKGTL  192

Query  145  SSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            S+GVEIAV+   I S+K+W+   E+ FR KV
Sbjct  193  STGVEIAVVSTMITSSKEWTEHSESCFRRKV  223



>gb|EMS63852.1| putative LRR receptor-like serine/threonine-protein kinase MRH1 
[Triticum urartu]
Length=479

 Score =   120 bits (301),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 83/113 (73%), Gaps = 2/113 (2%)
 Frame = -3

Query  391  LIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELET  212
            + ++ VLG  +++I S + ++  +R K   V PWATG+SGQL+KAFVTG+P L R+ELE 
Sbjct  161  VCISGVLG--LVVIASVVYLLVSRRKKDNTVNPWATGLSGQLRKAFVTGVPSLGRAELEA  218

Query  211  ACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            ACE+FSNVIG+ S   L KGTLSSGVEIAV    ++SAK+WS   E QFR+K+
Sbjct  219  ACENFSNVIGTVSDSALYKGTLSSGVEIAVASSPVKSAKEWSDRSEEQFRNKI  271



>ref|XP_006280105.1| hypothetical protein CARUB_v10025993mg [Capsella rubella]
 gb|EOA13003.1| hypothetical protein CARUB_v10025993mg [Capsella rubella]
Length=699

 Score =   122 bits (307),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 87/130 (67%), Gaps = 4/130 (3%)
 Frame = -3

Query  433  PRNEIKNSKKHHKILIMAAVLGGSV---LLIVSAIGIVFCQRNKMAVVKPWATGISGQLQ  263
            P  + +   K  K + +  V+G S    +LI+ A+ I FC++  +  + PW TG+SGQLQ
Sbjct  327  PPRKFEEKSKGFKDIWLYVVIGFSAFVAMLIIVAV-IFFCRKRAVKSIGPWKTGLSGQLQ  385

Query  262  KAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSR  83
            KAFVTG+PKL RSELETACEDFSN+I +   YT+ KGTLSSGVEIAV   AI   ++W+R
Sbjct  386  KAFVTGVPKLNRSELETACEDFSNIIEAFDGYTVYKGTLSSGVEIAVASTAILETREWTR  445

Query  82   DQEAQFRHKV  53
              E  +R ++
Sbjct  446  AMEMTYRRRI  455



>dbj|BAK00032.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=500

 Score =   120 bits (302),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 83/113 (73%), Gaps = 2/113 (2%)
 Frame = -3

Query  391  LIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELET  212
            L ++  LG  +++I S + ++  +R K   V PWATG+SGQL+KAFVTG+P L R+ELET
Sbjct  153  LCISGALG--LVVIASIVYLLLSRRKKDNTVIPWATGLSGQLRKAFVTGVPSLGRAELET  210

Query  211  ACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            ACE+FSNVIG+ S   L KGTLSSGVEIAV    ++SAK+WS   E QFR+K+
Sbjct  211  ACENFSNVIGTVSDNALYKGTLSSGVEIAVASSPVKSAKEWSDRSEEQFRNKI  263



>ref|XP_006654778.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like [Oryza brachyantha]
Length=457

 Score =   120 bits (301),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = -3

Query  325  CQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTL  146
            C++   A + PW TG+SGQLQKAFV+G+P+L+RSELE ACEDFSN++ S   YT+ KGTL
Sbjct  123  CRKRSDATIGPWKTGLSGQLQKAFVSGVPQLQRSELERACEDFSNIVASHPYYTVYKGTL  182

Query  145  SSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            SSGVEIAV+   I+S+KDWS+  E  FR K+
Sbjct  183  SSGVEIAVVSTTIKSSKDWSKHGEDCFRKKI  213



>gb|EAY99002.1| hypothetical protein OsI_20961 [Oryza sativa Indica Group]
Length=505

 Score =   120 bits (302),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = -3

Query  373  LGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFS  194
            + G ++L   A   + C++  +A + PW TG+SGQLQKAFV+G+P+L+R ELE ACEDFS
Sbjct  155  VAGLIMLAGMAWMFLPCRKKSVATIGPWRTGLSGQLQKAFVSGVPQLQRPELERACEDFS  214

Query  193  NVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            N++ S   YT+ KGTLSSGVEIAV+   I+S+KDWS+  E  FR K+
Sbjct  215  NIVASHPYYTVYKGTLSSGVEIAVVSTTIKSSKDWSKHCEDCFRKKI  261



>ref|XP_004978586.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like isoform X1 [Setaria italica]
 ref|XP_004978587.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like isoform X2 [Setaria italica]
 ref|XP_004978588.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like isoform X3 [Setaria italica]
 ref|XP_004978589.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like isoform X4 [Setaria italica]
Length=460

 Score =   120 bits (301),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 88/127 (69%), Gaps = 3/127 (2%)
 Frame = -3

Query  424  EIKNSKKHHKILIMAAVLGGSVLLIVSAIG---IVFCQRNKMAVVKPWATGISGQLQKAF  254
            E +  K  H  +   A+ GG+++ + +A     ++F +R K   V PW+TG+SG L+KAF
Sbjct  104  EPERKKLPHWAIYTIAISGGALVFVAAAAATTYLLFYRRKKDTTVMPWSTGLSGPLRKAF  163

Query  253  VTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQE  74
            V G+P L R+EL+TACEDF NVIGSSS  TL KGTLSSGVEIAV+  + +SAKDWS   E
Sbjct  164  VAGVPSLGRAELQTACEDFINVIGSSSECTLYKGTLSSGVEIAVVSTSADSAKDWSDRSE  223

Query  73   AQFRHKV  53
             +F++K+
Sbjct  224  EKFKNKI  230



>gb|ABR16832.1| unknown [Picea sitchensis]
Length=754

 Score =   122 bits (307),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = -3

Query  358  LLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGS  179
              +++++ +  C+R  +  ++PW TGISGQLQKAFVTG+PKL R +LE ACE+FSNVIGS
Sbjct  399  FFLITSVLVCICRRRNVVTIRPWKTGISGQLQKAFVTGVPKLNRVDLEAACEEFSNVIGS  458

Query  178  SSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +    L KGTLSSGVEIAV    I SAKDWS   E  FR K+
Sbjct  459  TPDSMLYKGTLSSGVEIAVTSTIISSAKDWSEHSELYFRKKI  500



>ref|XP_008675203.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45840 isoform X1 [Zea mays]
 ref|XP_008675204.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45840 isoform X1 [Zea mays]
Length=660

 Score =   122 bits (305),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = -3

Query  364  SVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVI  185
            ++L+   A  ++ C+      + PW TG+SGQLQKAFVTG+PKL+RSELE ACEDFSN++
Sbjct  312  ALLMFGIACMLLLCRTKSGTTIGPWKTGLSGQLQKAFVTGVPKLQRSELEGACEDFSNIV  371

Query  184  GSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
             S   YT+ KGTLSSGVEIAV+   I S+KDWS+  E +FR K+
Sbjct  372  ASYPQYTVYKGTLSSGVEIAVVSTMIISSKDWSKHSEGRFRKKI  415



>ref|XP_008675205.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45840 isoform X2 [Zea mays]
 tpg|DAA58157.1| TPA: putative leucine-rich repeat transmembrane protein kinase 
family protein [Zea mays]
Length=657

 Score =   122 bits (305),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = -3

Query  364  SVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVI  185
            ++L+   A  ++ C+      + PW TG+SGQLQKAFVTG+PKL+RSELE ACEDFSN++
Sbjct  309  ALLMFGIACMLLLCRTKSGTTIGPWKTGLSGQLQKAFVTGVPKLQRSELEGACEDFSNIV  368

Query  184  GSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
             S   YT+ KGTLSSGVEIAV+   I S+KDWS+  E +FR K+
Sbjct  369  ASYPQYTVYKGTLSSGVEIAVVSTMIISSKDWSKHSEGRFRKKI  412



>ref|XP_006287483.1| hypothetical protein CARUB_v10000694mg [Capsella rubella]
 gb|EOA20381.1| hypothetical protein CARUB_v10000694mg [Capsella rubella]
Length=529

 Score =   120 bits (302),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 92/124 (74%), Gaps = 4/124 (3%)
 Frame = -3

Query  415  NSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRN-KMAVVKPW-ATGISGQLQKAFVTGL  242
            N+K++HKI I+  VL G V  +++A+ I F   N K+ ++KPW ATG SGQL++A +TG+
Sbjct  195  NNKRYHKIYIIIGVLVG-VSGVMAALVIFFLLWNQKVKMIKPWGATGSSGQLREAVITGI  253

Query  241  PKLRRSELETACEDFSNVIGS-SSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQF  65
            PKL+ SELE ACEDFSN+IGS SS  T+ KGTLS+G EIAVL +A  S +DWS D E QF
Sbjct  254  PKLKLSELEAACEDFSNIIGSTSSDATIYKGTLSTGSEIAVLAVASGSLQDWSVDHETQF  313

Query  64   RHKV  53
            + K+
Sbjct  314  QEKI  317



>emb|CDX78881.1| BnaA01g09480D [Brassica napus]
Length=660

 Score =   122 bits (305),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 85/125 (68%), Gaps = 1/125 (1%)
 Frame = -3

Query  427  NEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVT  248
            N+     KH  + ++ AV     LLI+ A+ I  C++  +  + PW TG+SGQLQKAFVT
Sbjct  293  NKQSKGSKHVWLYVVIAVASFLGLLIIVAV-IFLCRKRAVKSIGPWKTGLSGQLQKAFVT  351

Query  247  GLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQ  68
            G+PKL R+ELETACEDFSN+I +   YT+ KGTLSSGVEIAV   A+  +K+W+R  E  
Sbjct  352  GVPKLNRAELETACEDFSNIIETFDGYTVYKGTLSSGVEIAVASTAVCESKEWTRAMEMA  411

Query  67   FRHKV  53
            +R K+
Sbjct  412  YRRKI  416



>ref|NP_001065935.1| Os12g0105800 [Oryza sativa Japonica Group]
 gb|ABA95611.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF28954.1| Os12g0105800 [Oryza sativa Japonica Group]
 dbj|BAG92241.1| unnamed protein product [Oryza sativa Japonica Group]
Length=322

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = -3

Query  361  VLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIG  182
            +  + +AI + F +R K   V PWATG+SGQL+KAFVTG+P L R+ELE ACE F NVIG
Sbjct  162  IAAVATAIYVFFSRRKKDNTVMPWATGLSGQLKKAFVTGVPSLERTELEAACEGFINVIG  221

Query  181  SSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +    TL KGTLSSGVEIAVL  ++ S++ WS   E QFR+K+
Sbjct  222  TLPECTLYKGTLSSGVEIAVLSTSVNSSQQWSAQSEEQFRNKI  264



>emb|CDX99448.1| BnaC01g11040D [Brassica napus]
Length=662

 Score =   121 bits (304),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 85/125 (68%), Gaps = 1/125 (1%)
 Frame = -3

Query  427  NEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVT  248
            N+     KH  + ++ AV     LLI+ A+ I  C++  +  + PW TG+SGQLQKAFVT
Sbjct  295  NKQSKGSKHVWLYVVIAVASFLGLLIIVAV-IFLCRKRAVKSIGPWKTGLSGQLQKAFVT  353

Query  247  GLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQ  68
            G+PKL R+ELETACEDFSN+I +   YT+ KGTLSSGVEIAV   A+  +K+W+R  E  
Sbjct  354  GVPKLNRAELETACEDFSNIIETFDGYTVYKGTLSSGVEIAVASTAVCESKEWTRAMEMA  413

Query  67   FRHKV  53
            +R K+
Sbjct  414  YRRKI  418



>gb|KHN06403.1| Putative LRR receptor-like serine/threonine-protein kinase MRH1 
[Glycine soja]
Length=626

 Score =   121 bits (304),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 81/114 (71%), Gaps = 3/114 (3%)
 Frame = -3

Query  394  ILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELE  215
            I+I+A V   +VL+IV  I +   ++    V+KPW TGISGQLQKAF+TG+PKL + ELE
Sbjct  272  IIIIAGV---AVLVIVFVIMLCIWRKRAAKVIKPWKTGISGQLQKAFITGVPKLNQGELE  328

Query  214  TACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            TACEDFSN+I S    T+ KGTLSSGVEIAV    + SA DWS++ E  +R K+
Sbjct  329  TACEDFSNIINSFDECTIYKGTLSSGVEIAVDSTIVTSAHDWSKNMETAYRKKI  382



>ref|XP_002534282.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF28099.1| receptor protein kinase, putative [Ricinus communis]
Length=678

 Score =   121 bits (304),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 87/128 (68%), Gaps = 4/128 (3%)
 Frame = -3

Query  436  TPRNEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKA  257
            TP NE ++S      LI+  V     L+I+S   ++ C++  +  + PW TG+SGQLQKA
Sbjct  309  TPTNE-QSSHTWIYFLIIPIVFA---LVIISLGLVLICRKRGVTTIGPWKTGLSGQLQKA  364

Query  256  FVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQ  77
            FVTG+PKL R+ELETACEDFSN+I +    T+ KGTLSSGVEIAV    + S+KDWS++ 
Sbjct  365  FVTGVPKLNRTELETACEDFSNIIDTHEGCTMYKGTLSSGVEIAVASTLVASSKDWSKNA  424

Query  76   EAQFRHKV  53
            E  +R K+
Sbjct  425  ELSYRKKI  432



>ref|XP_008443337.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 [Cucumis melo]
Length=716

 Score =   122 bits (305),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 87/130 (67%), Gaps = 4/130 (3%)
 Frame = -3

Query  439  ATPRNEIKNSKKHHKILIMAAVLGG-SVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQ  263
             T +N+  +S+   K +I   ++GG S+ +I++ I    C+   +  + PW TG+SGQLQ
Sbjct  343  TTQQNQTDDSRNFWKYVI---IIGGVSLSVILATIIFCMCRSRGVTTIGPWKTGLSGQLQ  399

Query  262  KAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSR  83
            KAF+TG PKL R ELE ACEDFSN+I +    T+ KGTLSSGVEIAV  +++ S+KDWS+
Sbjct  400  KAFITGAPKLNRPELEVACEDFSNIIDTFDCCTIYKGTLSSGVEIAVASVSVTSSKDWSK  459

Query  82   DQEAQFRHKV  53
              E  +R K+
Sbjct  460  SSEQTYRKKI  469



>ref|XP_007159453.1| hypothetical protein PHAVU_002G238900g [Phaseolus vulgaris]
 gb|ESW31447.1| hypothetical protein PHAVU_002G238900g [Phaseolus vulgaris]
Length=697

 Score =   121 bits (304),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 82/114 (72%), Gaps = 3/114 (3%)
 Frame = -3

Query  394  ILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELE  215
            I+I+A V   S L+I+  I +   ++    V+KPW TGISGQLQKAF+TG+PKL ++ELE
Sbjct  342  IIIIAGV---SFLVIIVLIMLCIWRKRAAKVIKPWKTGISGQLQKAFITGVPKLNQAELE  398

Query  214  TACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            TACEDFSN+I S    T+ KGTLSSGVEIAV    + SA+DWS++ E  +R K+
Sbjct  399  TACEDFSNIINSFDECTIYKGTLSSGVEIAVDSTIVSSARDWSKNMETAYRKKI  452



>ref|XP_004293957.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45840-like [Fragaria vesca subsp. vesca]
Length=702

 Score =   121 bits (304),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 85/131 (65%), Gaps = 2/131 (2%)
 Frame = -3

Query  439  ATPRNEIKNSKKHHKILIMAAVLGGSV--LLIVSAIGIVFCQRNKMAVVKPWATGISGQL  266
            ++  N+ ++S K    +    V G SV  LLIV  +    C+   +  +KPW TGISGQL
Sbjct  329  SSQNNQQQDSPKSSSNMWKYIVTGISVAVLLIVLVMMFFMCRSQAVKTIKPWKTGISGQL  388

Query  265  QKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWS  86
            QKAF+TG+PKL RSELETACEDFSN+I +     + KGTLSSGVEIAV    + S KDWS
Sbjct  389  QKAFITGVPKLNRSELETACEDFSNIISTIDGCIVYKGTLSSGVEIAVASTTLTSLKDWS  448

Query  85   RDQEAQFRHKV  53
            ++ E  +R K+
Sbjct  449  KNAEKAYRKKI  459



>ref|XP_010057112.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 isoform X3 [Eucalyptus grandis]
Length=715

 Score =   121 bits (304),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 89/129 (69%), Gaps = 4/129 (3%)
 Frame = -3

Query  439  ATPRNEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQK  260
            ++PR  +    + + I+I+ +V   +VLLI+     +FC++  +A + PW TG+SGQLQK
Sbjct  346  SSPRG-LSEEARRYIIIIVPSV---AVLLIIVISMFIFCRKRGVATIGPWKTGLSGQLQK  401

Query  259  AFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRD  80
            AF+TG+PKL RSELE ACEDFSN++ +++  T+ KGTLSSGVEIAV      S+KDWS  
Sbjct  402  AFITGVPKLNRSELEAACEDFSNIVSTNNGCTVYKGTLSSGVEIAVTEPTAISSKDWSAS  461

Query  79   QEAQFRHKV  53
             E  +R K+
Sbjct  462  VEKAYRKKI  470



>ref|XP_010057111.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 isoform X2 [Eucalyptus grandis]
 gb|KCW74120.1| hypothetical protein EUGRSUZ_E02755 [Eucalyptus grandis]
Length=718

 Score =   121 bits (304),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 89/129 (69%), Gaps = 4/129 (3%)
 Frame = -3

Query  439  ATPRNEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQK  260
            ++PR  +    + + I+I+ +V   +VLLI+     +FC++  +A + PW TG+SGQLQK
Sbjct  349  SSPRG-LSEEARRYIIIIVPSV---AVLLIIVISMFIFCRKRGVATIGPWKTGLSGQLQK  404

Query  259  AFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRD  80
            AF+TG+PKL RSELE ACEDFSN++ +++  T+ KGTLSSGVEIAV      S+KDWS  
Sbjct  405  AFITGVPKLNRSELEAACEDFSNIVSTNNGCTVYKGTLSSGVEIAVTEPTAISSKDWSAS  464

Query  79   QEAQFRHKV  53
             E  +R K+
Sbjct  465  VEKAYRKKI  473



>ref|XP_010057110.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 isoform X1 [Eucalyptus grandis]
 gb|KCW74119.1| hypothetical protein EUGRSUZ_E02755 [Eucalyptus grandis]
Length=720

 Score =   121 bits (303),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 89/129 (69%), Gaps = 4/129 (3%)
 Frame = -3

Query  439  ATPRNEIKNSKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQK  260
            ++PR  +    + + I+I+ +V   +VLLI+     +FC++  +A + PW TG+SGQLQK
Sbjct  351  SSPRG-LSEEARRYIIIIVPSV---AVLLIIVISMFIFCRKRGVATIGPWKTGLSGQLQK  406

Query  259  AFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRD  80
            AF+TG+PKL RSELE ACEDFSN++ +++  T+ KGTLSSGVEIAV      S+KDWS  
Sbjct  407  AFITGVPKLNRSELEAACEDFSNIVSTNNGCTVYKGTLSSGVEIAVTEPTAISSKDWSAS  466

Query  79   QEAQFRHKV  53
             E  +R K+
Sbjct  467  VEKAYRKKI  475



>ref|XP_010316819.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 [Solanum lycopersicum]
Length=718

 Score =   121 bits (303),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 74/105 (70%), Gaps = 0/105 (0%)
 Frame = -3

Query  367  GSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNV  188
            G+ L+ +    I+ C+      ++PW TG+SGQLQKAF+TG+PKL R+ELE ACEDFSN+
Sbjct  371  GAFLVAIFVFLILICKSKAAQTIRPWKTGLSGQLQKAFITGVPKLNRTELENACEDFSNI  430

Query  187  IGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +     +T+ KGTLSSGVEIAV+  AI S KDWS+  E  FR K+
Sbjct  431  VCHQDTFTVYKGTLSSGVEIAVVSTAINSLKDWSKRSELAFRKKI  475



>ref|NP_001136868.1| uncharacterized LOC100217021 precursor [Zea mays]
 ref|XP_008647458.1| PREDICTED: uncharacterized LOC100217021 isoform X1 [Zea mays]
 ref|XP_008647459.1| PREDICTED: uncharacterized LOC100217021 isoform X1 [Zea mays]
 gb|ACF82791.1| unknown [Zea mays]
 gb|ACL53928.1| unknown [Zea mays]
 gb|ACN28692.1| unknown [Zea mays]
 gb|AFW79132.1| putative leucine-rich repeat transmembrane protein kinase family 
protein isoform 1 [Zea mays]
 gb|AFW79133.1| putative leucine-rich repeat transmembrane protein kinase family 
protein isoform 2 [Zea mays]
 gb|AFW79134.1| putative leucine-rich repeat transmembrane protein kinase family 
protein isoform 3 [Zea mays]
 gb|AFW79135.1| putative leucine-rich repeat transmembrane protein kinase family 
protein isoform 4 [Zea mays]
Length=473

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = -3

Query  325  CQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTL  146
            C+++ +A + PW TG+SGQLQKAFVTG+PKL+RSELE ACEDFSN++ S   YT+ KGTL
Sbjct  134  CRKSAVATIGPWKTGLSGQLQKAFVTGVPKLQRSELERACEDFSNIVVSYPHYTVYKGTL  193

Query  145  SSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            S+GVEIAV+   I S+K+W+   E+ FR KV
Sbjct  194  STGVEIAVVSTMITSSKEWTEHSESCFRRKV  224



>ref|XP_010999746.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 [Populus euphratica]
 ref|XP_010999747.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 [Populus euphratica]
Length=712

 Score =   121 bits (303),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 77/103 (75%), Gaps = 1/103 (1%)
 Frame = -3

Query  358  LLIVSAIGIVF-CQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIG  182
            +LI+   G++F C++  +  + PW TG+SGQLQKAFVTG+PKL RSELETACEDFSN+I 
Sbjct  367  VLIIFVAGLLFRCRKQGVTTIGPWKTGLSGQLQKAFVTGVPKLNRSELETACEDFSNIID  426

Query  181  SSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +   +T  KGTLSSGVEI+V    + S+KDWS++ E  +R K+
Sbjct  427  TFDGFTAYKGTLSSGVEISVASTTVASSKDWSKNAEMAYRKKI  469



>ref|XP_009101562.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45840 isoform X2 [Brassica rapa]
Length=669

 Score =   120 bits (302),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 88/132 (67%), Gaps = 2/132 (2%)
 Frame = -3

Query  442  TATPRNEIKNSKKHHKILIMAAVLG-GSVLLIVSAIGIVF-CQRNKMAVVKPWATGISGQ  269
            ++ P  + +   K    + +  V+G  + + ++  IG++F C++  +  + PW TG+SGQ
Sbjct  294  SSDPPRQFEEETKGSTAVWLYVVIGVAAFVAVLIVIGVIFFCRKRAVKSIGPWKTGLSGQ  353

Query  268  LQKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDW  89
            LQKAFVTG+PKL RSELETACEDFSN+I +   YT+ KGTLSSGVEIAV   A+   ++W
Sbjct  354  LQKAFVTGVPKLNRSELETACEDFSNIIEAFDGYTVYKGTLSSGVEIAVASTAVLETREW  413

Query  88   SRDQEAQFRHKV  53
            +R  E  +R K+
Sbjct  414  TRAMEMTYRRKI  425



>ref|XP_009786947.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 [Nicotiana sylvestris]
Length=722

 Score =   120 bits (302),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 73/104 (70%), Gaps = 1/104 (1%)
 Frame = -3

Query  361  VLLIVSAIGIVFCQRNKMA-VVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVI  185
            V L+V+A  +    R++ A  + PW TG+SGQLQKAFVTG+PKL RSELETACEDFSN+I
Sbjct  375  VFLLVAAAFVFLVWRSRAARTIGPWKTGLSGQLQKAFVTGVPKLNRSELETACEDFSNII  434

Query  184  GSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
             S   Y + KGTLSSGVEIAV    + S KDWS   E  FR K+
Sbjct  435  SSHDAYIIYKGTLSSGVEIAVASTTLTSLKDWSESSEMAFRKKI  478



>emb|CDY58052.1| BnaA06g40210D [Brassica napus]
Length=682

 Score =   120 bits (302),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 88/132 (67%), Gaps = 2/132 (2%)
 Frame = -3

Query  442  TATPRNEIKNSKKHHKILIMAAVLG-GSVLLIVSAIGIVF-CQRNKMAVVKPWATGISGQ  269
            ++ P  + +   K    + +  V+G  + + ++  IG++F C++  +  + PW TG+SGQ
Sbjct  319  SSDPPRQFEEETKGSTAVWLYVVIGVAAFVAVLIVIGVIFFCRKRAVKSIGPWKTGLSGQ  378

Query  268  LQKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDW  89
            LQKAFVTG+PKL RSELETACEDFSN+I +   YT+ KGTLSSGVEIAV   A+   ++W
Sbjct  379  LQKAFVTGVPKLNRSELETACEDFSNIIEAFDGYTVYKGTLSSGVEIAVASTAVLETREW  438

Query  88   SRDQEAQFRHKV  53
            +R  E  +R K+
Sbjct  439  TRAMEMTYRRKI  450



>emb|CDY61466.1| BnaCnng37840D [Brassica napus]
Length=683

 Score =   120 bits (302),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 88/132 (67%), Gaps = 2/132 (2%)
 Frame = -3

Query  442  TATPRNEIKNSKKHHKILIMAAVLG-GSVLLIVSAIGIVF-CQRNKMAVVKPWATGISGQ  269
            ++ P  + +   K    + +  V+G  + + ++  IG++F C++  +  + PW TG+SGQ
Sbjct  319  SSDPPRQFEEETKGSTAVWLYVVIGVAAFVAVLIVIGVIFFCRKRAVKSIGPWKTGLSGQ  378

Query  268  LQKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDW  89
            LQKAFVTG+PKL RSELETACEDFSN+I +   YT+ KGTLSSGVEIAV   A+   ++W
Sbjct  379  LQKAFVTGVPKLNRSELETACEDFSNIIEAFDGYTVYKGTLSSGVEIAVASTAVLETREW  438

Query  88   SRDQEAQFRHKV  53
            +R  E  +R K+
Sbjct  439  TRAMEMTYRRKI  450



>ref|XP_009101558.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45840 isoform X1 [Brassica rapa]
 ref|XP_009101560.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45840 isoform X1 [Brassica rapa]
 ref|XP_009101561.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45840 isoform X1 [Brassica rapa]
Length=694

 Score =   120 bits (302),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 88/132 (67%), Gaps = 2/132 (2%)
 Frame = -3

Query  442  TATPRNEIKNSKKHHKILIMAAVLG-GSVLLIVSAIGIVF-CQRNKMAVVKPWATGISGQ  269
            ++ P  + +   K    + +  V+G  + + ++  IG++F C++  +  + PW TG+SGQ
Sbjct  319  SSDPPRQFEEETKGSTAVWLYVVIGVAAFVAVLIVIGVIFFCRKRAVKSIGPWKTGLSGQ  378

Query  268  LQKAFVTGLPKLRRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDW  89
            LQKAFVTG+PKL RSELETACEDFSN+I +   YT+ KGTLSSGVEIAV   A+   ++W
Sbjct  379  LQKAFVTGVPKLNRSELETACEDFSNIIEAFDGYTVYKGTLSSGVEIAVASTAVLETREW  438

Query  88   SRDQEAQFRHKV  53
            +R  E  +R K+
Sbjct  439  TRAMEMTYRRKI  450



>ref|XP_011039429.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 isoform X2 [Populus euphratica]
Length=682

 Score =   120 bits (301),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 81/114 (71%), Gaps = 5/114 (4%)
 Frame = -3

Query  394  ILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELE  215
            I+ +A VLG     IV+   ++ C++  +  + PW TG+SGQLQKAFVTG+PKL RSELE
Sbjct  331  IIPIAGVLG-----IVAVGLLLMCRKQVVTTIGPWKTGLSGQLQKAFVTGVPKLNRSELE  385

Query  214  TACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            +ACEDFSN+I +   +T  KGTLSSGVEI+V   A+ S+KDWS+  E  +R K+
Sbjct  386  SACEDFSNIIDTFDGFTAYKGTLSSGVEISVASTAVTSSKDWSKSAEMAYRKKI  439



>ref|XP_010535361.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45840 [Tarenaya hassleriana]
Length=591

 Score =   119 bits (299),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 83/120 (69%), Gaps = 1/120 (1%)
 Frame = -3

Query  412  SKKHHKILIMAAVLGGSVLLIVSAIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKL  233
            SK  +K+ I   VL G +  I  A+ ++   RN    +KPWATGISGQLQ + +T +PKL
Sbjct  241  SKPANKLYITVGVLVG-LFSISVAVIVLLLFRNHKVSIKPWATGISGQLQASLITAVPKL  299

Query  232  RRSELETACEDFSNVIGSSSVYTLCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            + SEL+ ACEDFSN+IGS S  T+ KGTLSSG EI+V+ LA+ S +DWS + E QF+ K+
Sbjct  300  KLSELQAACEDFSNIIGSFSDGTIYKGTLSSGAEISVVSLAVGSREDWSSNLETQFKEKI  359



>ref|XP_008789371.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1 [Phoenix dactylifera]
Length=721

 Score =   120 bits (301),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = -3

Query  343  AIGIVFCQRNKMAVVKPWATGISGQLQKAFVTGLPKLRRSELETACEDFSNVIGSSSVYT  164
            A  I  C+   +A + PW TG+SGQLQKAFVTG+PKL R+ELE ACEDFSN++ S   YT
Sbjct  381  ACMIFVCRHKGVATIGPWRTGLSGQLQKAFVTGVPKLNRAELEAACEDFSNIVISYPDYT  440

Query  163  LCKGTLSSGVEIAVLWLAIESAKDWSRDQEAQFRHKV  53
            + KGTLSSGVEIAV   A+ SAK+WS+  E  FR K+
Sbjct  441  VFKGTLSSGVEIAVASTAVPSAKEWSKRSEMHFRKKI  477



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2737025756952