BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18980_g2_i1 len=2645 path=[2712:0-1359 4072:1360-2619
5331:2620-2644]

Length=2645
                                                                      Score     E

ref|XP_009765003.1|  PREDICTED: ABC transporter G family member 2...   1061   0.0      
ref|XP_009597344.1|  PREDICTED: ABC transporter G family member 2...   1049   0.0      
ref|XP_006345684.1|  PREDICTED: ABC transporter G family member 2...   1031   0.0      
ref|XP_004246729.1|  PREDICTED: ABC transporter G family member 20     1026   0.0      
ref|XP_011094785.1|  PREDICTED: ABC transporter G family member 2...    991   0.0      
ref|XP_002277271.1|  PREDICTED: ABC transporter G family member 20      942   0.0      Vitis vinifera
ref|XP_007027149.1|  ABC-2 type transporter family protein              940   0.0      
gb|KDP46092.1|  hypothetical protein JCGZ_06603                         912   0.0      
ref|XP_002525222.1|  ATP-binding cassette transporter, putative         906   0.0      Ricinus communis
ref|XP_007208058.1|  hypothetical protein PRUPE_ppa002035mg             905   0.0      
ref|XP_009341777.1|  PREDICTED: ABC transporter G family member 2...    904   0.0      
ref|XP_011023380.1|  PREDICTED: ABC transporter G family member 2...    903   0.0      
ref|XP_010528237.1|  PREDICTED: ABC transporter G family member 2...    902   0.0      
ref|XP_002301347.2|  ABC transporter family protein                     902   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008369824.1|  PREDICTED: ABC transporter G family member 2...    900   0.0      
ref|XP_007142686.1|  hypothetical protein PHAVU_007G008200g             899   0.0      
ref|XP_008350411.1|  PREDICTED: ABC transporter G family member 2...    897   0.0      
ref|XP_009340895.1|  PREDICTED: ABC transporter G family member 2...    895   0.0      
gb|EYU41661.1|  hypothetical protein MIMGU_mgv1a002205mg                894   0.0      
ref|XP_003625526.1|  ABC transporter G family member                    893   0.0      
ref|XP_002320112.2|  ABC transporter family protein                     891   0.0      Populus trichocarpa [western balsam poplar]
gb|AIU41650.1|  ABC transporter family protein                          890   0.0      
ref|XP_007009605.1|  ABC-2 type transporter family protein              890   0.0      
ref|XP_011015324.1|  PREDICTED: ABC transporter G family member 2...    889   0.0      
ref|XP_010047167.1|  PREDICTED: ABC transporter G family member 2...    889   0.0      
ref|XP_007219556.1|  hypothetical protein PRUPE_ppa001878mg             888   0.0      
ref|XP_011035805.1|  PREDICTED: ABC transporter G family member 2...    887   0.0      
ref|XP_004239760.1|  PREDICTED: ABC transporter G family member 6       887   0.0      
emb|CDP00016.1|  unnamed protein product                                885   0.0      
gb|KDP29036.1|  hypothetical protein JCGZ_16425                         885   0.0      
ref|XP_010101507.1|  ABC transporter G family member 16                 885   0.0      
ref|XP_006345915.1|  PREDICTED: ABC transporter G family member 1...    884   0.0      
ref|XP_008233528.1|  PREDICTED: ABC transporter G family member 6...    883   0.0      
ref|XP_009344892.1|  PREDICTED: ABC transporter G family member 6...    882   0.0      
ref|XP_006428975.1|  hypothetical protein CICLE_v10011147mg             882   0.0      
ref|XP_004149819.1|  PREDICTED: ABC transporter G family member 1...    882   0.0      
ref|XP_003556547.1|  PREDICTED: ABC transporter G family member 1...    882   0.0      
ref|XP_003520635.1|  PREDICTED: ABC transporter G family member 2...    882   0.0      
ref|XP_010086759.1|  ABC transporter G family member 2                  882   0.0      
ref|XP_002525084.1|  ATP-binding cassette transporter, putative         882   0.0      Ricinus communis
ref|XP_010259980.1|  PREDICTED: ABC transporter G family member 6...    880   0.0      
ref|XP_008463532.1|  PREDICTED: ABC transporter G family member 6       879   0.0      
ref|XP_006480710.1|  PREDICTED: ABC transporter G family member 2...    879   0.0      
gb|KFK34602.1|  hypothetical protein AALP_AA5G167000                    878   0.0      
ref|XP_010517003.1|  PREDICTED: ABC transporter G family member 2       877   0.0      
ref|XP_006436144.1|  hypothetical protein CICLE_v10030782mg             877   0.0      
ref|XP_003553533.1|  PREDICTED: ABC transporter G family member 2...    877   0.0      
ref|XP_009626224.1|  PREDICTED: ABC transporter G family member 6       877   0.0      
ref|XP_011027346.1|  PREDICTED: ABC transporter G family member 6...    876   0.0      
ref|XP_006403679.1|  hypothetical protein EUTSA_v10010147mg             875   0.0      
ref|XP_010509348.1|  PREDICTED: ABC transporter G family member 2...    874   0.0      
ref|XP_007162694.1|  hypothetical protein PHAVU_001G172400g             874   0.0      
ref|XP_010505317.1|  PREDICTED: ABC transporter G family member 2...    874   0.0      
ref|XP_008354104.1|  PREDICTED: ABC transporter G family member 6...    873   0.0      
ref|XP_009796484.1|  PREDICTED: ABC transporter G family member 1...    872   0.0      
ref|XP_009357635.1|  PREDICTED: ABC transporter G family member 6...    872   0.0      
ref|XP_008370127.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    871   0.0      
gb|KCW88884.1|  hypothetical protein EUGRSUZ_A01212                     871   0.0      
ref|XP_006295587.1|  hypothetical protein CARUB_v10024695mg             871   0.0      
ref|XP_009335931.1|  PREDICTED: ABC transporter G family member 6...    870   0.0      
ref|XP_006290640.1|  hypothetical protein CARUB_v10016733mg             870   0.0      
ref|XP_004308829.1|  PREDICTED: ABC transporter G family member 6...    869   0.0      
ref|XP_010669774.1|  PREDICTED: ABC transporter G family member 6...    868   0.0      
ref|XP_011101624.1|  PREDICTED: ABC transporter G family member 1...    867   0.0      
ref|XP_010067225.1|  PREDICTED: ABC transporter G family member 6...    867   0.0      
ref|XP_006410918.1|  hypothetical protein EUTSA_v10016295mg             867   0.0      
ref|XP_010427003.1|  PREDICTED: ABC transporter G family member 20      864   0.0      
ref|XP_010504115.1|  PREDICTED: ABC transporter G family member 2...    864   0.0      
ref|XP_004302811.1|  PREDICTED: ABC transporter G family member 2...    864   0.0      
ref|XP_008442601.1|  PREDICTED: ABC transporter G family member 20      862   0.0      
gb|KFK36622.1|  hypothetical protein AALP_AA4G147700                    861   0.0      
ref|XP_003633443.1|  PREDICTED: ABC transporter G family member 6...    861   0.0      
ref|XP_008241789.1|  PREDICTED: ABC transporter G family member 20      860   0.0      
ref|XP_004493913.1|  PREDICTED: ABC transporter G family member 2...    860   0.0      
ref|XP_002877923.1|  abc transporter family protein                     859   0.0      
emb|CDY18451.1|  BnaA04g21360D                                          859   0.0      
ref|XP_003592758.1|  ABC transporter G family member                    860   0.0      
ref|XP_002315262.1|  ABC transporter family protein                     857   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009141649.1|  PREDICTED: ABC transporter G family member 2       858   0.0      
ref|XP_008364101.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    858   0.0      
ref|NP_190919.1|  ABC transporter G family member 20                    857   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010515843.1|  PREDICTED: ABC transporter G family member 2...    857   0.0      
ref|XP_006361395.1|  PREDICTED: ABC transporter G family member 6...    856   0.0      
ref|XP_010529750.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    856   0.0      
ref|XP_010558773.1|  PREDICTED: ABC transporter G family member 6       855   0.0      
ref|XP_009597347.1|  PREDICTED: ABC transporter G family member 6...    853   0.0      
gb|AAR06252.1|  stigma/style ABC transporter                            853   0.0      Nicotiana tabacum [American tobacco]
emb|CDX93388.1|  BnaC04g45080D                                          853   0.0      
ref|XP_009767486.1|  PREDICTED: ABC transporter G family member 6...    852   0.0      
ref|XP_010253396.1|  PREDICTED: ABC transporter G family member 6...    853   0.0      
ref|XP_004168142.1|  PREDICTED: ABC transporter G family member 2...    849   0.0      
ref|XP_004236771.1|  PREDICTED: ABC transporter G family member 6...    848   0.0      
ref|XP_011019268.1|  PREDICTED: ABC transporter G family member 20      846   0.0      
ref|XP_004137951.1|  PREDICTED: ABC transporter G family member 2...    846   0.0      
ref|NP_181272.1|  ABC transporter G family member 2                     847   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_011019683.1|  PREDICTED: ABC transporter G family member 6...    845   0.0      
ref|XP_010534453.1|  PREDICTED: ABC transporter G family member 1...    843   0.0      
gb|EYU33174.1|  hypothetical protein MIMGU_mgv1a026904mg                843   0.0      
ref|XP_010068855.1|  PREDICTED: ABC transporter G family member 6...    842   0.0      
ref|XP_002308489.2|  ABC transporter family protein                     840   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009787941.1|  PREDICTED: ABC transporter G family member 2...    835   0.0      
ref|NP_181467.1|  ABC transporter G family member 1                     837   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010920754.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    835   0.0      
ref|XP_006361394.1|  PREDICTED: ABC transporter G family member 1...    833   0.0      
ref|XP_004497331.1|  PREDICTED: ABC transporter G family member 1...    833   0.0      
ref|XP_006843658.1|  hypothetical protein AMTR_s00007p00181450          832   0.0      
ref|XP_006295608.1|  hypothetical protein CARUB_v10024720mg             832   0.0      
ref|XP_010517272.1|  PREDICTED: ABC transporter G family member 1...    830   0.0      
ref|XP_006411161.1|  hypothetical protein EUTSA_v10016300mg             830   0.0      
ref|XP_010509030.1|  PREDICTED: ABC transporter G family member 1       828   0.0      
ref|XP_010505600.1|  PREDICTED: ABC transporter G family member 1...    825   0.0      
ref|XP_010427257.1|  PREDICTED: ABC transporter G family member 1...    824   0.0      
emb|CAB82704.1|  ABC transporter-like protein                           823   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881649.1|  abc transporter family protein                     824   0.0      
gb|EYU33173.1|  hypothetical protein MIMGU_mgv1a018654mg                823   0.0      
ref|XP_004236770.1|  PREDICTED: ABC transporter G family member 6...    822   0.0      
ref|XP_009143325.1|  PREDICTED: ABC transporter G family member 1       823   0.0      
ref|NP_191069.2|  ABC transporter G family member 16                    823   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008810525.1|  PREDICTED: ABC transporter G family member 6...    823   0.0      
ref|XP_002878016.1|  abc transporter family protein                     822   0.0      
ref|XP_011091494.1|  PREDICTED: ABC transporter G family member 1       821   0.0      
ref|XP_010910345.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    818   0.0      
ref|XP_006292248.1|  hypothetical protein CARUB_v10018456mg             820   0.0      
ref|XP_010684173.1|  PREDICTED: ABC transporter G family member 20      820   0.0      
ref|XP_006403493.1|  hypothetical protein EUTSA_v10010146mg             820   0.0      
ref|XP_008811960.1|  PREDICTED: ABC transporter G family member 2...    818   0.0      
ref|XP_010937796.1|  PREDICTED: ABC transporter G family member 6...    819   0.0      
ref|XP_010516065.1|  PREDICTED: ABC transporter G family member 16      819   0.0      
ref|XP_002881504.1|  abc transporter family protein                     818   0.0      
ref|XP_010504353.1|  PREDICTED: ABC transporter G family member 1...    818   0.0      
ref|XP_008777932.1|  PREDICTED: ABC transporter G family member 6       811   0.0      
ref|XP_008793934.1|  PREDICTED: ABC transporter G family member 2...    809   0.0      
ref|XP_009121752.1|  PREDICTED: ABC transporter G family member 6       810   0.0      
ref|XP_006399852.1|  hypothetical protein EUTSA_v10012786mg             809   0.0      
ref|XP_010419943.1|  PREDICTED: ABC transporter G family member 6...    808   0.0      
gb|KFK36827.1|  hypothetical protein AALP_AA4G176600                    808   0.0      
gb|KFK25590.1|  hypothetical protein AALP_AA8G134300                    806   0.0      
ref|XP_006287124.1|  hypothetical protein CARUB_v10000296mg             807   0.0      
emb|CDY09810.1|  BnaC09g43510D                                          807   0.0      
ref|XP_010453438.1|  PREDICTED: ABC transporter G family member 6...    806   0.0      
gb|KCW65320.1|  hypothetical protein EUGRSUZ_G02773                     803   0.0      
ref|XP_009139200.1|  PREDICTED: ABC transporter G family member 16      803   0.0      
ref|XP_002871574.1|  abc transporter family protein                     802   0.0      
emb|CDX69629.1|  BnaA10g19780D                                          802   0.0      
ref|NP_196862.1|  ABC transporter G family member 6                     800   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010492119.1|  PREDICTED: ABC transporter G family member 6       800   0.0      
emb|CDX73549.1|  BnaC08g24540D                                          799   0.0      
ref|XP_009412596.1|  PREDICTED: ABC transporter G family member 6...    799   0.0      
gb|KFK36825.1|  hypothetical protein AALP_AA4G176400                    792   0.0      
ref|XP_009144100.1|  PREDICTED: ABC transporter G family member 1...    793   0.0      
ref|XP_009406965.1|  PREDICTED: ABC transporter G family member 6...    790   0.0      
ref|XP_003558198.1|  PREDICTED: ABC transporter G family member 1...    784   0.0      
gb|KFK36826.1|  hypothetical protein AALP_AA4G176500                    779   0.0      
ref|XP_004984786.1|  PREDICTED: ABC transporter G family member 1...    783   0.0      
emb|CDY02906.1|  BnaC04g25800D                                          798   0.0      
emb|CDX74853.1|  BnaA05g05990D                                          774   0.0      
ref|XP_006480523.1|  PREDICTED: ABC transporter G family member 2...    776   0.0      
ref|XP_006428968.1|  hypothetical protein CICLE_v10011234mg             775   0.0      
emb|CDX76122.1|  BnaA04g03860D                                          797   0.0      
ref|XP_002468066.1|  hypothetical protein SORBIDRAFT_01g038970          779   0.0      Sorghum bicolor [broomcorn]
gb|ACN28499.1|  unknown                                                 777   0.0      Zea mays [maize]
gb|AEP23076.1|  ATP-binding cassette protein subfamily G member 5       778   0.0      
gb|EMS46278.1|  ABC transporter G family member 16                      777   0.0      
ref|NP_001151504.1|  ATPase, coupled to transmembrane movement of...    777   0.0      Zea mays [maize]
tpg|DAA44748.1|  TPA: ATPase, coupled to transmembrane movement o...    778   0.0      
emb|CBI32651.3|  unnamed protein product                                768   0.0      
ref|XP_010534454.1|  PREDICTED: ABC transporter G family member 1...    772   0.0      
ref|XP_009402343.1|  PREDICTED: ABC transporter G family member 6...    773   0.0      
gb|KFK36824.1|  hypothetical protein AALP_AA4G176300                    769   0.0      
gb|EPS67070.1|  abc transporter family protein                          769   0.0      
gb|EYU19905.1|  hypothetical protein MIMGU_mgv1a026629mg                761   0.0      
emb|CBI25312.3|  unnamed protein product                                761   0.0      
ref|XP_007027151.1|  ABC transporter G family member 2                  761   0.0      
ref|XP_007027150.1|  ABC transporter G family member 2                  753   0.0      
ref|XP_002312057.2|  hypothetical protein POPTR_0008s04780g             751   0.0      Populus trichocarpa [western balsam poplar]
dbj|BAF00471.1|  ABC transporter - like protein                         749   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_191071.1|  ABC transporter G family member 18                    749   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002878018.1|  abc transporter family protein                     749   0.0      
ref|XP_010504355.1|  PREDICTED: ABC transporter G family member 1...    745   0.0      
ref|XP_010427259.1|  PREDICTED: ABC transporter G family member 18      742   0.0      
ref|XP_003564558.1|  PREDICTED: ABC transporter G family member 6...    742   0.0      
ref|XP_006428973.1|  hypothetical protein CICLE_v10013485mg             738   0.0      
gb|KHN02392.1|  ABC transporter G family member 2                       732   0.0      
dbj|BAJ97356.1|  predicted protein                                      739   0.0      
ref|XP_006290668.1|  hypothetical protein CARUB_v10016759mg             737   0.0      
ref|XP_004970499.1|  PREDICTED: ABC transporter G family member 1...    738   0.0      
ref|NP_001049746.1|  Os03g0281900                                       738   0.0      Oryza sativa Japonica Group [Japonica rice]
sp|B8ALI0.1|AB5G_ORYSI  RecName: Full=ABC transporter G family me...    737   0.0      Oryza sativa Indica Group [Indian rice]
emb|CDM84867.1|  unnamed protein product                                733   0.0      
ref|XP_010068854.1|  PREDICTED: ABC transporter G family member 6...    728   0.0      
ref|XP_008657087.1|  PREDICTED: ABC transporter G family member 1...    730   0.0      
emb|CDX67624.1|  BnaA07g16640D                                          726   0.0      
ref|XP_008674853.1|  PREDICTED: ABC transporter G family member 16      728   0.0      
ref|XP_002456598.1|  hypothetical protein SORBIDRAFT_03g039110          725   0.0      Sorghum bicolor [broomcorn]
ref|XP_009103951.1|  PREDICTED: ABC transporter G family member 1...    722   0.0      
ref|XP_006403491.1|  hypothetical protein EUTSA_v10010159mg             720   0.0      
ref|XP_007027152.1|  ABC transporter G family member 2                  715   0.0      
ref|XP_003561756.1|  PREDICTED: ABC transporter G family member 6...    718   0.0      
ref|NP_191070.1|  ABC transporter G family member 17                    711   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004960315.1|  PREDICTED: ABC transporter G family member 1...    712   0.0      
emb|CDX73404.1|  BnaC08g25990D                                          715   0.0      
gb|EAY76412.1|  hypothetical protein OsI_04343                          713   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006292545.1|  hypothetical protein CARUB_v10018780mg             710   0.0      
ref|NP_191073.1|  ABC transporter G family member 19                    712   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_001044732.1|  Os01g0836600                                       713   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006292173.1|  hypothetical protein CARUB_v10018379mg             711   0.0      
ref|XP_010504358.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    709   0.0      
ref|XP_009116211.1|  PREDICTED: ABC transporter G family member 1...    707   0.0      
emb|CDY40201.1|  BnaA09g34830D                                          707   0.0      
ref|XP_010427258.1|  PREDICTED: ABC transporter G family member 17      704   0.0      
gb|ABB97036.1|  ABC transporter-like protein                            706   0.0      Brassica rapa
ref|XP_010504354.1|  PREDICTED: ABC transporter G family member 1...    704   0.0      
ref|XP_002878017.1|  abc transporter family protein                     704   0.0      
ref|XP_009139198.1|  PREDICTED: ABC transporter G family member 1...    705   0.0      
ref|XP_006649877.1|  PREDICTED: ABC transporter G family member 6...    707   0.0      
gb|EAY89510.1|  hypothetical protein OsI_11045                          707   0.0      Oryza sativa Indica Group [Indian rice]
gb|AAN64479.1|  putative ATP-binding-cassette transporter protein       707   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004960311.1|  PREDICTED: ABC transporter G family member 1...    704   0.0      
gb|KDO47516.1|  hypothetical protein CISIN_1g048028mg                   699   0.0      
ref|XP_006651261.1|  PREDICTED: ABC transporter G family member 1...    708   0.0      
ref|XP_002440493.1|  hypothetical protein SORBIDRAFT_09g001900          703   0.0      Sorghum bicolor [broomcorn]
ref|XP_010096686.1|  ABC transporter G family member 6                  702   0.0      
ref|XP_010516068.1|  PREDICTED: ABC transporter G family member 1...    701   0.0      
ref|XP_006403492.1|  hypothetical protein EUTSA_v10010176mg             699   0.0      
ref|XP_010427269.1|  PREDICTED: ABC transporter G family member 1...    701   0.0      
gb|KDO42779.1|  hypothetical protein CISIN_1g007474mg                   696   0.0      
ref|XP_010516066.1|  PREDICTED: ABC transporter G family member 1...    697   0.0      
ref|XP_004987055.1|  PREDICTED: ABC transporter G family member 1...    700   0.0      
ref|NP_001145981.1|  uncharacterized protein LOC100279509               697   0.0      Zea mays [maize]
ref|XP_008648601.1|  PREDICTED: ABC transporter G family member 16      697   0.0      
ref|XP_010503151.1|  PREDICTED: ABC transporter G family member 1...    697   0.0      
ref|XP_006403489.1|  hypothetical protein EUTSA_v10010975mg             697   0.0      
gb|EAY96335.1|  hypothetical protein OsI_18238                          695   0.0      Oryza sativa Indica Group [Indian rice]
gb|EEE62138.1|  hypothetical protein OsJ_16925                          694   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054490.2|  Os05g0120200                                       695   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010430990.1|  PREDICTED: ABC transporter G family member 1...    701   0.0      
dbj|BAA90508.1|  unnamed protein product                                692   0.0      Oryza sativa [red rice]
gb|EAY96333.1|  hypothetical protein OsI_18236                          689   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_002878020.1|  hypothetical protein ARALYDRAFT_906929             690   0.0      
ref|NP_001054488.2|  Os05g0120000                                       687   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CDY65003.1|  BnaAnng19960D                                          687   0.0      
ref|XP_002439184.1|  hypothetical protein SORBIDRAFT_09g001940          686   0.0      Sorghum bicolor [broomcorn]
ref|XP_009124228.1|  PREDICTED: ABC transporter G family member 1...    687   0.0      
ref|XP_006480709.1|  PREDICTED: ABC transporter G family member 2...    686   0.0      
ref|XP_009139199.1|  PREDICTED: ABC transporter G family member 17      683   0.0      
emb|CDY37656.1|  BnaC04g29980D                                          685   0.0      
ref|XP_006428974.1|  hypothetical protein CICLE_v10011167mg             686   0.0      
ref|XP_010516067.1|  PREDICTED: ABC transporter G family member 1...    686   0.0      
ref|XP_009403872.1|  PREDICTED: ABC transporter G family member 2...    685   0.0      
gb|KDO67830.1|  hypothetical protein CISIN_1g037973mg                   674   0.0      
ref|XP_006644973.1|  PREDICTED: ABC transporter G family member 1...    676   0.0      
ref|XP_009139197.1|  PREDICTED: ABC transporter G family member 19      678   0.0      
dbj|BAJ94806.1|  predicted protein                                      674   0.0      
ref|XP_003569021.1|  PREDICTED: ABC transporter G family member 1       674   0.0      
ref|XP_003561649.2|  PREDICTED: ABC transporter G family member 1...    673   0.0      
gb|EAZ26488.1|  hypothetical protein OsJ_10380                          670   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009403873.1|  PREDICTED: ABC transporter G family member 1...    669   0.0      
ref|XP_006292174.1|  hypothetical protein CARUB_v10018380mg             668   0.0      
dbj|BAA90507.1|  unnamed protein product                                663   0.0      Oryza sativa [red rice]
gb|KDO42780.1|  hypothetical protein CISIN_1g036088mg                   666   0.0      
emb|CDX76119.1|  BnaA04g03830D                                          657   0.0      
gb|KCW65322.1|  hypothetical protein EUGRSUZ_G027752                    644   0.0      
dbj|BAJ96842.1|  predicted protein                                      646   0.0      
ref|XP_010427270.1|  PREDICTED: ABC transporter G family member 1...    642   0.0      
emb|CDM80772.1|  unnamed protein product                                641   0.0      
ref|XP_002966047.1|  ATP-binding cassette transporter                   644   0.0      
ref|XP_002971450.1|  hypothetical protein SELMODRAFT_95523              644   0.0      
gb|AAR06253.1|  stigma/style ABC transporter                            630   0.0      Nicotiana tabacum [American tobacco]
emb|CDY02907.1|  BnaC04g25790D                                          624   0.0      
ref|XP_010095941.1|  ABC transporter G family member 16                 622   0.0      
ref|XP_010686386.1|  PREDICTED: ABC transporter G family member 2...    620   0.0      
gb|EPS65094.1|  hypothetical protein M569_09685                         608   0.0      
ref|XP_006478358.1|  PREDICTED: ABC transporter G family member 2...    593   0.0      
gb|EMS52133.1|  ABC transporter G family member 1                       573   0.0      
gb|EMT27092.1|  ABC transporter G family member 1                       563   0.0      
gb|EMT08074.1|  ABC transporter G family member 16                      561   0.0      
ref|XP_010096689.1|  ABC transporter G family member 16                 550   0.0      
gb|ACN28998.1|  unknown                                                 543   0.0      Zea mays [maize]
ref|XP_006654931.1|  PREDICTED: ABC transporter G family member 1...    540   2e-179   
ref|XP_001767039.1|  ATP-binding cassette transporter, subfamily ...    534   3e-175   
ref|XP_006379565.1|  hypothetical protein POPTR_0008s047701g            509   2e-169   
gb|AEP23077.1|  ATP-binding cassette protein subfamily G member 6       506   4e-164   
emb|CDP00014.1|  unnamed protein product                                479   4e-154   
ref|XP_010412783.1|  PREDICTED: ABC transporter G family member 1...    483   2e-153   
emb|CDX76121.1|  BnaA04g03850D                                          466   3e-151   
ref|XP_009139358.1|  PREDICTED: ABC transporter G family member 1...    462   3e-150   
gb|EMT28272.1|  ABC transporter G family member 16                      454   3e-147   
gb|EMS46245.1|  ABC transporter G family member 16                      450   4e-145   
gb|EMS61049.1|  ABC transporter G family member 16                      417   5e-133   
ref|XP_009116043.1|  PREDICTED: ABC transporter G family member 20      384   4e-122   
emb|CDY44641.1|  BnaC04g06210D                                          381   2e-121   
ref|XP_010431371.1|  PREDICTED: ABC transporter G family member 1...    388   9e-121   
emb|CBI15591.3|  unnamed protein product                                393   3e-120   
ref|XP_002321525.2|  hypothetical protein POPTR_0015s04860g             384   2e-117   
ref|XP_010095943.1|  ABC transporter G family member 2                  370   2e-115   
ref|XP_002991813.1|  ATP-binding cassette transporter                   377   3e-114   
ref|XP_001763780.1|  ATP-binding cassette transporter, subfamily ...    369   7e-114   
ref|XP_006279090.1|  hypothetical protein CARUB_v10012709mg             363   5e-113   
gb|EMT16368.1|  ABC transporter G family member 2                       350   3e-109   
dbj|BAD28517.1|  putative white pigment protein                         363   1e-108   
dbj|BAC42186.1|  putative ABC transporter                               342   8e-107   
ref|XP_003566290.1|  PREDICTED: ABC transporter G family member 6       352   1e-104   
emb|CDM84188.1|  unnamed protein product                                350   6e-104   
dbj|BAK00469.1|  predicted protein                                      349   8e-104   
dbj|BAD30878.1|  putative ABC transporter                               340   2e-100   
gb|EAZ03077.1|  hypothetical protein OsI_25222                          339   3e-100   
ref|XP_002973980.1|  hypothetical protein SELMODRAFT_100089             338   5e-100   
ref|XP_002969083.1|  ATP-binding cassette transporter                   337   1e-99    
ref|XP_006856623.1|  hypothetical protein AMTR_s00046p00226870          338   2e-99    
ref|XP_006658359.1|  PREDICTED: ABC transporter G family member 1...    337   2e-99    
ref|XP_001764842.1|  ATP-binding cassette transporter, subfamily ...    328   7e-98    
ref|XP_001764895.1|  ATP-binding cassette transporter, subfamily ...    325   2e-96    
ref|XP_004972127.1|  PREDICTED: ABC transporter G family member 6...    325   1e-94    
ref|XP_008440506.1|  PREDICTED: ABC transporter G family member 1...    322   2e-93    
gb|EAZ38989.1|  hypothetical protein OsJ_23407                          319   7e-93    
ref|XP_001775040.1|  ATP-binding cassette transporter, subfamily ...    314   1e-92    
ref|XP_008227400.1|  PREDICTED: ABC transporter G family member 5       312   2e-90    
ref|XP_010027639.1|  PREDICTED: ABC transporter G family member 5...    308   3e-89    
ref|XP_010027638.1|  PREDICTED: ABC transporter G family member 5...    308   4e-89    
ref|XP_007158327.1|  hypothetical protein PHAVU_002G143300g             308   3e-88    
ref|XP_004288110.1|  PREDICTED: ABC transporter G family member 5...    303   1e-87    
gb|KDO78699.1|  hypothetical protein CISIN_1g039035mg                   303   2e-87    
dbj|BAJ94640.1|  predicted protein                                      294   2e-87    
ref|XP_007214262.1|  hypothetical protein PRUPE_ppa024858mg             304   2e-87    
gb|KFK39940.1|  hypothetical protein AALP_AA3G309600                    302   4e-87    
ref|XP_010090828.1|  ABC transporter G family member 5                  302   7e-87    
ref|XP_010260431.1|  PREDICTED: ABC transporter G family member 5...    301   7e-87    
ref|XP_009355839.1|  PREDICTED: ABC transporter G family member 5       301   2e-86    
ref|XP_010324385.1|  PREDICTED: ABC transporter G family member 10      299   3e-86    
ref|XP_009619739.1|  PREDICTED: ABC transporter G family member 1...    299   5e-86    
ref|XP_006348289.1|  PREDICTED: ABC transporter G family member 1...    298   6e-86    
gb|AIU41646.1|  ABC transporter family protein                          298   7e-86    
gb|EMT29324.1|  ABC transporter G family member 16                      293   8e-86    
ref|XP_008361085.1|  PREDICTED: ABC transporter G family member 5...    300   9e-86    
ref|XP_009335188.1|  PREDICTED: ABC transporter G family member 1...    297   2e-85    
ref|XP_001769263.1|  ATP-binding cassette transporter, subfamily ...    295   2e-85    
ref|XP_010105125.1|  ABC transporter G family member 16                 299   3e-85    
ref|XP_002516304.1|  ATP-binding cassette transporter, putative         296   3e-85    
ref|XP_007048427.1|  ABC-2 type transporter family protein              297   3e-85    
ref|XP_006409681.1|  hypothetical protein EUTSA_v10022588mg             297   4e-85    
ref|XP_009342292.1|  PREDICTED: ABC transporter G family member 1...    296   5e-85    
emb|CBJ30358.1|  conserved unknown protein                              296   1e-84    
ref|XP_006852446.1|  hypothetical protein AMTR_s00021p00104980          295   1e-84    
ref|XP_006300140.1|  hypothetical protein CARUB_v10016369mg             296   1e-84    
ref|XP_004147363.1|  PREDICTED: ABC transporter G family member 5...    294   2e-84    
gb|KGN62206.1|  hypothetical protein Csa_2G335550                       294   3e-84    
gb|KDP39428.1|  hypothetical protein JCGZ_03710                         294   5e-84    
ref|XP_008460882.1|  PREDICTED: ABC transporter G family member 5       293   6e-84    
ref|XP_010680229.1|  PREDICTED: ABC transporter G family member 5       293   7e-84    
ref|XP_008348825.1|  PREDICTED: ABC transporter G family member 1...    292   8e-84    
ref|XP_008382071.1|  PREDICTED: ABC transporter G family member 10      292   9e-84    
ref|XP_006432169.1|  hypothetical protein CICLE_v10000557mg             293   1e-83    
gb|KDO50720.1|  hypothetical protein CISIN_1g006505mg                   293   1e-83    
ref|XP_010467187.1|  PREDICTED: ABC transporter G family member 5...    293   1e-83    
ref|XP_002274622.1|  PREDICTED: ABC transporter G family member 5       292   2e-83    
ref|XP_011022930.1|  PREDICTED: ABC transporter G family member 5...    293   2e-83    
ref|XP_007159853.1|  hypothetical protein PHAVU_002G273300g             292   3e-83    
ref|NP_178984.1|  ABC transporter G family member 5                     291   5e-83    
ref|XP_011099722.1|  PREDICTED: ABC transporter G family member 5       291   6e-83    
ref|XP_008226519.1|  PREDICTED: ABC transporter G family member 10      290   6e-83    
ref|XP_006584647.1|  PREDICTED: ABC transporter G family member 5...    291   7e-83    
ref|XP_010488858.1|  PREDICTED: ABC transporter G family member 5       290   2e-82    
ref|XP_003630284.1|  ABC transporter G family member                    290   2e-82    
ref|XP_007212414.1|  hypothetical protein PRUPE_ppa016488mg             288   2e-82    
ref|XP_002309921.2|  hypothetical protein POPTR_0007s04270g             288   5e-82    
gb|KHN31160.1|  ABC transporter G family member 5                       288   8e-82    
ref|XP_002885884.1|  abc transporter family protein                     288   1e-81    
ref|XP_003522483.1|  PREDICTED: ABC transporter G family member 5...    287   1e-81    
ref|XP_007021688.1|  White-brown-complex ABC transporter family         287   2e-81    
ref|XP_004503928.1|  PREDICTED: ABC transporter G family member 5...    286   3e-81    
ref|XP_009340174.1|  PREDICTED: ABC transporter G family member 1...    287   4e-81    
ref|XP_009757719.1|  PREDICTED: ABC transporter G family member 5       285   9e-81    
ref|XP_010527096.1|  PREDICTED: ABC transporter G family member 5       284   3e-80    
ref|XP_009625613.1|  PREDICTED: ABC transporter G family member 5       283   4e-80    
ref|XP_010526988.1|  PREDICTED: ABC transporter G family member 5...    283   6e-80    
ref|XP_010108255.1|  ABC transporter G family member 10                 281   1e-79    
ref|XP_003602630.1|  ABC transporter G family member                    280   8e-79    
gb|EYU23735.1|  hypothetical protein MIMGU_mgv1a027025mg                279   9e-79    
ref|XP_009611306.1|  PREDICTED: ABC transporter G family member 1...    276   5e-78    
ref|XP_009786358.1|  PREDICTED: ABC transporter G family member 1...    276   8e-78    
gb|KHN04895.1|  ABC transporter G family member 17                      279   1e-77    
ref|XP_009414604.1|  PREDICTED: ABC transporter G family member 5...    277   1e-77    
ref|XP_002285381.1|  PREDICTED: ABC transporter G family member 10      275   2e-77    
emb|CAN66605.1|  hypothetical protein VITISV_017552                     275   2e-77    
ref|XP_006345760.1|  PREDICTED: ABC transporter G family member 5...    276   2e-77    
ref|XP_009415757.1|  PREDICTED: ABC transporter G family member 5...    276   3e-77    
ref|XP_010675410.1|  PREDICTED: ABC transporter G family member 10      273   6e-77    
ref|XP_003556918.1|  PREDICTED: ABC transporter G family member 2...    273   2e-76    
ref|XP_007137794.1|  hypothetical protein PHAVU_009G156100g             272   5e-76    
ref|XP_010911492.1|  PREDICTED: ABC transporter G family member 5       273   7e-76    
ref|XP_001784129.1|  ATP-binding cassette transporter, subfamily ...    269   1e-75    
emb|CDY02909.1|  BnaC04g25770D                                          268   2e-75    
ref|XP_007048669.1|  White-brown-complex ABC transporter family         270   2e-75    
ref|XP_006440319.1|  hypothetical protein CICLE_v10024157mg             270   2e-75    
ref|XP_008377541.1|  PREDICTED: ABC transporter G family member 2...    270   3e-75    
ref|XP_008357247.1|  PREDICTED: ABC transporter G family member 2...    270   4e-75    
ref|XP_004969166.1|  PREDICTED: ABC transporter G family member 1...    267   1e-74    
gb|KDP31788.1|  hypothetical protein JCGZ_12249                         266   3e-74    
ref|XP_003529479.1|  PREDICTED: ABC transporter G family member 2...    266   7e-74    
ref|XP_006477580.1|  PREDICTED: ABC transporter G family member 2...    264   4e-73    
ref|XP_002458156.1|  hypothetical protein SORBIDRAFT_03g027870          262   7e-73    
dbj|BAJ98704.1|  predicted protein                                      260   4e-72    
gb|EMS61215.1|  ABC transporter G family member 19                      264   2e-71    
ref|XP_008449657.1|  PREDICTED: ABC transporter G family member 23      259   2e-71    
ref|XP_007036886.1|  STR                                                261   5e-71    
ref|XP_008346868.1|  PREDICTED: ABC transporter G family member 1...    260   6e-71    
ref|XP_009792934.1|  PREDICTED: ABC transporter G family member 1...    261   8e-71    
ref|XP_009610634.1|  PREDICTED: ABC transporter G family member 1...    261   9e-71    
ref|XP_004959919.1|  PREDICTED: ABC transporter G family member 5...    258   1e-70    
ref|XP_010673755.1|  PREDICTED: ABC transporter G family member 2...    257   1e-70    
ref|XP_002278856.1|  PREDICTED: ABC transporter G family member 1...    260   2e-70    
ref|XP_008240289.1|  PREDICTED: ABC transporter G family member 1...    260   2e-70    
ref|XP_008374853.1|  PREDICTED: ABC transporter G family member 1...    260   2e-70    
ref|XP_009356016.1|  PREDICTED: ABC transporter G family member 1...    259   3e-70    
ref|XP_004163819.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    259   4e-70    
ref|XP_004137629.1|  PREDICTED: ABC transporter G family member 1...    259   4e-70    
ref|XP_007160552.1|  hypothetical protein PHAVU_002G331200g             259   4e-70    
ref|XP_008393442.1|  PREDICTED: ABC transporter G family member 1...    259   5e-70    
emb|CDM83447.1|  unnamed protein product                                254   6e-70    
ref|XP_006347757.1|  PREDICTED: ABC transporter G family member 1...    259   6e-70    
gb|KHG22954.1|  ABC transporter G family member 19                      258   8e-70    
ref|XP_008446009.1|  PREDICTED: ABC transporter G family member 1...    258   1e-69    
ref|XP_002530787.1|  ATP-binding cassette transporter, putative         258   1e-69    
gb|EYU22253.1|  hypothetical protein MIMGU_mgv1a020130mg                258   1e-69    
ref|XP_010932586.1|  PREDICTED: ABC transporter G family member 1...    257   2e-69    
ref|XP_004140196.1|  PREDICTED: ABC transporter G family member 2...    253   2e-69    
ref|XP_004301244.1|  PREDICTED: ABC transporter G family member 1...    257   3e-69    
ref|XP_011039177.1|  PREDICTED: ABC transporter G family member 1...    256   3e-69    
ref|XP_011072016.1|  PREDICTED: ABC transporter G family member 1...    256   5e-69    
ref|XP_008227284.1|  PREDICTED: ABC transporter G family member 23      253   5e-69    
ref|XP_004231234.1|  PREDICTED: ABC transporter G family member 1...    256   5e-69    
ref|XP_010087013.1|  ABC transporter G family member 16                 255   7e-69    
gb|EMT20028.1|  ABC transporter G family member 19                      258   7e-69    
ref|XP_002318509.1|  hypothetical protein POPTR_0012s04240g             255   8e-69    
gb|AAS76671.1|  WBC1 ABC transporter                                    238   9e-69    
ref|XP_008803919.1|  PREDICTED: ABC transporter G family member 1...    255   1e-68    
ref|XP_011035574.1|  PREDICTED: ABC transporter G family member 1...    255   1e-68    
ref|XP_009117159.1|  PREDICTED: ABC transporter G family member 2...    241   2e-68    
ref|XP_006661204.1|  PREDICTED: ABC transporter G family member 6...    254   2e-68    
gb|AFW56755.1|  hypothetical protein ZEAMMB73_719044                    255   2e-68    
ref|XP_006451582.1|  hypothetical protein CICLE_v10007469mg             254   3e-68    
ref|XP_011076083.1|  PREDICTED: ABC transporter G family member 8...    249   3e-68    
ref|XP_002445326.1|  hypothetical protein SORBIDRAFT_07g009430          255   4e-68    
ref|XP_009419454.1|  PREDICTED: ABC transporter G family member 1...    253   4e-68    
ref|XP_003631132.1|  ABC transporter G family member                    253   5e-68    
gb|KDO62777.1|  hypothetical protein CISIN_1g003437mg                   253   5e-68    
ref|XP_010069422.1|  PREDICTED: ABC transporter G family member 1...    252   1e-67    
ref|XP_003525183.1|  PREDICTED: ABC transporter G family member 2...    252   1e-67    
gb|EAZ44665.1|  hypothetical protein OsJ_29288                          253   1e-67    
gb|KCW57777.1|  hypothetical protein EUGRSUZ_H00535                     252   1e-67    
gb|AET86899.1|  ABC transporter                                         253   1e-67    
gb|EAZ09038.1|  hypothetical protein OsI_31299                          253   1e-67    
ref|XP_010276664.1|  PREDICTED: ABC transporter G family member 8...    247   2e-67    
ref|XP_006828538.1|  hypothetical protein AMTR_s00060p00208620          250   3e-67    
gb|EYU25163.1|  hypothetical protein MIMGU_mgv1a003070mg                246   3e-67    
gb|KHN00138.1|  ABC transporter G family member 19                      250   4e-67    
ref|XP_004503258.1|  PREDICTED: ABC transporter G family member 1...    250   4e-67    
emb|CDP03494.1|  unnamed protein product                                249   7e-67    
gb|KFK26886.1|  hypothetical protein AALP_AA8G306400                    245   7e-67    
ref|XP_003530969.1|  PREDICTED: ABC transporter G family member 1...    249   1e-66    
dbj|BAJ90696.1|  predicted protein                                      246   2e-66    
ref|XP_002456777.1|  hypothetical protein SORBIDRAFT_03g042560          246   2e-66    
dbj|BAJ90968.1|  predicted protein                                      245   3e-66    
dbj|BAN92426.1|  ABCG transporter                                       248   3e-66    
ref|XP_002867592.1|  abc transporter family protein                     243   3e-66    
ref|XP_010521368.1|  PREDICTED: ABC transporter G family member 8...    243   4e-66    
ref|XP_010555696.1|  PREDICTED: ABC transporter G family member 8...    243   6e-66    
dbj|BAJ87640.1|  predicted protein                                      244   7e-66    
ref|NP_194305.1|  ABC transporter G family member 4                     242   7e-66    
gb|KDP44294.1|  hypothetical protein JCGZ_22923                         246   8e-66    
ref|XP_002276766.1|  PREDICTED: ABC transporter G family member 4...    242   9e-66    
gb|KHN46645.1|  ABC transporter G family member 23                      240   9e-66    
ref|XP_006653927.1|  PREDICTED: ABC transporter G family member 5...    242   2e-65    
ref|XP_003576511.1|  PREDICTED: ABC transporter G family member 1...    244   2e-65    
ref|XP_009368714.1|  PREDICTED: ABC transporter G family member 4...    241   2e-65    
ref|XP_003592180.1|  ABC transporter G family member                    241   3e-65    
ref|XP_004496513.1|  PREDICTED: ABC transporter G family member 4...    241   4e-65    
ref|XP_007221106.1|  hypothetical protein PRUPE_ppa017858mg             238   2e-64    
ref|XP_008234817.1|  PREDICTED: ABC transporter G family member 4       238   2e-64    
gb|KDO56854.1|  hypothetical protein CISIN_1g007383mg                   238   2e-64    
ref|XP_009377580.1|  PREDICTED: ABC transporter G family member 4...    237   4e-64    
ref|XP_006490601.1|  PREDICTED: ABC transporter G family member 8...    238   5e-64    
gb|KDO61450.1|  hypothetical protein CISIN_1g006897mg                   238   5e-64    
ref|XP_006422082.1|  hypothetical protein CICLE_v10004505mg             238   7e-64    
ref|XP_002992973.1|  hypothetical protein SELMODRAFT_448960             241   3e-63    
ref|XP_004289783.1|  PREDICTED: ABC transporter G family member 8...    234   5e-63    
ref|XP_010105723.1|  ABC transporter G family member 8                  233   1e-62    
emb|CBI22616.3|  unnamed protein product                                233   1e-62    
ref|XP_008380310.1|  PREDICTED: ABC transporter G family member 4...    233   2e-62    
ref|XP_010087014.1|  ABC transporter G family member 19                 236   2e-62    
ref|XP_009765620.1|  PREDICTED: ABC transporter G family member 8...    232   4e-62    
ref|XP_009594606.1|  PREDICTED: ABC transporter G family member 8...    231   5e-62    
ref|XP_002527217.1|  ATP-binding cassette transporter, putative         233   1e-61    
ref|XP_008776357.1|  PREDICTED: ABC transporter G family member 1...    224   2e-61    
gb|EYU24388.1|  hypothetical protein MIMGU_mgv1a024795mg                231   3e-61    
ref|XP_009397787.1|  PREDICTED: ABC transporter G family member 6...    232   3e-61    
ref|XP_010026574.1|  PREDICTED: ABC transporter G family member 1...    230   9e-61    
ref|XP_006466575.1|  PREDICTED: ABC transporter G family member 1...    230   1e-60    
ref|XP_006426212.1|  hypothetical protein CICLE_v10026941mg             229   2e-60    
emb|CDX94418.1|  BnaC01g17660D                                          226   2e-60    



>ref|XP_009765003.1| PREDICTED: ABC transporter G family member 20-like [Nicotiana 
sylvestris]
Length=740

 Score =  1061 bits (2744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 605/750 (81%), Positives = 672/750 (90%), Gaps = 12/750 (2%)
 Frame = +2

Query  257   MSQASSRDDMSTASSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNN  436
             MS     DDMS+AS DLPFLGPR  M+LQE +R+PRH+VS+TLGELL RVGDS  E  NN
Sbjct  1     MSSLGGGDDMSSAS-DLPFLGPRSTMDLQEFSRKPRHNVSVTLGELLKRVGDSTEETYNN  59

Query  437   GVGGANDHRVLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVEN  616
                   +H     Y  +  PSSFPF+LSFHNLSYSVKV+ KM +P +L R       +++
Sbjct  60    NSLELGNH-----YSNIASPSSFPFILSFHNLSYSVKVKTKMALPKFLRRGNKDNELLDD  114

Query  617   DVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKL  796
             ++K+LL+DISGEAREGEIMAVLGASGSGKSTLIDALA+RI+RESL GTV +NGEVLESKL
Sbjct  115   NMKMLLNDISGEAREGEIMAVLGASGSGKSTLIDALADRISRESLKGTVTLNGEVLESKL  174

Query  797   LKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKT  976
             LKVISAYVMQDDLLFPMLTVEETLMFSAEFRLP +LS+S+KKARVQALI+QLGL TAAKT
Sbjct  175   LKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPGTLSKSKKKARVQALIDQLGLTTAAKT  234

Query  977   VIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGS  1156
             VIGDEGHRGVSGGERRRVSIGIDIIHDPIVLFLDEPTSGLDSTSA+MVVKVLQRIAQSG 
Sbjct  235   VIGDEGHRGVSGGERRRVSIGIDIIHDPIVLFLDEPTSGLDSTSAYMVVKVLQRIAQSGG  294

Query  1157  IVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALD  1336
             IVIMS+HQPSYRIL+LLD LI LS+G TVF+ SPSSL +FF EFGNPIPENENR EFALD
Sbjct  295   IVIMSIHQPSYRILSLLDHLIILSRGNTVFTSSPSSLQQFFAEFGNPIPENENRIEFALD  354

Query  1337  FIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPN-PKPSLKDAISASISRGKLV  1513
             FIRELE +P GTKNLV+FNK+WQRK     TSN +++F N  KPSLKDAISAS+SRGKLV
Sbjct  355   FIRELEGTPNGTKNLVEFNKTWQRK----KTSNSSSLFYNGTKPSLKDAISASVSRGKLV  410

Query  1514  SGATNINSTLSPS-VPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILAT  1690
             SGATNI+S+LS S +PKFANPFWV+MVVI KRSM+NS+RMPELF MRFGAVVVTGIILAT
Sbjct  411   SGATNIDSSLSSSNIPKFANPFWVDMVVIAKRSMLNSMRMPELFGMRFGAVVVTGIILAT  470

Query  1691  IFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL  1870
             IFWKLD+SPKG+QER+GFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL
Sbjct  471   IFWKLDNSPKGVQERVGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL  530

Query  1871  SHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIY  2050
             SH+IISLPS+  LS+AFAVTTYW+VGLAGG SGFLFFLLF+ ASFWAGSSFVTFLSG+IY
Sbjct  531   SHAIISLPSILVLSIAFAVTTYWSVGLAGGVSGFLFFLLFMVASFWAGSSFVTFLSGVIY  590

Query  2051  NVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKC  2230
             NVM+AYT+VVAILAYFVLFSG+FI+RDRIPPYWIWFHY SLVKYP+QGVLQNEFD P KC
Sbjct  591   NVMMAYTVVVAILAYFVLFSGYFISRDRIPPYWIWFHYMSLVKYPYQGVLQNEFDDPLKC  650

Query  2231  FVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKW  2410
             FVKGIQIFDGSPL+AVPE +K+KLL NMSKTLG+NITSSTCLTTG DILKQTGV D+NKW
Sbjct  651   FVKGIQIFDGSPLRAVPEQLKIKLLHNMSKTLGMNITSSTCLTTGADILKQTGVNDLNKW  710

Query  2411  NCLWITIAlgfffrllfyfallIGSKNKRR  2500
             +CLWITIALGFFFR+LFYFAL+IGSKNKRR
Sbjct  711   SCLWITIALGFFFRILFYFALVIGSKNKRR  740



>ref|XP_009597344.1| PREDICTED: ABC transporter G family member 20-like [Nicotiana 
tomentosiformis]
Length=739

 Score =  1049 bits (2713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 603/750 (80%), Positives = 670/750 (89%), Gaps = 13/750 (2%)
 Frame = +2

Query  257   MSQASSRDDMSTASSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNN  436
             MS     DDMS+AS DLPFLGPR  M+LQE +R+PRH+VS+TLGELL RVGDS  E  NN
Sbjct  1     MSSLGGGDDMSSAS-DLPFLGPRTNMDLQEFSRKPRHNVSVTLGELLKRVGDSTEETYNN  59

Query  437   GVGGANDHRVLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVEN  616
                  N   +   Y  +  PSSFPF+LSFHNLSYSVKV+ KM +P  L R+    + +++
Sbjct  60    -----NSLELGNNYSNIATPSSFPFILSFHNLSYSVKVKSKMALPKCL-RKDKDNALLDD  113

Query  617   DVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKL  796
             ++K+LL+DISGEAREGEIMAVLGASGSGKSTLIDALA+RI+RESL GTV +NGEVLESKL
Sbjct  114   NMKMLLNDISGEAREGEIMAVLGASGSGKSTLIDALADRISRESLKGTVTLNGEVLESKL  173

Query  797   LKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKT  976
             LKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPR+LS+S+KKARVQALI+QLGL TAAKT
Sbjct  174   LKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPRTLSKSKKKARVQALIDQLGLTTAAKT  233

Query  977   VIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGS  1156
             VIGDEGHRGVSGGERRRVSIGIDIIHDPIVLFLDEPTSGLDSTSA+MVVKVLQRIAQSGS
Sbjct  234   VIGDEGHRGVSGGERRRVSIGIDIIHDPIVLFLDEPTSGLDSTSAYMVVKVLQRIAQSGS  293

Query  1157  IVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALD  1336
             IVIMS+HQPSYRIL+LLD LI LS+G TVF+ SPSSL  FF EFGNPIPENENR EFALD
Sbjct  294   IVIMSIHQPSYRILSLLDHLIILSRGNTVFTSSPSSLQHFFAEFGNPIPENENRIEFALD  353

Query  1337  FIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPN-PKPSLKDAISASISRGKLV  1513
             FIRELE +P GTKNLV+FNK+WQRK     TSN ++ F N  KPSLKDAISAS+SRGKLV
Sbjct  354   FIRELEGTPNGTKNLVEFNKTWQRK----KTSNSSSFFYNGSKPSLKDAISASVSRGKLV  409

Query  1514  SGATNINSTLSPS-VPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILAT  1690
             SG TNI+ +LS S VPKFANPFWV+MVVI KRSM+NS+RMPELF MRFGAVVVTG+ILAT
Sbjct  410   SGGTNIDPSLSSSNVPKFANPFWVDMVVIAKRSMLNSMRMPELFGMRFGAVVVTGVILAT  469

Query  1691  IFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL  1870
             IFWKLD+SPKG+QER+GFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL
Sbjct  470   IFWKLDNSPKGVQERVGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL  529

Query  1871  SHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIY  2050
             SH+IISLPS+  LS+AFAV TYW+VGLAGG SGFLFFLLF+ ASFWAGSSFVTFLSG+IY
Sbjct  530   SHAIISLPSILVLSIAFAVITYWSVGLAGGVSGFLFFLLFMVASFWAGSSFVTFLSGVIY  589

Query  2051  NVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKC  2230
             NVM+AYT+VVAILAYFVLFSG+FI+RDRIPPYWIWFHY SLVKYP+QGVLQNEFD P +C
Sbjct  590   NVMMAYTVVVAILAYFVLFSGYFISRDRIPPYWIWFHYMSLVKYPYQGVLQNEFDDPLEC  649

Query  2231  FVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKW  2410
             FVKGIQIFDGSPL+AVPE +K+KLL NMSKTLG+NITSSTCLTTG DILKQTGV D+NKW
Sbjct  650   FVKGIQIFDGSPLRAVPEQLKIKLLHNMSKTLGMNITSSTCLTTGADILKQTGVNDLNKW  709

Query  2411  NCLWITIAlgfffrllfyfallIGSKNKRR  2500
             +CLWITIALGFFFR+LFYFAL+IGSKNKRR
Sbjct  710   SCLWITIALGFFFRILFYFALVIGSKNKRR  739



>ref|XP_006345684.1| PREDICTED: ABC transporter G family member 20-like [Solanum tuberosum]
Length=741

 Score =  1031 bits (2665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/755 (78%), Positives = 671/755 (89%), Gaps = 21/755 (3%)
 Frame = +2

Query  257   MSQASSRDDMSTASSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNN  436
             MS     DDMS+AS DLPFLGPR  MELQE  R+PRH+VS+TLGELL R+GDSA EK   
Sbjct  1     MSNLGGGDDMSSAS-DLPFLGPRNNMELQEFGRKPRHNVSITLGELLKRLGDSAEEK---  56

Query  437   GVGGANDHRVLQLYDPVPY----PSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPS  604
                    ++VL+L +   Y    PSSFPFVLSFHNL+YSVKV+ K+ +P WL RR     
Sbjct  57    -------NQVLELGNHSNYTTTTPSSFPFVLSFHNLTYSVKVKSKISLPRWL-RRGDKDD  108

Query  605   QV--ENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGE  778
             ++  +N++KVLL+DISGEAREGEIMAVLGASGSGKSTLIDALA+RI+RESL G V +NGE
Sbjct  109   ELSSDNNMKVLLNDISGEAREGEIMAVLGASGSGKSTLIDALADRISRESLKGNVTLNGE  168

Query  779   VLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGL  958
             VLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPR+LS+S+K ARVQALI+QLGL
Sbjct  169   VLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPRTLSKSKKNARVQALIDQLGL  228

Query  959   QTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQR  1138
             + AAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPIVLFLDEPTSGLDSTSA+MVVKVLQR
Sbjct  229   RNAAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPIVLFLDEPTSGLDSTSAYMVVKVLQR  288

Query  1139  IAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENR  1318
             IAQSGSIVIMS+HQPSYRIL+LLDRLI LS+G TV +  PSSL +FF +FGNPIPENENR
Sbjct  289   IAQSGSIVIMSIHQPSYRILSLLDRLIILSRGHTVLTSPPSSLQQFFADFGNPIPENENR  348

Query  1319  CEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASIS  1498
              EFALDFIRELE +P GTK L++FNK+WQR+   +ST++ ++ +  PKPSLKDAISAS+S
Sbjct  349   IEFALDFIRELEGTPNGTKTLMEFNKTWQRE--RNSTTSTSSFYNGPKPSLKDAISASVS  406

Query  1499  RGKLVSGATNINSTLSPS-VPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTG  1675
             RGKLVSGATNI+  +S S VPKFANPFWV+MVVI KRSM+NS+RMPELF MRFGAVVVTG
Sbjct  407   RGKLVSGATNIDPNVSSSNVPKFANPFWVDMVVIAKRSMLNSMRMPELFGMRFGAVVVTG  466

Query  1676  IILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRR  1855
             IILATIFWKLD+SPKG+QERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETA+NAYRR
Sbjct  467   IILATIFWKLDNSPKGVQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAHNAYRR  526

Query  1856  SSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFL  2035
             SSYV+SH+IISLPS+  LS+AFAVTTYW+VGLAGG SGFL+FLLF+ ASFWAGSSFVTFL
Sbjct  527   SSYVVSHAIISLPSILVLSIAFAVTTYWSVGLAGGVSGFLYFLLFLLASFWAGSSFVTFL  586

Query  2036  SGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFD  2215
             SG+IYN+M+AYT+VVA+LAYF LFSGFFI+RDRIPPYWIWFHY SLVKYP+QGVLQNEF 
Sbjct  587   SGVIYNIMMAYTVVVAVLAYFFLFSGFFISRDRIPPYWIWFHYMSLVKYPYQGVLQNEFS  646

Query  2216  YPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVT  2395
              P+KCFVKG+Q+FD SPL+AVPEA+K+KLLQNMSKTLG+NIT++TCLTTG DILKQ+G T
Sbjct  647   DPNKCFVKGVQLFDTSPLRAVPEALKIKLLQNMSKTLGMNITNTTCLTTGSDILKQSGGT  706

Query  2396  DINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             D+NKW C WITI LGFFFR+LFYFALLIGSKNKRR
Sbjct  707   DLNKWTCFWITIGLGFFFRILFYFALLIGSKNKRR  741



>ref|XP_004246729.1| PREDICTED: ABC transporter G family member 20 [Solanum lycopersicum]
Length=738

 Score =  1026 bits (2653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/753 (79%), Positives = 667/753 (89%), Gaps = 20/753 (3%)
 Frame = +2

Query  257   MSQASSRDDMSTASSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNN  436
             MS     DDMS+AS DLPFLGPR  MELQE  R+PRH+VS+TLGELL R GDSA EK   
Sbjct  1     MSSLCGGDDMSSAS-DLPFLGPRNNMELQEFGRKPRHNVSITLGELLKRFGDSAEEK---  56

Query  437   GVGGANDHRVLQLYDPVPY---PSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQ  607
                    ++VL+L +   Y   PSSFPFVLSFHNL+YSVKV+ K+ +P WL RR     +
Sbjct  57    -------NQVLELGNISNYTTSPSSFPFVLSFHNLNYSVKVKSKISLPRWL-RRGDKDDE  108

Query  608   VENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLE  787
             + +D KVLL+DISGEAREGEIMAVLGASGSGKSTLIDALA+RI+RESL G V +NGEVLE
Sbjct  109   LSSD-KVLLNDISGEAREGEIMAVLGASGSGKSTLIDALADRISRESLKGNVTLNGEVLE  167

Query  788   SKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTA  967
             SKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPR+LS+S+K ARVQALI+QLGL+ A
Sbjct  168   SKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPRTLSKSKKNARVQALIDQLGLRNA  227

Query  968   AKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQ  1147
             AKTVIGDEGHRGVSGGERRRVSIGIDIIHDPIVLFLDEPTSGLDSTSA+MVVKVLQRIAQ
Sbjct  228   AKTVIGDEGHRGVSGGERRRVSIGIDIIHDPIVLFLDEPTSGLDSTSAYMVVKVLQRIAQ  287

Query  1148  SGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEF  1327
             SGSIVIMS+HQPSYRIL+LLDRLI LS+G TV +  PS L +FF +FGNPIPENENR EF
Sbjct  288   SGSIVIMSIHQPSYRILSLLDRLIILSRGHTVLTSPPSCLQQFFADFGNPIPENENRIEF  347

Query  1328  ALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGK  1507
             ALDFIRELE +P GTK L++FNK WQR    +ST++ ++ +  PKPSLKDAISAS+SRGK
Sbjct  348   ALDFIRELEGTPNGTKTLMEFNKIWQR--GKNSTTSTSSFYNGPKPSLKDAISASVSRGK  405

Query  1508  LVSGATN-INSTLSPS-VPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGII  1681
             LVSGATN I+  LS S VPKFANPFWV+MVVI KRSM+NS+RMPELF MRFGAVVVTGII
Sbjct  406   LVSGATNNIDPNLSSSNVPKFANPFWVDMVVIAKRSMLNSMRMPELFGMRFGAVVVTGII  465

Query  1682  LATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSS  1861
             LATIFWKLD+SPKG+QERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSS
Sbjct  466   LATIFWKLDNSPKGVQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSS  525

Query  1862  YVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSG  2041
             YV+SH+IISLPS+  LS+AFAVTTYW+VGLAGG SGFL+FLLF+ ASFWAGSSFVTFLSG
Sbjct  526   YVVSHAIISLPSILVLSIAFAVTTYWSVGLAGGVSGFLYFLLFLVASFWAGSSFVTFLSG  585

Query  2042  IIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYP  2221
             +IYN+M+AYT+VVA+LAYF LFSGFFI+RDRIPPYWIWFHY SLVKYP+QGVLQNEF  P
Sbjct  586   VIYNIMMAYTVVVAVLAYFFLFSGFFISRDRIPPYWIWFHYMSLVKYPYQGVLQNEFSDP  645

Query  2222  DKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDI  2401
             +KCFVKG+Q+FD SPL+AVPEA+K+KLLQNMSKTLG+NIT++TCLTTG DILKQ+GVTD+
Sbjct  646   NKCFVKGVQLFDASPLRAVPEALKIKLLQNMSKTLGMNITNTTCLTTGSDILKQSGVTDL  705

Query  2402  NKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             NKW C WITIALGFFFR+LFYFALL+GSKNKRR
Sbjct  706   NKWTCFWITIALGFFFRILFYFALLVGSKNKRR  738



>ref|XP_011094785.1| PREDICTED: ABC transporter G family member 20-like [Sesamum indicum]
Length=737

 Score =   991 bits (2563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 579/751 (77%), Positives = 652/751 (87%), Gaps = 23/751 (3%)
 Frame = +2

Query  269   SSRDDMSTASSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGG  448
             S+  D  + + DLPFLGPRQ MELQEL+R+P+ S S TLGELL  VG+SA E        
Sbjct  3     STECDKLSMACDLPFLGPRQTMELQELSRKPKRSSSHTLGELLQHVGNSAVEP-------  55

Query  449   ANDHRVLQLYDPVPYPS-SFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVEN---  616
                H+VL + +PV  P+ S PFVLSFHNL+YSVKVRRK+ +PA   R +       N   
Sbjct  56    --SHQVLDVREPVFQPAASMPFVLSFHNLTYSVKVRRKV-LPACFSRSSTNNPDNRNLIE  112

Query  617   ---DVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLE  787
                 +KVLL+DISGEAREGEIMAVLGASGSGKSTLIDALA+RIARESL GTV +NGEVLE
Sbjct  113   HKSRMKVLLNDISGEAREGEIMAVLGASGSGKSTLIDALADRIARESLKGTVTLNGEVLE  172

Query  788   SKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTA  967
             SKLLKVISAYVMQDDLLFPMLTVEET MFSAEFRLPR++SRSRKKARVQALI+QLGL++A
Sbjct  173   SKLLKVISAYVMQDDLLFPMLTVEETFMFSAEFRLPRTMSRSRKKARVQALIDQLGLRSA  232

Query  968   AKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQ  1147
             AKTVIGDE HRGVSGGERRRVSIG DIIHDPI+LFLDEPTSGLDSTSA+MVVKVLQRIAQ
Sbjct  233   AKTVIGDEAHRGVSGGERRRVSIGTDIIHDPILLFLDEPTSGLDSTSAYMVVKVLQRIAQ  292

Query  1148  SGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEF  1327
             SGSIVI+S+HQPSYRIL+LLDRLI LS GQTVFSG+P  LP+FF EFG PIP NE++ EF
Sbjct  293   SGSIVILSIHQPSYRILSLLDRLIILSHGQTVFSGAPGVLPQFFAEFGKPIPVNEDKTEF  352

Query  1328  ALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGK  1507
             ALD+IRELE +P GTKNLVDFNK+WQ++ +P S S+       PK SLKDAISASIS GK
Sbjct  353   ALDYIRELESTPGGTKNLVDFNKTWQKR-NPLSRSS-----TGPKLSLKDAISASISMGK  406

Query  1508  LVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILA  1687
             LVSGATN++  LS SVPK+ANPFW EMVVI  R++ NS R PELF  RFGAV+VTGIILA
Sbjct  407   LVSGATNMDPNLSSSVPKYANPFWKEMVVIADRAITNSRRAPELFGARFGAVLVTGIILA  466

Query  1688  TIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYV  1867
             TIFW+LD+SPKG+QERLGFFAFAMSTTFYTCAEAIPVFL ERYIFMRETAYNAYRRSSYV
Sbjct  467   TIFWRLDNSPKGVQERLGFFAFAMSTTFYTCAEAIPVFLLERYIFMRETAYNAYRRSSYV  526

Query  1868  LSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGII  2047
             LS SIIS+PSL  LSLAFAVTTYWAVGLAGG SGFLF+ +F+ ASFWAGSSFVTFLSGII
Sbjct  527   LSQSIISIPSLLILSLAFAVTTYWAVGLAGGTSGFLFYFIFILASFWAGSSFVTFLSGII  586

Query  2048  YNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDK  2227
             +N+M+AYT+VVAILAYF+LFSGFFI RDRIP YWIWFHYASLVKYP+QGV+QNEFD P K
Sbjct  587   FNLMMAYTVVVAILAYFLLFSGFFITRDRIPSYWIWFHYASLVKYPYQGVMQNEFDDPSK  646

Query  2228  CFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINK  2407
             CFV+GIQ+FDGSPL+AVP+++KLKLL++MSKTLG+NITSSTCLTTG DILKQ+GVTDI+K
Sbjct  647   CFVRGIQVFDGSPLRAVPDSLKLKLLKSMSKTLGMNITSSTCLTTGSDILKQSGVTDIDK  706

Query  2408  WNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             W+CLWITIALGFFFR+LFYFALLIGSKNKRR
Sbjct  707   WSCLWITIALGFFFRVLFYFALLIGSKNKRR  737



>ref|XP_002277271.1| PREDICTED: ABC transporter G family member 20 [Vitis vinifera]
Length=722

 Score =   942 bits (2436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 555/729 (76%), Positives = 625/729 (86%), Gaps = 15/729 (2%)
 Frame = +2

Query  332   MELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDH-RVLQLYDPVPYPSSFP  508
             MELQE   R +  VS TLGELL RVGD+  +    G    + H RV+ L D +P+P SFP
Sbjct  1     MELQEPVWRSKLRVSPTLGELLKRVGDARDD--TPGCQTTSSHQRVIDLNDAIPHPRSFP  58

Query  509   FVLSFHNLSYSVKVRRKMGVPA---WLGRRTAAPSQVE---NDVKVLLDDISGEAREGEI  670
             FVLSFHNLSYSVKVRRKM  P    W      +  +VE   + +KVLL+DISGEAREGEI
Sbjct  59    FVLSFHNLSYSVKVRRKMKFPGLFCWKEGPGLSEDEVETKDSGMKVLLNDISGEAREGEI  118

Query  671   MAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPML  850
             M VLGASGSGKSTLIDALA+RIA++SL G+V +N EVLESKLLKVISAYVMQDDLLFPML
Sbjct  119   MGVLGASGSGKSTLIDALADRIAKDSLKGSVTLNDEVLESKLLKVISAYVMQDDLLFPML  178

Query  851   TVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrv  1030
             TVEETLMFSAEFRLPRSLS S+KKARVQALI+QLGL++AAKTVIGDEGHRGVSGGERRRV
Sbjct  179   TVEETLMFSAEFRLPRSLSSSKKKARVQALIDQLGLRSAAKTVIGDEGHRGVSGGERRRV  238

Query  1031  sigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLD  1210
             SIGIDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMS+HQPSYRIL LLD
Sbjct  239   SIGIDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLD  298

Query  1211  RLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDF  1390
             RLIFLS+G TV+SGSPSSLP FF EFG+PIPE ENR EFALD IRELE SP GTK LV+F
Sbjct  299   RLIFLSRGNTVYSGSPSSLPLFFAEFGHPIPETENRTEFALDLIRELEGSPGGTKTLVEF  358

Query  1391  NKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFAN  1570
             NKSWQR  +P     + +V    KPSLKDAISASISRGKLVSGA+N ++  +  VP FAN
Sbjct  359   NKSWQRMTNP-----QTDVEEGAKPSLKDAISASISRGKLVSGASN-DANPASLVPTFAN  412

Query  1571  PFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFA  1750
             P W+EMVV+GKRS+ NS RMPELF +R GAV+VTGIILATIF +LD SPKG+QERLGFFA
Sbjct  413   PIWIEMVVLGKRSLKNSKRMPELFGIRLGAVLVTGIILATIFLQLDSSPKGVQERLGFFA  472

Query  1751  FAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVT  1930
             FAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL+HSIIS+P+L FLS AFA T
Sbjct  473   FAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLAHSIISIPALVFLSFAFAAT  532

Query  1931  TYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFS  2110
             TYWAVGLAGG SGFLFF   +FASFWAGSSFVTFLSG++ +VM+ YT+VVAILAYF+LFS
Sbjct  533   TYWAVGLAGGVSGFLFFFFMIFASFWAGSSFVTFLSGVVSHVMLGYTVVVAILAYFLLFS  592

Query  2111  GFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAM  2290
             GFFI+R+RIPPYWIWFHY SLVKYP++GVL NEF+ P KCFV+GIQ+FD +PL AVPEA+
Sbjct  593   GFFISRNRIPPYWIWFHYISLVKYPYEGVLHNEFEDPMKCFVRGIQMFDNTPLGAVPEAL  652

Query  2291  KLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfa  2470
             K++LL++MS TLG++ITSSTC+TTG D+LKQ GVTDI+KWNCLWIT+ALGFFFR +FY  
Sbjct  653   KVRLLKSMSDTLGMSITSSTCVTTGSDVLKQQGVTDISKWNCLWITLALGFFFRFMFYLT  712

Query  2471  llIGSKNKR  2497
             LL GSKNKR
Sbjct  713   LLFGSKNKR  721



>ref|XP_007027149.1| ABC-2 type transporter family protein [Theobroma cacao]
 gb|EOY07651.1| ABC-2 type transporter family protein [Theobroma cacao]
Length=742

 Score =   940 bits (2429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/737 (74%), Positives = 626/737 (85%), Gaps = 17/737 (2%)
 Frame = +2

Query  302   DLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGAN---DHRVLQ  472
             + P     + MELQ+ T+R + +VS TL ELL  V D+      N   G N   DHRVL+
Sbjct  19    NFPLFNSSKQMELQKYTKRAKPTVSPTLAELLMHVDDA-----QNDASGNNTPVDHRVLE  73

Query  473   L-YDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISG  649
             L Y     PSS PFVLSF+NL+YSVKVR+K+ +P + G  +   S  E   K+LL+DISG
Sbjct  74    LGYACSSLPSSQPFVLSFNNLTYSVKVRKKLALP-FCGEGSKLDSN-EIHSKILLNDISG  131

Query  650   EAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQD  829
             EAREGEIMAVLGASGSGKSTLIDALANRIA+ESL G++ +NGEVLES+LL+VISAYVMQD
Sbjct  132   EAREGEIMAVLGASGSGKSTLIDALANRIAKESLKGSLTLNGEVLESRLLRVISAYVMQD  191

Query  830   DLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvs  1009
             DLLFPMLTVEETLMFSAEFRLPRSLS+ +KKARVQALI+QLGL++AAKTVIGDEGHRGVS
Sbjct  192   DLLFPMLTVEETLMFSAEFRLPRSLSKKKKKARVQALIDQLGLRSAAKTVIGDEGHRGVS  251

Query  1010  ggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSY  1189
             GGERRRVSIGIDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSY
Sbjct  252   GGERRRVSIGIDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSY  311

Query  1190  RILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEG  1369
             RIL+LLDRLIFLS G TV+SGSP +LP FF EFG+PIPENENR EFALD IRELE++P G
Sbjct  312   RILSLLDRLIFLSHGHTVYSGSPGNLPHFFAEFGHPIPENENRTEFALDLIRELEETPGG  371

Query  1370  TKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSP  1549
             TK+LV+FN SWQ + +P     R+     P  SLKDAISASISRGKLVSGATN +S L+ 
Sbjct  372   TKSLVEFNTSWQARKNP-----RSGFSCKPNLSLKDAISASISRGKLVSGATN-DSNLTS  425

Query  1550  SVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQ  1729
             SVP FANPFW+EM+VI KRSM NS RMPELF +R GAV+VTGIILAT+FWKLD+SPKGIQ
Sbjct  426   SVPTFANPFWIEMIVIAKRSMTNSKRMPELFGIRLGAVLVTGIILATMFWKLDNSPKGIQ  485

Query  1730  ERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslafl  1909
             ERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL+HS+IS+P+L  L
Sbjct  486   ERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLAHSLISIPALVVL  545

Query  1910  slafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAIL  2089
             S++FA TT+WAVGLAGG SGF FF L +FASFWAGSSFVTFLSGI+ +VM+ +T+VVAIL
Sbjct  546   SISFAATTFWAVGLAGGLSGFFFFFLTIFASFWAGSSFVTFLSGIVAHVMLGFTVVVAIL  605

Query  2090  AYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPL  2269
             AYF+LFSGFFI+RDRIP YWIWFHY SLVKYP++ VLQNEFD P KCFV+G+Q+FD +PL
Sbjct  606   AYFLLFSGFFISRDRIPLYWIWFHYISLVKYPYEAVLQNEFDDPTKCFVRGVQMFDNTPL  665

Query  2270  KAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfff  2449
              AVP ++KLKLLQ+MS  LG+NIT STC+TTG  IL Q G+TDI+KWNCLWI IA GF F
Sbjct  666   GAVPVSLKLKLLQSMSSVLGVNITGSTCVTTGRGILVQQGITDISKWNCLWIIIAWGFLF  725

Query  2450  rllfyfallIGSKNKRR  2500
             R+LFYF LL+GSKNKRR
Sbjct  726   RILFYFTLLLGSKNKRR  742



>gb|KDP46092.1| hypothetical protein JCGZ_06603 [Jatropha curcas]
Length=751

 Score =   912 bits (2356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/755 (71%), Positives = 628/755 (83%), Gaps = 24/755 (3%)
 Frame = +2

Query  278   DDMSTASSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGAND  457
             D+ S  S+ + F    Q+MEL     RP   VS TLG+LL RVGD   +K  NG G    
Sbjct  7     DNFSHDSNTVTFY--TQSMELDRFPSRPSAGVSPTLGQLLKRVGDV--QKEANGDGSETP  62

Query  458   -HRVLQLYDP-VPYPSSFPFVLSFHNLSYSVKVRRKMGVPA-------WLGRRTAA-PSQ  607
              H+VL+  D  +  P S PF+LSF+NL+YSVKVRRKM +PA        LG  TAA P  
Sbjct  63    VHQVLEFGDTNMEVPRSIPFILSFNNLTYSVKVRRKMKLPAIFTPRRHHLGPATAAEPVA  122

Query  608   VEN---DVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGE  778
              E+     K LL+DISGEA +GEI+AVLGASGSGKSTLIDALANRIA+ SL G++ +NGE
Sbjct  123   GESLFTTTKTLLNDISGEAHDGEILAVLGASGSGKSTLIDALANRIAKGSLKGSITLNGE  182

Query  779   VLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGL  958
             VLES++LKVISAYVMQDDLLFPMLTVEETLMF+AEFRLPRSLS+S+KK RVQALI+QLGL
Sbjct  183   VLESRMLKVISAYVMQDDLLFPMLTVEETLMFAAEFRLPRSLSKSKKKMRVQALIDQLGL  242

Query  959   QTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQR  1138
             + AAKT+IGDEGHRGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQR
Sbjct  243   RNAAKTIIGDEGHRGVSGGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAFMVVKVLQR  302

Query  1139  IAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENR  1318
             IAQ+GSIVIMSVHQPSYRIL LLDRLIFLS+GQTV+SGSP  LP FF EFG+PIPENEN+
Sbjct  303   IAQTGSIVIMSVHQPSYRILGLLDRLIFLSRGQTVYSGSPVHLPAFFAEFGHPIPENENK  362

Query  1319  CEFALDFIRELEQSPEGTKNLVDFNKSWQR-KFSPSSTSNRNNVFPNPKPSLKDAISASI  1495
              EFALD IRELE SP GTK+LV+FNKSWQ  K +P++   RN +      SLK+AISASI
Sbjct  363   TEFALDLIRELEGSPGGTKSLVEFNKSWQNMKHTPNTEPERNGL------SLKEAISASI  416

Query  1496  SRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTG  1675
             S+GKLVSGATN  S+++  VP FANPFW+EM V+ KRS+ NS R+PELF +R GAV+VTG
Sbjct  417   SKGKLVSGATNNGSSMNSMVPTFANPFWIEMAVLSKRSVTNSKRVPELFGIRLGAVLVTG  476

Query  1676  IILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRR  1855
              ILAT+FW+LD SPKG+QERLGFFAFAMSTTFYTCA+A+PVFLQERYIFMRETAYNAYRR
Sbjct  477   FILATMFWQLDSSPKGVQERLGFFAFAMSTTFYTCADALPVFLQERYIFMRETAYNAYRR  536

Query  1856  SSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFL  2035
             SSYVLSH+I+SLP+L FLS AF+  T+WAVGL GGFSGF F+ + + ASFWAG+SFVTFL
Sbjct  537   SSYVLSHAIVSLPALIFLSFAFSAITFWAVGLDGGFSGFFFYFIIILASFWAGNSFVTFL  596

Query  2036  SGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFD  2215
             SG++ +VM+ YT+VVAILAYF+LFSGFFINRDRIP YWIWFHY SLVKYP++ VLQNEF 
Sbjct  597   SGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPSYWIWFHYLSLVKYPYEAVLQNEFQ  656

Query  2216  YPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVT  2395
              P KCFV+G+QIFD +PL +VP++MK++LLQ +S TLG+ ITSSTCLTTG  IL+Q G+T
Sbjct  657   DPTKCFVRGVQIFDNTPLGSVPDSMKVRLLQTLSSTLGMKITSSTCLTTGSGILQQQGIT  716

Query  2396  DINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             D++KWNC W+T+A GFFFR+LFYF+LL+GSKNKRR
Sbjct  717   DLSKWNCFWVTVAWGFFFRILFYFSLLLGSKNKRR  751



>ref|XP_002525222.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF37188.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=743

 Score =   906 bits (2341),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 547/750 (73%), Positives = 628/750 (84%), Gaps = 20/750 (3%)
 Frame = +2

Query  275   RDDMST-----ASSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNG  439
             R DMS          LP       MELQ+ +RR + +VS TL ELL RV D+  +  N+ 
Sbjct  6     RSDMSREKPFGGDYQLPVFNSAHQMELQQFSRRSKPTVSATLAELLKRVEDAQSD--NSN  63

Query  440   VGGANDHRVLQL---YDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQV  610
                   H+ L++      +P PSS PFVLSFHNLSYSVKV +KM  P + G  +   S  
Sbjct  64    YTSPIHHQALEVGYACSSMP-PSSDPFVLSFHNLSYSVKVAQKMSFP-FSGNDSFDSS--  119

Query  611   ENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLES  790
             EN +K+LL+DISGEAREGEIMAVLGASGSGKSTLIDALA+RIA+ESL G+V +NGEVLES
Sbjct  120   ENGIKLLLNDISGEAREGEIMAVLGASGSGKSTLIDALADRIAKESLKGSVTLNGEVLES  179

Query  791   KLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAA  970
             +LLKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPRSLSRS+KKARVQALI+QLGL++AA
Sbjct  180   RLLKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPRSLSRSKKKARVQALIDQLGLRSAA  239

Query  971   KTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQS  1150
              TVIGDEGHRGVSGGERRRVSIG DI+HDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQS
Sbjct  240   NTVIGDEGHRGVSGGERRRVSIGTDIVHDPILLFLDEPTSGLDSTSAFMVVKVLQRIAQS  299

Query  1151  GSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFA  1330
             GSIVIMSVHQPSYRIL+LLDRLIFLS GQTV+ G P+SLP FF EFG+PIPENENR EFA
Sbjct  300   GSIVIMSVHQPSYRILSLLDRLIFLSHGQTVYGGPPTSLPDFFAEFGHPIPENENRTEFA  359

Query  1331  LDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKL  1510
             LD IRELE+ P GT++LVDFN+SWQ   +P     RN++  + K SLKDAISASIS+GKL
Sbjct  360   LDLIRELEEIPGGTRSLVDFNRSWQALKNP-----RNHICRSSKLSLKDAISASISKGKL  414

Query  1511  VSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILAT  1690
             VSGA N +S LS SVP FANPFWVEM+VI KRS++NS RMPELF +RFGAV VTG+ILAT
Sbjct  415   VSGARN-DSNLSSSVPTFANPFWVEMLVIAKRSLINSRRMPELFGIRFGAVFVTGLILAT  473

Query  1691  IFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL  1870
             IFW LD+SP+G QERLGFFAFAMSTT+YTCAE+IP FLQERYIFMRETAYNAYRRSSYVL
Sbjct  474   IFWHLDNSPRGAQERLGFFAFAMSTTYYTCAESIPAFLQERYIFMRETAYNAYRRSSYVL  533

Query  1871  SHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIY  2050
             +HSIIS+PSL   S+AFA TTYWAVGLAGG SGFLFF   V ++FWAGSSFVTFLSG++ 
Sbjct  534   AHSIISIPSLIIFSIAFAATTYWAVGLAGGASGFLFFFFTVLSAFWAGSSFVTFLSGVVS  593

Query  2051  NVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKC  2230
             +VM+ +T+VVAILAYF+LFSGFFI+RDRIPPYWIWFHY SLVKYP++G LQNEF  P KC
Sbjct  594   HVMLGFTIVVAILAYFLLFSGFFISRDRIPPYWIWFHYLSLVKYPYEGALQNEFQDPTKC  653

Query  2231  FVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKW  2410
             +V+G+Q+FD +PL  VP A+KLKLLQ++S TLG NITSSTC+ TGPDILK  G+TD++KW
Sbjct  654   YVRGVQMFDNTPLSEVPVALKLKLLQSLSSTLGRNITSSTCIVTGPDILKGQGITDLSKW  713

Query  2411  NCLWITIAlgfffrllfyfallIGSKNKRR  2500
             +CLWITIA GFFFR+LFYF LL+GSKNKRR
Sbjct  714   SCLWITIAWGFFFRVLFYFTLLLGSKNKRR  743



>ref|XP_007208058.1| hypothetical protein PRUPE_ppa002035mg [Prunus persica]
 gb|EMJ09257.1| hypothetical protein PRUPE_ppa002035mg [Prunus persica]
Length=725

 Score =   905 bits (2338),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/735 (73%), Positives = 621/735 (84%), Gaps = 22/735 (3%)
 Frame = +2

Query  332   MELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDP---VPYPSS  502
             MEL+E + R R  V+ TLGELL  VGD+            +DH +L L  P   VP PSS
Sbjct  1     MELKEFSPRIRRGVNPTLGELLKSVGDAQSPD--------HDHHILDLGFPCSSVP-PSS  51

Query  503   FPFVLSFHNLSYSVKVRRKMG-VPAWLG-RRTAAPSQVEN---DVKVLLDDISGEAREGE  667
              PFVLSF NL+YSVKVRRK+  +P+  G   T A  ++ +   + KVLL+ ISGEAREGE
Sbjct  52    HPFVLSFTNLTYSVKVRRKVNLIPSCFGANSTTAEVKLGSSNANTKVLLNGISGEAREGE  111

Query  668   IMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPM  847
             +MAVLGASGSGKSTLIDALA+RI+++SL G++ +NGE L+S+LLKVISAYVMQDDLLFPM
Sbjct  112   LMAVLGASGSGKSTLIDALADRISKDSLKGSITLNGEALDSRLLKVISAYVMQDDLLFPM  171

Query  848   LTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrr  1027
             LTVEETLMFSAEFRLPRSLS+S+KKARVQALI+QLGL+ AA TVIGDEGHRGVSGGERRR
Sbjct  172   LTVEETLMFSAEFRLPRSLSKSKKKARVQALIDQLGLRNAATTVIGDEGHRGVSGGERRR  231

Query  1028  vsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLL  1207
             VSIGIDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIV+MS+HQPSYRIL+LL
Sbjct  232   VSIGIDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVVMSIHQPSYRILSLL  291

Query  1208  DRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVD  1387
             DRLIFLS GQTV+ GSP++LP FF+EFG+PIPE ENR EFALD IRELE++P GTK+LV+
Sbjct  292   DRLIFLSHGQTVYGGSPANLPVFFREFGHPIPETENRTEFALDLIRELEETPGGTKSLVE  351

Query  1388  FNKSWQ----RKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSV  1555
             FN SWQ    ++   +  +N  N    PK SLKDAISASISRGKLVSGA N + +LS SV
Sbjct  352   FNASWQLNKNQQRQEADPNNLINSITRPKLSLKDAISASISRGKLVSGAPN-DPSLSSSV  410

Query  1556  PKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQER  1735
             P FANP W+E+ VI KRS  NS RMPELF +R GAV+VTG+ILAT+FWKLD+SPKG+QER
Sbjct  411   PTFANPCWIEIAVISKRSFTNSRRMPELFGIRLGAVLVTGLILATMFWKLDNSPKGVQER  470

Query  1736  LGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflsl  1915
             LGFFAFAMSTTFYTCAEAIP+FLQERYIFMRETAYNAYRRSSYVL+HS+IS+PSL FLSL
Sbjct  471   LGFFAFAMSTTFYTCAEAIPIFLQERYIFMRETAYNAYRRSSYVLAHSLISIPSLIFLSL  530

Query  1916  afaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAY  2095
             AFA TT+WAVGLAGG  GFLFF   + A+FWAGSSFVTFLSGI+ +VM+ YT+VVAILAY
Sbjct  531   AFAATTFWAVGLAGGVHGFLFFFFTICAAFWAGSSFVTFLSGIVTHVMLGYTVVVAILAY  590

Query  2096  FVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKA  2275
             F+LFSGFFI+RDRIP YWIWFHY SLVKYP++GVLQNEFD P KCFV+G Q+FD +PL  
Sbjct  591   FLLFSGFFISRDRIPLYWIWFHYISLVKYPYEGVLQNEFDDPTKCFVRGTQMFDSTPLGT  650

Query  2276  VPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrl  2455
             VP A+KL+LL++MS TLG+NIT STC+TTG DILKQ G+TD++KW+CLWIT+A GFFFR 
Sbjct  651   VPVAVKLELLKSMSTTLGVNITGSTCVTTGTDILKQQGITDLSKWSCLWITVAWGFFFRF  710

Query  2456  lfyfallIGSKNKRR  2500
             LFYF LL+GSKNKRR
Sbjct  711   LFYFTLLLGSKNKRR  725



>ref|XP_009341777.1| PREDICTED: ABC transporter G family member 20-like [Pyrus x bretschneideri]
Length=729

 Score =   904 bits (2335),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/737 (73%), Positives = 624/737 (85%), Gaps = 22/737 (3%)
 Frame = +2

Query  332   MELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQL-YDPVPYPSSFP  508
             MEL +   RPR  ++ TLGELL  VGD+    +       +DH VL+L Y      SS+P
Sbjct  1     MELVDFNPRPR-GLNPTLGELLQWVGDAQSPDIT-----PHDH-VLELGYGCTSGSSSYP  53

Query  509   FVLSFHNLSYSVKVRRKMG-VPAWLGRR--TAAPSQVEND------VKVLLDDISGEARE  661
             FVLSF +L+YSV+V+RKM  VPA   R+  TA      N+       KVLL+ ISGEARE
Sbjct  54    FVLSFTDLTYSVEVQRKMTLVPACFKRKPNTAEVKLGMNNNSTNPNTKVLLNGISGEARE  113

Query  662   GEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLF  841
             GEIMAVLGASGSGKSTLIDALA+RIA++SL G++ +NGE L+S+LLKVISAYVMQDDLLF
Sbjct  114   GEIMAVLGASGSGKSTLIDALADRIAKDSLKGSITLNGEALDSRLLKVISAYVMQDDLLF  173

Query  842   PMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsgger  1021
             PMLTVEETLMFSAEFRLPR LS+S+KKARVQAL++QLGL+ AAKTVIGDEGHRGVSGGER
Sbjct  174   PMLTVEETLMFSAEFRLPRRLSKSKKKARVQALMDQLGLRNAAKTVIGDEGHRGVSGGER  233

Query  1022  rrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILN  1201
             RRVSIGIDIIHDPIVLFLDEPTSGLDSTSA+MVVKVLQRIAQSGSIV+MS+HQPSYRIL+
Sbjct  234   RRVSIGIDIIHDPIVLFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVVMSIHQPSYRILS  293

Query  1202  LLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNL  1381
             L+DRLIFLS GQTV+SGSP++LP FF EFG+PIPE ENR EFALD IRELE++P GTKNL
Sbjct  294   LMDRLIFLSHGQTVYSGSPANLPVFFGEFGHPIPETENRTEFALDLIRELEETPGGTKNL  353

Query  1382  VDFNKSWQRKFSPSST-SNRNNVFPN---PKPSLKDAISASISRGKLVSGATNINSTLSP  1549
             V+FNKSWQ          N+NN+  +   P+ SLKDAISASISRGKLVSGA N +S LS 
Sbjct  354   VEFNKSWQITMDEQKQRENQNNLINSNCKPRLSLKDAISASISRGKLVSGAPN-DSNLSS  412

Query  1550  SVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQ  1729
             SVP FANP W+E+ VI KRS+ NS R+PELF +R GA++VTGIILAT+FW LDDSPKGIQ
Sbjct  413   SVPTFANPSWIEIAVISKRSLTNSRRLPELFGIRLGAILVTGIILATMFWHLDDSPKGIQ  472

Query  1730  ERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslafl  1909
             ERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL+HSIIS+PSLAFL
Sbjct  473   ERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLAHSIISIPSLAFL  532

Query  1910  slafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAIL  2089
             S+ FA TT+WAVGLAGG  GFLFF    FA+FWAGSSFVTFLSG++ +VM+ YT+VVA+L
Sbjct  533   SIVFAATTFWAVGLAGGLHGFLFFFFTTFAAFWAGSSFVTFLSGVVTHVMLGYTVVVAVL  592

Query  2090  AYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPL  2269
             AYFVLFSGFFI+RDRIPPYW+WFHY SLVKYP++GVLQNE D P KCFV+G Q+FD SP+
Sbjct  593   AYFVLFSGFFISRDRIPPYWLWFHYISLVKYPYEGVLQNELDDPIKCFVRGTQMFDNSPI  652

Query  2270  KAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfff  2449
             +A P AMKLKLL++MS TLG+NIT+STC+TTG DILKQ G+T+++KWNCLWITIA GFFF
Sbjct  653   EAFPVAMKLKLLKSMSTTLGVNITASTCVTTGMDILKQQGITELSKWNCLWITIAWGFFF  712

Query  2450  rllfyfallIGSKNKRR  2500
             R+LFYFALL+GSKNKRR
Sbjct  713   RILFYFALLLGSKNKRR  729



>ref|XP_011023380.1| PREDICTED: ABC transporter G family member 20-like [Populus euphratica]
Length=740

 Score =   903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/744 (71%), Positives = 618/744 (83%), Gaps = 9/744 (1%)
 Frame = +2

Query  269   SSRDDMSTASSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGG  448
             S   +MS      PF      MELQ   RR + S+S TL ELL RV D+  +  N     
Sbjct  4     SGHSNMSQGKGLPPFNHNNHQMELQNYPRRSKPSLSPTLAELLKRVDDAQSDTSNYSTP-  62

Query  449   ANDHRVLQL-YDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVK  625
              + H+VL+L Y     P   PFVLSF+NL+YSVKV +K+  P + G+ T+  S   + +K
Sbjct  63    VHQHQVLELGYACSSMPPLTPFVLSFNNLTYSVKVNQKLSFP-FCGKDTSLGSSDTSSMK  121

Query  626   VLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKV  805
             VLL+DISGEAREGEIMAVLGASGSGKSTLIDALA+RIA+ESL G+V +NGEVLES+LLKV
Sbjct  122   VLLNDISGEAREGEIMAVLGASGSGKSTLIDALADRIAKESLKGSVTLNGEVLESRLLKV  181

Query  806   ISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIG  985
             ISAYVMQDDLLFPMLTVEETLMFSA+FRLPRSLS+S+KKARVQALI+QLGL+ AA TVIG
Sbjct  182   ISAYVMQDDLLFPMLTVEETLMFSADFRLPRSLSKSKKKARVQALIDQLGLRNAANTVIG  241

Query  986   DeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVI  1165
             DEGHRGVSGGERRRVSIGIDI+HDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQ GSIVI
Sbjct  242   DEGHRGVSGGERRRVSIGIDIVHDPILLFLDEPTSGLDSTSAFMVVKVLQRIAQRGSIVI  301

Query  1166  MSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIR  1345
             MSVHQPSYRIL LLDRLIFLS GQTV++GSP SLP FF +FG+PIPENENR EFALD IR
Sbjct  302   MSVHQPSYRILTLLDRLIFLSHGQTVYAGSPGSLPEFFSQFGHPIPENENRTEFALDLIR  361

Query  1346  ELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGAT  1525
             ELE++PEGTK LV+FNKSWQ   +P    NRN  F   K SLKDAI ASISRGKLVSGA 
Sbjct  362   ELEEAPEGTKTLVEFNKSWQVMKNPK---NRN--FNASKLSLKDAIGASISRGKLVSGAP  416

Query  1526  NINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKL  1705
             N NS+L+ SVP FANP W+EM+VI KRS++N+ RMPELF +R GAV+VTGIILAT+F+ L
Sbjct  417   N-NSSLTSSVPTFANPLWIEMMVISKRSLLNAKRMPELFGIRLGAVLVTGIILATVFYHL  475

Query  1706  DDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsii  1885
             D SP+G QERLGFFAFAMSTT+YTCAE+IP FLQERYIFMRETAYNAYRRSSYV++HS+I
Sbjct  476   DSSPRGAQERLGFFAFAMSTTYYTCAESIPAFLQERYIFMRETAYNAYRRSSYVIAHSLI  535

Query  1886  slpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIA  2065
             S+PSL  LS+AFA TT+WAV L GGFSGF FF   + ++FWAGSSFVTFLSG++ +VM+ 
Sbjct  536   SIPSLVVLSIAFAATTFWAVRLDGGFSGFCFFFFTILSAFWAGSSFVTFLSGVVSHVMLG  595

Query  2066  YTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGI  2245
             +T+VVAILAYF+LFSGFFI+RDRIP +W+WFHY SLVKYP++  LQNEF    KCFV+G+
Sbjct  596   FTIVVAILAYFLLFSGFFISRDRIPSFWLWFHYISLVKYPYEAALQNEFQDSTKCFVRGV  655

Query  2246  QIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWI  2425
             Q+FD +PL AVP ++KL +L+++S TLG+NITS+TC+ TG DIL+Q G+TDI+KWNCLWI
Sbjct  656   QMFDTTPLAAVPLSLKLNMLKSISNTLGMNITSNTCVVTGADILRQQGITDISKWNCLWI  715

Query  2426  TIAlgfffrllfyfallIGSKNKR  2497
             TIA GFFFR+LFYFALL GSKNKR
Sbjct  716   TIAWGFFFRILFYFALLFGSKNKR  739



>ref|XP_010528237.1| PREDICTED: ABC transporter G family member 20-like [Tarenaya 
hassleriana]
Length=750

 Score =   902 bits (2332),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/744 (71%), Positives = 617/744 (83%), Gaps = 16/744 (2%)
 Frame = +2

Query  293   ASSDLPFLGPRQA-MELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVL  469
             A  DLP     QA +ELQ   RR +  +S TL +LL  V  S  +         + H+ L
Sbjct  15    AGDDLPLFNVDQASLELQGYPRRDKQRLSATLADLLIPVEGSTSDH--------HHHQAL  66

Query  470   QLYDPVPYPSSFP--FVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDI  643
               +  VP  S+ P  FVLSF++LSYSVK+R+K  +    G+  +  +    + KVLL+ I
Sbjct  67    DSWSSVPTSSASPSLFVLSFNDLSYSVKIRKKFELFPCQGKSASDGNGSAVNTKVLLNGI  126

Query  644   SGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVM  823
             SGEAR+GEIMAVLGASGSGKSTLIDALANRIA+ESL G++ +NGEVLES LLKVISAYVM
Sbjct  127   SGEARDGEIMAVLGASGSGKSTLIDALANRIAKESLRGSIALNGEVLESSLLKVISAYVM  186

Query  824   QDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrg  1003
             QDDLLFPMLTVEETLMFSAEFRLPRSLS+ +KKARVQALI+QLGL++AAKT+IGDEGHRG
Sbjct  187   QDDLLFPMLTVEETLMFSAEFRLPRSLSKKKKKARVQALIDQLGLKSAAKTIIGDEGHRG  246

Query  1004  vsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQP  1183
             VSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIA+SGSIVIMS+HQP
Sbjct  247   VSGGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAFMVVKVLQRIAESGSIVIMSIHQP  306

Query  1184  SYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSP  1363
             SYRIL LLDRLIFLS+G TV+SGSP++LPRFF EFG+PIPENEN+ EFALD IRELE SP
Sbjct  307   SYRILGLLDRLIFLSRGNTVYSGSPANLPRFFSEFGHPIPENENKTEFALDLIRELEDSP  366

Query  1364  EGTKNLVDFNKSWQRKFSPSSTSNRNNVFP-----NPKPSLKDAISASISRGKLVSGATN  1528
             EGTK LV+F+K W+ K + S   N NN        N   SLKDAISASISRGKLVSG+T+
Sbjct  367   EGTKTLVEFHKQWRMKQTSSLNINNNNASRQNQNRNTNVSLKDAISASISRGKLVSGSTS  426

Query  1529  INSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLD  1708
              ++ L+ SV  FANP+W+EM+VIGKR+++NS R PELF +R GAV+VTGIILATIFWKLD
Sbjct  427   DSANLTSSVSTFANPYWIEMIVIGKRALLNSRRQPELFGIRLGAVLVTGIILATIFWKLD  486

Query  1709  DSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiis  1888
              SPKG+QERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL+ SIIS
Sbjct  487   SSPKGVQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLAQSIIS  546

Query  1889  lpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAY  2068
             +PSL  LS++FA TT+WAVGLAGG +GFL+F L + ASFWAGSSFVTFLSG++ +VM+ +
Sbjct  547   IPSLIVLSISFAATTFWAVGLAGGGNGFLYFFLTILASFWAGSSFVTFLSGVVSHVMLGF  606

Query  2069  TLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQ  2248
             T+VVAILAYF+LFSGFFI+RDRIP YWIWFHY SLVKYP++GVLQNEF+ P KCF +GIQ
Sbjct  607   TVVVAILAYFLLFSGFFISRDRIPLYWIWFHYISLVKYPYEGVLQNEFEDPTKCFARGIQ  666

Query  2249  IFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWIT  2428
             +FD SPL   PEA+K++LL +MS  LGIN+T+ TC+TTG DILKQ G+ ++ KW+CLWIT
Sbjct  667   MFDNSPLGQAPEAVKMRLLSSMSGVLGINLTAETCVTTGIDILKQQGIGNLGKWDCLWIT  726

Query  2429  IAlgfffrllfyfallIGSKNKRR  2500
             IA GFFFR+LFYF LLIGSKNKRR
Sbjct  727   IAWGFFFRVLFYFTLLIGSKNKRR  750



>ref|XP_002301347.2| ABC transporter family protein [Populus trichocarpa]
 gb|EEE80620.2| ABC transporter family protein [Populus trichocarpa]
Length=740

 Score =   902 bits (2331),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/744 (71%), Positives = 618/744 (83%), Gaps = 9/744 (1%)
 Frame = +2

Query  269   SSRDDMSTASSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGG  448
             S   +MS      PF      MELQ   RR + S+S TL ELL RV D+  +  N     
Sbjct  4     SGHSNMSQGKGLPPFNHNNHQMELQNYPRRSKPSLSPTLAELLKRVDDAQSDTSNYSTP-  62

Query  449   ANDHRVLQL-YDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVK  625
              + H+VL+L +     P   PFVLSF+NL YSVKV +K+  P + G+ ++  S   + +K
Sbjct  63    VHQHQVLELGFACSSMPPLTPFVLSFNNLIYSVKVNQKLSFP-FCGKDSSLGSSDTSGMK  121

Query  626   VLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKV  805
             VLL+DISGEAREGEIMAVLGASGSGKSTLIDALA+RIA+ESL G+V +NGEVLES+LLKV
Sbjct  122   VLLNDISGEAREGEIMAVLGASGSGKSTLIDALADRIAKESLKGSVTLNGEVLESRLLKV  181

Query  806   ISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIG  985
             ISAYVMQDDLLFPMLTVEETLMFSA+FRLPRSLS+S+KKARVQALI+QLGL+ AA TVIG
Sbjct  182   ISAYVMQDDLLFPMLTVEETLMFSADFRLPRSLSKSKKKARVQALIDQLGLRNAANTVIG  241

Query  986   DeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVI  1165
             DEGHRGVSGGERRRVSIGIDI+HDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQ GSIVI
Sbjct  242   DEGHRGVSGGERRRVSIGIDIVHDPILLFLDEPTSGLDSTSAFMVVKVLQRIAQRGSIVI  301

Query  1166  MSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIR  1345
             MSVHQPSYRIL LLDRLIFLS GQTV++GSP SLP FF +FG+PIPENENR EFALD IR
Sbjct  302   MSVHQPSYRILTLLDRLIFLSHGQTVYAGSPGSLPEFFSQFGHPIPENENRTEFALDLIR  361

Query  1346  ELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGAT  1525
             ELE++PEGTK LV+FNKSWQ   +P     +N  F   K SLKDAISASISRGKLVSGA 
Sbjct  362   ELEEAPEGTKTLVEFNKSWQVMKNP-----KNKNFNASKLSLKDAISASISRGKLVSGAP  416

Query  1526  NINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKL  1705
             N NS+L+ SVP FANP W+EM+VI KRS++N+ RMPELF +R GAV+VTGIILAT+F+ L
Sbjct  417   N-NSSLTSSVPTFANPLWIEMMVISKRSLLNAKRMPELFGIRLGAVLVTGIILATVFYHL  475

Query  1706  DDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsii  1885
             D+SP+G QERLGFFAFAMSTT+YTCAE+IP FLQERYIFMRETAYNAYRRSSYVL+HS+I
Sbjct  476   DNSPRGAQERLGFFAFAMSTTYYTCAESIPAFLQERYIFMRETAYNAYRRSSYVLAHSLI  535

Query  1886  slpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIA  2065
             S+PSL  LS+AFA TT+WAV L GGFSGF FF   + ++FWAGSSFVTFLSG++ +VM+ 
Sbjct  536   SIPSLVVLSIAFAATTFWAVRLDGGFSGFCFFFFTILSAFWAGSSFVTFLSGVVSHVMLG  595

Query  2066  YTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGI  2245
             +T+VVAILAYF+LFSGFFI+RDRIP +W+WFHY SLVKYP++  LQNEF  P KCFV+G+
Sbjct  596   FTIVVAILAYFLLFSGFFISRDRIPSFWLWFHYISLVKYPYEAALQNEFHDPTKCFVRGV  655

Query  2246  QIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWI  2425
             Q+FD +PL AVP ++KL +L+++S TLG+NIT +TC+ TG DIL+Q G+TDI+KWNCLWI
Sbjct  656   QMFDTTPLAAVPISLKLNMLKSISNTLGMNITGNTCVVTGADILRQQGITDISKWNCLWI  715

Query  2426  TIAlgfffrllfyfallIGSKNKR  2497
             TIA GFFFR+LFYFALL GSKNKR
Sbjct  716   TIAWGFFFRILFYFALLFGSKNKR  739



>ref|XP_008369824.1| PREDICTED: ABC transporter G family member 20-like [Malus domestica]
Length=728

 Score =   900 bits (2326),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/736 (74%), Positives = 620/736 (84%), Gaps = 21/736 (3%)
 Frame = +2

Query  332   MELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQL-YDPVPYPSSFP  508
             MEL +   RPR  +  TL ELL  V D+  E  NN     +DH VLQL Y     PSS+P
Sbjct  1     MELIDFNPRPR-GLKPTLAELLQWVRDA--ESPNNS---PHDH-VLQLGYGCTSVPSSYP  53

Query  509   FVLSFHNLSYSVKVRRKMG-VPAWLGR-RTAAPSQVEND-----VKVLLDDISGEAREGE  667
             FVLSF NL+YSVKVRRKM  VP+   R R  A  ++  D      KVLL+ ISGEAREGE
Sbjct  54    FVLSFTNLTYSVKVRRKMTLVPSCFKRKRKTAEIKLGMDNNNTNTKVLLNRISGEAREGE  113

Query  668   IMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPM  847
             IMAVLGASGSGKSTLIDALANRI++ESL G++ +NGE L+S+LLKVISAYVMQDDLLFPM
Sbjct  114   IMAVLGASGSGKSTLIDALANRISKESLKGSITLNGEALDSRLLKVISAYVMQDDLLFPM  173

Query  848   LTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrr  1027
             LTVEETLMFSAEFRLPRSLS+SRKKARVQALI+QLGL+ AAKTVIGDEGHRGVSGGERRR
Sbjct  174   LTVEETLMFSAEFRLPRSLSKSRKKARVQALIDQLGLRNAAKTVIGDEGHRGVSGGERRR  233

Query  1028  vsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLL  1207
             VSIGIDIIHDPIVLFLDEPTSGLDSTSA+MVVKVLQ IAQSGSIV+MS+HQPSYRIL+LL
Sbjct  234   VSIGIDIIHDPIVLFLDEPTSGLDSTSAYMVVKVLQLIAQSGSIVVMSIHQPSYRILSLL  293

Query  1208  DRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVD  1387
             DRLIFLS GQTV+S S ++LP FF EFG+PIPE ENR EFALD IRELE++P GTK+LV+
Sbjct  294   DRLIFLSHGQTVYSDSRANLPVFFGEFGHPIPETENRTEFALDLIRELEETPGGTKSLVE  353

Query  1388  FNKSWQ-RKFSPSSTSNRNNVFPN----PKPSLKDAISASISRGKLVSGATNINSTLSPS  1552
             FNKSWQ  K      +N+NN+  N    PK SLKDAISASISRGKLVSGA N +S LS S
Sbjct  354   FNKSWQITKNQQKQRANQNNLMINSCCKPKLSLKDAISASISRGKLVSGAPN-DSNLSSS  412

Query  1553  VPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQE  1732
             VP FANP W+EM VI KRS+ NS RMPELF +R GAV++TGIILAT+FW LD SPKGI+E
Sbjct  413   VPTFANPSWIEMAVISKRSLTNSRRMPELFGIRLGAVLITGIILATMFWHLDSSPKGIKE  472

Query  1733  RLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslafls  1912
             RLGFFAF MSTTFYTCAEAIP FLQERYIFMRETAYNAYRRSSYVL+HS+IS+PSLAFLS
Sbjct  473   RLGFFAFTMSTTFYTCAEAIPSFLQERYIFMRETAYNAYRRSSYVLAHSLISIPSLAFLS  532

Query  1913  lafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILA  2092
             L FA TT+WAVGLAGG  GFLFF   +FA+FWAGSSFVTFLSGI+ +VM+ YT+VVAILA
Sbjct  533   LTFAATTFWAVGLAGGLHGFLFFFFTIFAAFWAGSSFVTFLSGIVTHVMLGYTVVVAILA  592

Query  2093  YFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLK  2272
             YF+LFSGFFI+RD+IPPYW+WFHY SLVKYP++G LQNEFD P KCFV+G ++FD SPL 
Sbjct  593   YFLLFSGFFISRDKIPPYWLWFHYMSLVKYPYEGALQNEFDDPIKCFVRGTEMFDNSPLG  652

Query  2273  AVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffr  2452
             A P AMKLKLL++MS TLG+NIT+STC+TTG DILKQ G+TD+NKW+CLWITIALGFFFR
Sbjct  653   AFPVAMKLKLLKSMSTTLGVNITASTCVTTGADILKQQGITDLNKWSCLWITIALGFFFR  712

Query  2453  llfyfallIGSKNKRR  2500
             +LFY  LL+GSKNKRR
Sbjct  713   ILFYLTLLLGSKNKRR  728



>ref|XP_007142686.1| hypothetical protein PHAVU_007G008200g [Phaseolus vulgaris]
 gb|ESW14680.1| hypothetical protein PHAVU_007G008200g [Phaseolus vulgaris]
Length=757

 Score =   899 bits (2323),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/740 (71%), Positives = 611/740 (83%), Gaps = 25/740 (3%)
 Frame = +2

Query  332   MELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPY---PSS  502
             ME+  LTRRP  +   TLG+LL+ VGD+  E   +G      H  L + D       P S
Sbjct  24    MEMDNLTRRPVSAEKPTLGQLLNHVGDARKEAAGDG-SETPGHHALDIVDGAGVGVGPCS  82

Query  503   FPFVLSFHNLSYSVKVRRKMGVPAWLGRRT------------AAPSQVENDVKVLLDDIS  646
              PFVLSF NL+YSVK RRKM + +   RR+            AA  ++    K LL+DIS
Sbjct  83    LPFVLSFSNLTYSVKARRKMSLSSMFPRRSSDLGASEVAENPAAGERMFGRTKTLLNDIS  142

Query  647   GEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQ  826
             GEAR+GEIMAVLGASGSGKSTLIDALANRIA+ SL GTV +NGE LES+LLKVISAYVMQ
Sbjct  143   GEARDGEIMAVLGASGSGKSTLIDALANRIAKGSLKGTVTLNGETLESRLLKVISAYVMQ  202

Query  827   DDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgv  1006
             DDLLFPMLTVEETLMF+AEFRLPR+LS+S+K ARVQALI+QLGL+ AAKTVIGDEGHRGV
Sbjct  203   DDLLFPMLTVEETLMFAAEFRLPRTLSKSKKSARVQALIDQLGLRNAAKTVIGDEGHRGV  262

Query  1007  sggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPS  1186
             SGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAF+VVKVLQRIAQSGSIVIMS+HQPS
Sbjct  263   SGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTSAFLVVKVLQRIAQSGSIVIMSIHQPS  322

Query  1187  YRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPE  1366
             YRIL LLDR+IFLS+GQTV+SGSPS LP FF EFG+PIPE +NR EFALD IRELE SP 
Sbjct  323   YRILGLLDRMIFLSRGQTVYSGSPSQLPVFFSEFGHPIPETDNRTEFALDLIRELEGSPG  382

Query  1367  GTKNLVDFNKSWQ---RKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINS  1537
             GTK+LV+FNKSWQ   +    ++ + RN +      SLK+AISASISRGKLVSGATN N 
Sbjct  383   GTKSLVEFNKSWQSMTKHNQTTTEAERNGL------SLKEAISASISRGKLVSGATNTNP  436

Query  1538  TLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSP  1717
               S  VP  ANPFW+EM  + KRS +NS RMPE+F +R GAV+VTG ILAT+FW+LDDSP
Sbjct  437   NPSSMVPTSANPFWIEMATLWKRSFLNSRRMPEVFGIRLGAVMVTGFILATMFWQLDDSP  496

Query  1718  KGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislps  1897
             KG+QERLGFFAFAMSTTFYT A+A+PVFLQERYIFMRETAYNAYRR SY++SH++++LP+
Sbjct  497   KGVQERLGFFAFAMSTTFYTTADALPVFLQERYIFMRETAYNAYRRLSYLVSHALVALPA  556

Query  1898  laflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLV  2077
             LAFLSLAFA TT+WAVGL GG SGFLF+ L +FASFWAG+SFVTFLSG++ +VM+ YT+V
Sbjct  557   LAFLSLAFAATTFWAVGLDGGVSGFLFYFLIIFASFWAGNSFVTFLSGVVPHVMLGYTIV  616

Query  2078  VAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFD  2257
             VAILAYF+LFSGFFINRDRIP YWIWFHY SLVKYP++ VLQNEF++  KCFV+G+QIFD
Sbjct  617   VAILAYFLLFSGFFINRDRIPSYWIWFHYLSLVKYPYEAVLQNEFEHSLKCFVRGVQIFD  676

Query  2258  GSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAl  2437
              +PL +VP+A+KL+LL  MS TLGINIT+STCLTTG DIL+Q GVTD +KWNCLWIT+A 
Sbjct  677   NTPLGSVPQALKLQLLDAMSNTLGINITTSTCLTTGSDILRQNGVTDFSKWNCLWITVAW  736

Query  2438  gfffrllfyfallIGSKNKR  2497
             GFFFR LFYF+LL+GSKNKR
Sbjct  737   GFFFRFLFYFSLLLGSKNKR  756



>ref|XP_008350411.1| PREDICTED: ABC transporter G family member 20-like [Malus domestica]
Length=729

 Score =   897 bits (2317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/737 (73%), Positives = 623/737 (85%), Gaps = 22/737 (3%)
 Frame = +2

Query  332   MELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQL-YDPVPYPSSFP  508
             MEL +   RPR  ++ TLGELL  VGD+    ++      +DH VL+L Y      SS+P
Sbjct  1     MELIDFNPRPR-GLNPTLGELLQWVGDAQSPDIS-----PHDH-VLELGYGCTSGTSSYP  53

Query  509   FVLSFHNLSYSVKVRRKMG-VPAWL-GRRTAAPSQVE-------NDVKVLLDDISGEARE  661
             FVLSF +L+YSVKV+RKM  VPA   G+   A  ++         + KVLL+ ISGEARE
Sbjct  54    FVLSFTDLTYSVKVQRKMTLVPACFKGKPNTAEVKLRMNNNSTNANTKVLLNGISGEARE  113

Query  662   GEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLF  841
             GEIMAVLGASGSGKSTLIDALA+RIA++SL G++ +NGE L S+LLKVISAYVMQDDLLF
Sbjct  114   GEIMAVLGASGSGKSTLIDALADRIAKDSLKGSITLNGEALNSRLLKVISAYVMQDDLLF  173

Query  842   PMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsgger  1021
             PMLTVEETLMFSAEFRLPR LS+S+KKARVQALI+QLGL+ AA TVIGDEGHRGVSGGER
Sbjct  174   PMLTVEETLMFSAEFRLPRRLSKSKKKARVQALIDQLGLRNAANTVIGDEGHRGVSGGER  233

Query  1022  rrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILN  1201
             RRVSIGIDIIHDPIVLFLDEPTSGLDSTSA+MVVKVLQRIAQSGSIV+MS+HQPSYRIL+
Sbjct  234   RRVSIGIDIIHDPIVLFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVVMSIHQPSYRILS  293

Query  1202  LLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNL  1381
             L+DRLIFLS GQTV+SGSP++LP FF EFG+PIPE ENR EFALD IRELE++P GTKNL
Sbjct  294   LMDRLIFLSHGQTVYSGSPANLPVFFGEFGHPIPETENRTEFALDLIRELEETPGGTKNL  353

Query  1382  VDFNKSWQRKFSPSST-SNRNNVFPN---PKPSLKDAISASISRGKLVSGATNINSTLSP  1549
             V+FNKSWQ          N+NN+  +   PK SLKDAISASISRGKLVSGA N +S LS 
Sbjct  354   VEFNKSWQITLDQQKQRENQNNLINSNCKPKLSLKDAISASISRGKLVSGAPN-DSNLSS  412

Query  1550  SVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQ  1729
             SVP FANP W+E+ VI KRS+ NS RMPELF +R GAV+VTGIILAT+FW LD+SPKGIQ
Sbjct  413   SVPTFANPSWIEIAVISKRSLTNSRRMPELFGIRLGAVLVTGIILATMFWHLDNSPKGIQ  472

Query  1730  ERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslafl  1909
             ERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL+HS+IS+PSLAFL
Sbjct  473   ERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLAHSLISIPSLAFL  532

Query  1910  slafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAIL  2089
             S+AFA TT+WAVGLAGG  GFLFF   +FA+FWAGSSFVTFLSG++ +VM+ YT+VVA+L
Sbjct  533   SIAFAATTFWAVGLAGGLHGFLFFFFTIFAAFWAGSSFVTFLSGVVTHVMLGYTVVVAVL  592

Query  2090  AYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPL  2269
             AYF+LFSGFFI+RDRIPPYW+WFHY SLVKYP++GVLQNE D P KCFV+G Q+FD SP+
Sbjct  593   AYFLLFSGFFISRDRIPPYWLWFHYISLVKYPYEGVLQNELDDPIKCFVRGTQMFDNSPI  652

Query  2270  KAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfff  2449
             +A P AMKLKLL++MS TLG+NIT+STC+TTG DILKQ G+TD++KW+CLWITIA GFFF
Sbjct  653   EAFPVAMKLKLLKSMSTTLGVNITASTCVTTGMDILKQQGITDLSKWSCLWITIAWGFFF  712

Query  2450  rllfyfallIGSKNKRR  2500
             R+LFYF L +GSKNKRR
Sbjct  713   RILFYFTLXLGSKNKRR  729



>ref|XP_009340895.1| PREDICTED: ABC transporter G family member 20-like [Pyrus x bretschneideri]
Length=727

 Score =   895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/735 (74%), Positives = 618/735 (84%), Gaps = 20/735 (3%)
 Frame = +2

Query  332   MELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQL-YDPVPYPSSFP  508
             MEL +   RPR  ++ TL ELL  V D   E  NN      DH VLQL Y     PSS+P
Sbjct  1     MELIDFNPRPR-GLNPTLAELLQWVEDV--ESSNNS---PYDH-VLQLGYGCTSVPSSYP  53

Query  509   FVLSFHNLSYSVKVRRKMG-VPAWLGR-RTAAPSQVEND----VKVLLDDISGEAREGEI  670
             FVLSF NL+YSVKV+RKM  VP+   R R  A  ++  D     KVLL+ ISGEAREGEI
Sbjct  54    FVLSFTNLTYSVKVQRKMTLVPSCFKRKRKMAEIKLGMDNNTNTKVLLNGISGEAREGEI  113

Query  671   MAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPML  850
             MAVLGASGSGKSTLIDALA+RI+++SL G++ +NGE L+S+LLKVISAYVMQDDLLFPML
Sbjct  114   MAVLGASGSGKSTLIDALADRISKDSLKGSITLNGEALDSRLLKVISAYVMQDDLLFPML  173

Query  851   TVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrv  1030
             TVEETLMFSAEFRLPRSLS+S+KKARVQALI+QLGL+ AAKTVIGDEGHRGVSGGERRRV
Sbjct  174   TVEETLMFSAEFRLPRSLSKSKKKARVQALIDQLGLRNAAKTVIGDEGHRGVSGGERRRV  233

Query  1031  sigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLD  1210
             SIGIDIIHDPIVLFLDEPTSGLDSTSA+MVVKVLQRIAQSGSIV+MS+HQPSYRIL+LLD
Sbjct  234   SIGIDIIHDPIVLFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVVMSIHQPSYRILSLLD  293

Query  1211  RLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDF  1390
             RLIFLS GQTV+S S ++LP FF EFG+PIPE ENR EFALD IRELE++P GTK+LV+F
Sbjct  294   RLIFLSHGQTVYSDSRANLPVFFGEFGHPIPETENRTEFALDLIRELEETPGGTKSLVEF  353

Query  1391  NKSWQ-RKFSPSSTSNRNNVFPN----PKPSLKDAISASISRGKLVSGATNINSTLSPSV  1555
             NKSWQ  K      +N+NN+  N    PK SLKDAISASISRGKLVSGA N +S LS SV
Sbjct  354   NKSWQITKNQQKQRANQNNLMINSKCKPKLSLKDAISASISRGKLVSGAPN-DSNLSSSV  412

Query  1556  PKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQER  1735
             P FANP W+EM VI KRS+ NS RMPELF +R GAV+VTGIILAT+FW LD SPKGI+ER
Sbjct  413   PTFANPSWIEMAVISKRSLTNSRRMPELFGIRLGAVLVTGIILATMFWHLDSSPKGIKER  472

Query  1736  LGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflsl  1915
             LGFFAF MSTTFYTCAEAIP FLQERYIFMRETAYNAYRRSSYVL+HS+IS+PSLAFLSL
Sbjct  473   LGFFAFTMSTTFYTCAEAIPSFLQERYIFMRETAYNAYRRSSYVLAHSLISIPSLAFLSL  532

Query  1916  afaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAY  2095
              FA TT+WAVGLAGG  GFLFF   +FA+FWAGSSFVTFLSG++  VM+ YT+VVAILAY
Sbjct  533   TFAATTFWAVGLAGGLHGFLFFFFTIFAAFWAGSSFVTFLSGVVTQVMLGYTVVVAILAY  592

Query  2096  FVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKA  2275
             F+LFSGFFI+RD+IPPYW+WFHY SLVKYP++G LQNEFD P KCFV G Q+FD SPL A
Sbjct  593   FLLFSGFFISRDKIPPYWLWFHYMSLVKYPYEGALQNEFDDPIKCFVTGTQMFDNSPLGA  652

Query  2276  VPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrl  2455
              P  MKLKLL++MS+TLG+NIT+STC+TTG DILKQ G+TD+NKW+CLWITIALGFFFR+
Sbjct  653   FPVEMKLKLLKSMSRTLGVNITASTCVTTGADILKQQGITDLNKWSCLWITIALGFFFRI  712

Query  2456  lfyfallIGSKNKRR  2500
             LFY  LL+GSKNKRR
Sbjct  713   LFYLTLLLGSKNKRR  727



>gb|EYU41661.1| hypothetical protein MIMGU_mgv1a002205mg [Erythranthe guttata]
Length=701

 Score =   894 bits (2309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/723 (71%), Positives = 600/723 (83%), Gaps = 22/723 (3%)
 Frame = +2

Query  332   MELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFPF  511
             MELQE  R+P+ + S TL +L    G  +             H+VL +++    P+S PF
Sbjct  1     MELQEFCRKPKRNSSQTLRQLFQLAGSPS-----------EHHQVLCVHESPFRPASVPF  49

Query  512   VLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGAS  691
             VLSFHNL+YSVKVRR++ +PA   R  A  S  ++ VK+LL+ ISGEAREGEI AVLGAS
Sbjct  50    VLSFHNLTYSVKVRRRI-LPACFSR--ARRSSEKSPVKILLNGISGEAREGEITAVLGAS  106

Query  692   GSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLM  871
             GSGKSTLIDALANRIA +SL G V MNGE LESKLLKVISAYVMQDDLLFPMLTVEETL 
Sbjct  107   GSGKSTLIDALANRIAGDSLTGAVTMNGEALESKLLKVISAYVMQDDLLFPMLTVEETLT  166

Query  872   FSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDII  1051
             F+AEFRLP ++ RSRKK+RVQALI+QLGL++AA TVIGDE  RGVSGGERRRVSIG DII
Sbjct  167   FAAEFRLPATMPRSRKKSRVQALIDQLGLRSAAATVIGDESRRGVSGGERRRVSIGADII  226

Query  1052  HDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSK  1231
             HDPIVLFLDEPTSGLDSTSA MVVKVLQRIAQ+GSIV+MS+HQPSYRIL LL+RLI LS 
Sbjct  227   HDPIVLFLDEPTSGLDSTSAHMVVKVLQRIAQTGSIVVMSIHQPSYRILGLLNRLIILSH  286

Query  1232  GQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQRK  1411
             GQTVF+GSPS LP+FFQEFGNPIP N+++ EFALD+IRELE +P GT NL DFNK WQ+K
Sbjct  287   GQTVFTGSPSLLPQFFQEFGNPIPTNDDKIEFALDYIRELECNPGGTDNLSDFNKKWQKK  346

Query  1412  FSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWVEMV  1591
              +P     RN     P+ SLK+AISASIS GKLVSG  N N+ L  S+PK+ANPFW EM+
Sbjct  347   NNPP----RNPNTIGPRISLKNAISASISMGKLVSGPNN-NNNLESSIPKYANPFWKEMI  401

Query  1592  VIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTF  1771
             VI KRS++NS R PELF  RFGAV++TGIILATIF KL+DSPKG+QERLGFFAFAMSTTF
Sbjct  402   VISKRSILNSTRSPELFGARFGAVLITGIILATIFRKLEDSPKGVQERLGFFAFAMSTTF  461

Query  1772  YTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvgl  1951
             YTCAEAIPVFL ERYIFMRETAYNAYRRSSYV+SH++IS+P+L  LS AFA TTYWAVGL
Sbjct  462   YTCAEAIPVFLLERYIFMRETAYNAYRRSSYVISHAVISIPALLILSAAFAATTYWAVGL  521

Query  1952  aggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRD  2131
             +GGF  F  F+L  F   WAGSSFVTFLSG+I+N+M+AYT+VVAILAYFVLFSGFFI RD
Sbjct  522   SGGFFFFYTFVLASF---WAGSSFVTFLSGVIFNLMMAYTVVVAILAYFVLFSGFFITRD  578

Query  2132  RIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQN  2311
             RIP YWIWFHYASLVKYP+QGV+QNEFD   +CF++G+Q+FDG+PL  VP ++KLK+L++
Sbjct  579   RIPSYWIWFHYASLVKYPYQGVMQNEFDDSKRCFMRGVQVFDGTPLAGVPHSVKLKMLKS  638

Query  2312  MSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKN  2491
             MS TLG+NIT+STCLT G DILK+ GV+D++KW+CL ITI LGF FR+LFYFAL+IGSKN
Sbjct  639   MSGTLGMNITASTCLTNGSDILKRAGVSDVDKWSCLLITIGLGFLFRVLFYFALMIGSKN  698

Query  2492  KRR  2500
             KR+
Sbjct  699   KRK  701



>ref|XP_003625526.1| ABC transporter G family member [Medicago truncatula]
 gb|AES81744.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=750

 Score =   893 bits (2308),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/743 (72%), Positives = 618/743 (83%), Gaps = 24/743 (3%)
 Frame = +2

Query  305   LPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDP  484
             LPF    Q+MEL    +R R  VS TLGELL RV D+  +  N        H VL L   
Sbjct  21    LPFF--NQSMELVPNPQRTRTHVSPTLGELLKRVEDAQNDNKN-----PQPHHVLDLSSS  73

Query  485   VPYPS-SFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVE------NDVKVLLDDI  643
                 +   PF LSF NL+YSVK+ +KM    +  +++A P+  E      N  K+LL+DI
Sbjct  74    SSSTTIPPPFFLSFTNLTYSVKLNKKM--TCFSSKKSALPTDEEPEITKPNGTKILLNDI  131

Query  644   SGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVM  823
             SGEAR+GEIMAVLGASGSGKSTLIDALA+RI++ESL GTV +NG+VLES L KVISAYVM
Sbjct  132   SGEARDGEIMAVLGASGSGKSTLIDALADRISKESLKGTVTLNGDVLESSLQKVISAYVM  191

Query  824   QDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrg  1003
             QDDLLFPMLTVEETLMFSAEFRLPRSLS+S+KKARVQALI+QLGL+ AA TVIGDEGHRG
Sbjct  192   QDDLLFPMLTVEETLMFSAEFRLPRSLSKSKKKARVQALIDQLGLRNAASTVIGDEGHRG  251

Query  1004  vsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQP  1183
             VSGGERRRVSIG DIIHDPI+LFLDEPTSGLDSTSA+MVVKVLQRIAQSGSIV+M+VHQP
Sbjct  252   VSGGERRRVSIGTDIIHDPIILFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVMMTVHQP  311

Query  1184  SYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSP  1363
             SYRIL LLDRLIFLS GQTV+SGSP++LP FF EFG+PIPENEN+ EFALD IRELE++P
Sbjct  312   SYRILGLLDRLIFLSHGQTVYSGSPANLPSFFHEFGHPIPENENKTEFALDLIRELEENP  371

Query  1364  EGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGA---TNIN  1534
              GTK+LV+FNKSWQ K+ P+S +  N     PK SLKDAISASISRGKLVSG        
Sbjct  372   GGTKSLVEFNKSWQLKYKPASVTAVN----GPKMSLKDAISASISRGKLVSGTNGGNGNG  427

Query  1535  STLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDS  1714
             ++++ SV  FANPFW+EM VIGKRS++NS RMPELF +R GAV+VTG ILATIF++LDDS
Sbjct  428   NSIASSVATFANPFWIEMAVIGKRSLLNSRRMPELFGIRLGAVLVTGGILATIFYRLDDS  487

Query  1715  PKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislp  1894
             PKG+QERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL+HSIISLP
Sbjct  488   PKGVQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLAHSIISLP  547

Query  1895  slaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTL  2074
             +L FLS AF+VTT+W+VGLAGG SGFLF+   + ASFWAGSSFVTFLSG++ +VM+ +T+
Sbjct  548   ALIFLSFAFSVTTFWSVGLAGGTSGFLFYFFTILASFWAGSSFVTFLSGVVSHVMLGFTV  607

Query  2075  VVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDY-PDKCFVKGIQI  2251
             VVAILAYF+LFSGFFI+RDRIPPYWIWFHY SLVKYPF+GVLQNEFD  P +CFVKGIQ+
Sbjct  608   VVAILAYFLLFSGFFISRDRIPPYWIWFHYLSLVKYPFEGVLQNEFDIKPPRCFVKGIQM  667

Query  2252  FDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITI  2431
             FD +PL  VP ++K++LL+++S TLG NITSSTC+ TG DILKQ GVT ++KWNCL+ITI
Sbjct  668   FDNTPLGDVPGSLKVELLKSLSSTLGTNITSSTCVVTGADILKQQGVTQLSKWNCLFITI  727

Query  2432  AlgfffrllfyfallIGSKNKRR  2500
             ALGFFFR LFY ALL GSKNKR+
Sbjct  728   ALGFFFRFLFYLALLFGSKNKRK  750



>ref|XP_002320112.2| ABC transporter family protein [Populus trichocarpa]
 gb|EEE98427.2| ABC transporter family protein [Populus trichocarpa]
Length=746

 Score =   891 bits (2302),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/736 (71%), Positives = 612/736 (83%), Gaps = 8/736 (1%)
 Frame = +2

Query  296   SSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQL  475
             S +LP       MELQ+  RR + S+S TLGELL RV D+  +   +     + H+ L+L
Sbjct  18    SDNLPLFNHNNRMELQQYPRRSKPSLSPTLGELLKRVEDAQSDTSIDSTP-VHHHQALEL  76

Query  476   -YDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGE  652
              Y     P S PFVLSF+NL+YSVKV + M  P       +  S     +KVLL+DISGE
Sbjct  77    GYACSSMPPSSPFVLSFNNLTYSVKVGQNMPFPVCGKEDLSHGSSETASMKVLLNDISGE  136

Query  653   AREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDD  832
             AREGEIMAVLGASGSGKSTLIDALA+RIA+ESL G+V +NGEVLES+LLKVISAYVMQDD
Sbjct  137   AREGEIMAVLGASGSGKSTLIDALADRIAKESLKGSVTLNGEVLESRLLKVISAYVMQDD  196

Query  833   LLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsg  1012
             LLFPMLTVEETLMFSA+FRLPRSLSRS+KKARVQALI+QLGL+ AA TVIGDEGHRGVSG
Sbjct  197   LLFPMLTVEETLMFSADFRLPRSLSRSKKKARVQALIDQLGLRNAANTVIGDEGHRGVSG  256

Query  1013  gerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYR  1192
             GERRRVSIG DI+HDPI+LFLDEPTSGLDSTSAFMVVKVLQRIA+SGSIVIMSVHQPSYR
Sbjct  257   GERRRVSIGTDIVHDPILLFLDEPTSGLDSTSAFMVVKVLQRIARSGSIVIMSVHQPSYR  316

Query  1193  ILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGT  1372
             IL +LD LIFLS GQTV+ GSP  LP FF +FG+PIPENENR EFALD IRELE++P+GT
Sbjct  317   ILTVLDSLIFLSHGQTVYGGSPGGLPEFFGQFGHPIPENENRTEFALDLIRELEEAPDGT  376

Query  1373  KNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPS  1552
             K LV+FNKSWQ K +P  T+   NV    K SLKDAISASISRGKLVSGA N NS  + S
Sbjct  377   KTLVEFNKSWQTKKNP--TNRTCNV---SKLSLKDAISASISRGKLVSGAPN-NSNSTSS  430

Query  1553  VPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQE  1732
             VP FANP W EM+VI KRS++N+ RMPELF +R GAV+VTGIILAT+F+ LD+SP+G QE
Sbjct  431   VPTFANPLWAEMMVISKRSLLNAKRMPELFGIRLGAVLVTGIILATVFYHLDNSPRGAQE  490

Query  1733  RLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslafls  1912
             RLGFFAFAMSTT+YTCAE+IP FLQERYIFMRETAYNAYRRSSYVL+HS+IS+PSL  LS
Sbjct  491   RLGFFAFAMSTTYYTCAESIPAFLQERYIFMRETAYNAYRRSSYVLAHSLISIPSLIVLS  550

Query  1913  lafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILA  2092
             +AFA TT+WAVGL GGFSGF F+   + ++FWAGSSFVTFLSG++ +VM+ +T+VVAILA
Sbjct  551   IAFAATTFWAVGLDGGFSGFCFYFFAILSAFWAGSSFVTFLSGVVSHVMLGFTIVVAILA  610

Query  2093  YFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLK  2272
             YF+LFSGFFI+RDR+P YWIWFHY SLVKYP++  LQNEF  P KCFV+G+Q+FD +PL 
Sbjct  611   YFLLFSGFFISRDRVPSYWIWFHYISLVKYPYEAALQNEFHDPTKCFVRGVQMFDTTPLA  670

Query  2273  AVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffr  2452
             AVP ++KLK+L+++S TLG+NIT +TC+ TG DIL+Q G+T I+KWNCLW+TIA GFFFR
Sbjct  671   AVPLSLKLKMLKSISSTLGMNITGNTCVVTGTDILRQQGITQISKWNCLWVTIAWGFFFR  730

Query  2453  llfyfallIGSKNKRR  2500
             +LFYFALL+GSKNKRR
Sbjct  731   ILFYFALLLGSKNKRR  746



>gb|AIU41650.1| ABC transporter family protein [Hevea brasiliensis]
Length=715

 Score =   890 bits (2299),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/723 (73%), Positives = 611/723 (85%), Gaps = 8/723 (1%)
 Frame = +2

Query  332   MELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFPF  511
             MELQ+  R    SVS+TL EL+ RV D+  +  +NG      H +   Y       S PF
Sbjct  1     MELQKYHRTSEPSVSITLSELIKRVEDAQSDH-SNGSTPIRHHALELGYACSSVSPSNPF  59

Query  512   VLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGAS  691
             VLSF+NLSYSVKV +K+  P        +P   E  +KVLL+DISGEAREGEIMAVLGAS
Sbjct  60    VLSFNNLSYSVKVGQKLTFPFCGNDSDDSP---ETGIKVLLNDISGEAREGEIMAVLGAS  116

Query  692   GSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLM  871
             GSGKSTLIDALA+RI++ESL G+V +NGEVLES+LLKVISAYVMQDDLLFPMLT+EETLM
Sbjct  117   GSGKSTLIDALADRISKESLKGSVSLNGEVLESRLLKVISAYVMQDDLLFPMLTIEETLM  176

Query  872   FSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDII  1051
             FSAEFRLPRSLS+S+KKARV+ALI+QLGL++AAKTVIGDEGHRGVSGGERRRVSIGIDI+
Sbjct  177   FSAEFRLPRSLSKSKKKARVEALIDQLGLRSAAKTVIGDEGHRGVSGGERRRVSIGIDIV  236

Query  1052  HDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSK  1231
             HDPI+LFLDEPTSGLDSTSAFMVVKVLQRIA+SGSIVIMS+HQPSYRIL+LLDRLIFLS 
Sbjct  237   HDPILLFLDEPTSGLDSTSAFMVVKVLQRIARSGSIVIMSIHQPSYRILSLLDRLIFLSH  296

Query  1232  GQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQRK  1411
             GQTV++G P SLP FF EFG+PIPENENR EFALD IRELE+ P+GT+ LV+FN+SWQ +
Sbjct  297   GQTVYAGPPGSLPEFFAEFGHPIPENENRTEFALDLIRELEEIPDGTRTLVEFNRSWQAQ  356

Query  1412  FSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWVEMV  1591
                   + RN +  +   SLKDAISASIS+GKLVSGATN +S LS SVP FANPFW+EM+
Sbjct  357   ---GKKNPRNRISNSSNLSLKDAISASISKGKLVSGATN-DSNLSSSVPTFANPFWIEML  412

Query  1592  VIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTF  1771
             VI KRS+ NS RMPELF +RFGAV +TG+ILATIFW LD+SP+G QERLGFFAFAMSTT+
Sbjct  413   VIAKRSLTNSRRMPELFGIRFGAVFITGVILATIFWHLDNSPRGAQERLGFFAFAMSTTY  472

Query  1772  YTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvgl  1951
             YTCAE+IP FLQERYIFMRETAYNAYRRSSYVL+HS+IS+PSL  LS+AFA TTYW VGL
Sbjct  473   YTCAESIPAFLQERYIFMRETAYNAYRRSSYVLAHSLISIPSLIILSIAFAATTYWTVGL  532

Query  1952  aggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRD  2131
             AGG SGF FF   + ++FWAGSSFVTFLSGI+ +VM+ +T+VVAILAYF+LFSGFFI+RD
Sbjct  533   AGGASGFFFFFFTILSAFWAGSSFVTFLSGIVSHVMLGFTIVVAILAYFLLFSGFFISRD  592

Query  2132  RIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQN  2311
             RIPPYWIWFHY SLVKYP++G LQNEF  P KCFV+G+Q+FD +PL AVP A+KLKLLQ+
Sbjct  593   RIPPYWIWFHYLSLVKYPYEGALQNEFQDPTKCFVRGVQMFDNTPLSAVPVALKLKLLQS  652

Query  2312  MSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKN  2491
             +S TLG N+T STC+ TGPDIL+  G+TDI+KW+CLWITIA GFFFR+LFYF LL+GSKN
Sbjct  653   LSNTLGRNVTGSTCIVTGPDILRGQGITDISKWSCLWITIAWGFFFRVLFYFTLLLGSKN  712

Query  2492  KRR  2500
             KRR
Sbjct  713   KRR  715



>ref|XP_007009605.1| ABC-2 type transporter family protein [Theobroma cacao]
 gb|EOY18415.1| ABC-2 type transporter family protein [Theobroma cacao]
Length=743

 Score =   890 bits (2299),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/751 (70%), Positives = 613/751 (82%), Gaps = 32/751 (4%)
 Frame = +2

Query  281   DMSTASSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDH  460
             D +T+S   P      +MEL           S TLG+LL  VGD+  E         ++ 
Sbjct  12    DNNTSSQFFP-----HSMELVSGEFSTAAGASPTLGQLLKHVGDARKE------ATGDET  60

Query  461   RVLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTA---------APSQVE  613
              V ++   V  P   PFVLSF+NLSYSVKV RKM +P +L +RT+         A  +  
Sbjct  61    PVHEILVDVTQPRPMPFVLSFNNLSYSVKVSRKMALPGFLRQRTSSAASSGNPLAADRYF  120

Query  614   NDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESK  793
             N  K LL+DISGEAR+GEI+AVLGASGSGKSTLIDALANRIA+ SL G V +NGEVLES+
Sbjct  121   NKTKTLLNDISGEARDGEILAVLGASGSGKSTLIDALANRIAKGSLQGNVTLNGEVLESR  180

Query  794   LLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAK  973
             +LKVISAYVMQDDLL+PMLTVEETLMF+AEFRLPR+LS+S+KK RVQALI+QLGL+ AAK
Sbjct  181   MLKVISAYVMQDDLLYPMLTVEETLMFAAEFRLPRTLSKSKKKMRVQALIDQLGLRNAAK  240

Query  974   TVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSG  1153
             TVIGDEGHRGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSG
Sbjct  241   TVIGDEGHRGVSGGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAFMVVKVLQRIAQSG  300

Query  1154  SIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFAL  1333
             SIVIMSVHQPSYRIL LLDRLIFLS+GQTV+SGSP+SLP +F EFG+PIPENENR EFAL
Sbjct  301   SIVIMSVHQPSYRILGLLDRLIFLSRGQTVYSGSPTSLPLYFSEFGHPIPENENRTEFAL  360

Query  1334  DFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKP---SLKDAISASISRG  1504
             D IRELE SP GTK+LV+FNKSWQ    P        ++  P     SLKDAISASISRG
Sbjct  361   DLIRELEGSPGGTKSLVEFNKSWQNTKHP--------IYTEPDRLGLSLKDAISASISRG  412

Query  1505  KLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIIL  1684
             KLVSGA+N + T +  VP+FANPFW EMVV+  RS++NS RMPELF  RFGAV+VTG IL
Sbjct  413   KLVSGASN-DVTSTSMVPRFANPFWKEMVVLSNRSILNSRRMPELFGTRFGAVMVTGFIL  471

Query  1685  ATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSY  1864
             AT+FW+LD+SP+G+QER+GFFAFAMSTTFYTCA A+P FLQERYIFMRETAYNAYRR SY
Sbjct  472   ATVFWRLDNSPRGVQERIGFFAFAMSTTFYTCANALPDFLQERYIFMRETAYNAYRRLSY  531

Query  1865  VLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGI  2044
             V+S+++++LP L FLSLAFA TT+WAVGL GGFSGFLF+ L +F SFW+G SFVTFLSG+
Sbjct  532   VISNALVALPGLIFLSLAFAATTFWAVGLDGGFSGFLFYFLIMFGSFWSGCSFVTFLSGV  591

Query  2045  IYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPD  2224
             + +VM+ YT+VVAILAYF+LFSGFFINRDRIP YWIWFHY SL+KYP++ VLQNEFD+P 
Sbjct  592   VPHVMLGYTIVVAILAYFLLFSGFFINRDRIPAYWIWFHYLSLIKYPYEAVLQNEFDHPT  651

Query  2225  KCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDIN  2404
             KCFV+GIQIFD +PL AVP  MK++LLQ++S TLG+ ITSSTCLTTG DILKQ G TD++
Sbjct  652   KCFVRGIQIFDNTPLAAVPGPMKVRLLQSLSNTLGMTITSSTCLTTGVDILKQQGATDLS  711

Query  2405  KWNCLWITIAlgfffrllfyfallIGSKNKR  2497
             KWNCLWIT+A GF FR+LFYF+LL+GSKNKR
Sbjct  712   KWNCLWITVAWGFLFRILFYFSLLLGSKNKR  742



>ref|XP_011015324.1| PREDICTED: ABC transporter G family member 20-like [Populus euphratica]
Length=746

 Score =   889 bits (2298),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/736 (71%), Positives = 610/736 (83%), Gaps = 8/736 (1%)
 Frame = +2

Query  296   SSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQL  475
             S +LP       MELQ+  RR + S+S TLGELL RV D+  +   +     + H+VL+L
Sbjct  18    SDNLPLFNHNNRMELQQYPRRSKPSLSPTLGELLKRVEDAQSDTSIDSTP-VHHHQVLEL  76

Query  476   -YDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGE  652
              Y     P S PFVLSF+NL+YSVKV + M             S     +KVLL+DISGE
Sbjct  77    GYACSSMPPSSPFVLSFNNLTYSVKVGQNMPFQVCGKEDLPHVSSETASMKVLLNDISGE  136

Query  653   AREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDD  832
             AREGEIMAVLGASGSGKSTLIDALA+RIA+ESL G+V +NGEVLES+LLKVISAYVMQDD
Sbjct  137   AREGEIMAVLGASGSGKSTLIDALADRIAKESLKGSVTLNGEVLESRLLKVISAYVMQDD  196

Query  833   LLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsg  1012
             LLFPMLTVEETLMFSA+FRLPRSLSRS+KKARVQALI+QLGL+ AA TVIGDEGHRGVSG
Sbjct  197   LLFPMLTVEETLMFSADFRLPRSLSRSKKKARVQALIDQLGLRNAANTVIGDEGHRGVSG  256

Query  1013  gerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYR  1192
             GERRRVSIG DI+HDPI+LFLDEPTSGLDSTSAFMVVKVLQRIA+SGSIVIMSVHQPSYR
Sbjct  257   GERRRVSIGTDIVHDPILLFLDEPTSGLDSTSAFMVVKVLQRIARSGSIVIMSVHQPSYR  316

Query  1193  ILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGT  1372
             IL +LD LIFLS GQTV+ GSP  LP FF +FG+PIPENENR EFALD IRELE++P+GT
Sbjct  317   ILTVLDSLIFLSHGQTVYGGSPGGLPEFFGQFGHPIPENENRTEFALDLIRELEEAPDGT  376

Query  1373  KNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPS  1552
             K LV+FNKSWQ K +P+     N      K SLKDAISASISRGKLVSGA N NS L+ S
Sbjct  377   KTLVEFNKSWQTKKNPT-----NRTCNGSKLSLKDAISASISRGKLVSGAPN-NSNLTSS  430

Query  1553  VPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQE  1732
             VP FANP W EM+VI KRS++N+ RMPELF +R GAV+VTGIILAT+F+ LD+SP+G QE
Sbjct  431   VPTFANPLWAEMMVISKRSLLNAKRMPELFGIRLGAVLVTGIILATVFYHLDNSPRGAQE  490

Query  1733  RLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslafls  1912
             RLGFFAFAMSTT+YTCAE+IP FLQERYIFMRETAYNAYRRSSYVL+HS+IS+PSL  LS
Sbjct  491   RLGFFAFAMSTTYYTCAESIPAFLQERYIFMRETAYNAYRRSSYVLAHSLISIPSLIILS  550

Query  1913  lafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILA  2092
             +AFA TT+WAVGL GGFSGF F+   + ++FWAGSSFVTFLSG++ +VM+ +T+VVAILA
Sbjct  551   IAFAATTFWAVGLDGGFSGFCFYFFAILSAFWAGSSFVTFLSGVVSHVMLGFTIVVAILA  610

Query  2093  YFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLK  2272
             YF+LFSGFFI+RDR+P YW+WFHY SLVKYP++  LQNEF  P KCFV+G+Q+FD +PL 
Sbjct  611   YFLLFSGFFISRDRVPSYWLWFHYISLVKYPYEAALQNEFHDPTKCFVRGVQMFDTTPLA  670

Query  2273  AVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffr  2452
             AVP ++KLK+L+++S TLG+NIT +TC+ TG DIL+Q G+T I+KWNCLW+TIA GFFFR
Sbjct  671   AVPLSLKLKMLKSISNTLGMNITGNTCVVTGTDILRQQGITQISKWNCLWVTIAWGFFFR  730

Query  2453  llfyfallIGSKNKRR  2500
             +LFYFALL+GSKNKRR
Sbjct  731   ILFYFALLLGSKNKRR  746



>ref|XP_010047167.1| PREDICTED: ABC transporter G family member 20-like [Eucalyptus 
grandis]
Length=756

 Score =   889 bits (2296),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/752 (70%), Positives = 622/752 (83%), Gaps = 11/752 (1%)
 Frame = +2

Query  269   SSRDDMSTASSDLPFLGPRQAMELQELTRRPR-HSVSMTLGELLHRVGDSAGEKLNNGVG  445
             SS    + A  +LP   P Q +EL+  +R+ R +  S TL ELL RV ++   ++ +   
Sbjct  8     SSAKPKALAGDNLPLFTPTQRIELEGYSRKARSNGSSSTLAELLRRVEEA---QVGDEAP  64

Query  446   GANDHRVLQL----YDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQV-  610
                   VLQ+       V  P+++PFVLSF NL+YSV V RK+   + LGR  ++     
Sbjct  65    STPSSHVLQMTSLASSSVSAPAAYPFVLSFENLTYSVNVPRKLSFSSLLGREKSSDGASL  124

Query  611   --ENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVL  784
                   KVLL+DISGEAREGEIMAVLGASGSGKSTLIDALA+RI++ESLGG + +NGEVL
Sbjct  125   PGRAGTKVLLNDISGEAREGEIMAVLGASGSGKSTLIDALADRISKESLGGAITLNGEVL  184

Query  785   ESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQT  964
             ES+LLKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPRSLS+SRKKARVQ LI+QLGL+ 
Sbjct  185   ESRLLKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPRSLSKSRKKARVQVLIDQLGLRN  244

Query  965   AAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIA  1144
             AA TVIGDEGHRGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIA
Sbjct  245   AAGTVIGDEGHRGVSGGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAFMVVKVLQRIA  304

Query  1145  QSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCE  1324
             QSGSIV+MS+HQPSYRI++LLDRLIFLS+G TVF+GSP+ LP+FF EFG+PIPE+ENR E
Sbjct  305   QSGSIVVMSIHQPSYRIMSLLDRLIFLSRGNTVFNGSPADLPKFFAEFGHPIPEHENRTE  364

Query  1325  FALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRG  1504
             F LD IRELE++P GTK++V+FNKSW+ K       N +  +  PKPSLKDAISAS+SRG
Sbjct  365   FVLDLIRELEETPGGTKSIVEFNKSWEAKQQSLGLRNGDITWTGPKPSLKDAISASVSRG  424

Query  1505  KLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIIL  1684
             KLVSG +  +S     VP FANPFW+EM+VI KRSM NS RMPELF +RFGAV+VTGIIL
Sbjct  425   KLVSGGSAGDSNQVVLVPTFANPFWMEMLVISKRSMTNSRRMPELFGIRFGAVMVTGIIL  484

Query  1685  ATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSY  1864
             AT+F  LD+SPKG+QERLGFFAFAMSTTFYTCAEAIPVFLQ+RYIFMRETAYNAYRR SY
Sbjct  485   ATMFRHLDNSPKGVQERLGFFAFAMSTTFYTCAEAIPVFLQDRYIFMRETAYNAYRRYSY  544

Query  1865  VLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGI  2044
             VL+H+IIS+PSL  LSLAFA TT+W VGLAGGFSGF+FF   VFA+FWAGSSFVTFLSG+
Sbjct  545   VLAHAIISVPSLVILSLAFAATTFWPVGLAGGFSGFMFFFYAVFAAFWAGSSFVTFLSGV  604

Query  2045  IYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPD  2224
             + +VM+ +T+VVAILAYF+LFSGFFI+R+RIPPYWIWFHY SLVKYP++ VLQNEFD P 
Sbjct  605   VSHVMLGFTIVVAILAYFLLFSGFFISRNRIPPYWIWFHYLSLVKYPYESVLQNEFDDPA  664

Query  2225  KCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDIN  2404
             KCFV+G+Q+FD +PL  VPEA+KL++L+NM  TLG+N+T STC+TTG DIL+  G+TDI+
Sbjct  665   KCFVRGVQMFDNTPLAVVPEALKLRMLKNMGSTLGMNLTGSTCVTTGVDILRTQGITDIS  724

Query  2405  KWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             KW+CLWITIA GFFFR+LFYF LL GSKNKR+
Sbjct  725   KWDCLWITIAWGFFFRVLFYFTLLYGSKNKRK  756



>ref|XP_007219556.1| hypothetical protein PRUPE_ppa001878mg [Prunus persica]
 gb|EMJ20755.1| hypothetical protein PRUPE_ppa001878mg [Prunus persica]
Length=749

 Score =   888 bits (2294),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/735 (73%), Positives = 615/735 (84%), Gaps = 14/735 (2%)
 Frame = +2

Query  332   MELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFPF  511
             MEL +L+R   H  S +LG+LL  VGD   E   +G G    H  L L D    P S PF
Sbjct  17    MELDDLSR-ASHGASPSLGQLLKHVGDVRKEATGDG-GETPAHHALDLSDDSIEPRSLPF  74

Query  512   VLSFHNLSYSVKVRRKMGVPAWL--GR-RTAAPSQVE--------NDVKVLLDDISGEAR  658
             VLSF NL+YSVKVRRK  +      GR R  A ++ E           K LL+DISGEAR
Sbjct  75    VLSFTNLTYSVKVRRKFSLSGMFSGGRSRLGAATESEPVGGESLFTRTKTLLNDISGEAR  134

Query  659   EGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLL  838
             EGEI+AVLGASGSGKSTLIDALANRIA+ SL GTV +NGEVLES+LLKVISAYVMQDDLL
Sbjct  135   EGEILAVLGASGSGKSTLIDALANRIAKGSLKGTVSLNGEVLESRLLKVISAYVMQDDLL  194

Query  839   FPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsgge  1018
             FPMLTVEETLMF+AEFRLPR+LS+S+KKARVQALI+QLGL+ AAKT+IGDEGHRGVSGGE
Sbjct  195   FPMLTVEETLMFAAEFRLPRTLSKSKKKARVQALIDQLGLRNAAKTIIGDEGHRGVSGGE  254

Query  1019  rrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRIL  1198
             RRRVSIGIDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIV+MSVHQPSYRIL
Sbjct  255   RRRVSIGIDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVVMSVHQPSYRIL  314

Query  1199  NLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKN  1378
              LLDRL+FLS+GQTV+SGSP++LP +F EFG+PIPE+ENR EFALD IRELE SP GTK+
Sbjct  315   GLLDRLLFLSRGQTVYSGSPTTLPSYFAEFGHPIPESENRTEFALDLIRELEGSPGGTKS  374

Query  1379  LVDFNKSWQR-KFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSV  1555
             LV+FN++WQ  K S ++TS +    P    SL++AISASISRGKLVSGATN + + +  V
Sbjct  375   LVEFNRTWQSMKHSDNNTSCQIACEPRHSVSLQEAISASISRGKLVSGATNNDPSPNSMV  434

Query  1556  PKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQER  1735
             P FANPFW+EM V+ KRSM N+ RMPELF +R GAV+VTG ILATIFW LD+SPKG+QER
Sbjct  435   PTFANPFWIEMAVLSKRSMKNARRMPELFGIRLGAVMVTGFILATIFWNLDNSPKGVQER  494

Query  1736  LGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflsl  1915
             LGF AFAMSTTFYTCA+A+PVFLQERYIFMRETAYNAYRRSSYVLSHS+++LPSL FLS+
Sbjct  495   LGFIAFAMSTTFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHSLVALPSLVFLSI  554

Query  1916  afaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAY  2095
             AF+  T+WAVGL GG SGFLF+ L +FASFWAGSSFVTFLSG++ +VM+ YT+VVAILAY
Sbjct  555   AFSALTFWAVGLDGGLSGFLFYFLIIFASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAY  614

Query  2096  FVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKA  2275
             F+LFSGFFI RDRIP YWIWFHY SLVKYP++GVLQNEF    KCFV+G+QIFD +PL +
Sbjct  615   FLLFSGFFITRDRIPAYWIWFHYMSLVKYPYEGVLQNEFQDATKCFVRGVQIFDNTPLAS  674

Query  2276  VPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrl  2455
             VP AMKLKLL++MS+TLG  ITSSTCLTTG DILKQ GVTD++KWNCL++T+A GF FR+
Sbjct  675   VPSAMKLKLLESMSQTLGTRITSSTCLTTGTDILKQQGVTDLSKWNCLYVTVAWGFLFRI  734

Query  2456  lfyfallIGSKNKRR  2500
             LFYF+LL+GSKNKRR
Sbjct  735   LFYFSLLLGSKNKRR  749



>ref|XP_011035805.1| PREDICTED: ABC transporter G family member 20-like [Populus euphratica]
Length=746

 Score =   887 bits (2293),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/736 (71%), Positives = 609/736 (83%), Gaps = 8/736 (1%)
 Frame = +2

Query  296   SSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQL  475
             S +LP       MELQ+  RR + S+S TLGELL RV D+  +   +     + H+VL+L
Sbjct  18    SDNLPLFNHNNRMELQQYPRRSKPSLSPTLGELLKRVEDAQSDTSIDSTP-VHHHQVLEL  76

Query  476   -YDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGE  652
              Y     P S PFVLSF+NL+YSVKV + M             S     +KVLL+DISGE
Sbjct  77    GYACSSMPPSSPFVLSFNNLTYSVKVGQNMPFQVCGKEELPHGSSETASMKVLLNDISGE  136

Query  653   AREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDD  832
             AREGEIMAVLGASGSGKSTLIDALA+RIA+ESL G+V +NGEVLES+LLKVISAYVMQDD
Sbjct  137   AREGEIMAVLGASGSGKSTLIDALADRIAKESLKGSVTLNGEVLESRLLKVISAYVMQDD  196

Query  833   LLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsg  1012
             LLFPMLTVEETLMFSA+FRLPRSLSRS+KKARVQALI+QLGL+ AA TVIGDEGHRGVSG
Sbjct  197   LLFPMLTVEETLMFSADFRLPRSLSRSKKKARVQALIDQLGLRNAANTVIGDEGHRGVSG  256

Query  1013  gerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYR  1192
             GERRRVSIGIDI+HDPI+LFLDEPTSGLDSTSAFMVVKVLQRIA+SGSIVIMSVHQPSYR
Sbjct  257   GERRRVSIGIDIVHDPILLFLDEPTSGLDSTSAFMVVKVLQRIARSGSIVIMSVHQPSYR  316

Query  1193  ILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGT  1372
             IL +LD LIFLS GQTV+ GSP  LP FF +FG+PIPENENR EFALD IRELE++P+GT
Sbjct  317   ILTVLDSLIFLSHGQTVYGGSPGGLPEFFGQFGHPIPENENRTEFALDLIRELEEAPDGT  376

Query  1373  KNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPS  1552
             K LV+FNKSWQ K +P+     N      K SLKDAISASISRGKLVSGA N NS L+ S
Sbjct  377   KTLVEFNKSWQTKKNPT-----NRTCNGSKLSLKDAISASISRGKLVSGAPN-NSNLTSS  430

Query  1553  VPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQE  1732
             VP FANP W EM+VI KRS++N+ RMPELF +R  AV+VTGIILAT+F+ LD SP+G QE
Sbjct  431   VPTFANPLWAEMMVISKRSLLNAKRMPELFGIRLAAVLVTGIILATVFYHLDSSPRGAQE  490

Query  1733  RLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslafls  1912
             RLGFFAFAMSTT+YTCAE+IP FLQERYIFMRETAYNAYRRSSYVL+HS+IS+PSL  LS
Sbjct  491   RLGFFAFAMSTTYYTCAESIPAFLQERYIFMRETAYNAYRRSSYVLAHSLISIPSLIVLS  550

Query  1913  lafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILA  2092
             +AFA TT+WAVGL GGFSGF F+   + ++FWAGSSFVTFLSG++ +VM+ +T+VVAILA
Sbjct  551   IAFAATTFWAVGLDGGFSGFCFYFFAILSAFWAGSSFVTFLSGVVSHVMLGFTIVVAILA  610

Query  2093  YFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLK  2272
             YF+LFSGFFI+RDR+P YW+WFHY SLVKYP++  LQNEF  P KCFV+G+Q+FD +PL 
Sbjct  611   YFLLFSGFFISRDRVPSYWLWFHYISLVKYPYEAALQNEFHDPTKCFVRGVQMFDTTPLA  670

Query  2273  AVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffr  2452
             AVP ++KLK+L+++S TLG+NIT +TC+ TG DIL+Q G+T I+KWNCLW+TIA GFFFR
Sbjct  671   AVPLSLKLKMLKSISNTLGMNITGNTCVVTGTDILRQQGITQISKWNCLWVTIAWGFFFR  730

Query  2453  llfyfallIGSKNKRR  2500
             +LFYFALL+GSKNKRR
Sbjct  731   ILFYFALLLGSKNKRR  746



>ref|XP_004239760.1| PREDICTED: ABC transporter G family member 6 [Solanum lycopersicum]
Length=750

 Score =   887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/755 (70%), Positives = 616/755 (82%), Gaps = 25/755 (3%)
 Frame = +2

Query  278   DDMSTASSDLPFLGPR--QAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGA  451
             ++M     ++ F   R  QAME+ + +       S TLG++L RVGD   E     V G 
Sbjct  7     ENMLQGGENVQFYDQRVQQAMEMSQASAY----TSPTLGQMLKRVGDVRKE-----VTGD  57

Query  452   ND--HRVLQLYDPVPYPS-SFPFVLSFHNLSYSVKVRRKMGVPAWLGR-----RTAAPSQ  607
                 HR+L + D     S S PFVLSF+NL+YSVKVRRKM  PA L R      T  P  
Sbjct  58    ETPVHRILDMSDTQSISSHSLPFVLSFNNLTYSVKVRRKMTFPAMLRRPAAGVSTGDPVP  117

Query  608   VEN---DVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGE  778
              EN     K LL++ISGEAR+GEI+AVLGASGSGKSTLIDALANRIA+ESL GT+ +NGE
Sbjct  118   GENLFTRTKFLLNNISGEARDGEIVAVLGASGSGKSTLIDALANRIAKESLKGTITLNGE  177

Query  779   VLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGL  958
              L+S+LLKVISAYVMQDDLL+PMLTVEETLMF+AEFRLPR+LS S+KK RVQALI+QLGL
Sbjct  178   PLDSRLLKVISAYVMQDDLLYPMLTVEETLMFAAEFRLPRNLSNSKKKMRVQALIDQLGL  237

Query  959   QTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQR  1138
             + AAKT+IGDEGHRGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSA+MVVKVLQR
Sbjct  238   RNAAKTIIGDEGHRGVSGGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAYMVVKVLQR  297

Query  1139  IAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENR  1318
             IAQSGSIVIMS+HQPSYRIL LLDR++FLS+GQTV+SGSP +LP FF +FG+PIP++ENR
Sbjct  298   IAQSGSIVIMSIHQPSYRILGLLDRMLFLSRGQTVYSGSPMNLPHFFADFGHPIPDSENR  357

Query  1319  CEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASIS  1498
              EFALD IRELE SP GTK+LV+FNK+W+   +  S  N   + P    +LK+AISASIS
Sbjct  358   TEFALDLIRELEGSPGGTKSLVEFNKTWEN--TKRSNENSEMLTPTHGLTLKEAISASIS  415

Query  1499  RGKLVSGAT-NINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTG  1675
             RGKLVSG T +I+++ +  VP +ANPFW+EMVV+ KRS  NS R+PELF +R GA+VVTG
Sbjct  416   RGKLVSGTTSDIHTSPASMVPTYANPFWIEMVVLSKRSFTNSWRVPELFGIRLGAIVVTG  475

Query  1676  IILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRR  1855
              ILAT+FW+LDDSPKG+QERLGFFAFAMSTTFYTCA+A+PVFLQERYIFMRETAYNAYRR
Sbjct  476   FILATMFWQLDDSPKGVQERLGFFAFAMSTTFYTCADALPVFLQERYIFMRETAYNAYRR  535

Query  1856  SSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFL  2035
             SSY LSH+++SLP+L FLS AFA  T+WAVGL GGF GFLF+   + ASFWAG+SFVTFL
Sbjct  536   SSYCLSHALVSLPALIFLSFAFAAITFWAVGLEGGFLGFLFYFAIILASFWAGNSFVTFL  595

Query  2036  SGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFD  2215
             SG++ +VM+ YT+VVAILAYF+LFSGFFINRDRIPPYWIWFHY SLVKYP++ VLQNEFD
Sbjct  596   SGVVPSVMLGYTIVVAILAYFLLFSGFFINRDRIPPYWIWFHYLSLVKYPYEAVLQNEFD  655

Query  2216  YPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVT  2395
              P KCFVKGIQ+FD SPL  VP A+K KLL  MS TL + ITSSTC+TTG DIL Q G+T
Sbjct  656   DPTKCFVKGIQLFDNSPLGNVPNALKEKLLSTMSNTLNVKITSSTCVTTGADILVQQGIT  715

Query  2396  DINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             D++KWNCLWITIA GFFFR+LFYF+LL+GSKNKRR
Sbjct  716   DLSKWNCLWITIAWGFFFRVLFYFSLLLGSKNKRR  750



>emb|CDP00016.1| unnamed protein product [Coffea canephora]
Length=726

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/746 (69%), Positives = 609/746 (82%), Gaps = 31/746 (4%)
 Frame = +2

Query  278   DDMSTASSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGAND  457
             +++S     +P    RQ +++      P    S TLG+LL RVGD+  E   +       
Sbjct  7     ENISPIRDCMPTSDRRQTVQMTAAGASP----SPTLGQLLKRVGDARKEATGDET---PV  59

Query  458   HRVLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVEN---DVKV  628
             H+VL L DP   P S PFVLSF NL+YS                   P+  E      KV
Sbjct  60    HQVLDLSDPGMEPRSLPFVLSFTNLTYS-------------------PTDGETLFAKTKV  100

Query  629   LLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVI  808
             LL+DISGEAR+GEIMAVLGASGSGKSTLIDALANRIA+ESL GT+ +NGE LES+LLKVI
Sbjct  101   LLNDISGEARDGEIMAVLGASGSGKSTLIDALANRIAKESLKGTITLNGEQLESRLLKVI  160

Query  809   SAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGD  988
             SAYVMQDDLL+PMLTVEETLMF+AEFRLPR+LS+S+K+ RVQALI+QLG++ AAKTVIGD
Sbjct  161   SAYVMQDDLLYPMLTVEETLMFAAEFRLPRTLSKSKKQMRVQALIDQLGIRNAAKTVIGD  220

Query  989   eghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIM  1168
             EGHRGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIM
Sbjct  221   EGHRGVSGGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIM  280

Query  1169  SVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRE  1348
             S+HQPSYRIL LLDRLIFLS+G TV+SG P++LP+FF +FG+PIPENENR EFALD IRE
Sbjct  281   SIHQPSYRILGLLDRLIFLSRGHTVYSGPPTNLPQFFADFGHPIPENENRTEFALDLIRE  340

Query  1349  LEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKP--SLKDAISASISRGKLVSGA  1522
             LE SP GT++LV+FN++WQ     ++T+   NV  +P    SLK+AISASISRGKLVSGA
Sbjct  341   LEGSPGGTRSLVEFNRTWQNMKRGTNTAGTGNVESSPTHGLSLKEAISASISRGKLVSGA  400

Query  1523  TNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWK  1702
             TN +++ +  VP++ANPFW+EM V+ KRS  NS RMPELF +R GAV+VTG ILAT+FW+
Sbjct  401   TNTDASPTSMVPRYANPFWIEMAVLSKRSFTNSRRMPELFGIRCGAVMVTGFILATMFWR  460

Query  1703  LDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsi  1882
             LD+SPKGIQERLGFFAFAMSTTFYTCA+A+PVFLQERYIFMRETA+NAYRR SY LSH++
Sbjct  461   LDNSPKGIQERLGFFAFAMSTTFYTCADALPVFLQERYIFMRETAHNAYRRISYCLSHAL  520

Query  1883  islpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMI  2062
             +SLP+L FLS AFA  T+W+VGL GG SGF F+   + ASFWAG+SFVTFLSG++ +VM+
Sbjct  521   VSLPALIFLSFAFAAITFWSVGLDGGTSGFFFYFAIILASFWAGNSFVTFLSGVVPHVML  580

Query  2063  AYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKG  2242
              YT+VVAILAYF+LFSGFFINRDRIPPYWIWFHY SLVKYP++ VLQNEFD P KCFV+G
Sbjct  581   GYTIVVAILAYFLLFSGFFINRDRIPPYWIWFHYISLVKYPYEAVLQNEFDDPAKCFVRG  640

Query  2243  IQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLW  2422
             IQIFD +PL AVP+++K+KLL +MS TLG+ ITSSTC+TTG DILKQ GVTD+ KW CLW
Sbjct  641   IQIFDSTPLGAVPDSLKIKLLASMSNTLGVKITSSTCVTTGVDILKQQGVTDLTKWACLW  700

Query  2423  ITIAlgfffrllfyfallIGSKNKRR  2500
             ITIA GFFFR+LFYF+LL+GSKNKRR
Sbjct  701   ITIAWGFFFRILFYFSLLLGSKNKRR  726



>gb|KDP29036.1| hypothetical protein JCGZ_16425 [Jatropha curcas]
Length=745

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/728 (73%), Positives = 615/728 (84%), Gaps = 9/728 (1%)
 Frame = +2

Query  320   PRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQL-YDPVPYP  496
             P Q MELQ+  RR + S+S TL ELL RV DS  +  N+       H  L+L Y     P
Sbjct  26    PHQ-MELQKYPRRSKPSLSPTLAELLKRVEDSQSD--NSIYSTPVPHHALELGYACSSMP  82

Query  497   SSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMA  676
                PFVLSF++LSYSVKV +KM  P + G  +   S     +KVLL+DISGEAREGEIMA
Sbjct  83    PLNPFVLSFNHLSYSVKVGQKMSFP-FCGSHSFDSSG--GGMKVLLNDISGEAREGEIMA  139

Query  677   VLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTV  856
             VLGASGSGKSTLIDALA+RI++ESL G+V +NGEVLES+LLKVISAYVMQDDLLFPMLTV
Sbjct  140   VLGASGSGKSTLIDALADRISKESLKGSVSLNGEVLESRLLKVISAYVMQDDLLFPMLTV  199

Query  857   EETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsi  1036
             EETLMFSAEFRLPRSLS+S+KKARVQALI+QLGL+ AAKTVIGDEGHRGVSGGERRRVSI
Sbjct  200   EETLMFSAEFRLPRSLSKSKKKARVQALIDQLGLRNAAKTVIGDEGHRGVSGGERRRVSI  259

Query  1037  giDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRL  1216
             GIDI+HDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMS+HQPSYRIL+LLDRL
Sbjct  260   GIDIVHDPILLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSYRILSLLDRL  319

Query  1217  IFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNK  1396
             IFLS GQTV++G P+ +P+FF EFG+PIPENENR EFALD IRELE+ P GT  LV+FN+
Sbjct  320   IFLSHGQTVYAGPPAGVPQFFAEFGHPIPENENRTEFALDLIRELEEIPGGTTTLVEFNR  379

Query  1397  SWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPF  1576
             SWQ +   +  S   N+  + K SLKDAISAS+S+GKLVSGATN ++ LS SVP FANPF
Sbjct  380   SWQAQ--ATKISRNQNLSNSSKVSLKDAISASVSKGKLVSGATNDSTNLSSSVPTFANPF  437

Query  1577  WVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFA  1756
             W+EM+VI KRS++NS RMPELF +RFGAV VT +ILATIFW LD+SP+G QERLGFFAFA
Sbjct  438   WIEMLVIAKRSIINSRRMPELFGIRFGAVFVTALILATIFWHLDNSPRGAQERLGFFAFA  497

Query  1757  MSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTY  1936
             MSTT+YTCAE+IP FLQERYIFMRETAYNAYRRSSYVL+HSIIS+PSL  LS AFA TTY
Sbjct  498   MSTTYYTCAESIPAFLQERYIFMRETAYNAYRRSSYVLAHSIISIPSLIVLSFAFAATTY  557

Query  1937  WAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGF  2116
             W VGLAGG SGFLFF   V ++FWAGSSFVTFLSG++ +VM+ +T+VVAILAYF+LFSGF
Sbjct  558   WTVGLAGGVSGFLFFFFTVLSAFWAGSSFVTFLSGVVSHVMLGFTIVVAILAYFLLFSGF  617

Query  2117  FINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKL  2296
             FI+RDRIPPYWIWFHY SLVKYP++G LQNEF  P KCFV+G+Q+FD +PL AVP  +KL
Sbjct  618   FISRDRIPPYWIWFHYLSLVKYPYEGALQNEFQDPTKCFVRGVQMFDNTPLNAVPLPLKL  677

Query  2297  KLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfall  2476
             KLL+++S TLG NITSSTC+ TGPDIL+  G+TD++KW+CLWIT+A GFFFR+LFYF LL
Sbjct  678   KLLKSLSSTLGRNITSSTCIVTGPDILRAQGITDLSKWSCLWITVAWGFFFRVLFYFTLL  737

Query  2477  IGSKNKRR  2500
             +GSKN+RR
Sbjct  738   VGSKNRRR  745



>ref|XP_010101507.1| ABC transporter G family member 16 [Morus notabilis]
 gb|EXB88504.1| ABC transporter G family member 16 [Morus notabilis]
Length=758

 Score =   885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 531/761 (70%), Positives = 617/761 (81%), Gaps = 16/761 (2%)
 Frame = +2

Query  257   MSQASSRDDMSTASSDLPFLGPRQAMELQELTRRPRHSV-SMTLGELLHRVGDSAGEKLN  433
             MS+  + + +S A    P      +MEL  L      +  S TLG+LL  VGD   E   
Sbjct  1     MSRVVADNCISLARDTSPIF--LNSMELNHLHPSTAAAADSPTLGQLLKHVGDVRKEATG  58

Query  434   NGVGGANDHRVLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWL--------GRR  589
             +G      H+VL+L      P S PFVLSF NL+YSVK+RRK  + + L        G  
Sbjct  59    DG-NETPVHQVLELGHVSMEPRSLPFVLSFSNLTYSVKIRRKPTLSSVLPHRLLRQRGSD  117

Query  590   TAAPSQVEN---DVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGT  760
              + P   E+     K LL++ISGEAR+GEI+AVLGASGSGKSTLIDALANRIA+ SL G 
Sbjct  118   DSEPVPGESLFTRTKNLLNNISGEARDGEILAVLGASGSGKSTLIDALANRIAKGSLKGK  177

Query  761   VKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQAL  940
             V +NGEVLES+LLKVISAYVMQDDLLFPMLTVEETLMF+AEFRLPR+LS S+KK RVQAL
Sbjct  178   VTLNGEVLESRLLKVISAYVMQDDLLFPMLTVEETLMFAAEFRLPRTLSSSKKKGRVQAL  237

Query  941   IEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMV  1120
             I+QLGL+ AAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMV
Sbjct  238   IDQLGLRNAAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTSAFMV  297

Query  1121  VKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPI  1300
             VKVLQRIAQSGSIVIMSVHQPSYRIL LLDRLIFLS+GQTVFSGSP +LP+FF EFG+PI
Sbjct  298   VKVLQRIAQSGSIVIMSVHQPSYRILGLLDRLIFLSRGQTVFSGSPVNLPQFFAEFGHPI  357

Query  1301  PENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDA  1480
             PENENR EFALD IRELE SP GT+ LV+FNK+WQ K   S++    ++  N   SLK+A
Sbjct  358   PENENRTEFALDLIRELEGSPGGTRALVEFNKTWQSKKVKSTSDRPTDININQALSLKEA  417

Query  1481  ISASISRGKLVSGATN-INSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFG  1657
             ISASISRGKLVSGA N ++ + +  VP FANPFW+EMVV+ KRS+ NS RMPELF +R G
Sbjct  418   ISASISRGKLVSGANNSVDPSPNSMVPTFANPFWIEMVVLSKRSVTNSRRMPELFGIRLG  477

Query  1658  AVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETA  1837
             AV+VTG ILAT+FW LDDSPKG+QERLGFFAFAMSTTFYTCA+A+PVFLQERYIFMRETA
Sbjct  478   AVMVTGFILATMFWNLDDSPKGVQERLGFFAFAMSTTFYTCADALPVFLQERYIFMRETA  537

Query  1838  YNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGS  2017
             +NAYRRSSYVLSHS ++LP L FLSL F+  T+WAVGL GGFSGFLF+ L +FASFW+GS
Sbjct  538   HNAYRRSSYVLSHSFVALPPLVFLSLGFSAATFWAVGLDGGFSGFLFYFLIIFASFWSGS  597

Query  2018  SFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGV  2197
             SFVTFLSG++ +VM+ YT+VVAILAYF+LFSGFFI RDRIP YWIWFHY SLVKYP++ V
Sbjct  598   SFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFITRDRIPSYWIWFHYLSLVKYPYEAV  657

Query  2198  LQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDIL  2377
             LQNEF+ P KCFV+GIQIFD +PL +VP +MKLKLL+NMS+TLG+ IT STCLTTG DIL
Sbjct  658   LQNEFENPLKCFVRGIQIFDNTPLASVPSSMKLKLLENMSQTLGMRITRSTCLTTGTDIL  717

Query  2378  KQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
              Q  VTD++KW+CLW+T+A GF FR+LFYF+LL+GSKNKRR
Sbjct  718   AQQAVTDLDKWSCLWVTVAWGFLFRILFYFSLLLGSKNKRR  758



>ref|XP_006345915.1| PREDICTED: ABC transporter G family member 1-like [Solanum tuberosum]
Length=750

 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/755 (70%), Positives = 617/755 (82%), Gaps = 25/755 (3%)
 Frame = +2

Query  278   DDMSTASSDLPFLGPR--QAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGA  451
             ++M     ++ F   R  QAME+ + +       S TLG++L RVGD   E     V G 
Sbjct  7     ENMLQGGENVQFYDQRVQQAMEMSQASAYS----SPTLGQMLKRVGDVRKE-----VTGD  57

Query  452   ND--HRVLQLYDPVPYPS-SFPFVLSFHNLSYSVKVRRKMGVPAWL-----GRRTAAPSQ  607
                 HR+L + D     S S PFVLSF+NL+YSVKVRRKM  PA L     G  T  P  
Sbjct  58    ETPVHRILDMSDTQSISSHSLPFVLSFNNLTYSVKVRRKMSFPAILRQPAAGVSTGDPVA  117

Query  608   VEN---DVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGE  778
              EN   + K LL++ISGEAR+GEI+AVLGASGSGKSTLIDALANRIA+ESL GT+ +NGE
Sbjct  118   GENLFTNTKFLLNNISGEARDGEIVAVLGASGSGKSTLIDALANRIAKESLKGTITLNGE  177

Query  779   VLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGL  958
              L+S+LLKVISAYVMQDDLL+PMLTVEETLMF+AEFRLPRSLS+S+KK RVQALI+QLGL
Sbjct  178   PLDSRLLKVISAYVMQDDLLYPMLTVEETLMFAAEFRLPRSLSKSKKKMRVQALIDQLGL  237

Query  959   QTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQR  1138
             + AAKT+IGDEGHRGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSA+MVVKVLQR
Sbjct  238   RNAAKTIIGDEGHRGVSGGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAYMVVKVLQR  297

Query  1139  IAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENR  1318
             IAQSGSIVIMS+HQPSYRIL LLDR++FLS+GQTV+SGSP +LP FF +FG+PIP++ENR
Sbjct  298   IAQSGSIVIMSIHQPSYRILGLLDRMLFLSRGQTVYSGSPMNLPHFFSDFGHPIPDSENR  357

Query  1319  CEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASIS  1498
              EFALD IRELE SP GTK+LV+FNK+W+   +  S  N     P    SLK+AISASIS
Sbjct  358   TEFALDLIRELEGSPGGTKSLVEFNKTWEN--TKRSNENPEIQTPTHGLSLKEAISASIS  415

Query  1499  RGKLVSGAT-NINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTG  1675
             RGKLVSG T +I+++ +  VP +ANPFW+EM+V+ KRS  NS R+PELF +R GA+VVTG
Sbjct  416   RGKLVSGTTSDIHTSPASMVPTYANPFWIEMLVLSKRSFTNSWRVPELFGIRLGAIVVTG  475

Query  1676  IILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRR  1855
              ILAT+FW+LDDSPKG+QERLGFFAFAMSTTFYTCA+A+PVFLQERYIFMRETAYNAYRR
Sbjct  476   FILATMFWQLDDSPKGVQERLGFFAFAMSTTFYTCADALPVFLQERYIFMRETAYNAYRR  535

Query  1856  SSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFL  2035
             SSY LSH+I+SLP+L FLS AFA  T+WAVGL GGFSGFLF+   + ASFWAG+SFVTFL
Sbjct  536   SSYCLSHAIVSLPALIFLSFAFAAITFWAVGLVGGFSGFLFYFAIILASFWAGNSFVTFL  595

Query  2036  SGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFD  2215
             SG++ +VM+ YT+VVAILAYF+LFSGFFINRDRIPPYWIWFHY SLVKYP++ VLQNEFD
Sbjct  596   SGVVPSVMLGYTIVVAILAYFLLFSGFFINRDRIPPYWIWFHYLSLVKYPYEAVLQNEFD  655

Query  2216  YPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVT  2395
                KCFVKGIQ+FD SPL  VP A+K KLL  MS TL + ITSSTC+TTG DIL Q G+T
Sbjct  656   DATKCFVKGIQLFDNSPLGNVPNALKEKLLSTMSNTLNVKITSSTCVTTGADILVQQGIT  715

Query  2396  DINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             D++KWNCLWITIA GFFFR+LFYF+LL+GSKNKRR
Sbjct  716   DLSKWNCLWITIAWGFFFRVLFYFSLLLGSKNKRR  750



>ref|XP_008233528.1| PREDICTED: ABC transporter G family member 6-like [Prunus mume]
Length=749

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/735 (72%), Positives = 615/735 (84%), Gaps = 14/735 (2%)
 Frame = +2

Query  332   MELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFPF  511
             MEL +L+R   H  S +LG+LL  +GD   E   +G G    H  L L D    P S PF
Sbjct  17    MELDDLSR-ASHRASPSLGQLLKHLGDVRKEATGDG-GETPAHHSLDLSDASIEPRSLPF  74

Query  512   VLSFHNLSYSVKVRRKMGVPA-WLGRRT--AAPSQVE--------NDVKVLLDDISGEAR  658
             VLSF NL+YSVKVRRK  +   + G R+   AP++ E           K LL+DISGEAR
Sbjct  75    VLSFTNLTYSVKVRRKFSLSGMFCGERSRLGAPTESEPVGGESLFTRTKTLLNDISGEAR  134

Query  659   EGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLL  838
             EGEI+AVLGASGSGKSTLIDALANRIA+ SL GTV +NGEVLES+LLKVISAYVMQDDLL
Sbjct  135   EGEILAVLGASGSGKSTLIDALANRIAKGSLKGTVSLNGEVLESRLLKVISAYVMQDDLL  194

Query  839   FPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsgge  1018
             FPMLTVEETLMF+AEFRLPR+LS+S+KKARVQALI+QLGL+ AAKT+IGDEGHRGVSGGE
Sbjct  195   FPMLTVEETLMFAAEFRLPRALSKSKKKARVQALIDQLGLRNAAKTIIGDEGHRGVSGGE  254

Query  1019  rrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRIL  1198
             RRRVSIGIDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIV+MSVHQPSYRIL
Sbjct  255   RRRVSIGIDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVVMSVHQPSYRIL  314

Query  1199  NLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKN  1378
              LLDRL+FLS+GQTV+SGSP++LP +F EFG+PIPE++NR EFALD +RELE SP GTK+
Sbjct  315   GLLDRLLFLSRGQTVYSGSPTTLPSYFAEFGHPIPESDNRTEFALDLVRELEGSPGGTKS  374

Query  1379  LVDFNKSWQR-KFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSV  1555
             LV+FN++WQ  K S + TS +    P    SL++AISASISRGKLVSGATN + + +  V
Sbjct  375   LVEFNRTWQSMKHSNNDTSCQIACEPRHSVSLQEAISASISRGKLVSGATNNDPSPNSMV  434

Query  1556  PKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQER  1735
             P FANPFW+EM V+ KRSM N+ RMPELF +R GAV+VTG ILAT+FW LD++PKG+QER
Sbjct  435   PTFANPFWIEMAVLSKRSMKNARRMPELFGIRLGAVMVTGFILATMFWNLDNTPKGVQER  494

Query  1736  LGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflsl  1915
             LGF AFAMSTTFYTCA+A+PVFLQERYIFMRETAYNAYRRSSYVLSHS+++LPSL FLS+
Sbjct  495   LGFIAFAMSTTFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHSLVALPSLVFLSI  554

Query  1916  afaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAY  2095
              F+  T+WAVGL GG SGFLF+ L +FASFWAGSSFVTFLSG++ +VM+ YT+VVAILAY
Sbjct  555   TFSALTFWAVGLDGGLSGFLFYFLIIFASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAY  614

Query  2096  FVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKA  2275
             F+LFSGFFI RDRIP YWIWFHY SLVKYP++GVLQNEF  P KCFV+G+QIFD +PL +
Sbjct  615   FLLFSGFFITRDRIPGYWIWFHYMSLVKYPYEGVLQNEFQDPTKCFVRGVQIFDNTPLAS  674

Query  2276  VPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrl  2455
             VP AMKLKLL +MS+TLG  ITSSTCLTTG DIL+Q GVTD++KWNCL++T+A GF FR+
Sbjct  675   VPAAMKLKLLDSMSQTLGTRITSSTCLTTGSDILQQQGVTDLSKWNCLYVTVAWGFLFRI  734

Query  2456  lfyfallIGSKNKRR  2500
             LFYF+LL+GSKNKRR
Sbjct  735   LFYFSLLLGSKNKRR  749



>ref|XP_009344892.1| PREDICTED: ABC transporter G family member 6-like [Pyrus x bretschneideri]
Length=751

 Score =   882 bits (2280),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/738 (71%), Positives = 614/738 (83%), Gaps = 16/738 (2%)
 Frame = +2

Query  329   AMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFP  508
             +MEL +  R P H  S +LG+LL +VGD+  E   +G G    H  L + D    P S P
Sbjct  16    SMELNDFPR-PAHGASPSLGQLLKQVGDARKEVTGDG-GETPAHHELDISDASLEPRSLP  73

Query  509   FVLSFHNLSYSVKVRRKM-------GVPAWLGRRTAAPSQVEND-----VKVLLDDISGE  652
             FVLSF+NL+YSVK+RRK        G    LG  TA+      D      K LL+DI+GE
Sbjct  74    FVLSFNNLTYSVKIRRKFSLSGMLSGCNNRLGAATASDPVCGGDNLFTRTKTLLNDITGE  133

Query  653   AREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDD  832
             AREGEI+AVLGASGSGKSTLIDALANRIA+ SL GTV +NGEVLES+LLKVISAYVMQDD
Sbjct  134   AREGEILAVLGASGSGKSTLIDALANRIAKGSLKGTVSLNGEVLESRLLKVISAYVMQDD  193

Query  833   LLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsg  1012
             LLFPMLTVEETLMF+AEFRLPR+LS+S+KK+RVQALI+QLGL+ AAKT+IGDEGHRGVSG
Sbjct  194   LLFPMLTVEETLMFAAEFRLPRALSKSKKKSRVQALIDQLGLRNAAKTIIGDEGHRGVSG  253

Query  1013  gerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYR  1192
             GERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIV+MSVHQPSYR
Sbjct  254   GERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVVMSVHQPSYR  313

Query  1193  ILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGT  1372
             IL LLDRL+FL++GQTV+SGSP++LP +F EFG+PIPE+ENR EFALD IRELE SP GT
Sbjct  314   ILGLLDRLLFLTRGQTVYSGSPTNLPSYFAEFGHPIPESENRTEFALDIIRELEGSPGGT  373

Query  1373  KNLVDFNKSWQRK--FSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLS  1546
             K+LV+FN++WQ K   +P+  S R          L++AISASISRGKLVSGATN N + +
Sbjct  374   KSLVEFNRTWQNKKHSNPNDASYRGASDARHVVPLQEAISASISRGKLVSGATNNNPSPN  433

Query  1547  PSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGI  1726
               VP FANP WVEM V+  RSM N+ RMPELF +R GAV+VTG ILAT+FWKLD++PKG+
Sbjct  434   SMVPTFANPIWVEMAVLANRSMKNARRMPELFGIRLGAVMVTGFILATMFWKLDNTPKGV  493

Query  1727  QERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaf  1906
             QERLGF AFAMSTTFYTCA+A+PVFLQERYIFMRETAYNAYRRSSYVLSHS+++LPSL F
Sbjct  494   QERLGFIAFAMSTTFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHSLVALPSLIF  553

Query  1907  lslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAI  2086
             LS AF+ TT+WAVGL GG SGFLF+ L +FASFWAGSSFVTFLSG++ +VM+ YT+VVAI
Sbjct  554   LSTAFSATTFWAVGLDGGLSGFLFYFLIIFASFWAGSSFVTFLSGVVPHVMLGYTIVVAI  613

Query  2087  LAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSP  2266
             LAYF+LFSGFFI RDRIP YWIWFHY SLVKYP++GV+QNEF  P KCFV+G+QIFD +P
Sbjct  614   LAYFLLFSGFFITRDRIPAYWIWFHYLSLVKYPYEGVMQNEFQDPTKCFVRGVQIFDNTP  673

Query  2267  LKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgff  2446
             L  VP AMKLKLL++MS+TLG+ IT+STCLTTG DIL+Q GVTD++KWNCLWIT+A GF 
Sbjct  674   LGTVPAAMKLKLLKSMSQTLGMRITTSTCLTTGADILEQQGVTDLSKWNCLWITVAWGFL  733

Query  2447  frllfyfallIGSKNKRR  2500
             FR+LFYFALL+GSKNKRR
Sbjct  734   FRILFYFALLLGSKNKRR  751



>ref|XP_006428975.1| hypothetical protein CICLE_v10011147mg [Citrus clementina]
 gb|ESR42215.1| hypothetical protein CICLE_v10011147mg [Citrus clementina]
Length=741

 Score =   882 bits (2280),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/741 (72%), Positives = 614/741 (83%), Gaps = 18/741 (2%)
 Frame = +2

Query  290   TASSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRV--GDSAGEKLNNGVGGANDHR  463
             TA   L F    +  E ++  +R R SVS +L ELL RV   D++G+  N  +   + H 
Sbjct  15    TAGDSLSFPNQNEPAEHKKYPKRGRPSVSPSLAELLKRVEGADTSGD--NTAID--HHHH  70

Query  464   VLQLYDPVP-YPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDD  640
             V++L       P+S+PFVLSF NL+YSVK  +K  +P      + +P       KVLL+D
Sbjct  71    VIELSHACSSVPTSYPFVLSFKNLTYSVKASQKFELPFCGKGLSDSPD------KVLLND  124

Query  641   ISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYV  820
             ISGEAREGEIMAVLGASGSGKSTLIDALANRI++ESL G+V +NGEVLES LLKVISAYV
Sbjct  125   ISGEAREGEIMAVLGASGSGKSTLIDALANRISKESLKGSVTLNGEVLESSLLKVISAYV  184

Query  821   MQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghr  1000
             MQDDLLFPMLTVEETLMFSAEFRLPRSLS+ +KKARVQALI+QLGL+ AAKTVIGDEGHR
Sbjct  185   MQDDLLFPMLTVEETLMFSAEFRLPRSLSKRKKKARVQALIDQLGLRNAAKTVIGDEGHR  244

Query  1001  gvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQ  1180
             GVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQ
Sbjct  245   GVSGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQ  304

Query  1181  PSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQS  1360
             PSYRILNLLDRLI LS G TVF GSP++LP FF +FG+PIPENENR EFALD IRELE++
Sbjct  305   PSYRILNLLDRLILLSHGNTVFGGSPANLPDFFSQFGHPIPENENRTEFALDLIRELEET  364

Query  1361  PEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGAT-NINS  1537
             PEGTKNLV+FNKSWQR  SP +    NN       SL DAI  S+SRGKLVSGAT +   
Sbjct  365   PEGTKNLVEFNKSWQRTKSPKN----NNHESKSSISLTDAIRQSVSRGKLVSGATTDPGP  420

Query  1538  TLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSP  1717
              L+ SVP FANP W EM+VI KRSM NS RMPELF +RFGAV+VTGIILATI+WKLD+SP
Sbjct  421   DLTSSVPTFANPMWFEMIVIAKRSMTNSRRMPELFGIRFGAVLVTGIILATIYWKLDNSP  480

Query  1718  KGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislps  1897
             KG+QER+ F AFAM TTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL+HSIIS+P+
Sbjct  481   KGVQERIAFLAFAMVTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLAHSIISIPA  540

Query  1898  laflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLV  2077
             L  LSL FA  T++AVGLAGGFSGF+FF   + ASFWAGSSFVTFLSGI+ +VM+ +T+V
Sbjct  541   LVVLSLTFAAVTFFAVGLAGGFSGFIFFFFIILASFWAGSSFVTFLSGIVSHVMLGFTVV  600

Query  2078  VAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFD  2257
             VAILAYF+LFSGFFI+RDRIP YWIWFHY SLVKYPF+GVLQNEFD P+KCFV+G+Q+FD
Sbjct  601   VAILAYFLLFSGFFISRDRIPAYWIWFHYISLVKYPFEGVLQNEFDDPNKCFVRGVQMFD  660

Query  2258  GSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAl  2437
              +PL ++P +MKLKLL++MS  LGINITSSTC+TT  DILKQ G+TDI+KWNCLWI +A 
Sbjct  661   NTPLGSLPMSMKLKLLKSMSNALGINITSSTCVTTASDILKQQGITDISKWNCLWILVAW  720

Query  2438  gfffrllfyfallIGSKNKRR  2500
             GFFFR+LFYF LL+GSKNKRR
Sbjct  721   GFFFRILFYFTLLVGSKNKRR  741



>ref|XP_004149819.1| PREDICTED: ABC transporter G family member 16-like [Cucumis sativus]
 ref|XP_004166147.1| PREDICTED: ABC transporter G family member 16-like [Cucumis sativus]
 gb|KGN51254.1| hypothetical protein Csa_5G505150 [Cucumis sativus]
Length=744

 Score =   882 bits (2280),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 537/756 (71%), Positives = 621/756 (82%), Gaps = 29/756 (4%)
 Frame = +2

Query  278   DDMSTASSDLPFLGPRQAMELQELTRRPRH--SVSMTLGELLHRVGDSAGEKLNNGVGGA  451
             ++MS A   + F      MEL +   RPR    +S TLG+LL RVGD   E   NG G  
Sbjct  3     ENMSPARDTVAFF---NDMELHD---RPRSFAGLSPTLGQLLKRVGDVRREA--NGDGNE  54

Query  452   ND-HRVLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRR-----------TA  595
                H+VL +      P S PF+LSF+NL+YSVKVRRK+   +    R           T 
Sbjct  55    TPVHQVLDINGASLEPRSLPFMLSFNNLTYSVKVRRKISFSSVFHHRGNRLGGSPVDDTV  114

Query  596   APSQVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNG  775
                 +    K LL++ISGEAREGEIMAVLGASGSGKSTLIDALANRIA+ SL GTV +NG
Sbjct  115   VGDSLFTKTKTLLNNISGEAREGEIMAVLGASGSGKSTLIDALANRIAKGSLKGTVTLNG  174

Query  776   EVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLG  955
             EVLES+LLKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPR+LS+S+KK RVQALI+QLG
Sbjct  175   EVLESRLLKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPRTLSKSKKKLRVQALIDQLG  234

Query  956   LQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQ  1135
             L+ AAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQ
Sbjct  235   LRNAAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAFMVVKVLQ  294

Query  1136  RIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENEN  1315
             RIAQSGSIV+MSVHQPSYRIL LLDRL+FLS+GQTV+SGSP++LP +F EFG+PIPENEN
Sbjct  295   RIAQSGSIVVMSVHQPSYRILGLLDRLLFLSRGQTVYSGSPANLPLYFSEFGHPIPENEN  354

Query  1316  RCEFALDFIRELEQSPEGTKNLVDFNKSWQR-KFSPSSTSNRNNVFPNPKPSLKDAISAS  1492
             R EFALD IRELE SP GTK+LV+F+KSWQ  K  P S S+  N+      SLK+AISAS
Sbjct  355   RTEFALDRIRELEGSPGGTKSLVEFHKSWQSMKNIPKSESDHQNM------SLKEAISAS  408

Query  1493  ISRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVT  1672
             ISRGKLVSGATN +++ +  VP FANPFW+EM V+ KRS++NS RMPELF +R GAV+VT
Sbjct  409   ISRGKLVSGATNNDASPNSMVPTFANPFWIEMAVLSKRSILNSRRMPELFGIRLGAVLVT  468

Query  1673  GIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYR  1852
             G ILAT+FW+LD+SPKG+QERLGFFAFAMSTTFYTCA+A+PVFLQERYIFMRETAYNAYR
Sbjct  469   GFILATMFWQLDNSPKGVQERLGFFAFAMSTTFYTCADALPVFLQERYIFMRETAYNAYR  528

Query  1853  RSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTF  2032
             RSSYVLSHS+++LP+L FLSLAFA TT+WAVGL GG SGFLF+ L + A+FWAGSSFVTF
Sbjct  529   RSSYVLSHSLVALPALIFLSLAFAATTFWAVGLDGGISGFLFYFLIILAAFWAGSSFVTF  588

Query  2033  LSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEF  2212
             LSG++ +VM+ YT+VVAILAYF+LFSGFFI RDRIP YWIWFHY SLVKYP++ VLQNEF
Sbjct  589   LSGVVPHVMLGYTIVVAILAYFLLFSGFFITRDRIPGYWIWFHYVSLVKYPYEAVLQNEF  648

Query  2213  DYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGV  2392
             + P KCFV+G+QIFD +PL  VP AMKLKLL+N+SKTLG+ IT STCLTTG DIL Q GV
Sbjct  649   ENPTKCFVRGVQIFDNTPLGMVPGAMKLKLLENLSKTLGMRITQSTCLTTGADILVQQGV  708

Query  2393  TDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
              D++KWNCL +T+A GF FR+LFYF+LLIGSKNKRR
Sbjct  709   MDLSKWNCLLVTVAWGFLFRILFYFSLLIGSKNKRR  744



>ref|XP_003556547.1| PREDICTED: ABC transporter G family member 1-like [Glycine max]
Length=750

 Score =   882 bits (2280),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/734 (71%), Positives = 598/734 (81%), Gaps = 21/734 (3%)
 Frame = +2

Query  332   MELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFPF  511
             MEL +LTRRP      TLG+LL  VGD   E   +G      H    L  P   P S PF
Sbjct  25    MELDDLTRRPSAGDMPTLGQLLKHVGDVRKEASGDGSETPVHH---ALDIPGIEPRSLPF  81

Query  512   VLSFHNLSYSVKVRRKMGVPAWLGRRT-------AAPSQVEN---DVKVLLDDISGEARE  661
             VLSF NL+YS+K RRKM + +   RR+        AP+  E+     K LL+DISGEAR+
Sbjct  82    VLSFSNLTYSIKSRRKMSLSSIFPRRSNRLGAVAEAPTVGESMFTRTKTLLNDISGEARD  141

Query  662   GEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLF  841
             GEIMAVLGASGSGKSTLIDALANRIA+ SL GTV +NGE LES+LLKVISAYVMQDDLLF
Sbjct  142   GEIMAVLGASGSGKSTLIDALANRIAKGSLKGTVALNGEALESRLLKVISAYVMQDDLLF  201

Query  842   PMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsgger  1021
             PMLTVEETLMF+AEFRLPR+LS+S+K ARVQALI+QLGL+ AAKTVIGDEGHRGVSGGER
Sbjct  202   PMLTVEETLMFAAEFRLPRTLSKSKKSARVQALIDQLGLRNAAKTVIGDEGHRGVSGGER  261

Query  1022  rrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILN  1201
             RRVSIG DIIHDPI+LFLDEPTSGLDSTSA+MVVKVLQRIAQSGSIVIMS+HQPSYRIL 
Sbjct  262   RRVSIGTDIIHDPILLFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSYRILG  321

Query  1202  LLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNL  1381
             LLDR+IFLS+GQTV+SGSPS LP +F EFG+PIPE +NR EFALD IRELE SP GTK+L
Sbjct  322   LLDRMIFLSRGQTVYSGSPSQLPLYFSEFGHPIPETDNRTEFALDLIRELEGSPGGTKSL  381

Query  1382  VDFNKSWQR--KFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSV  1555
             V+FNKSWQ   K        RN +      SLK+AISASISRGKLVSGA+N N   S  V
Sbjct  382   VEFNKSWQSMTKHHQEKEEERNGL------SLKEAISASISRGKLVSGASNTNPNPSSMV  435

Query  1556  PKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQER  1735
             P FAN FWVEM  + KRS +NS RMPEL  +R G V+VTG ILAT+FW+LD+SPKG+QER
Sbjct  436   PTFANQFWVEMATLSKRSFLNSRRMPELIGIRLGTVMVTGFILATMFWQLDNSPKGVQER  495

Query  1736  LGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflsl  1915
             LGFFAFAMSTTFYT A+A+PVFLQERYIFMRETAYNAYRR SY++SH++++LP+LAFLSL
Sbjct  496   LGFFAFAMSTTFYTTADALPVFLQERYIFMRETAYNAYRRLSYLVSHALVALPALAFLSL  555

Query  1916  afaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAY  2095
             AFA  T+WAVGL GG SGFLF+ L +FASFWAG+SFVTFLSG++ +VM+ YT+VVAILAY
Sbjct  556   AFAAATFWAVGLDGGISGFLFYFLIIFASFWAGNSFVTFLSGVVPHVMLGYTIVVAILAY  615

Query  2096  FVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKA  2275
             F+LFSGFFINRDRIP YWIWFHY SLVKYP++ VLQNEFD P KCFV+G+QIFD +PL +
Sbjct  616   FLLFSGFFINRDRIPSYWIWFHYLSLVKYPYEAVLQNEFDDPVKCFVRGVQIFDNTPLGS  675

Query  2276  VPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrl  2455
             VPE +K+KLL+ MS TLG  IT+STCLTTG DIL+Q GVTD+ KWNC WIT+A GFFFR 
Sbjct  676   VPEPLKVKLLETMSSTLGTKITTSTCLTTGADILQQNGVTDLTKWNCFWITVAWGFFFRF  735

Query  2456  lfyfallIGSKNKR  2497
             LFY +LL+GSKNKR
Sbjct  736   LFYLSLLLGSKNKR  749



>ref|XP_003520635.1| PREDICTED: ABC transporter G family member 20-like [Glycine max]
Length=734

 Score =   882 bits (2280),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/733 (72%), Positives = 602/733 (82%), Gaps = 19/733 (3%)
 Frame = +2

Query  305   LPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDP  484
             LPF    Q+MEL     R R   S TLG+LL RV D+      N +     H VL L   
Sbjct  20    LPFFN--QSMELVNPPTRTR---SRTLGDLLKRVQDA-----QNDIPLTPPHHVLDLSSS  69

Query  485   VPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREG  664
                 ++ PFVLSF NL+YSV +RRK          T       N  K LL+DISGEA++G
Sbjct  70    ---STTHPFVLSFTNLTYSVNLRRKFTFFPATTISTPDHETKPNGTKTLLNDISGEAKDG  126

Query  665   EIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFP  844
             EIMAVLGASGSGKSTLIDALA+RI++ESL GTV +NG+VLES LLKVISAYVMQDDLLFP
Sbjct  127   EIMAVLGASGSGKSTLIDALADRISKESLKGTVTLNGDVLESSLLKVISAYVMQDDLLFP  186

Query  845   MLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerr  1024
             MLTVEETLMF+AEFRLPRS S+S+KKARVQALI+QLGL+ AA TVIGDEGHRGVSGGERR
Sbjct  187   MLTVEETLMFAAEFRLPRSFSKSKKKARVQALIDQLGLRAAATTVIGDEGHRGVSGGERR  246

Query  1025  rvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNL  1204
             RVSIG DIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMS+HQPSYRIL+L
Sbjct  247   RVSIGTDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSYRILSL  306

Query  1205  LDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLV  1384
             LD LIFLS G TVFSGSP++LP FF EFG+PIPENENR EFALD IRELEQ P GTK+LV
Sbjct  307   LDHLIFLSHGNTVFSGSPANLPGFFSEFGHPIPENENRTEFALDLIRELEQEPTGTKSLV  366

Query  1385  DFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKF  1564
             DFNKSWQ K       N+      PK SLKDAISASISRGKLVSG  N NST   SVP F
Sbjct  367   DFNKSWQLK-----NKNQAQNGAKPKLSLKDAISASISRGKLVSGTKNNNSTALVSVPAF  421

Query  1565  ANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGF  1744
             ANPFW+EM+VIGKRS+ NS+RMPELF +R  AV+VTG ILATIF+ LDDSPKG+QER+GF
Sbjct  422   ANPFWMEMLVIGKRSLTNSMRMPELFGIRLVAVLVTGAILATIFFHLDDSPKGVQERVGF  481

Query  1745  FAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafa  1924
             FAFAMSTTFYTCAEA+PVFLQERYIFMRETA+NAYRRSSYVL H+IISLPSL FLSLAFA
Sbjct  482   FAFAMSTTFYTCAEAMPVFLQERYIFMRETAHNAYRRSSYVLVHAIISLPSLLFLSLAFA  541

Query  1925  VTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVL  2104
              TT+WAVGLAGG SGFLF+ L + ASFWAG+SFVTFLSG++ +VMI +T+VVAILAYF+L
Sbjct  542   ATTFWAVGLAGGSSGFLFYFLTILASFWAGNSFVTFLSGVVSHVMIGFTVVVAILAYFLL  601

Query  2105  FSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPD-KCFVKGIQIFDGSPLKAVP  2281
             FSGFFI+RDRIPPYWIWFHY SLVKYP++GVLQNEFD    +CFV+GIQ+FD +PL  VP
Sbjct  602   FSGFFISRDRIPPYWIWFHYLSLVKYPYEGVLQNEFDVRSPRCFVRGIQMFDNTPLGMVP  661

Query  2282  EAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllf  2461
             EA+K++LL++MS+TLG+NI+ STC+ TG D+LKQ G+T ++KWNC W+T+A GFFFR LF
Sbjct  662   EALKVELLKSMSETLGMNISRSTCVVTGEDVLKQQGITQLSKWNCFWVTVAWGFFFRFLF  721

Query  2462  yfallIGSKNKRR  2500
             Y ALL GS+NKRR
Sbjct  722   YLALLFGSRNKRR  734



>ref|XP_010086759.1| ABC transporter G family member 2 [Morus notabilis]
 gb|EXB23438.1| ABC transporter G family member 2 [Morus notabilis]
Length=767

 Score =   882 bits (2279),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/751 (71%), Positives = 625/751 (83%), Gaps = 32/751 (4%)
 Frame = +2

Query  305   LPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQL---  475
              PF  P   MEL +    P+  V  TLGELL +V D+     ++    +++  +L +   
Sbjct  30    FPFFNPN--MELADFN--PKPPVKPTLGELLKQVEDAQSPISSH----SHNSHLLDIGFP  81

Query  476   YDPVPYPSSFPFVLSFHNLSYSVKVRRKMGV-PAWL--GRRTAAPSQVEND-----VKVL  631
             Y+ +P PSS PFVLSFHNL+YSVKVR K+   P+ +   R     + VEN+      K+L
Sbjct  82    YNSLP-PSSSPFVLSFHNLTYSVKVRTKISFFPSKMEAARGNEEFTAVENNNNRNNTKIL  140

Query  632   LDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVIS  811
             L++ISGEAREGEIMAVLGASGSGKSTLIDALA+RIA+ESL G+V +NGE LES+LLKVIS
Sbjct  141   LNNISGEAREGEIMAVLGASGSGKSTLIDALADRIAKESLKGSVCLNGEALESRLLKVIS  200

Query  812   AYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDe  991
             AYVMQDDLLFPMLTVEETLMFSAEFRLPRSLS+S+K+ARVQALI+QLGL++AAKTVIGDE
Sbjct  201   AYVMQDDLLFPMLTVEETLMFSAEFRLPRSLSKSKKRARVQALIDQLGLRSAAKTVIGDE  260

Query  992   ghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMS  1171
             GHRGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSI+IMS
Sbjct  261   GHRGVSGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIIIMS  320

Query  1172  VHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIREL  1351
             +HQPS RIL+LLDRLIFLS GQTV+SGSP+SLP FF EFG+PIPE ENR EFALD IREL
Sbjct  321   IHQPSSRILSLLDRLIFLSHGQTVYSGSPTSLPIFFSEFGHPIPEKENRTEFALDLIREL  380

Query  1352  EQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNI  1531
             E++P GT+ LV+FNKS Q+     +++ R+    N   SLKDAISAS+SRGKLVSGA   
Sbjct  381   EETPGGTRTLVEFNKSCQKI----NSNRRDYCNSNCTVSLKDAISASVSRGKLVSGAPQK  436

Query  1532  NSTLSPSV--------PKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILA  1687
             +ST S S           FANPFW+EMVVI +RS+ NS RMPELF +R GAV+VTG+ILA
Sbjct  437   DSTFSSSSSSSSSSSFQTFANPFWMEMVVISRRSITNSRRMPELFGIRLGAVLVTGVILA  496

Query  1688  TIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYV  1867
             T+FWKLD+SPKG+QERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYV
Sbjct  497   TMFWKLDNSPKGVQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYV  556

Query  1868  LSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGII  2047
             L+HS+IS+PSL FLSL FA TT+WAVGLAGG SGF FF   + A+FWAGSSFVTFLSG++
Sbjct  557   LAHSLISIPSLVFLSLTFAATTFWAVGLAGGLSGFFFFFFTILAAFWAGSSFVTFLSGVV  616

Query  2048  YNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDK  2227
              +VM+ YT+VVAILAYF+LFSGFFI+RDRIP YW+WFHY SLVKYP++GVLQNEFD P K
Sbjct  617   THVMLGYTVVVAILAYFLLFSGFFISRDRIPVYWLWFHYISLVKYPYEGVLQNEFDDPVK  676

Query  2228  CFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINK  2407
             CF++G+QIFD +PL  VPE++K +LL++MSKTLG+NIT+STC+TTG DIL+Q G+TDI+K
Sbjct  677   CFIRGVQIFDNTPLGLVPESLKAQLLKSMSKTLGMNITASTCVTTGTDILRQQGITDISK  736

Query  2408  WNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             WNCLWIT+A GFFFR+LFYF LL GSKNKRR
Sbjct  737   WNCLWITVAWGFFFRVLFYFTLLFGSKNKRR  767



>ref|XP_002525084.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF37331.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=746

 Score =   882 bits (2278),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/753 (70%), Positives = 615/753 (82%), Gaps = 25/753 (3%)
 Frame = +2

Query  278   DDMSTASSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGAND  457
             DD+  +   +PF   +    L+    R   +VS TLG+LL RVGD   E   +G      
Sbjct  7     DDLPPSRDTVPFYS-QNLDRLEYFPTRASSAVSPTLGQLLKRVGDVRKEATGDG-SETPV  64

Query  458   HRVLQL-YDP-VPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRT---------AAPS  604
             H+VL+L  DP V  P S PFVLSF+NL+YSVK +     P+ L RRT          A  
Sbjct  65    HQVLELGSDPNVEAPRSIPFVLSFNNLTYSVKTKS----PSIL-RRTRRRSHDVGAVAGE  119

Query  605   QVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVL  784
              V    K LL+DISGEAR+GEI+AVLGASGSGKSTLIDALANRIA+ SL G + +NGE+L
Sbjct  120   SVYTRTKTLLNDISGEARDGEIVAVLGASGSGKSTLIDALANRIAKGSLKGKITLNGEIL  179

Query  785   ESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQT  964
             ES++LKVISAYVMQDD+LFPMLTVEETLMF+AEFRLPRSLS+S+KK RV ALI+QLGL+ 
Sbjct  180   ESRMLKVISAYVMQDDMLFPMLTVEETLMFAAEFRLPRSLSKSKKKMRVHALIDQLGLRN  239

Query  965   AAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIA  1144
             AAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIA
Sbjct  240   AAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAFMVVKVLQRIA  299

Query  1145  QSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCE  1324
             QSGSIVIMSVHQPSYRIL LLDRL+FLS+GQTV+SG P  LP FF EFG+PIPENENR E
Sbjct  300   QSGSIVIMSVHQPSYRILGLLDRLVFLSRGQTVYSGPPIYLPSFFAEFGHPIPENENRTE  359

Query  1325  FALDFIRELEQSPEGTKNLVDFNKSWQR-KFSPSSTSNRNNVFPNPKPSLKDAISASISR  1501
             FALD IRELE SP GTK+LV+FNK+WQ  K +P++  + + +      SLK+AISASIS+
Sbjct  360   FALDLIRELEGSPGGTKSLVEFNKTWQSTKHAPNTEVDSHGL------SLKEAISASISK  413

Query  1502  GKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGII  1681
             GKLVSGATN  +  +  VP FANP W+EM V+ KRS+ NS RMPELF +R GAV+VTG I
Sbjct  414   GKLVSGATNNGAGTNSLVPTFANPVWIEMAVLSKRSVTNSRRMPELFGIRLGAVLVTGFI  473

Query  1682  LATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSS  1861
             LAT+FW+LD+SPKG+QERLGFFAFAMSTTFYTCA+A+PVFLQERYIFMRETA+NAYRRSS
Sbjct  474   LATMFWQLDNSPKGVQERLGFFAFAMSTTFYTCADALPVFLQERYIFMRETAHNAYRRSS  533

Query  1862  YVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSG  2041
             YVLSH+++SLPSL FLSLAF+  T+WAVGL GG +GFLF+ L +FASFWAG+SFVTFLSG
Sbjct  534   YVLSHALVSLPSLIFLSLAFSALTFWAVGLDGGLAGFLFYFLIIFASFWAGNSFVTFLSG  593

Query  2042  IIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYP  2221
             ++ +VM+ YT+VVAILAYF+LFSGFFINRDRIPPYWIWFHY SLVKYP++ VLQNEF  P
Sbjct  594   VVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPPYWIWFHYMSLVKYPYEAVLQNEFQDP  653

Query  2222  DKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDI  2401
              KCFV+G+QIFD +PL AVP  MK+ LL  +S TLG+ ITSSTCLTTG DIL+Q G+TD+
Sbjct  654   VKCFVRGVQIFDNTPLGAVPTPMKVNLLATLSNTLGMTITSSTCLTTGSDILQQQGITDL  713

Query  2402  NKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             +KWNCLW+T+A GF FR+LFYF+LLIGSKNKRR
Sbjct  714   SKWNCLWVTVAWGFLFRILFYFSLLIGSKNKRR  746



>ref|XP_010259980.1| PREDICTED: ABC transporter G family member 6-like [Nelumbo nucifera]
Length=752

 Score =   880 bits (2275),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/742 (70%), Positives = 607/742 (82%), Gaps = 16/742 (2%)
 Frame = +2

Query  302   DLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYD  481
             D P L  + A+ELQ     PR   S TLGELL RVG++  E   N       H+V+ + D
Sbjct  18    DKPGLETKHALELQGPAGTPRTRSSPTLGELLRRVGETRCEASGNE---TPPHQVVNMSD  74

Query  482   PVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVE---------NDVKVLL  634
                 P S PFVLSF NL+YSVK+RRK+       R     +  E          + K+LL
Sbjct  75    TSLDPRSLPFVLSFTNLTYSVKIRRKISFSTCFHRTNRLGTTTEPIDNEPSRFTNTKILL  134

Query  635   DDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISA  814
             +DISGEAR+GEIMAVLGASGSGKSTLIDALANRIA+ SL G + +N E + S+LLKVISA
Sbjct  135   NDISGEARDGEIMAVLGASGSGKSTLIDALANRIAKGSLKGCITLNNEAVPSRLLKVISA  194

Query  815   YVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeg  994
             YVMQDDLLFPMLTV+ETLMFSAEFRLPR+L +S+KKARVQALI+QLGL+ AA TVIGDEG
Sbjct  195   YVMQDDLLFPMLTVQETLMFSAEFRLPRTLDKSKKKARVQALIDQLGLRNAANTVIGDEG  254

Query  995   hrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSV  1174
             HRGVSGGERRRVSIGIDIIHDPIVLFLDEPTSGLDSTSAFMVV VL+RIAQSGSIVIMS+
Sbjct  255   HRGVSGGERRRVSIGIDIIHDPIVLFLDEPTSGLDSTSAFMVVNVLKRIAQSGSIVIMSI  314

Query  1175  HQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELE  1354
             HQPSYRI+ LLDRLIFLS+GQTV+SGSP++LP FF++FG+PIPE+ENR EFALD IR+LE
Sbjct  315   HQPSYRIIGLLDRLIFLSRGQTVYSGSPANLPNFFRDFGHPIPEHENRTEFALDLIRQLE  374

Query  1355  QSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNIN  1534
              SP GTK+LV+FNKSWQ+     +    N      + SLKDAISASISRGKLVSGATN  
Sbjct  375   GSPGGTKSLVEFNKSWQQNVKHPTIPEHNQ----HEHSLKDAISASISRGKLVSGATNDA  430

Query  1535  STLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDS  1714
             S +S S+P +ANPFW E+ V+  RS+ NS RMPEL  +RF AV+VTG ILATIFW +D+S
Sbjct  431   SPMSSSMPTYANPFWTEIAVLSNRSVTNSKRMPELVGIRFAAVMVTGFILATIFWHVDNS  490

Query  1715  PKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislp  1894
             PKG+QERLGFFAFAMSTTFYTCAEA+PVFLQERYIFMRETAYNAYRRSSYVLSHSI+++P
Sbjct  491   PKGVQERLGFFAFAMSTTFYTCAEALPVFLQERYIFMRETAYNAYRRSSYVLSHSIVAIP  550

Query  1895  slaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTL  2074
             SL FLSLAFA  T+W+VGLAGGFSGFLF+ L +FASFWAGSSFVTFLSG++ +VM+ YT+
Sbjct  551   SLIFLSLAFAAITFWSVGLAGGFSGFLFYFLIIFASFWAGSSFVTFLSGVVSHVMLGYTV  610

Query  2075  VVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIF  2254
             VVAILAYF+LFSGFFI RDRIP YWIWFHY SLVKYP++ VLQNEF  P KCFV+G+QIF
Sbjct  611   VVAILAYFLLFSGFFITRDRIPAYWIWFHYISLVKYPYEAVLQNEFLDPTKCFVRGVQIF  670

Query  2255  DGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIA  2434
             D +PL  VPEA+KL+LL+ +S +LG+NI S TC+TTG DIL+  G+TD++KWNCLWIT+A
Sbjct  671   DNTPLGVVPEALKLRLLKTLSNSLGMNIGSDTCVTTGVDILRMQGITDLSKWNCLWITVA  730

Query  2435  lgfffrllfyfallIGSKNKRR  2500
              GFFFR+LFYFALL+GSKNKRR
Sbjct  731   WGFFFRILFYFALLLGSKNKRR  752



>ref|XP_008463532.1| PREDICTED: ABC transporter G family member 6 [Cucumis melo]
Length=742

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/755 (71%), Positives = 624/755 (83%), Gaps = 29/755 (4%)
 Frame = +2

Query  278   DDMSTASSDLPFLGPRQAMELQELTRRPRH--SVSMTLGELLHRVGDSAGEKLNNGVGGA  451
             ++MS A   + F      MEL +   RPR    +S TLG+LL RVGD   E   NG    
Sbjct  3     ENMSPARDTVAFF---NDMELHD---RPRSFAGLSPTLGQLLKRVGDVRREA--NG-DET  53

Query  452   NDHRVLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTA--APSQVENDV-  622
               H+VL +      P S PF+LSF+NL+YSVKVRRK+   +    R +    S V++ V 
Sbjct  54    PVHQVLDMNGASLEPRSLPFMLSFNNLTYSVKVRRKISFSSLFHHRGSRLGGSPVDDTVV  113

Query  623   --------KVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGE  778
                     K LL++ISGEAREGEIMAVLGASGSGKSTLIDALANRIA+ SL GTV +NGE
Sbjct  114   GDSLFTKTKTLLNNISGEAREGEIMAVLGASGSGKSTLIDALANRIAKGSLKGTVTLNGE  173

Query  779   VLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGL  958
             VLES+LLKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPR+LS+S+KK RVQALI+QLGL
Sbjct  174   VLESRLLKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPRTLSKSKKKLRVQALIDQLGL  233

Query  959   QTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQR  1138
             + AAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQR
Sbjct  234   RNAAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAFMVVKVLQR  293

Query  1139  IAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENR  1318
             IAQSGSIV+MSVHQPSYRIL LLDRL+FLS+GQTV+SGSP++LP +F EFG+PIPENENR
Sbjct  294   IAQSGSIVVMSVHQPSYRILGLLDRLLFLSRGQTVYSGSPANLPLYFSEFGHPIPENENR  353

Query  1319  CEFALDFIRELEQSPEGTKNLVDFNKSWQR-KFSPSSTSNRNNVFPNPKPSLKDAISASI  1495
              EFALD IRELE SP GTK+LV+F+KSWQ  K  P S S+  N+      SLK+AISASI
Sbjct  354   TEFALDRIRELEGSPGGTKSLVEFHKSWQSMKNIPKSESDHQNM------SLKEAISASI  407

Query  1496  SRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTG  1675
             SRGKLVSGATN +++ +  VP FANPFW+EM V+ KRS +NS RMPELF +R GAV+VTG
Sbjct  408   SRGKLVSGATNNDASPNSMVPTFANPFWIEMAVLSKRSFLNSRRMPELFGIRLGAVLVTG  467

Query  1676  IILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRR  1855
              ILAT+FW+LD+SPKG+QERLGFFAFAMSTTFYTCA+A+PVFLQERYIFMRETAYNAYRR
Sbjct  468   FILATMFWQLDNSPKGVQERLGFFAFAMSTTFYTCADALPVFLQERYIFMRETAYNAYRR  527

Query  1856  SSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFL  2035
             SSYVLSHS+++LP+L FLSLAFA TT+WAVGL GG SGFLF+ L + A+FWAGSSFVTFL
Sbjct  528   SSYVLSHSLVALPALIFLSLAFAATTFWAVGLDGGISGFLFYFLIILAAFWAGSSFVTFL  587

Query  2036  SGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFD  2215
             SG++ +VM+ YT+VVAILAYF+LFSGFFI RDRIP YWIWFHY SLVKYP++ VLQNEF+
Sbjct  588   SGVVPHVMLGYTIVVAILAYFLLFSGFFITRDRIPGYWIWFHYLSLVKYPYEAVLQNEFE  647

Query  2216  YPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVT  2395
              P KCFV+G+QIFD +PL  VP AMKLKLL+N+SKTLG+ IT STCLTTG DIL+Q GV 
Sbjct  648   NPTKCFVRGVQIFDNTPLGMVPGAMKLKLLENLSKTLGMRITRSTCLTTGADILEQQGVM  707

Query  2396  DINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             D++KWNCL +T+A GF FR+LFYF+LLIGSKNKRR
Sbjct  708   DLSKWNCLVVTVAWGFLFRILFYFSLLIGSKNKRR  742



>ref|XP_006480710.1| PREDICTED: ABC transporter G family member 20-like [Citrus sinensis]
Length=741

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/741 (72%), Positives = 612/741 (83%), Gaps = 18/741 (2%)
 Frame = +2

Query  290   TASSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRV--GDSAGEKLNNGVGGANDHR  463
             TA   L F    +  + ++  +R R SVS +L ELL RV   D++G+  N  +   + H 
Sbjct  15    TAGDSLSFPNQNEPADHKKYPKRGRPSVSPSLAELLKRVEGADTSGD--NTAID--HHHH  70

Query  464   VLQLYDPVP-YPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDD  640
             V++L       P+S+PFVLSF NL+YSVK  +K  +P      + +P       KVLL+D
Sbjct  71    VIELSHACSSVPTSYPFVLSFKNLTYSVKASQKFELPFCGKGLSDSPD------KVLLND  124

Query  641   ISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYV  820
             ISGEAREGEIMAVLGASGSGKSTLIDALANRI++ESL G+V +NGEVLES LLKVISAYV
Sbjct  125   ISGEAREGEIMAVLGASGSGKSTLIDALANRISKESLKGSVTLNGEVLESSLLKVISAYV  184

Query  821   MQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghr  1000
             MQDDLLFPMLTVEETLMFSAEFRLPRSLS+ +KKARVQALI+QLGL+ AAKTVIGDEG R
Sbjct  185   MQDDLLFPMLTVEETLMFSAEFRLPRSLSKRKKKARVQALIDQLGLRNAAKTVIGDEGRR  244

Query  1001  gvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQ  1180
             GVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQ
Sbjct  245   GVSGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQ  304

Query  1181  PSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQS  1360
             PSYRILNLLDRLI LS G TVF GSP++LP FF +FG+PIPENENR EFALD IRELE++
Sbjct  305   PSYRILNLLDRLILLSHGNTVFGGSPANLPDFFSQFGHPIPENENRTEFALDLIRELEET  364

Query  1361  PEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGAT-NINS  1537
             PEGTKNLV+FNKSWQR  SP +    NN       SL DAI  S+SRGKLVSGAT +   
Sbjct  365   PEGTKNLVEFNKSWQRTKSPKN----NNHESKSSISLTDAIRQSVSRGKLVSGATTDPGP  420

Query  1538  TLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSP  1717
              L+ SVP FANP W EM+VI KRSM NS RMPELF +RFGAV+VTGIILATI+WKLD+SP
Sbjct  421   DLTSSVPTFANPMWFEMIVIAKRSMTNSRRMPELFGIRFGAVLVTGIILATIYWKLDNSP  480

Query  1718  KGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislps  1897
             KG+QER+ F AFAM TTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL+HSIIS+P+
Sbjct  481   KGVQERIAFLAFAMVTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLAHSIISIPA  540

Query  1898  laflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLV  2077
             L  LSL FA  T++AVGLAGGFSGF+FF   + ASFWAGSSFVTFLSGI+ +VM+ +T+V
Sbjct  541   LVVLSLTFAAVTFFAVGLAGGFSGFIFFFFIILASFWAGSSFVTFLSGIVSHVMLGFTVV  600

Query  2078  VAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFD  2257
             VAILAYF+LFSGFFI+RDRIP YWIWFHY SLVKYPF+GVLQNEFD P+KCFV+G+Q+FD
Sbjct  601   VAILAYFLLFSGFFISRDRIPAYWIWFHYISLVKYPFEGVLQNEFDDPNKCFVRGVQMFD  660

Query  2258  GSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAl  2437
              +PL ++P +MKLKLL++MS  LGINITSSTC+TT  DIL Q G+TDI+KWNCLWI +A 
Sbjct  661   NTPLGSLPMSMKLKLLKSMSNALGINITSSTCVTTASDILTQQGITDISKWNCLWILVAW  720

Query  2438  gfffrllfyfallIGSKNKRR  2500
             GFFFR+LFYF LL+GSKNKRR
Sbjct  721   GFFFRILFYFTLLVGSKNKRR  741



>gb|KFK34602.1| hypothetical protein AALP_AA5G167000 [Arabis alpina]
Length=728

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/730 (70%), Positives = 591/730 (81%), Gaps = 37/730 (5%)
 Frame = +2

Query  341   QELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDH-RVLQL------YDPVP---  490
             ++   R    VS+TL ELL  V D             NDH R L +      +  +P   
Sbjct  26    EQRCHRDTARVSVTLAELLMSVEDEQ-----------NDHSRALDVAVASSFWSSIPSYS  74

Query  491   YPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEI  670
               SS PFVLSF +L+YSVK+++K    A  G    +   +  + KVLL+ ISGEAREGE+
Sbjct  75    VRSSSPFVLSFKDLTYSVKIQKKFKPFACCGN---SRFDMVMNTKVLLNGISGEAREGEM  131

Query  671   MAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPML  850
             MAVLGASGSGKSTLIDALANRIA+ESL G + +NGEVLES L KVISAYVMQDDLLFPML
Sbjct  132   MAVLGASGSGKSTLIDALANRIAKESLNGAITLNGEVLESSLHKVISAYVMQDDLLFPML  191

Query  851   TVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrv  1030
             TVEETLMFSAEFRLP SLS+ +KKARVQALI+QLGL+ AAKTVIGDEGHRGVSGGERRRV
Sbjct  192   TVEETLMFSAEFRLPHSLSKKKKKARVQALIDQLGLRNAAKTVIGDEGHRGVSGGERRRV  251

Query  1031  sigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLD  1210
             SIGIDIIHDPI+LFLDEPTSGLDSTSA+MVVKVLQRIAQSGSIVIMS+HQPSYRIL LLD
Sbjct  252   SIGIDIIHDPIILFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLD  311

Query  1211  RLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDF  1390
             +LIFLS+G TV+SGSP+ LPRFF EFG+PIPENEN+ EFALD IRELE SPEGTK LV++
Sbjct  312   KLIFLSRGHTVYSGSPTHLPRFFTEFGHPIPENENKTEFALDLIRELEDSPEGTKTLVEY  371

Query  1391  NKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFAN  1570
             +K W+ K + S +   +NV      SLKDAI+ASISRGKLVSGATN+ S    S   FAN
Sbjct  372   HKQWRAKQTSSQSRRNSNV------SLKDAITASISRGKLVSGATNLKS----SFQTFAN  421

Query  1571  PFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFA  1750
             P W EMVVIGKRS++NS R PELF +R GAV+VTG ILATIFWKLD+SP+GIQERLGFFA
Sbjct  422   PVWTEMVVIGKRSILNSRRQPELFGIRLGAVLVTGTILATIFWKLDNSPRGIQERLGFFA  481

Query  1751  FAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVT  1930
             FAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL+H+IIS+P+L  LS  FA T
Sbjct  482   FAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLAHTIISIPALIILSATFAAT  541

Query  1931  TYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFS  2110
             T+WAVGL+  F  F   +L  F   WAGSSFVTFLSG++ +VMI +T+VVAILAYF+LFS
Sbjct  542   TFWAVGLSQSFFFFFLTILAAF---WAGSSFVTFLSGVVSHVMIGFTVVVAILAYFLLFS  598

Query  2111  GFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAM  2290
             GFFI+RDRIP YWIWFHY SLVKYP++GVLQNEF+ P KCF++GIQ+FD SPL  VP A+
Sbjct  599   GFFISRDRIPLYWIWFHYLSLVKYPYEGVLQNEFEDPTKCFIRGIQMFDNSPLGQVPAAV  658

Query  2291  KLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfa  2470
             K+ LL++MS  LGIN+T+ TC+TTG DILKQ G+T+I+KWNCLWIT+ALGFFFR+ FYF 
Sbjct  659   KIGLLKSMSGVLGINVTAETCVTTGIDILKQQGITEISKWNCLWITVALGFFFRVFFYFT  718

Query  2471  llIGSKNKRR  2500
             LLIGSKNKRR
Sbjct  719   LLIGSKNKRR  728



>ref|XP_010517003.1| PREDICTED: ABC transporter G family member 2 [Camelina sativa]
Length=750

 Score =   877 bits (2267),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/754 (70%), Positives = 614/754 (81%), Gaps = 35/754 (5%)
 Frame = +2

Query  290   TASSDLPFLGPRQ-AMELQELTR-RPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHR  463
             T+++DLP     Q +ME Q   R  PR  VS+T  ELL  V D+  ++       +   R
Sbjct  15    TSNNDLPLFYVNQTSMEPQRCPRDTPR--VSVTFAELLMNVEDARNDQ-------STTRR  65

Query  464   VLQLYDPV-PYPSSFP--------------FVLSFHNLSYSVKVRRKMGVPAWLGRRTAA  598
              L++  P+    SSF               FVLSF++L+YSVK +++    A  G+    
Sbjct  66    TLEMASPITSSASSFDTWTSAPASSLSSSPFVLSFNDLTYSVKSQKRFNPLACYGKSRNG  125

Query  599   PSQVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGE  778
              S    + K+LL+ ISGEA EGE+MAVLGASGSGKSTLIDALANRIA++SL G++ +NGE
Sbjct  126   SSV---NTKILLNSISGEAHEGEMMAVLGASGSGKSTLIDALANRIAKDSLKGSITLNGE  182

Query  779   VLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGL  958
             VLES+L KVISAYVMQDDLLFPMLTVEETLMFSAEFRLPRSLS+ +KKARVQALI+QLGL
Sbjct  183   VLESRLQKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPRSLSKKKKKARVQALIDQLGL  242

Query  959   QTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQR  1138
             + AAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSA+MV+KVLQR
Sbjct  243   RNAAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAYMVIKVLQR  302

Query  1139  IAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENR  1318
             IAQSGSIVIMS+HQPSYRI+ LLD+LIFLS+G TV+SGSP+ LP+FF EF +PIPENEN+
Sbjct  303   IAQSGSIVIMSIHQPSYRIMGLLDKLIFLSRGNTVYSGSPTHLPQFFSEFEHPIPENENK  362

Query  1319  CEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASIS  1498
              EFALD IRELE S EGTK LV+F+K W+ K +PS  +   NV      +LK+AI+ASIS
Sbjct  363   TEFALDLIRELENSAEGTKTLVEFHKQWRAKQAPSYNNRNTNV------TLKEAITASIS  416

Query  1499  RGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGI  1678
             RGKLVSGATN  S L+ S   FANPFW+EM+VIGKR+++NS R PEL AMR GAV+VTGI
Sbjct  417   RGKLVSGATNNTSNLTTSFQTFANPFWIEMIVIGKRAILNSRRQPELLAMRLGAVMVTGI  476

Query  1679  ILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRS  1858
             ILAT+F  LD+SPKG+QERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRS
Sbjct  477   ILATMFTNLDNSPKGVQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRS  536

Query  1859  SYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLS  2038
             SYVLS SIIS+P+L FLS +FA TT+WAVGLAGG SGFLFF L + ASFWAGSSFVTFLS
Sbjct  537   SYVLSQSIISIPALIFLSASFAATTFWAVGLAGGSSGFLFFYLTILASFWAGSSFVTFLS  596

Query  2039  GIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDY  2218
             G++ NVM+ +T+VVAILAYF+LFSGFFI+RDRIP YWIWFHY SLVKYP++GVLQNEF+ 
Sbjct  597   GVVSNVMLGFTVVVAILAYFLLFSGFFISRDRIPLYWIWFHYLSLVKYPYEGVLQNEFED  656

Query  2219  PDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTD  2398
             P KCFV+G+QIFD SPL  V EAMKL LL++MS  LGIN+T+ TC+TTG DILKQ G+TD
Sbjct  657   PTKCFVRGVQIFDNSPLGQVSEAMKLTLLKSMSGVLGINVTAETCVTTGIDILKQQGITD  716

Query  2399  INKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             I+KWNCLWIT+A GFFFR+LFYF LLIGSKNKRR
Sbjct  717   ISKWNCLWITVAWGFFFRVLFYFTLLIGSKNKRR  750



>ref|XP_006436144.1| hypothetical protein CICLE_v10030782mg [Citrus clementina]
 ref|XP_006485994.1| PREDICTED: ABC transporter G family member 6-like [Citrus sinensis]
 gb|ESR49384.1| hypothetical protein CICLE_v10030782mg [Citrus clementina]
Length=752

 Score =   877 bits (2267),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/758 (69%), Positives = 611/758 (81%), Gaps = 27/758 (4%)
 Frame = +2

Query  272   SRDDMSTASSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGA  451
             + ++ S A   LPF     +MEL  +TR     VS TLG+LL RVGD   E+  +     
Sbjct  7     AENNTSPARDTLPFFST-NSMELTHITRSA-SGVSPTLGQLLKRVGDVRKEQTGDET---  61

Query  452   NDHRVLQLYDPVPYPS-SFPFVLSFHNLSYSVKVRRK-MGVPAW-------LGRRTAA-P  601
               H++L + D     + S PFVLSF+NL+YSVK RRK + +PA        LG  TA  P
Sbjct  62    PVHQILDVSDTSSVETRSLPFVLSFNNLTYSVKARRKSITLPAVFRRQPHPLGAVTATDP  121

Query  602   SQVEN---DVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMN  772
                EN     K LL+DISGEAR+GEIMAVLGASGSGKSTLIDALANRIA+ESL GT+K+N
Sbjct  122   VPGENLFSKTKTLLNDISGEARDGEIMAVLGASGSGKSTLIDALANRIAKESLKGTIKLN  181

Query  773   GEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQL  952
             GEVLES++LKVISAYVMQDDLLFPMLTVEETLMF+AEFRLPR+LS+S+KK RVQALI+QL
Sbjct  182   GEVLESRMLKVISAYVMQDDLLFPMLTVEETLMFAAEFRLPRTLSKSKKKIRVQALIDQL  241

Query  953   GLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVL  1132
             GL+ AAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSA+MVVKVL
Sbjct  242   GLRNAAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTSAYMVVKVL  301

Query  1133  QRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENE  1312
             QRIAQSGSIVIMS+HQPSYRIL LLDR+IFLS+GQTV+SGSP +LP FF EFG+PIPENE
Sbjct  302   QRIAQSGSIVIMSIHQPSYRILGLLDRMIFLSRGQTVYSGSPMNLPHFFDEFGHPIPENE  361

Query  1313  NRCEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISAS  1492
             NR EFALD IRELE SP GTK+LV+FNK+WQ       + N N    +   SLK+AISAS
Sbjct  362   NRTEFALDLIRELEGSPGGTKSLVEFNKTWQNM---KQSRNTNAHSDSQGLSLKEAISAS  418

Query  1493  ISRGKLVSGATNINSTLSPS--VPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVV  1666
             ISRGKLVSGATN N   SP+  VP FANP W EMVV+ +RS+ NS RMPELF +R GAV+
Sbjct  419   ISRGKLVSGATN-NDASSPTSMVPNFANPAWKEMVVLSQRSVTNSRRMPELFGIRAGAVI  477

Query  1667  VTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNA  1846
             VTG ILATIFW+LD SPKG+QERLGFFAFAMSTTFYTCA+A+PVFLQERYIFMRETA+NA
Sbjct  478   VTGFILATIFWQLDSSPKGVQERLGFFAFAMSTTFYTCADALPVFLQERYIFMRETAHNA  537

Query  1847  YRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFV  2026
             YRRSSYVLSH++ SLP+L FLS AF+  T+WAVGL GGF  +   +   F   WAG+SFV
Sbjct  538   YRRSSYVLSHTLTSLPALVFLSFAFSAITFWAVGLDGGFFFYFLMMFASF---WAGNSFV  594

Query  2027  TFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQN  2206
             TFLSG++ +VM+ YT+VVAILAYF+LFSGFFI RDRIPPYWIWFHY SLVKYP++ VLQ+
Sbjct  595   TFLSGVVPHVMLGYTIVVAILAYFLLFSGFFITRDRIPPYWIWFHYLSLVKYPYEAVLQS  654

Query  2207  EFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQT  2386
             EF  P KCFV+G+QIFD +PL AVP AMK++LL+ +S+TL + IT+STCLTTG DIL + 
Sbjct  655   EFGNPVKCFVRGVQIFDNTPLAAVPTAMKVRLLETLSRTLNMRITTSTCLTTGVDILDKE  714

Query  2387  GVTDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
              V  ++KW+CLWIT+A GFFFR LFYF+LL+GSKNKRR
Sbjct  715   AVNQLSKWSCLWITVAWGFFFRFLFYFSLLLGSKNKRR  752



>ref|XP_003553533.1| PREDICTED: ABC transporter G family member 20-like [Glycine max]
Length=736

 Score =   877 bits (2267),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/739 (72%), Positives = 608/739 (82%), Gaps = 26/739 (4%)
 Frame = +2

Query  305   LPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDP  484
             LPF    Q+MEL +   R R   S TLG+LL RV D+      N    A  H VL L   
Sbjct  17    LPFFN--QSMELVQPPTRTR---SRTLGDLLKRVEDA-----QNDTPLAPPHHVLDLSSS  66

Query  485   VPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVE---NDVKVLLDDISGEA  655
                 ++ PFVLSF NL+Y+V +RRK     +    TA+    E   N  K LL+DISGEA
Sbjct  67    ---SATHPFVLSFTNLTYNVNLRRKF---TFFPATTASAPDHETKPNGTKTLLNDISGEA  120

Query  656   REGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDL  835
             R+GEIMAVLGASGSGKSTLIDALA+RI++ESL GTVK+NG+VLES LLKVISAYVMQDDL
Sbjct  121   RDGEIMAVLGASGSGKSTLIDALADRISKESLRGTVKLNGDVLESSLLKVISAYVMQDDL  180

Query  836   LFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsgg  1015
             LFPMLTVEETLMF+AEFRLPRS S+S+KKARVQALI+QLGL++AA TVIGDEGHRGVSGG
Sbjct  181   LFPMLTVEETLMFAAEFRLPRSFSKSKKKARVQALIDQLGLRSAASTVIGDEGHRGVSGG  240

Query  1016  errrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRI  1195
             ERRRVSIG DIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMS+HQPSYRI
Sbjct  241   ERRRVSIGTDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSYRI  300

Query  1196  LNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTK  1375
             L+LLD LIFLS G TVFSGSP++LP FF EFG+PIPENENR EFALD IRELEQ   GTK
Sbjct  301   LSLLDHLIFLSHGNTVFSGSPANLPAFFSEFGHPIPENENRTEFALDLIRELEQEATGTK  360

Query  1376  NLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATN---INSTLS  1546
             +LVDFNKSWQ K + +    +N    + K SLKDAISASISRGKLVSG       NST  
Sbjct  361   SLVDFNKSWQLK-NKNQAQAQNEY--DSKLSLKDAISASISRGKLVSGTNGNGRNNSTAL  417

Query  1547  PSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGI  1726
              SVP FAN FW+EM+VIGKRS+ NS RMPELF +R GAV+VTG ILATIFW LDDSPKG+
Sbjct  418   VSVPAFANSFWMEMLVIGKRSLTNSRRMPELFGIRLGAVLVTGAILATIFWHLDDSPKGV  477

Query  1727  QERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaf  1906
             QER+GFFAFAMSTTFYTCAEA+PVFLQERYIFMRETA+NAYRRSSYVL+H+IISLPSL F
Sbjct  478   QERVGFFAFAMSTTFYTCAEAMPVFLQERYIFMRETAHNAYRRSSYVLAHAIISLPSLLF  537

Query  1907  lslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAI  2086
             LSLAFA TT+WAVG+ GG SGFLF+ + + ASFWAG+SFVTFLSG++ +VMI +T+VVAI
Sbjct  538   LSLAFAATTFWAVGMTGGTSGFLFYFITILASFWAGNSFVTFLSGVVSHVMIGFTVVVAI  597

Query  2087  LAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPD-KCFVKGIQIFDGS  2263
             LAYF+LFSGFFI+RDRIPPYWIWFHY SLVKYP++GVLQNEFD    +CFV+GIQ+F+ +
Sbjct  598   LAYFLLFSGFFISRDRIPPYWIWFHYLSLVKYPYEGVLQNEFDVRSPRCFVRGIQMFENT  657

Query  2264  PLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgf  2443
             PL  VPEA+K++LL++MS+TLG+NIT STC+ TG D+LKQ G+T + KWNCLWIT+A GF
Sbjct  658   PLGMVPEALKVELLKSMSQTLGMNITRSTCVVTGEDVLKQQGITQLTKWNCLWITLAWGF  717

Query  2444  ffrllfyfallIGSKNKRR  2500
             FFR LFY ALL GS+NKRR
Sbjct  718   FFRFLFYLALLFGSRNKRR  736



>ref|XP_009626224.1| PREDICTED: ABC transporter G family member 6 [Nicotiana tomentosiformis]
Length=750

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/737 (70%), Positives = 607/737 (82%), Gaps = 19/737 (3%)
 Frame = +2

Query  326   QAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGAND--HRVLQLYDPVPYPS  499
             Q ++  E+++   +S S TLG+LL RVGD   E     V G     H+VL + DP    +
Sbjct  21    QRVQPMEMSQASAYS-SPTLGQLLKRVGDVRKE-----VTGDETPVHQVLDMSDPGIQQN  74

Query  500   SFPFVLSFHNLSYSVKVRRKMGVP-------AWLGRRTAAPSQVEN---DVKVLLDDISG  649
             S PFVLSF+NL+YSVKVRRKM  P       A     T  P   EN     KVLLD+ISG
Sbjct  75    SLPFVLSFNNLTYSVKVRRKMTFPTLFRQPVAGTAAATGEPVPGENLFTRTKVLLDNISG  134

Query  650   EAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQD  829
             EAR+GEI+AVLGASGSGKSTLID LANRIA+ESL GT+ +NGE L+S+LLKVISAYVMQD
Sbjct  135   EARDGEIVAVLGASGSGKSTLIDGLANRIAKESLKGTITLNGEPLDSRLLKVISAYVMQD  194

Query  830   DLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvs  1009
             DLL+PMLTVEETLMF+AEFRLPR+LS+S+KK RVQALI+QLGL+ AAKT+IGDEGHRGVS
Sbjct  195   DLLYPMLTVEETLMFAAEFRLPRTLSKSKKKMRVQALIDQLGLRNAAKTIIGDEGHRGVS  254

Query  1010  ggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSY  1189
             GGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSA+MVVKVLQRIAQSGSIVIMS+HQPSY
Sbjct  255   GGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSY  314

Query  1190  RILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEG  1369
             RIL+LLDR++FLS+GQTV+SGSP +LP FF +FG+PIP+NENR EFALD IRELE SP G
Sbjct  315   RILSLLDRMLFLSRGQTVYSGSPMNLPHFFADFGHPIPDNENRTEFALDLIRELEGSPGG  374

Query  1370  TKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSP  1549
             TK+LV+FNK+WQ      S  N   V P    SLK+AISASISRGKLVSG T+ +++ + 
Sbjct  375   TKSLVEFNKTWQNT-KRQSNQNCEIVTPTHGLSLKEAISASISRGKLVSGTTSDHTSPAS  433

Query  1550  SVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQ  1729
              VP +ANPFW+EM  + KRS  NS R+PELF +R GA+VVTG ILAT+FW+LD+SPKG+Q
Sbjct  434   MVPTYANPFWIEMTTLSKRSFTNSWRVPELFGIRLGAIVVTGFILATMFWQLDNSPKGVQ  493

Query  1730  ERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslafl  1909
             ERLGFFAFAMSTTFYTCA+A+PVFLQERYIFMRETAYNAYRRSSY LSH+++SLP+L FL
Sbjct  494   ERLGFFAFAMSTTFYTCADALPVFLQERYIFMRETAYNAYRRSSYCLSHALVSLPALIFL  553

Query  1910  slafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAIL  2089
             S AFA  T+WAVGL GGFSGFLF+   + ASFWAG+SFVTFLSG++ +VM+ YT+VVAIL
Sbjct  554   SFAFAAITFWAVGLDGGFSGFLFYFGIILASFWAGNSFVTFLSGVVPSVMLGYTIVVAIL  613

Query  2090  AYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPL  2269
             AYF+LFSGFF+NRDRIPPYWIWFHY SLVKYP++ VLQNEFD P KCFVKGIQ+FD SPL
Sbjct  614   AYFLLFSGFFMNRDRIPPYWIWFHYLSLVKYPYEAVLQNEFDDPTKCFVKGIQMFDNSPL  673

Query  2270  KAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfff  2449
              +VP A+K KLL  MS TL + IT STC+TTG DIL Q G+T+++ W CLWITIA GFFF
Sbjct  674   GSVPIALKEKLLSTMSNTLNVKITGSTCVTTGADILVQQGITELSMWGCLWITIAWGFFF  733

Query  2450  rllfyfallIGSKNKRR  2500
             R+LFYF+LL+GSKNKRR
Sbjct  734   RVLFYFSLLLGSKNKRR  750



>ref|XP_011027346.1| PREDICTED: ABC transporter G family member 6-like [Populus euphratica]
Length=741

 Score =   876 bits (2263),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/729 (71%), Positives = 596/729 (82%), Gaps = 26/729 (4%)
 Frame = +2

Query  368   SVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDP-VPYPSSFPFVLSFHNLSYSV  544
             + S TLG+LL  VGD   E   NG      H+ L+L    +  P S PFVLSF  L+YSV
Sbjct  21    ATSPTLGQLLKNVGDVIREATGNG-SETPVHQGLELGSTNLEVPRSIPFVLSFKKLTYSV  79

Query  545   KVRRKMGVPAWLGRRTAAPSQVENDV------------KVLLDDISGEAREGEIMAVLGA  688
             KVRRK   PA L  R         D             K LL+DISGEAR+GEI+AVLGA
Sbjct  80    KVRRKFKFPAILPSRNIHRLGAATDTDPVGGESLFTTTKTLLNDISGEARDGEILAVLGA  139

Query  689   SGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETL  868
             SGSGKSTLIDALANRIA+ SL GT  +NGEVLES++LKVISAYVMQDDLLFPMLTVEETL
Sbjct  140   SGSGKSTLIDALANRIAKGSLKGTKTLNGEVLESRMLKVISAYVMQDDLLFPMLTVEETL  199

Query  869   MFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDI  1048
             MF+AEFRLPRSLS+S+K+ RVQALIEQLGL+ AAKTVIGDEGHRGVSGGERRRVSIGIDI
Sbjct  200   MFAAEFRLPRSLSKSKKRLRVQALIEQLGLKNAAKTVIGDEGHRGVSGGERRRVSIGIDI  259

Query  1049  IHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLS  1228
             IHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRIL LLDRLIFLS
Sbjct  260   IHDPIILFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILGLLDRLIFLS  319

Query  1229  KGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQ-  1405
             +G TV+SGSP +LP +F +FG+PIPENENR EFALD IRELE SP GT++LV+FNKSWQ 
Sbjct  320   RGHTVYSGSPMNLPVYFSDFGHPIPENENRTEFALDLIRELEGSPGGTRSLVEFNKSWQD  379

Query  1406  --RKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPS--VPKFANP  1573
                  +  S  +R  +      SLK+AISASIS+GKLVSGATN N  +SP+  VP FANP
Sbjct  380   LKHSRNGGSEPDRGGL------SLKEAISASISKGKLVSGATN-NDAISPNSMVPTFANP  432

Query  1574  FWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAF  1753
              W+EM V+ KRS +NS RMPELF +R GAV+VTG ILAT+FW+LD+SPKG+QERLGFFAF
Sbjct  433   VWIEMAVLSKRSFLNSRRMPELFGIRLGAVMVTGFILATMFWQLDNSPKGVQERLGFFAF  492

Query  1754  AMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTT  1933
             AMSTTFYTCA+A+PVFLQERYIFMRETAYNAYRRSSYVLSH ++ LPSL FLSLAF+ TT
Sbjct  493   AMSTTFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHGLVVLPSLIFLSLAFSATT  552

Query  1934  YWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSG  2113
             +WAVGL GG SGFLF+ L +FASFWAGSSFVTFLSG++ +VM+ YT+VVAILAYF+LFSG
Sbjct  553   FWAVGLDGGLSGFLFYFLIIFASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSG  612

Query  2114  FFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMK  2293
             FFINRDRIP YWIWFHY SLVKYP++ VL NEF  P KCFV+G+QIFD SPL  VP ++K
Sbjct  613   FFINRDRIPDYWIWFHYLSLVKYPYEAVLLNEFQDPAKCFVRGVQIFDQSPLGEVPTSLK  672

Query  2294  LKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfal  2473
             L+LL++MS TLG  ITSSTCLTTG DIL+Q G+TD++KWNCLW+T+A GF FR+LFY +L
Sbjct  673   LQLLESMSNTLGTKITSSTCLTTGADILQQQGITDLSKWNCLWVTVAWGFLFRILFYISL  732

Query  2474  lIGSKNKRR  2500
             L GSKNKRR
Sbjct  733   LFGSKNKRR  741



>ref|XP_006403679.1| hypothetical protein EUTSA_v10010147mg [Eutrema salsugineum]
 gb|ESQ45132.1| hypothetical protein EUTSA_v10010147mg [Eutrema salsugineum]
Length=738

 Score =   875 bits (2262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/740 (70%), Positives = 607/740 (82%), Gaps = 27/740 (4%)
 Frame = +2

Query  302   DLP-FLGPRQAMELQELTRR-PRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQL  475
             DLP F   +++++LQ   R  P+  VS+TL ELL  V D       NG   A D  V   
Sbjct  19    DLPLFYNDQKSVDLQRCQRNTPK--VSITLAELLMSVEDE-----QNGHSRALDVAVASN  71

Query  476   Y----DPVPYPSSFPFVLSFHNLSYSVKVRRKMG-VPAWLGRRTAAPSQVENDVKVLLDD  640
             +          SS PFVLSF +L+YSVK+++K   +P +     +  + ++ + KVLL+ 
Sbjct  72    FWSSVPSYSLSSSSPFVLSFKDLTYSVKIQKKFNPIPCF---SASDGNDMDMNTKVLLNG  128

Query  641   ISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYV  820
             ISGEAREGE+MAVLGASGSGKSTLIDALANRI++ESL G + +NGEVLES L KVISAYV
Sbjct  129   ISGEAREGEMMAVLGASGSGKSTLIDALANRISKESLRGAITLNGEVLESSLHKVISAYV  188

Query  821   MQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghr  1000
             MQDDLLFPMLTVEETLMFSAEFRLP SLS+ +KKARVQALI+QLGL+ AAKTVIGDEGHR
Sbjct  189   MQDDLLFPMLTVEETLMFSAEFRLPSSLSKKKKKARVQALIDQLGLRNAAKTVIGDEGHR  248

Query  1001  gvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQ  1180
             GVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSA+MVVKVLQR+AQSGSIVIMS+HQ
Sbjct  249   GVSGGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAYMVVKVLQRVAQSGSIVIMSIHQ  308

Query  1181  PSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQS  1360
             PSYRIL LLDRLIFLS+G TV+SGSP+ +PRFF E+G+PIPENEN+ EFALD IRELE S
Sbjct  309   PSYRILGLLDRLIFLSRGNTVYSGSPTHIPRFFSEYGHPIPENENKTEFALDLIRELEDS  368

Query  1361  PEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINST  1540
             P+GTK LV+F+K W+ K S   +    NV      SLKDAI+ASISRGKLVSGA N+ S 
Sbjct  369   PQGTKTLVEFHKQWRAKQSSRQSRRNTNV------SLKDAINASISRGKLVSGAANLKS-  421

Query  1541  LSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPK  1720
                S   FANPFW E++VIGKRSM+NS R PELF +R GAV++TGIILATIFWKLD+SP+
Sbjct  422   ---SFQTFANPFWTEILVIGKRSMLNSRRQPELFGIRLGAVLITGIILATIFWKLDNSPR  478

Query  1721  GIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpsl  1900
             GIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL+H+IIS+P+L
Sbjct  479   GIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLAHTIISIPAL  538

Query  1901  aflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVV  2080
               LS +FA TT+WAVGLAG   GF FF L + A+FWAGSSFVTFLSG++ +VMI +T+VV
Sbjct  539   IILSASFAATTFWAVGLAGDSEGFFFFFLTILAAFWAGSSFVTFLSGVVSHVMIGFTVVV  598

Query  2081  AILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDG  2260
             AILAYF+LFSGFFI+RDRIP YWIWFHY SLVKYP++GVLQNEF+ P KCFV+GIQ+FD 
Sbjct  599   AILAYFLLFSGFFISRDRIPLYWIWFHYLSLVKYPYEGVLQNEFEDPTKCFVRGIQMFDN  658

Query  2261  SPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlg  2440
             SPL  VP A+K+ LL++MS  LGIN+T+ TC+TTG DILKQ G+T+I+KWNCLWIT+A G
Sbjct  659   SPLGQVPAAVKISLLKSMSGVLGINVTAETCVTTGIDILKQQGITEISKWNCLWITVAWG  718

Query  2441  fffrllfyfallIGSKNKRR  2500
             FFFR+LFYF LLIGSKNKRR
Sbjct  719   FFFRVLFYFTLLIGSKNKRR  738



>ref|XP_010509348.1| PREDICTED: ABC transporter G family member 2-like [Camelina sativa]
Length=749

 Score =   874 bits (2258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/753 (70%), Positives = 616/753 (82%), Gaps = 34/753 (5%)
 Frame = +2

Query  290   TASSDLPFLGPRQ-AMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRV  466
             T+++DLP     Q +ME Q   RR    VS+T  ELL  V D+  ++       +   R 
Sbjct  15    TSNNDLPLFYVNQTSMEPQ---RRDTPRVSVTFAELLMNVEDARNDQ-------STTRRT  64

Query  467   LQLYDPVPYPSS---------------FPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAP  601
             L++  P+   +S                PFVLSF +L+YSVK +++    A  G+     
Sbjct  65    LEMASPITSSTSSFDTWTSAPASSLSSSPFVLSFKDLTYSVKNQKRFNPLACYGKSRNGS  124

Query  602   SQVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEV  781
             S    + K+LL+ ISGEA EGE+MAVLGASGSGKSTLIDALANRIA++SL G++ +NGEV
Sbjct  125   SV---NTKILLNSISGEAHEGEMMAVLGASGSGKSTLIDALANRIAKDSLKGSITLNGEV  181

Query  782   LESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQ  961
             LES+L KVISAYVMQDDLLFPMLTVEETLMFSAEFRLPRSLS+ +KKARVQALI+QLGL+
Sbjct  182   LESRLQKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPRSLSKKKKKARVQALIDQLGLR  241

Query  962   TAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRI  1141
              AAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSA+MV+KVLQRI
Sbjct  242   NAAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAYMVIKVLQRI  301

Query  1142  AQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRC  1321
             AQSGSIVIMS+HQPSYRI+ LLD+LIFLS+G TV+SGSP+ LP+FF EF +PIPENEN+ 
Sbjct  302   AQSGSIVIMSIHQPSYRIMGLLDKLIFLSRGNTVYSGSPTHLPQFFSEFEHPIPENENKT  361

Query  1322  EFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISR  1501
             EFALD IRELE S EGTK LV+F+K W+ K +PS  +NRNN       +LK+AI+ASISR
Sbjct  362   EFALDLIRELENSAEGTKTLVEFHKQWRAKQAPSYNNNRNNNV-----TLKEAITASISR  416

Query  1502  GKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGII  1681
             GKLVSGATN  S L+ S   FANPFW+EM+VIGKR+++NS R PEL AMR GAV+VTGII
Sbjct  417   GKLVSGATNNTSNLTTSFQTFANPFWIEMIVIGKRAILNSRRQPELLAMRLGAVMVTGII  476

Query  1682  LATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSS  1861
             LAT+F  LD+SPKG+QERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSS
Sbjct  477   LATMFTNLDNSPKGVQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSS  536

Query  1862  YVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSG  2041
             YVLS SIIS+P+L FLS +FA TT+WAVGLAGG SGFLFF L + ASFWAGSSFVTFLSG
Sbjct  537   YVLSQSIISIPALIFLSASFAATTFWAVGLAGGSSGFLFFYLTILASFWAGSSFVTFLSG  596

Query  2042  IIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYP  2221
             ++ NVM+ +T+VVAILAYF+LFSGFFI+RDRIP YWIWFHY SLVKYP++GVLQNEF+ P
Sbjct  597   VVSNVMLGFTVVVAILAYFLLFSGFFISRDRIPLYWIWFHYLSLVKYPYEGVLQNEFEDP  656

Query  2222  DKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDI  2401
              KCFV+G+QIFD SPL  VPEAMKL LL++MS  LGIN+T+ TC+TTG DILKQ G+TDI
Sbjct  657   TKCFVRGVQIFDNSPLGQVPEAMKLTLLKSMSGVLGINVTAETCVTTGIDILKQQGITDI  716

Query  2402  NKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             +KWNCLWIT+A GFFFR+LFYFALLIGSKNKRR
Sbjct  717   SKWNCLWITVAWGFFFRVLFYFALLIGSKNKRR  749



>ref|XP_007162694.1| hypothetical protein PHAVU_001G172400g [Phaseolus vulgaris]
 gb|ESW34688.1| hypothetical protein PHAVU_001G172400g [Phaseolus vulgaris]
Length=743

 Score =   874 bits (2258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/728 (72%), Positives = 598/728 (82%), Gaps = 15/728 (2%)
 Frame = +2

Query  326   QAMELQELTRRPR-HSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSS  502
             Q+M+L +L   P   + S TL +LL RV D+      N    A  H VL L       + 
Sbjct  26    QSMDLVQLPNLPTTRTRSRTLADLLKRVQDA-----QNDPPPAPPHHVLDLSSS---STI  77

Query  503   FPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVL  682
              PFVLSF NL+YSVK+RRK          +       N  K LL+DISGEAR+GEIMAVL
Sbjct  78    HPFVLSFSNLTYSVKLRRKFTFFPATTVSSPDHETKPNGTKTLLNDISGEARDGEIMAVL  137

Query  683   GASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEE  862
             GASGSGKSTLIDALANRI++ESL GTV +NG+VL S +LKVISAYVMQDDLLFPMLTVEE
Sbjct  138   GASGSGKSTLIDALANRISKESLKGTVTLNGDVLNSSVLKVISAYVMQDDLLFPMLTVEE  197

Query  863   TLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigi  1042
             TLMF+AEFRLPRSLS+S+KKARVQALI+QLGL++AA T+IGDEGHRGVSGGERRRVSIGI
Sbjct  198   TLMFAAEFRLPRSLSKSKKKARVQALIDQLGLRSAASTIIGDEGHRGVSGGERRRVSIGI  257

Query  1043  DIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIF  1222
             DIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMS+HQPSYRIL LLD +IF
Sbjct  258   DIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLDHMIF  317

Query  1223  LSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSW  1402
             LS G TV+SGSP++LP FF EFG+PIPENENR EFALD IRELE+ P GTK+LVDFNKSW
Sbjct  318   LSHGNTVYSGSPTNLPAFFSEFGHPIPENENRTEFALDLIRELEEEPGGTKSLVDFNKSW  377

Query  1403  QRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGA--TNINSTLSPSVPKFANPF  1576
             Q K   S+ +      P  KPSLKDAISASISRGKLVSGA     NST   SVP FANPF
Sbjct  378   QLKEKNSAQAQNE---PKNKPSLKDAISASISRGKLVSGANGNGNNSTAVVSVPAFANPF  434

Query  1577  WVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFA  1756
             W+EM VIGKRS+ NS RMPELF +R GAV+VTG ILATIFW LDDSPKG+QER+GFFAFA
Sbjct  435   WMEMAVIGKRSLKNSWRMPELFGVRLGAVLVTGTILATIFWHLDDSPKGVQERVGFFAFA  494

Query  1757  MSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTY  1936
             MSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSH+IISLPSL FLS AFA TT+
Sbjct  495   MSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHAIISLPSLVFLSFAFAATTF  554

Query  1937  WAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGF  2116
             WAVGLAGG SGF+F+ L + ASFWAGSSFVTFLSG++ +VMI +T+VVAILAYF+LFSGF
Sbjct  555   WAVGLAGGSSGFVFYFLVIVASFWAGSSFVTFLSGVVSHVMIGFTVVVAILAYFLLFSGF  614

Query  2117  FINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPD-KCFVKGIQIFDGSPLKAVPEAMK  2293
             FI+RDRIPPYW+WFHY SLVKYP++GVLQNEFD    +CFV+GIQ+FD +PL  V + +K
Sbjct  615   FISRDRIPPYWLWFHYLSLVKYPYEGVLQNEFDVNSPRCFVRGIQMFDNTPLGMVADTLK  674

Query  2294  LKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfal  2473
             ++LL++MS TLG+NI+ STC+ TG D+LKQ G+T ++KW+CLWIT+A GFFFR LFY  L
Sbjct  675   VELLKSMSNTLGMNISRSTCVITGADVLKQQGITQLSKWSCLWITVAWGFFFRFLFYLTL  734

Query  2474  lIGSKNKR  2497
             L GSKNKR
Sbjct  735   LFGSKNKR  742



>ref|XP_010505317.1| PREDICTED: ABC transporter G family member 2-like [Camelina sativa]
Length=750

 Score =   874 bits (2257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/754 (69%), Positives = 613/754 (81%), Gaps = 37/754 (5%)
 Frame = +2

Query  293   ASSDLPFLGPRQ-AMELQELTRRPRHS--VSMTLGELLHRVGDSAGEKLNNGVGGANDHR  463
              ++DLP     Q +ME Q   R PR +  VS+T  ELL  V D+  ++       +   R
Sbjct  16    GNNDLPLFYVNQTSMEPQ---RYPRDTPRVSVTFAELLMNVEDARNDQ-------SVARR  65

Query  464   VLQLYDPVPYPSS---------------FPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAA  598
              L++  P+   +S                PFVLSF++L+YSVK +++    A  G+    
Sbjct  66    TLEMASPITSSTSSFDTWTSAPASSISSSPFVLSFNDLTYSVKSQKRFNPLACYGKSRNG  125

Query  599   PSQVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGE  778
              S    + K+LL+ ISGEA EGE+MAVLGASGSGKSTLIDALANRIA++SL G++ +NGE
Sbjct  126   SSV---NTKILLNSISGEAHEGEMMAVLGASGSGKSTLIDALANRIAKDSLKGSITLNGE  182

Query  779   VLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGL  958
             VLES+L KVISAYVMQDDLLFPMLTVEETLMFSAEFRLPRSLS+ +KKARVQALI+QLGL
Sbjct  183   VLESRLQKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPRSLSKKKKKARVQALIDQLGL  242

Query  959   QTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQR  1138
             + AAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSA+MV+KVLQR
Sbjct  243   RNAAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAYMVIKVLQR  302

Query  1139  IAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENR  1318
             IAQSGSIVIMS+HQPSYRI+ LLD+LIFLS+G TV+SGSP+ LP+FF EF +PIPENEN+
Sbjct  303   IAQSGSIVIMSIHQPSYRIMGLLDKLIFLSRGNTVYSGSPTHLPQFFSEFEHPIPENENK  362

Query  1319  CEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASIS  1498
              EFALD IRELE S EGTK LV+F+K W+ K +PS  +   NV      +LK+AI+ASIS
Sbjct  363   TEFALDLIRELENSAEGTKTLVEFHKQWRAKQAPSYNNRNTNV------TLKEAITASIS  416

Query  1499  RGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGI  1678
             RGKLVSGATN  S L+ S   FANPFW+EM+VIGKR+++NS R PEL AMR GAV+VTGI
Sbjct  417   RGKLVSGATNNTSNLTTSFQTFANPFWIEMIVIGKRAILNSRRQPELLAMRLGAVMVTGI  476

Query  1679  ILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRS  1858
             ILAT+F  LD+SPKG+QERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRS
Sbjct  477   ILATMFTNLDNSPKGVQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRS  536

Query  1859  SYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLS  2038
             SYVLS SIIS+P+L FLS +FA TT+WAVGLAGG SGFLFF L + ASFWAGSSFVTFLS
Sbjct  537   SYVLSQSIISIPALIFLSASFAATTFWAVGLAGGSSGFLFFYLTILASFWAGSSFVTFLS  596

Query  2039  GIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDY  2218
             G++ NVM+ +T+VVAILAYF+LFSGFFI+RDRIP YWIWFHY SLVKYP++GVLQNEF+ 
Sbjct  597   GVVSNVMLGFTVVVAILAYFLLFSGFFISRDRIPLYWIWFHYLSLVKYPYEGVLQNEFED  656

Query  2219  PDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTD  2398
               KCFV+G+QIFD SPL  VPEAMKL LL++MS  LGIN+T+ TC+TTG DILKQ G+TD
Sbjct  657   RTKCFVRGVQIFDNSPLGQVPEAMKLTLLKSMSGVLGINVTAETCVTTGIDILKQQGITD  716

Query  2399  INKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             I+KWNCLWIT+A GFFFR+LFYF LLIGSKNKRR
Sbjct  717   ISKWNCLWITVAWGFFFRVLFYFTLLIGSKNKRR  750



>ref|XP_008354104.1| PREDICTED: ABC transporter G family member 6-like [Malus domestica]
Length=751

 Score =   873 bits (2256),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/738 (71%), Positives = 610/738 (83%), Gaps = 16/738 (2%)
 Frame = +2

Query  329   AMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFP  508
             +MEL +  R P +  S +LG+LL  VGD   +   +G G    H  L + D    P S P
Sbjct  16    SMELNDFPR-PANGASPSLGQLLKHVGDVRKDVTGDG-GETPAHHALDISDASLEPRSLP  73

Query  509   FVLSFHNLSYSVKVRRKM-------GVPAWLGRRTAAPSQVEND-----VKVLLDDISGE  652
             FVLSF+NL+YSVK+RRK        G    LG  TA+      D      K LL+DI+GE
Sbjct  74    FVLSFNNLTYSVKIRRKFSLSGMLSGSNNLLGPATASDPVCGGDNLFTRTKTLLNDITGE  133

Query  653   AREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDD  832
             AREGEI+AVLGASGSGKSTLIDALANRIA+ SL GTV +NGEVLES+LLKVISAYVMQDD
Sbjct  134   AREGEILAVLGASGSGKSTLIDALANRIAKGSLKGTVSLNGEVLESRLLKVISAYVMQDD  193

Query  833   LLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsg  1012
             LLFPMLTVEETLMF+AEFRLPR+LS+S+KK+RVQALI+QLGL+ AAKT+IGDEGHRGVSG
Sbjct  194   LLFPMLTVEETLMFAAEFRLPRALSKSKKKSRVQALIDQLGLRNAAKTIIGDEGHRGVSG  253

Query  1013  gerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYR  1192
             GERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIV+MSVHQPSYR
Sbjct  254   GERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVVMSVHQPSYR  313

Query  1193  ILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGT  1372
             IL LLDRL+FL++GQTV+SGSP++LP +F EFG+PIPE+ENR EFALD IRELE SP GT
Sbjct  314   ILGLLDRLLFLTRGQTVYSGSPANLPSYFAEFGHPIPESENRTEFALDIIRELEGSPGGT  373

Query  1373  KNLVDFNKSW--QRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLS  1546
             K+LV+FN++W  ++  +P+  S R          L++AISASISRGKLVSGATN N + +
Sbjct  374   KSLVEFNRTWLNKKHSNPNDASYRGASDARHVVPLREAISASISRGKLVSGATNNNPSPN  433

Query  1547  PSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGI  1726
               VP FANP WVEM V+  RSM N+ R+PELF +R GAV+VTG ILAT+FW LD++PKG+
Sbjct  434   SMVPTFANPIWVEMAVLANRSMKNARRLPELFGIRLGAVMVTGFILATMFWNLDNTPKGV  493

Query  1727  QERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaf  1906
             QERLGF AFAMSTTFYTCA+A+PVFLQERYIFMRETAYNAYRRSSYVLSHS+++LPSL  
Sbjct  494   QERLGFIAFAMSTTFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHSLVALPSLVI  553

Query  1907  lslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAI  2086
             LS AF+ TT+WAVGL GG SGFLF+ L +FASFWAGSSFVTFLSG++ +VM+ YT+VVAI
Sbjct  554   LSAAFSTTTFWAVGLDGGLSGFLFYFLIIFASFWAGSSFVTFLSGVVPHVMLGYTIVVAI  613

Query  2087  LAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSP  2266
             LAYF+LFSGFFI RDRIP YWIWFHY SLVKYP++GVLQNEF  P KCFV+G+QIFD +P
Sbjct  614   LAYFLLFSGFFITRDRIPAYWIWFHYLSLVKYPYEGVLQNEFQDPTKCFVRGVQIFDNTP  673

Query  2267  LKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgff  2446
             L  VP AMKLKLL++MSKTLG+ IT+STCLTTG DIL+Q GVTD++KWNCLWIT+A GF 
Sbjct  674   LGTVPGAMKLKLLESMSKTLGVRITTSTCLTTGADILEQQGVTDLSKWNCLWITVAWGFL  733

Query  2447  frllfyfallIGSKNKRR  2500
             FR+LFYFALL+GSKNKRR
Sbjct  734   FRILFYFALLLGSKNKRR  751



>ref|XP_009796484.1| PREDICTED: ABC transporter G family member 1-like [Nicotiana 
sylvestris]
Length=750

 Score =   872 bits (2253),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/739 (69%), Positives = 605/739 (82%), Gaps = 23/739 (3%)
 Frame = +2

Query  326   QAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGAND--HRVLQLYDPVPYPS  499
             Q ++  E+++   +S S TLG+LL RVGD   E     V G     H+VL + DP    +
Sbjct  21    QRVQPMEMSQASAYS-SPTLGQLLKRVGDVRKE-----VTGDETPVHQVLDMSDPGIQQN  74

Query  500   SFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVEND----------VKVLLDDISG  649
             S PFVLSF+NL+YSVKV RKM  P    R  A  +    D           KVLLD+ISG
Sbjct  75    SLPFVLSFNNLTYSVKVPRKMTFPTIFRRPVAGTAAATGDPVAGENLFTRTKVLLDNISG  134

Query  650   EAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQD  829
             EAR+GEI+AVLGASGSGKSTLID LANRIA+ESL GT+ +NGE L+S+LLKVISAYVMQD
Sbjct  135   EARDGEIVAVLGASGSGKSTLIDGLANRIAKESLKGTITLNGEPLDSRLLKVISAYVMQD  194

Query  830   DLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvs  1009
             DLL+PMLTVEETLMF+AEFRLPR+LS+S+KK RVQALI+QLGL+ AAKT+IGDEGHRGVS
Sbjct  195   DLLYPMLTVEETLMFAAEFRLPRTLSKSKKKMRVQALIDQLGLRNAAKTIIGDEGHRGVS  254

Query  1010  ggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSY  1189
             GGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSA+MVVKVLQRIAQSGSIVIMS+HQPSY
Sbjct  255   GGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSY  314

Query  1190  RILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEG  1369
             RIL LLDR++FLS+GQTV+SGSP +LP FF +FG+PIP+NENR EFALD IRELE SP G
Sbjct  315   RILGLLDRMLFLSRGQTVYSGSPMNLPHFFADFGHPIPDNENRTEFALDLIRELEGSPGG  374

Query  1370  TKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKP--SLKDAISASISRGKLVSGATNINSTL  1543
             TK+LV+FNK+WQ   +    SN+N     P    SLK+AISASISRGKLVSG T+ +++ 
Sbjct  375   TKSLVEFNKTWQ---NTKRQSNQNCEIATPTHGLSLKEAISASISRGKLVSGTTSDHTSP  431

Query  1544  SPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKG  1723
             +  VP +ANPFW+EM  + KRS  NS R+PELF +R GA+VVTG ILAT+FW+LD+SPKG
Sbjct  432   ASMVPTYANPFWIEMTTLSKRSFTNSWRVPELFGIRLGAIVVTGFILATMFWQLDNSPKG  491

Query  1724  IQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpsla  1903
             +QERLGFFAFAMSTTFYTCA+A+PVFLQERYIFMRETAYNAYRRSSY LSH+++SLP+L 
Sbjct  492   VQERLGFFAFAMSTTFYTCADALPVFLQERYIFMRETAYNAYRRSSYCLSHALVSLPALI  551

Query  1904  flslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVA  2083
             FLS AFA  T+WAVGL GGFSGF+F+   + ASFWAG+SFVTFLSG++ +VM+ YT+VVA
Sbjct  552   FLSFAFAAITFWAVGLDGGFSGFMFYFGIILASFWAGNSFVTFLSGVVPSVMLGYTIVVA  611

Query  2084  ILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGS  2263
             ILAYF+LFSGFF+NRDRIPPYWIWFHY SLVKYP++ VLQNEFD P KCFVKGIQ+FD S
Sbjct  612   ILAYFLLFSGFFMNRDRIPPYWIWFHYLSLVKYPYEAVLQNEFDDPTKCFVKGIQMFDNS  671

Query  2264  PLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgf  2443
             PL +VP  +K KLL  MS TL + IT STC+TTG DIL Q G+T+++ W CLWITIA GF
Sbjct  672   PLGSVPIELKEKLLSTMSNTLNVKITGSTCVTTGADILVQQGITELSMWGCLWITIAWGF  731

Query  2444  ffrllfyfallIGSKNKRR  2500
             FFR+LFYF+LL+GSKNKRR
Sbjct  732   FFRVLFYFSLLLGSKNKRR  750



>ref|XP_009357635.1| PREDICTED: ABC transporter G family member 6-like [Pyrus x bretschneideri]
Length=751

 Score =   872 bits (2253),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/738 (71%), Positives = 608/738 (82%), Gaps = 16/738 (2%)
 Frame = +2

Query  329   AMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFP  508
             +MEL +  R   H  S +LG+LL  VGD   E   +G G    H  L + D    P S P
Sbjct  16    SMELDDFPRST-HGASPSLGQLLKHVGDVRKEATGDG-GETPAHHALDISDASLEPRSLP  73

Query  509   FVLSFHNLSYSVKVRRKMGVPAWL---GRRTAAPS---------QVENDVKVLLDDISGE  652
             FVLSF+NL+YSVKVRRK  +   L     R +AP+          V +  + LL+DISGE
Sbjct  74    FVLSFNNLTYSVKVRRKFSLSGMLSGCNNRLSAPTASDPISGGESVFSQTRTLLNDISGE  133

Query  653   AREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDD  832
             AREGEI+AVLGASGSGKSTLIDALANRIA+ SL GTV +NGEVLES+LLKVISAYVMQDD
Sbjct  134   AREGEILAVLGASGSGKSTLIDALANRIAKGSLKGTVSLNGEVLESRLLKVISAYVMQDD  193

Query  833   LLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsg  1012
             LLFPMLTVEETLMF+AEFRLPR+LS+S+KK+RVQALI+QLG++ AAKT+IGDEGHRGVSG
Sbjct  194   LLFPMLTVEETLMFAAEFRLPRALSKSKKKSRVQALIDQLGIRNAAKTIIGDEGHRGVSG  253

Query  1013  gerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYR  1192
             GERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIV+MSVHQPSYR
Sbjct  254   GERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVVMSVHQPSYR  313

Query  1193  ILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGT  1372
             IL LLDRL+FL++GQTV+SGSP++LP +F EFG PIPE+ENR EFALD IRELE SP GT
Sbjct  314   ILGLLDRLLFLTRGQTVYSGSPANLPSYFAEFGYPIPESENRTEFALDVIRELEGSPGGT  373

Query  1373  KNLVDFNKSWQRK--FSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLS  1546
             K+LV+FN++WQ K   +P+  S R          L++AISASISRGKLVSGATN N + +
Sbjct  374   KSLVEFNRTWQSKKHSNPNDESYRGASDARHVVPLQEAISASISRGKLVSGATNNNPSPN  433

Query  1547  PSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGI  1726
               VP FANP WVEM V+  RSM N+ RMPELF +R G V+VTG ILAT+FW LDDSPKG+
Sbjct  434   SMVPTFANPIWVEMAVLANRSMKNARRMPELFGIRLGTVMVTGFILATMFWNLDDSPKGV  493

Query  1727  QERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaf  1906
             QERLGF AFAMSTTFYTCA+A+P+FLQERYIFMRETAYNAYRRSSYVLSHS++ LPSL F
Sbjct  494   QERLGFIAFAMSTTFYTCADALPIFLQERYIFMRETAYNAYRRSSYVLSHSLVVLPSLVF  553

Query  1907  lslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAI  2086
             LS+AF+VTT+WAVGL GG SGFLF+ L +FASFWAGSSFVTFLSG++  VM+ YT+VVAI
Sbjct  554   LSIAFSVTTFWAVGLDGGLSGFLFYFLIIFASFWAGSSFVTFLSGVVPQVMLGYTIVVAI  613

Query  2087  LAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSP  2266
             LAYF+LFSGFFI R+RIP YWIWFHY SLVKYP++GVLQNEF    KCFV+GIQIFD +P
Sbjct  614   LAYFLLFSGFFITRNRIPAYWIWFHYLSLVKYPYEGVLQNEFQNTAKCFVRGIQIFDNTP  673

Query  2267  LKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgff  2446
             L  VP++MKLKLL +MS+TLG+ IT STCLTTG DIL+Q GVTD++KWNCLW+T+A GF 
Sbjct  674   LGTVPDSMKLKLLDSMSETLGMRITRSTCLTTGTDILEQQGVTDLSKWNCLWVTVAWGFL  733

Query  2447  frllfyfallIGSKNKRR  2500
             FR+LFYFALL+GSKNKRR
Sbjct  734   FRILFYFALLLGSKNKRR  751



>ref|XP_008370127.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
6-like [Malus domestica]
Length=751

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/738 (71%), Positives = 609/738 (83%), Gaps = 16/738 (2%)
 Frame = +2

Query  329   AMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFP  508
             +MEL +  R P +  S +LG+LL  VGD   +   +G G    H  L + D    P S P
Sbjct  16    SMELNDFPR-PANGASPSLGQLLKHVGDVRKDVTGDG-GETPAHHALDISDASLEPRSLP  73

Query  509   FVLSFHNLSYSVKVRRKM-------GVPAWLGRRTAAPSQVEND-----VKVLLDDISGE  652
             FVLSF+NL+YSVK+RRK        G    LG  TA+      D      K LL+DI+GE
Sbjct  74    FVLSFNNLTYSVKIRRKFSLSGMLSGSNNLLGPATASDPVCGGDNLFTRTKTLLNDITGE  133

Query  653   AREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDD  832
             AREGEI+AVLGASGSGKSTLIDALANRIA+ SL GTV +NGEVLES+LLKVISAYVMQDD
Sbjct  134   AREGEILAVLGASGSGKSTLIDALANRIAKGSLKGTVSLNGEVLESRLLKVISAYVMQDD  193

Query  833   LLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsg  1012
             LLFPMLTVEETLMF+AEFRLPR+LS+S+KK+RVQALI+QLGL+ AAKT+IGDEGHRGVSG
Sbjct  194   LLFPMLTVEETLMFAAEFRLPRALSKSKKKSRVQALIDQLGLRNAAKTIIGDEGHRGVSG  253

Query  1013  gerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYR  1192
             GERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIV+MSVHQPSYR
Sbjct  254   GERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVVMSVHQPSYR  313

Query  1193  ILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGT  1372
             IL LLDRL+FL++GQTV+SGSP++LP +F EFG+PIPE+ENR EFALD IRELE SP GT
Sbjct  314   ILGLLDRLLFLTRGQTVYSGSPANLPSYFAEFGHPIPESENRTEFALDIIRELEGSPGGT  373

Query  1373  KNLVDFNKSW--QRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLS  1546
             K+LV+FN++W  ++  +P+  S R          L++AISASISRGKLVSGATN N + +
Sbjct  374   KSLVEFNRTWLNKKHSNPNDASYRGASDARHVVPLREAISASISRGKLVSGATNNNPSPN  433

Query  1547  PSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGI  1726
               VP FANP WVEM V+  RSM N+ R+PELF +R GAV+VTG ILAT+FW LD++PKG+
Sbjct  434   SMVPTFANPIWVEMAVLANRSMKNARRLPELFGIRLGAVMVTGFILATMFWNLDNTPKGV  493

Query  1727  QERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaf  1906
             QERLGF AFAMSTTFYTCA+A+PVFLQERYIFMRETAYNAYRRSSYVLSHS+++LPSL  
Sbjct  494   QERLGFIAFAMSTTFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHSLVALPSLVI  553

Query  1907  lslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAI  2086
             LS AF+ TT+WAVGL GG SGFLF+ L +FASFWAGSSFVTFLSG++ +VM+ YT+VVAI
Sbjct  554   LSAAFSTTTFWAVGLDGGLSGFLFYFLIIFASFWAGSSFVTFLSGVVPHVMLGYTIVVAI  613

Query  2087  LAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSP  2266
             LAYF+LFSGFFI RDRIP YWIWFHY SLVKYP++GVLQNEF  P KCFV+G QIFD +P
Sbjct  614   LAYFLLFSGFFITRDRIPAYWIWFHYLSLVKYPYEGVLQNEFQDPTKCFVRGXQIFDNTP  673

Query  2267  LKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgff  2446
             L  VP AMKLKLL++MSKTLG+ IT+STCLTTG DIL+Q GVTD++KWNCLWIT+A GF 
Sbjct  674   LGTVPGAMKLKLLESMSKTLGVRITTSTCLTTGADILEQQGVTDLSKWNCLWITVAWGFL  733

Query  2447  frllfyfallIGSKNKRR  2500
             FR+LFYFALL+GSKNKRR
Sbjct  734   FRILFYFALLLGSKNKRR  751



>gb|KCW88884.1| hypothetical protein EUGRSUZ_A01212 [Eucalyptus grandis]
Length=683

 Score =   871 bits (2250),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/669 (75%), Positives = 583/669 (87%), Gaps = 3/669 (0%)
 Frame = +2

Query  503   FPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQV---ENDVKVLLDDISGEAREGEIM  673
             +PFVLSF NL+YSV V RK+   + LGR  ++           KVLL+DISGEAREGEIM
Sbjct  15    YPFVLSFENLTYSVNVPRKLSFSSLLGREKSSDGASLPGRAGTKVLLNDISGEAREGEIM  74

Query  674   AVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLT  853
             AVLGASGSGKSTLIDALA+RI++ESLGG + +NGEVLES+LLKVISAYVMQDDLLFPMLT
Sbjct  75    AVLGASGSGKSTLIDALADRISKESLGGAITLNGEVLESRLLKVISAYVMQDDLLFPMLT  134

Query  854   VEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvs  1033
             VEETLMFSAEFRLPRSLS+SRKKARVQ LI+QLGL+ AA TVIGDEGHRGVSGGERRRVS
Sbjct  135   VEETLMFSAEFRLPRSLSKSRKKARVQVLIDQLGLRNAAGTVIGDEGHRGVSGGERRRVS  194

Query  1034  igiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDR  1213
             IGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIV+MS+HQPSYRI++LLDR
Sbjct  195   IGIDIIHDPIILFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVVMSIHQPSYRIMSLLDR  254

Query  1214  LIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFN  1393
             LIFLS+G TVF+GSP+ LP+FF EFG+PIPE+ENR EF LD IRELE++P GTK++V+FN
Sbjct  255   LIFLSRGNTVFNGSPADLPKFFAEFGHPIPEHENRTEFVLDLIRELEETPGGTKSIVEFN  314

Query  1394  KSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANP  1573
             KSW+ K       N +  +  PKPSLKDAISAS+SRGKLVSG +  +S     VP FANP
Sbjct  315   KSWEAKQQSLGLRNGDITWTGPKPSLKDAISASVSRGKLVSGGSAGDSNQVVLVPTFANP  374

Query  1574  FWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAF  1753
             FW+EM+VI KRSM NS RMPELF +RFGAV+VTGIILAT+F  LD+SPKG+QERLGFFAF
Sbjct  375   FWMEMLVISKRSMTNSRRMPELFGIRFGAVMVTGIILATMFRHLDNSPKGVQERLGFFAF  434

Query  1754  AMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTT  1933
             AMSTTFYTCAEAIPVFLQ+RYIFMRETAYNAYRR SYVL+H+IIS+PSL  LSLAFA TT
Sbjct  435   AMSTTFYTCAEAIPVFLQDRYIFMRETAYNAYRRYSYVLAHAIISVPSLVILSLAFAATT  494

Query  1934  YWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSG  2113
             +W VGLAGGFSGF+FF   VFA+FWAGSSFVTFLSG++ +VM+ +T+VVAILAYF+LFSG
Sbjct  495   FWPVGLAGGFSGFMFFFYAVFAAFWAGSSFVTFLSGVVSHVMLGFTIVVAILAYFLLFSG  554

Query  2114  FFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMK  2293
             FFI+R+RIPPYWIWFHY SLVKYP++ VLQNEFD P KCFV+G+Q+FD +PL  VPEA+K
Sbjct  555   FFISRNRIPPYWIWFHYLSLVKYPYESVLQNEFDDPAKCFVRGVQMFDNTPLAVVPEALK  614

Query  2294  LKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfal  2473
             L++L+NM  TLG+N+T STC+TTG DIL+  G+TDI+KW+CLWITIA GFFFR+LFYF L
Sbjct  615   LRMLKNMGSTLGMNLTGSTCVTTGVDILRTQGITDISKWDCLWITIAWGFFFRVLFYFTL  674

Query  2474  lIGSKNKRR  2500
             L GSKNKR+
Sbjct  675   LYGSKNKRK  683



>ref|XP_006295587.1| hypothetical protein CARUB_v10024695mg [Capsella rubella]
 gb|EOA28485.1| hypothetical protein CARUB_v10024695mg [Capsella rubella]
Length=753

 Score =   871 bits (2250),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/753 (70%), Positives = 613/753 (81%), Gaps = 32/753 (4%)
 Frame = +2

Query  293   ASSDLPFLGPRQ-AMELQELTR-RPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRV  466
              ++DLP     Q +ME Q   R  PR SV  T  ELL  V D+  ++       +   R 
Sbjct  16    GNNDLPLFYVNQTSMEPQRCPRDTPRASV--TFAELLMNVEDARNDQ-------STTRRG  66

Query  467   LQLYDPV-PYPSSFP--------------FVLSFHNLSYSVKVRRKMGVPAWLGRRTAAP  601
             L++  P+    SSF               FVLSF++L+YSVK+++K    A  G+     
Sbjct  67    LEMVSPITSSASSFDTWTSAPASSISSSPFVLSFNDLTYSVKIQKKFNPLACCGKSRNGS  126

Query  602   SQVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEV  781
             S    + K+LL+ ISGEA EGE+MAVLGASGSGKSTLIDALANRIA++SL G++ +NGEV
Sbjct  127   SV---NTKILLNSISGEAHEGEMMAVLGASGSGKSTLIDALANRIAKDSLRGSITLNGEV  183

Query  782   LESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQ  961
             LES+L KVISAYVMQDDLLFPMLTVEETLMFSAEFRLPRSLS+ +KK RVQALI+QLGL+
Sbjct  184   LESRLQKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPRSLSKKKKKTRVQALIDQLGLR  243

Query  962   TAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRI  1141
             +AAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSA+MV+KVLQRI
Sbjct  244   SAAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAYMVIKVLQRI  303

Query  1142  AQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRC  1321
             AQSGSIVIMS+HQPSYRI+ LLDRLIFLS+G TV+SGSP+ LP+FF EF +PIPENEN+ 
Sbjct  304   AQSGSIVIMSIHQPSYRIMGLLDRLIFLSRGNTVYSGSPAHLPQFFSEFEHPIPENENKT  363

Query  1322  EFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISR  1501
             EFALD IRELE S EGTK+LV+F+K W+ K +P + +  N        SLK+AI+ASISR
Sbjct  364   EFALDLIRELENSAEGTKSLVEFHKQWRAKQAPRNNNGNNRN---TNVSLKEAITASISR  420

Query  1502  GKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGII  1681
             GKLVSGATN +S L+ S   FANPFW+EM+VIGKR+++NS R PEL  MR GAV+VTGII
Sbjct  421   GKLVSGATNNSSNLTNSFQTFANPFWIEMIVIGKRAILNSRRQPELLGMRLGAVMVTGII  480

Query  1682  LATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSS  1861
             LAT+F  LD+SPKG+QERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSS
Sbjct  481   LATMFTNLDNSPKGVQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSS  540

Query  1862  YVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSG  2041
             YVLS SIIS+P+L FLS +FA TT+WAVGLAGG SGFLFF L + ASFWAGSSFVTFLSG
Sbjct  541   YVLSQSIISIPALIFLSASFAATTFWAVGLAGGSSGFLFFFLTILASFWAGSSFVTFLSG  600

Query  2042  IIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYP  2221
             ++ NVM+ +T+VVAILAYF+LFSGFFI+RDRIP YWIWFHY SLVKYP++GVLQNEF+ P
Sbjct  601   VVSNVMLGFTVVVAILAYFLLFSGFFISRDRIPLYWIWFHYLSLVKYPYEGVLQNEFEDP  660

Query  2222  DKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDI  2401
              KCFV+G+QIFD SPL  VPEAMKL LL++MS  LGIN+T+ TC+TTG DILKQ G+TDI
Sbjct  661   TKCFVRGVQIFDNSPLGQVPEAMKLTLLKSMSGVLGINVTAETCVTTGIDILKQQGITDI  720

Query  2402  NKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             +KWNCLWIT+A GFFFR+LFYF LLIGSKNKRR
Sbjct  721   SKWNCLWITVAWGFFFRVLFYFTLLIGSKNKRR  753



>ref|XP_009335931.1| PREDICTED: ABC transporter G family member 6-like [Pyrus x bretschneideri]
Length=751

 Score =   870 bits (2249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/738 (71%), Positives = 607/738 (82%), Gaps = 16/738 (2%)
 Frame = +2

Query  329   AMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFP  508
             +MEL +  R   H  S +LG+LL  VGD   E   +G G    H  L + D    P S P
Sbjct  16    SMELDDFPR-ATHGASPSLGQLLKHVGDVRKEATGDG-GETPAHHALGISDASLEPRSLP  73

Query  509   FVLSFHNLSYSVKVRRKM-------GVPAWLGRRTAAP-----SQVENDVKVLLDDISGE  652
             FVLSF+NL+YSVKVRRK+       G    LG  TA+        V +  + LL+DISGE
Sbjct  74    FVLSFNNLTYSVKVRRKLSLSGMLSGCNNRLGAATASDPISGGESVFSQTRTLLNDISGE  133

Query  653   AREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDD  832
             AREGEI+AVLGASGSGKSTLIDALANRIA+ SL GTV +NGEVLES+LLKVISAYVMQDD
Sbjct  134   AREGEILAVLGASGSGKSTLIDALANRIAKGSLKGTVSLNGEVLESRLLKVISAYVMQDD  193

Query  833   LLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsg  1012
             LLFPMLTVEETLMF+AEFRLPR+LS+S+KK+RVQALI+QLG++ AAKT+IGDEGHRGVSG
Sbjct  194   LLFPMLTVEETLMFAAEFRLPRALSKSKKKSRVQALIDQLGIRNAAKTIIGDEGHRGVSG  253

Query  1013  gerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYR  1192
             GERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIV+MSVHQPSYR
Sbjct  254   GERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVVMSVHQPSYR  313

Query  1193  ILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGT  1372
             IL LLDRL+FL++GQTV+SGSP++LP +F EFG PIP +ENR EFALD IRELE SP GT
Sbjct  314   ILGLLDRLLFLTRGQTVYSGSPANLPSYFAEFGYPIPASENRTEFALDVIRELEGSPGGT  373

Query  1373  KNLVDFNKSWQRK--FSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLS  1546
             K+LV+FN++WQ K   +P+  S R          L++AISASISRGKLVSGATN N + +
Sbjct  374   KSLVEFNRTWQSKKHSNPNDASYRGASDARHVVPLQEAISASISRGKLVSGATNNNPSPN  433

Query  1547  PSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGI  1726
               VP FANP WVEM V+  RSM N+ RMPELF +R G V+VTG ILAT+FW LDDSPKG+
Sbjct  434   SMVPTFANPIWVEMAVLANRSMKNARRMPELFGIRLGTVMVTGFILATMFWNLDDSPKGV  493

Query  1727  QERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaf  1906
             QERLGF AFAMSTTFYTCA+A+P+FLQERYIFMRETAYNAYRRSSYVLSHS++ LPSL F
Sbjct  494   QERLGFIAFAMSTTFYTCADALPIFLQERYIFMRETAYNAYRRSSYVLSHSLVVLPSLVF  553

Query  1907  lslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAI  2086
             LS+AF+VTT+WAVGL GG SGFLF+ L +FASFWAGSSFVTFLSG++  VM+ YT+VVAI
Sbjct  554   LSIAFSVTTFWAVGLDGGLSGFLFYFLIIFASFWAGSSFVTFLSGVVPQVMLGYTIVVAI  613

Query  2087  LAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSP  2266
             LAYF+LFSGFFI R+RIP YWIWFHY SLVKYP++GVLQNEF    KCFV+GIQIFD +P
Sbjct  614   LAYFLLFSGFFITRNRIPAYWIWFHYLSLVKYPYEGVLQNEFQNTAKCFVRGIQIFDNTP  673

Query  2267  LKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgff  2446
             L  VP+AMKLKLL +MS+TLG+ IT STCLTTG DIL+Q GVTD++KWNCLW+T+A GF 
Sbjct  674   LGTVPDAMKLKLLDSMSETLGMRITRSTCLTTGADILEQQGVTDLSKWNCLWVTVAWGFL  733

Query  2447  frllfyfallIGSKNKRR  2500
             FR+LFYFALL+GSKNKRR
Sbjct  734   FRILFYFALLLGSKNKRR  751



>ref|XP_006290640.1| hypothetical protein CARUB_v10016733mg [Capsella rubella]
 gb|EOA23538.1| hypothetical protein CARUB_v10016733mg [Capsella rubella]
Length=740

 Score =   870 bits (2248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/744 (71%), Positives = 602/744 (81%), Gaps = 40/744 (5%)
 Frame = +2

Query  311   FLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDH-RVLQLYDPV  487
             F    +++ELQ   +R    VS+TL ELL  V D             NDH R L     V
Sbjct  23    FYNIHKSVELQR-CQRDTARVSVTLAELLMSVEDEG-----------NDHSRALD----V  66

Query  488   PYPSSF-------------PFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKV  628
                S+F             PFVLSF +L+YSVK ++K       G  +   + +E + KV
Sbjct  67    AVASNFWASVPSPCVPSSSPFVLSFRDLTYSVKTQKKFKPFPCCGNSSFVGNDMEMNTKV  126

Query  629   LLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVI  808
             LL+ ISGEAREGE+MAVLGASGSGKSTLIDALANRIA+ESL G + +NGEVLES L KVI
Sbjct  127   LLNGISGEAREGEMMAVLGASGSGKSTLIDALANRIAKESLRGAITLNGEVLESSLHKVI  186

Query  809   SAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGD  988
             SAYVMQDDLLFPMLTVEETLMFSAEFRLP SLS+ +KKARVQALI+QLGL+ AAKTVIGD
Sbjct  187   SAYVMQDDLLFPMLTVEETLMFSAEFRLPSSLSKKKKKARVQALIDQLGLRNAAKTVIGD  246

Query  989   eghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIM  1168
             EGHRGVSGGERRRVSIG DIIHDPI+LFLDEPTSGLDSTSA+MVVKVLQRIAQSGSIVIM
Sbjct  247   EGHRGVSGGERRRVSIGTDIIHDPIILFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIM  306

Query  1169  SVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRE  1348
             S+HQPSYRIL LLD+LIFLS+G TV+SGSP+ LPRFF EFG+PIPENEN+ EFALD IRE
Sbjct  307   SIHQPSYRILGLLDKLIFLSRGNTVYSGSPTHLPRFFSEFGHPIPENENKPEFALDLIRE  366

Query  1349  LEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATN  1528
             LE SPEGTK LV+++K W+ K   SS S RN   P     L+DAI+ASISRGKLVSGATN
Sbjct  367   LEDSPEGTKTLVEYHKQWRAK-QTSSQSRRNTNVP-----LRDAITASISRGKLVSGATN  420

Query  1529  INSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLD  1708
             + S    S   FANPFW EM+VIGKRS++NS R PELF +R GAV+VTGIILATIFWKLD
Sbjct  421   LKS----SFQTFANPFWTEMLVIGKRSILNSSRQPELFGIRLGAVLVTGIILATIFWKLD  476

Query  1709  DSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiis  1888
             +SP+GIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL+H+IIS
Sbjct  477   NSPRGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLAHTIIS  536

Query  1889  lpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAY  2068
             +P+L  LS AFA TT+WAVGLAGG  GF FF   +  SFWAGSSFVTFLSG++ +VMI +
Sbjct  537   IPALIILSAAFAATTFWAVGLAGGSEGFFFFFFTILTSFWAGSSFVTFLSGVVSHVMIGF  596

Query  2069  TLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQ  2248
             T+VVAILAYF+LFSGFFI+RDRIPPYWIWFHY SLVKYP++GVLQNEFD P KCFV+GIQ
Sbjct  597   TVVVAILAYFLLFSGFFISRDRIPPYWIWFHYLSLVKYPYEGVLQNEFDDPTKCFVRGIQ  656

Query  2249  IFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWIT  2428
             +FD SPL  VP A+K+ LL++MS  LGIN+T+ TC+TTG DILKQ G+T+I+KW+CLWIT
Sbjct  657   MFDNSPLGKVPTAVKIGLLKSMSGVLGINVTAETCVTTGIDILKQQGITEISKWSCLWIT  716

Query  2429  IAlgfffrllfyfallIGSKNKRR  2500
             +ALGFFFR+LFYF LLIGSKNKRR
Sbjct  717   VALGFFFRVLFYFTLLIGSKNKRR  740



>ref|XP_004308829.1| PREDICTED: ABC transporter G family member 6-like [Fragaria vesca 
subsp. vesca]
Length=747

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/746 (70%), Positives = 612/746 (82%), Gaps = 25/746 (3%)
 Frame = +2

Query  314   LGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGA----NDHRVLQLYD  481
             + P   MEL +  R   H  S +LG+LL  VGD   E    G GG     + H+VL + D
Sbjct  10    ISPFFTMELDDFPR-ASHGASPSLGQLLKHVGDVRKEA--TGDGGETPLHHHHQVLDVSD  66

Query  482   P-VPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLG---RRTAAPSQVE--------NDVK  625
               +  P + PFVLSF NL+YSVK+RRK  +         R  A +Q E           K
Sbjct  67    ESLDEPRTLPFVLSFTNLTYSVKIRRKFSLSGMFSSDRNRLGAATQAEPVGGESLFTSTK  126

Query  626   VLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKV  805
              LL+DISGEAREGE++AVLGASGSGKSTLIDALANRIA+ SL G V +NGEVLES+LLKV
Sbjct  127   TLLNDISGEAREGEVLAVLGASGSGKSTLIDALANRIAKGSLKGKVSLNGEVLESRLLKV  186

Query  806   ISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIG  985
             ISAYVMQDDLLFPMLTVEETLMF+AEFRLPR+LS+S+KK RVQALI+QLGL+ AA T+IG
Sbjct  187   ISAYVMQDDLLFPMLTVEETLMFAAEFRLPRALSKSKKKMRVQALIDQLGLRNAANTIIG  246

Query  986   DeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVI  1165
             DEGHRGVSGGERRRVSIGIDI+HDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVI
Sbjct  247   DEGHRGVSGGERRRVSIGIDIVHDPIILFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVI  306

Query  1166  MSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIR  1345
             MSVHQPSYRIL LLDRL+FLS+GQTVFSGSP+ LP +F EFG PIP++EN+ EFALD IR
Sbjct  307   MSVHQPSYRILGLLDRLLFLSRGQTVFSGSPAQLPPYFAEFGRPIPDSENKTEFALDLIR  366

Query  1346  ELEQSPEGTKNLVDFNKSWQR-KFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGA  1522
             ELE SP GTK+LV+FNKSWQ  K + + T++  +V P     L++AISASISRGKLVSGA
Sbjct  367   ELEGSPGGTKSLVEFNKSWQAMKHTTNRTTDTRHVVP-----LQEAISASISRGKLVSGA  421

Query  1523  TNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWK  1702
             TN +++ +  VP FANP  VE+ V+ KRSM N+ RMPELF +R GAV+VTG ILAT+FW 
Sbjct  422   TNNDASPNSMVPTFANPILVEIAVLAKRSMKNARRMPELFGIRLGAVMVTGFILATMFWN  481

Query  1703  LDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsi  1882
             LD++PKG+QERLGF AFAMSTTFYTCA+A+PVFLQERYIFMRETAYNAYRRSSYVLSHS+
Sbjct  482   LDNTPKGVQERLGFIAFAMSTTFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHSL  541

Query  1883  islpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMI  2062
             ++LPSL FLS AF+ TT+WAVGL GG SGFLF+ L +FASFWAGSSFVTFLSG++ +VM+
Sbjct  542   VALPSLIFLSAAFSATTFWAVGLDGGLSGFLFYFLIIFASFWAGSSFVTFLSGVVPHVML  601

Query  2063  AYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKG  2242
              YT+VVAILAYF+LFSGFFINRDRIP YWIWFHY SLVKYP++GV+QNEF  P KCFV+G
Sbjct  602   GYTIVVAILAYFLLFSGFFINRDRIPDYWIWFHYMSLVKYPYEGVMQNEFQDPTKCFVRG  661

Query  2243  IQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLW  2422
             +QIFD +PL AVP A+KLKLL +MS+TLG+ IT STCLTTG DILKQ GVTD++KW+CLW
Sbjct  662   VQIFDNTPLAAVPAALKLKLLDSMSETLGMKITRSTCLTTGSDILKQQGVTDLSKWSCLW  721

Query  2423  ITIAlgfffrllfyfallIGSKNKRR  2500
             IT+A GF FR+LFYF+LL+GSKNKRR
Sbjct  722   ITVAWGFLFRILFYFSLLVGSKNKRR  747



>ref|XP_010669774.1| PREDICTED: ABC transporter G family member 6-like [Beta vulgaris 
subsp. vulgaris]
Length=762

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/730 (70%), Positives = 596/730 (82%), Gaps = 32/730 (4%)
 Frame = +2

Query  362   RHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFPFVLSFHNLSYS  541
             R S S TLG+LL RVGD+  E      G  ++  V       P   + PFVL F NL+Y+
Sbjct  48    RVSFSPTLGQLLKRVGDARRE------GTGDETPVHHTLAMSPETRALPFVLRFSNLTYN  101

Query  542   VKVRRKMGVPAWLGRRTAAPSQ--------VENDVKVLLDDISGEAREGEIMAVLGASGS  697
             VKV +KM +P  +    A P +        V +  K LL+DISGEAR+GEIMAVLGASGS
Sbjct  102   VKVTKKMQIPG-VNSHIATPGEHHPVGNNGVFSRTKTLLNDISGEARDGEIMAVLGASGS  160

Query  698   GKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFS  877
             GKSTLIDALANRIAR SL G + +NGE LES+LLKVISAYVMQDDLLFPMLTVEETLMFS
Sbjct  161   GKSTLIDALANRIARGSLKGKITLNGEPLESRLLKVISAYVMQDDLLFPMLTVEETLMFS  220

Query  878   AEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHD  1057
             AEFRLPR+LS+S+K+ARVQ LI+QLGL+ AAKT+IGDEGHRGVSGGERRRVSIG+DIIHD
Sbjct  221   AEFRLPRTLSKSKKEARVQQLIDQLGLRNAAKTIIGDEGHRGVSGGERRRVSIGLDIIHD  280

Query  1058  PIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQ  1237
             PI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIV+MS+HQPSYRI+ LLDRLIFLSKGQ
Sbjct  281   PIILFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVMMSIHQPSYRIMGLLDRLIFLSKGQ  340

Query  1238  TVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQRKFS  1417
             TVFSGSPS LP +F EFG  IPENEN+ E+ALD IRELE +P G K LV+F+K WQ K  
Sbjct  341   TVFSGSPSDLPGYFDEFGKSIPENENKTEYALDLIRELEGAPGGAKALVEFHKGWQMK--  398

Query  1418  PSSTSNRNNVFPN----PKPS-----LKDAISASISRGKLVSGATNINSTLSPSVPKFAN  1570
                   + +VFPN    P+ S     LK+AISASISRGKLVSGATN +++ +  VP FAN
Sbjct  399   ------KRSVFPNIEGAPQDSRGGLSLKEAISASISRGKLVSGATNADASPASMVPTFAN  452

Query  1571  PFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFA  1750
             PFW E+V + KRS++NS R PELF +R GAV+VTG ILATIFW+LD+SPKG+QERLGFFA
Sbjct  453   PFWNEIVTLSKRSVMNSRRTPELFGIRLGAVLVTGFILATIFWQLDNSPKGVQERLGFFA  512

Query  1751  FAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVT  1930
             FAMSTTFYTCA+A+PVFLQERYIFMRETAYNAYRRSSYVLSH++ +LPSL FLS AFA T
Sbjct  513   FAMSTTFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHALTALPSLIFLSFAFAAT  572

Query  1931  TYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFS  2110
             T+WAVGL GG SGF F+   +FASFWAG+SFV+FLSG++ +VM+ Y +VVAILAYF+LFS
Sbjct  573   TFWAVGLDGGVSGFFFYFGIIFASFWAGNSFVSFLSGVVPHVMLGYVIVVAILAYFLLFS  632

Query  2111  GFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAM  2290
             GFFINRDRIP YWIWFHY SLVKYP++GVLQNEF  P KCF++G+QIFD +PL AVP AM
Sbjct  633   GFFINRDRIPNYWIWFHYMSLVKYPYEGVLQNEFQDPTKCFIRGVQIFDNTPLGAVPNAM  692

Query  2291  KLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfa  2470
             K++LLQ +S +LG+ IT STC+TTG DIL+Q GVTD+ KW CLW+T+A GFFFR+LFYF+
Sbjct  693   KVRLLQTISGSLGMTITPSTCVTTGADILQQQGVTDLTKWGCLWVTVAWGFFFRILFYFS  752

Query  2471  llIGSKNKRR  2500
             LL+GSKNKRR
Sbjct  753   LLLGSKNKRR  762



>ref|XP_011101624.1| PREDICTED: ABC transporter G family member 1-like [Sesamum indicum]
Length=747

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/747 (69%), Positives = 605/747 (81%), Gaps = 33/747 (4%)
 Frame = +2

Query  305   LPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGAND--HRVLQLY  478
             +PF   R   E+     R    +S TLG+LL RVGD   E     V G     H+VL + 
Sbjct  19    VPFYDRR---EVAAEMSRADACISPTLGQLLKRVGDVRKE-----VTGDETPVHQVLDVS  70

Query  479   DPVPY-PSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAA-PSQVE---NDVKVLLDDI  643
             D     P S PFVLSF +++YSVKVRRK+ +  +  R+ AA P   E   +  K +L+DI
Sbjct  71    DTSSVEPRSLPFVLSFTHITYSVKVRRKVSLTNFFRRQPAADPDSGETLFSATKTILNDI  130

Query  644   SGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVM  823
             SGEAR+GEIMAV+GASGSGKSTLIDALANR+A+ SL G++ +NGE LES+LLKVISAYVM
Sbjct  131   SGEARDGEIMAVMGASGSGKSTLIDALANRMAKGSLKGSISLNGEQLESRLLKVISAYVM  190

Query  824   QDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrg  1003
             QDDLLFPMLTVEETLMF+AEFRLPR+LS+S+KK RVQALI+QLGL+ AAKTVIGDEGHRG
Sbjct  191   QDDLLFPMLTVEETLMFAAEFRLPRTLSKSKKKLRVQALIDQLGLRNAAKTVIGDEGHRG  250

Query  1004  vsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQP  1183
             VSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMS+HQP
Sbjct  251   VSGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQP  310

Query  1184  SYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSP  1363
             SYRIL LLDR+IFLS+G TV+SG PS+LP FF +FG+PIP+NENR EFALD IRELE SP
Sbjct  311   SYRILGLLDRMIFLSRGHTVYSGPPSNLPVFFSDFGHPIPDNENRTEFALDLIRELEGSP  370

Query  1364  EGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKP------SLKDAISASISRGKLVSGAT  1525
              GTK+LV+FNKSWQ          R N   +  P      SLK+AISASIS+GKLVSGAT
Sbjct  371   GGTKSLVEFNKSWQ-------ALKRGNQMNSESPANILNLSLKEAISASISKGKLVSGAT  423

Query  1526  NINSTLSPS--VPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFW  1699
               N   SP+  VP FANP W+EM V+ KRS  NS RMPELF +R GAV+VTG ILAT+FW
Sbjct  424   ATNGANSPTSMVPTFANPSWIEMAVLSKRSFTNSRRMPELFGVRLGAVMVTGFILATMFW  483

Query  1700  KLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHs  1879
             +LD+SPKGIQERLGFFAFAMSTTFYTCA+A+PVFLQERYIFMRETAYNAYRRSSYVLSHS
Sbjct  484   RLDNSPKGIQERLGFFAFAMSTTFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHS  543

Query  1880  iislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVM  2059
             ++SLPSL FLSLAFA TT+WAVGL G F  +   +   F   WAGSSFVTFLSG++ +VM
Sbjct  544   LVSLPSLLFLSLAFAATTFWAVGLDGSFFFYFLIIFASF---WAGSSFVTFLSGVVPHVM  600

Query  2060  IAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVK  2239
             + YT+VVAILAYF+LFSGFFINRDRIPPYWIWFHY SLVKYP++ VLQNEF+ P KCFV+
Sbjct  601   LGYTIVVAILAYFLLFSGFFINRDRIPPYWIWFHYISLVKYPYEAVLQNEFEDPVKCFVR  660

Query  2240  GIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCL  2419
             G+QIFD +PL AVP A+K+KLL ++S +LG+ ITS+TC+TTG DIL+Q G+TD++KW+CL
Sbjct  661   GVQIFDNTPLGAVPNALKVKLLDSLSNSLGMKITSTTCVTTGADILQQQGITDLSKWSCL  720

Query  2420  WITIAlgfffrllfyfallIGSKNKRR  2500
             W+T+A GFFFR+LFY +LL+GSKNKRR
Sbjct  721   WVTVAWGFFFRILFYLSLLVGSKNKRR  747



>ref|XP_010067225.1| PREDICTED: ABC transporter G family member 6-like [Eucalyptus 
grandis]
Length=760

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/764 (69%), Positives = 629/764 (82%), Gaps = 35/764 (5%)
 Frame = +2

Query  281   DMSTASSDLPFLGPRQAMELQELTRRPRHSVSMT------LGELLHRVGDSAGEKLNNGV  442
             ++S+A    PF     AMEL +L RR     +        L +LL RVGD+  E    G 
Sbjct  8     NLSSARDPRPFF--TTAMELHDLPRRAAEPPAAAPTPSPTLAQLLKRVGDARKEA--TGD  63

Query  443   GG---ANDHRVLQ--LYDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTA--AP  601
             GG    + H  L   L D    P S PFVL F+NL+YS+KVRRK+ +P+ L RR +    
Sbjct  64    GGETPVHHHHALDVDLSDSSLEPRSLPFVLQFNNLTYSIKVRRKVALPSLLPRRRSRLGS  123

Query  602   SQVENDV---------KVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLG  754
             + VE  V         KVLL+DISGEAR+GEI+AVLGASGSGKSTL+DALANRIA+ SL 
Sbjct  124   AAVEEPVAGESLFSRTKVLLNDISGEARDGEILAVLGASGSGKSTLVDALANRIAKGSLK  183

Query  755   GTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQ  934
             G+V +NGE LES+LLKVISAYVMQDDLLFPMLTVEETLMF+AEFRLPR+LS+S+K+ RVQ
Sbjct  184   GSVTLNGEPLESRLLKVISAYVMQDDLLFPMLTVEETLMFAAEFRLPRTLSKSKKRMRVQ  243

Query  935   ALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAF  1114
             ALI+QLGL+ AAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSA+
Sbjct  244   ALIDQLGLRNAAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAY  303

Query  1115  MVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGN  1294
             MVVKVLQRIAQSGSIV+M+VHQPSYRIL LLDRL+FLS+GQTV+SGSP+SLP FF EFG+
Sbjct  304   MVVKVLQRIAQSGSIVVMTVHQPSYRILGLLDRLLFLSRGQTVYSGSPTSLPLFFSEFGH  363

Query  1295  PIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQ--RKFSPSSTSNRNNVFPNPKPS  1468
             PIPENENR EFALD IRELE SP GT++LV+FNKSWQ  ++ + +S  +RN +      S
Sbjct  364   PIPENENRTEFALDLIRELEGSPGGTRSLVEFNKSWQSMKQGARNSEPDRNGL------S  417

Query  1469  LKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAM  1648
             LK+AI ASISRGKLVSGATN +++ +  VP FANPFW+EM V+ KRS+ NS RMPELF +
Sbjct  418   LKEAIGASISRGKLVSGATN-DASPASMVPTFANPFWIEMAVLSKRSITNSRRMPELFGI  476

Query  1649  RFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMR  1828
             R GAV+VTG ILAT+FW+LD+SPKG+QERLGF AFAMSTTFYTCA+A+PVFLQERYIFMR
Sbjct  477   RLGAVLVTGFILATMFWQLDNSPKGVQERLGFIAFAMSTTFYTCADALPVFLQERYIFMR  536

Query  1829  ETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfW  2008
             ETAYNAYRR SYVLSHS+++LP+L  L+LAF+ TT++AVGL GGFSGFLF+ L +FASFW
Sbjct  537   ETAYNAYRRWSYVLSHSLVALPALVLLALAFSATTFFAVGLDGGFSGFLFYFLIIFASFW  596

Query  2009  AGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPF  2188
             AGSSFVTFLSG++ +VM+ YT+VVAILAYF+LFSGFFINRDRIP YWIWFHY SLVKYP+
Sbjct  597   AGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPSYWIWFHYLSLVKYPY  656

Query  2189  QGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGP  2368
             +GVLQNEF  P KCFVKG+QIFD +PL AVP+++KLKLL  +S TLG+ IT+STCLTTG 
Sbjct  657   EGVLQNEFQDPTKCFVKGVQIFDNTPLGAVPDSVKLKLLSTISNTLGMKITASTCLTTGT  716

Query  2369  DILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             DIL+Q GVTD++KW+CLW+T+A GF FR+LFYF+LL+GSKNKRR
Sbjct  717   DILQQQGVTDLSKWSCLWVTVAWGFLFRILFYFSLLLGSKNKRR  760



>ref|XP_006410918.1| hypothetical protein EUTSA_v10016295mg [Eutrema salsugineum]
 gb|ESQ52371.1| hypothetical protein EUTSA_v10016295mg [Eutrema salsugineum]
Length=752

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/754 (70%), Positives = 618/754 (82%), Gaps = 35/754 (5%)
 Frame = +2

Query  293   ASSDLPFLGPRQ-AMELQELTRRPRHS--VSMTLGELLHRVGDSAGEKLNNGVGGANDHR  463
              ++DLP     Q +ME Q   R PR +  V+ TL ELL  V D+  +++          R
Sbjct  16    GNNDLPLFYVNQTSMEPQ---RSPRDTPRVTATLAELLMNVEDARNDQITT-------RR  65

Query  464   VLQLYDPVPYPSS---------------FPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAA  598
              L++  P+   +S                PFVLSF++L+YSVK+R+K    A  G+ ++ 
Sbjct  66    ALEMVSPLTSSASSFNSWTSAPASSISSSPFVLSFNDLTYSVKIRKKFEPLACCGK-SSN  124

Query  599   PSQVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGE  778
              S V  + K+LL++ISGEA EGE+MAVLGASGSGKSTLIDALANRIA++SL G++ +NGE
Sbjct  125   DSAV--NTKILLNNISGEAHEGEMMAVLGASGSGKSTLIDALANRIAKDSLRGSITLNGE  182

Query  779   VLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGL  958
             VLES L KVISAYVMQDDLLFPMLTVEETLMFSAEFRLPRSLS+ +KKARVQALI+QLGL
Sbjct  183   VLESSLQKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPRSLSKKKKKARVQALIDQLGL  242

Query  959   QTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQR  1138
             ++AAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSA+MV+KVLQR
Sbjct  243   RSAAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAYMVIKVLQR  302

Query  1139  IAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENR  1318
             IAQSGSIVIMS+HQPSYRI+ LLDRLIFLS+G TV+SGSP+ LP+FF EF +PIPENEN+
Sbjct  303   IAQSGSIVIMSIHQPSYRIMGLLDRLIFLSRGNTVYSGSPTHLPQFFSEFEHPIPENENK  362

Query  1319  CEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASIS  1498
              EFALD IRELE S  GTK LV+F+K W+ K   SS  N N    NP  SLK+AI+ASIS
Sbjct  363   TEFALDLIRELENSAGGTKTLVEFHKQWRAK-QASSYDNNNR---NPNVSLKEAITASIS  418

Query  1499  RGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGI  1678
             RGKLVSGATN +S L+ S   FANPFW+E++VIGKRS++NS R PEL  MR GAV+VTGI
Sbjct  419   RGKLVSGATNSSSNLTSSFQTFANPFWIEVIVIGKRSILNSRRQPELLGMRLGAVMVTGI  478

Query  1679  ILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRS  1858
             ILAT+F KLD+SPKG+QERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRS
Sbjct  479   ILATMFTKLDNSPKGVQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRS  538

Query  1859  SYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLS  2038
             SYVLS SIIS+PSL FL+ +FA TT+WAVGLAGG SGFLFF L + ASFWAGSSFVTFLS
Sbjct  539   SYVLSQSIISIPSLIFLAASFAATTFWAVGLAGGASGFLFFFLTILASFWAGSSFVTFLS  598

Query  2039  GIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDY  2218
             G++ NVM+ +T+VVAILAYF+LFSGFFI+RDRIP YWIWFHY SLVKYP++GVLQNEF+ 
Sbjct  599   GVVSNVMLGFTVVVAILAYFLLFSGFFISRDRIPLYWIWFHYLSLVKYPYEGVLQNEFED  658

Query  2219  PDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTD  2398
             P KCFV+GIQIFD SPL  VP A+KL LL++MS  LGIN+T+ TC+TTG DILKQ G+TD
Sbjct  659   PTKCFVRGIQIFDNSPLGQVPNAVKLSLLKSMSGVLGINVTAETCVTTGIDILKQQGITD  718

Query  2399  INKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             I+KWNCLWIT+A GFFFR+LFYF LLIGSKNKRR
Sbjct  719   ISKWNCLWITVAWGFFFRVLFYFTLLIGSKNKRR  752



>ref|XP_010427003.1| PREDICTED: ABC transporter G family member 20 [Camelina sativa]
Length=740

 Score =   864 bits (2233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/731 (71%), Positives = 598/731 (82%), Gaps = 13/731 (2%)
 Frame = +2

Query  311   FLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVP  490
             F    +++ELQ   +R    VS+TL ELL  V D  G   +     A             
Sbjct  22    FYNIHRSVELQR-CQRDTARVSVTLAELLMSVEDE-GNDHSRAFDDAVASNFWASNPSSC  79

Query  491   YPSSFPFVLSFHNLSYSVKVRRKMGVP-AWLGRRTAAPSQVENDVKVLLDDISGEAREGE  667
              PSS PFVLSF +L+YSVK+++K   P    G      + +E + KVLL+ ISGEAREGE
Sbjct  80    VPSSSPFVLSFRDLTYSVKIQKKFKSPFPCCGNSPFDGNDMEMNTKVLLNGISGEAREGE  139

Query  668   IMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPM  847
             +MAVLGASGSGKSTLIDALANRIA+ESL G + +NGEVLES L KVISAYVMQDDLLFPM
Sbjct  140   MMAVLGASGSGKSTLIDALANRIAKESLRGAIALNGEVLESSLHKVISAYVMQDDLLFPM  199

Query  848   LTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrr  1027
             LTVEETLMFSAEFRLP SLS+ +KKARVQALI+QLGL+ AAKTVIGDEGHRGVSGGERRR
Sbjct  200   LTVEETLMFSAEFRLPSSLSKKKKKARVQALIDQLGLRNAAKTVIGDEGHRGVSGGERRR  259

Query  1028  vsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLL  1207
             VSIG DIIHDPI+LFLDEPTSGLDSTSA+MVVKVLQRIAQSGSIVIMS+HQPSYRIL LL
Sbjct  260   VSIGTDIIHDPIILFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSYRILGLL  319

Query  1208  DRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVD  1387
             D+LIFLS+G TV+SGSP+ LPRFF EFG+PIPENEN+ EFALD IRELE SPEGTK LV+
Sbjct  320   DKLIFLSRGNTVYSGSPTHLPRFFSEFGHPIPENENKPEFALDLIRELEDSPEGTKTLVE  379

Query  1388  FNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFA  1567
             F+K W+ K + S +    NV      SL+DAI++SISRGKLVSGATN+ S    S   FA
Sbjct  380   FHKQWRAKQTSSQSRRNTNV------SLRDAITSSISRGKLVSGATNLKS----SFQTFA  429

Query  1568  NPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFF  1747
             NPFW EM+VIGKRS++NS R PELF +R GAV+VTGIILATIFWKLD+SP+GIQERLGFF
Sbjct  430   NPFWTEMLVIGKRSILNSSRQPELFGIRLGAVLVTGIILATIFWKLDNSPRGIQERLGFF  489

Query  1748  AFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaV  1927
             AFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL+H+IIS+P+L  LS AFA 
Sbjct  490   AFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLAHTIISIPALIILSAAFAA  549

Query  1928  TTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLF  2107
             TT+WAVGLAGG  GF FF   +  +FWAGSSFVTFLSG++ +VMI +T+VVAILAYF+LF
Sbjct  550   TTFWAVGLAGGSEGFFFFFFTILTAFWAGSSFVTFLSGVVSHVMIGFTVVVAILAYFLLF  609

Query  2108  SGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEA  2287
             SGFFI+RDRIPPYWIWFHY SLVKYP++GVLQNEF+ P KCFV+GIQ+FD SPL  VP A
Sbjct  610   SGFFISRDRIPPYWIWFHYLSLVKYPYEGVLQNEFEDPTKCFVRGIQMFDNSPLGQVPAA  669

Query  2288  MKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyf  2467
             +K+ LL++MS  LG N+T+ TC+TTG DILKQ G+T+I+KW+CLWIT+ALGF FR+LFYF
Sbjct  670   VKISLLKSMSGVLGKNVTAETCVTTGIDILKQQGITEISKWSCLWITVALGFVFRVLFYF  729

Query  2468  allIGSKNKRR  2500
              LLIGSKNKRR
Sbjct  730   TLLIGSKNKRR  740



>ref|XP_010504115.1| PREDICTED: ABC transporter G family member 20-like [Camelina 
sativa]
Length=740

 Score =   864 bits (2233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/745 (70%), Positives = 600/745 (81%), Gaps = 41/745 (6%)
 Frame = +2

Query  311   FLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDH-RVLQLYDPV  487
             F    +++ELQ   +R    VS+TL ELL  V D             NDH R L     V
Sbjct  22    FYNIHRSVELQR-CQRDTARVSVTLAELLMSVEDEG-----------NDHSRALD----V  65

Query  488   PYPSSF-------------PFVLSFHNLSYSVKVRRKMGVP-AWLGRRTAAPSQVENDVK  625
                S+F             PFVLSF +LSYSVK+++K  +P +  G      + +E + K
Sbjct  66    AVASNFWASNPSSCVPSSSPFVLSFRDLSYSVKIQKKFKLPFSCCGNSPFDGNDMEMNTK  125

Query  626   VLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKV  805
             VLL+ ISGEAREGE+MAVLGASGSGKSTLIDALANRIA+ESL G + +NGEVLES L KV
Sbjct  126   VLLNGISGEAREGEMMAVLGASGSGKSTLIDALANRIAKESLRGAITLNGEVLESSLHKV  185

Query  806   ISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIG  985
             ISAYVMQDDLLFPMLTVEETLMFSAEFRLP SLS+ +KKARVQALI+QLGL+ AAKTVIG
Sbjct  186   ISAYVMQDDLLFPMLTVEETLMFSAEFRLPSSLSKKKKKARVQALIDQLGLRNAAKTVIG  245

Query  986   DeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVI  1165
             DEGHRGVSGGERRRVSIG DIIHDPI+LFLDEPTSGLDSTSA+MVVKVLQRIAQSGSIVI
Sbjct  246   DEGHRGVSGGERRRVSIGTDIIHDPIILFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVI  305

Query  1166  MSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIR  1345
             MS+HQPSYRIL LLD+LIFLS+G TV+SGSP+ LPRFF EFG+PIPENEN+ EFALD IR
Sbjct  306   MSIHQPSYRILGLLDKLIFLSRGNTVYSGSPTHLPRFFSEFGHPIPENENKPEFALDLIR  365

Query  1346  ELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGAT  1525
             ELE SPEGTK LV+F+K W+ K + S +    NV      SL+DAI++SISRGKLVSGAT
Sbjct  366   ELEDSPEGTKTLVEFHKQWRAKQTSSQSRRNTNV------SLRDAITSSISRGKLVSGAT  419

Query  1526  NINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKL  1705
             N+ S    S   FANPFW EM+VIGKRS++NS R PELF +R GAV+VTGIILATIFWKL
Sbjct  420   NLKS----SFQTFANPFWTEMLVIGKRSILNSSRQPELFGIRLGAVLVTGIILATIFWKL  475

Query  1706  DDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsii  1885
             D+SP+GIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL+H+II
Sbjct  476   DNSPRGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLAHTII  535

Query  1886  slpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIA  2065
             S+P+L  LS AFA TT+WAVGLAGG  GF FF   +  +FWAGSSFVTFLSG++ +VMI 
Sbjct  536   SIPALIILSAAFAATTFWAVGLAGGSEGFFFFFFTILTAFWAGSSFVTFLSGVVSHVMIG  595

Query  2066  YTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGI  2245
             +T+VVAILAYF+LFSGFFI+RDRIPPYWIWFHY SLVKYP++GVLQNEF+ P  CFV+GI
Sbjct  596   FTVVVAILAYFLLFSGFFISRDRIPPYWIWFHYLSLVKYPYEGVLQNEFEDPTTCFVRGI  655

Query  2246  QIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWI  2425
             Q+FD SPL   P A K+ LL++MS  LGIN+T+ TC+T G DILKQ G+T+I+KW+CLWI
Sbjct  656   QMFDNSPLGKFPAAAKITLLKSMSGVLGINVTAETCVTRGIDILKQKGITEISKWSCLWI  715

Query  2426  TIAlgfffrllfyfallIGSKNKRR  2500
             T+ALGF FR+LFYF LLIGSKNKRR
Sbjct  716   TVALGFVFRVLFYFTLLIGSKNKRR  740



>ref|XP_004302811.1| PREDICTED: ABC transporter G family member 2-like [Fragaria vesca 
subsp. vesca]
Length=736

 Score =   864 bits (2233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/732 (71%), Positives = 615/732 (84%), Gaps = 13/732 (2%)
 Frame = +2

Query  332   MELQELT-RRPRHSVSMTLGELLHRVGDSAG-EKLNNGVGGANDHRVLQLYDPVPY--PS  499
             +EL+E    RPR  ++ TL ELL  V  S   ++        N H VL +  P      S
Sbjct  9     LELREFNPTRPR--INPTLAELLQWVEQSQTPDRKTTSSNHNNAHHVLDIGFPSTSLSQS  66

Query  500   SFPFVLSFHNLSYSVKVRRKMGV-PAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMA  676
             ++PFVLSF+NL+YSVKVRRKM + P++            +  KVLL+ +SGEAREG+IMA
Sbjct  67    TYPFVLSFNNLTYSVKVRRKMTLLPSFRKTEAKLGGSGASSTKVLLNGVSGEAREGQIMA  126

Query  677   VLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTV  856
             VLGASGSGKSTLIDALA+RIA++SL GT+ +N E+L S++LKVISAYVMQDDLLFPMLTV
Sbjct  127   VLGASGSGKSTLIDALADRIAKDSLKGTITLNDEILNSRMLKVISAYVMQDDLLFPMLTV  186

Query  857   EETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsi  1036
             EETLMFSAEFRLP+SLS+S+KK+RV+ALI+QLGL+ AAKTVIGDEGHRGVSGGERRRVSI
Sbjct  187   EETLMFSAEFRLPQSLSKSKKKSRVEALIDQLGLRNAAKTVIGDEGHRGVSGGERRRVSI  246

Query  1037  giDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRL  1216
             GIDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIV+MSVHQPSYRIL LLDRL
Sbjct  247   GIDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVVMSVHQPSYRILGLLDRL  306

Query  1217  IFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNK  1396
             + LS GQTV+SGSP++LP FF+EFG+PIPE ENR EFALD IRELE++P GTK+LV+FNK
Sbjct  307   VLLSHGQTVYSGSPANLPVFFREFGHPIPETENRTEFALDLIRELEETPGGTKSLVEFNK  366

Query  1397  SWQ----RKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKF  1564
              WQ    +KF  ++ S+ N+    PK SLKDAISASISRGKLVSGA + ++ L+ SVP F
Sbjct  367   KWQITKRQKFKQANGSD-NSASSMPKLSLKDAISASISRGKLVSGAPS-DTNLASSVPTF  424

Query  1565  ANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGF  1744
             ANP W EM+VI KRS+ NS RMPELF +R GAV+VTGIILAT+FW LDDSPKG++ERLGF
Sbjct  425   ANPIWTEMLVISKRSIKNSTRMPELFGIRLGAVLVTGIILATMFWHLDDSPKGVEERLGF  484

Query  1745  FAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafa  1924
             FAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL+HS++S+PSL  LSLAFA
Sbjct  485   FAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLAHSLLSIPSLLILSLAFA  544

Query  1925  VTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVL  2104
              TT+WAVGLAGG  GFLFFLL + ++FWAGSSFVTFLSG++ +VM+ YT+VVAILAYF+L
Sbjct  545   ATTFWAVGLAGGLQGFLFFLLTICSAFWAGSSFVTFLSGVVTHVMLGYTVVVAILAYFLL  604

Query  2105  FSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPE  2284
             FSGFFI+RDRIP YWIWFHY SLVKYP++ VLQNEFD   KC V GIQ+FD +PL  VP 
Sbjct  605   FSGFFISRDRIPVYWIWFHYISLVKYPYEAVLQNEFDDHMKCLVTGIQMFDNTPLGDVPV  664

Query  2285  AMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfy  2464
             A+KLKLL+NMS TLG+N+T+S+C+TTG DILK+ G+TDI+KWNCLW+TIA GFFFR+LFY
Sbjct  665   ALKLKLLENMSNTLGMNVTASSCVTTGLDILKRQGITDISKWNCLWVTIAWGFFFRVLFY  724

Query  2465  fallIGSKNKRR  2500
             F LL+GSKNKRR
Sbjct  725   FTLLLGSKNKRR  736



>ref|XP_008442601.1| PREDICTED: ABC transporter G family member 20 [Cucumis melo]
Length=726

 Score =   862 bits (2228),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/732 (70%), Positives = 600/732 (82%), Gaps = 31/732 (4%)
 Frame = +2

Query  332   MELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSS---  502
             +EL+E+ RRP      TLGELL RV D+           + DH V+ +     YP++   
Sbjct  17    LELREIGRRP------TLGELLKRVEDAQ----------SPDHSVVDVSYGCRYPAAAPL  60

Query  503   -FPFVLSFHNLSYSVKVRRKMG---VPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEI  670
              +PF LSF NLSYSVKVRR+ G   +P  L     A  +    VK+LL+DISGEAREGEI
Sbjct  61    LYPFKLSFQNLSYSVKVRRRGGGSSLPENL-----AAEESGGRVKLLLNDISGEAREGEI  115

Query  671   MAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPML  850
             MAVLGASGSGKSTLIDALA+RIA+  L G V +N EVLES LLKVISAYVMQDDLLFPML
Sbjct  116   MAVLGASGSGKSTLIDALADRIAKGKLKGKVTLNNEVLESGLLKVISAYVMQDDLLFPML  175

Query  851   TVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrv  1030
             TVEETLMFSAEFRLPRSLS+S+KKARVQALI QLGL  AA TVIGDEGHRGVSGGERRRV
Sbjct  176   TVEETLMFSAEFRLPRSLSKSKKKARVQALINQLGLTAAANTVIGDEGHRGVSGGERRRV  235

Query  1031  sigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLD  1210
             SIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMS+HQPSYRIL+LLD
Sbjct  236   SIGIDIIHDPILLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSYRILSLLD  295

Query  1211  RLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDF  1390
             RLIFLS GQTV+SGSP+ LP F  EFG+PIP NENR EFALD +R+LE++  GTK++V+ 
Sbjct  296   RLIFLSHGQTVYSGSPTDLPNFLAEFGHPIPGNENRTEFALDLVRDLEETVGGTKSMVEH  355

Query  1391  NKSWQRKFSP--SSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKF  1564
             NKSWQRK +          +        LKDAISASISRGKLVSGA  I+S  S S  KF
Sbjct  356   NKSWQRKNNDHLEDYEIHRDFSRRFHLCLKDAISASISRGKLVSGAP-IDSNRSSSFSKF  414

Query  1565  ANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGF  1744
             +NP W+E++VI KRS++NS RMPELF +R GAV++TGIILAT+FW LD+SPKGIQERLGF
Sbjct  415   SNPLWIEILVIAKRSIMNSRRMPELFGIRLGAVLITGIILATMFWHLDNSPKGIQERLGF  474

Query  1745  FAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafa  1924
             FAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL+HS+IS+PSL  LSL FA
Sbjct  475   FAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLAHSLISIPSLIILSLTFA  534

Query  1925  VTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVL  2104
              TTY+AVGLAGGFSGF+FF   V ++FWAGSSFVTFLSG++ +VM+ YT+VVAILAYF+L
Sbjct  535   GTTYFAVGLAGGFSGFVFFFFAVLSAFWAGSSFVTFLSGVVSHVMLGYTVVVAILAYFLL  594

Query  2105  FSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPE  2284
             FSGFF++RDR+PPYWIWFHY SLVKYP++ VLQNEF+    CF++G+Q+FD +PL  VP 
Sbjct  595   FSGFFLSRDRMPPYWIWFHYMSLVKYPYEAVLQNEFEAKSGCFIRGVQMFDNTPLAVVPS  654

Query  2285  AMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfy  2464
             AMK++LL++M KTLG+NIT STC+TTG D+L+Q G+TD++KWNC+WI++A GF FR+LFY
Sbjct  655   AMKVELLKSMGKTLGLNITGSTCVTTGSDVLRQQGITDLSKWNCIWISMAWGFLFRILFY  714

Query  2465  fallIGSKNKRR  2500
             FALL GSKNKR+
Sbjct  715   FALLFGSKNKRK  726



>gb|KFK36622.1| hypothetical protein AALP_AA4G147700 [Arabis alpina]
Length=754

 Score =   861 bits (2224),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/751 (70%), Positives = 616/751 (82%), Gaps = 25/751 (3%)
 Frame = +2

Query  290   TASSDLPFLGPRQ-AMELQELTR-RPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHR  463
             T ++DLP     Q +ME Q   R  PR  VS TL ELL  V D+  ++  +   GA +  
Sbjct  15    TGNNDLPLFYVNQTSMEPQRCPRGAPR--VSATLAELLMNVEDARNDQ--STPRGALEMS  70

Query  464   VLQLYDPVPYPS----------SFPFVLSFHNLSYSVKVRRKMGVPAWLGR-RTAAPSQV  610
                      + S          S PFVLSF++L+YSVK+++K    A   R R  +P   
Sbjct  71    SPLTSSASSFNSWTSAPASSISSSPFVLSFNDLTYSVKIQKKFEPFACCKRSRNGSPV--  128

Query  611   ENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLES  790
               + K+LL+ ISGEAREGE+MAVLGASGSGKSTLIDALANRIA++SL G++ +NGEVLES
Sbjct  129   --NTKILLNGISGEAREGEMMAVLGASGSGKSTLIDALANRIAKDSLKGSITLNGEVLES  186

Query  791   KLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAA  970
              L KVISAYVMQDDLLFPMLTVEETLMFSAEFRLPRSLS+ +KKARVQALI+QLGL++AA
Sbjct  187   SLQKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPRSLSKKKKKARVQALIDQLGLRSAA  246

Query  971   KTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQS  1150
             KTVIGDEGHRGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSA+MV+KVLQRIAQS
Sbjct  247   KTVIGDEGHRGVSGGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAYMVIKVLQRIAQS  306

Query  1151  GSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFA  1330
             GSIVIMS+HQPSYRI+ LLDRLIFLS+G TV+SGSP+ LPRFF EF +PIPENEN+ EFA
Sbjct  307   GSIVIMSIHQPSYRIMGLLDRLIFLSRGNTVYSGSPTHLPRFFSEFNHPIPENENKTEFA  366

Query  1331  LDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKL  1510
             LD IRELE S EGTK LV+F+K W+ K +PS  +N +        +LK+AI+ASIS+GKL
Sbjct  367   LDLIRELENSAEGTKELVEFHKQWRTKQAPSYNNNGSRN---NNVTLKEAITASISKGKL  423

Query  1511  VSGATNINST-LSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILA  1687
             VSGATN ++T LS S   FANPFW+EM+VIGKR+++NS R PEL  MR GAV+VTGIILA
Sbjct  424   VSGATNNSTTNLSSSFQTFANPFWIEMIVIGKRAILNSRRQPELLGMRLGAVMVTGIILA  483

Query  1688  TIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYV  1867
             T+F KLD+SPKG+QERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYV
Sbjct  484   TMFTKLDNSPKGVQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYV  543

Query  1868  LSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGII  2047
             LS SIIS+PSL FL+ +FA TT++AVGLAGG +GFLFF L + ASFWAGSSFVTFLSG++
Sbjct  544   LSQSIISIPSLIFLAASFAATTFFAVGLAGGANGFLFFFLTILASFWAGSSFVTFLSGVV  603

Query  2048  YNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDK  2227
              NVM+ +T+VVAILAYF+LFSGFFI+RDRIP YWIWFHY SLVKYP++GVLQNEF+ P K
Sbjct  604   SNVMLGFTVVVAILAYFLLFSGFFISRDRIPLYWIWFHYLSLVKYPYEGVLQNEFEDPTK  663

Query  2228  CFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINK  2407
             CFV+GIQIFD SPL  VP A+KL LL++MS  LGIN+T+ TC+TTG DILKQ G+TDI+K
Sbjct  664   CFVRGIQIFDNSPLGQVPNAVKLSLLKSMSGVLGINVTAETCVTTGVDILKQQGITDISK  723

Query  2408  WNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             WNCLWIT+A GFFFR+LFYF LLIGSKNKRR
Sbjct  724   WNCLWITVAWGFFFRVLFYFTLLIGSKNKRR  754



>ref|XP_003633443.1| PREDICTED: ABC transporter G family member 6-like [Vitis vinifera]
Length=747

 Score =   861 bits (2224),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/740 (71%), Positives = 612/740 (83%), Gaps = 28/740 (4%)
 Frame = +2

Query  323   RQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGAND--HRVLQLYDPVPYP  496
             RQ ME +ELT       S TLG LL  VGD   E     V G     H+VL++ +    P
Sbjct  22    RQTMEDEELTVSS-SGPSPTLGHLLKCVGDVRKE-----VTGDETPVHQVLEMGEANMEP  75

Query  497   SSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVEND----------VKVLLDDIS  646
              S PFVLSF NL+YSV VRRKM +PA + RRT+       D           K LL+DIS
Sbjct  76    RSLPFVLSFSNLTYSVNVRRKMALPA-IFRRTSQLGVATADHIPGESMLTGTKTLLNDIS  134

Query  647   GEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQ  826
             GEAR+GEI+AVLGASGSGKSTLIDALANRIA+ SL G V +NGE LES+LLKVISAYVMQ
Sbjct  135   GEARDGEILAVLGASGSGKSTLIDALANRIAKGSLKGAVTLNGEALESRLLKVISAYVMQ  194

Query  827   DDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgv  1006
             DDLL+PMLTVEETLMF+AEFRLPR+LS+S+KKARV+ALI+QLGL+ AAKTVIGDEGHRGV
Sbjct  195   DDLLYPMLTVEETLMFAAEFRLPRTLSKSKKKARVEALIDQLGLRNAAKTVIGDEGHRGV  254

Query  1007  sggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPS  1186
             SGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPS
Sbjct  255   SGGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPS  314

Query  1187  YRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIP-ENENRCEFALDFIRELEQSP  1363
             YRIL LLDRLIFLS+GQTV+SG P +LP FF EFG+PIP +NENR EFALD IRELE SP
Sbjct  315   YRILGLLDRLIFLSRGQTVYSGPPMNLPLFFAEFGHPIPPDNENRTEFALDLIRELEGSP  374

Query  1364  EGTKNLVDFNKSWQR-KFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINST  1540
              GTK+LV+FNK WQ  K + S  +  N +      S+K+AISASIS+GKLVSGATN  S+
Sbjct  375   GGTKSLVEFNKQWQSTKHTRSYEAGTNGL------SMKEAISASISKGKLVSGATNDASS  428

Query  1541  LSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPK  1720
              S  VP FAN FWVEM V+ KRS+ NS RMPELF +R GAV++TG ILATI+W+LD+SPK
Sbjct  429   TS-LVPTFANSFWVEMAVLSKRSITNSRRMPELFGIRLGAVLITGFILATIYWQLDNSPK  487

Query  1721  GIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpsl  1900
             G QERLGFFAFAMSTTFYTCA+A+PVFLQERYIF+RETAYNAYRRSSYVLSHS+ SLP+L
Sbjct  488   GAQERLGFFAFAMSTTFYTCADALPVFLQERYIFLRETAYNAYRRSSYVLSHSLTSLPAL  547

Query  1901  aflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVV  2080
              FLS AFA TT++AVGL GG SGFLF+ L +FASFWAG+SFVTFLSG++ +VM+ YT+VV
Sbjct  548   IFLSFAFAATTFFAVGLDGGLSGFLFYFLIIFASFWAGNSFVTFLSGVVPHVMLGYTIVV  607

Query  2081  AILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDG  2260
             A+LAYF+LFSGFFINR+RIP YWIWFHY SLVKYP++GVLQNEF+ P KC+V+G+QIFD 
Sbjct  608   ALLAYFLLFSGFFINRNRIPSYWIWFHYVSLVKYPYEGVLQNEFNDPAKCYVRGVQIFDN  667

Query  2261  SPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlg  2440
             +PL AV +AMK+ LL+++S TLG+ ITSSTC+TTG DILKQ G+TD++KWNCLW+T+A G
Sbjct  668   TPLGAVSQAMKVNLLKSLSNTLGMEITSSTCVTTGVDILKQQGITDLSKWNCLWVTVAWG  727

Query  2441  fffrllfyfallIGSKNKRR  2500
             FFFR+LFYFALL+GSKNKRR
Sbjct  728   FFFRILFYFALLMGSKNKRR  747



>ref|XP_008241789.1| PREDICTED: ABC transporter G family member 20 [Prunus mume]
Length=701

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/731 (71%), Positives = 602/731 (82%), Gaps = 38/731 (5%)
 Frame = +2

Query  332   MELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDP---VPYPSS  502
             MEL+E + R R  V+ TLGELL  VGD+            +DH +L+L  P   VP PSS
Sbjct  1     MELKEFSPRIRRGVNPTLGELLKSVGDAQSPD--------HDHHILELGFPCSSVP-PSS  51

Query  503   FPFVLSFHNLSYSVKVRRKMGV-PAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAV  679
             +PFVLSF NL+YSVKVRRK+ + P+  G  +      + + KVLL+ ISGEAREGE+MAV
Sbjct  52    YPFVLSFTNLTYSVKVRRKVNLTPSCFGANSTTAEVSKANTKVLLNGISGEAREGELMAV  111

Query  680   LGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVE  859
             LGASGSGKSTLIDALA+RI+++SL GT+ +NGE L+S+LLKVISAYVMQDDLLFPMLTVE
Sbjct  112   LGASGSGKSTLIDALADRISKDSLKGTITLNGEALDSRLLKVISAYVMQDDLLFPMLTVE  171

Query  860   ETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsig  1039
             ETLMFSAEFRLPRSLS+S+KKARVQALI+QLGL+ AA TVIGDEGHRGVSGGERRRVSIG
Sbjct  172   ETLMFSAEFRLPRSLSKSKKKARVQALIDQLGLRNAATTVIGDEGHRGVSGGERRRVSIG  231

Query  1040  iDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLI  1219
             IDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIV+MS+HQPSYRIL+LLDRLI
Sbjct  232   IDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVVMSIHQPSYRILSLLDRLI  291

Query  1220  FLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKS  1399
             FLS GQTV+ GSP++LP FF+EFG+PIPE ENR EFALD IRELE++P GTK+LV+FN+S
Sbjct  292   FLSHGQTVYGGSPANLPVFFREFGHPIPETENRTEFALDLIRELEETPGGTKSLVEFNES  351

Query  1400  WQ----RKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFA  1567
             WQ    ++   +  +N  N    PK SLKDAISASISRGKLVSGA N + +LS SVP FA
Sbjct  352   WQLNKNQQRQEADPNNLINSITKPKLSLKDAISASISRGKLVSGAPN-DPSLSSSVPTFA  410

Query  1568  NPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFF  1747
             NP W+E+ VI KRS+ NS RMPELF +R GAV+VTG+ILAT+FWKLD+SPK         
Sbjct  411   NPCWIEIAVISKRSLTNSRRMPELFGIRLGAVLVTGLILATMFWKLDNSPK---------  461

Query  1748  AFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaV  1927
                        AEAIP+FLQERYIFMRETAYNAYRRSSYVL+HS+IS+PSL FLSLAFA 
Sbjct  462   -----------AEAIPIFLQERYIFMRETAYNAYRRSSYVLAHSLISIPSLLFLSLAFAA  510

Query  1928  TTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLF  2107
             TT+WAVGLAGG  GFLFF   + A+FWAG SFVTFLSGI+ +VM+ YT+VVAILAYF+LF
Sbjct  511   TTFWAVGLAGGVHGFLFFFFTICAAFWAGGSFVTFLSGIVTHVMLGYTVVVAILAYFLLF  570

Query  2108  SGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEA  2287
             SGFFI+RDRIP YWIWFHY SLVKYP++GVLQNEFD P KCFV+G Q+FD +PL  VP A
Sbjct  571   SGFFISRDRIPLYWIWFHYISLVKYPYEGVLQNEFDDPTKCFVRGTQMFDNTPLGTVPVA  630

Query  2288  MKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyf  2467
             MKL+LL++MS TLG+NIT STC+TTG DILKQ G+TD++KW+CLWIT+A GFFFR+LFYF
Sbjct  631   MKLELLKSMSTTLGVNITGSTCVTTGTDILKQQGITDLSKWSCLWITVAWGFFFRILFYF  690

Query  2468  allIGSKNKRR  2500
              LL+GSKNKRR
Sbjct  691   TLLLGSKNKRR  701



>ref|XP_004493913.1| PREDICTED: ABC transporter G family member 20-like [Cicer arietinum]
Length=746

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/749 (70%), Positives = 611/749 (82%), Gaps = 29/749 (4%)
 Frame = +2

Query  305   LPFLGPRQAMELQELTR--RPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLY  478
             LPF    Q+MEL +L +  R R  +S TLGELL RV D+  +  N        H VL L 
Sbjct  10    LPFF--NQSMELVQLPKPLRTRTHLSPTLGELLKRVEDAQNDSTN-----PQPHHVLDLS  62

Query  479   DPVPYPSSFP---FVLSFHNLSYSVKVRRKMGV-PAWLGRRTAAPSQVE------NDVKV  628
                   ++ P   F LSF NL+YSVK+ +KM   P +   + + P+ +       N  K+
Sbjct  63    SSSSSSTTLPPHPFFLSFSNLTYSVKLHQKMTFSPRFSSNQNSQPTDIPEAETKPNGTKI  122

Query  629   LLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVI  808
             LL++ISGEAR+GE+MAVLGASGSGKSTLIDALA+RI+++SL GT+ +NG+VLES L KVI
Sbjct  123   LLNNISGEARDGEVMAVLGASGSGKSTLIDALADRISKDSLKGTITLNGDVLESSLQKVI  182

Query  809   SAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGD  988
             SAYVMQDDLLFPMLTVEETLMFSA+FRLPRSLS+S+KKARVQALI+QLGL++AA TVIGD
Sbjct  183   SAYVMQDDLLFPMLTVEETLMFSADFRLPRSLSKSKKKARVQALIDQLGLRSAASTVIGD  242

Query  989   eghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIM  1168
             EGHRGVSGGERRRVSIG DIIHDPI+LFLDEPTSGLDSTSA+MVVKVLQRIAQSGSIVIM
Sbjct  243   EGHRGVSGGERRRVSIGTDIIHDPIILFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIM  302

Query  1169  SVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRE  1348
             SVHQPSYRIL LLDRLIFLS GQTV+SGSP++LP FF EF +PIPENENR EFALD IRE
Sbjct  303   SVHQPSYRILGLLDRLIFLSHGQTVYSGSPANLPLFFSEFDHPIPENENRTEFALDLIRE  362

Query  1349  LEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVS----  1516
             LE +P GTK+LV+FNKSWQ K  P    N        K SLK+AISASISRGKLVS    
Sbjct  363   LEGTPGGTKSLVEFNKSWQLKNKPVPPLNN-----GAKLSLKEAISASISRGKLVSGTNG  417

Query  1517  GATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIF  1696
                N N   + S+  FANPFW+EM VIGKRS+ NS RMPELF +R GAV+VTG ILATIF
Sbjct  418   ANGNGNGNATDSIATFANPFWIEMAVIGKRSLTNSRRMPELFGIRLGAVLVTGGILATIF  477

Query  1697  WKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSH  1876
             ++LD+SPKG+QERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSH
Sbjct  478   YRLDNSPKGVQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSH  537

Query  1877  siislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNV  2056
             SIISLPSL FLS AFA+TT+W+VGLAGG SGFLF+   + ASFWAGSSFVTFLSG++ +V
Sbjct  538   SIISLPSLIFLSFAFAITTFWSVGLAGGTSGFLFYFFTILASFWAGSSFVTFLSGVVSHV  597

Query  2057  MIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDY-PDKCF  2233
             M+ +T+VVAILAYF+LFSGFFI+R+RIPPYWIWFHY SLVKYP++GVLQNEFD  P +CF
Sbjct  598   MLGFTVVVAILAYFLLFSGFFISRNRIPPYWIWFHYLSLVKYPYEGVLQNEFDIQPPRCF  657

Query  2234  VKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWN  2413
             V+GIQ+FD +PL  VP ++K++LL+++S TLGINITSSTC+ TG DILKQ G+T ++KWN
Sbjct  658   VRGIQMFDNTPLGDVPGSLKVELLKSLSSTLGINITSSTCVVTGADILKQQGITQLSKWN  717

Query  2414  CLWITIAlgfffrllfyfallIGSKNKRR  2500
             CL+ITIA GFFFR LFY ALL GSKNKR+
Sbjct  718   CLFITIAWGFFFRFLFYLALLFGSKNKRK  746



>ref|XP_002877923.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54182.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=737

 Score =   859 bits (2220),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/730 (71%), Positives = 601/730 (82%), Gaps = 14/730 (2%)
 Frame = +2

Query  311   FLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVP  490
             F    +++ELQ   +R    VS+TL ELL  V D  G+  +  +  A             
Sbjct  22    FYNIHKSVELQR-CQRDTARVSVTLAELLMSVEDE-GDDHSRALDVAVASNFWASVPSSC  79

Query  491   YPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEI  670
              PSS PFVLSF +L+YSVK+++K       G   +  + +E + KVLL+ ISGEAREGE+
Sbjct  80    VPSSSPFVLSFKDLTYSVKIQKKFKPFPCCG--NSPFNGMEMNTKVLLNGISGEAREGEM  137

Query  671   MAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPML  850
             MAVLGASGSGKSTLIDALANRI++ESL G + +NGEVLES L KVISAYVMQDDLLFPML
Sbjct  138   MAVLGASGSGKSTLIDALANRISKESLRGDITLNGEVLESSLHKVISAYVMQDDLLFPML  197

Query  851   TVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrv  1030
             TVEETLMFSAEFRLP SLS+ +KKARVQALI+QLGL+ AAKTVIGDEGHRGVSGGERRRV
Sbjct  198   TVEETLMFSAEFRLPSSLSKKKKKARVQALIDQLGLRNAAKTVIGDEGHRGVSGGERRRV  257

Query  1031  sigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLD  1210
             SIG DIIHDPI+LFLDEPTSGLDSTSA+MVVKVLQRIAQSGSIVIMS+HQPSYRIL LLD
Sbjct  258   SIGTDIIHDPIILFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLD  317

Query  1211  RLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDF  1390
             +LIFLS+G TV+SGSP+ LP+FF EFG+PIPENEN+ EFALD IRELE SP+GTK LV+F
Sbjct  318   KLIFLSRGNTVYSGSPTHLPQFFSEFGHPIPENENKPEFALDLIRELEDSPQGTKALVEF  377

Query  1391  NKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFAN  1570
             +K W+ K + S +    NV      SLKDAISASIS+GKLVSGATN+ S    S   FAN
Sbjct  378   HKQWRAKQTSSQSRRNTNV------SLKDAISASISKGKLVSGATNLRS----SFQTFAN  427

Query  1571  PFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFA  1750
             PFW EM+VIGKRS++NS R PELF MR GAV+VTGIILATIFWKLD+SP+GIQERLGFFA
Sbjct  428   PFWTEMLVIGKRSILNSRRQPELFGMRLGAVLVTGIILATIFWKLDNSPRGIQERLGFFA  487

Query  1751  FAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVT  1930
             FAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL+H+IIS+P+L  LS AFA T
Sbjct  488   FAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLAHTIISIPALIILSAAFAAT  547

Query  1931  TYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFS  2110
             T+WAVGLAGG  GFLFF   +  +FWAGSSFVTFLSG++ +VMI +T+VVAILAYF+LFS
Sbjct  548   TFWAVGLAGGSEGFLFFFFTILTAFWAGSSFVTFLSGVVSHVMIGFTVVVAILAYFLLFS  607

Query  2111  GFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAM  2290
             GFFI+RDRIP YWIWFHY SLVKYP++GVLQNEF+ P KCF++GIQ+FD SPL  VP A+
Sbjct  608   GFFISRDRIPVYWIWFHYLSLVKYPYEGVLQNEFEDPTKCFIRGIQMFDNSPLGQVPAAV  667

Query  2291  KLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfa  2470
             K+ LL++MS  LGIN+T+ TC+TTG DILKQ G+T+I+KWNCLWIT+A GFFFR+LFYF 
Sbjct  668   KISLLKSMSGVLGINVTAETCVTTGIDILKQQGITEISKWNCLWITVAWGFFFRVLFYFT  727

Query  2471  llIGSKNKRR  2500
             LLIGSKNKRR
Sbjct  728   LLIGSKNKRR  737



>emb|CDY18451.1| BnaA04g21360D [Brassica napus]
Length=742

 Score =   859 bits (2220),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/736 (70%), Positives = 606/736 (82%), Gaps = 41/736 (6%)
 Frame = +2

Query  347   LTRRPRHS--VSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPV-PYPSSF----  505
             + R PR +  V+ TLGELL  V D++           NDHR L++  P+    SSF    
Sbjct  30    MERCPRDTPRVTATLGELLMNVDDAS-----------NDHRGLEMASPLTSSASSFNSWT  78

Query  506   ----------PFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEA  655
                       PFVLSF +L+YSVK+++K   P + G  ++  S +  + K+LL+ ISGEA
Sbjct  79    SAPASSITSSPFVLSFTDLTYSVKIKKKF--PPFFGNSSSNDSAL--NTKILLNSISGEA  134

Query  656   REGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDL  835
              EGE+MAVLGASGSGKSTLIDALANRIA++SL G++ +NGEVLES L KVISAYVMQDDL
Sbjct  135   HEGEMMAVLGASGSGKSTLIDALANRIAKDSLRGSITLNGEVLESSLQKVISAYVMQDDL  194

Query  836   LFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsgg  1015
             LFPMLTVEETLMFSAEFRLPRSLS+ +KKARVQ+LI+QLGL++AA+T+IGDEGHRG+SGG
Sbjct  195   LFPMLTVEETLMFSAEFRLPRSLSKKKKKARVQSLIDQLGLRSAARTMIGDEGHRGISGG  254

Query  1016  errrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRI  1195
             ERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSA+MV+KVLQRIAQSGSIVIMS+HQPSYRI
Sbjct  255   ERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAYMVIKVLQRIAQSGSIVIMSIHQPSYRI  314

Query  1196  LNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTK  1375
             + LLDRLIFLS+G TVFSGSP+ LP+FF EF +PIPENEN+ EFALD IRELE SPEGTK
Sbjct  315   MGLLDRLIFLSRGNTVFSGSPTYLPQFFSEFDHPIPENENKTEFALDLIRELENSPEGTK  374

Query  1376  NLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPS-  1552
              LV+++K W+ K   ++    N +      +LK+AI+ASIS+GKLVSGA    +T SPS 
Sbjct  375   KLVEYHKEWRAKQQAAARYYNNGI------TLKEAITASISKGKLVSGAAT--TTTSPSS  426

Query  1553  VPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQE  1732
                +ANPFW+EM+VIGKRS++NS+R PEL  MR GAV+VTGIILAT+F KLD+SPKG+QE
Sbjct  427   FQTYANPFWIEMIVIGKRSILNSMRQPELIGMRIGAVMVTGIILATMFTKLDNSPKGVQE  486

Query  1733  RLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslafls  1912
             RLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLS SIIS+PSL FL+
Sbjct  487   RLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSQSIISIPSLIFLA  546

Query  1913  lafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILA  2092
               FA TT++AVGLAGG SGFLFF L + ASFWAGSSFVTFLSG++ NVM+ +T+VVAILA
Sbjct  547   ACFAATTFFAVGLAGGASGFLFFFLTILASFWAGSSFVTFLSGVVSNVMLGFTVVVAILA  606

Query  2093  YFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLK  2272
             YF+LFSGFFI+RDRIP YWIWFHY SLVKYP++GVLQNEF+   KCFV+GIQIFD SPL 
Sbjct  607   YFLLFSGFFISRDRIPLYWIWFHYLSLVKYPYEGVLQNEFEDTTKCFVRGIQIFDNSPLG  666

Query  2273  AVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffr  2452
               P A+KL LL++MS  LGIN+T+ TC+TTG DILKQ GVT+I+KWNCLWIT+A GFFFR
Sbjct  667   QFPNAVKLSLLKSMSGVLGINVTAETCVTTGIDILKQQGVTEISKWNCLWITVAWGFFFR  726

Query  2453  llfyfallIGSKNKRR  2500
             +LFYF LLIGSKNKRR
Sbjct  727   VLFYFTLLIGSKNKRR  742



>ref|XP_003592758.1| ABC transporter G family member [Medicago truncatula]
 gb|AES63009.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=754

 Score =   860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/742 (69%), Positives = 602/742 (81%), Gaps = 26/742 (4%)
 Frame = +2

Query  332   MELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFPF  511
             ME+ + TRR       TLG+LL  VGD   E + +G      H  L +        S PF
Sbjct  18    MEMDDFTRRRDAGDMPTLGQLLKHVGDVRKEAIGDG-SETPVHHTLDINGM--EVRSLPF  74

Query  512   VLSFHNLSYSVKVRRKMGVPAWLGRRTAAP--------SQVENDVKVLLDDISGEAREGE  667
             VLSF+NL+YSVK+R KM       RR A+P            +  K+LL++ISGEAR+GE
Sbjct  75    VLSFNNLTYSVKIRNKMSFTDLFSRRRASPVAETPALGETAFSRSKILLNEISGEARDGE  134

Query  668   IMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPM  847
             IMA LGASGSGKSTLIDALANRIA+  L GTVK+NGE +ES+LLKVISAYVMQDDLLFPM
Sbjct  135   IMAFLGASGSGKSTLIDALANRIAKGKLKGTVKLNGESVESRLLKVISAYVMQDDLLFPM  194

Query  848   LTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrr  1027
             LTVEETL F+AEFRLPRSLS+S+K ARVQALI+QLGL+ AAKTVIGDEGHRGVSGGERRR
Sbjct  195   LTVEETLTFAAEFRLPRSLSKSKKNARVQALIDQLGLRNAAKTVIGDEGHRGVSGGERRR  254

Query  1028  vsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLL  1207
             VSIGIDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMS+HQPSYRIL LL
Sbjct  255   VSIGIDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSYRILGLL  314

Query  1208  DRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVD  1387
             DR+IFLS+GQTV+SGSPS LP +F EFG+PIPE +NR EFALD IRELE SP GTK+LV+
Sbjct  315   DRMIFLSRGQTVYSGSPSQLPSYFAEFGHPIPEGDNRTEFALDLIRELEGSPGGTKSLVE  374

Query  1388  FNKSWQRKFSPSSTSNRNNVFPNPKPSL--KDAISASISRGKLVSGAT---NINSTLSPS  1552
             FNKSWQ   S +   N N++  N  PSL  K+AISASISRGKLVSGAT   N N+  +  
Sbjct  375   FNKSWQ---SMTKLHNNNDISQNATPSLSLKEAISASISRGKLVSGATAATNSNAIATSP  431

Query  1553  -------VPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDD  1711
                    VP +ANPFW+E++ + KRS+ NS RMPELF +R GAV+VTG ILAT+FW+LD+
Sbjct  432   SSSSSSIVPTYANPFWIELLTLSKRSITNSRRMPELFGIRLGAVMVTGFILATMFWQLDN  491

Query  1712  SPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiisl  1891
             SPKG+QERLGFFAFAMSTTFYT A+A+PVF+QER+IFMRET++NAYRR SYV+SH+I++L
Sbjct  492   SPKGVQERLGFFAFAMSTTFYTTADALPVFIQERFIFMRETSHNAYRRWSYVISHAIVAL  551

Query  1892  pslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYT  2071
             P+L FLSLAFA  T+WAVGL GGFSGFLF+ + + ASFWAG+SFV+FLSG++ +VM+ YT
Sbjct  552   PALLFLSLAFACITFWAVGLDGGFSGFLFYFVIILASFWAGNSFVSFLSGVVPHVMLGYT  611

Query  2072  LVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQI  2251
             +VVAILAYF+LFSGFFINRDRIP YWIWFHY SLVKYP++ VLQNEF    KCFV+G+QI
Sbjct  612   IVVAILAYFLLFSGFFINRDRIPGYWIWFHYMSLVKYPYEAVLQNEFSDAAKCFVRGVQI  671

Query  2252  FDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITI  2431
             FD SPL +V +A+KLKLL +MS TLG+ IT+STCLTTG D+LKQ  VTD++KWNCLW+T+
Sbjct  672   FDNSPLASVSDALKLKLLDSMSDTLGMKITASTCLTTGTDLLKQNAVTDLSKWNCLWVTV  731

Query  2432  AlgfffrllfyfallIGSKNKR  2497
             A GFFFR+LFY +LL+GSKNKR
Sbjct  732   AWGFFFRILFYLSLLLGSKNKR  753



>ref|XP_002315262.1| ABC transporter family protein [Populus trichocarpa]
 gb|EEF01433.1| ABC transporter family protein [Populus trichocarpa]
Length=686

 Score =   857 bits (2214),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/709 (72%), Positives = 587/709 (83%), Gaps = 29/709 (4%)
 Frame = +2

Query  392   LLHRVGDSAGEKLNNGVGGANDHRVLQLYDP-VPYPSSFPFVLSFHNLSYSVKVRRKMGV  568
             +L RVGD + E   +G      H+VL+L    +  P S PFVLSF+ L+YSVKVRR+   
Sbjct  1     MLKRVGDVSREATGDG-SETPVHQVLELGSTNLEVPRSIPFVLSFNKLTYSVKVRRE---  56

Query  569   PAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARES  748
                          +    K LL+DISGEAR+GEI+AVLGASGSGKSTLIDALANRIA+ S
Sbjct  57    ------------SLFTTTKTLLNDISGEARDGEILAVLGASGSGKSTLIDALANRIAKGS  104

Query  749   LGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkar  928
             L GT  +NGEVLES++LKVISAYVMQDDLLFPMLTVEETLMF+AEFRLPRSLS+S+K+ R
Sbjct  105   LKGTKTLNGEVLESRMLKVISAYVMQDDLLFPMLTVEETLMFAAEFRLPRSLSKSKKRLR  164

Query  929   VQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTS  1108
             VQALIEQLGL+ AAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTS
Sbjct  165   VQALIEQLGLKNAAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPIILFLDEPTSGLDSTS  224

Query  1109  AFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEF  1288
             AFMVVKVLQRIAQSGSIVIMSVHQPSYRIL LLDRLIFLS+GQTV+SGSP +LP +F +F
Sbjct  225   AFMVVKVLQRIAQSGSIVIMSVHQPSYRILGLLDRLIFLSRGQTVYSGSPMNLPVYFSDF  284

Query  1289  GNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQ---RKFSPSSTSNRNNVFPNP  1459
             G+PIPENENR EFALD IRELE SP GT++LV+FNKSWQ      +  S  +R  +    
Sbjct  285   GHPIPENENRTEFALDLIRELEGSPGGTRSLVEFNKSWQDLKHSRNGGSEPDRGGL----  340

Query  1460  KPSLKDAISASISRGKLVSGATNINSTLSPS--VPKFANPFWVEMVVIGKRSMVNSLRMP  1633
               SLK+AISASIS+GKLVSGATN N  +SP+  VP FAN   +EM V+ KRS +NS RMP
Sbjct  341   --SLKEAISASISKGKLVSGATN-NDAISPNSMVPTFANSVLIEMAVLSKRSFLNSRRMP  397

Query  1634  ELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQER  1813
             ELF +R GAV+VTG ILAT+FW+LD+SPKG+QERLGFFAFAMSTTFYTCA+A+PVFLQER
Sbjct  398   ELFGIRLGAVMVTGFILATMFWQLDNSPKGVQERLGFFAFAMSTTFYTCADALPVFLQER  457

Query  1814  YIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfv  1993
             YIFMRETAYNAYRRSSYVLSH ++ LPSL FLSLAF+ TT+WAVGL GG SGFLF+ L +
Sbjct  458   YIFMRETAYNAYRRSSYVLSHGLVVLPSLIFLSLAFSATTFWAVGLDGGLSGFLFYFLII  517

Query  1994  fasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASL  2173
             FASFWAGSSFVTFLSG++ +VM+ YT+VVAILAYF+LFSGFFINRDRIP YWIWFHY SL
Sbjct  518   FASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPAYWIWFHYLSL  577

Query  2174  VKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTC  2353
             VKYP++ VL NEF  P KCFV+G+QIFD SPL  V  ++KL+LL++MS TLG  ITSSTC
Sbjct  578   VKYPYEAVLLNEFQDPAKCFVRGVQIFDQSPLGEVSTSLKLQLLESMSNTLGTKITSSTC  637

Query  2354  LTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             LTTG DIL Q G+TD++KWNCLW+T+A GF FR+LFY +LL GSKNKRR
Sbjct  638   LTTGADILLQQGITDLSKWNCLWVTVAWGFLFRILFYISLLFGSKNKRR  686



>ref|XP_009141649.1| PREDICTED: ABC transporter G family member 2 [Brassica rapa]
Length=742

 Score =   858 bits (2217),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/736 (70%), Positives = 606/736 (82%), Gaps = 41/736 (6%)
 Frame = +2

Query  347   LTRRPRHS--VSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPV-PYPSSF----  505
             + R PR +  V+ TLGELL  V D++           NDHR L++  P+    SSF    
Sbjct  30    MERCPRDTPRVTATLGELLMNVDDAS-----------NDHRGLEMASPLTSSASSFNSWT  78

Query  506   ----------PFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEA  655
                       PFVLSF +L+YSVK+++K   P + G  ++  S +  + K+LL+ ISGEA
Sbjct  79    SAPASSITSSPFVLSFTDLTYSVKIKKKF--PPFCGNSSSNDSAL--NTKILLNGISGEA  134

Query  656   REGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDL  835
              EGE+MAVLGASGSGKSTLIDALANRIA++SL G++ +NGEVLES L KVISAYVMQDDL
Sbjct  135   HEGEMMAVLGASGSGKSTLIDALANRIAKDSLRGSITLNGEVLESSLQKVISAYVMQDDL  194

Query  836   LFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsgg  1015
             LFPMLTVEETLMFSAEFRLPRSLS+ +KKARVQ+LI+QLGL++AA+T+IGDEGHRG+SGG
Sbjct  195   LFPMLTVEETLMFSAEFRLPRSLSKKKKKARVQSLIDQLGLRSAARTMIGDEGHRGISGG  254

Query  1016  errrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRI  1195
             ERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSA+MV+KVLQRIAQSGSIVIMS+HQPSYRI
Sbjct  255   ERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAYMVIKVLQRIAQSGSIVIMSIHQPSYRI  314

Query  1196  LNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTK  1375
             + LLDRLIFLS+G TVFSGSP+ LP+FF EF +PIPENEN+ EFALD IRELE SPEGTK
Sbjct  315   MGLLDRLIFLSRGNTVFSGSPTYLPQFFSEFDHPIPENENKTEFALDLIRELENSPEGTK  374

Query  1376  NLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPS-  1552
              LV+++K W+ K   ++    N +      +LK+AI+ASIS+GKLVSGA    +T SPS 
Sbjct  375   KLVEYHKEWRAKQQAAARYYNNGI------TLKEAITASISKGKLVSGAAT--TTNSPSS  426

Query  1553  VPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQE  1732
                +ANPFW+EM+VIGKRS++NS+R PEL  MR GAV+VTGIILAT+F KLD+SPKG+QE
Sbjct  427   FQTYANPFWIEMIVIGKRSVLNSMRQPELIGMRIGAVMVTGIILATMFTKLDNSPKGVQE  486

Query  1733  RLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslafls  1912
             RLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLS SIIS+PSL FL+
Sbjct  487   RLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSQSIISIPSLIFLA  546

Query  1913  lafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILA  2092
               FA TT++AVGLAGG SGFLFF L + ASFWAGSSFVTFLSG++ NVM+ +T+VVAILA
Sbjct  547   ACFAATTFFAVGLAGGASGFLFFFLTILASFWAGSSFVTFLSGVVSNVMLGFTVVVAILA  606

Query  2093  YFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLK  2272
             YF+LFSGFFI+RDRIP YWIWFHY SLVKYP++GVLQNEF+   KCFV+GIQIFD SPL 
Sbjct  607   YFLLFSGFFISRDRIPLYWIWFHYLSLVKYPYEGVLQNEFEDTTKCFVRGIQIFDNSPLG  666

Query  2273  AVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffr  2452
               P A+KL LL++MS  LGIN+T+ TC+TTG DILKQ GVT+I+KWNCLWIT+A GFFFR
Sbjct  667   QFPNAVKLSLLKSMSGVLGINVTAETCVTTGIDILKQQGVTEISKWNCLWITVAWGFFFR  726

Query  2453  llfyfallIGSKNKRR  2500
             +LFYF LLIGSKNKRR
Sbjct  727   VLFYFTLLIGSKNKRR  742



>ref|XP_008364101.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
6-like [Malus domestica]
Length=752

 Score =   858 bits (2217),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/739 (71%), Positives = 606/739 (82%), Gaps = 17/739 (2%)
 Frame = +2

Query  329   AMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFP  508
             +MEL +  R   H  S +LG+LL  VGD   E   +G G    H  L + +    P S P
Sbjct  16    SMELDDFPR-ATHGASPSLGQLLKHVGDVRKEATGDG-GETPAHHALDISEASLEPRSLP  73

Query  509   FVLSFHNLSYSVKVRRKMGVPAWLG----RRTAAP-----SQVEN---DVKVLLDDISGE  652
             FVLSF+NL+YSVKVRRK  +   L     R +AA      S  EN     + LL+DISGE
Sbjct  74    FVLSFNNLTYSVKVRRKFSLSGMLSGCNNRLSAATASDPISGGENFFSKTRTLLNDISGE  133

Query  653   AREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDD  832
             AREGEI+AVLGASGSGKSTLIDALANRIA+ SL GTV +NGEVLES+LLKVISAYVMQDD
Sbjct  134   AREGEILAVLGASGSGKSTLIDALANRIAKGSLKGTVSLNGEVLESRLLKVISAYVMQDD  193

Query  833   LLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsg  1012
             LLFPMLTVEETLMF+AEFRLPR+LS+S+KK+RVQALI+QLG++ AAKT+IGDEGHRGVSG
Sbjct  194   LLFPMLTVEETLMFAAEFRLPRALSKSKKKSRVQALIDQLGIRNAAKTIIGDEGHRGVSG  253

Query  1013  gerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYR  1192
             GERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIV+MSVHQPSYR
Sbjct  254   GERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVVMSVHQPSYR  313

Query  1193  ILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGT  1372
             IL LLDRL+FL++GQTV+SGSP++LP +F EFG PIPE+ENR EFALD IRELE SP GT
Sbjct  314   ILGLLDRLLFLTRGQTVYSGSPANLPSYFAEFGYPIPESENRTEFALDVIRELEGSPGGT  373

Query  1373  KNLVDFNKSWQ-RKFS-PSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLS  1546
             K+LV+F+++WQ RK S P+  S R          L++AISASISRGKLVSGA   N+   
Sbjct  374   KSLVEFSRTWQSRKHSNPNDASYRGASDARHVVPLQEAISASISRGKLVSGAXPNNNPSP  433

Query  1547  PS-VPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKG  1723
              S VP FANP WVEM V+  RSM N+ RMPELF +R G V+VTG ILAT+FW LDDSPKG
Sbjct  434   NSMVPTFANPIWVEMAVLANRSMKNARRMPELFGIRLGTVMVTGFILATMFWNLDDSPKG  493

Query  1724  IQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpsla  1903
             +QERLGF AFAMSTTFYTCA+A+PVFLQERYIFMRETAYNAYRRSSYVLSHS++ LPSL 
Sbjct  494   VQERLGFIAFAMSTTFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHSLVVLPSLV  553

Query  1904  flslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVA  2083
             FLS+AF+VTT+WAVGL GG SGFLF+ L +FASFWAGSSFVTFLSG++  VM+ YT+VVA
Sbjct  554   FLSIAFSVTTFWAVGLDGGLSGFLFYFLIIFASFWAGSSFVTFLSGVVPQVMLGYTIVVA  613

Query  2084  ILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGS  2263
             ILAYF+LFSGFFI RDRIP YWIWFHY SLVKYP++GVLQNEF    KCFV+G QIFD +
Sbjct  614   ILAYFLLFSGFFITRDRIPAYWIWFHYLSLVKYPYEGVLQNEFQNTAKCFVRGTQIFDNT  673

Query  2264  PLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgf  2443
             PL  VP+AMKLKLL +MS+TLG+ IT STCLTTG DIL+Q GVTD++KWNCLW+T+A GF
Sbjct  674   PLGTVPDAMKLKLLDSMSETLGMRITRSTCLTTGTDILEQQGVTDLSKWNCLWVTVAWGF  733

Query  2444  ffrllfyfallIGSKNKRR  2500
              FR+LFYFALL+GSKNKRR
Sbjct  734   LFRILFYFALLLGSKNKRR  752



>ref|NP_190919.1| ABC transporter G family member 20 [Arabidopsis thaliana]
 sp|Q9LFG8.1|AB20G_ARATH RecName: Full=ABC transporter G family member 20; Short=ABC transporter 
ABCG.20; Short=AtABCG20; AltName: Full=Probable white-brown 
complex homolog protein 20; Short=AtWBC20 [Arabidopsis 
thaliana]
 emb|CAB67658.1| ABC transporter-like protein [Arabidopsis thaliana]
 gb|AEE79099.1| ABC transporter G family member 20 [Arabidopsis thaliana]
Length=739

 Score =   857 bits (2215),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/730 (71%), Positives = 599/730 (82%), Gaps = 12/730 (2%)
 Frame = +2

Query  311   FLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVP  490
             F    +++ELQ    R    VS+TL ELL  V D  G+  +  +  A             
Sbjct  22    FYNIHKSVELQR-CHRDTARVSVTLAELLMSVEDE-GDDQSRAMDIAVASNFWSSVPSSR  79

Query  491   YPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEI  670
              PSS PFVLSF +L+YSVK+++K       G      + +E + KVLL+ ISGEAREGE+
Sbjct  80    VPSSSPFVLSFKDLTYSVKIKKKFKPFPCCGNSPFDGNDMEMNTKVLLNGISGEAREGEM  139

Query  671   MAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPML  850
             MAVLGASGSGKSTLIDALANRI++ESL G + +NGEVLES L KVISAYVMQDDLLFPML
Sbjct  140   MAVLGASGSGKSTLIDALANRISKESLRGDITLNGEVLESSLHKVISAYVMQDDLLFPML  199

Query  851   TVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrv  1030
             TVEETLMFSAEFRLP SLS+ +KKARVQALI+QLGL+ AAKTVIGDEGHRGVSGGERRRV
Sbjct  200   TVEETLMFSAEFRLPSSLSKKKKKARVQALIDQLGLRNAAKTVIGDEGHRGVSGGERRRV  259

Query  1031  sigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLD  1210
             SIG DIIHDPI+LFLDEPTSGLDSTSA+MVVKVLQRIAQSGSIVIMS+HQPSYRIL LLD
Sbjct  260   SIGTDIIHDPIILFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLD  319

Query  1211  RLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDF  1390
             +LIFLS+G TV+SGSP+ LP+FF EFG+PIPENEN+ EFALD IRELE SPEGTK+LV+F
Sbjct  320   KLIFLSRGNTVYSGSPTHLPQFFSEFGHPIPENENKPEFALDLIRELEDSPEGTKSLVEF  379

Query  1391  NKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFAN  1570
             +K W+ K + S +    NV      SLKDAISASISRGKLVSGATN+ S    S   FAN
Sbjct  380   HKQWRAKQTSSQSRRNTNV------SLKDAISASISRGKLVSGATNLRS----SFQTFAN  429

Query  1571  PFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFA  1750
             PFW EM+VIGKRS++NS R PELF +R GAV+VTG+ILATIFWKLD+SP+GIQERLGFFA
Sbjct  430   PFWTEMLVIGKRSILNSRRQPELFGIRLGAVLVTGMILATIFWKLDNSPRGIQERLGFFA  489

Query  1751  FAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVT  1930
             FAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL+H+IIS+P+L  LS AFA +
Sbjct  490   FAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLAHTIISIPALIILSAAFAAS  549

Query  1931  TYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFS  2110
             T+ AVGLAGG  GFLFF   +  +FWAGSSFVTFLSG++ +VMI +T+VVAILAYF+LFS
Sbjct  550   TFSAVGLAGGSEGFLFFFFTILTAFWAGSSFVTFLSGVVSHVMIGFTVVVAILAYFLLFS  609

Query  2111  GFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAM  2290
             GFFI+RDRIP YWIWFHY SLVKYP++GVLQNEF+ P KCFV+GIQ+FD SPL  VP A+
Sbjct  610   GFFISRDRIPLYWIWFHYLSLVKYPYEGVLQNEFEDPTKCFVRGIQMFDNSPLGQVPTAV  669

Query  2291  KLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfa  2470
             K+ LL++MS  LGIN+T+ TC+TTG DILKQ G+T+I+KWNCLWIT+A GFFFR+LFYF 
Sbjct  670   KISLLKSMSGVLGINVTAETCVTTGIDILKQQGITEISKWNCLWITVAWGFFFRVLFYFT  729

Query  2471  llIGSKNKRR  2500
             LLIGSKNKRR
Sbjct  730   LLIGSKNKRR  739



>ref|XP_010515843.1| PREDICTED: ABC transporter G family member 20-like [Camelina 
sativa]
Length=740

 Score =   857 bits (2214),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/731 (70%), Positives = 596/731 (82%), Gaps = 13/731 (2%)
 Frame = +2

Query  311   FLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVP  490
             F    +++ELQ   +R    VS+TL ELL  V D  G++ +  +  A             
Sbjct  22    FYNIHRSVELQR-CQRDTARVSVTLAELLMSVEDE-GDEHSQALDVAVASNFWASNPSSC  79

Query  491   YPSSFPFVLSFHNLSYSVKVRRKMGVP-AWLGRRTAAPSQVENDVKVLLDDISGEAREGE  667
              PSS PFVLSF +LSYSVK+++K   P    G      + +E + KVLL+ ISGEAREGE
Sbjct  80    VPSSSPFVLSFKDLSYSVKIQKKFKSPFPCCGNSPFDGNDMEMNTKVLLNGISGEAREGE  139

Query  668   IMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPM  847
             +MAVLGASGSGKSTLIDALANRIA+ESL G + +NGEVLES L KVISAYVMQDDLLFPM
Sbjct  140   MMAVLGASGSGKSTLIDALANRIAKESLRGAITLNGEVLESSLHKVISAYVMQDDLLFPM  199

Query  848   LTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrr  1027
             LTVEETLMFSAEFRLP SLS+ +KKARVQALI+QLGL+ AA+TVIGDEGHRGVSGGERRR
Sbjct  200   LTVEETLMFSAEFRLPSSLSKKKKKARVQALIDQLGLRNAARTVIGDEGHRGVSGGERRR  259

Query  1028  vsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLL  1207
             VSIG DIIHDPI+LFLDEPTSGLDSTSA+MVVKVLQRIAQSGSIVIMS+HQPSYRIL LL
Sbjct  260   VSIGTDIIHDPIILFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSYRILGLL  319

Query  1208  DRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVD  1387
             D+LIFLS+G TV+SGSP+ LPRFF EFG+PIPENEN+ EFALD IRELE SPEGTK LV+
Sbjct  320   DKLIFLSRGNTVYSGSPTHLPRFFSEFGHPIPENENKPEFALDLIRELEDSPEGTKTLVE  379

Query  1388  FNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFA  1567
             F+K W+ K + S +    NV      SL+DAI++SISRGKLVSGATN+ S    S   FA
Sbjct  380   FHKQWRAKQTSSQSRRNTNV------SLRDAITSSISRGKLVSGATNLKS----SFQTFA  429

Query  1568  NPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFF  1747
             NPFW EM+VIGKRS++NS R PELF +R GAV+VTGIILATIFWKLD+SP+GIQERLGFF
Sbjct  430   NPFWTEMLVIGKRSILNSSRQPELFGIRLGAVLVTGIILATIFWKLDNSPRGIQERLGFF  489

Query  1748  AFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaV  1927
             AFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL+H+IIS+P+L  LS AFA 
Sbjct  490   AFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLAHTIISIPALIILSAAFAA  549

Query  1928  TTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLF  2107
             TT+WAVGLAGG  GF FF   +  +FWAGSSFVTFLSG++ +VMI +T+VVAILAYF+LF
Sbjct  550   TTFWAVGLAGGSEGFFFFFFTILTAFWAGSSFVTFLSGVVSHVMIGFTVVVAILAYFLLF  609

Query  2108  SGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEA  2287
             SGFFI+RDRIPP WIWFHY SLV YP++GVLQNEF+ P  CFV+GIQ+FD SPL   P A
Sbjct  610   SGFFISRDRIPPCWIWFHYLSLVTYPYEGVLQNEFEDPTTCFVRGIQMFDNSPLGQFPAA  669

Query  2288  MKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyf  2467
              K+ LL++MS  LGIN+T+ TC+T G DILKQ G+T+I+KW+CLWIT+ALGF FR+LFYF
Sbjct  670   AKITLLKSMSGVLGINVTAETCVTAGIDILKQQGITEISKWSCLWITVALGFVFRVLFYF  729

Query  2468  allIGSKNKRR  2500
              LLIGSKNKRR
Sbjct  730   TLLIGSKNKRR  740



>ref|XP_006361395.1| PREDICTED: ABC transporter G family member 6-like [Solanum tuberosum]
Length=724

 Score =   856 bits (2212),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/735 (69%), Positives = 596/735 (81%), Gaps = 29/735 (4%)
 Frame = +2

Query  305   LPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDS-AGEKLNNGVGGANDHRVLQLYD  481
             +P    RQ +E+           S T  +LL+ VGD   G++    V     H+VL +  
Sbjct  16    VPLYDRRQMLEMS----------SPTFAQLLNNVGDHVTGDETETSV-----HQVLTM--  58

Query  482   PVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEARE  661
              +P   S PFVLSF NL+YSV+VRRK   PA  GRR   P       KVLL+DISGEAR+
Sbjct  59    ELPVQQSIPFVLSFSNLTYSVRVRRKSIFPAISGRRADEPRSTRT--KVLLNDISGEARD  116

Query  662   GEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLF  841
             GE++AVLGASGSGKSTLIDALANRIA+ESL G VK+NGE L SKLLKVISAYVMQDDLL+
Sbjct  117   GELLAVLGASGSGKSTLIDALANRIAKESLKGEVKLNGEPLHSKLLKVISAYVMQDDLLY  176

Query  842   PMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsgger  1021
             PMLTVEETLMFSAEFRLPR+LS+S+KK RVQALI+QLGL+ AAKT+IGDEGHRGVSGGER
Sbjct  177   PMLTVEETLMFSAEFRLPRTLSKSKKKGRVQALIDQLGLRNAAKTIIGDEGHRGVSGGER  236

Query  1022  rrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILN  1201
             RRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMS+HQPSYRIL 
Sbjct  237   RRVSIGIDIIHDPIILFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSYRILG  296

Query  1202  LLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNL  1381
             LLDRLIFLS+GQTV+SGSP +LP+FF +FG+ IPENEN+ EFALD IRELE SP+GT NL
Sbjct  297   LLDRLIFLSRGQTVYSGSPLNLPQFFADFGHSIPENENKTEFALDLIRELEGSPDGTDNL  356

Query  1382  VDFNKSWQRKFSPSSTSNRNNVFPNPKP--SLKDAISASISRGKLVSGATNINSTLSPSV  1555
             V+FN+ W+        +NRN+     +   SLK+AISASISRGKLVSGA N  +  +  V
Sbjct  357   VEFNRKWK-------NTNRNSAATPARYDLSLKEAISASISRGKLVSGAANDAANPTSMV  409

Query  1556  PKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQER  1735
             P FANP W EM V+ KRS  NS RMPE+F +RFGAV+VTG ILAT+FW+LDDSPKG++ER
Sbjct  410   PTFANPIWTEMAVLSKRSFTNSWRMPEIFFVRFGAVMVTGFILATMFWRLDDSPKGVRER  469

Query  1736  LGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflsl  1915
             +GFFAFAMSTT+YTCA+A+PVF+ ER+IFMRETAYNAYRRSSY LSH+++S+P+L FLS+
Sbjct  470   IGFFAFAMSTTYYTCADALPVFIHERFIFMRETAYNAYRRSSYCLSHALVSIPALIFLSI  529

Query  1916  afaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAY  2095
             +FA  T+WAVGL GG SGFLF+L  V ASFWAG+SFVTFLSG+I +VMI Y +VVAI AY
Sbjct  530   SFAALTFWAVGLDGGASGFLFYLSVVLASFWAGNSFVTFLSGVIPHVMIGYVIVVAIFAY  589

Query  2096  FVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKA  2275
             ++LFSGFF+NRDRIP YWIWFHY SLVKYP++ VLQNEF  P KCFV+GIQ+FD SPL  
Sbjct  590   YLLFSGFFLNRDRIPSYWIWFHYLSLVKYPYEAVLQNEFKDPTKCFVRGIQLFDNSPLGD  649

Query  2276  VPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrl  2455
             +  ++K KLL ++SKTL + ITSSTC+ TG DIL Q G+T +NKWNCLW+TIA GFFFR+
Sbjct  650   ISISLKEKLLDSISKTLNVRITSSTCVMTGADILVQQGITQLNKWNCLWVTIAWGFFFRI  709

Query  2456  lfyfallIGSKNKRR  2500
             LFYF+LL+GSKNKRR
Sbjct  710   LFYFSLLLGSKNKRR  724



>ref|XP_010529750.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
20-like [Tarenaya hassleriana]
Length=757

 Score =   856 bits (2212),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/750 (69%), Positives = 597/750 (80%), Gaps = 27/750 (4%)
 Frame = +2

Query  302   DLP-FLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLY  478
             DLP F   + +ME Q   RR    VS TL ELL RV  S  +         + HR  Q  
Sbjct  18    DLPLFYLDQTSMEPQSCPRRGTPRVSATLAELLMRVEGSPDDH--------SAHRRHQAM  69

Query  479   DPVPYPSSFPFVLS-----------FHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDV-  622
             D     +++  V +           F++L+YSVK  +K       G   +A     ND  
Sbjct  70    DVNVTSNAWSSVPTSSVSSSPFVLSFNDLTYSVKTGKKFEFSPCCG--NSASGSDANDWA  127

Query  623   --KVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKL  796
                 LL   SGEA++GEIMAVLGASGSGKSTLIDALANRIA+ESL G++ +NGEVLES L
Sbjct  128   GNSKLLKTXSGEAQDGEIMAVLGASGSGKSTLIDALANRIAKESLRGSITLNGEVLESSL  187

Query  797   LKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKT  976
              KVISAYVMQDDLLFPMLTVEETLMFSAEFRLPR+LS+ +K ARVQALI+QLGL++AAKT
Sbjct  188   QKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPRTLSKKKKAARVQALIDQLGLRSAAKT  247

Query  977   VIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGS  1156
             +IGDEGHRGVSGGERRRVSIG DIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSGS
Sbjct  248   IIGDEGHRGVSGGERRRVSIGTDIIHDPIILFLDEPTSGLDSTSAFMVVKVLQRIAQSGS  307

Query  1157  IVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALD  1336
             IVIMS+HQPSYRIL LLDRLIFLS+G TV+SGSP +LPRFF EFG+PIPENEN+ EFALD
Sbjct  308   IVIMSIHQPSYRILGLLDRLIFLSRGNTVYSGSPENLPRFFAEFGHPIPENENKTEFALD  367

Query  1337  FIRELEQSPEGTKNLVDFNKSWQRK--FSPSSTSNRNNVFPNPKPSLKDAISASISRGKL  1510
              IRELE SPEGTK LV+F+K W+ K   S  S+ +  N   N   SLKDAISASISRGKL
Sbjct  368   LIRELEDSPEGTKTLVEFHKQWRTKNSSSSCSSCSSKNQNRNTNVSLKDAISASISRGKL  427

Query  1511  VSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILAT  1690
             VSGA    S L+ SVP FANP+W+EM+VI KR+++NS R PELF +R GAV+VTGIILAT
Sbjct  428   VSGAKKNGSNLTSSVPTFANPYWIEMIVIAKRALLNSRRQPELFGIRLGAVLVTGIILAT  487

Query  1691  IFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL  1870
             IFWKLD SPKG+QERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL
Sbjct  488   IFWKLDSSPKGVQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL  547

Query  1871  SHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIY  2050
             + SIIS+PSL  LSL+FA TTYWAVGLAGG +GFL+F L + ASFWAGSSFVTFLSG++ 
Sbjct  548   AQSIISIPSLIVLSLSFAATTYWAVGLAGGGNGFLYFFLTILASFWAGSSFVTFLSGVVS  607

Query  2051  NVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKC  2230
             +VM+ +T+VVAILAYF+LFSGFFI+RDRIP YWIWFHY SLVKYP++GVLQNEF+ P KC
Sbjct  608   HVMLGFTVVVAILAYFLLFSGFFISRDRIPLYWIWFHYISLVKYPYEGVLQNEFEDPTKC  667

Query  2231  FVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKW  2410
             FV+GIQ+FD SPL   P A+K +LL +MS  LGIN+T+ TC+TTG DILKQ G+TD+ KW
Sbjct  668   FVRGIQMFDNSPLGQAPLAVKTRLLSSMSSVLGINVTAETCVTTGIDILKQQGITDLGKW  727

Query  2411  NCLWITIAlgfffrllfyfallIGSKNKRR  2500
             +C WITIA GFFFR+LFYF LLIGSKNKRR
Sbjct  728   DCFWITIAWGFFFRVLFYFTLLIGSKNKRR  757



>ref|XP_010558773.1| PREDICTED: ABC transporter G family member 6 [Tarenaya hassleriana]
Length=746

 Score =   855 bits (2210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/720 (71%), Positives = 593/720 (82%), Gaps = 22/720 (3%)
 Frame = +2

Query  374   SMTLGELLHRVGDSAGEKLNNGVGGAN-DHRVLQLYDPVPYPSSFPFVLSFHNLSYSVKV  550
             S TL  LL RVGD            +N    +L L  P     S PFVLSF+NL+YSVKV
Sbjct  38    SPTLAHLLKRVGDRTRHLAGEESPPSNLRQHILDLGSP---ERSVPFVLSFNNLTYSVKV  94

Query  551   RRKMGVPAWLGRRTAAPSQ---------VENDVKVLLDDISGEAREGEIMAVLGASGSGK  703
             RR++ +P    RR   P+            +  K+LL+ ISGEAR+GEI+AVLGASGSGK
Sbjct  95    RRRIDIPGIFSRRRPXPADPAVVPAERLFSSKTKILLNGISGEARDGEILAVLGASGSGK  154

Query  704   STLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAE  883
             STLIDALANRIARESL GTV +NGEVL SK+ K ISAYVMQDDLLFPMLTVEETLMF+AE
Sbjct  155   STLIDALANRIARESLKGTVTLNGEVLNSKMQKAISAYVMQDDLLFPMLTVEETLMFAAE  214

Query  884   FrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPI  1063
             FRLPRSLS+S+K  RVQALI+QLGL+ AAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPI
Sbjct  215   FRLPRSLSKSKKSLRVQALIDQLGLRNAAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPI  274

Query  1064  VLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTV  1243
             +LFLDEPTSGLDSTSAF+VVKVL+RIAQSGS+V+M++HQPSYR+L LLDRL+FLS+GQTV
Sbjct  275   LLFLDEPTSGLDSTSAFIVVKVLKRIAQSGSMVVMTLHQPSYRLLGLLDRLLFLSRGQTV  334

Query  1244  FSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSW-QRKFSP  1420
             FSGSP+ LPRFF EFG+PIPE+ENR EFALD IRELE S  GT++LV+FNK W Q K  P
Sbjct  335   FSGSPTVLPRFFAEFGHPIPEHENRTEFALDLIRELEGSAGGTRSLVEFNKRWNQTKAEP  394

Query  1421  SSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIG  1600
             +ST   N        SLK+AISASISRGKLVSG T  +S +S SVP FANPFWVE+ V+ 
Sbjct  395   TSTQATNQ-------SLKEAISASISRGKLVSGGTTGSSPVS-SVPTFANPFWVELAVLA  446

Query  1601  KRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTC  1780
             +RSM NS R PELF +R GAV++TG ILAT+FW+LD+SPKG+QERLGFFAFAMSTTFYTC
Sbjct  447   RRSMTNSRRRPELFGIRLGAVLITGFILATMFWRLDNSPKGVQERLGFFAFAMSTTFYTC  506

Query  1781  AEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglagg  1960
             A+A+PVFLQER+IFMRETAYNAYRRSSYVLSHS+ +LP+L  LSLAFA TT+W VGL GG
Sbjct  507   ADALPVFLQERFIFMRETAYNAYRRSSYVLSHSLTALPALIVLSLAFAATTFWGVGLDGG  566

Query  1961  fsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIP  2140
               GFLF+ L + ASFWAGSSFVTFLSG++ +VM+ YT+VVAILAYF+LFSGFFINRDRIP
Sbjct  567   LMGFLFYFLIILASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIP  626

Query  2141  PYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSK  2320
              YWIWFHY SLVKYP++ VL NEF  P KCFV+GIQIFD +PL+AVP  MK+KLL+ MS+
Sbjct  627   SYWIWFHYISLVKYPYEAVLMNEFSDPTKCFVRGIQIFDNTPLRAVPRGMKVKLLETMSR  686

Query  2321  TLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             +LG+ ITSSTCLTTG DIL+Q GVTD++KWNCLW+T+A GFFFR+LFY +LL+GSKNKRR
Sbjct  687   SLGMRITSSTCLTTGYDILQQQGVTDLSKWNCLWVTVAWGFFFRILFYLSLLLGSKNKRR  746



>ref|XP_009597347.1| PREDICTED: ABC transporter G family member 6-like [Nicotiana 
tomentosiformis]
Length=725

 Score =   853 bits (2205),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/743 (67%), Positives = 599/743 (81%), Gaps = 26/743 (3%)
 Frame = +2

Query  281   DMSTASSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDH  460
             + S     +PF   RQ +E+           S T  +LL  VGD         V G ++ 
Sbjct  6     NASPVRDSVPFYDRRQIVEMS----------SPTFSQLLKNVGD---------VTGDDES  46

Query  461   RVLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRT---AAPSQVENDVKVL  631
              + Q     P+ S+ PFVL+F+NL+YSVKVRRK+  PA    R+   AA        KVL
Sbjct  47    PLHQALTMDPHHSNIPFVLAFNNLTYSVKVRRKVSFPAISRSRSLHIAAEEIPSTRTKVL  106

Query  632   LDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVIS  811
             L+DI GEAR+GE++AV GASGSGKSTLIDALANRIA++SL GTV +NGE L SKLLKVIS
Sbjct  107   LNDICGEARDGELLAVFGASGSGKSTLIDALANRIAKDSLKGTVTLNGEPLHSKLLKVIS  166

Query  812   AYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDe  991
             AYVMQDDLL+PMLTVEETLMF+AEFRLPRSLS+S+KK+RVQALI+QLGL+ AAKT+IGDE
Sbjct  167   AYVMQDDLLYPMLTVEETLMFAAEFRLPRSLSKSKKKSRVQALIDQLGLRNAAKTIIGDE  226

Query  992   ghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMS  1171
             GHRGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMV+KVLQRIAQSGSIVIMS
Sbjct  227   GHRGVSGGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAFMVIKVLQRIAQSGSIVIMS  286

Query  1172  VHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIREL  1351
             +HQPSYRIL LLDRLIFLS+GQTV+SGSP +LP++F +FGNPIPENEN  EFALD IREL
Sbjct  287   IHQPSYRILGLLDRLIFLSRGQTVYSGSPMNLPQYFADFGNPIPENENPTEFALDLIREL  346

Query  1352  EQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNI  1531
             E S  GTK+LVDFNK+WQ     +ST+   N     + SLK+AISASISRGKLV G+T++
Sbjct  347   EGS-GGTKSLVDFNKTWQHTKRINSTNQARN---RNRLSLKEAISASISRGKLVPGSTHV  402

Query  1532  NSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDD  1711
              ++ +  VP FANP W E+ V+ KRS  NS RMPE+FA+RFGAV+VTG ILAT+FW+LD 
Sbjct  403   ATSPTSMVPTFANPIWTEIAVLSKRSFSNSWRMPEIFAVRFGAVMVTGFILATMFWRLDS  462

Query  1712  SPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiisl  1891
             SPKG++ERL FFAFAMSTT+YTCA+A+PVF+QERYIFMRETAYNAYRRSSY LSH++ S+
Sbjct  463   SPKGVKERLAFFAFAMSTTYYTCADALPVFIQERYIFMRETAYNAYRRSSYCLSHALTSI  522

Query  1892  pslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYT  2071
             P+L FL+L+FA  T+WAVGL GGFS FLF+   + ASFWAG+SFVTFLSG++ +VM+ YT
Sbjct  523   PALIFLALSFAAVTFWAVGLDGGFSSFLFYFGVILASFWAGNSFVTFLSGVVPHVMLGYT  582

Query  2072  LVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQI  2251
             +VVAILAYF+LFSGFF+NRDRIP YW+WFHY SLVKYP++ VLQNEF+ P KCFV+GIQ+
Sbjct  583   IVVAILAYFLLFSGFFMNRDRIPSYWVWFHYISLVKYPYEAVLQNEFEDPTKCFVRGIQM  642

Query  2252  FDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITI  2431
             FD SPL AVP ++K KLL ++S TL + ITSSTC+TTG DIL Q GVT ++KWNCLW+TI
Sbjct  643   FDNSPLGAVPNSLKEKLLSSISSTLNMRITSSTCVTTGSDILVQQGVTQLSKWNCLWVTI  702

Query  2432  AlgfffrllfyfallIGSKNKRR  2500
             A G  FR+LFYF LL+GSKNKRR
Sbjct  703   AWGLLFRILFYFCLLLGSKNKRR  725



>gb|AAR06252.1| stigma/style ABC transporter [Nicotiana tabacum]
Length=730

 Score =   853 bits (2203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/750 (67%), Positives = 602/750 (80%), Gaps = 37/750 (5%)
 Frame = +2

Query  281   DMSTASSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDH  460
             + S     +P    RQ +E+           S T G+LL  VGD         V G ++ 
Sbjct  6     NASPVRDSIPLYDRRQVVEMS----------SPTFGQLLKNVGD---------VTGDDES  46

Query  461   RVLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVE---NDVKVL  631
              + Q     P+ S+ PFVL+F+NL+YSVKVRRK+  PA    R++     E      KVL
Sbjct  47    PLHQALTMDPHHSNIPFVLAFNNLTYSVKVRRKVNFPAISRSRSSRSPAEEIPSTRTKVL  106

Query  632   LDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVIS  811
             L+DI GEAR+GE++AVLGASGSGKSTLIDALANRIA++SL GTV +NGE L SKLLKVIS
Sbjct  107   LNDICGEARDGELLAVLGASGSGKSTLIDALANRIAKDSLKGTVTLNGEPLHSKLLKVIS  166

Query  812   AYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDe  991
             AYVMQDDLL+PMLTVEETLMF+AEFRLPRSLS+S+KK+RVQALI+QLGL+ AAKT+IGDE
Sbjct  167   AYVMQDDLLYPMLTVEETLMFAAEFRLPRSLSKSKKKSRVQALIDQLGLRNAAKTIIGDE  226

Query  992   ghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMS  1171
             GHRGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMV+KVLQRIAQSGSIVIMS
Sbjct  227   GHRGVSGGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAFMVIKVLQRIAQSGSIVIMS  286

Query  1172  VHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIREL  1351
             +HQPSYRI+ LLDRLIFLS+GQTV+SGSP +LP+FF +FGNPIPENENR EFALD IREL
Sbjct  287   IHQPSYRIVGLLDRLIFLSRGQTVYSGSPLNLPQFFADFGNPIPENENRIEFALDLIREL  346

Query  1352  EQSPEGTKNLVDFNKSWQRKFSPSSTS--------NRNNVFPNPKPSLKDAISASISRGK  1507
             E S   T++LVDFNK+WQ     SST+        NRN +      SLK+AISASISRGK
Sbjct  347   EGSGR-TRSLVDFNKTWQHMKRTSSTNQNTETTGRNRNRL------SLKEAISASISRGK  399

Query  1508  LVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILA  1687
             LV G+T++ ++ +  VP FANP W E+ V+ KRS  NS RMPE+FA+RFGAV+VTG ILA
Sbjct  400   LVPGSTHVATSPTSMVPTFANPIWTEIAVLSKRSFTNSWRMPEIFAVRFGAVMVTGFILA  459

Query  1688  TIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYV  1867
             T+FW+LD SPKG+QERLGFFAFAMSTT+YTCA+A+PVF+QERYIFMRETAYN YRRSSY 
Sbjct  460   TMFWRLDSSPKGVQERLGFFAFAMSTTYYTCADALPVFIQERYIFMRETAYNGYRRSSYC  519

Query  1868  LSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGII  2047
             LSH++ S+P+L FL+L+FA  T+WAVGL GGFS FLF+   + ASFWAG+SFVTFLSG++
Sbjct  520   LSHALTSIPALIFLALSFAAVTFWAVGLDGGFSSFLFYFTVILASFWAGNSFVTFLSGVV  579

Query  2048  YNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDK  2227
              +VM+ YT+VVAILAYF+LFSGFF+NRDRIP YWIWFHY SLVKYP++ VLQNEFD P K
Sbjct  580   PHVMLGYTIVVAILAYFLLFSGFFMNRDRIPSYWIWFHYISLVKYPYEAVLQNEFDDPTK  639

Query  2228  CFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINK  2407
             CFV+GIQ+FD SPL AVP ++K KLL ++S TL + ITSSTC+TTG DIL Q G+T ++K
Sbjct  640   CFVRGIQMFDNSPLGAVPNSLKEKLLSSISSTLNMRITSSTCVTTGSDILVQQGITQLSK  699

Query  2408  WNCLWITIAlgfffrllfyfallIGSKNKR  2497
             WNCLW+TIA GF FR+LFYF LL+GSKNKR
Sbjct  700   WNCLWVTIAWGFLFRILFYFCLLLGSKNKR  729



>emb|CDX93388.1| BnaC04g45080D [Brassica napus]
Length=741

 Score =   853 bits (2203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/729 (70%), Positives = 600/729 (82%), Gaps = 40/729 (5%)
 Frame = +2

Query  359   PRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPV-PYPSSF----------  505
             PR +   TLGELL  V D+            ND R L++  P+    SSF          
Sbjct  38    PRATA--TLGELLMNVEDAR-----------NDQRGLEMASPLTSSASSFNSWTSAPASS  84

Query  506   ----PFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIM  673
                 PFVLSF +L+YSVK+++K   P + G  ++  S +  + K+LL+ ISGEA EGE+M
Sbjct  85    ITSSPFVLSFTDLTYSVKIKKKF--PPFCGNSSSNDSAL--NTKILLNGISGEAHEGEMM  140

Query  674   AVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLT  853
             AVLGASGSGKSTLIDALANRIA++SL G++ +NGEVLES+L KVISAYVMQDDLLFPMLT
Sbjct  141   AVLGASGSGKSTLIDALANRIAKDSLRGSITLNGEVLESRLQKVISAYVMQDDLLFPMLT  200

Query  854   VEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvs  1033
             VEETLMFSAEFRLPRSLS+ +KKARVQ+LI+QLGL++AA+T+IGDEGHRGVSGGERRRVS
Sbjct  201   VEETLMFSAEFRLPRSLSKKKKKARVQSLIDQLGLRSAARTMIGDEGHRGVSGGERRRVS  260

Query  1034  igiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDR  1213
             IGIDIIHDPI+LFLDEPTSGLDSTSA+MV+KVLQRIAQSGSIVIMS+HQPSYRI+ LLDR
Sbjct  261   IGIDIIHDPIILFLDEPTSGLDSTSAYMVIKVLQRIAQSGSIVIMSIHQPSYRIMGLLDR  320

Query  1214  LIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFN  1393
             LIFLS+G TVFSGSP+ LP+FF EF +PIPENEN+ EFALD IRELE SPEGTK LV+++
Sbjct  321   LIFLSRGNTVFSGSPTYLPQFFFEFDHPIPENENKTEFALDLIRELENSPEGTKKLVEYH  380

Query  1394  KSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANP  1573
             K W+ K   +S    N +      +LK+AI+ASIS+GKLVSGAT  NS    S   +ANP
Sbjct  381   KEWRVKQQAASRYYNNGI------TLKEAITASISKGKLVSGATTTNS--PSSFQTYANP  432

Query  1574  FWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAF  1753
             FW+EM+VIGKRS++NS+R PEL  MR GAV+VTGIILAT+F KLD+SPKG+QERLGFFAF
Sbjct  433   FWIEMIVIGKRSILNSMRQPELIGMRIGAVMVTGIILATMFTKLDNSPKGVQERLGFFAF  492

Query  1754  AMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTT  1933
             AMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLS SIIS+PSL FL+  FA TT
Sbjct  493   AMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSQSIISIPSLIFLAACFAATT  552

Query  1934  YWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSG  2113
             ++AVGLAGG SGFLFF L + ASFWAGSSFVTFLSG++ NVM+ +T+VVAILAYF+LFSG
Sbjct  553   FFAVGLAGGASGFLFFFLTILASFWAGSSFVTFLSGVVSNVMLGFTVVVAILAYFLLFSG  612

Query  2114  FFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMK  2293
             FFI+RDRIP YWIWFHY SLVKYP++GVLQNEF+   KCFV+GIQIFD SPL   P A+K
Sbjct  613   FFISRDRIPLYWIWFHYLSLVKYPYEGVLQNEFEDTTKCFVRGIQIFDNSPLGQFPNAVK  672

Query  2294  LKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfal  2473
             L LL++MS  LGIN+T+ TC+TTG DILKQ GVT+I+KWNCLWIT+A GFFFR+LFYF L
Sbjct  673   LSLLKSMSGVLGINVTAETCVTTGIDILKQQGVTEISKWNCLWITVAWGFFFRVLFYFTL  732

Query  2474  lIGSKNKRR  2500
             LIGSKNKRR
Sbjct  733   LIGSKNKRR  741



>ref|XP_009767486.1| PREDICTED: ABC transporter G family member 6-like [Nicotiana 
sylvestris]
Length=730

 Score =   852 bits (2202),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/750 (67%), Positives = 601/750 (80%), Gaps = 37/750 (5%)
 Frame = +2

Query  281   DMSTASSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDH  460
             + S     +P    RQ +E+           S T G+LL  VGD         V G ++ 
Sbjct  6     NASPVRDSIPLYDRRQVVEMS----------SPTFGQLLKNVGD---------VTGDDES  46

Query  461   RVLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVE---NDVKVL  631
              + Q     P+ S+ PFVL+F+NL+YSVKVRR++  PA    R++     E      KVL
Sbjct  47    PLHQALTMDPHHSNIPFVLAFNNLTYSVKVRRRVNFPAISRSRSSRSPAEEIPSTRTKVL  106

Query  632   LDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVIS  811
             L+DI GEAR+GE++AVLGASGSGKSTLIDALANRIA++SL GTV +NGE L SKLLKVIS
Sbjct  107   LNDICGEARDGELLAVLGASGSGKSTLIDALANRIAKDSLKGTVTLNGEPLHSKLLKVIS  166

Query  812   AYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDe  991
             AYVMQDDLL+PMLTVEETLMF+AEFRLPRSLS+S+KK+RVQALI+QLGL+ AAKT+IGDE
Sbjct  167   AYVMQDDLLYPMLTVEETLMFAAEFRLPRSLSKSKKKSRVQALIDQLGLRNAAKTIIGDE  226

Query  992   ghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMS  1171
             GHRGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMV+KVLQRIAQSGSIVIMS
Sbjct  227   GHRGVSGGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAFMVIKVLQRIAQSGSIVIMS  286

Query  1172  VHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIREL  1351
             +HQPSYRI+ LLDRLIFLS+GQTV+SGSP +LP+FF +FGNPIPENENR EFALD IREL
Sbjct  287   IHQPSYRIVGLLDRLIFLSRGQTVYSGSPLNLPQFFADFGNPIPENENRIEFALDLIREL  346

Query  1352  EQSPEGTKNLVDFNKSWQRKFSPSST--------SNRNNVFPNPKPSLKDAISASISRGK  1507
             E S   T++LVDFNK+WQ     SST         NRN +      SLK+AISASISRGK
Sbjct  347   EGSGR-TRSLVDFNKTWQHMKRTSSTIQNTETTGRNRNRL------SLKEAISASISRGK  399

Query  1508  LVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILA  1687
             LV G+T++ ++ +  VP FANP W E+ V+ KRS  NS RMPE+FA+RFGAV+VTG ILA
Sbjct  400   LVPGSTHVATSPTSMVPTFANPIWTEIAVLSKRSFTNSWRMPEIFAVRFGAVMVTGFILA  459

Query  1688  TIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYV  1867
             T+FW+LD SPKG+QERLGFFAFAMSTT+YTCA+A+PVF+QERYIFMRETAYN YRRSSY 
Sbjct  460   TMFWRLDSSPKGVQERLGFFAFAMSTTYYTCADALPVFIQERYIFMRETAYNGYRRSSYC  519

Query  1868  LSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGII  2047
             LSH++ S+P+L FL+L+FA  T+WAVGL GGFS FLF+   + ASFWAG+SFVTFLSG++
Sbjct  520   LSHALTSIPALIFLALSFAAVTFWAVGLDGGFSSFLFYFTVILASFWAGNSFVTFLSGVV  579

Query  2048  YNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDK  2227
              +VM+ YT+VVAILAYF+LFSGFF+NRDRIP YWIWFHY SLVKYP++ VLQNEFD P K
Sbjct  580   PHVMLGYTIVVAILAYFLLFSGFFMNRDRIPSYWIWFHYISLVKYPYEAVLQNEFDDPTK  639

Query  2228  CFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINK  2407
             CFV+GIQ+FD SPL AVP ++K KLL ++S TL + ITSSTC+TTG DIL Q G+T ++K
Sbjct  640   CFVRGIQMFDNSPLGAVPNSLKEKLLSSISSTLNMRITSSTCVTTGSDILVQQGITQLSK  699

Query  2408  WNCLWITIAlgfffrllfyfallIGSKNKR  2497
             WNCLW+TIA GF FR+LFYF LL+GSKNKR
Sbjct  700   WNCLWVTIAWGFLFRILFYFCLLLGSKNKR  729



>ref|XP_010253396.1| PREDICTED: ABC transporter G family member 6-like [Nelumbo nucifera]
Length=754

 Score =   853 bits (2203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/743 (69%), Positives = 594/743 (80%), Gaps = 20/743 (3%)
 Frame = +2

Query  308   PFLGPRQAMELQELTRRPRHSV--SMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYD  481
             P   PR AMELQ L  R   +   S TL EL  RV ++  E           H+ L + D
Sbjct  20    PVFEPRPAMELQGLAPRGVQNTGPSPTLSELFWRVENAQDEATRIET---PRHQSLDIND  76

Query  482   PVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRT---AAPSQVEND-------VKVL  631
                     PF+LSF+NL+YSVK RRK+  PA  GR     AA   + ND        KVL
Sbjct  77    TGVDSRYLPFILSFNNLTYSVKTRRKISFPACFGRAKSLGAAAGPIHNDPRVLNSNTKVL  136

Query  632   LDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVIS  811
             L+DI G AREGEI+AVLGASGSGKSTLIDALA+RIA+ SL G + +NGEV+ S+L KVIS
Sbjct  137   LNDICGYAREGEILAVLGASGSGKSTLIDALASRIAKGSLRGCITLNGEVIPSRLRKVIS  196

Query  812   AYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDe  991
             AYVMQDDLLFPMLTVEETLMFSAEFRLPR LS+S+KKARVQALIEQLGL  AA TVIGDE
Sbjct  197   AYVMQDDLLFPMLTVEETLMFSAEFRLPRELSKSKKKARVQALIEQLGLTNAAYTVIGDE  256

Query  992   ghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMS  1171
             GHRGVSGGERRRVSIGIDIIHDPIVLFLDEPTSGLDSTSAFMVV VL+RIA SGSIVIMS
Sbjct  257   GHRGVSGGERRRVSIGIDIIHDPIVLFLDEPTSGLDSTSAFMVVNVLKRIAASGSIVIMS  316

Query  1172  VHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIREL  1351
             +HQPS+RI+ LLDRL+FLS+GQTVFSG+P  +P FF EFG PIP+NEN+ EFALD+I+EL
Sbjct  317   IHQPSFRIIGLLDRLLFLSRGQTVFSGTPDDMPNFFSEFGRPIPQNENKTEFALDYIQEL  376

Query  1352  EQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNI  1531
             E  P GTK+LV+F+KSWQ+K +  ST      +     +LKDAI+ASISRGKLVSGATN 
Sbjct  377   EGLPGGTKSLVEFHKSWQQKMNHPSTCG----YDRQGLTLKDAIAASISRGKLVSGATN-  431

Query  1532  NSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDD  1711
             +++ + SVP FANPFW E+ V+  RSM N+ RMPEL  +R GAV+VTGIILATIFW +D+
Sbjct  432   DASGTSSVPTFANPFWTEVAVLSNRSMTNAKRMPELVGVRLGAVLVTGIILATIFWHVDN  491

Query  1712  SPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiisl  1891
             SPKGIQERLGFFAFAMSTTFYTCAEA+PVFL ERYIFMRETAYNAYRRSSYVLS S++S+
Sbjct  492   SPKGIQERLGFFAFAMSTTFYTCAEAMPVFLHERYIFMRETAYNAYRRSSYVLSQSLVSI  551

Query  1892  pslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYT  2071
             PSL  LSLAFA  T+W VGLAGG+SGFLF+ L + ASFWAG+SFVTFLSG+I   M+ YT
Sbjct  552   PSLILLSLAFAAVTFWTVGLAGGWSGFLFYFLIIVASFWAGNSFVTFLSGVITQEMMGYT  611

Query  2072  LVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQI  2251
             +V+++LAYFVLFSGFFI RDRIP YWIW+HY SLVKYPFQGVLQNEFD P KCFVKG+QI
Sbjct  612   VVLSMLAYFVLFSGFFITRDRIPAYWIWYHYISLVKYPFQGVLQNEFDDPAKCFVKGVQI  671

Query  2252  FDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITI  2431
             FD +PL  VPEAMK+ LL+ MS +LG+NI+S+TC+TTG DIL+  G TD++KWNCLW T+
Sbjct  672   FDNTPLGMVPEAMKVGLLKKMSSSLGMNISSNTCVTTGVDILRMQGTTDLSKWNCLWATV  731

Query  2432  AlgfffrllfyfallIGSKNKRR  2500
             A GFFFR LFYF LL+GSKNKR+
Sbjct  732   AWGFFFRTLFYFTLLLGSKNKRK  754



>ref|XP_004168142.1| PREDICTED: ABC transporter G family member 2-like [Cucumis sativus]
Length=726

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/756 (68%), Positives = 604/756 (80%), Gaps = 50/756 (7%)
 Frame = +2

Query  287   STASSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRV  466
             S    + P+    + +EL+E+ RRP      TLGELL RV D+           + DH V
Sbjct  3     SIGGDNFPYFTNNE-LELREIGRRP------TLGELLKRVEDAQ----------SPDHSV  45

Query  467   LQLYDPVPY----PSSFPFVLSFHNLSYSVKVRRKMG---VPAWLGRRTAAPSQVENDVK  625
             + +     Y    P  +PF LSF NLSYSVKVR + G   +P  L     A  +    VK
Sbjct  46    VDVSYGCRYLAEAPLLYPFKLSFRNLSYSVKVRGRGGGSSLPENL-----AAEESGGRVK  100

Query  626   VLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKV  805
             +LL+DISGEAREGEIMAVLGASGSGKSTLIDALA+RIA+  L G V +N EVLES LLKV
Sbjct  101   LLLNDISGEAREGEIMAVLGASGSGKSTLIDALADRIAKGKLKGKVTLNNEVLESGLLKV  160

Query  806   ISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIG  985
             ISAYVMQDDLLFPMLTVEETLMFSAEFRLPRSLS+S+KKARVQALI QLGL TAA TVIG
Sbjct  161   ISAYVMQDDLLFPMLTVEETLMFSAEFRLPRSLSKSKKKARVQALINQLGLTTAANTVIG  220

Query  986   DeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVI  1165
             DEGHRGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVI
Sbjct  221   DEGHRGVSGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVI  280

Query  1166  MSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIR  1345
             MS+HQPSYRIL+LLDRLIFLS GQTV+SGSP+ LP F  EFG+PIP NENR EFALD +R
Sbjct  281   MSIHQPSYRILSLLDRLIFLSHGQTVYSGSPTDLPNFLAEFGHPIPGNENRTEFALDLVR  340

Query  1346  ELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKP-----------SLKDAISAS  1492
             +LE++  GTK++V+ NKSWQRK         NNV                  LKDAISAS
Sbjct  341   DLEETVGGTKSMVEHNKSWQRK---------NNVHLEDYEIHRDFSRRFHLCLKDAISAS  391

Query  1493  ISRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVT  1672
             ISRGKLVSGA  I+S+ S S  KF+NP WVE++VI KRS++NS RMPELF +R GAV++T
Sbjct  392   ISRGKLVSGAP-IDSSRSSSFSKFSNPLWVEILVIAKRSIMNSRRMPELFGIRLGAVLIT  450

Query  1673  GIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYR  1852
             GIILAT+FW LD+SPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYR
Sbjct  451   GIILATMFWHLDNSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYR  510

Query  1853  RSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTF  2032
             RSSYVL+HS++S+PSL  LS+ FA TTY+AV LAGGFSGF+FF   + ++FWAGSSFVTF
Sbjct  511   RSSYVLAHSLLSIPSLIILSITFAGTTYFAVNLAGGFSGFVFFFFAILSAFWAGSSFVTF  570

Query  2033  LSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEF  2212
             LSG++ +VM+ YT+VVAILAYF+LFSGFF++RDR+PPYWIWFHY SLVKYP++ VLQNEF
Sbjct  571   LSGVVSHVMLGYTVVVAILAYFLLFSGFFLSRDRMPPYWIWFHYMSLVKYPYEAVLQNEF  630

Query  2213  DYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGV  2392
             +    CF++G+Q+FD +PL  VP AMK++LL++M KTLG+NIT STC+TTG D+L+Q G+
Sbjct  631   EAKSGCFIRGVQMFDNTPLAVVPSAMKMELLKSMGKTLGLNITGSTCVTTGSDVLRQQGI  690

Query  2393  TDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             TD++KWNC+WI++A GF FR+LFYFALL GSKNKR+
Sbjct  691   TDLSKWNCIWISVAWGFLFRILFYFALLFGSKNKRK  726



>ref|XP_004236771.1| PREDICTED: ABC transporter G family member 6-like [Solanum lycopersicum]
Length=718

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 498/716 (70%), Positives = 589/716 (82%), Gaps = 22/716 (3%)
 Frame = +2

Query  362   RHSVSM---TLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFPFVLSFHNL  532
             R +V M   T  +LL+ VGD     +     G + H++L +   +P   S PFVLSF NL
Sbjct  22    RQTVEMSSPTFAQLLNNVGDD----VTGDETGGSVHQILTM--ELPLQQSIPFVLSFSNL  75

Query  533   SYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTL  712
             +YSV+VRRK   PA  GRR           KVLL+DISGEAR+GE++AVLGASGSGKSTL
Sbjct  76    TYSVRVRRKNIFPAMSGRRNRTDEPRCTRTKVLLNDISGEARDGELLAVLGASGSGKSTL  135

Query  713   IDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrl  892
             IDALANRI+++SL G +K+NGE L SKLLKVISAYVMQDDLL+PMLTVEETLMFSAEFRL
Sbjct  136   IDALANRISKDSLKGEMKLNGEPLHSKLLKVISAYVMQDDLLYPMLTVEETLMFSAEFRL  195

Query  893   prslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLF  1072
             PR+LS+S+KK+RVQALI+QLGL+ AAKT+IGDEGHRGVSGGERRRVSIGIDIIHDPI+LF
Sbjct  196   PRTLSKSKKKSRVQALIDQLGLRNAAKTIIGDEGHRGVSGGERRRVSIGIDIIHDPIILF  255

Query  1073  LDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSG  1252
             LDEPTSGLDSTSAFM+VKVLQRIAQSGSIVIMS+HQPSYRIL LLDRLIFLS+GQTV+SG
Sbjct  256   LDEPTSGLDSTSAFMMVKVLQRIAQSGSIVIMSIHQPSYRILGLLDRLIFLSRGQTVYSG  315

Query  1253  SPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTS  1432
             SP +LP+FF +FG+PIPENEN+ EFALD IRELE SP GT +LV+FN+ W+   + S+TS
Sbjct  316   SPFNLPQFFADFGHPIPENENKTEFALDLIRELEGSPNGTSSLVEFNRKWK---NSSTTS  372

Query  1433  NRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSM  1612
                ++      SLK+AISASISRGKLVSGA N  S     VP FANP W+EM V+  RS 
Sbjct  373   TIYDL------SLKEAISASISRGKLVSGAANPTSM----VPTFANPIWIEMAVLSNRSF  422

Query  1613  VNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAI  1792
              NS RMPE+FA+RFGAV+VTG ILAT+FW+LDDSP+G++ER+GFFAFAMSTT+YTCAEA+
Sbjct  423   TNSWRMPEIFAVRFGAVMVTGFILATLFWRLDDSPRGVRERIGFFAFAMSTTYYTCAEAL  482

Query  1793  PVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgf  1972
             PVF+ ER+IFMRETAYNAYRRSSY LSH+++S+PSL FLSL+FA  T+WAVGL GG S F
Sbjct  483   PVFIHERFIFMRETAYNAYRRSSYCLSHALVSIPSLIFLSLSFAALTFWAVGLDGGASSF  542

Query  1973  lffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWI  2152
             LF+L  V ASFWAG+SFVTFLS +I +VMI Y +VVAI AY++LFSGFF+NRDRIP YWI
Sbjct  543   LFYLSVVLASFWAGNSFVTFLSCVIPHVMIGYVIVVAIFAYYLLFSGFFLNRDRIPSYWI  602

Query  2153  WFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGI  2332
             WFHY SLVKYP++ VLQNEF  P KCFV+GIQ+FD SPL  VP ++K KLL ++S TL +
Sbjct  603   WFHYISLVKYPYEAVLQNEFKDPMKCFVRGIQLFDNSPLGDVPISLKEKLLDSISNTLNV  662

Query  2333  NITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
              ITSSTC+ TG DIL Q G+T +NKWNCLW+TIA GFFFR+LFYF LL+GSKNKRR
Sbjct  663   RITSSTCVVTGADILVQQGITQLNKWNCLWVTIAWGFFFRILFYFTLLLGSKNKRR  718



>ref|XP_011019268.1| PREDICTED: ABC transporter G family member 20 [Populus euphratica]
Length=716

 Score =   846 bits (2186),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/726 (69%), Positives = 602/726 (83%), Gaps = 13/726 (2%)
 Frame = +2

Query  332   MELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQL-YDPVPYPSSFP  508
             ME+Q+L R  + S+S TL E+   V DS  + +++       H+VL+L +     P S P
Sbjct  1     MEVQKLPRTSKPSLSPTLAEIQKGVHDSQSDMISD-YSSPVHHQVLELGHACSSIPPSNP  59

Query  509   FVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGA  688
             FVLSF NL+Y VK  +KM + +  G+ ++  S  E   K+LL+DIS  AREGEI AVLGA
Sbjct  60    FVLSFDNLTYGVKGGQKMSL-SICGKDSSLDSS-ETGKKILLNDISEAAREGEITAVLGA  117

Query  689   SGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETL  868
             SGSGKSTLIDALA+RIA+ESL G+V +NGEVLES+LLK+ISAYVMQDDLLFPMLTVEETL
Sbjct  118   SGSGKSTLIDALADRIAKESLKGSVTLNGEVLESRLLKMISAYVMQDDLLFPMLTVEETL  177

Query  869   MFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDI  1048
             MFSAEFRLPR LS+S+KKARVQALI+QLGL+ AA TVIGDEGHRGVSGGERRRVSIGIDI
Sbjct  178   MFSAEFRLPRFLSKSKKKARVQALIDQLGLRNAANTVIGDEGHRGVSGGERRRVSIGIDI  237

Query  1049  IHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLS  1228
             +HDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMS+HQPSYR+L LLDRLIFLS
Sbjct  238   VHDPILLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSYRLLTLLDRLIFLS  297

Query  1229  KGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQR  1408
              GQTV++GSP SLP FF EFG+PIPENENR EFALD+IR+LE+ P GTK LV+FNKSWQ 
Sbjct  298   HGQTVYAGSPGSLPEFFAEFGHPIPENENRTEFALDYIRDLEEIPGGTKTLVEFNKSWQ-  356

Query  1409  KFSPSSTSNRNNVFPNP-KPSLKDAISASISRGKLVSGATN-INSTLSPSVPKFANPFWV  1582
                  +  N  N F N  K SL+D IS SISRGKLVSGA N +NST SP V  FANP WV
Sbjct  357   -----AMKNAKNRFSNASKLSLRDTISVSISRGKLVSGAPNDLNSTSSP-VLSFANPLWV  410

Query  1583  EMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMS  1762
             E++VIGKRS +N+ RMPELF +R  AV+VTGIILAT+++ LD+SP+G+QERLGFFAFA+S
Sbjct  411   EVMVIGKRSSLNAKRMPELFGIRLAAVLVTGIILATVYYHLDNSPRGVQERLGFFAFAIS  470

Query  1763  TTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWA  1942
             TT+YTCAE+IP F+QERYIFMRETAYNAYRRSSYVL+HS+IS+PSL  LS+AFA TT+WA
Sbjct  471   TTYYTCAESIPAFIQERYIFMRETAYNAYRRSSYVLAHSLISIPSLIVLSIAFATTTFWA  530

Query  1943  vglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFI  2122
             VGL GGFSGF F+   +F +FWAGSSFVTFLSG++ +VM+++TLVVAIL+YF+LFSGF+I
Sbjct  531   VGLDGGFSGFCFYFFTIFCAFWAGSSFVTFLSGVVSHVMLSFTLVVAILSYFLLFSGFYI  590

Query  2123  NRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKL  2302
             +RDRIPP+W+WFHY SLVKYP++  LQNEF  P KCFV G+Q+FD +PL  +P +MKLK+
Sbjct  591   SRDRIPPFWLWFHYMSLVKYPYEAALQNEFHSPTKCFVMGVQMFDNTPLAVMPLSMKLKM  650

Query  2303  LQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIG  2482
             L+ +S  LG NITS+TC  TG DIL+Q G+T ++KWNCLWITIA GFFFR+LFYFALL+ 
Sbjct  651   LKTISTRLGRNITSNTCAVTGTDILQQQGITQLSKWNCLWITIAWGFFFRILFYFALLLW  710

Query  2483  SKNKRR  2500
             SKNKRR
Sbjct  711   SKNKRR  716



>ref|XP_004137951.1| PREDICTED: ABC transporter G family member 2-like [Cucumis sativus]
 gb|KGN58908.1| hypothetical protein Csa_3G736560 [Cucumis sativus]
Length=726

 Score =   846 bits (2186),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/756 (68%), Positives = 604/756 (80%), Gaps = 50/756 (7%)
 Frame = +2

Query  287   STASSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRV  466
             S    + P+    + +EL+E+ RRP      TLGELL RV D+           + DH V
Sbjct  3     SIGGDNFPYFTNNE-LELREIGRRP------TLGELLKRVEDAQ----------SPDHSV  45

Query  467   LQLYDPVPY----PSSFPFVLSFHNLSYSVKVRRKMG---VPAWLGRRTAAPSQVENDVK  625
             + +     Y    P  +PF LSF NLSYSVKVR + G   +P  L     A  +    VK
Sbjct  46    VDVSYGCRYLAEAPLLYPFKLSFRNLSYSVKVRGRGGGSSLPENL-----AAEESGGRVK  100

Query  626   VLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKV  805
             +LL+DISG+AREGEIMAVLGASGSGKSTLIDALA+RIA+  L G V +N EVLES LLKV
Sbjct  101   LLLNDISGDAREGEIMAVLGASGSGKSTLIDALADRIAKGKLKGKVTLNNEVLESGLLKV  160

Query  806   ISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIG  985
             ISAYVMQDDLLFPMLTVEETLMFSAEFRLPRSLS+S+KKARVQALI QLGL TAA TVIG
Sbjct  161   ISAYVMQDDLLFPMLTVEETLMFSAEFRLPRSLSKSKKKARVQALINQLGLTTAANTVIG  220

Query  986   DeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVI  1165
             DEGHRGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVI
Sbjct  221   DEGHRGVSGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVI  280

Query  1166  MSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIR  1345
             MS+HQPSYRIL+LLDRLIFLS GQTV+SGSP+ LP F  EFG+PIP NENR EFALD +R
Sbjct  281   MSIHQPSYRILSLLDRLIFLSHGQTVYSGSPTDLPNFLAEFGHPIPGNENRTEFALDLVR  340

Query  1346  ELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKP-----------SLKDAISAS  1492
             +LE++  GTK++V+ NKSWQRK         NNV                  LKDAISAS
Sbjct  341   DLEETVGGTKSMVEHNKSWQRK---------NNVHLEDYEIHRDFSRRFHLCLKDAISAS  391

Query  1493  ISRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVT  1672
             ISRGKLVSGA  I+S+ S S  KF+NP WVE++VI KRS++NS RMPELF +R GAV++T
Sbjct  392   ISRGKLVSGAP-IDSSRSSSFSKFSNPLWVEILVIAKRSIMNSRRMPELFGIRLGAVLIT  450

Query  1673  GIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYR  1852
             GIILAT+FW LD+SPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYR
Sbjct  451   GIILATMFWHLDNSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYR  510

Query  1853  RSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTF  2032
             RSSYVL+HS++S+PSL  LS+ FA TTY+AV LAGGFSGF+FF   + ++FWAGSSFVTF
Sbjct  511   RSSYVLAHSLLSIPSLIILSITFAGTTYFAVNLAGGFSGFVFFFFAILSAFWAGSSFVTF  570

Query  2033  LSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEF  2212
             LSG++ +VM+ YT+VVAILAYF+LFSGFF++RDR+PPYWIWFHY SLVKYP++ VLQNEF
Sbjct  571   LSGVVSHVMLGYTVVVAILAYFLLFSGFFLSRDRMPPYWIWFHYMSLVKYPYEAVLQNEF  630

Query  2213  DYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGV  2392
             +    CF++G+Q+FD +PL  VP AMK++LL++M KTLG+NIT STC+TTG D+L+Q G+
Sbjct  631   EAKSGCFIRGVQMFDNTPLAVVPSAMKVELLKSMGKTLGLNITGSTCVTTGSDVLRQQGI  690

Query  2393  TDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             TD++KWNC+WI++A GF FR+LFYFALL GSKNKR+
Sbjct  691   TDLSKWNCIWISVAWGFLFRILFYFALLFGSKNKRK  726



>ref|NP_181272.1| ABC transporter G family member 2 [Arabidopsis thaliana]
 sp|Q9ZUT0.1|AB2G_ARATH RecName: Full=ABC transporter G family member 2; Short=ABC transporter 
ABCG.2; Short=AtABCG2; AltName: Full=White-brown complex 
homolog protein 2; Short=AtWBC2 [Arabidopsis thaliana]
 gb|AAC98055.1| putative ABC transporter [Arabidopsis thaliana]
 gb|AEC09388.1| ABC transporter G family member 2 [Arabidopsis thaliana]
Length=755

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/733 (69%), Positives = 594/733 (81%), Gaps = 30/733 (4%)
 Frame = +2

Query  356   RPRHS--VSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPV-PYPSSF-------  505
             RP  +  VS+T  E L  V D+  ++       +   R L +  P+    SSF       
Sbjct  35    RPSDTTRVSVTFAEHLMNVEDARNDE-------SASSRALGIASPINSAASSFNSWASAP  87

Query  506   -------PFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREG  664
                    PFVLSF +L+YSVK+++K   P    RR+   S V  + K+LL+ ISGEAREG
Sbjct  88    ASSISSSPFVLSFTDLTYSVKIQKKFN-PLACCRRSGNDSSV--NTKILLNGISGEAREG  144

Query  665   EIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFP  844
             E+MAVLGASGSGKSTLIDALANRIA++SL G++ +NGEVLES + KVISAYVMQDDLLFP
Sbjct  145   EMMAVLGASGSGKSTLIDALANRIAKDSLRGSITLNGEVLESSMQKVISAYVMQDDLLFP  204

Query  845   MLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerr  1024
             MLTVEETLMFSAEFRLPRSLS+ +KKARVQALI+QLGL++AAKTVIGDEGHRGVSGGERR
Sbjct  205   MLTVEETLMFSAEFRLPRSLSKKKKKARVQALIDQLGLRSAAKTVIGDEGHRGVSGGERR  264

Query  1025  rvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNL  1204
             RVSIG DIIHDPI+LFLDEPTSGLDSTSA+MV+KVLQRIAQSGSIVIMS+HQPSYRI+ L
Sbjct  265   RVSIGNDIIHDPIILFLDEPTSGLDSTSAYMVIKVLQRIAQSGSIVIMSIHQPSYRIMGL  324

Query  1205  LDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLV  1384
             LD+LIFLSKG TV+SGSP+ LP+FF EF +PIPENEN+ EFALD IRELE S EGTK LV
Sbjct  325   LDQLIFLSKGNTVYSGSPTHLPQFFSEFKHPIPENENKTEFALDLIRELEYSTEGTKPLV  384

Query  1385  DFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINST-LSPSVPK  1561
             +F+K W+ K +PS  +N          SLK+AI+ASISRGKLVSGATN NS+ L+PS   
Sbjct  385   EFHKQWRAKQAPSYNNNNKRN--TNVSSLKEAITASISRGKLVSGATNNNSSNLTPSFQT  442

Query  1562  FANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLG  1741
             FANPFW+EM+VIGKR+++NS R PEL  MR GAV+VTGIILAT+F  LD+SPKG QERLG
Sbjct  443   FANPFWIEMIVIGKRAILNSRRQPELLGMRLGAVMVTGIILATMFTNLDNSPKGAQERLG  502

Query  1742  FFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslaf  1921
             FFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLS SIIS+P+L  LS +F
Sbjct  503   FFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSQSIISIPALIVLSASF  562

Query  1922  aVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFV  2101
             A TT+WAVGL GG +GF FF   + ASFWAGSSFVTFLSG+I NVM+ +T+VVAILAYF+
Sbjct  563   AATTFWAVGLDGGANGFFFFYFTILASFWAGSSFVTFLSGVIPNVMLGFTVVVAILAYFL  622

Query  2102  LFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVP  2281
             LFSGFFI+RDRIP YW+WFHY SLVKYP++GVLQNEF  P +CF +G+Q+FD SPL   P
Sbjct  623   LFSGFFISRDRIPVYWLWFHYISLVKYPYEGVLQNEFQNPTRCFARGVQLFDNSPLGEFP  682

Query  2282  EAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllf  2461
               +K+ LL++MS  LG N+T+ TC+TTG DILKQ G+TDI+KWNCLWIT+A GFFFR+LF
Sbjct  683   NDVKVNLLKSMSGVLGTNVTAETCVTTGIDILKQQGITDISKWNCLWITVAWGFFFRVLF  742

Query  2462  yfallIGSKNKRR  2500
             YF LLIGSKNKR+
Sbjct  743   YFTLLIGSKNKRK  755



>ref|XP_011019683.1| PREDICTED: ABC transporter G family member 6-like [Populus euphratica]
Length=762

 Score =   845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/726 (71%), Positives = 594/726 (82%), Gaps = 22/726 (3%)
 Frame = +2

Query  368   SVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDP-VPYPSSFPFVLSFHNLSYSV  544
             + S TLG+LL  VGD   E   NG      H+VL+L    +  P S PFVLSF+NL+YSV
Sbjct  42    ATSPTLGQLLKNVGDVIREATGNG-SETPVHQVLELGSTNLEVPRSIPFVLSFNNLTYSV  100

Query  545   KVRRKMGVPAWLGRRTAAPSQVEND------------VKVLLDDISGEAREGEIMAVLGA  688
             KVRRK  + + L  R         D             K LL+DISGEAR+GEI+AVLGA
Sbjct  101   KVRRKFRLRSILPSRNIHRPCATTDSDPVGGESLFTTTKTLLNDISGEARDGEILAVLGA  160

Query  689   SGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETL  868
             SGSGKSTLIDALANRIA+ SL GT  +NGEVLES++LKVISAYVMQDDLLFPMLTVEETL
Sbjct  161   SGSGKSTLIDALANRIAKGSLKGTKTLNGEVLESRMLKVISAYVMQDDLLFPMLTVEETL  220

Query  869   MFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDI  1048
             MF+AEFRLPRSLS+S+K+ RVQALIEQLGL+ AAKTVIGDEGHRGVSGGERRRVSIGIDI
Sbjct  221   MFAAEFRLPRSLSKSKKRLRVQALIEQLGLKNAAKTVIGDEGHRGVSGGERRRVSIGIDI  280

Query  1049  IHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLS  1228
             IHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRIL LLDRLI LS
Sbjct  281   IHDPIILFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILGLLDRLILLS  340

Query  1229  KGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQR  1408
             +GQTV+SGSP SLP +F +FG+PIP+ ENR E+ALD IRELE SP GTK+LV+FNKSW  
Sbjct  341   RGQTVYSGSPMSLPVYFSDFGHPIPDGENRTEYALDLIRELEGSPGGTKSLVEFNKSWHN  400

Query  1409  -KFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPS--VPKFANPFW  1579
              K S +     +        SLK+AISA+IS+GKLVSGATN N  +SP+  VP FANP W
Sbjct  401   LKLSRNGRGEPDG----DGLSLKEAISAAISKGKLVSGATN-NDAISPNSMVPAFANPVW  455

Query  1580  VEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAM  1759
              EM V+ KRS +NS R+PELF +R GAV+VTG ILAT+FW+LD SPKG++ERLGFFAFAM
Sbjct  456   KEMAVLSKRSFMNSRRVPELFGIRLGAVMVTGFILATVFWQLDSSPKGVRERLGFFAFAM  515

Query  1760  STTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYW  1939
             STTFYTCAEA+PVFLQERYIFMRETAYNAYRRSSYVLSH ++ LPSL FLS AFA TT+W
Sbjct  516   STTFYTCAEALPVFLQERYIFMRETAYNAYRRSSYVLSHGLVVLPSLIFLSFAFAATTFW  575

Query  1940  AvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFF  2119
             AVGL GG SGFLF+ L +FASFWAGSSFVTFLSG++ +VM+ YT+VVAILAYF+LFSGFF
Sbjct  576   AVGLDGGLSGFLFYFLIIFASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFF  635

Query  2120  INRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLK  2299
             INRDRIP  WIWFHY SLVKYP++ VLQNEF  P KCFV+G+QIFD SPL  VP ++KLK
Sbjct  636   INRDRIPSCWIWFHYLSLVKYPYEAVLQNEFQDPTKCFVRGVQIFDQSPLGEVPTSLKLK  695

Query  2300  LLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallI  2479
             LL++MS TLG+ ITSSTCLTTG D+L+Q G+TD++KWNCLW+T+A GF FR+LFY +LL+
Sbjct  696   LLESMSNTLGMEITSSTCLTTGADVLQQQGITDLSKWNCLWVTVAWGFLFRILFYVSLLL  755

Query  2480  GSKNKR  2497
             GSKNKR
Sbjct  756   GSKNKR  761



>ref|XP_010534453.1| PREDICTED: ABC transporter G family member 16-like [Tarenaya 
hassleriana]
Length=752

 Score =   843 bits (2179),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/746 (67%), Positives = 590/746 (79%), Gaps = 28/746 (4%)
 Frame = +2

Query  320   PRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPS  499
             P  +MEL  ++R        TLG+LL +VGD+  E + +       H  L +   +  P 
Sbjct  16    PYYSMELSTISRAV--DAPSTLGQLLKKVGDARKEAVGDET--PIHHHALTVAHGIDAPD  71

Query  500   S-----FPFVLSFHNLSYSVKVRRKMGVPAWLGRR--TAAPSQVE---------NDVKVL  631
                    PFVLSF NL+YSV VRRK      L RR   AAP   E         +  K L
Sbjct  72    HDEMRPVPFVLSFQNLTYSVNVRRKFHFSDVLPRRRTEAAPEDPEIAPAERLFSSKTKTL  131

Query  632   LDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVIS  811
             LD+ISGE  +GEI+AVLGASGSGKSTLIDALANRIA+ SL GTV +NGEVL+S++LKVIS
Sbjct  132   LDNISGETCDGEILAVLGASGSGKSTLIDALANRIAKGSLRGTVTLNGEVLQSRMLKVIS  191

Query  812   AYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDe  991
             AYVMQDDLLFPMLTVEETLMF+AEFRLPR+L  S+KK RVQALI+QLG++ A+KT+IGDE
Sbjct  192   AYVMQDDLLFPMLTVEETLMFAAEFRLPRTLPISKKKLRVQALIDQLGIRNASKTIIGDE  251

Query  992   ghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMS  1171
             GHRG+SGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSA+MVV VL+RIA+SGSIV+MS
Sbjct  252   GHRGISGGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAYMVVNVLKRIAESGSIVVMS  311

Query  1172  VHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIREL  1351
             +HQPSYR+L LLDRLIFLS+GQTVFSGSPSSLP FF EFG+PIPENEN+ EFALD IREL
Sbjct  312   IHQPSYRVLGLLDRLIFLSRGQTVFSGSPSSLPLFFSEFGHPIPENENKTEFALDLIREL  371

Query  1352  EQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPS---LKDAISASISRGKLVSGA  1522
             E S  GT+ LV+FNK WQ          R  + P   PS   LK+AISASISRGKL S  
Sbjct  372   EGSAGGTRGLVEFNKKWQEM----KQIRRQTLTPPATPSGITLKEAISASISRGKLFS-G  426

Query  1523  TNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWK  1702
                 +  S  VP FANPFWVE++ + KRSM+NS R PELF  R  AVV+TG ILAT+FW+
Sbjct  427   GAGGNGGSVMVPSFANPFWVELMALSKRSMLNSRRQPELFGTRVAAVVITGFILATVFWR  486

Query  1703  LDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsi  1882
             LD+SPKG+QERLGFFAFAMST FYTCAEA+PVFLQERYIFMRETA+NAYRRSSYVLSH++
Sbjct  487   LDNSPKGVQERLGFFAFAMSTMFYTCAEALPVFLQERYIFMRETAHNAYRRSSYVLSHAL  546

Query  1883  islpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMI  2062
             +SLPSL  LSLAFAVTT+WAVGL GG  GFLF+ L + ASFW+G+SFVTFLSG++ +VM+
Sbjct  547   VSLPSLVLLSLAFAVTTFWAVGLDGGGIGFLFYCLIILASFWSGNSFVTFLSGVVPHVML  606

Query  2063  AYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKG  2242
              YT+VVAILAYF+LFSGFFINRDRIPPYWIWFHY SLVKYPF+ VLQNEF  P +CFV+G
Sbjct  607   GYTIVVAILAYFLLFSGFFINRDRIPPYWIWFHYMSLVKYPFEAVLQNEFSDPTECFVRG  666

Query  2243  IQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLW  2422
             +Q+FD +PL  +PEA+K+ LL  +S++LG+ ITS TCLTTG DILKQ G+T ++KWNCLW
Sbjct  667   VQVFDNTPLGELPEAVKVSLLGTVSQSLGMTITSDTCLTTGADILKQQGITQLSKWNCLW  726

Query  2423  ITIAlgfffrllfyfallIGSKNKRR  2500
             +T+A GFFFR+LFYF LL+GSKNKRR
Sbjct  727   VTVAWGFFFRVLFYFCLLLGSKNKRR  752



>gb|EYU33174.1| hypothetical protein MIMGU_mgv1a026904mg [Erythranthe guttata]
Length=752

 Score =   843 bits (2177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/735 (67%), Positives = 591/735 (80%), Gaps = 31/735 (4%)
 Frame = +2

Query  359   PRHSV--SMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQL-------YDPVPYPSSFPF  511
             PR +   S TL ELL  V D +     NG  G  D   + L        +P   P S PF
Sbjct  28    PRAAACESPTLAELLKSVSDLS----RNGAPGDEDDAPVTLDISSGGGENP---PPSVPF  80

Query  512   VLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDV------KVLLDDISGEAREGEIM  673
             VL+F NL+Y VKVRRK+ +P +L RR +AP  V  +       K +LD++SGEAR+GEIM
Sbjct  81    VLAFTNLTYRVKVRRKLALPGFLRRRGSAPDPVFGETLSPAHTKTILDEVSGEARDGEIM  140

Query  674   AVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLT  853
             AV+GASGSGKSTLIDALANR+A+ SL G   +NGE +E++L+KVISAYVMQDDLLFPMLT
Sbjct  141   AVMGASGSGKSTLIDALANRMAKGSLKGNATLNGEPIETRLMKVISAYVMQDDLLFPMLT  200

Query  854   VEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvs  1033
             VEETLMFSAEFRLPR+LS+S+KK RVQALI+QLGL+ AAKTVIGDEGHRGVSGGERRRVS
Sbjct  201   VEETLMFSAEFRLPRALSKSKKKLRVQALIDQLGLRNAAKTVIGDEGHRGVSGGERRRVS  260

Query  1034  igiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDR  1213
             IG DIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIA+SGS+VIMS+HQPSYRIL LLD+
Sbjct  261   IGTDIIHDPILLFLDEPTSGLDSTSAFMVVKVLQRIARSGSVVIMSIHQPSYRILGLLDQ  320

Query  1214  LIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFN  1393
             +IFLS+G+TV+SG PS+LP FF +FG+PIP+ +NR EFALD IR+LE SP G K++ +FN
Sbjct  321   MIFLSRGKTVYSGPPSNLPVFFSDFGHPIPDTDNRTEFALDLIRQLEGSPGGIKSMAEFN  380

Query  1394  KSWQ--RKFSPSST--SNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPS--V  1555
             KSWQ  +K + S+T  ++  N       SLK+AISASISRGKLVSG T   +  SP+  V
Sbjct  381   KSWQSLKKGNLSNTLCASETNTSTTTNLSLKEAISASISRGKLVSGTTATKNNSSPTAMV  440

Query  1556  PKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQER  1735
             P +ANP WVE+ V+ +RS  NS RMPELF +R  AV+VTG ILATIFW+LDDSPKGIQER
Sbjct  441   PSYANPPWVELAVLSRRSFTNSWRMPELFGVRVAAVMVTGFILATIFWRLDDSPKGIQER  500

Query  1736  LGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflsl  1915
             LGFFAFAMSTTFYTCA+A+PVFLQERYIFMRETAYNAYRRSSY+L+H++ SLP+L  LSL
Sbjct  501   LGFFAFAMSTTFYTCADALPVFLQERYIFMRETAYNAYRRSSYLLAHALTSLPTLLLLSL  560

Query  1916  afaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAY  2095
             AFA  T+WAVGL G F  +   +   F   WAGSSFVTFLSG++ +VM+ Y +VVAI+AY
Sbjct  561   AFAAATFWAVGLDGSFLFYFLIIFASF---WAGSSFVTFLSGVVPHVMLGYIIVVAIIAY  617

Query  2096  FVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKA  2275
             F+LFSGFFINRDRIP YWIWFHY SLVKYP++ VLQNEF+   KCFV+G+QIFDG+PL A
Sbjct  618   FLLFSGFFINRDRIPAYWIWFHYISLVKYPYEAVLQNEFENGAKCFVRGVQIFDGTPLAA  677

Query  2276  VPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrl  2455
             VPEAMK+ LL +MS TLG++ITSS+C+TTG DIL+Q GVTD++KWNCLW+T+A GFFFR 
Sbjct  678   VPEAMKVNLLASMSGTLGVDITSSSCVTTGADILRQQGVTDLSKWNCLWVTVAWGFFFRF  737

Query  2456  lfyfallIGSKNKRR  2500
             LFY A++IGSKNKRR
Sbjct  738   LFYLAVVIGSKNKRR  752



>ref|XP_010068855.1| PREDICTED: ABC transporter G family member 6-like [Eucalyptus 
grandis]
 gb|KCW65324.1| hypothetical protein EUGRSUZ_G02776 [Eucalyptus grandis]
Length=731

 Score =   842 bits (2174),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/727 (70%), Positives = 601/727 (83%), Gaps = 23/727 (3%)
 Frame = +2

Query  368   SVSMTLGELLHRVGDSA-GEKLNNGVGGANDHRVLQ--LYDPVPYPSSFPFVLSFHNLSY  538
             S +++  +LL RVGD+  G   + G    + H  L   L D    P S PFVL F+NL+Y
Sbjct  12    SPTLSSAQLLKRVGDACKGATGDGGETPMHHHHALDVDLSDASLEPRSLPFVLQFNNLNY  71

Query  539   SVKVRRKMGVPAWLGRRTAAPSQ--VENDV---------KVLLDDISGEAREGEIMAVLG  685
             SVKV RK+ + + L  R +  S   VE  V         KVLL+DISGEAR+GEI+AVLG
Sbjct  72    SVKVHRKVALSSLLPWRRSCLSSAAVEEPVAGESLFTRTKVLLNDISGEARDGEILAVLG  131

Query  686   ASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEET  865
             ASGSGKSTL+DALANRIA+ SL G+V +NGE LES+LLKVISAYVMQDDLLFPMLTVEET
Sbjct  132   ASGSGKSTLVDALANRIAKGSLKGSVTLNGEPLESRLLKVISAYVMQDDLLFPMLTVEET  191

Query  866   LMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiD  1045
             LMF+AEFRLPR+LS+S+K+ RVQALI+QLGLQ AAKTVIGDEGHRGVSGGERRRVSIGID
Sbjct  192   LMFAAEFRLPRTLSKSKKRMRVQALIDQLGLQNAAKTVIGDEGHRGVSGGERRRVSIGID  251

Query  1046  IIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFL  1225
             IIHDPI+LFLDEPTSGLDSTSA+MVVKVLQRIAQ GSIV+M+VHQPSYRIL LLDRL+FL
Sbjct  252   IIHDPIILFLDEPTSGLDSTSAYMVVKVLQRIAQRGSIVVMTVHQPSYRILGLLDRLLFL  311

Query  1226  SKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQ  1405
             S+GQTV+SGSP+SLP FF EFG+PIPENENR EFALD IRELE SP GT++LV+FNKSWQ
Sbjct  312   SRGQTVYSGSPTSLPLFFSEFGHPIPENENRTEFALDLIRELEGSPGGTRSLVEFNKSWQ  371

Query  1406  --RKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFW  1579
               ++ + +S  +RN +      SLK+AI  SISRGKL+SGATN  S  S  VP FANPFW
Sbjct  372   SRKQDARNSEPDRNGL------SLKEAIGVSISRGKLLSGATNDPSPAS-MVPTFANPFW  424

Query  1580  VEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAM  1759
             +EM ++ KRS  NS RMPELF +R GAV+VTG ILAT+FW+LD+SPKG+QERLGF AFAM
Sbjct  425   IEMAILSKRSTTNSRRMPELFGIRLGAVLVTGFILATMFWQLDNSPKGVQERLGFIAFAM  484

Query  1760  STTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYW  1939
             STTFYTCA+A+PVFLQERYIFMRETA+NAYRR SYVLSHS+ +LP+L  L+LAF+  T++
Sbjct  485   STTFYTCADALPVFLQERYIFMRETAHNAYRRWSYVLSHSLTALPALVILALAFSAMTFF  544

Query  1940  AvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFF  2119
              VGL GG SGFLF+ L +FASFWAGSSFVTFLSG+I +VM+ YT+VVAILAYF+LFSGFF
Sbjct  545   PVGLDGGLSGFLFYFLIIFASFWAGSSFVTFLSGVIPHVMLGYTIVVAILAYFLLFSGFF  604

Query  2120  INRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLK  2299
             INRDRIPPYWIWFHY SLVKYP++GVL+NEF  P KCFVKG+QIFD  PL AVP+A+KLK
Sbjct  605   INRDRIPPYWIWFHYLSLVKYPYEGVLRNEFQDPAKCFVKGVQIFDNMPLGAVPDALKLK  664

Query  2300  LLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallI  2479
             LL  +S TLG  IT+STCLTTG  IL+Q GVTD++KW+CLW+T+A GF FR+LFYF+LL+
Sbjct  665   LLSTISSTLGRKITASTCLTTGTGILQQQGVTDLSKWSCLWVTVAWGFLFRILFYFSLLL  724

Query  2480  GSKNKRR  2500
             GSKNKRR
Sbjct  725   GSKNKRR  731



>ref|XP_002308489.2| ABC transporter family protein [Populus trichocarpa]
 gb|EEE92012.2| ABC transporter family protein [Populus trichocarpa]
Length=717

 Score =   840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/726 (69%), Positives = 598/726 (82%), Gaps = 12/726 (2%)
 Frame = +2

Query  332   MELQELTRR-PRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQL-YDPVPYPSSF  505
             ME+Q+L R   + S+S TL E+   V DS  + +++       H+VL+L +     P S 
Sbjct  1     MEVQKLPRTISKPSLSPTLAEIQKGVHDSQSDMISD-YSTPVHHQVLELGHACSSIPPSN  59

Query  506   PFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLG  685
             PFVLSF NL+YSVKV +KM +P   G+ ++  S  E   K+LL+DIS  AREGEI AVLG
Sbjct  60    PFVLSFDNLTYSVKVGQKMSLPI-CGKDSSLDSS-ETGKKILLNDISEAAREGEITAVLG  117

Query  686   ASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEET  865
             ASGSGKSTLIDALA+RIA+ESL G+V +NGEVLES+LLK ISAYVMQDDLLFPMLTVEET
Sbjct  118   ASGSGKSTLIDALADRIAKESLKGSVTLNGEVLESRLLKTISAYVMQDDLLFPMLTVEET  177

Query  866   LMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiD  1045
             LMFSAEFRLPRSLS+S+KKARVQALI+QLGL+ AA TVIGDEGHRGVSGGERRRVSIGID
Sbjct  178   LMFSAEFRLPRSLSKSKKKARVQALIDQLGLRNAANTVIGDEGHRGVSGGERRRVSIGID  237

Query  1046  IIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFL  1225
             I+HDPI+LFLDEPTSGLDSTSA MVVKVLQRIAQSGSIVIMS+HQPSYR+L LLDRLIFL
Sbjct  238   IVHDPILLFLDEPTSGLDSTSALMVVKVLQRIAQSGSIVIMSIHQPSYRLLTLLDRLIFL  297

Query  1226  SKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQ  1405
             S GQTV++GSP SLP FF EFG+PIPENENR EFALD+IR+LE+ P GTK LV FNKSWQ
Sbjct  298   SHGQTVYAGSPGSLPEFFAEFGHPIPENENRTEFALDYIRDLEEIPGGTKTLVKFNKSWQ  357

Query  1406  RKFSPSSTSNRNNVFPNP-KPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWV  1582
                   +  N  N F N  K SLKD IS SISRGKLVSGA N +++ S  V  FANP WV
Sbjct  358   ------AMKNAKNRFSNASKLSLKDTISVSISRGKLVSGAPNDSNSTSSPVLSFANPLWV  411

Query  1583  EMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMS  1762
             E++VIGKRS +N+ RMPELF +R  AV+VTGIILAT+++ LD+SP+G+QERLGFFAFA+S
Sbjct  412   EVMVIGKRSSLNAKRMPELFGIRLAAVLVTGIILATVYYHLDNSPRGVQERLGFFAFAIS  471

Query  1763  TTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWA  1942
             TT+YT AE+IP F+QERYIFMRETAYNAYRRSSYVL+HS+IS+PSL  LS+AFA TT+WA
Sbjct  472   TTYYTSAESIPAFIQERYIFMRETAYNAYRRSSYVLAHSLISIPSLIVLSIAFATTTFWA  531

Query  1943  vglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFI  2122
             VGL GGFSGF F+   +F +FWAGSSFVTFLSG++ +VM+++TLVVAIL+YF LFSGF+I
Sbjct  532   VGLDGGFSGFCFYFFTIFCAFWAGSSFVTFLSGVVSHVMLSFTLVVAILSYFPLFSGFYI  591

Query  2123  NRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKL  2302
             +RDRIPP+W+WFHY SLVKYP++  LQNEF  P KCFV G+Q+FD +PL  +P +MKLK+
Sbjct  592   SRDRIPPFWLWFHYMSLVKYPYEAALQNEFHSPTKCFVMGVQMFDNTPLAVMPLSMKLKM  651

Query  2303  LQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIG  2482
             L+ +S  LG NITS+TC  TG DIL+Q G+T ++KWNCLWITIA GFFFR+LFYFALL+ 
Sbjct  652   LKTISTRLGRNITSNTCAVTGTDILQQQGITQLSKWNCLWITIAWGFFFRILFYFALLLW  711

Query  2483  SKNKRR  2500
             SKNKRR
Sbjct  712   SKNKRR  717



>ref|XP_009787941.1| PREDICTED: ABC transporter G family member 20-like [Nicotiana 
sylvestris]
Length=688

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/693 (72%), Positives = 574/693 (83%), Gaps = 14/693 (2%)
 Frame = +2

Query  434   NGVGGANDHRVLQL---YDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPS  604
             N    ++  +VL+L    + +P P+SFPFVLSFHNLSYSVKVRR M +P  L R      
Sbjct  6     NSNCNSDAEQVLELGHDLNILPNPTSFPFVLSFHNLSYSVKVRRYMVLPKCLRR-----D  60

Query  605   QVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVL  784
             +     KVLL+DISGEAR+GEIMAVLGASGSGKSTLIDALAN I +ESL G+V +NGEVL
Sbjct  61    EDMTRTKVLLNDISGEARKGEIMAVLGASGSGKSTLIDALANHIKKESLKGSVTLNGEVL  120

Query  785   ESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQT  964
             ESK LK+ISAYVMQDDLLFPMLTVEETLMFSAEF LP +LS SRKK RV+AL++QL LQ 
Sbjct  121   ESKFLKMISAYVMQDDLLFPMLTVEETLMFSAEFHLPTTLSWSRKKERVRALLDQLDLQN  180

Query  965   AAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIA  1144
             AA T+IGDEGHRGVSGGERRRVSIGI IIHDPI+LFLDEPTSGLDST A+ VVKVLQ+IA
Sbjct  181   AANTMIGDEGHRGVSGGERRRVSIGIGIIHDPILLFLDEPTSGLDSTCAYTVVKVLQKIA  240

Query  1145  QSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCE  1324
             QSGSIVIMS+HQPS+RIL LLD LIFLS GQ VFSGSP++LP++F E G+PIP + N+ E
Sbjct  241   QSGSIVIMSIHQPSHRILCLLDHLIFLSCGQIVFSGSPANLPQYFAELGSPIPRDANQTE  300

Query  1325  FALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRG  1504
             FALDFI+++E +P GTKNLV+FN+SWQR+ +P+  S     F  PKPSL+DAISA +SRG
Sbjct  301   FALDFIQKVEGTPNGTKNLVEFNRSWQRE-NPTCIS----FFKGPKPSLQDAISACVSRG  355

Query  1505  KLVSGATNINSTLSP-SVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGII  1681
             KLVSGA NI   LS   V KF NPFW+EMVVI KRS++NS+RMPELF +RFG  V TGII
Sbjct  356   KLVSGAKNIGHNLSSLDVAKFVNPFWIEMVVIAKRSILNSMRMPELFYVRFGGAVATGII  415

Query  1682  LATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSS  1861
             L T+F KLD+SP+GIQER GFFAFA+ST +Y CAEA+ +F+QER IFMRETA+NAYR SS
Sbjct  416   LGTLFRKLDNSPEGIQERFGFFAFAISTIYYICAEAMLIFIQERDIFMRETAHNAYRCSS  475

Query  1862  YVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSG  2041
             YVLSH+I S+PSL  LSLAFAVTTYW+VGLA GFSGFLFFLLF+F SFW  +SF+TFLSG
Sbjct  476   YVLSHAITSIPSLLVLSLAFAVTTYWSVGLAHGFSGFLFFLLFIFVSFWTANSFITFLSG  535

Query  2042  IIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYP  2221
              IYN ++ YTLV  I   F+L SGFFI RD I PYWIWFHY SLVKYP+QGVLQNEFD P
Sbjct  536   FIYNGIVGYTLVTRIFGCFLLLSGFFIRRDEIAPYWIWFHYMSLVKYPYQGVLQNEFDDP  595

Query  2222  DKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDI  2401
              KCFVKGIQIFD SPLK V E++K++LLQ+MSK L +NIT+STCLTTG DILKQTGV D+
Sbjct  596   HKCFVKGIQIFDASPLKDVTESLKIELLQDMSKILDMNITNSTCLTTGTDILKQTGVNDL  655

Query  2402  NKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             +KW  LWITIALG F+R+LFYFALLIGSKNKRR
Sbjct  656   DKWTSLWITIALGIFYRILFYFALLIGSKNKRR  688



>ref|NP_181467.1| ABC transporter G family member 1 [Arabidopsis thaliana]
 sp|O80946.1|AB1G_ARATH RecName: Full=ABC transporter G family member 1; Short=ABC transporter 
ABCG.1; Short=AtABCG1; AltName: Full=White-brown complex 
homolog protein 1; Short=AtWBC1 [Arabidopsis thaliana]
 gb|AAC28975.1| putative ABC transporter [Arabidopsis thaliana]
 dbj|BAC42008.1| putative ABC transporter [Arabidopsis thaliana]
 gb|AEC09664.1| ABC transporter G family member 1 [Arabidopsis thaliana]
Length=740

 Score =   837 bits (2162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/722 (68%), Positives = 582/722 (81%), Gaps = 21/722 (3%)
 Frame = +2

Query  380   TLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRK  559
             TLG+LL  V D    K+  G        + Q Y+   Y  + PFVLSF NL+Y+V VR K
Sbjct  25    TLGQLLKNVSDV--RKMAIGDETPVHESLNQDYND-GYMRTVPFVLSFDNLTYNVSVRPK  81

Query  560   MGVPAWLGRRTAAPSQVEN----DVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALA  727
             +       RR     ++        K LL++ISGE R+GEIMAVLGASGSGKSTLIDALA
Sbjct  82    LDFRNLFPRRRTEDPEIAQTARPKTKTLLNNISGETRDGEIMAVLGASGSGKSTLIDALA  141

Query  728   NRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprsls  907
             NRIA+ SL GTVK+NGE L+S++LKVISAYVMQDDLLFPMLTVEETLMF+AEFRLPRSL 
Sbjct  142   NRIAKGSLKGTVKLNGETLQSRMLKVISAYVMQDDLLFPMLTVEETLMFAAEFRLPRSLP  201

Query  908   rsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPT  1087
             +S+KK RVQALI+QLG++ AAKT+IGDEGHRG+SGGERRRVSIGIDIIHDPI+LFLDEPT
Sbjct  202   KSKKKLRVQALIDQLGIRNAAKTIIGDEGHRGISGGERRRVSIGIDIIHDPILLFLDEPT  261

Query  1088  SGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSL  1267
             SGLDSTSAFMVVKVL+RIAQSGSIVIMS+HQPS+R+L LLDRLIFLS+G TV+SGSP+SL
Sbjct  262   SGLDSTSAFMVVKVLKRIAQSGSIVIMSIHQPSHRVLGLLDRLIFLSRGHTVYSGSPASL  321

Query  1268  PRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNV  1447
             PRFF EFG+PIPENENR EFALD IRELE S  GT+ L++FNK WQ        SNR   
Sbjct  322   PRFFTEFGSPIPENENRTEFALDLIRELEGSAGGTRGLIEFNKKWQEM---KKQSNRQPP  378

Query  1448  F-----PNPKPSLKDAISASISRGKLVSGATNI------NSTLSPSVPKFANPFWVEMVV  1594
                   P P  +LK+AI+ASISRGKLVSG  ++       +T + +VP FANP W+E+  
Sbjct  379   LTPPSSPYPNLTLKEAIAASISRGKLVSGGESVAHGGATTNTTTLAVPAFANPMWIEIKT  438

Query  1595  IGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFY  1774
             + KRSM+NS R PELF +R  +VV+TG ILAT+FW+LD+SPKG+QERLGFFAFAMST FY
Sbjct  439   LSKRSMLNSRRQPELFGIRIASVVITGFILATVFWRLDNSPKGVQERLGFFAFAMSTMFY  498

Query  1775  TCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvgla  1954
             TCA+A+PVFLQERYIFMRETAYNAYRRSSYVLSH+I+S PSL FLS+AFA TTYWAVGL 
Sbjct  499   TCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVSFPSLIFLSVAFAATTYWAVGLD  558

Query  1955  ggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDR  2134
             GG +G LF+ L + ASFW+GSSFVTFLSG++ +VM+ YT+VVAILAYF+LFSGFFINR+R
Sbjct  559   GGLTGLLFYCLIILASFWSGSSFVTFLSGVVPSVMLGYTIVVAILAYFLLFSGFFINRNR  618

Query  2135  IPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNM  2314
             IP YWIWFHY SLVKYP++ VLQNEF    KCFV+G+QIFD +PL  +PE MKLKLL  +
Sbjct  619   IPDYWIWFHYMSLVKYPYEAVLQNEFSDATKCFVRGVQIFDNTPLGELPEVMKLKLLGTV  678

Query  2315  SKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNK  2494
             SK+LG+ I+S+TCLTTG DIL+Q GV  ++KWNCL+IT+A GFFFR+LFYF LL+GSKNK
Sbjct  679   SKSLGVTISSTTCLTTGSDILRQQGVVQLSKWNCLFITVAFGFFFRILFYFTLLLGSKNK  738

Query  2495  RR  2500
             RR
Sbjct  739   RR  740



>ref|XP_010920754.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
6-like [Elaeis guineensis]
Length=749

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/762 (67%), Positives = 598/762 (78%), Gaps = 36/762 (5%)
 Frame = +2

Query  284   MSTASSDLPFLGPRQA--MELQELTRRP----RHSV-SMTLGELLHRVGD-SAGEKLNNG  439
             MS     LPF   R    ME  E   R     RHS  + TLG+LL+RVGD  AG+   + 
Sbjct  1     MSRFVDKLPFFDRRSTSPMEEAEDIGRSGLLVRHSHPTATLGQLLNRVGDVRAGDSAES-  59

Query  440   VGGANDHRVLQL-------YDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWL--GRRT  592
                +  H VL+L        D    P+   FVLSF +L+YSVK  +K+    +    R +
Sbjct  60    ---SPAHHVLELGGMGGPPADGNLCPTPLHFVLSFTDLTYSVKNPKKLSFFPFFRKNRLS  116

Query  593   AAPSQVEND------VKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLG  754
               P     D       K LLD ISGEAREGEI+AVLGASGSGKSTLIDALANRIARESL 
Sbjct  117   TDPVTAVRDPEAFSRTKTLLDSISGEAREGEILAVLGASGSGKSTLIDALANRIARESLR  176

Query  755   GTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQ  934
             G++ +NGE LE +LLKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPR+LS ++K+ARV+
Sbjct  177   GSITLNGENLEGRLLKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPRTLSTAKKRARVE  236

Query  935   ALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAF  1114
             ALI+QLGL+ AA T+IGDEGHRGVSGGERRRVSIG+DIIHDPI+LFLDEPTSGLDSTSAF
Sbjct  237   ALIDQLGLRRAANTIIGDEGHRGVSGGERRRVSIGMDIIHDPILLFLDEPTSGLDSTSAF  296

Query  1115  MVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGN  1294
             MVVKVLQRIA SGSIVIMSVHQPSYRIL LLDRLIFLS+GQTV+SG+P  LP FF + G+
Sbjct  297   MVVKVLQRIAHSGSIVIMSVHQPSYRILGLLDRLIFLSRGQTVYSGAPDGLPSFFSDLGH  356

Query  1295  PIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLK  1474
             P+PENEN  EFALD IRELE +P G ++LV++NKS Q        + + ++   P  SLK
Sbjct  357   PMPENENPTEFALDLIRELESTPAGCRSLVEYNKSRQ--------ATKPSLTEKPSLSLK  408

Query  1475  DAISASISRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRF  1654
             DAISASISRGKLVSGAT   S  S SVP FANPFW+EM V+ KRS  N+ R PELF +R 
Sbjct  409   DAISASISRGKLVSGATEGTSPAS-SVPTFANPFWIEMAVLTKRSATNTRRTPELFGIRL  467

Query  1655  GAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRET  1834
             GAV++TG ILATIFW+LD+SPKG QERLGFFA AMST FYTCA+A+PVFLQERYIFMRET
Sbjct  468   GAVLLTGFILATIFWRLDNSPKGAQERLGFFAIAMSTMFYTCADALPVFLQERYIFMRET  527

Query  1835  AYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAG  2014
             AYNAYRRSSYVLS++I+  PSL  LS+AFA+TT++AVGLAGG SGF FF L + ASFWAG
Sbjct  528   AYNAYRRSSYVLSNAIVGFPSLVVLSIAFALTTFFAVGLAGGASGFFFFFLIILASFWAG  587

Query  2015  SSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQG  2194
             S FVTFLSG+I +VM+ YT+VVAILAYF+LFSGFFINRDRIP YWIWFHY SLVKYP++ 
Sbjct  588   SGFVTFLSGVISHVMVGYTVVVAILAYFLLFSGFFINRDRIPDYWIWFHYLSLVKYPYEA  647

Query  2195  VLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDI  2374
             VLQNEFD   KCFV+G+Q+FD +PL ++P A+KL +L+ MS TLG++IT +TC+TTG DI
Sbjct  648   VLQNEFDDTTKCFVRGVQMFDNTPLGSLPTAVKLNVLKAMSNTLGVSITGNTCITTGSDI  707

Query  2375  LKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             LKQ G+TD++KWNCLW+T+A GFFFR+LFYF LL+GSKNKRR
Sbjct  708   LKQQGITDLSKWNCLWVTVAWGFFFRVLFYFTLLVGSKNKRR  749



>ref|XP_006361394.1| PREDICTED: ABC transporter G family member 1-like [Solanum tuberosum]
Length=721

 Score =   833 bits (2153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/719 (68%), Positives = 583/719 (81%), Gaps = 25/719 (3%)
 Frame = +2

Query  362   RHSVSMTL---GELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFPFVLSFHNL  532
             R +V M+L    +LL+ +GD  G++    V     H+VL +       +S PF+LSF NL
Sbjct  22    RQTVEMSLPTFAQLLNNMGDVTGDETETPV-----HQVLTMQPQ----NSIPFLLSFSNL  72

Query  533   SYSVKVRRKMGVPA-WLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGASGSGKST  709
             +YSV+VRRK+  PA + GR   AP       KVLL DISGEAR+GE++AVLGASGSGKST
Sbjct  73    TYSVRVRRKVAFPAIYGGRAEEAPV---TRTKVLLHDISGEARDGELLAVLGASGSGKST  129

Query  710   LIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFr  889
             LIDALANRIA+ESL G VK+NGE L +KLLKVISAYVMQDDLL+PMLTVEETLMFSA+FR
Sbjct  130   LIDALANRIAKESLKGEVKLNGEKLHTKLLKVISAYVMQDDLLYPMLTVEETLMFSAQFR  189

Query  890   lprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVL  1069
             LPR+LS+S+KK RVQALI+QLGL+ AAKT+IGDEGHRGVSGGERRRVSIGIDIIHDPI+L
Sbjct  190   LPRTLSKSKKKGRVQALIDQLGLRNAAKTIIGDEGHRGVSGGERRRVSIGIDIIHDPIIL  249

Query  1070  FLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFS  1249
             FLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMS+HQPS RIL LLDRLIFLS GQTV+S
Sbjct  250   FLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSNRILGLLDRLIFLSHGQTVYS  309

Query  1250  GSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSST  1429
              SP +LP+FF +FG+PIPENENR EFALD IRELE SP+GT NLV+FN+ W+        
Sbjct  310   DSPLNLPQFFADFGHPIPENENRTEFALDLIRELEDSPDGTNNLVEFNRKWK-------N  362

Query  1430  SNRNNVFPNPKP--SLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGK  1603
             +NRN+     +   SLK+AISASISRGKLVSGATN  +  +  VP FANP W E+ V+ K
Sbjct  363   TNRNSATTPARYDLSLKEAISASISRGKLVSGATNNAANPTVMVPTFANPIWTEIAVLSK  422

Query  1604  RSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCA  1783
             RS  NS RMPE+F +RF AV+VTG ILATIFW+LD+SPKGI ERLGF AFA+STT+Y C 
Sbjct  423   RSFTNSWRMPEIFFVRFSAVMVTGFILATIFWRLDNSPKGIWERLGFIAFAVSTTYYICT  482

Query  1784  EAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggf  1963
             EA+PVF+QERYIFMRETAYNAYRRSSY +SH+++SLP L FLSL F   T+WAVGL GG 
Sbjct  483   EALPVFIQERYIFMRETAYNAYRRSSYCISHALVSLPGLIFLSLLFVALTFWAVGLDGGA  542

Query  1964  sgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPP  2143
             SGFLF+     AS WAG+SFVTFLSG++ +VMI Y +VVA+L YF+LFSGF++NRDRIP 
Sbjct  543   SGFLFYFCVFLASIWAGNSFVTFLSGVVPHVMIGYIIVVALLGYFLLFSGFYMNRDRIPS  602

Query  2144  YWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKT  2323
             YWIWFHY SLVKYP++ VL NEF  P KCFV+G+Q+FD S L  +P ++K KLL+N+S+T
Sbjct  603   YWIWFHYLSLVKYPYEAVLLNEFKDPTKCFVRGVQLFDNSQLGDLPNSIKEKLLENISET  662

Query  2324  LGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             L + ITSSTCLT+G DIL Q G+T +NKWNCLW+TIA GFFFR+LFYF+LL+GSKNKRR
Sbjct  663   LNVTITSSTCLTSGADILVQQGITQLNKWNCLWVTIAWGFFFRILFYFSLLLGSKNKRR  721



>ref|XP_004497331.1| PREDICTED: ABC transporter G family member 1-like [Cicer arietinum]
Length=757

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/746 (67%), Positives = 592/746 (79%), Gaps = 32/746 (4%)
 Frame = +2

Query  332   MELQELTRRPRHSVSM-TLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFP  508
             ME+ + TRR R +V M TLG+LL  VGD   E + +G      H    L        S P
Sbjct  19    MEMNDFTRR-RDAVEMPTLGQLLKNVGDVRKEVIGDGSETPGHH---SLDVSGMETRSLP  74

Query  509   FVLSFHNLSYSVKVRRKMGVPAWLGRRTAAP--------SQVENDVKVLLDDISGEAREG  664
             FVLSF+NL+YSVKVR+KM       RR  +P          V    K+LL+DISGEAR+G
Sbjct  75    FVLSFNNLTYSVKVRQKMTFADICTRRRRSPVDEPPAVGETVFARTKILLNDISGEARDG  134

Query  665   EIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFP  844
             EIMA LGASGSGKSTLIDALANRIA+  L G V +NGE +ES+L+KVISAYVMQDDLLFP
Sbjct  135   EIMAFLGASGSGKSTLIDALANRIAKGKLKGKVTLNGESVESRLMKVISAYVMQDDLLFP  194

Query  845   MLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerr  1024
             MLTVEETL F+AEFRLPRSLS+S+KKARVQALI+QLGL+ AAKTVIGDEGHRGVSGGERR
Sbjct  195   MLTVEETLTFAAEFRLPRSLSKSKKKARVQALIDQLGLRNAAKTVIGDEGHRGVSGGERR  254

Query  1025  rvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNL  1204
             RVSIGIDIIHDPIVLFLDEPTSGLDSTSAF+VVKVLQR+AQSGSIVIMS+HQPSYRIL L
Sbjct  255   RVSIGIDIIHDPIVLFLDEPTSGLDSTSAFLVVKVLQRVAQSGSIVIMSIHQPSYRILGL  314

Query  1205  LDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLV  1384
             LDR+IFLS+GQTV+SGSPS LP +F EFG+ IPE +NR EFALD IRELE SP GTK+LV
Sbjct  315   LDRMIFLSRGQTVYSGSPSQLPLYFAEFGHSIPEGDNRTEFALDVIRELEGSPGGTKSLV  374

Query  1385  DFNKSWQR--KFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPS--  1552
             +FNKSWQ   K  P  +S           SLK+AISASIS+GKLVSGA    +T + S  
Sbjct  375   EFNKSWQSMTKLHPEDSSQN----ATSSLSLKEAISASISKGKLVSGANAAATTTNNSNG  430

Query  1553  -----------VPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFW  1699
                        VP +AN FW+E+  + KRS+ NS RMPELF +R GAV VTG ILAT+FW
Sbjct  431   NATSSTTTSSMVPTYANSFWIELATLSKRSLTNSKRMPELFGIRLGAVFVTGFILATVFW  490

Query  1700  KLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHs  1879
              LDD+PKG+QERLGFFAFAMSTTFYT A+A+PVF+QER+IFMRET++NAYR SSY++SH+
Sbjct  491   HLDDTPKGVQERLGFFAFAMSTTFYTTADALPVFIQERFIFMRETSHNAYRISSYLVSHA  550

Query  1880  iislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVM  2059
             I++LP+L  LS  FA  T+WAVGL GGF GF+F+   +FASFWAG+SFV+FLSG++ +VM
Sbjct  551   IVALPALVVLSFVFAAMTFWAVGLDGGFKGFMFYFFIMFASFWAGNSFVSFLSGVVPHVM  610

Query  2060  IAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVK  2239
             + YT+VVAILAYF+LFSGFFINR+RIP YWIWF+Y SL+KYP++ VLQNEF  P KCFV+
Sbjct  611   LGYTIVVAILAYFLLFSGFFINRNRIPKYWIWFNYMSLIKYPYEAVLQNEFSDPMKCFVR  670

Query  2240  GIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCL  2419
             G+QIFD +PL ++P A+KLKLL +MS TLG+ IT STCLTTG D+L QTGVTD++KWNCL
Sbjct  671   GVQIFDSTPLSSIPNALKLKLLGDMSNTLGVKITGSTCLTTGVDVLIQTGVTDLSKWNCL  730

Query  2420  WITIAlgfffrllfyfallIGSKNKR  2497
             W+T+A GFFFR+LFYF+LL+GSKNKR
Sbjct  731   WVTLAWGFFFRILFYFSLLVGSKNKR  756



>ref|XP_006843658.1| hypothetical protein AMTR_s00007p00181450 [Amborella trichopoda]
 gb|ERN05333.1| hypothetical protein AMTR_s00007p00181450 [Amborella trichopoda]
Length=743

 Score =   832 bits (2150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/719 (69%), Positives = 581/719 (81%), Gaps = 23/719 (3%)
 Frame = +2

Query  374   SMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFPFVLSFHNLSYSVKVR  553
             S TLGELL  VGD+ G++         D R L+  D      + PF+LSF+NLSYSVKVR
Sbjct  38    SPTLGELLKHVGDTRGDQ-------EADPRALEFTDLSLNQRALPFILSFNNLSYSVKVR  90

Query  554   RKMGVPAWL-GRR---TAAPSQVEN--DVKVLLDDISGEAREGEIMAVLGASGSGKSTLI  715
             RK+       G++    A P  +    + K LL+DISGEAR+GEI+AVLGASGSGKSTLI
Sbjct  91    RKITFSGLFSGKKDIEAAGPEGLNKFTETKTLLNDISGEARDGEILAVLGASGSGKSTLI  150

Query  716   DALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlp  895
             DALANRIAR SL G++ +NGE LE +LLKVISAYVMQDDLLFPMLTVEETLMFSAEFRLP
Sbjct  151   DALANRIARGSLKGSITLNGERLEERLLKVISAYVMQDDLLFPMLTVEETLMFSAEFRLP  210

Query  896   rslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFL  1075
             R+LS+S+K+ARVQALI+QLGL+ AAKT+IGDEGHRGVSGGERRRVSIGIDI+HDPI+LFL
Sbjct  211   RTLSKSKKRARVQALIDQLGLRAAAKTIIGDEGHRGVSGGERRRVSIGIDIVHDPILLFL  270

Query  1076  DEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGS  1255
             DEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRIL LLDRLIFLS+GQTV+SG 
Sbjct  271   DEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILGLLDRLIFLSRGQTVYSGP  330

Query  1256  PSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSN  1435
             P  LP FF EFG+ +PE+ENR EFALD IRELE +P G K LV+FNK WQ+ + P ++  
Sbjct  331   PLKLPDFFSEFGHAMPESENRTEFALDLIRELEGTPGGIKALVEFNKQWQKAYPPQASPT  390

Query  1436  RNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVP----KFANPFWVEMVVIGK  1603
             R  +      SLKDAISASISRGKLVSG    +S+   S       FANPFW EM V+ +
Sbjct  391   RQGL------SLKDAISASISRGKLVSGKPETDSSSMSSSSSAMATFANPFWTEMWVLTR  444

Query  1604  RSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCA  1783
             RS +N  R PELF +R GAVVVTG ILATIFWKLD SPKG+QERLGFFAFAMSTTFYTCA
Sbjct  445   RSALNIRRTPELFLIRLGAVVVTGFILATIFWKLDHSPKGVQERLGFFAFAMSTTFYTCA  504

Query  1784  EAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggf  1963
             +A+PVFLQERYIFMRETAYNAYRRSSYVLS+S++++P+L  LS AFA +T+WAVGL GG 
Sbjct  505   DALPVFLQERYIFMRETAYNAYRRSSYVLSNSVVAVPALVLLSGAFAASTFWAVGLGGGT  564

Query  1964  sgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPP  2143
             SGF FF L +FASFWAGSSFVTFLSG++ +VM+ YT+VVAILAYF+LFSGFFINRDRIP 
Sbjct  565   SGFFFFFLIIFASFWAGSSFVTFLSGVVSHVMLGYTVVVAILAYFLLFSGFFINRDRIPA  624

Query  2144  YWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKT  2323
             YWIWFHY SLVKYP++ VLQNEF+ P  CF +G Q+FD +PL A+  AMK   L+ +S +
Sbjct  625   YWIWFHYLSLVKYPYEAVLQNEFNDPTICFSRGTQVFDNTPLGAMTPAMKTMFLRLLSGS  684

Query  2324  LGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             +G N+T STC+T+G DIL++ G+T + KW CLW+TIA GFFFR+LFYF+LL+GSKNKRR
Sbjct  685   IGRNVTESTCVTSGVDILREQGITQLGKWECLWVTIAWGFFFRILFYFSLLLGSKNKRR  743



>ref|XP_006295608.1| hypothetical protein CARUB_v10024720mg [Capsella rubella]
 gb|EOA28506.1| hypothetical protein CARUB_v10024720mg [Capsella rubella]
Length=742

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/723 (68%), Positives = 581/723 (80%), Gaps = 21/723 (3%)
 Frame = +2

Query  380   TLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRK  559
             TLG+LL  V D     + +             YD   Y  + PFVLSF NL+Y+V +RRK
Sbjct  25    TLGQLLKNVSDVRKMAIGDETPVHESLNRDDDYDG--YMRTVPFVLSFDNLTYNVSIRRK  82

Query  560   MGVPAWL--GRRTAAPS---QVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDAL  724
             +        G  T  P     V  + K LL++ISGE R+GEIMAVLGASGSGKSTLIDAL
Sbjct  83    LEFRNLFPRGSTTEDPEIAQTVRPNTKTLLNNISGETRDGEIMAVLGASGSGKSTLIDAL  142

Query  725   ANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprsl  904
             ANRIA+ SL GTVK+NGE L+S++LKVISAYVMQDDLLFPMLTVEETLMF+AEFRLPRSL
Sbjct  143   ANRIAKGSLKGTVKLNGETLQSRMLKVISAYVMQDDLLFPMLTVEETLMFAAEFRLPRSL  202

Query  905   srsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEP  1084
              +S+KK RVQALI+QLG++ AAKT+IGDEGHRG+SGGERRRVSIGIDIIHDPI+LFLDEP
Sbjct  203   PKSKKKLRVQALIDQLGIRNAAKTIIGDEGHRGISGGERRRVSIGIDIIHDPILLFLDEP  262

Query  1085  TSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSS  1264
             TSGLDSTSAFMVVKVL+RIAQSGSIVIMS+HQPS+R+L LLDRLIFLS+G TV+SGSP+S
Sbjct  263   TSGLDSTSAFMVVKVLKRIAQSGSIVIMSIHQPSHRVLGLLDRLIFLSRGHTVYSGSPAS  322

Query  1265  LPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNN  1444
             LPRFF EFG+PIPENENR EFALD IRELE S  GT+ LV+FNK WQ        SNR  
Sbjct  323   LPRFFSEFGSPIPENENRTEFALDLIRELEVSAGGTRGLVEFNKKWQEM---KKQSNRQP  379

Query  1445  VF-----PNPKPSLKDAISASISRGKLVSGATNIN------STLSPSVPKFANPFWVEMV  1591
                    P P  +LK+AI+ASISRGKLVSG  ++       ++ + +VP+FANP W+E+ 
Sbjct  380   PLTPPSSPYPNLTLKEAIAASISRGKLVSGGESVANGGTTATSTTLAVPEFANPMWMEIK  439

Query  1592  VIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTF  1771
              + KRSM+NS R PELF +R  +VV+TG ILAT+FW+LD+SPKG+QERLGFFAFAMST F
Sbjct  440   TLSKRSMLNSRRQPELFGIRVASVVITGFILATVFWRLDNSPKGVQERLGFFAFAMSTMF  499

Query  1772  YTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvgl  1951
             YTCA+A+PVFLQERYIFMRETAYNAYRRSSYVLSH+I+S+PSL FLSLAFA TTYWAVGL
Sbjct  500   YTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVSIPSLIFLSLAFAATTYWAVGL  559

Query  1952  aggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRD  2131
              GG  G LF+ L + A+FW+GSSFVTFLSG++ +VM+ Y +VVAILAYF+LFSGFFINR+
Sbjct  560   DGGPMGLLFYCLIILAAFWSGSSFVTFLSGVVPSVMLGYIIVVAILAYFLLFSGFFINRN  619

Query  2132  RIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQN  2311
             RIP YWIWFHY SLVKYP++ VLQNEF    KCFV+G+QIFD +PL  +PE MKLKLL +
Sbjct  620   RIPDYWIWFHYLSLVKYPYEAVLQNEFSDATKCFVRGVQIFDNTPLGELPEVMKLKLLGS  679

Query  2312  MSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKN  2491
             +SK+LG+ I+SSTCLTTG DILK  G+  ++KWNCL+IT+A GFFFR+LFYF LL+GSKN
Sbjct  680   VSKSLGVTISSSTCLTTGADILKNQGIVQLSKWNCLFITVAFGFFFRILFYFTLLLGSKN  739

Query  2492  KRR  2500
             KRR
Sbjct  740   KRR  742



>ref|XP_010517272.1| PREDICTED: ABC transporter G family member 1-like [Camelina sativa]
Length=741

 Score =   830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/723 (68%), Positives = 582/723 (80%), Gaps = 22/723 (3%)
 Frame = +2

Query  380   TLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRK  559
             TLG+LL  V D    K++ G          Q YD   Y  + PFVLSF NL+YSV VRRK
Sbjct  25    TLGQLLKNVSDV--RKMDIGDETPVHESFNQDYDD-GYMRTVPFVLSFDNLTYSVSVRRK  81

Query  560   MGVPAWLGRRTAAPSQVENDV----KVLLDDISGEAREGEIMAVLGASGSGKSTLIDALA  727
             +       R      ++   V    K LL++ISGE R+GEIMAVLGASGSGKSTLIDALA
Sbjct  82    LEFRNLFPRGNTEDPEIAQTVMPNTKTLLNNISGETRDGEIMAVLGASGSGKSTLIDALA  141

Query  728   NRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprsls  907
             NRIA+ SL GTVK+NGE L+S++LKVISAYVMQDDLLFPMLTVEETLMF+AEFRLPRSL 
Sbjct  142   NRIAKGSLKGTVKLNGETLQSRMLKVISAYVMQDDLLFPMLTVEETLMFAAEFRLPRSLP  201

Query  908   rsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPT  1087
             +S+KK RVQALI+QLG++ AAKT+IGDEGHRG+SGGERRRVSIGIDIIHDPI+LFLDEPT
Sbjct  202   KSKKKLRVQALIDQLGIRNAAKTIIGDEGHRGISGGERRRVSIGIDIIHDPILLFLDEPT  261

Query  1088  SGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSL  1267
             SGLDSTSAFMVVKVL+RIAQSGSIVIMS+HQPS+R+L+LLDRLIFLS+G TV+SGSP+SL
Sbjct  262   SGLDSTSAFMVVKVLKRIAQSGSIVIMSIHQPSHRVLSLLDRLIFLSRGHTVYSGSPASL  321

Query  1268  PRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNV  1447
             PRFF EFG+PIPENENR EFALD IRELE S  GT+ LV+FNK WQ        +NR   
Sbjct  322   PRFFSEFGSPIPENENRTEFALDLIRELEGSAGGTRGLVEFNKKWQEM---KKQNNRQPP  378

Query  1448  F-----PNPKPSLKDAISASISRGKLVSGATNINS-------TLSPSVPKFANPFWVEMV  1591
                   P P  +LK+AI+ASISRGKLVSG  ++ +       T + +VP+FANP W+E+ 
Sbjct  379   LTPPSSPYPNLTLKEAIAASISRGKLVSGGESVANGGTTATSTTTLAVPEFANPMWIEIK  438

Query  1592  VIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTF  1771
              + KRSM+NS R PELF +R  +VV+TG ILAT+FW+LD+SPKG+QERLGFFAFAMST F
Sbjct  439   TLSKRSMLNSRRQPELFGIRVASVVITGFILATVFWRLDNSPKGVQERLGFFAFAMSTMF  498

Query  1772  YTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvgl  1951
             YTCA+A+PVFLQERYIFMRETAYNAYRRSSYVLSH+I+S+PSL FLSLAFA TTYWAVGL
Sbjct  499   YTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVSIPSLIFLSLAFAATTYWAVGL  558

Query  1952  aggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRD  2131
              GG  G LF+ L + ASFW+GSSFVTFLSG++ +VM+ Y +VVAILAYF+LFSGFFINR+
Sbjct  559   GGGPMGLLFYCLIILASFWSGSSFVTFLSGVVPSVMLGYIIVVAILAYFLLFSGFFINRN  618

Query  2132  RIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQN  2311
             RIP YWIWFHY SLVKYP++ VLQNEF    KCFV+G+QIFD +PL  +PE MKL LL +
Sbjct  619   RIPDYWIWFHYLSLVKYPYEAVLQNEFSDATKCFVRGVQIFDNTPLGELPEVMKLNLLGS  678

Query  2312  MSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKN  2491
             +SK+LG+ I+S+TCLTTG DILK  GV  ++KWNCL +T+A GFFFR+LFYF LL+GSKN
Sbjct  679   VSKSLGVTISSTTCLTTGADILKNQGVVQLSKWNCLLVTVAFGFFFRILFYFTLLLGSKN  738

Query  2492  KRR  2500
             KRR
Sbjct  739   KRR  741



>ref|XP_006411161.1| hypothetical protein EUTSA_v10016300mg [Eutrema salsugineum]
 gb|ESQ52614.1| hypothetical protein EUTSA_v10016300mg [Eutrema salsugineum]
Length=746

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/683 (70%), Positives = 563/683 (82%), Gaps = 19/683 (3%)
 Frame = +2

Query  500   SFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVEN----DVKVLLDDISGEAREGE  667
             + PFVLSF NL+Y+V + RK+     + RR     ++      + K LLD+ISGE R+GE
Sbjct  67    TVPFVLSFDNLTYNVSISRKLEFRNLIPRRKTEDPEIAQTGRPNTKTLLDNISGETRDGE  126

Query  668   IMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPM  847
             IMAVLGASGSGKSTLIDALANRIA+ SL G VK+NGE L+S++LKVISAYVMQDDLLFPM
Sbjct  127   IMAVLGASGSGKSTLIDALANRIAKGSLKGKVKLNGETLQSRMLKVISAYVMQDDLLFPM  186

Query  848   LTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrr  1027
             LTVEETLMF+A+FRLPRSL +S+KK RVQALI+QLG++ AAKT+IGDEGHRG+SGGERRR
Sbjct  187   LTVEETLMFAADFRLPRSLPKSKKKLRVQALIDQLGIRNAAKTIIGDEGHRGISGGERRR  246

Query  1028  vsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLL  1207
             VSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVL+RIAQSGSIVIMS+HQPS+R+L LL
Sbjct  247   VSIGIDIIHDPILLFLDEPTSGLDSTSAFMVVKVLKRIAQSGSIVIMSIHQPSHRVLGLL  306

Query  1208  DRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVD  1387
             DRLIFLS+G TV+SGSP+SLPRFF EFGNPIPENENR EFALD IRELE S  GT+ LV+
Sbjct  307   DRLIFLSRGHTVYSGSPASLPRFFAEFGNPIPENENRTEFALDLIRELEGSAGGTRGLVE  366

Query  1388  FNKSWQRKFSPSSTSNRNNVF-----PNPKPSLKDAISASISRGKLVSGATNI-------  1531
             FNK WQ         NR         P P  +LK+AISASISRGKLVSG  +        
Sbjct  367   FNKKWQEM---KKQKNRQPPLTPPASPYPNLTLKEAISASISRGKLVSGGESAAIPHGGG  423

Query  1532  NSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDD  1711
             N+T + +VP FANP W+E+  + KRSM+NS R PELF +R  +VV+TG ILAT+FW+LD+
Sbjct  424   NTTTTLAVPAFANPIWIEIKTLSKRSMLNSQRQPELFGIRLASVVITGFILATVFWRLDN  483

Query  1712  SPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiisl  1891
             SPKG+QERLGFFAFAMST FYTCAEA+PVFLQERYIFMRETAYNAYRRSSYVLSH+I+S 
Sbjct  484   SPKGVQERLGFFAFAMSTMFYTCAEALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVSF  543

Query  1892  pslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYT  2071
             PSL FLS+AFA TT+WAVGL GG  G LF+ L + ASFW+GSSFVTFLSG++ +VM+ YT
Sbjct  544   PSLIFLSIAFAATTFWAVGLDGGPMGLLFYCLIILASFWSGSSFVTFLSGVVPHVMLGYT  603

Query  2072  LVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQI  2251
             +VVAILAYF+LFSGFFINR+RIP YWIWFHY SLVKYP++ VLQNEF    KCFV+G+QI
Sbjct  604   IVVAILAYFLLFSGFFINRNRIPDYWIWFHYLSLVKYPYEAVLQNEFSDATKCFVRGVQI  663

Query  2252  FDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITI  2431
             FD +PL  +PE MKL+LL  +S++LG  I+SSTCLTTG DIL Q GVT ++KWNCL +T+
Sbjct  664   FDNTPLGELPEGMKLRLLDTVSRSLGTTISSSTCLTTGADILTQQGVTQLSKWNCLLVTV  723

Query  2432  AlgfffrllfyfallIGSKNKRR  2500
             A GFFFR+LFYF LL+GSKNKRR
Sbjct  724   AFGFFFRVLFYFCLLLGSKNKRR  746



>ref|XP_010509030.1| PREDICTED: ABC transporter G family member 1 [Camelina sativa]
Length=741

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/723 (68%), Positives = 584/723 (81%), Gaps = 22/723 (3%)
 Frame = +2

Query  380   TLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRK  559
             TLG+LL  V D    K++ G        + Q YD   Y  + PFVLSF NL+Y+V VRRK
Sbjct  25    TLGQLLKNVSDV--RKMDIGDETPVHESLNQDYDD-GYMRTVPFVLSFDNLTYNVSVRRK  81

Query  560   MGVPAWLGRRTAAPSQVENDV----KVLLDDISGEAREGEIMAVLGASGSGKSTLIDALA  727
             +       R      ++   V    K LL++ISGE+R+GEIMAVLGASGSGKSTLIDALA
Sbjct  82    LEFRNLFPRGNTEDPEIAQTVMPNTKTLLNNISGESRDGEIMAVLGASGSGKSTLIDALA  141

Query  728   NRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprsls  907
             NRIA+ SL GTVK+NGE L+S++LKVISAYVMQDDLLFPMLTVEETLMF+AEFRLPRSL 
Sbjct  142   NRIAKGSLKGTVKLNGETLQSRMLKVISAYVMQDDLLFPMLTVEETLMFAAEFRLPRSLP  201

Query  908   rsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPT  1087
             +S+KK RVQALI+QLG++ AAKT+IGDEGHRG+SGGERRRVSIGIDIIHDPI+LFLDEPT
Sbjct  202   KSKKKLRVQALIDQLGIRNAAKTIIGDEGHRGISGGERRRVSIGIDIIHDPILLFLDEPT  261

Query  1088  SGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSL  1267
             SGLDSTSAFMVVKVL+RIAQSGSIVIMS+HQPS+R+L+LLDRLIFLS+G TV+SGSP+SL
Sbjct  262   SGLDSTSAFMVVKVLKRIAQSGSIVIMSIHQPSHRVLSLLDRLIFLSRGHTVYSGSPASL  321

Query  1268  PRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNV  1447
              RFF EFG+PIPENENR EFALD IRELE S  GT+ LV+FNK WQ        +NR   
Sbjct  322   ARFFSEFGSPIPENENRTEFALDLIRELEVSAGGTRGLVEFNKKWQEM---KKQNNRQPP  378

Query  1448  F-----PNPKPSLKDAISASISRGKLVSGATNINS-------TLSPSVPKFANPFWVEMV  1591
                   P P  +LK+AI+ASISRGKLVSG  ++ +       T + +VP+FANP W+E+ 
Sbjct  379   LTPPSSPYPNLTLKEAIAASISRGKLVSGGESVANGGATATSTTTLAVPEFANPMWIEIK  438

Query  1592  VIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTF  1771
              + KRSM+NS R PELF +R  +VV+TG ILAT+FW+LD+SPKG+QERLGFFAFAMST F
Sbjct  439   TLSKRSMLNSRRQPELFGIRVASVVITGFILATVFWRLDNSPKGVQERLGFFAFAMSTMF  498

Query  1772  YTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvgl  1951
             YTCA+A+PVFLQERYIFMRETAYNAYRRSSYVLSH+I+S+PSL FLSLAFA TTYWAVGL
Sbjct  499   YTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVSIPSLIFLSLAFAATTYWAVGL  558

Query  1952  aggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRD  2131
              GG  G LF+ L + ASFW+GSSFVTFLSG++ +VM+ Y +VVAILAYF+LFSGFFINR+
Sbjct  559   GGGPMGLLFYCLIILASFWSGSSFVTFLSGVVPSVMLGYIIVVAILAYFLLFSGFFINRN  618

Query  2132  RIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQN  2311
             RIP YWIWFHY SLVKYP++ VLQNEF    KCFV+G+QIFD +PL  +PE MKL LL +
Sbjct  619   RIPDYWIWFHYLSLVKYPYEAVLQNEFSDATKCFVRGVQIFDNTPLGELPEVMKLNLLGS  678

Query  2312  MSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKN  2491
             +SK+LG+ I+S+TCLTTG DILK  GV  ++KWNCL++T+A GFFFR+LFYF LL+GSKN
Sbjct  679   VSKSLGVTISSTTCLTTGADILKNQGVVQLSKWNCLFVTVAFGFFFRILFYFTLLLGSKN  738

Query  2492  KRR  2500
             KRR
Sbjct  739   KRR  741



>ref|XP_010505600.1| PREDICTED: ABC transporter G family member 1-like [Camelina sativa]
Length=741

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/723 (68%), Positives = 583/723 (81%), Gaps = 22/723 (3%)
 Frame = +2

Query  380   TLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRK  559
             TLG+LL  V D    K++ G        + Q YD   Y  + PFVLSF NL+Y+V VRRK
Sbjct  25    TLGQLLKNVSDV--RKMDIGDETPVHESLNQDYDD-GYMRTVPFVLSFDNLTYNVSVRRK  81

Query  560   MGVPAWLGRRTAAPSQVENDV----KVLLDDISGEAREGEIMAVLGASGSGKSTLIDALA  727
             +       R      ++   V    K LL++ISGE+R+GEIMAVLGASGSGKSTLIDALA
Sbjct  82    LEFRNLFPRGNTEDPEIAQTVMPNTKTLLNNISGESRDGEIMAVLGASGSGKSTLIDALA  141

Query  728   NRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprsls  907
             NRIA+ SL GTVK+NGE L+S++LKVISAYVMQDDLLFPMLTVEETL+F+AEFRLPRSL 
Sbjct  142   NRIAKGSLKGTVKLNGETLQSRMLKVISAYVMQDDLLFPMLTVEETLIFAAEFRLPRSLP  201

Query  908   rsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPT  1087
             +S+KK RVQALI+QLG++ AAKT+IGDEGHRG+SGGERRRVSIGIDIIHDPI+LFLDEPT
Sbjct  202   KSKKKLRVQALIDQLGIRNAAKTIIGDEGHRGISGGERRRVSIGIDIIHDPILLFLDEPT  261

Query  1088  SGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSL  1267
             SGLDSTSAFMVVKVL+RIAQSGSIVIMS+HQPS+R+L+LLDRLIFLS+G TV+SGSP+SL
Sbjct  262   SGLDSTSAFMVVKVLKRIAQSGSIVIMSIHQPSHRVLSLLDRLIFLSRGHTVYSGSPASL  321

Query  1268  PRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNV  1447
             PRFF EFG+PIPENENR EFALD I ELE S  GT+ LV+FNK WQ        +NR   
Sbjct  322   PRFFSEFGSPIPENENRTEFALDLICELEGSAGGTRGLVEFNKKWQEM---KKQNNRQPP  378

Query  1448  F-----PNPKPSLKDAISASISRGKLVSGATNINS-------TLSPSVPKFANPFWVEMV  1591
                   P P  +LK+AI+ASISRGKLVSG  ++ +       T + +VP+FANP W+E+ 
Sbjct  379   LTPPSSPYPNLTLKEAIAASISRGKLVSGGESVANGGTTATSTTTLAVPEFANPMWIEIK  438

Query  1592  VIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTF  1771
              + KRSM+NS R PELF +R  +VV+TG ILAT+FW+LD+SPKG+QERLGFFAFAMST F
Sbjct  439   TLSKRSMLNSRRQPELFGIRVASVVITGFILATVFWRLDNSPKGVQERLGFFAFAMSTMF  498

Query  1772  YTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvgl  1951
             YTCA+A+PVFLQERYIFMRETAYNAYRRSSYVLSH+I+S+PSL FLSLAFA TTYWAVGL
Sbjct  499   YTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVSIPSLIFLSLAFAATTYWAVGL  558

Query  1952  aggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRD  2131
              GG  G LF+ L + ASFW+GSSFVTFLSG++ +VM+ Y +VVAILAYF+LFSGFFINR+
Sbjct  559   GGGPMGLLFYCLIILASFWSGSSFVTFLSGVVPSVMLGYIIVVAILAYFLLFSGFFINRN  618

Query  2132  RIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQN  2311
             RIP YWIWFHY SLVKYP++ VLQNEF    KCFV+G+QIFD +PL  +PE MKL LL +
Sbjct  619   RIPDYWIWFHYLSLVKYPYEAVLQNEFSDATKCFVRGVQIFDNTPLGELPEVMKLNLLGS  678

Query  2312  MSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKN  2491
             +SK+LG+ I+S+TCLTTG DILK  GV  ++KWNCL +T+A GFFFR+LFYF LL+GSKN
Sbjct  679   VSKSLGVTISSTTCLTTGADILKNQGVVQLSKWNCLLVTVAFGFFFRILFYFTLLLGSKN  738

Query  2492  KRR  2500
             KRR
Sbjct  739   KRR  741



>ref|XP_010427257.1| PREDICTED: ABC transporter G family member 16-like [Camelina 
sativa]
Length=738

 Score =   824 bits (2129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/731 (67%), Positives = 588/731 (80%), Gaps = 33/731 (5%)
 Frame = +2

Query  368   SVSMTLGELLHRVGD----SAGEKL----------NNGVGGANDHRVLQLYDPVPYPSSF  505
             S S+TLG+LL  V D      G++           ++ + G +DH  ++   PVP     
Sbjct  21    SSSLTLGQLLKNVSDVRKVQVGDETPVHEFFDRDGSSSLDGEDDHHHMR---PVP-----  72

Query  506   PFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLG  685
              FVLSF+NL+Y+V VRRK+     +  R ++ S+     K LLD+ISGE R+GEI+AVLG
Sbjct  73    -FVLSFNNLTYNVSVRRKLEFHDLVPWRRSSFSKT----KTLLDNISGETRDGEILAVLG  127

Query  686   ASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEET  865
             ASGSGKSTLIDALANRIA+ SL GTV +NGE L+S++LKVISAYVMQDDLLFPMLTVEET
Sbjct  128   ASGSGKSTLIDALANRIAKGSLKGTVTLNGEALQSRMLKVISAYVMQDDLLFPMLTVEET  187

Query  866   LMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiD  1045
             LMF+AEFRLPRSL +S+KK RVQALI+QLG++ AAKT+IGDEGHRG+SGGERRRVSIGID
Sbjct  188   LMFAAEFRLPRSLPKSKKKLRVQALIDQLGIRNAAKTIIGDEGHRGISGGERRRVSIGID  247

Query  1046  IIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFL  1225
             IIHDPIVLFLDEPTSGLDSTSAFMVVKVL+RIA+SGSIVIMS+HQPS+R+L+LLDRLIFL
Sbjct  248   IIHDPIVLFLDEPTSGLDSTSAFMVVKVLKRIAESGSIVIMSIHQPSHRVLSLLDRLIFL  307

Query  1226  SKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQ  1405
             S+G TVFSGSP+SLP FF  FGNPIPENEN+ EF LD IRELE S  GT+ LV+FNK WQ
Sbjct  308   SRGHTVFSGSPASLPSFFAGFGNPIPENENQTEFTLDLIRELEGSAGGTRALVEFNKKWQ  367

Query  1406  R-KFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSP-----SVPKFA  1567
               K   +S +  +   PNP  +LK+AISASISRGKLVSG+    S ++      +VP FA
Sbjct  368   EMKKQSNSQTLTSPASPNPNLTLKEAISASISRGKLVSGSGAGTSAVNHGGGTLAVPSFA  427

Query  1568  NPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFF  1747
             NPFW+E+  + +RS++NS R PEL  MR   V VTG ILAT+FW+LD+SPKG+QERLGFF
Sbjct  428   NPFWIEIKTLTQRSILNSRRQPELIGMRLATVTVTGFILATVFWRLDNSPKGVQERLGFF  487

Query  1748  AFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaV  1927
             AFAMST FYTCA+A+PVFLQERYIFMRETAYNAYRRSSYVLSH+I++ PSL FLS+AFA 
Sbjct  488   AFAMSTMFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVTFPSLIFLSVAFAA  547

Query  1928  TTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLF  2107
             TT+WAVGL GG  GFLF+ L + ASFW+GSSFVTFLSG++ +VM+ YT+VVAILAYF+LF
Sbjct  548   TTFWAVGLEGGLMGFLFYCLIILASFWSGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLF  607

Query  2108  SGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEA  2287
             SGFFINRDRIP YWIWF+Y SLVKYP++ VLQNEF  P +CFV+G+QIFD +PL  +   
Sbjct  608   SGFFINRDRIPQYWIWFNYLSLVKYPYEAVLQNEFSDPTECFVRGVQIFDNTPLGELAYG  667

Query  2288  MKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyf  2467
             MKL+LL ++S+++G+ I+SSTCLTTG DILKQ GVT ++KWNCL IT+  GF FR+LFY 
Sbjct  668   MKLRLLDSVSRSIGMRISSSTCLTTGADILKQQGVTQLSKWNCLLITVGFGFLFRVLFYL  727

Query  2468  allIGSKNKRR  2500
              LL+GSKNKRR
Sbjct  728   CLLLGSKNKRR  738



>emb|CAB82704.1| ABC transporter-like protein [Arabidopsis thaliana]
Length=720

 Score =   823 bits (2127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/736 (67%), Positives = 593/736 (81%), Gaps = 45/736 (6%)
 Frame = +2

Query  368   SVSMTLGELLHRVGD----SAGEKL---------NNGVGGANDHRVLQLYDPVPYPSSFP  508
             S S+TLG+LL  V D      G++           + + G NDH    L  PVP      
Sbjct  5     SSSLTLGQLLKNVSDVRKVEVGDETPVHEFFDRDGSSLDGDNDH----LMRPVP------  54

Query  509   FVLSFHNLSYSVKVRRKMG----VPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMA  676
             FVLSF+NL+Y+V VRRK+     VP W  RRT+      +  K LLD+ISGE R+GEI+A
Sbjct  55    FVLSFNNLTYNVSVRRKLDFHDLVP-W--RRTSF-----SKTKTLLDNISGETRDGEILA  106

Query  677   VLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTV  856
             VLGASGSGKSTLIDALANRIA+ SL GTV +NGE L+S++LKVISAYVMQDDLLFPMLTV
Sbjct  107   VLGASGSGKSTLIDALANRIAKGSLKGTVTLNGEALQSRMLKVISAYVMQDDLLFPMLTV  166

Query  857   EETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsi  1036
             EETLMF+AEFRLPRSL +S+KK RVQALI+QLG++ AAKT+IGDEGHRG+SGGERRRVSI
Sbjct  167   EETLMFAAEFRLPRSLPKSKKKLRVQALIDQLGIRNAAKTIIGDEGHRGISGGERRRVSI  226

Query  1037  giDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRL  1216
             GIDIIHDPIVLFLDEPTSGLDSTSAFMVVKVL+RIA+SGSI+IMS+HQPS+R+L+LLDRL
Sbjct  227   GIDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLKRIAESGSIIIMSIHQPSHRVLSLLDRL  286

Query  1217  IFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNK  1396
             IFLS+G TVFSGSP+SLP FF  FGNPIPENEN+ EFALD IRELE S  GT+ LV+FNK
Sbjct  287   IFLSRGHTVFSGSPASLPSFFAGFGNPIPENENQTEFALDLIRELEGSAGGTRGLVEFNK  346

Query  1397  SWQ---RKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSP-----S  1552
              WQ   ++ +P + +   +  PNP  +LK+AISASISRGKLVSG    +S ++      +
Sbjct  347   KWQEMKKQSNPQTLTPPAS--PNPNLTLKEAISASISRGKLVSGGGGGSSVINHGGGTLA  404

Query  1553  VPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQE  1732
             VP FANPFW+E+  + +RS++NS R PEL  MR   V+VTG ILAT+FW+LD+SPKG+QE
Sbjct  405   VPAFANPFWIEIKTLTRRSILNSRRQPELLGMRLATVIVTGFILATVFWRLDNSPKGVQE  464

Query  1733  RLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslafls  1912
             RLGFFAFAMST FYTCA+A+PVFLQERYIFMRETAYNAYRRSSYVLSH+I++ PSL FLS
Sbjct  465   RLGFFAFAMSTMFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVTFPSLIFLS  524

Query  1913  lafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILA  2092
             LAFAVTT+WAVGL GG  GFLF+ L + ASFW+GSSFVTFLSG++ +VM+ YT+VVAILA
Sbjct  525   LAFAVTTFWAVGLEGGLMGFLFYCLIILASFWSGSSFVTFLSGVVPHVMLGYTIVVAILA  584

Query  2093  YFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLK  2272
             YF+LFSGFFINRDRIP YWIWFHY SLVKYP++ VLQNEF  P +CFV+G+Q+FD SPL 
Sbjct  585   YFLLFSGFFINRDRIPQYWIWFHYLSLVKYPYEAVLQNEFSDPTECFVRGVQLFDNSPLG  644

Query  2273  AVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffr  2452
              +   MKL+LL ++S+++G+ I+SSTCLTTG D+LKQ GVT ++KWNCL IT+  GF FR
Sbjct  645   ELTYGMKLRLLDSVSRSIGMRISSSTCLTTGADVLKQQGVTQLSKWNCLLITVGFGFLFR  704

Query  2453  llfyfallIGSKNKRR  2500
             +LFY  LL+GSKNKRR
Sbjct  705   ILFYLCLLLGSKNKRR  720



>ref|XP_002881649.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57908.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=740

 Score =   824 bits (2129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/719 (68%), Positives = 580/719 (81%), Gaps = 15/719 (2%)
 Frame = +2

Query  380   TLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRK  559
             TLG+LL  V D    K+  G        + Q ++   Y  + PFVLSF NL+Y+V VRRK
Sbjct  25    TLGQLLKNVSDV--RKMAIGDETPVHESLNQDFND-GYMRTVPFVLSFDNLTYNVSVRRK  81

Query  560   MGVPAWLGRRTAAPSQVENDV----KVLLDDISGEAREGEIMAVLGASGSGKSTLIDALA  727
             +       RR     ++        K LL++ISGE R+GEIMAVLGASGSGKSTLIDALA
Sbjct  82    LEFRNLFPRRRTEDPEIAQTARPKSKTLLNNISGETRDGEIMAVLGASGSGKSTLIDALA  141

Query  728   NRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprsls  907
             NRIA+ SL GTVK+NGE L S++LKVISAYVMQDDLLFPMLTVEETLMF+AEFRLPRSL 
Sbjct  142   NRIAKGSLKGTVKLNGETLHSRMLKVISAYVMQDDLLFPMLTVEETLMFAAEFRLPRSLP  201

Query  908   rsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPT  1087
             +S+KK RVQALI+QLG++ AAKT+IGDEGHRG+SGGERRRVSIGIDIIHDPI+LFLDEPT
Sbjct  202   KSKKKLRVQALIDQLGIRNAAKTIIGDEGHRGISGGERRRVSIGIDIIHDPILLFLDEPT  261

Query  1088  SGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSL  1267
             SGLDSTSAFMVVKVL+RIAQSGSIVIMS+HQPS+R+L LLDRLIFLS+G TV+SGSP+SL
Sbjct  262   SGLDSTSAFMVVKVLKRIAQSGSIVIMSIHQPSHRVLGLLDRLIFLSRGHTVYSGSPASL  321

Query  1268  PRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQ--RKFSPSSTSNRN  1441
             PRFF EFG+PIPENENR EFALD IRELE S  GT+ LV+FNK WQ  +K +        
Sbjct  322   PRFFTEFGSPIPENENRTEFALDLIRELEGSAGGTRGLVEFNKKWQEMKKQNNRQPPLTP  381

Query  1442  NVFPNPKPSLKDAISASISRGKLVSGATNI------NSTLSPSVPKFANPFWVEMVVIGK  1603
                P P  +LK+AI+ASISRGKLVSG  ++       +T + +VP FANP W+E+  + K
Sbjct  382   PPSPYPNLTLKEAIAASISRGKLVSGGESVAHGGTTTNTTTLAVPAFANPMWIEIKTLSK  441

Query  1604  RSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCA  1783
             RSM+NS R PE+F +R  +VV+TG ILAT+FW+LD+SPKG+QERLGFFAFAMST FYTCA
Sbjct  442   RSMLNSRRQPEIFGIRIASVVITGFILATVFWRLDNSPKGVQERLGFFAFAMSTMFYTCA  501

Query  1784  EAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggf  1963
             +A+PVFLQERYIFMRETAYNAYRRSSYVLSH+I+S PSL FLS+AFA TTYWAVGL GG 
Sbjct  502   DALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVSFPSLIFLSVAFAATTYWAVGLDGGP  561

Query  1964  sgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPP  2143
              G LF+ L + ASFW+GSSFVTFLSG++ +VM+ YT+VVAILAYF+LFSGFFINR+RIP 
Sbjct  562   MGLLFYCLIILASFWSGSSFVTFLSGVVPSVMLGYTIVVAILAYFLLFSGFFINRNRIPD  621

Query  2144  YWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKT  2323
             YWIWFHY SLVKYP++ VLQNEF    KCFV+G+QIFD +PL  +PE MKL+LL  +SK+
Sbjct  622   YWIWFHYMSLVKYPYEAVLQNEFSDATKCFVRGVQIFDNTPLGELPEVMKLRLLGTVSKS  681

Query  2324  LGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             LG+ I+SSTCLTTG DIL + GV  ++KWNCL+IT+A GFFFR+LFYF LL+GSKNKRR
Sbjct  682   LGVTISSSTCLTTGSDILTKQGVVQLSKWNCLFITVAFGFFFRILFYFTLLLGSKNKRR  740



>gb|EYU33173.1| hypothetical protein MIMGU_mgv1a018654mg [Erythranthe guttata]
Length=718

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/724 (67%), Positives = 576/724 (80%), Gaps = 33/724 (5%)
 Frame = +2

Query  380   TLGELLHRVGD-----SAGEK-----LNNGVGGANDHRVLQLYDPVPYPSSFPFVLSFHN  529
             TL ELL  V D     S G+      L+   GG N             P S PFVL+F N
Sbjct  11    TLAELLKSVSDLSRNESRGDDDAPVTLDISGGGVNP------------PPSVPFVLAFTN  58

Query  530   LSYSVKVRRKMGVPAWLGRRTAAPSQV--ENDVKVLLDDISGEAREGEIMAVLGASGSGK  703
             L+Y VKVRRK+ +P +L RR A   +       K +LD+++GEAR+GEIMAV+GASGSGK
Sbjct  59    LTYRVKVRRKVALPGFLRRRYAQEPRTLSPQHTKTILDEVTGEARDGEIMAVMGASGSGK  118

Query  704   STLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAE  883
             STLIDALANR+A+ SL G   +NGE +ES+L+KVISAYVMQDDLLFPMLTVEETLMF+AE
Sbjct  119   STLIDALANRMAKGSLKGNATLNGEAIESRLMKVISAYVMQDDLLFPMLTVEETLMFAAE  178

Query  884   FrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPI  1063
             FRLPR+LS+S+KK RVQALI+QLGL+ AAKTVIGDEGHRGVSGGERRRVSIG DIIHDPI
Sbjct  179   FRLPRALSKSKKKLRVQALIDQLGLRNAAKTVIGDEGHRGVSGGERRRVSIGTDIIHDPI  238

Query  1064  VLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTV  1243
             +LFLDEPTSGLDSTSAFMVVKVLQRIA+SGS+VIMS+HQPSYRIL LLD++IFLS+G+TV
Sbjct  239   LLFLDEPTSGLDSTSAFMVVKVLQRIARSGSVVIMSIHQPSYRILGLLDQMIFLSRGKTV  298

Query  1244  FSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQ--RKFS  1417
             +SG PS+LP FF +FG+PIP+ +NR EFALD IR+LE SP G K++ +FNKSWQ  +K +
Sbjct  299   YSGPPSNLPVFFSDFGHPIPDTDNRTEFALDLIRQLEGSPGGIKSMAEFNKSWQSLKKGN  358

Query  1418  PSST--SNRNNVFPNPKPSLKDAISASISRGKLVSGATNI-NSTLSPSVPKFANPFWVEM  1588
              S+T  ++ NN       SLK+AISASISRGKLV GAT   NS+ +  VP +ANP WVE+
Sbjct  359   LSNTLCASENNT-TTTNLSLKEAISASISRGKLVFGATATSNSSPTAVVPSYANPPWVEL  417

Query  1589  VVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTT  1768
              V+ +RS  NS RMPELF +R  AV+VTG ILATIFW+LDDSPKGIQERLGFFAFAMSTT
Sbjct  418   AVLSRRSFTNSWRMPELFVVRMAAVMVTGFILATIFWRLDDSPKGIQERLGFFAFAMSTT  477

Query  1769  FYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvg  1948
             FY CA+A+PVFLQERYIFMRETAYN YRRSSY+L+H++ SLP+L  LSLAFAV T+WAVG
Sbjct  478   FYACADALPVFLQERYIFMRETAYNTYRRSSYLLAHALTSLPALLLLSLAFAVATFWAVG  537

Query  1949  laggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINR  2128
             L G F  +   +   F   W GSSFV FLSG++  VM+ Y +V AI+AYF+LFSGFFINR
Sbjct  538   LDGSFLFYFLIIFASF---WVGSSFVAFLSGVVPYVMLGYIIVAAIIAYFLLFSGFFINR  594

Query  2129  DRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQ  2308
             DRIP YWIWFHY SLVKYP++ VLQNEF+   KCFV+G+QIFDG+PL AVPEAMK+ LL 
Sbjct  595   DRIPAYWIWFHYISLVKYPYEAVLQNEFENGAKCFVRGVQIFDGTPLAAVPEAMKVNLLA  654

Query  2309  NMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSK  2488
             +MS TLG++I SS+C+ TG DIL+Q GVTD++KWNCLW+T+  GFFFR LFY A+LIGSK
Sbjct  655   SMSGTLGVDINSSSCVMTGVDILRQQGVTDLSKWNCLWVTVGWGFFFRFLFYLAILIGSK  714

Query  2489  NKRR  2500
             NKRR
Sbjct  715   NKRR  718



>ref|XP_004236770.1| PREDICTED: ABC transporter G family member 6-like [Solanum lycopersicum]
Length=714

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/735 (67%), Positives = 583/735 (79%), Gaps = 39/735 (5%)
 Frame = +2

Query  305   LPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGAND---HRVLQL  475
             +P    RQ +E+           S T  +LL+ VGD          GG  +   HRVL +
Sbjct  16    VPLYDRRQTVEMS----------SPTFAQLLNNVGDHVA-------GGETETPVHRVLTM  58

Query  476   YDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEA  655
               P    +S PFVLSF NL+YSV VRRK   PA + R     + V    KVLL DISGEA
Sbjct  59    QPP----NSIPFVLSFSNLTYSVTVRRKNIFPA-MSRGLTEEAPVTR-TKVLLHDISGEA  112

Query  656   REGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDL  835
             R+GE++AVLGASGSGKSTLIDALANRIA+ESL G +K+NGE L +KLLKVISAYVMQDDL
Sbjct  113   RDGELLAVLGASGSGKSTLIDALANRIAKESLKGEMKLNGEKLHTKLLKVISAYVMQDDL  172

Query  836   LFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsgg  1015
             L+PMLTVEETLMFSAEFRLPR+LS+S+KK+RVQALI+QLGL+ AAKT+IGDEGHRGVSGG
Sbjct  173   LYPMLTVEETLMFSAEFRLPRTLSKSKKKSRVQALIDQLGLRNAAKTIIGDEGHRGVSGG  232

Query  1016  errrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRI  1195
             ERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMS+HQPS RI
Sbjct  233   ERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSNRI  292

Query  1196  LNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTK  1375
             L+LLDRLIFLS GQTV+S SP +LP+FF +FG+PIPENENR EFALD IREL+ +P+GT 
Sbjct  293   LSLLDRLIFLSHGQTVYSDSPFNLPQFFTDFGHPIPENENRTEFALDLIRELDGTPDGTN  352

Query  1376  NLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSV  1555
             NLV+FN+ W+   S S+TS   ++      SLK+AISASISRGKLVSGATN  S     V
Sbjct  353   NLVEFNRKWK---SCSTTSTIYDL------SLKEAISASISRGKLVSGATNPTSM----V  399

Query  1556  PKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQER  1735
             P FANP W EM V+ KRS  NS RMPE+F +RF AV+VTG IL+TIFW+LD+SPKGI ER
Sbjct  400   PTFANPIWTEMAVLSKRSFTNSWRMPEIFFVRFSAVMVTGFILSTIFWRLDNSPKGIWER  459

Query  1736  LGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflsl  1915
             LGF AFA+STT+Y CAEA+PVF+ ERYIFMRETAYNAYRRSSY LSH+++SLPSL  LSL
Sbjct  460   LGFIAFAVSTTYYICAEALPVFIHERYIFMRETAYNAYRRSSYCLSHALVSLPSLIILSL  519

Query  1916  afaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAY  2095
             +FA  T+WAVGL GG SGFLF+   V AS WAG+SFVTFLS ++ +VMI YT+VVA+L Y
Sbjct  520   SFAALTFWAVGLDGGASGFLFYFSVVLASIWAGNSFVTFLSSVVPHVMIGYTIVVALLGY  579

Query  2096  FVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKA  2275
             F+LFSGF++NRDRIP YWIWFHY SLVKYP++ VL NEF  P KCFV+G+Q+FD S L  
Sbjct  580   FLLFSGFYMNRDRIPSYWIWFHYLSLVKYPYEAVLLNEFKDPTKCFVRGVQLFDNSQLGD  639

Query  2276  VPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrl  2455
             +P ++K KLL N+S+TL + ITSSTC T+G DIL Q G+T +NKW CLW+TIA GF +R+
Sbjct  640   LPNSIKEKLLDNISETLNVTITSSTCFTSGADILVQQGITQLNKWICLWVTIAWGFSYRI  699

Query  2456  lfyfallIGSKNKRR  2500
             LFYF LL+GSKNKRR
Sbjct  700   LFYFTLLLGSKNKRR  714



>ref|XP_009143325.1| PREDICTED: ABC transporter G family member 1 [Brassica rapa]
Length=744

 Score =   823 bits (2127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/734 (67%), Positives = 580/734 (79%), Gaps = 32/734 (4%)
 Frame = +2

Query  374   SMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSF-------------PFV  514
             SM L  +      + G+ L N     +D R L + D  P   SF             PFV
Sbjct  18    SMELNSISSVSDSTLGQLLKN----VSDVRKLAIGDETPVHESFNQDNDDDNLMQTVPFV  73

Query  515   LSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDV-----KVLLDDISGEAREGEIMAV  679
             LSF NL+Y+V +R+K+     + RR     ++   V     K LL++ISGE R+GEIMAV
Sbjct  74    LSFDNLTYNVSIRQKLTFRDLIPRRKTEDPELAQTVTPPNTKTLLNNISGETRDGEIMAV  133

Query  680   LGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVE  859
             LGASGSGKSTLIDALANRIA+ SL GTVK+NGE L+S+ LKVISAYVMQDDLLFPMLTVE
Sbjct  134   LGASGSGKSTLIDALANRIAKGSLKGTVKLNGETLQSRTLKVISAYVMQDDLLFPMLTVE  193

Query  860   ETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsig  1039
             ETLMF+AEFRLPRSL +S+KK RVQALIEQLG++ AAKT+IGDEGHRG+SGGERRRVSIG
Sbjct  194   ETLMFAAEFRLPRSLPKSKKKLRVQALIEQLGIKNAAKTIIGDEGHRGISGGERRRVSIG  253

Query  1040  iDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLI  1219
             IDIIHDPI+LFLDEPTSGLDSTSA+MVVKVL+RIAQSGSIVIMS+HQPS+R+L LL+RLI
Sbjct  254   IDIIHDPILLFLDEPTSGLDSTSAYMVVKVLKRIAQSGSIVIMSIHQPSHRVLGLLNRLI  313

Query  1220  FLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKS  1399
             FLS+G TVFSGSP SLPRFF EFG+PIPENENR EFALD IRELE S  GT+ L++FNK 
Sbjct  314   FLSRGNTVFSGSPGSLPRFFAEFGSPIPENENRTEFALDLIRELEGSAGGTRGLIEFNKK  373

Query  1400  WQRKFSPSSTSNRNNVF-----PNPKPSLKDAISASISRGKLVSGATNINSTLSP--SVP  1558
             WQ        +NR         P P  +LK+AI+ASISRGKLVSG  +  +T +   +VP
Sbjct  374   WQEM---KKENNRQPPLTPPASPYPNLTLKEAIAASISRGKLVSGGESATATAATTLTVP  430

Query  1559  KFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERL  1738
              FAN  W+E+V + KRSM+NS R PELF +R  +VV+TG ILAT+FW++D+SPKG+QERL
Sbjct  431   AFANSIWIEIVTLSKRSMLNSRRQPELFGIRLASVVITGFILATVFWRIDNSPKGVQERL  490

Query  1739  GFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflsla  1918
             GFFAFAMST FYTCAEA+PVFLQERYIFMRETAYNAYRRSSYVLSH+I++ PSL FLS+A
Sbjct  491   GFFAFAMSTMFYTCAEALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVAFPSLIFLSVA  550

Query  1919  faVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYF  2098
             FA TT+WAVGL GG  GFLF+ L + ASFW+GSSFVTFLSGI+ +VM+ YT+VVAILAYF
Sbjct  551   FAATTFWAVGLDGGPMGFLFYCLIILASFWSGSSFVTFLSGIVPHVMLGYTIVVAILAYF  610

Query  2099  VLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAV  2278
             +LFSGFFINR+RIP YWIWFHY SLVKYP++ VLQNEF    KCFV+G+QIFD +PL  +
Sbjct  611   LLFSGFFINRNRIPDYWIWFHYMSLVKYPYEAVLQNEFSDATKCFVRGVQIFDNTPLGVL  670

Query  2279  PEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrll  2458
             PE MKL+LL ++S++LG  I+SSTCLTTG DIL Q GVT ++KWNCL IT+  GFFFR L
Sbjct  671   PEGMKLRLLDSVSRSLGTTISSSTCLTTGADILTQQGVTQLSKWNCLLITVGFGFFFRAL  730

Query  2459  fyfallIGSKNKRR  2500
             FYF LL+GSKNKRR
Sbjct  731   FYFCLLLGSKNKRR  744



>ref|NP_191069.2| ABC transporter G family member 16 [Arabidopsis thaliana]
 sp|Q9M2V7.2|AB16G_ARATH RecName: Full=ABC transporter G family member 16; Short=ABC transporter 
ABCG.16; Short=AtABCG16; AltName: Full=Probable white-brown 
complex homolog protein 16; Short=AtWBC16 [Arabidopsis 
thaliana]
 gb|AEE79339.1| ABC transporter G family member 16 [Arabidopsis thaliana]
Length=736

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/736 (67%), Positives = 593/736 (81%), Gaps = 45/736 (6%)
 Frame = +2

Query  368   SVSMTLGELLHRVGD----SAGEKL---------NNGVGGANDHRVLQLYDPVPYPSSFP  508
             S S+TLG+LL  V D      G++           + + G NDH    L  PVP      
Sbjct  21    SSSLTLGQLLKNVSDVRKVEVGDETPVHEFFDRDGSSLDGDNDH----LMRPVP------  70

Query  509   FVLSFHNLSYSVKVRRKMG----VPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMA  676
             FVLSF+NL+Y+V VRRK+     VP W  RRT+      +  K LLD+ISGE R+GEI+A
Sbjct  71    FVLSFNNLTYNVSVRRKLDFHDLVP-W--RRTSF-----SKTKTLLDNISGETRDGEILA  122

Query  677   VLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTV  856
             VLGASGSGKSTLIDALANRIA+ SL GTV +NGE L+S++LKVISAYVMQDDLLFPMLTV
Sbjct  123   VLGASGSGKSTLIDALANRIAKGSLKGTVTLNGEALQSRMLKVISAYVMQDDLLFPMLTV  182

Query  857   EETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsi  1036
             EETLMF+AEFRLPRSL +S+KK RVQALI+QLG++ AAKT+IGDEGHRG+SGGERRRVSI
Sbjct  183   EETLMFAAEFRLPRSLPKSKKKLRVQALIDQLGIRNAAKTIIGDEGHRGISGGERRRVSI  242

Query  1037  giDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRL  1216
             GIDIIHDPIVLFLDEPTSGLDSTSAFMVVKVL+RIA+SGSI+IMS+HQPS+R+L+LLDRL
Sbjct  243   GIDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLKRIAESGSIIIMSIHQPSHRVLSLLDRL  302

Query  1217  IFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNK  1396
             IFLS+G TVFSGSP+SLP FF  FGNPIPENEN+ EFALD IRELE S  GT+ LV+FNK
Sbjct  303   IFLSRGHTVFSGSPASLPSFFAGFGNPIPENENQTEFALDLIRELEGSAGGTRGLVEFNK  362

Query  1397  SWQ---RKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSP-----S  1552
              WQ   ++ +P + +   +  PNP  +LK+AISASISRGKLVSG    +S ++      +
Sbjct  363   KWQEMKKQSNPQTLTPPAS--PNPNLTLKEAISASISRGKLVSGGGGGSSVINHGGGTLA  420

Query  1553  VPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQE  1732
             VP FANPFW+E+  + +RS++NS R PEL  MR   V+VTG ILAT+FW+LD+SPKG+QE
Sbjct  421   VPAFANPFWIEIKTLTRRSILNSRRQPELLGMRLATVIVTGFILATVFWRLDNSPKGVQE  480

Query  1733  RLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslafls  1912
             RLGFFAFAMST FYTCA+A+PVFLQERYIFMRETAYNAYRRSSYVLSH+I++ PSL FLS
Sbjct  481   RLGFFAFAMSTMFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVTFPSLIFLS  540

Query  1913  lafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILA  2092
             LAFAVTT+WAVGL GG  GFLF+ L + ASFW+GSSFVTFLSG++ +VM+ YT+VVAILA
Sbjct  541   LAFAVTTFWAVGLEGGLMGFLFYCLIILASFWSGSSFVTFLSGVVPHVMLGYTIVVAILA  600

Query  2093  YFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLK  2272
             YF+LFSGFFINRDRIP YWIWFHY SLVKYP++ VLQNEF  P +CFV+G+Q+FD SPL 
Sbjct  601   YFLLFSGFFINRDRIPQYWIWFHYLSLVKYPYEAVLQNEFSDPTECFVRGVQLFDNSPLG  660

Query  2273  AVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffr  2452
              +   MKL+LL ++S+++G+ I+SSTCLTTG D+LKQ GVT ++KWNCL IT+  GF FR
Sbjct  661   ELTYGMKLRLLDSVSRSIGMRISSSTCLTTGADVLKQQGVTQLSKWNCLLITVGFGFLFR  720

Query  2453  llfyfallIGSKNKRR  2500
             +LFY  LL+GSKNKRR
Sbjct  721   ILFYLCLLLGSKNKRR  736



>ref|XP_008810525.1| PREDICTED: ABC transporter G family member 6-like [Phoenix dactylifera]
Length=748

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/761 (67%), Positives = 598/761 (79%), Gaps = 35/761 (5%)
 Frame = +2

Query  284   MSTASSDLPFLGPRQAM--ELQELTRRP---RHSV-SMTLGELLHRVGDSAGEKLNNGVG  445
             MS     LP+   R  +  E +++TR     RHS  S  L ELL  VG+S          
Sbjct  1     MSRFVDKLPYFDRRSPLMEEAEDITRSGLLVRHSRPSSPLCELLEPVGESTDR-------  53

Query  446   GANDHRVLQLYDPVPYPSS-------FPFVLSFHNLSYSVKVRRKMGV-PAWL-GRRTAA  598
              +  HRVL+L D    PS         PF+LSF +L+YSVK  RK+   P +L G R A 
Sbjct  54    -SPPHRVLELGDRGSPPSGGDLSPCPLPFILSFTDLTYSVKNPRKLSFFPTFLRGNRLAT  112

Query  599   PSQVEND-------VKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGG  757
                   +        K LLD ISGEAREGEI+AVLGASGSGKSTLIDALA+RIARESL G
Sbjct  113   DLVTAGEGPEAFARTKTLLDSISGEAREGEILAVLGASGSGKSTLIDALADRIARESLKG  172

Query  758   TVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQA  937
             ++ +NGE L+ +LLKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPR+LS ++K+ARVQA
Sbjct  173   SITLNGENLDGRLLKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPRTLSSAQKRARVQA  232

Query  938   LIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFM  1117
             LI+QLGL+ AA T+IGDEGHRGVSGGERRRVSIGIDI+HDPIVLFLDEPTSGLDSTSAFM
Sbjct  233   LIDQLGLRQAANTIIGDEGHRGVSGGERRRVSIGIDIVHDPIVLFLDEPTSGLDSTSAFM  292

Query  1118  VVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNP  1297
             VVKVLQRIA  GSIVIMS+HQPSYRIL LLDRL+FLS+GQTV+SG+P  LP FF +FG+P
Sbjct  293   VVKVLQRIAHGGSIVIMSIHQPSYRILGLLDRLLFLSRGQTVYSGAPDGLPSFFSDFGHP  352

Query  1298  IPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKD  1477
             IPEN N  EFALD IRELE +P G ++LV+FNKS +R   PS T+        P  SLKD
Sbjct  353   IPENGNATEFALDLIRELESTPTGARSLVEFNKS-RRAAKPSMTAAATE---KPSLSLKD  408

Query  1478  AISASISRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFG  1657
             AISASISRGKLVSGAT+     S SVP FANPFW+E+ V+ KRS  N+ RMPELF +R G
Sbjct  409   AISASISRGKLVSGATDGTGPAS-SVPTFANPFWIEIAVLTKRSATNTRRMPELFGIRLG  467

Query  1658  AVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETA  1837
             AV++TG ILATIFW+LD+SPKG+QERLGFFA AMST FYTCA+A+PVFLQERYIFMRETA
Sbjct  468   AVMMTGFILATIFWRLDNSPKGVQERLGFFAIAMSTMFYTCADALPVFLQERYIFMRETA  527

Query  1838  YNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGS  2017
             YNAYRRSSYVLS++I+S P L  LS+AFA+TT++AVGL+GG +GF FF L + ASFWAGS
Sbjct  528   YNAYRRSSYVLSNAIVSFPPLVVLSIAFALTTFFAVGLSGGATGFFFFFLIILASFWAGS  587

Query  2018  SFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGV  2197
              FVTFLSG+I +VM+ YT+VVAILAYF+LFSGFFINRDRIP YWIWFHY SLV YP++ V
Sbjct  588   GFVTFLSGVISHVMVGYTVVVAILAYFLLFSGFFINRDRIPDYWIWFHYLSLVMYPYEAV  647

Query  2198  LQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDIL  2377
             LQNEFD P KCFV+G+QIFD +P  ++P A KL +L+ MS  LG N+TS+TC+TTGPDIL
Sbjct  648   LQNEFDDPTKCFVRGVQIFDNTPAASLPTATKLNVLKAMSSALGTNLTSNTCITTGPDIL  707

Query  2378  KQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             KQ GVTDI+KWNCLW+T+A GFFFR+LFYF LL+GSKNKRR
Sbjct  708   KQQGVTDISKWNCLWVTVAWGFFFRVLFYFTLLVGSKNKRR  748



>ref|XP_002878016.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54275.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=736

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/737 (66%), Positives = 587/737 (80%), Gaps = 47/737 (6%)
 Frame = +2

Query  368   SVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSF--------------  505
             S S+TLG+LL  V               +D R +Q+ D  P    F              
Sbjct  21    SSSLTLGQLLKNV---------------SDVRKVQVGDETPVHEFFDRDSSSLDGDDDHL  65

Query  506   ----PFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIM  673
                 PFVLSF+NL+Y+V VRRK+     +  R ++ S+     K LLD+ISGE R+GEI+
Sbjct  66    MRPVPFVLSFNNLTYNVSVRRKLEFHDLVPWRRSSFSKT----KTLLDNISGETRDGEIL  121

Query  674   AVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLT  853
             AVLGASGSGKSTLIDALANRIA+ SL GTV +NGE L+S++LKVISAYVMQDDLLFPMLT
Sbjct  122   AVLGASGSGKSTLIDALANRIAKGSLKGTVTLNGEALQSRMLKVISAYVMQDDLLFPMLT  181

Query  854   VEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvs  1033
             VEETLMF+AEFRLPRSL +S+KK RVQALI+QLG++ AAKT+IGDEGHRG+SGGERRRVS
Sbjct  182   VEETLMFAAEFRLPRSLPKSKKKLRVQALIDQLGIRNAAKTIIGDEGHRGISGGERRRVS  241

Query  1034  igiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDR  1213
             IGIDIIHDPIVLFLDEPTSGLDSTSAFMVVKVL+RIA+SGSIVIMS+HQPS+R+L+LLDR
Sbjct  242   IGIDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLKRIAESGSIVIMSIHQPSHRVLSLLDR  301

Query  1214  LIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFN  1393
             LIFLS+G TVFSGSP+SLP FF  FGNPIPENEN+ EFALD IRELE S  GT+ LV+FN
Sbjct  302   LIFLSRGHTVFSGSPASLPTFFAGFGNPIPENENQTEFALDLIRELEGSAGGTRVLVEFN  361

Query  1394  KSWQ---RKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSP-----  1549
             K WQ   ++ +P + +   +  PNP  +LK+AISASISRGKLVSG    +S ++      
Sbjct  362   KKWQEMKKQSNPQTLTPPAS--PNPNLTLKEAISASISRGKLVSGGGAGSSVINHGGGTL  419

Query  1550  SVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQ  1729
             +VP FANPFW+E+  + +RS++NS R PEL  MR   V+VTG ILAT+FW+LD+SPKG+Q
Sbjct  420   AVPAFANPFWMEIKTLTQRSILNSRRQPELLGMRLATVIVTGFILATVFWRLDNSPKGVQ  479

Query  1730  ERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslafl  1909
             ERLGFFAFAMST FYTCA+A+PVFLQERYIFMRETAYNAYRRSSYVLSH+I++ PSL FL
Sbjct  480   ERLGFFAFAMSTMFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVTFPSLIFL  539

Query  1910  slafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAIL  2089
             SLAFAVTT+WAVGL GG  GFLF+ L + ASFW+GSSFVTFLSG++ +VM+ YT+VVAIL
Sbjct  540   SLAFAVTTFWAVGLEGGPMGFLFYCLIILASFWSGSSFVTFLSGVVPHVMLGYTIVVAIL  599

Query  2090  AYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPL  2269
             AYF+LFSGFFINRDRIP YWIWFHY SLVKYP++ VLQNEF  P +CFV+G+Q+FD SPL
Sbjct  600   AYFLLFSGFFINRDRIPKYWIWFHYLSLVKYPYEAVLQNEFSDPTECFVRGVQLFDNSPL  659

Query  2270  KAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfff  2449
               +   MKL+LL ++S+++G+ I+SSTCLTTG DILKQ GVT ++KWNCL IT+  GF F
Sbjct  660   GELTYGMKLRLLDSVSRSIGMRISSSTCLTTGADILKQQGVTQLSKWNCLLITVGFGFLF  719

Query  2450  rllfyfallIGSKNKRR  2500
             R+LFY  LL+GSKNKRR
Sbjct  720   RVLFYLCLLLGSKNKRR  736



>ref|XP_011091494.1| PREDICTED: ABC transporter G family member 1 [Sesamum indicum]
Length=725

 Score =   821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/675 (71%), Positives = 559/675 (83%), Gaps = 21/675 (3%)
 Frame = +2

Query  503   FPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVE---NDVKVLLDDISGEAREGEIM  673
              PF+LSF +L+YSV+V  K+G+P++  RR A P   E   +  K +L DISGEAR+GEIM
Sbjct  62    LPFLLSFSHLTYSVRVTSKVGLPSFFCRRAADPVSGETLSSGTKTILSDISGEARDGEIM  121

Query  674   AVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLT  853
             AV+GASGSGKSTLIDALANR+A+ S+ G+VK+NGE LES+LLKVISAYVMQDDLLFPMLT
Sbjct  122   AVMGASGSGKSTLIDALANRMAKGSVKGSVKLNGEELESRLLKVISAYVMQDDLLFPMLT  181

Query  854   VEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvs  1033
             VEETLMF+AEFRLPR+LS+S+KK RVQALI+QLGL+ A KTVIGDEGHRGVSGGERRRVS
Sbjct  182   VEETLMFAAEFRLPRTLSKSKKKLRVQALIDQLGLRNATKTVIGDEGHRGVSGGERRRVS  241

Query  1034  igiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDR  1213
             IGIDIIHDPI+LFLDEPTSGLDSTSA+MVVKVLQRIAQSGSIVIMS+HQPSYRI+ LLDR
Sbjct  242   IGIDIIHDPILLFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSYRIMGLLDR  301

Query  1214  LIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFN  1393
             +IFLS+G+TV+SG PS+LP FF +FG+PIP+NENR EF LD IRELE S  GTK+LV+FN
Sbjct  302   MIFLSRGKTVYSGPPSNLPLFFSDFGHPIPDNENRTEFTLDLIRELEGSSGGTKSLVEFN  361

Query  1394  KSWQRKFSPSSTSNRNNVFPNPKP-----SLKDAISASISRGKLVSGATNINSTLSPSVP  1558
             KSWQ          R N   +P       SLK+AISASISRGKLVSGA   NS+ S  +P
Sbjct  362   KSWQ-------ALERGNQINSPAANGSNLSLKEAISASISRGKLVSGAAPSNSSTS-MIP  413

Query  1559  KFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERL  1738
              F NP W E  V+ KRS  NS RMPELF +R   V+VTG ILAT+FW+LD+SPKGIQERL
Sbjct  414   TFTNPSWFEFAVLSKRSFTNSRRMPELFGVRLATVLVTGFILATMFWRLDNSPKGIQERL  473

Query  1739  GFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflsla  1918
             GFFAFAMSTTFYTCA+A+PVFLQERYIFMRETAYNAYRRSSYVLSHS++SLP+L FLSLA
Sbjct  474   GFFAFAMSTTFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHSLVSLPALLFLSLA  533

Query  1919  faVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYF  2098
             FA  T+W     G    FLF+ L + ASFWAGSSFVTFLSG++ +VM+ Y +VVAILAYF
Sbjct  534   FAAITFWP---VGLDGSFLFYFLIILASFWAGSSFVTFLSGVVPHVMLGYVIVVAILAYF  590

Query  2099  VLFSGFF--INRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLK  2272
             +LFSGFF      RIPPYWIWFHY SLVKYP++ VLQNEF  P KCFV+GIQIFDG+PL 
Sbjct  591   LLFSGFFPGAXXXRIPPYWIWFHYISLVKYPYEAVLQNEFTDPTKCFVRGIQIFDGTPLG  650

Query  2273  AVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffr  2452
             AVP+A+KLK+L++MS +LG+ ITS TC+ TG DILKQ  VTD++KW+CLW+T+A GFFFR
Sbjct  651   AVPDALKLKILESMSSSLGMKITSGTCVMTGADILKQQVVTDLSKWSCLWVTLAWGFFFR  710

Query  2453  llfyfallIGSKNKR  2497
              LFY +LLIGSKNKR
Sbjct  711   FLFYLSLLIGSKNKR  725



>ref|XP_010910345.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
1-like [Elaeis guineensis]
Length=677

 Score =   818 bits (2114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/668 (72%), Positives = 564/668 (84%), Gaps = 10/668 (1%)
 Frame = +2

Query  503   FPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVL  682
              PFVL+F NL+YSVK  +K+  P+ L R   + S   +  K+LLD ISGEAREGEI+AVL
Sbjct  18    LPFVLAFINLTYSVKTPKKLSFPS-LFRPRRSNSGAASGTKILLDSISGEAREGEILAVL  76

Query  683   GASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEE  862
             GASGSGKSTLIDALANRIA+ SL G++ ++GE LES+LLKVISAYVMQDDLLFPMLTVEE
Sbjct  77    GASGSGKSTLIDALANRIAKGSLKGSITLDGETLESRLLKVISAYVMQDDLLFPMLTVEE  136

Query  863   TLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigi  1042
             TLMF+AEFRLPRSLS ++K+ARV ALI+QLGL+ AA+T+IGDEGHRGVSGGERRRVSIG 
Sbjct  137   TLMFAAEFRLPRSLSATKKRARVHALIDQLGLRPAARTIIGDEGHRGVSGGERRRVSIGT  196

Query  1043  DIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIF  1222
             DIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRIL LLDRLIF
Sbjct  197   DIIHDPIILFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILGLLDRLIF  256

Query  1223  LSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQS-PEGTKNLVDFNKS  1399
             LS+GQTV+SG P+ LP FF EFG+PIPENENR EFALD IRELE S P G+K LVDFN+S
Sbjct  257   LSRGQTVYSGPPAGLPVFFSEFGHPIPENENRTEFALDLIRELETSGPTGSKPLVDFNRS  316

Query  1400  WQ-RKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPF  1576
             WQ  K  P   S      P  + SLKDAISASISRGKLVSGAT+ + + S SVP FANPF
Sbjct  317   WQLMKLPPGRRS------PGARLSLKDAISASISRGKLVSGATDGSGSAS-SVPIFANPF  369

Query  1577  WVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFA  1756
             W+EM V+ KRS  N+ RMPELF +R GAV+VTG ILATIFW+LD SP+G+QERLGFFAFA
Sbjct  370   WIEMGVLTKRSFTNTRRMPELFLIRLGAVMVTGFILATIFWRLDSSPRGVQERLGFFAFA  429

Query  1757  MSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTY  1936
             MST FYTCA+A+PVF+QERYIFMRETAYNAYRRSSYVLS++++  PSL  LS AFA TT+
Sbjct  430   MSTMFYTCADALPVFIQERYIFMRETAYNAYRRSSYVLSNAVVGFPSLVLLSAAFAATTF  489

Query  1937  WAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGF  2116
             +AVGL+GG SGF+FF L + ASFWAGS FVTFLSG++ +VM+ YT+VVAILAYF+LFSGF
Sbjct  490   FAVGLSGGLSGFVFFFLIILASFWAGSGFVTFLSGVVPHVMLGYTVVVAILAYFLLFSGF  549

Query  2117  FINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKL  2296
             FINR+RIP YWIWFHY SLVKYP++ VL+NEF    +CFV+G QIFD +PL  +PEAMK 
Sbjct  550   FINRERIPGYWIWFHYLSLVKYPYEAVLRNEFGMASECFVRGEQIFDNTPLGNIPEAMKQ  609

Query  2297  KLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfall  2476
             ++L  +S  LG+ ITS TC+TTG DIL+Q G+T + KW+CLW+T+A GFFFR+LFYF+LL
Sbjct  610   RVLGAISGVLGMRITSGTCVTTGDDILRQQGITQLGKWDCLWVTVAWGFFFRVLFYFSLL  669

Query  2477  IGSKNKRR  2500
             IGSKNKRR
Sbjct  670   IGSKNKRR  677



>ref|XP_006292248.1| hypothetical protein CARUB_v10018456mg [Capsella rubella]
 gb|EOA25146.1| hypothetical protein CARUB_v10018456mg [Capsella rubella]
Length=733

 Score =   820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/732 (67%), Positives = 580/732 (79%), Gaps = 30/732 (4%)
 Frame = +2

Query  359   PRHSV-----SMTLGELLHRVGDSAGEKLNNGVGGA-----NDHRVLQLYDPVPYPSSFP  508
             P HS+     S+TLG+LL  V D     L +          +D     L  PVP      
Sbjct  14    PFHSMEIISSSLTLGQLLKNVSDVRKVPLGDDTSVHEFFYRDDDDGDHLMRPVP------  67

Query  509   FVLSFHNLSYSVKVRRKMGVPAWLGRRTAAP--SQVENDVKVLLDDISGEAREGEIMAVL  682
             FVLSF+NL+Y+V VRRK+        R   P  S   +  K LLDDISGE R+GEI+AVL
Sbjct  68    FVLSFNNLTYNVSVRRKLEF------RDLVPWSSSSSSKTKTLLDDISGETRDGEILAVL  121

Query  683   GASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEE  862
             GASGSGKSTLIDALANRIA+ SL GTV +NGE L+S++LKVISAYVMQDDLLFPMLTVEE
Sbjct  122   GASGSGKSTLIDALANRIAKGSLKGTVTLNGEALQSRMLKVISAYVMQDDLLFPMLTVEE  181

Query  863   TLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigi  1042
             TLMF+AEFRLPR+L +S+KK RVQALI+QLG++ AAKT+IGDEGHRG+SGGERRRVSIGI
Sbjct  182   TLMFAAEFRLPRTLPKSKKKLRVQALIDQLGIRNAAKTIIGDEGHRGISGGERRRVSIGI  241

Query  1043  DIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIF  1222
             DIIHDPIVLFLDEPTSGLDSTSAFMVVKVL+RIA+SGSIVIMS+HQPS+R+L+LLDRLIF
Sbjct  242   DIIHDPIVLFLDEPTSGLDSTSAFMVVKVLKRIAESGSIVIMSIHQPSHRVLSLLDRLIF  301

Query  1223  LSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSW  1402
             LS+G TVFSGSP+SLP FF  FGNPIPENEN+ EF LD IRELE S  GT+ LV+FNK W
Sbjct  302   LSRGHTVFSGSPASLPSFFAGFGNPIPENENQTEFTLDLIRELEGSAGGTRGLVEFNKQW  361

Query  1403  QRKFSPSSTSNRNN-VFPNPKPSLKDAISASISRGKLVSGATNINSTLSP-----SVPKF  1564
             Q     S+         PNP  +LK+AISASISRGKLVSG    +S ++      +VP F
Sbjct  362   QEMKKQSNLQTLTPPASPNPNLTLKEAISASISRGKLVSGGGASSSAITHGGGTLAVPAF  421

Query  1565  ANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGF  1744
             ANPFW+E+  + KRS++NS R PEL  MR   VVVTG ILAT+FW LD+SPKG+QERLGF
Sbjct  422   ANPFWIEIKTLTKRSILNSRRQPELLGMRLATVVVTGFILATVFWGLDNSPKGVQERLGF  481

Query  1745  FAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafa  1924
             FAFAMST FYTCA+A+PVFLQERYIFMRETAYNAYRRSSYVLSH+I++ PSL FLSLAFA
Sbjct  482   FAFAMSTMFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVTFPSLIFLSLAFA  541

Query  1925  VTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVL  2104
             VTT+WAVGL GG  GFLF+ L + ASFW+GSSFVTFLSG++ +VM+ YT+VVAILAYF+L
Sbjct  542   VTTFWAVGLEGGLMGFLFYCLIILASFWSGSSFVTFLSGVVPHVMLGYTIVVAILAYFLL  601

Query  2105  FSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPE  2284
             FSGFFI RDRIP YWIWFHY SLVKYP++ VLQNEF  P +CFV+G+QIFD +PL  +  
Sbjct  602   FSGFFITRDRIPQYWIWFHYLSLVKYPYEAVLQNEFSDPTECFVRGVQIFDNTPLGELAY  661

Query  2285  AMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfy  2464
              MKL+LL ++S+++G++I+SSTCLTTG DILK+ GVT ++KW+CL IT+  GF FR+LFY
Sbjct  662   GMKLRLLDSVSQSIGMSISSSTCLTTGADILKKQGVTQLSKWHCLLITVGFGFLFRILFY  721

Query  2465  fallIGSKNKRR  2500
               LL+GSKNKRR
Sbjct  722   LCLLLGSKNKRR  733



>ref|XP_010684173.1| PREDICTED: ABC transporter G family member 20 [Beta vulgaris 
subsp. vulgaris]
Length=728

 Score =   820 bits (2118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/724 (69%), Positives = 590/724 (81%), Gaps = 28/724 (4%)
 Frame = +2

Query  341   QELTRRPRHSVSMTLGELLHRV---GDSAGEKLNNGVGGANDHRVLQLYDPVPYPS-SFP  508
             +E +++ + S+S TLG+LL  V    D  GE           H V++L D    P  S+P
Sbjct  29    KEYSQKTKPSISPTLGDLLRWVYNDDDPDGED-------KPPHHVVELGDATAKPVISYP  81

Query  509   FVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGA  688
             FVLSFHNL+YSVK+ +K+            PS +  D KVLL+DISGEA+EGEIMAVLGA
Sbjct  82    FVLSFHNLTYSVKINKKL------------PSGL--DHKVLLNDISGEAKEGEIMAVLGA  127

Query  689   SGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETL  868
             SGSGKSTLID LA+RI++ESL G+V +NGEVLESKLLKVISAYVMQ+DLLFPMLTVEETL
Sbjct  128   SGSGKSTLIDGLADRISKESLKGSVHLNGEVLESKLLKVISAYVMQEDLLFPMLTVEETL  187

Query  869   MFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDI  1048
             MFSAEFRLPR+LS+S+KKARV+ALI+QLGL++AA TVIGDEGHRGVSGGERRRVSIGIDI
Sbjct  188   MFSAEFRLPRALSKSKKKARVEALIDQLGLRSAANTVIGDEGHRGVSGGERRRVSIGIDI  247

Query  1049  IHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLS  1228
             IHDPI+LFLDEPTSGLDSTSAFMVV VLQRIA+SGSIVIM++HQPS RILNLLDRL+ LS
Sbjct  248   IHDPIILFLDEPTSGLDSTSAFMVVNVLQRIARSGSIVIMTIHQPSSRILNLLDRLLLLS  307

Query  1229  KGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQR  1408
             +GQTVF+G+ S LP FF EFG+ IPENENR EFALD IRELE+SP+GT+ +V+FNKSWQ+
Sbjct  308   RGQTVFNGTSSDLPMFFSEFGHSIPENENRTEFALDHIRELEESPQGTQGMVNFNKSWQQ  367

Query  1409  KFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWVEM  1588
             +    +TS  +   P  + SL DAISASIS+GKLVSG  N  S  + SVPK+ANPFW+E+
Sbjct  368   QQQRKNTSLPSRTLP--RMSLSDAISASISKGKLVSGGANDESNPT-SVPKYANPFWLEV  424

Query  1589  VVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTT  1768
              VIGKRS +NS RMPELF +R GA+VVTG ILATIFW LD SPKG +ERLGFFAFAMSTT
Sbjct  425   YVIGKRSFLNSRRMPELFGIRLGAIVVTGTILATIFWHLDQSPKGAKERLGFFAFAMSTT  484

Query  1769  FYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvg  1948
             FYTCAEAIP FLQERYIFMRETAYN YRRSSYVLS ++IS+PSL  LSL FA  T+WAVG
Sbjct  485   FYTCAEAIPTFLQERYIFMRETAYNTYRRSSYVLSQALISIPSLIILSLTFAAITFWAVG  544

Query  1949  laggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINR  2128
             LAGG  GFL++  F+ ASFWAG SFVTFLSG++ +VM+ +T+VVAILAYF+LFSGFFI R
Sbjct  545   LAGGLQGFLYYFGFILASFWAGHSFVTFLSGVVTHVMLGFTVVVAILAYFLLFSGFFITR  604

Query  2129  DRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQ  2308
             DRIP YW WFH+ SLVKYP++GVLQNEF    KCFVKG+Q+FD +PL+AVP+ +KL LL+
Sbjct  605   DRIPSYWQWFHFISLVKYPYEGVLQNEFSDHTKCFVKGVQMFDSTPLQAVPDILKLTLLK  664

Query  2309  NMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSK  2488
             NM   LG N+T S+CLTTG DIL+Q G+TD+++ +CL ITIA GF FR LFY  L+ GSK
Sbjct  665   NMGDVLGRNLTGSSCLTTGLDILQQQGITDLSRLSCLLITIAWGFLFRFLFYVTLMFGSK  724

Query  2489  NKRR  2500
             NKRR
Sbjct  725   NKRR  728



>ref|XP_006403493.1| hypothetical protein EUTSA_v10010146mg [Eutrema salsugineum]
 gb|ESQ44946.1| hypothetical protein EUTSA_v10010146mg [Eutrema salsugineum]
Length=740

 Score =   820 bits (2117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/735 (67%), Positives = 587/735 (80%), Gaps = 31/735 (4%)
 Frame = +2

Query  359   PRHSV----SMTLGELLH--------RVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSS  502
             P HS+    ++TLG+LL         +VGD    +  +  GG+       L  PVP    
Sbjct  16    PYHSMEISSTLTLGQLLKNVSDVRKLQVGDETPVREFSDRGGSVVDEDYGLMRPVP----  71

Query  503   FPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVL  682
               FVLSF+NL+Y+V VRRK      + RR  + S+     K LLDDISGE R+GEI+AVL
Sbjct  72    --FVLSFNNLTYNVSVRRKFEFRDLIPRRRLSFSKN----KTLLDDISGETRDGEILAVL  125

Query  683   GASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEE  862
             GASGSGKSTLIDALANRIA+ SL GTV +NGE L+S++LKVISAYVMQDDLLFPMLTVEE
Sbjct  126   GASGSGKSTLIDALANRIAKGSLKGTVTLNGEALQSRMLKVISAYVMQDDLLFPMLTVEE  185

Query  863   TLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigi  1042
             TLMF+AEFRLPRSL +S+KK RVQALI+QLG++ AAKT+IGDEGHRG+SGGERRRVSIGI
Sbjct  186   TLMFAAEFRLPRSLPKSKKKLRVQALIDQLGIRNAAKTIIGDEGHRGISGGERRRVSIGI  245

Query  1043  DIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIF  1222
             DIIHDPIVLFLDEPTSGLDSTSAFMVVKVL+RIA+SGSIV+MS+HQPS+R+L LLDRLIF
Sbjct  246   DIIHDPIVLFLDEPTSGLDSTSAFMVVKVLKRIAESGSIVMMSIHQPSHRVLGLLDRLIF  305

Query  1223  LSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSW  1402
             LS+G TV+SGSP+SLP FF  FGNPIPENEN+ EFALD IRELE S  GT+ LV+FNK W
Sbjct  306   LSRGHTVYSGSPASLPSFFAGFGNPIPENENQTEFALDLIRELEGSAGGTRGLVEFNKRW  365

Query  1403  Q--RKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINS-------TLSPSV  1555
             Q  +K S    +      P P  +LK+AISASISRGKLVSG    +S       T + +V
Sbjct  366   QEMKKQSNPQQTLTPPASPYPNLTLKEAISASISRGKLVSGGGAGSSAVNHGTGTTTLAV  425

Query  1556  PKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQER  1735
             P FANPFW+E+  + KRS++NS R PELF +R  +V+VTG ILAT+FW+LD+SPKG+QER
Sbjct  426   PAFANPFWIEIKTLSKRSILNSRRQPELFGIRLASVIVTGFILATVFWRLDNSPKGVQER  485

Query  1736  LGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflsl  1915
             LGFFA+AMST FYTCAEA+PVFLQERYIFMRETAYNAYRRSSYV+SHSI+SLPSL FLS+
Sbjct  486   LGFFAYAMSTMFYTCAEALPVFLQERYIFMRETAYNAYRRSSYVISHSIVSLPSLIFLSV  545

Query  1916  afaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAY  2095
             AFA TT+WAVGL GG  GFLF+ L + ASFW+GSSFVTF+SG++ +VM+ YT+VVAILAY
Sbjct  546   AFAATTFWAVGLEGGPMGFLFYCLIILASFWSGSSFVTFISGVVPHVMLGYTVVVAILAY  605

Query  2096  FVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKA  2275
             F+LFSGFFINRDRIP YWIWFHY SLVKYP++ VL NEF  P +CFV+G+QIFD +PL  
Sbjct  606   FLLFSGFFINRDRIPHYWIWFHYLSLVKYPYEAVLLNEFSDPMECFVRGVQIFDNTPLGE  665

Query  2276  VPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrl  2455
             +   MKLKLL ++S+++G+ ITSSTCLTTG DILK+ GVT+++KW+CL +T+  GF FR 
Sbjct  666   LTYGMKLKLLDSVSRSIGMRITSSTCLTTGADILKKQGVTELSKWDCLLVTVGFGFLFRA  725

Query  2456  lfyfallIGSKNKRR  2500
             LFY  LL+GSKNKRR
Sbjct  726   LFYLCLLLGSKNKRR  740



>ref|XP_008811960.1| PREDICTED: ABC transporter G family member 20-like [Phoenix dactylifera]
Length=704

 Score =   818 bits (2113),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/702 (69%), Positives = 564/702 (80%), Gaps = 29/702 (4%)
 Frame = +2

Query  419   GEKLNNGVGGANDHRVLQLYDPVPYPSS-------FPFVLSFHNLSYSVKVRRKMGVPAW  577
             GE++      +  HRVL+L D    PS         PF+LSF +L+YSVK          
Sbjct  24    GERVGESTDRSPPHRVLELGDRGSSPSGGNLRPCPLPFILSFTDLTYSVK----------  73

Query  578   LGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGG  757
                    P +  +  K LLD ISGEAREGEI+AVLGASGSGKSTLIDALANRI RESL G
Sbjct  74    ------NPRKAFSRTKTLLDSISGEAREGEILAVLGASGSGKSTLIDALANRIGRESLKG  127

Query  758   TVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQA  937
             ++ +NGE L+ +LLKVISAYVMQ+DLLFPMLTVEETLMFSAEFRLPR+LS ++K+ARVQA
Sbjct  128   SITLNGENLDGRLLKVISAYVMQEDLLFPMLTVEETLMFSAEFRLPRTLSAAQKRARVQA  187

Query  938   LIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFM  1117
             LI+QLGLQ AA T+IGDEGHRGVSGGERRRVSIGIDI+HDPIVLFLDEPTSGLDSTSAFM
Sbjct  188   LIDQLGLQQAANTIIGDEGHRGVSGGERRRVSIGIDIVHDPIVLFLDEPTSGLDSTSAFM  247

Query  1118  VVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNP  1297
             VVKVLQRIA SGSIVIMS+HQPSYRIL LLDRLIFL++GQTV+SG P  LP FF +FG+P
Sbjct  248   VVKVLQRIAHSGSIVIMSIHQPSYRILGLLDRLIFLARGQTVYSGPPDGLPSFFSDFGHP  307

Query  1298  IPEN-ENRCEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLK  1474
             IPEN +N  EFALD IRELE +P G ++LV+FNKS Q   S  + +        P  SLK
Sbjct  308   IPENGQNATEFALDLIRELESTPAGARSLVEFNKSRQAANSSIAAAAAEK----PSLSLK  363

Query  1475  DAISASISRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRF  1654
             DAISASISRGKLVSGATN     S SVP FANPFW+EM V+ KRS  N+ RMPELF +R 
Sbjct  364   DAISASISRGKLVSGATNGTGPAS-SVPTFANPFWIEMAVLTKRSATNTRRMPELFGIRL  422

Query  1655  GAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRET  1834
             GAV++TG ILATIFW+LD+SPKG+QERLGFFA AMST FYTCA+A+PVFLQERYIFMRET
Sbjct  423   GAVMLTGFILATIFWRLDNSPKGVQERLGFFAIAMSTMFYTCADALPVFLQERYIFMRET  482

Query  1835  AYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAG  2014
             AYNAYRRSSYVLS++I+  P L  LS+AFA+TT++AVGLAGG +GF FF L + ASFWAG
Sbjct  483   AYNAYRRSSYVLSNAIVGFPPLVVLSIAFALTTFFAVGLAGGAAGFFFFFLIILASFWAG  542

Query  2015  SSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQG  2194
             S FVTFLSG+I +V++ Y +V+AILAYF++FSGFFINRDRIP YWIWFHY SLV YP++ 
Sbjct  543   SGFVTFLSGVISHVIVGYIVVMAILAYFLIFSGFFINRDRIPDYWIWFHYLSLVMYPYEA  602

Query  2195  VLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDI  2374
             VLQNEFD P KCFV+G+QIFD +P  ++P A KL +L+ MS  LG N+T +TC+TTGPDI
Sbjct  603   VLQNEFDDPTKCFVRGVQIFDNTPAGSLPTATKLNVLKAMSNALGANLTGNTCITTGPDI  662

Query  2375  LKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             LKQ G+TDI+KWNCLW+T+A GFFFR LFYF LL+GSKNKRR
Sbjct  663   LKQQGITDISKWNCLWVTVAWGFFFRALFYFTLLVGSKNKRR  704



>ref|XP_010937796.1| PREDICTED: ABC transporter G family member 6-like [Elaeis guineensis]
Length=737

 Score =   819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/755 (65%), Positives = 590/755 (78%), Gaps = 34/755 (5%)
 Frame = +2

Query  284   MSTASSDLPFLGPRQ-AMELQELTRRP----RHSV-SMTLGELLHRVGDSAGEKLNNGVG  445
             MS     LPF   R  AME  E   R     RHS  S  L        DS GE  +    
Sbjct  1     MSRFVDKLPFFDQRSSAMEEAEDIARSGLLVRHSAPSANL--------DSVGESTDR---  49

Query  446   GANDHRVLQLYDPVPYPSS-FPFVLSFHNLSYSVKVRRKMGV-PAWLGRRTAAPSQVE--  613
              +  HRVL+L D   +P    PFVL+F +L+YSVK  +K+   P++  R   A   V   
Sbjct  50    -SPPHRVLELGDRGSFPGGGLPFVLTFTDLTYSVKNPKKLSFFPSFFRRNHHAADPVTAG  108

Query  614   ------NDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNG  775
                   +  K LLD ISGEAREGEI+AVLGASGSGKSTLIDALANRI RESL G++ +NG
Sbjct  109   EGPEAFSRTKTLLDSISGEAREGEILAVLGASGSGKSTLIDALANRIKRESLKGSITLNG  168

Query  776   EVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLG  955
             E L+ +LLKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPR+LS ++K+ARVQAL++QLG
Sbjct  169   EFLDGRLLKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPRTLSAAQKRARVQALMDQLG  228

Query  956   LQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQ  1135
             L+ AA T+IGDEGHRGVSGGERRRVSIG+DI+HDPIVLFLDEPTSGLDSTSAF VV VLQ
Sbjct  229   LRQAANTIIGDEGHRGVSGGERRRVSIGMDIVHDPIVLFLDEPTSGLDSTSAFKVVNVLQ  288

Query  1136  RIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENEN  1315
             RIA  GSIVIMS+HQPSYRIL LL+ LIFLS+GQTV+SG P  LP FF +FG+PIPENEN
Sbjct  289   RIAHGGSIVIMSIHQPSYRILGLLNHLIFLSRGQTVYSGPPDGLPSFFSDFGHPIPENEN  348

Query  1316  RCEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASI  1495
               EFALD IRELE +P G ++LV+FNKS +    PS T++       P  SLKDAISASI
Sbjct  349   PSEFALDLIRELESTPAGARSLVEFNKS-RPAAKPSMTADTEK----PSLSLKDAISASI  403

Query  1496  SRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTG  1675
             SRGKLVSGATN  + L+ SVP FANPFW+E+ V+ KRS  N+ RMPELF MR  AV+VTG
Sbjct  404   SRGKLVSGATN-GAGLASSVPTFANPFWIELAVLTKRSATNTRRMPELFGMRLAAVMVTG  462

Query  1676  IILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRR  1855
              ILAT++W+LDDSP+G QERLGFFAF+MST FYTCA+A+PVFLQERYIFMRETAYNAYRR
Sbjct  463   FILATVYWRLDDSPRGAQERLGFFAFSMSTMFYTCADALPVFLQERYIFMRETAYNAYRR  522

Query  1856  SSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFL  2035
             SSYVLS++I++ P L FL++AF +TT++AVGLAGG +GFLFF L + AS+WAGS FVTFL
Sbjct  523   SSYVLSNAIVAFPPLVFLAIAFTLTTFFAVGLAGGATGFLFFFLIILASYWAGSGFVTFL  582

Query  2036  SGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFD  2215
             S +I +V++ YT+VVAILAYF+LF GFFI+R+RIP YWIWFHY SLVKYP++ VLQNEFD
Sbjct  583   SSVISHVIVGYTVVVAILAYFLLFCGFFIDRNRIPDYWIWFHYLSLVKYPYEAVLQNEFD  642

Query  2216  YPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVT  2395
                +CF +G+Q+FD +P++++P A KL +L+ MSKTLG+N+T  TC+TTG DIL+Q GVT
Sbjct  643   DSTRCFERGVQMFDDTPMESLPTAKKLDVLKAMSKTLGMNLTGDTCITTGSDILRQEGVT  702

Query  2396  DINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             D++KWNC WIT+A GF FR+LFYFALL+GSKNKRR
Sbjct  703   DLSKWNCFWITVAWGFLFRVLFYFALLVGSKNKRR  737



>ref|XP_010516065.1| PREDICTED: ABC transporter G family member 16 [Camelina sativa]
Length=738

 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/733 (66%), Positives = 587/733 (80%), Gaps = 37/733 (5%)
 Frame = +2

Query  368   SVSMTLGELLH--------RVGDSA------GEKLNNGVGGANDHRVLQLYDPVPYPSSF  505
             S S+TLG+LL         +VGD            ++ + G +DH  ++   PVP     
Sbjct  21    SSSLTLGQLLKNVSNVRKVQVGDETPVHEFFDRDGSSSLDGEDDHHHMR---PVP-----  72

Query  506   PFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLG  685
              FVLSF+NL+Y+V VRRK+     +  R ++ S+     K LLD+ISGE R+GEI+AVLG
Sbjct  73    -FVLSFNNLTYNVSVRRKLEFHDLVPWRKSSFSKT----KTLLDNISGETRDGEILAVLG  127

Query  686   ASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEET  865
             ASGSGKSTLIDALANRIA+ SL GT+ +NGE L+S++LKVISAYVMQDDLLFPMLTVEET
Sbjct  128   ASGSGKSTLIDALANRIAKGSLKGTLTLNGEALQSRMLKVISAYVMQDDLLFPMLTVEET  187

Query  866   LMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiD  1045
             LMF+AEFRLPRSL +S+KK RVQALI+QLG++ AAKT+IGDEGHRG+SGGERRRVSIGID
Sbjct  188   LMFAAEFRLPRSLPKSKKKLRVQALIDQLGIRNAAKTIIGDEGHRGISGGERRRVSIGID  247

Query  1046  IIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFL  1225
             IIHDPIVLFLDEPTSGLDSTSAFMVVKVL+RIA+SGSIVIMS+HQPS+R+L+LLDRLIFL
Sbjct  248   IIHDPIVLFLDEPTSGLDSTSAFMVVKVLKRIAESGSIVIMSIHQPSHRVLSLLDRLIFL  307

Query  1226  SKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQ  1405
             S+G TVFSGSP+SLP FF  FGNPIPENEN+ EF LD IRELE S  GT+ LV+FNK WQ
Sbjct  308   SRGHTVFSGSPASLPSFFAGFGNPIPENENQTEFTLDLIRELEGSAGGTRALVEFNKKWQ  367

Query  1406  ---RKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSP-----SVPK  1561
                ++ +P + +   +  PNP  +LK+AISASISRGKLVSG    +S ++      +VP 
Sbjct  368   EMKKQSNPQTLTPPAS--PNPNLTLKEAISASISRGKLVSGGGAGSSAVNHGGGTLAVPA  425

Query  1562  FANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLG  1741
             FANPFW+E+  + +RS++NS R PEL  MR   V VTG ILAT+FW+LD+SPKG+QERLG
Sbjct  426   FANPFWIEIKTLTQRSILNSRRQPELIGMRLATVTVTGFILATVFWRLDNSPKGVQERLG  485

Query  1742  FFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslaf  1921
             FFAFAMST FYTCA+A+PVFLQERYIFMRETAYNAYRRSSYVLSH+I++ PSL FLS+AF
Sbjct  486   FFAFAMSTMFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVTFPSLIFLSVAF  545

Query  1922  aVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFV  2101
             A TT+WAVGL GG  GFLF+ L + ASFW+GSSFVTFLSG++ +VM+ YT+VVAILAYF+
Sbjct  546   AATTFWAVGLEGGLMGFLFYCLIILASFWSGSSFVTFLSGVVPHVMLGYTIVVAILAYFL  605

Query  2102  LFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVP  2281
             LFSGFFINRDRIP YWIWFHY SLVKYP++ VLQNEF  P +CFV+G+QIFD +PL  + 
Sbjct  606   LFSGFFINRDRIPQYWIWFHYLSLVKYPYEAVLQNEFSDPTECFVRGVQIFDNTPLGELA  665

Query  2282  EAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllf  2461
               MKLKLL ++S ++G+ I+ STCLTTG DILKQ GVT ++KWNCL IT+  GF FR+LF
Sbjct  666   YGMKLKLLDSVSTSIGMRISRSTCLTTGADILKQQGVTQLSKWNCLLITVGFGFLFRVLF  725

Query  2462  yfallIGSKNKRR  2500
             Y  LL+GSKNKRR
Sbjct  726   YLCLLLGSKNKRR  738



>ref|XP_002881504.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57763.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=744

 Score =   818 bits (2113),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/770 (66%), Positives = 605/770 (79%), Gaps = 48/770 (6%)
 Frame = +2

Query  248   VGAMSQASSRDDMSTASSDLP-FLGPRQAMELQELTRRPRHS--VSMTLGELLHRVGDSA  418
             +G +S A   D     ++DLP F     +ME Q   RRPR +  VS+T  E L  V D+ 
Sbjct  4     LGKLSPAKRVD----GNNDLPLFYVNTMSMEPQ---RRPRDTPRVSVTFAEHLMNVEDAR  56

Query  419   GEKLNNGVGGANDHRVLQLYDPVPYPSS---------------FPFVLSFHNLSYSVKVR  553
              ++       +   R L +  P+   +S                PFVLSF++L+YSVK++
Sbjct  57    NDE-------SASSRALGIASPITSSASSFNSWTSAPASSISSSPFVLSFNDLTYSVKIQ  109

Query  554   RKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANR  733
             +K   P    R++   S V  + K+LL+ ISGEA EGE+   +G S S         ANR
Sbjct  110   KKFN-PLACCRKSRNGSSV--NTKILLNGISGEAHEGEM---IGGSWS-------KWANR  156

Query  734   IARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrs  913
             IA++SL G++ +NGEVLES+L KVISAYVMQDDLLF MLTVEETLMFSAEFRLPRSLS+ 
Sbjct  157   IAKDSLRGSITLNGEVLESRLQKVISAYVMQDDLLFSMLTVEETLMFSAEFRLPRSLSKK  216

Query  914   rkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSG  1093
             +KKARVQALI+QLGL++AAKTVIGDEGHRGVSGGERRRVSIG DIIHDPI+LFLDEPTSG
Sbjct  217   KKKARVQALIDQLGLRSAAKTVIGDEGHRGVSGGERRRVSIGNDIIHDPIILFLDEPTSG  276

Query  1094  LDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPR  1273
             LDSTSA+MV+KVLQRIAQSGSIVIMS+HQPSYRI+ LLD+LIFLS+G TV+SGSP+ LP+
Sbjct  277   LDSTSAYMVIKVLQRIAQSGSIVIMSIHQPSYRIMGLLDQLIFLSRGNTVYSGSPTHLPQ  336

Query  1274  FFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPS-STSNRNNVF  1450
             FF EF +PIPENEN+ EFALD IRELE S EGTK LV+F+K W+ K + S S SN N   
Sbjct  337   FFSEFEHPIPENENKTEFALDLIRELENSAEGTKPLVEFHKKWRAKQAQSPSYSNGNK--  394

Query  1451  PNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRM  1630
              N   SLK+AI+ASISRGKLVSGATN +S L+PS   FANPFW+EM+VIGKR+++NS+R 
Sbjct  395   KNNNASLKEAITASISRGKLVSGATNNSSNLTPSFQTFANPFWIEMIVIGKRAILNSMRQ  454

Query  1631  PELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQE  1810
             PEL  MR GAV+VTGIILAT+F  LD+SPKG QERLGFFAFAMSTTFYTCAEAIPVFL+E
Sbjct  455   PELLGMRLGAVMVTGIILATMFTNLDNSPKGAQERLGFFAFAMSTTFYTCAEAIPVFLEE  514

Query  1811  RYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllf  1990
             RYIFMRETAYNAYRRSSYVLS SIIS+P+L FLS +FA TT+WAVGL+GG SGFLFF L 
Sbjct  515   RYIFMRETAYNAYRRSSYVLSQSIISIPALIFLSASFAATTFWAVGLSGGTSGFLFFFLT  574

Query  1991  vfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYAS  2170
             + ASFWAGSSFVTFLSG++ NVM+ +T+VVAILAYF+LFSGFFI+RDRIP YW+WFHY S
Sbjct  575   ILASFWAGSSFVTFLSGVVANVMLGFTIVVAILAYFLLFSGFFISRDRIPVYWLWFHYIS  634

Query  2171  LVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSST  2350
             LVKYP++GVLQNEF+ P KCFV+G+QIFD SPL   P  +KL LL++MS  LG N+T+ T
Sbjct  635   LVKYPYEGVLQNEFEDPTKCFVRGVQIFDNSPLGEFPNDVKLNLLKSMSGVLGTNVTAET  694

Query  2351  CLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             C+TTG DILKQ G+TD++KWNCLWIT+A GFFFR+LFYF LLIGSKNKRR
Sbjct  695   CVTTGIDILKQQGITDLSKWNCLWITVAWGFFFRVLFYFTLLIGSKNKRR  744



>ref|XP_010504353.1| PREDICTED: ABC transporter G family member 16-like [Camelina 
sativa]
Length=738

 Score =   818 bits (2112),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/733 (66%), Positives = 587/733 (80%), Gaps = 37/733 (5%)
 Frame = +2

Query  368   SVSMTLGELLHRVGD----SAGEKL----------NNGVGGANDHRVLQLYDPVPYPSSF  505
             S S+TLG+LL  V D      G++           ++ + G +DH  ++   PVP     
Sbjct  21    SSSLTLGQLLKNVSDVRKVQVGDETPAHEFFDRDGSSSLDGDDDHHHMR---PVP-----  72

Query  506   PFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLG  685
              FVLSF+NL+Y+V VRRK+     +  R ++ S+     K LLD+ISGE R+GEI+AVLG
Sbjct  73    -FVLSFNNLTYNVSVRRKLEFHDLVPWRKSSFSKT----KTLLDNISGETRDGEILAVLG  127

Query  686   ASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEET  865
             ASGSGKSTLIDALANRIA+ SL G V +NGE L+S++LKVISAYVMQDDLLFPMLTVEET
Sbjct  128   ASGSGKSTLIDALANRIAKGSLKGMVTLNGEALQSRMLKVISAYVMQDDLLFPMLTVEET  187

Query  866   LMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiD  1045
             LMF+AEFRLPRSL +S+KK RVQALI+QLG++ AA T+IGDEGHRG+SGGERRRVSIGID
Sbjct  188   LMFAAEFRLPRSLPKSKKKLRVQALIDQLGIRNAATTIIGDEGHRGISGGERRRVSIGID  247

Query  1046  IIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFL  1225
             IIHDPIVLFLDEPTSGLDSTSAFMVVKVL+RIA+SGSIVIMS+HQPS+R+L+LLDRLIFL
Sbjct  248   IIHDPIVLFLDEPTSGLDSTSAFMVVKVLKRIAESGSIVIMSIHQPSHRVLSLLDRLIFL  307

Query  1226  SKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQ  1405
             S+G TVFSGSP+SL  FF  FGNPIPENEN+ EF LD IRELE S  GT+ LV+FNK WQ
Sbjct  308   SRGHTVFSGSPASLRSFFAGFGNPIPENENQTEFTLDLIRELEGSAGGTRALVEFNKKWQ  367

Query  1406  ---RKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSP-----SVPK  1561
                R+ +P + ++  +  PNP  +LK+AISASISRGKLVSG    +S ++      +VP 
Sbjct  368   EMKRQSNPQTLTSPAS--PNPNLTLKEAISASISRGKLVSGGGAGSSAVNHGGGTLAVPA  425

Query  1562  FANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLG  1741
             FANPFW+E+  + +RS++NS R PEL  MR   V VTG ILAT+FW+LD+SPKG+QERLG
Sbjct  426   FANPFWIEIKTLTQRSILNSRRQPELIGMRLATVTVTGFILATVFWRLDNSPKGVQERLG  485

Query  1742  FFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslaf  1921
             FFAFAMST FYTCA+A+PVFLQERYIFMRETAYNAYRRSSYVLSH+I++ PSL FLS+AF
Sbjct  486   FFAFAMSTMFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVTFPSLIFLSVAF  545

Query  1922  aVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFV  2101
             A TT+WAVGL GG  GFLF+ L + ASFW+GSSFVTFLSG++ +VM+ YT+VVAILAYF+
Sbjct  546   AATTFWAVGLEGGLMGFLFYCLIILASFWSGSSFVTFLSGVVPHVMLGYTIVVAILAYFL  605

Query  2102  LFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVP  2281
             LFSGFFINRDRIP YWIWFHY SLVKYP++ VLQNEF  P +CFV+G+QIFD +PL  + 
Sbjct  606   LFSGFFINRDRIPQYWIWFHYLSLVKYPYEAVLQNEFSDPTECFVRGVQIFDNTPLGELA  665

Query  2282  EAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllf  2461
                KLKLL ++S+++G+ I+SSTCLTTG DILKQ GVT ++KWNCL IT+  GF FR+LF
Sbjct  666   YGKKLKLLDSVSRSIGMRISSSTCLTTGADILKQQGVTQLSKWNCLLITVGFGFLFRVLF  725

Query  2462  yfallIGSKNKRR  2500
             Y  LL+GSKNKRR
Sbjct  726   YLCLLLGSKNKRR  738



>ref|XP_008777932.1| PREDICTED: ABC transporter G family member 6 [Phoenix dactylifera]
Length=730

 Score =   811 bits (2096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/718 (69%), Positives = 578/718 (81%), Gaps = 21/718 (3%)
 Frame = +2

Query  380   TLGELLHRVGDS---AGEKLNNGVGGAN---DHRVLQLYD-PVPYPSS--FPFVLSFHNL  532
             TLGELL RVGD+   AG        G++   DH V++L D  V +      PFVL+F NL
Sbjct  23    TLGELLKRVGDAHDGAGSDSGTSCDGSSASPDH-VVELDDVSVGHLRGRPLPFVLAFTNL  81

Query  533   SYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTL  712
             +YSVK  +K+  P+   RR +      +  K LLD ISGEAREGEI+AVLGASGSGKSTL
Sbjct  82    AYSVKTPKKLAFPSLFRRRRS--HSATSGTKTLLDSISGEAREGEILAVLGASGSGKSTL  139

Query  713   IDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrl  892
             IDALANRIA+ SL G++ +NGE LES+LLKVISAYVMQDDLLFPMLTVEETLMF+AEFRL
Sbjct  140   IDALANRIAKGSLKGSITLNGEALESRLLKVISAYVMQDDLLFPMLTVEETLMFAAEFRL  199

Query  893   prslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLF  1072
             PRSLS ++K+ARV ALI+QLGL  AA+T+IGDEGHRGVSGGERRRVSIG DIIHDPI+LF
Sbjct  200   PRSLSAAKKRARVHALIDQLGLLPAARTIIGDEGHRGVSGGERRRVSIGTDIIHDPIILF  259

Query  1073  LDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSG  1252
             LDEPTSGLDSTSAFMVV+VLQRIA+SGS+V+MSVHQPSYRIL LLDRLIFLS+G+TV+SG
Sbjct  260   LDEPTSGLDSTSAFMVVQVLQRIARSGSVVVMSVHQPSYRILGLLDRLIFLSRGRTVYSG  319

Query  1253  SPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPE-GTKNLVDFNKSWQ-RKFSPSS  1426
              P  LP FF EFG+PIPENENR EFALD IRELE S + G+K LVDFN+SWQ  K  P  
Sbjct  320   PPDGLPVFFAEFGHPIPENENRTEFALDLIRELETSGQTGSKPLVDFNRSWQLMKLPP--  377

Query  1427  TSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKR  1606
                    FP    SLKDAISASISRGKLV GAT+   + S SVP FANPFW+EM V+ KR
Sbjct  378   ----GRHFPGAHLSLKDAISASISRGKLVYGATDGPGSAS-SVPTFANPFWIEMGVLTKR  432

Query  1607  SMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAE  1786
             S  N+ RMPELF +R GAV+VTG ILATIFW+LD SP+G+QERLGFFAF+MST +YTCA+
Sbjct  433   SFTNTRRMPELFLIRLGAVLVTGFILATIFWRLDSSPRGVQERLGFFAFSMSTMYYTCAD  492

Query  1787  AIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfs  1966
             A+PVFLQERYIFMRETAYNAYRRSSYVLS++++  PSL  LS AFA TT++AVGLAGGFS
Sbjct  493   ALPVFLQERYIFMRETAYNAYRRSSYVLSNAVVGFPSLVLLSAAFAATTFFAVGLAGGFS  552

Query  1967  gflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPY  2146
             GF FF L + ASFWAGS FVTFLSG++ +VM+ YT+VVAILAYF+LFSGFFINRDRIP Y
Sbjct  553   GFAFFFLIILASFWAGSGFVTFLSGVVPHVMLGYTVVVAILAYFLLFSGFFINRDRIPGY  612

Query  2147  WIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTL  2326
             WIWFHY SLVKYP++ VL+NEF    +CFV+G QIFD +P   +P  MK ++L  +S  L
Sbjct  613   WIWFHYLSLVKYPYEAVLRNEFGMAAECFVRGEQIFDNTPFGNMPGEMKQRVLGAISGAL  672

Query  2327  GINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             G  ITS TC+TTG DIL+Q G+T + KW+CLW+T+A GFFFR+LFYF+LLIGSKNKRR
Sbjct  673   GTRITSGTCVTTGEDILRQQGITQLGKWDCLWVTVAWGFFFRVLFYFSLLIGSKNKRR  730



>ref|XP_008793934.1| PREDICTED: ABC transporter G family member 20-like [Phoenix dactylifera]
Length=682

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/684 (70%), Positives = 558/684 (82%), Gaps = 20/684 (3%)
 Frame = +2

Query  476   YDPVPYPSSFPFVLSFHNLSYSVKVRRKMGV-PAWLGRRTAAPSQVE--------NDVKV  628
             + P P     PFVLSF +L+YSVK  +K+ + P++  +   +  QV         +  K 
Sbjct  10    FSPSPL---IPFVLSFTDLTYSVKNPKKLSLFPSFFRKNPLSADQVSAGEGAEAVSRTKT  66

Query  629   LLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVI  808
             LLD ISGEAREGEI+AVLGASGSGKSTLIDALANRIARESL G+V +NGE LE +LLKVI
Sbjct  67    LLDSISGEAREGEILAVLGASGSGKSTLIDALANRIARESLKGSVTLNGENLEGRLLKVI  126

Query  809   SAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGD  988
             SAYVMQDDLLFPMLTVEETLMFSAEFRLPR+LS ++K+ARV ALI+QLGL+ AA T+IGD
Sbjct  127   SAYVMQDDLLFPMLTVEETLMFSAEFRLPRTLSAAKKRARVLALIDQLGLRQAANTIIGD  186

Query  989   eghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIM  1168
             EGHRGVSGGERRRVSIG+DIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIA SGSIVIM
Sbjct  187   EGHRGVSGGERRRVSIGMDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAHSGSIVIM  246

Query  1169  SVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRE  1348
             SVHQPSYRIL LLDRLIFLS+GQTV+SG P  LP FF   G+P+PENEN  EFALD IRE
Sbjct  247   SVHQPSYRILGLLDRLIFLSRGQTVYSGPPDGLPPFFSGLGHPMPENENPTEFALDLIRE  306

Query  1349  LEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATN  1528
             LE +P G ++L++ NKS Q    PS     + +      SLKDAISASISRGKLVSGAT 
Sbjct  307   LESTPAGCRSLIEHNKSRQAA-KPSIAEKPSTL------SLKDAISASISRGKLVSGATE  359

Query  1529  INSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLD  1708
                  S SVP FANPFW+E  V+ KRS  N+ RMPELF +R GAV++TG ILATIFW+LD
Sbjct  360   GTGPAS-SVPTFANPFWIETAVLTKRSATNTRRMPELFGIRLGAVMLTGFILATIFWRLD  418

Query  1709  DSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiis  1888
             +SPKG QERLGFFA AMST FYTCA+A+PVFLQERYIFMRETAYNAYRRSSYVL ++I+ 
Sbjct  419   NSPKGAQERLGFFAIAMSTMFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLCNAIVG  478

Query  1889  lpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAY  2068
              P L  LS+ FA+TT++AVGLAGG SGF FF L V ASFWAGS FVTFLSG+I +VM+ Y
Sbjct  479   FPPLIILSIGFALTTFFAVGLAGGASGFFFFFLIVLASFWAGSGFVTFLSGVIPHVMVGY  538

Query  2069  TLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQ  2248
             T+VVAILAYF+LFSGFFINRDRIP YWIWFHY SLVKYP++ VLQNEFD   KCFV+G+Q
Sbjct  539   TVVVAILAYFLLFSGFFINRDRIPDYWIWFHYLSLVKYPYEAVLQNEFDDTTKCFVRGVQ  598

Query  2249  IFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWIT  2428
             +FD +PL ++P A+KL +L+ MS TLG ++T +TC+TTG DILKQ G+TD++KWNCLW+T
Sbjct  599   MFDNTPLGSLPTAVKLNVLKAMSNTLGQSLTGNTCITTGSDILKQQGITDLSKWNCLWVT  658

Query  2429  IAlgfffrllfyfallIGSKNKRR  2500
             +A GFFFR+LFYF LL+GSKNKRR
Sbjct  659   VAWGFFFRVLFYFTLLVGSKNKRR  682



>ref|XP_009121752.1| PREDICTED: ABC transporter G family member 6 [Brassica rapa]
Length=726

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/754 (68%), Positives = 601/754 (80%), Gaps = 34/754 (5%)
 Frame = +2

Query  257   MSQASSRDDMSTASSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNN  436
             MS+  + DD    +  LPF  P    E   L+     S S T  +LL  VGD+   +LN+
Sbjct  1     MSRVVATDD----NMSLPFFSP----EPNHLSTFSTASSSPTFAQLLKNVGDTTTVELND  52

Query  437   GVGGANDHRVLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAP----S  604
                    H  + L  P     S PF LSF++L+YSVKVRRK     W    +A P    S
Sbjct  53    -----QHHVDMNLASP---NQSVPFHLSFNDLTYSVKVRRKF---TWKRAPSADPIVGES  101

Query  605   QVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVL  784
              + +  K LL+ ISGEAR+GEI+AVLGASGSGKSTLIDALANRIA+ SL G V +NGEVL
Sbjct  102   PLSSKTKTLLNGISGEARDGEILAVLGASGSGKSTLIDALANRIAKGSLKGNVTLNGEVL  161

Query  785   ESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQT  964
              SK+ K ISAYVMQDDLLFPMLTVEETLMF+AEFRLPRSLS+S+K  RVQALI+QLGL+ 
Sbjct  162   NSKMQKAISAYVMQDDLLFPMLTVEETLMFAAEFRLPRSLSKSKKSLRVQALIDQLGLRN  221

Query  965   AAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIA  1144
             AAKT+IGDEGHRG+SGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSA  VVKVL+RIA
Sbjct  222   AAKTIIGDEGHRGISGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTSALSVVKVLKRIA  281

Query  1145  QSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCE  1324
             QSGS+VIM++HQPSYR+L LLDRL+FLS+GQTVFSGSP+ LP FF EFG+PIPE ENR E
Sbjct  282   QSGSMVIMTLHQPSYRLLRLLDRLLFLSRGQTVFSGSPAMLPSFFAEFGHPIPERENRTE  341

Query  1325  FALDFIRELEQSPEGTKNLVDFNKSW-QRKFSPSSTSNRNNVFPNPKPSLKDAISASISR  1501
             FALD IRELE S  GT++LV+FNK + QRK  P + +           SLK+AISASIS+
Sbjct  342   FALDLIRELEGSAGGTRSLVEFNKEFRQRKAEPRTQTGL---------SLKEAISASISK  392

Query  1502  GKLVSGATNINSTLSPS-VPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGI  1678
             GKLVSGAT+ + +   S +P FANPFWVE++V+ KRSM N  R PELF +R GAV+VTG 
Sbjct  393   GKLVSGATSGSGSSPVSTIPTFANPFWVELLVLAKRSMTNYRRQPELFGIRLGAVLVTGF  452

Query  1679  ILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRS  1858
             ILAT+FW+LD+SPKG+QERLGFFAFAMSTTFYTCA+A+PVFLQER+IFMRETAYNAYRRS
Sbjct  453   ILATMFWQLDNSPKGVQERLGFFAFAMSTTFYTCADALPVFLQERFIFMRETAYNAYRRS  512

Query  1859  SYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLS  2038
             SYVLSHS+++LPSL  LSLAFA TT+WAVGL GG  GFLF+ L V A+FWAGSSFVTFLS
Sbjct  513   SYVLSHSLVALPSLIILSLAFAATTFWAVGLDGGLMGFLFYFLIVLAAFWAGSSFVTFLS  572

Query  2039  GIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDY  2218
             G++ +VM+ YT+VVAILAYF+LFSGFFI RDRIP YWIWFHY SLVKYP++ VL NEF  
Sbjct  573   GVVPHVMLGYTIVVAILAYFLLFSGFFITRDRIPAYWIWFHYISLVKYPYEAVLINEFGD  632

Query  2219  PDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTD  2398
             P KCF++G+QIFD +PL AVP+ MK+KLL  MSK+LG+ ITSSTCLTTG DIL+Q GVTD
Sbjct  633   PTKCFIRGVQIFDNTPLAAVPQGMKVKLLSTMSKSLGMRITSSTCLTTGYDILQQQGVTD  692

Query  2399  INKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             ++KWNCLWIT+A GFFFR+LFYF+LL+GSKNKRR
Sbjct  693   LSKWNCLWITVACGFFFRILFYFSLLLGSKNKRR  726



>ref|XP_006399852.1| hypothetical protein EUTSA_v10012786mg [Eutrema salsugineum]
 gb|ESQ41305.1| hypothetical protein EUTSA_v10012786mg [Eutrema salsugineum]
Length=733

 Score =   809 bits (2090),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/763 (67%), Positives = 601/763 (79%), Gaps = 45/763 (6%)
 Frame = +2

Query  257   MSQASSRDDMSTASSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNN  436
             MS+  + DD    +  LPF  P    E   L+     S S T  +LL  VGD+       
Sbjct  1     MSRVVAADD----NMSLPFFSP----EPNHLSSYSGTS-SPTFAQLLKNVGDTTTVL---  48

Query  437   GVGGANDHRV-LQLYDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRT------A  595
               GG + H V + L  P     S PFVLSF +L+YSVKVRRK    AW  RR        
Sbjct  49    -TGGHHQHHVDVDLASP---DRSVPFVLSFTDLTYSVKVRRKF---AW--RRVPSDPIVG  99

Query  596   APSQ--VENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKM  769
             APS     +  K LL+ ISGEAR+GEI+AVLGASGSGKSTLIDALANRIA+ SL G V +
Sbjct  100   APSDGLFSSKTKTLLNGISGEARDGEILAVLGASGSGKSTLIDALANRIAKGSLKGNVTL  159

Query  770   NGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQ  949
             NGEVL SK+ K ISAYVMQDDLLFPMLTVEETLMF+AEFRLPRSLS+S+K  RVQALI+Q
Sbjct  160   NGEVLNSKMQKAISAYVMQDDLLFPMLTVEETLMFAAEFRLPRSLSKSKKNLRVQALIDQ  219

Query  950   LGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKV  1129
             LGL+ AAKT+IGDEGHRG+SGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSA  V+KV
Sbjct  220   LGLRNAAKTIIGDEGHRGISGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTSALSVIKV  279

Query  1130  LQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPEN  1309
             L+RIAQSGS+VIM++HQPSYR+L LLDRL+FLS+GQTVFSGSP+ LP FF EFG+PIPE+
Sbjct  280   LKRIAQSGSMVIMTLHQPSYRLLRLLDRLLFLSRGQTVFSGSPAMLPSFFAEFGHPIPEH  339

Query  1310  ENRCEFALDFIRELEQSPEGTKNLVDFNKSW-QRKFSPSSTSNRNNVFPNPKPSLKDAIS  1486
             ENR EFALD IRELE S  GT++LV+FNK + QRK  P + +           SLK+AIS
Sbjct  340   ENRTEFALDLIRELEGSAGGTRSLVEFNKGFRQRKAEPRTQTGL---------SLKEAIS  390

Query  1487  ASISRGKLVSGATNINSTLSPS-----VPKFANPFWVEMVVIGKRSMVNSLRMPELFAMR  1651
             ASIS+GKLVSGAT   +  S S     +P FANPFWVE+ V+ KRSM N  R PELF +R
Sbjct  391   ASISKGKLVSGATTTTTPGSGSNPVSTIPTFANPFWVELAVLAKRSMTNYRRQPELFGIR  450

Query  1652  FGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRE  1831
              GAV+VTG ILAT+FW+LD+SPKG+QERLGFFAFAMSTTFYTCA+A+PVFLQER+IFMRE
Sbjct  451   LGAVLVTGFILATMFWQLDNSPKGVQERLGFFAFAMSTTFYTCADALPVFLQERFIFMRE  510

Query  1832  TAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWA  2011
             TAYNAYRRSSYVLSHS+++LPSL  LSLAFA TT+W VGL GG  GFLF+ L V A+FWA
Sbjct  511   TAYNAYRRSSYVLSHSLVALPSLIILSLAFAATTFWGVGLDGGLMGFLFYFLIVLAAFWA  570

Query  2012  GSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQ  2191
             GSSFVTFLSG++ +VM+ YT+VVAILAYF+LFSGFFINRDRIP YWIWFHY SLVKYP++
Sbjct  571   GSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPSYWIWFHYISLVKYPYE  630

Query  2192  GVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPD  2371
              VL NEF  P KCFV+G+QIFD +PL AVP+ MK++LL  MSK+LG+ ITSSTCLTTG D
Sbjct  631   AVLINEFSDPTKCFVRGVQIFDNTPLVAVPQGMKVRLLATMSKSLGMRITSSTCLTTGYD  690

Query  2372  ILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             IL+Q GVTD++KWNCLW+T+A GFFFR+LFYF+LL+GSKNKRR
Sbjct  691   ILQQQGVTDLSKWNCLWVTVAWGFFFRILFYFSLLLGSKNKRR  733



>ref|XP_010419943.1| PREDICTED: ABC transporter G family member 6-like [Camelina sativa]
Length=728

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/722 (69%), Positives = 585/722 (81%), Gaps = 32/722 (4%)
 Frame = +2

Query  368   SVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFPFVLSFHNLSYSVK  547
             S S T  +LL  VGD+         GG +D   + + D      S PFVLSF +L+YSVK
Sbjct  28    SSSPTFAQLLQNVGDTTRR------GGHHDQHHVDV-DLTSPDQSVPFVLSFTDLTYSVK  80

Query  548   VRRKMGVPAWLGRRTAAPSQVEND------VKVLLDDISGEAREGEIMAVLGASGSGKST  709
             VRRK+    W  RRT+ P    ++       K LL+ ISGEAR+GEI+AV+GASGSGKST
Sbjct  81    VRRKL---TW--RRTSDPGAPSSEGLFSSKTKTLLNGISGEARDGEIVAVMGASGSGKST  135

Query  710   LIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFr  889
             LIDALANRIA+ SL G V +NGEVL SK+ K ISAYVMQDDLLFPMLTVEETLMF+AEFR
Sbjct  136   LIDALANRIAKGSLKGNVTLNGEVLNSKMQKAISAYVMQDDLLFPMLTVEETLMFAAEFR  195

Query  890   lprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVL  1069
             LPRSLS+S+K  RVQALI+QLGL+ AA TVIGDEGHRG+SGGERRRVSIGIDIIHDPI+L
Sbjct  196   LPRSLSKSKKSLRVQALIDQLGLRNAANTVIGDEGHRGISGGERRRVSIGIDIIHDPILL  255

Query  1070  FLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFS  1249
             FLDEPTSGLDSTSA  V+KVL+RIAQSGS+VIM++HQPSYR+L LLDRL+FLS+GQTVFS
Sbjct  256   FLDEPTSGLDSTSALSVIKVLKRIAQSGSMVIMTLHQPSYRLLRLLDRLLFLSRGQTVFS  315

Query  1250  GSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSW-QRKFSPSS  1426
             GSP+ LPRFF EFG+PIPE+ENR EFALD IRELE S  GT++LV+FNK + QRK  P +
Sbjct  316   GSPAMLPRFFAEFGHPIPEHENRTEFALDLIRELEGSAGGTRSLVEFNKVFRQRKAEPRT  375

Query  1427  TSNRNNVFPNPKPSLKDAISASISRGKLVSGA--TNINSTLSP--SVPKFANPFWVEMVV  1594
              +           SLK+AISASIS+GKLVSGA  T   S  +P  ++P FANPFWVE+VV
Sbjct  376   QTGL---------SLKEAISASISKGKLVSGANTTTPGSGSNPVSTIPTFANPFWVELVV  426

Query  1595  IGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFY  1774
             + KRSM NS R PELF +R GAV+VTG ILAT+FW+LD SPKG+QERLG FAFAMSTTFY
Sbjct  427   LAKRSMTNSRRQPELFGIRLGAVLVTGFILATMFWQLDSSPKGVQERLGCFAFAMSTTFY  486

Query  1775  TCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvgla  1954
             TCA+A+PVFLQER+IFMRETAYNAYRRSSYVLSHS+++LPSL  LSLAFA  T+W VGL 
Sbjct  487   TCADALPVFLQERFIFMRETAYNAYRRSSYVLSHSLVALPSLIILSLAFAAITFWGVGLD  546

Query  1955  ggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDR  2134
             GG  GFLF+ L + ASFWAGSSFVTFLSG++ +VM+ YT+VVAILAYF+LFSGFFINRDR
Sbjct  547   GGLMGFLFYFLVILASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDR  606

Query  2135  IPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNM  2314
             IP YWIWFHY SLVKYP++ VL NEF  P KCFV+G+QIFD +PL AVP  MK++LL  M
Sbjct  607   IPDYWIWFHYISLVKYPYEAVLLNEFGDPTKCFVRGVQIFDNTPLVAVPRGMKVRLLATM  666

Query  2315  SKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNK  2494
             SK+LG+ ITSSTCLTTG DIL+Q GVTD+ KWNCLW+T+A GFFFR+LFYF+LL+GSKNK
Sbjct  667   SKSLGMRITSSTCLTTGYDILQQQGVTDLTKWNCLWVTVAWGFFFRILFYFSLLLGSKNK  726

Query  2495  RR  2500
             RR
Sbjct  727   RR  728



>gb|KFK36827.1| hypothetical protein AALP_AA4G176600 [Arabis alpina]
Length=736

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/715 (66%), Positives = 571/715 (80%), Gaps = 28/715 (4%)
 Frame = +2

Query  419   GEKLNNGVGGANDHRVLQLYDPVP------YPSSFPFVLSFHNLSYSVKVRRKMGVPAWL  580
             G+ L N     +D R + + D  P      Y  + PFVL+F NL+Y+V VRRK+     +
Sbjct  29    GQLLKN----VSDVRKMTIGDETPVHEDDGYMRTVPFVLTFDNLTYNVSVRRKLEFRNLI  84

Query  581   GRRTAAPSQVE----NDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARES  748
              RR     ++      + K LL++ISGE R+GEIMAVLGASGSGKSTLIDALANRIA+ S
Sbjct  85    PRRKTDDPELALTGGPNTKTLLNNISGETRDGEIMAVLGASGSGKSTLIDALANRIAKGS  144

Query  749   LGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkar  928
             L G+VK+NGE L+S++LKVISAYVMQDDLL+PMLTVEETLMF+A+FRLPRSL +S+KK R
Sbjct  145   LKGSVKLNGETLQSRMLKVISAYVMQDDLLYPMLTVEETLMFAADFRLPRSLPKSKKKLR  204

Query  929   VQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTS  1108
             VQALI+QLG++ AA+T+IGDEGHRG+SGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTS
Sbjct  205   VQALIDQLGIRNAAQTIIGDEGHRGISGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTS  264

Query  1109  AFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEF  1288
             AFMVV VL+RIAQSGSIV+MS+HQPS+R+L LLDRLIFLS+G TV+SGSP+SLPRFF EF
Sbjct  265   AFMVVNVLKRIAQSGSIVVMSIHQPSHRVLGLLDRLIFLSRGHTVYSGSPASLPRFFSEF  324

Query  1289  GNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVF-----P  1453
             G+PIPENENR EFALD IRELE SP GT+ LV+FNK WQ        SNR         P
Sbjct  325   GSPIPENENRTEFALDLIRELEGSPGGTRALVEFNKKWQEM---KKQSNRQPPLTPPASP  381

Query  1454  NPKPSLKDAISASISRGKLVSGA------TNINSTLSPSVPKFANPFWVEMVVIGKRSMV  1615
              P  +LK+AI+ASISRGKLVSG        N  +T + +VP FANP W+E+  + +RSM+
Sbjct  382   YPNLTLKEAIAASISRGKLVSGGESSAVQQNATATTTLAVPSFANPMWIEIKTLSQRSML  441

Query  1616  NSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIP  1795
             N+ R PELF ++  +V+VTG ILAT+FW+LD+SPKGI+ERLGFFAFAMST +YTC EA+P
Sbjct  442   NARRQPELFGIKLASVMVTGFILATVFWRLDNSPKGIRERLGFFAFAMSTMYYTCVEALP  501

Query  1796  VFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgfl  1975
              FLQERYIFMRETAYNAYRRSSYVLSH+I+S PSL  L++AFAV T+WAVGL GG  G L
Sbjct  502   DFLQERYIFMRETAYNAYRRSSYVLSHAIVSFPSLIVLTVAFAVPTFWAVGLDGGLMGLL  561

Query  1976  ffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIW  2155
             F+ L + ASFW+GSSFVTFLSG++ NVM+ YT+ VAILAYF+LFSGFFINR+RIP YW+W
Sbjct  562   FYCLIILASFWSGSSFVTFLSGLVPNVMLGYTISVAILAYFLLFSGFFINRNRIPDYWVW  621

Query  2156  FHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGIN  2335
             FHY SLVKY ++ VLQNEF    KCFV+G+Q FD +PL  +PE MKL+LL  +SK+LG  
Sbjct  622   FHYMSLVKYSYEAVLQNEFSDATKCFVRGVQTFDNTPLGELPEVMKLRLLDTISKSLGTT  681

Query  2336  ITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             I+SSTC+TTG DIL   GVT ++KW+CL +T+A GFFFR+LFYF+LL+GSKNKRR
Sbjct  682   ISSSTCMTTGADILTNQGVTQLSKWHCLLVTVAFGFFFRVLFYFSLLLGSKNKRR  736



>gb|KFK25590.1| hypothetical protein AALP_AA8G134300 [Arabis alpina]
Length=723

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/717 (69%), Positives = 581/717 (81%), Gaps = 34/717 (5%)
 Frame = +2

Query  383   LGELLHRVGDSAGEKLNNGVGGANDHRV-LQLYDPVPYPSSFPFVLSFHNLSYSVKVRRK  559
               +LL  VGD+        +G   +H V + L  P     S PFVLSF +L+YSVK+RRK
Sbjct  30    FAQLLKNVGDTT-------IGDNQEHHVDVDLTSP---DRSVPFVLSFTDLTYSVKIRRK  79

Query  560   MGVPAWLGRRTAA-----PSQVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDAL  724
                  W  RR  +      S   +  K LL+ ISGEAR+GEI+AVLGASGSGKSTLIDAL
Sbjct  80    F---TW--RRVPSDPIIGASSENSKTKTLLNGISGEARDGEILAVLGASGSGKSTLIDAL  134

Query  725   ANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprsl  904
             ANRIA+ SL G V +NGE+L SK+ K ISAYVMQDDLLFPMLTVEETLMF+AEFRLPRSL
Sbjct  135   ANRIAKGSLKGNVTLNGEILNSKMQKAISAYVMQDDLLFPMLTVEETLMFAAEFRLPRSL  194

Query  905   srsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEP  1084
             S+S+K  RVQALI+QLGL+ AAKTVIGDEGHRG+SGGERRRVSIGIDIIHDPI+LFLDEP
Sbjct  195   SKSKKNLRVQALIDQLGLRNAAKTVIGDEGHRGISGGERRRVSIGIDIIHDPILLFLDEP  254

Query  1085  TSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSS  1264
             TSGLDSTSA  V+KVL+RIAQSGS+VIM++HQPSYR+L LLDRL+FLS+GQTVFSGSP+ 
Sbjct  255   TSGLDSTSALSVIKVLKRIAQSGSMVIMTLHQPSYRLLRLLDRLLFLSRGQTVFSGSPAM  314

Query  1265  LPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSW-QRKFSPSSTSNRN  1441
             LP FF EFG+PIPE+ENR EFALD IRELE S  GT++LV+FNK + QRK  P + +   
Sbjct  315   LPSFFAEFGHPIPEHENRTEFALDLIRELEGSAGGTRSLVEFNKGFRQRKAEPRTQTT--  372

Query  1442  NVFPNPKPSLKDAISASISRGKLVSGATNIN----STLSPSVPKFANPFWVEMVVIGKRS  1609
                     SLK+AISASIS+GKLVSGAT       S    ++P FANPFWVE +V+ KRS
Sbjct  373   ------GLSLKEAISASISKGKLVSGATTTTPSSGSNPVSTIPTFANPFWVEFLVLAKRS  426

Query  1610  MVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEA  1789
             M N  R PELF +R GAV+VTG ILAT+FW+LD+SPKG+QERLGFFAFAMSTTFYTCA+A
Sbjct  427   MTNYRRQPELFGIRLGAVLVTGFILATMFWQLDNSPKGVQERLGFFAFAMSTTFYTCADA  486

Query  1790  IPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsg  1969
             +PVFLQER+IFMRETAYNAYRRSSYVLSHS+++LPSL  LSLAFA TT+W VGL GG  G
Sbjct  487   LPVFLQERFIFMRETAYNAYRRSSYVLSHSLVALPSLIILSLAFAATTFWGVGLDGGLMG  546

Query  1970  flffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYW  2149
             FLF+ L V A+FWAGSSFVTFLSG++ +VM+ YT+VVAILAYF+LFSGFFINRDRIP YW
Sbjct  547   FLFYFLIVLAAFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPSYW  606

Query  2150  IWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLG  2329
             IWFHY SLVKYP++ VL NEF  P KCFVKG+QIFD +PL AVP+ MK+KLL  MSK+LG
Sbjct  607   IWFHYISLVKYPYEAVLINEFSDPTKCFVKGVQIFDNTPLVAVPQGMKVKLLATMSKSLG  666

Query  2330  INITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             + ITSSTCLTTG DIL+Q G+TD++KWNCLW+T+A GFFFR+LFYF+LL+GSKNKRR
Sbjct  667   MRITSSTCLTTGYDILQQQGITDLSKWNCLWVTVAWGFFFRILFYFSLLLGSKNKRR  723



>ref|XP_006287124.1| hypothetical protein CARUB_v10000296mg, partial [Capsella rubella]
 gb|EOA20022.1| hypothetical protein CARUB_v10000296mg, partial [Capsella rubella]
Length=749

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/762 (67%), Positives = 596/762 (78%), Gaps = 47/762 (6%)
 Frame = +2

Query  254   AMSQASSRDDMSTASSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLN  433
             AMS+  + DD  T    LPF  P       EL      S S T  +LL  V D+      
Sbjct  22    AMSRVVAADDNMT----LPFFSP-------ELNGVSGASSSPTFAQLLQNVDDTTRR---  67

Query  434   NGVGGANDHRV-LQLYDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTA-----  595
                 G + H V + L  P     S PFVLSF +L+YSVKVRRK     W  RR++     
Sbjct  68    ----GHDQHHVDVDLASP---DQSVPFVLSFTDLTYSVKVRRKF---TW--RRSSPSDPG  115

Query  596   APSQ--VENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKM  769
             APS     +  K LL+ ISGEAR+GEI+AVLGASGSGKSTLIDALANRIA+ SL G V +
Sbjct  116   APSGGLFSSKTKTLLNGISGEARDGEILAVLGASGSGKSTLIDALANRIAKGSLKGNVTL  175

Query  770   NGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQ  949
             NGEVL SK+ K ISAYVMQDDLLFPMLTVEETLMF+AEFRLPRSLS+S+K  RVQALI+Q
Sbjct  176   NGEVLNSKMQKAISAYVMQDDLLFPMLTVEETLMFAAEFRLPRSLSKSKKSLRVQALIDQ  235

Query  950   LGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKV  1129
             LGL+ AA TVIGDEGHRG+SGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSA  V+KV
Sbjct  236   LGLRNAANTVIGDEGHRGISGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTSALSVIKV  295

Query  1130  LQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPEN  1309
             L+RIAQSGS+VIM++HQPSYR+L LLDRL+FLS+GQTVFSGSP+ LPRFF EFG+PIPE+
Sbjct  296   LKRIAQSGSMVIMTLHQPSYRLLRLLDRLLFLSRGQTVFSGSPAMLPRFFAEFGHPIPEH  355

Query  1310  ENRCEFALDFIRELEQSPEGTKNLVDFNKSW-QRKFSPSSTSNRNNVFPNPKPSLKDAIS  1486
             ENR EFALD IRELE S  GT++LV+FNK + QRK +   T            SLK+AIS
Sbjct  356   ENRTEFALDLIRELEGSAGGTRSLVEFNKGFRQRKAAEPRTQT--------GLSLKEAIS  407

Query  1487  ASISRGKLVSGATNI----NSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRF  1654
             ASIS+GKLVSGAT       S    ++P FANPFWVE+ V+ KRSM NS R PELF +R 
Sbjct  408   ASISKGKLVSGATTTTPASGSNPVSTIPTFANPFWVELAVLAKRSMTNSRRQPELFGIRL  467

Query  1655  GAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRET  1834
             GAV+VTG ILAT+FW+LD+SPKG+QERLG FAFAMSTTFYTCA+A+PVFLQER+IFMRET
Sbjct  468   GAVLVTGFILATMFWQLDNSPKGVQERLGCFAFAMSTTFYTCADALPVFLQERFIFMRET  527

Query  1835  AYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAG  2014
             AYNAYRRSSYVLSHS+++LPSL  LSLAFA  T+W VGL GG  GFLF+ L + ASFWAG
Sbjct  528   AYNAYRRSSYVLSHSLVALPSLIILSLAFAAITFWGVGLDGGLMGFLFYFLVILASFWAG  587

Query  2015  SSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQG  2194
             SSFVTFLSG++ +VM+ YT+VVAILAYF+LFSGFFINRDRIP YWIWFHY SLVKYP++ 
Sbjct  588   SSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPGYWIWFHYISLVKYPYEA  647

Query  2195  VLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDI  2374
             VL NEF  P KCFV+G+QIFD +PL AVP+ MK++LL  MSK+LG+ ITSSTCLTTG DI
Sbjct  648   VLLNEFGDPTKCFVRGVQIFDNTPLVAVPQGMKVRLLATMSKSLGMRITSSTCLTTGYDI  707

Query  2375  LKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             L+Q GVTD+ KWNCLW+T+A GFFFR+LFYF+LL+GSKNKRR
Sbjct  708   LQQQGVTDLTKWNCLWVTVAWGFFFRILFYFSLLLGSKNKRR  749



>emb|CDY09810.1| BnaC09g43510D [Brassica napus]
Length=752

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/759 (67%), Positives = 602/759 (79%), Gaps = 39/759 (5%)
 Frame = +2

Query  257   MSQASSRDDMSTASSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNN  436
             MS+  + DD    +  LPF  P    E   L+     S S T  +LL  VGD+   +LN+
Sbjct  1     MSRVVAADD----NMSLPFFSP----EPNNLSTFSAASSSPTFAQLLKNVGDTTTVELND  52

Query  437   GVGGANDHRV-LQLYDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVE  613
                  + H V + L  P     S PF LSF++L+YSVKVRRK     W    +A P+  E
Sbjct  53    -----HQHHVDMDLASP---NQSVPFHLSFNDLTYSVKVRRKF---TWKRAPSADPTVGE  101

Query  614   N----DVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEV  781
             +      K LL+ ISGEAR+GEI+AVLGASGSGKSTLIDALANRIA+ SL G V +NGEV
Sbjct  102   SLFSSKTKTLLNGISGEARDGEILAVLGASGSGKSTLIDALANRIAKGSLKGNVTLNGEV  161

Query  782   LESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQ  961
             L SK+ K ISAYVMQDDLLFPMLTVEETLMF+AEFRLPRSLS+S+K  RVQALI+QLGL+
Sbjct  162   LNSKMQKAISAYVMQDDLLFPMLTVEETLMFAAEFRLPRSLSKSKKSLRVQALIDQLGLR  221

Query  962   TAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRI  1141
              AAKT+IGDEGHRG+SGGERRRVSIG DIIHDPI+LFLDEPTSGLDSTSA  VVKVL+RI
Sbjct  222   NAAKTIIGDEGHRGISGGERRRVSIGNDIIHDPILLFLDEPTSGLDSTSALSVVKVLKRI  281

Query  1142  AQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRC  1321
             AQSGS+VIM++HQPSYR+L LLDRL+FLS+GQTVFSGSP+ LP FF EFG+PIPE ENR 
Sbjct  282   AQSGSMVIMTLHQPSYRLLRLLDRLLFLSRGQTVFSGSPAMLPSFFAEFGHPIPERENRT  341

Query  1322  EFALDFIRELEQSPEGTKNLVDFNKSW-QRKFSPSSTSNRNNVFPNPKPSLKDAISASIS  1498
             EFALD IRELE S  GT++LV+FNK + QRK  P + +           SLK+AISASIS
Sbjct  342   EFALDLIRELEGSAGGTRSLVEFNKEFRQRKAEPRTQTGL---------SLKEAISASIS  392

Query  1499  RGKLVSGATNINSTLS-----PSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAV  1663
             +GKLVSGAT   +T S      ++P FANPFWVE++V+ KRSM N  R PELF +R GAV
Sbjct  393   KGKLVSGATTATTTGSGSSPVSTIPTFANPFWVELLVLAKRSMTNYRRQPELFGIRLGAV  452

Query  1664  VVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYN  1843
             +VTG ILAT+FW+LD+SPKG+QERLGFFAFAMSTTFYTCA+A+PVFLQER+IFMRETAYN
Sbjct  453   LVTGFILATMFWQLDNSPKGVQERLGFFAFAMSTTFYTCADALPVFLQERFIFMRETAYN  512

Query  1844  AYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSF  2023
             AYRRSSYVLSHS+++LPSL  LSLAFA TT+WAVGL GG  GFLF+ L V A+FWAGSSF
Sbjct  513   AYRRSSYVLSHSLVALPSLIILSLAFAATTFWAVGLDGGLMGFLFYFLIVLAAFWAGSSF  572

Query  2024  VTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQ  2203
             VTFLSG++ +VM+ YT+VVAILAYF+LFSGFFI RDRIP YWIWFHY SLVKYP++ VL 
Sbjct  573   VTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFITRDRIPAYWIWFHYISLVKYPYEAVLI  632

Query  2204  NEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQ  2383
             NEF  P KCF++G+QIFD +PL AVP+ MK+KLL  MSK+LG+ ITSSTCLTTG DIL+Q
Sbjct  633   NEFSDPTKCFIRGVQIFDNTPLAAVPQGMKVKLLSTMSKSLGMRITSSTCLTTGYDILQQ  692

Query  2384  TGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
              GVTD++KWNCLWIT+A GFFFR+LFYF+LL+GSKNKRR
Sbjct  693   QGVTDLSKWNCLWITVAWGFFFRILFYFSLLLGSKNKRR  731



>ref|XP_010453438.1| PREDICTED: ABC transporter G family member 6-like [Camelina sativa]
Length=728

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/759 (67%), Positives = 600/759 (79%), Gaps = 42/759 (6%)
 Frame = +2

Query  257   MSQASSRDDMSTASSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNN  436
             MS+  + DD  T+    PF  P    E   ++ R   S S T  +LL  VGD+       
Sbjct  1     MSRVVAADDNMTS----PFFTP----EFNGVSGRA--SSSPTFAQLLQNVGDTTRR----  46

Query  437   GVGGANDHRVLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVEN  616
               GG +D   + + D      S PFVLSF +L+YSVKVRRK     W  RR++ P    +
Sbjct  47    --GGHHDQHHVDV-DLTSPDQSVPFVLSFTDLTYSVKVRRKF---TW--RRSSDPGAPSS  98

Query  617   D------VKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGE  778
             +       K +L+ ISGEAR+GEI+AV+GASGSGKSTLIDALANRIA+ SL G V +NGE
Sbjct  99    EGLFSSKTKTILNGISGEARDGEIVAVMGASGSGKSTLIDALANRIAKGSLKGNVTLNGE  158

Query  779   VLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGL  958
             VL SK+ K ISAYVMQDDLLFPMLTVEETLMF+AEFRLPRSLS+S+K  RVQALI+QLGL
Sbjct  159   VLNSKMQKAISAYVMQDDLLFPMLTVEETLMFAAEFRLPRSLSKSKKSLRVQALIDQLGL  218

Query  959   QTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQR  1138
             + AA TVIGDEGHRG+SGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSA  V+KVL+R
Sbjct  219   RNAANTVIGDEGHRGISGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTSALSVIKVLKR  278

Query  1139  IAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENR  1318
             IAQSGS+VIM++HQPSYR+L LLDRL+FLS+GQTVFSGSP+ LP FF EFG+PIPE+ENR
Sbjct  279   IAQSGSMVIMTLHQPSYRLLRLLDRLLFLSRGQTVFSGSPAMLPGFFAEFGHPIPEHENR  338

Query  1319  CEFALDFIRELEQSPEGTKNLVDFNKSW-QRKFSPSSTSNRNNVFPNPKPSLKDAISASI  1495
              EFALD IRELE S  GT++LV+FNK + QRK  P + +           SLK+AISASI
Sbjct  339   TEFALDLIRELEGSAGGTRSLVEFNKGFRQRKAEPRTQTGL---------SLKEAISASI  389

Query  1496  SRGKLVSGA--TNINSTLSP--SVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAV  1663
             S+GKLVSGA  TN +S  +P  ++P FANPFWVE+ V+ KRSM NS R PELF +R GAV
Sbjct  390   SKGKLVSGANTTNPDSGSNPGSTIPTFANPFWVELAVLAKRSMTNSRRQPELFGIRLGAV  449

Query  1664  VVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYN  1843
             +VTG ILAT+FW+LD+SPKG+QERLG FAFAMSTTFYTCA+A+PVFLQER+IFMRETAYN
Sbjct  450   LVTGFILATMFWQLDNSPKGVQERLGCFAFAMSTTFYTCADALPVFLQERFIFMRETAYN  509

Query  1844  AYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSF  2023
             AYRRSSYVLSHS+++LPSL  LSLAFA  T+W VGL GG  GFLF+ L + ASFWAGSSF
Sbjct  510   AYRRSSYVLSHSLVALPSLIILSLAFAAITFWGVGLDGGLIGFLFYFLVILASFWAGSSF  569

Query  2024  VTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQ  2203
             VTFLSG++ +VM+ YT+VVAILAYF+LFSGFFINRDRIP YWIWFHY SLVKYP++ VL 
Sbjct  570   VTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPGYWIWFHYISLVKYPYEAVLL  629

Query  2204  NEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQ  2383
             NEF  P KCFV+G+QIFD +PL AVP  MK++LL  MSK+LG+ ITSSTCLTTG DIL+Q
Sbjct  630   NEFGDPTKCFVRGVQIFDNTPLVAVPRGMKVRLLATMSKSLGMRITSSTCLTTGYDILQQ  689

Query  2384  TGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
              GVTD+ KWNCLW+T+A GFFFR+LFYF+LL+GSKNKRR
Sbjct  690   QGVTDLTKWNCLWVTVAWGFFFRILFYFSLLLGSKNKRR  728



>gb|KCW65320.1| hypothetical protein EUGRSUZ_G02773 [Eucalyptus grandis]
Length=708

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/724 (69%), Positives = 587/724 (81%), Gaps = 57/724 (8%)
 Frame = +2

Query  383   LGELLHRVGDSAGEKLNNGVGG---ANDHRVLQ--LYDPVPYPSSFPFVLSFHNLSYSVK  547
             L +LL RVGD+  E    G GG    + H  L   L D    P S PFVL F+NL+YS+K
Sbjct  24    LAQLLKRVGDARKEA--TGDGGETPVHHHHALDVDLSDSSLEPRSLPFVLQFNNLTYSIK  81

Query  548   VRRKMGVPAWLGRRTA--APSQVENDV---------KVLLDDISGEAREGEIMAVLGASG  694
             VRRK+ +P+ L RR +    + VE  V         KVLL+DISGEAR+GEI+AVLGASG
Sbjct  82    VRRKVALPSLLPRRRSRLGSAAVEEPVAGESLFSRTKVLLNDISGEARDGEILAVLGASG  141

Query  695   SGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMF  874
             SGKSTL+DALANRIA+ SL G+V +NGE LES+LLKVISAYVMQDDLLFPMLTVEETLMF
Sbjct  142   SGKSTLVDALANRIAKGSLKGSVTLNGEPLESRLLKVISAYVMQDDLLFPMLTVEETLMF  201

Query  875   SAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIH  1054
             +AEFRLPR+LS+S+K+ RVQALI+QLGL+ AAKTVIGDEGHRGVSGGERRRVSIGIDIIH
Sbjct  202   AAEFRLPRTLSKSKKRMRVQALIDQLGLRNAAKTVIGDEGHRGVSGGERRRVSIGIDIIH  261

Query  1055  DPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKG  1234
             DPI+LFLDEPTSGLDSTSA+MVVKVLQRIAQSGSIV+M+VHQPSYRIL LLDRL+FLS+G
Sbjct  262   DPIILFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVVMTVHQPSYRILGLLDRLLFLSRG  321

Query  1235  QTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQ--R  1408
             QTV+SGSP+SLP FF EFG+PIPENENR EFALD IRELE SP GT++LV+FNKSWQ  +
Sbjct  322   QTVYSGSPTSLPLFFSEFGHPIPENENRTEFALDLIRELEGSPGGTRSLVEFNKSWQSMK  381

Query  1409  KFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWVEM  1588
             + + +S  +RN +      SLK+AI ASISRGKLVSGATN +++ +  VP FANPFW+EM
Sbjct  382   QGARNSEPDRNGL------SLKEAIGASISRGKLVSGATN-DASPASMVPTFANPFWIEM  434

Query  1589  VVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTT  1768
              V+ KRS+ NS RMPELF +R GAV+VTG ILAT+FW+LD+SPKG+QERLGF AFAMSTT
Sbjct  435   AVLSKRSITNSRRMPELFGIRLGAVLVTGFILATMFWQLDNSPKGVQERLGFIAFAMSTT  494

Query  1769  FYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvg  1948
             FYTCA+A+PVFLQERYIFMRETAYNAYRR SYVLSHS+++LP+L  L+LAF+ TT++AVG
Sbjct  495   FYTCADALPVFLQERYIFMRETAYNAYRRWSYVLSHSLVALPALVLLALAFSATTFFAVG  554

Query  1949  laggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINR  2128
             L GGFSGFLF+ L +FASFWAGSSFVTFLSG++ +VM+ YT+VVAILAYF+LFSGFFINR
Sbjct  555   LDGGFSGFLFYFLIIFASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINR  614

Query  2129  DRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQ  2308
             DRIP YWIWFHY SLVKYP++GVLQNEF  P                             
Sbjct  615   DRIPSYWIWFHYLSLVKYPYEGVLQNEFQDP-----------------------------  645

Query  2309  NMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSK  2488
               + TLG+ IT+STCLTTG DIL+Q GVTD++KW+CLW+T+A GF FR+LFYF+LL+GSK
Sbjct  646   -TNNTLGMKITASTCLTTGTDILQQQGVTDLSKWSCLWVTVAWGFLFRILFYFSLLLGSK  704

Query  2489  NKRR  2500
             NKRR
Sbjct  705   NKRR  708



>ref|XP_009139200.1| PREDICTED: ABC transporter G family member 16 [Brassica rapa]
Length=718

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/726 (67%), Positives = 586/726 (81%), Gaps = 35/726 (5%)
 Frame = +2

Query  359   PRHSV----SMTLGELLHRVGD----SAGEK--LNNGVGGANDHRVLQLYDPVPYPSSFP  508
             P HS+    S+TLG+LL  V D     AG++  L++  G        Q YD +  P   P
Sbjct  16    PYHSMEIGSSLTLGQLLKNVSDVRKVDAGDETPLHSSQGD-------QDYDDLMRP--VP  66

Query  509   FVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGA  688
             FVLSF+NL+Y+V VRRK  +   + RR+ + S+     K LLD+ISGE R+GEI+AVLGA
Sbjct  67    FVLSFNNLTYNVSVRRKFNL---IPRRSLSSSKT----KTLLDNISGETRDGEILAVLGA  119

Query  689   SGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETL  868
             SGSGKSTLIDALANRIA+ SL G V +NGE L+S+ LKVISAYVMQDDLLFPMLTVEETL
Sbjct  120   SGSGKSTLIDALANRIAKGSLKGKVTLNGEPLQSRTLKVISAYVMQDDLLFPMLTVEETL  179

Query  869   MFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDI  1048
             MF+AEFRLPRSL +S+KK RVQ LIEQLG++ AA T+IGDEGHRG+SGGERRRVSIGIDI
Sbjct  180   MFAAEFRLPRSLPKSKKKLRVQTLIEQLGIKNAANTIIGDEGHRGISGGERRRVSIGIDI  239

Query  1049  IHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLS  1228
             IHDPIVLFLDEPTSGLDSTSAFMVV VL++IA+SGSIVIMS+HQPS+R+L LL+RLIFLS
Sbjct  240   IHDPIVLFLDEPTSGLDSTSAFMVVNVLKKIAESGSIVIMSIHQPSHRVLGLLNRLIFLS  299

Query  1229  KGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQ-  1405
             +G+TVFSGSP+SLP FF  FG+P+PENEN+ EFALD IRELE S  GT+ LV+FNK WQ 
Sbjct  300   RGKTVFSGSPASLPGFFARFGSPVPENENQTEFALDLIRELEGSAGGTRGLVEFNKRWQE  359

Query  1406  -RKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWV  1582
              +  SP ++       PNP  +LK+AISASISRGKLVSG      +   S   FANPFW+
Sbjct  360   MKNRSPPAS-------PNPNLTLKEAISASISRGKLVSGGGGGGGSSVVSHGGFANPFWI  412

Query  1583  EMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMS  1762
             E+  + +RS++NS R PELF  R  AV+VTG ILAT+FW+LD+SPKG+QERLGFFAFAMS
Sbjct  413   EIKTLTERSILNSRRQPELFGTRLAAVLVTGFILATVFWRLDNSPKGVQERLGFFAFAMS  472

Query  1763  TTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWA  1942
             T FYTCA+A+PVFLQERYIFMRETAYNAYRRSSYVLSH+++SLPSL FLSLAFA TT+WA
Sbjct  473   TMFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAVVSLPSLVFLSLAFASTTFWA  532

Query  1943  vglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFI  2122
             VGL GG  GFLF+ L +FASFW+GSSFVTFLSG++ +VM+ YT+VVAILAYF+LFSGFFI
Sbjct  533   VGLEGGPMGFLFYCLIIFASFWSGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFI  592

Query  2123  NRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKL  2302
             NRDRIP YW+WFHY SLVKYP++ VLQNEF  P +CFV+G+Q+FD +PL  +   MKL+L
Sbjct  593   NRDRIPQYWLWFHYLSLVKYPYEAVLQNEFSDPMECFVRGVQMFDNTPLGQLSYGMKLRL  652

Query  2303  LQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIG  2482
             L ++S+++G+ ITSSTCLTTG DIL+Q GVT+++KW+CL +T+  GFFFR LFY  LL G
Sbjct  653   LDSVSRSIGMRITSSTCLTTGADILRQQGVTELSKWSCLLVTVGFGFFFRALFYLCLLFG  712

Query  2483  SKNKRR  2500
             SKNKRR
Sbjct  713   SKNKRR  718



>ref|XP_002871574.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47833.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=726

 Score =   802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/713 (69%), Positives = 577/713 (81%), Gaps = 24/713 (3%)
 Frame = +2

Query  380   TLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRK  559
             T  +LL  V D+     +        H  + L  P     S PFVLSF +L+YSVKVRRK
Sbjct  32    TFAQLLQNVDDTTRRSHDQ------HHVDVDLASP---DQSVPFVLSFTDLTYSVKVRRK  82

Query  560   MGVPAWLGRRTAAPSQ--VENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANR  733
                   +     APS+    +  K LL+ ISGEAR+GEI+AVLGASGSGKSTLIDALANR
Sbjct  83    FTWRRSVSSDPGAPSEGIFSSKTKTLLNGISGEARDGEILAVLGASGSGKSTLIDALANR  142

Query  734   IARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrs  913
             IA+ SL G V +NGEVL SK+ K ISAYVMQDDLLFPMLTVEETLMF+AEFRLPRSLS+S
Sbjct  143   IAKGSLKGNVTLNGEVLNSKMQKAISAYVMQDDLLFPMLTVEETLMFAAEFRLPRSLSKS  202

Query  914   rkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSG  1093
             +K  RVQALI+QLGL+ AA TVIGDEGHRG+SGGERRRVSIGIDIIHDPI+LFLDEPTSG
Sbjct  203   KKSLRVQALIDQLGLRNAANTVIGDEGHRGISGGERRRVSIGIDIIHDPILLFLDEPTSG  262

Query  1094  LDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPR  1273
             LDSTSA  V+KVL+RIAQSGS+VIM++HQPSYR+L LLDRL+FLS+GQTVFSGSP+ LPR
Sbjct  263   LDSTSALSVIKVLKRIAQSGSMVIMTLHQPSYRLLRLLDRLLFLSRGQTVFSGSPAMLPR  322

Query  1274  FFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSW-QRKFSPSSTSNRNNVF  1450
             FF EFG+PIPE+ENR EFALD IRELE S  GT++LV+FNK + QRK  P + +      
Sbjct  323   FFAEFGHPIPEHENRTEFALDLIRELEGSAGGTRSLVEFNKGFRQRKAEPRTQTGL----  378

Query  1451  PNPKPSLKDAISASISRGKLVSGATNI---NSTLSPSVPKFANPFWVEMVVIGKRSMVNS  1621
                  SLK+AISASIS+GKLVSGAT      S+   ++P FANPFWVE+ V+ KRSM NS
Sbjct  379   -----SLKEAISASISKGKLVSGATTTTTPGSSPVSTIPTFANPFWVELAVLAKRSMTNS  433

Query  1622  LRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVF  1801
              R PELF +R GAV+VTG ILAT+FW+LD+SPKG+QERLG FAFAMSTTFYTCA+A+PVF
Sbjct  434   RRQPELFGIRLGAVLVTGFILATMFWQLDNSPKGVQERLGCFAFAMSTTFYTCADALPVF  493

Query  1802  LQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflff  1981
             LQER+IFMRETAYNAYRRSSYVLSHS+++LPSL  LSLAFA  T+W VGL GG  GFLF+
Sbjct  494   LQERFIFMRETAYNAYRRSSYVLSHSLVALPSLIILSLAFAAITFWGVGLDGGLMGFLFY  553

Query  1982  llfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFH  2161
              L + ASFWAGSSFVTFLSG++ +VM+ YT+VVAILAYF+LFSGFFINRDRIP YWIWFH
Sbjct  554   FLVILASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPGYWIWFH  613

Query  2162  YASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINIT  2341
             Y SLVKYP++ VL NEF  P KCFV+G+QIFD +PL AVP+ MK+KLL  MSK+LG+ IT
Sbjct  614   YISLVKYPYEAVLLNEFGDPTKCFVRGVQIFDNTPLVAVPQGMKVKLLATMSKSLGMRIT  673

Query  2342  SSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             SSTCLTTG DIL+Q GVTD+ KWNCLW+T+A GFFFR+LFYF+LL+GSKNKRR
Sbjct  674   SSTCLTTGYDILQQQGVTDLTKWNCLWVTVAWGFFFRILFYFSLLLGSKNKRR  726



>emb|CDX69629.1| BnaA10g19780D [Brassica napus]
Length=728

 Score =   802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/755 (68%), Positives = 599/755 (79%), Gaps = 39/755 (5%)
 Frame = +2

Query  257   MSQASSRDDMSTASSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNN  436
             MS+  + DD    +  LPF  P    E   L+     S S T  +LL  VGD+  ++   
Sbjct  1     MSRVVAADD----NMSLPFFSP----EPNHLSTFSTASSSPTFAQLLKNVGDTTTDQ---  49

Query  437   GVGGANDHRVLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAP----S  604
                    H  + L  P     S PF LSF++L+YSVKVRRK     W    +A P    S
Sbjct  50    ------HHVDMNLTSP---NQSVPFHLSFNDLTYSVKVRRKF---TWKRAPSADPIVGES  97

Query  605   QVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVL  784
              + +  K LL+ ISGEAR+GEI+AVLGASGSGKSTLIDALANRIA+ SL G V +NGEVL
Sbjct  98    PLSSKTKTLLNGISGEARDGEILAVLGASGSGKSTLIDALANRIAKGSLKGNVTLNGEVL  157

Query  785   ESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQT  964
              SK+ K ISAYVMQDDLLFPMLTVEETLMF+AEFRLPRSLS+S+K  RVQALI+QLGL+ 
Sbjct  158   NSKMQKAISAYVMQDDLLFPMLTVEETLMFAAEFRLPRSLSKSKKSLRVQALIDQLGLRN  217

Query  965   AAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIA  1144
             AAKT+IGDEGHRG+SGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSA  VVKVL+RIA
Sbjct  218   AAKTIIGDEGHRGISGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTSALSVVKVLKRIA  277

Query  1145  QSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCE  1324
             QSGS+VIM++HQPSYR+L LLDRL+FLS+GQTVFSGSP+ LP FF EFG+PIPE ENR E
Sbjct  278   QSGSMVIMTLHQPSYRLLRLLDRLLFLSRGQTVFSGSPAMLPSFFAEFGHPIPERENRTE  337

Query  1325  FALDFIRELEQSPEGTKNLVDFNKSW-QRKFSPSSTSNRNNVFPNPKPSLKDAISASISR  1501
             FALD IRELE S  GT++LV+FNK + QRK  P + +           SLK+AISASIS+
Sbjct  338   FALDLIRELEGSAGGTRSLVEFNKEFRQRKAEPRTQTGL---------SLKEAISASISK  388

Query  1502  GKLVSGATNINSTLSPS--VPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTG  1675
             GKLVSGAT+  S  SP   +P FANPFWVE++V+ KRSM N  R PELF +R GAV+VTG
Sbjct  389   GKLVSGATSGGSGSSPVSTIPTFANPFWVELLVLAKRSMTNYRRQPELFGIRLGAVLVTG  448

Query  1676  IILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRR  1855
              ILAT+FW+LD+SPKG+QERLGFFAFAMSTTFYTCA+A+PVFLQER+IFMRETAYNAYRR
Sbjct  449   FILATMFWQLDNSPKGVQERLGFFAFAMSTTFYTCADALPVFLQERFIFMRETAYNAYRR  508

Query  1856  SSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFL  2035
             SSYVLSHS+++LPSL  LSLAFA TT+WAVGL GG  GFLF+ L V A+FWAGSSFVTFL
Sbjct  509   SSYVLSHSLVALPSLIILSLAFAATTFWAVGLDGGLMGFLFYFLIVLAAFWAGSSFVTFL  568

Query  2036  SGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFD  2215
             SG++ +VM+ YT+VVAILAYF+LFSGFFI RDRIP YWIWFHY SLVKYP++ VL NEF 
Sbjct  569   SGVVPHVMLGYTIVVAILAYFLLFSGFFITRDRIPAYWIWFHYISLVKYPYEAVLINEFS  628

Query  2216  YPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVT  2395
              P KCF++G+QIFD +PL AVP+ MK+KLL  MSK+LG+ ITSSTCLTTG DIL+Q GVT
Sbjct  629   DPTKCFIRGVQIFDNTPLAAVPQGMKVKLLSTMSKSLGMRITSSTCLTTGYDILQQQGVT  688

Query  2396  DINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             D++KWNCLWIT+A GFFFR+LFYF+LL+GSKNKRR
Sbjct  689   DLSKWNCLWITVAWGFFFRILFYFSLLLGSKNKRR  723



>ref|NP_196862.1| ABC transporter G family member 6 [Arabidopsis thaliana]
 sp|Q9FNB5.1|AB6G_ARATH RecName: Full=ABC transporter G family member 6; Short=ABC transporter 
ABCG.6; Short=AtABCG6; AltName: Full=White-brown complex 
homolog protein 6; Short=AtWBC6 [Arabidopsis thaliana]
 dbj|BAB08684.1| ABC transporter-like protein [Arabidopsis thaliana]
 gb|AAO41933.1| putative ABC transporter family protein [Arabidopsis thaliana]
 gb|AAO50489.1| putative ABC transporter family protein [Arabidopsis thaliana]
 gb|AED91914.1| ABC transporter G family member 6 [Arabidopsis thaliana]
Length=727

 Score =   800 bits (2067),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/755 (67%), Positives = 591/755 (78%), Gaps = 35/755 (5%)
 Frame = +2

Query  257   MSQASSRDDMSTASSDLPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNN  436
             MS+  + DD    +  LPF  P    E   ++     S   T  +LL  V DS     + 
Sbjct  1     MSRVVAADD----NMALPFFSP----EFGNVS--GASSSPTTFAQLLQNVDDSTRRSHHQ  50

Query  437   GVGGANDHRVLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQ--V  610
                    H  + L  P     S PFVLSF +L+YSVKVRRK      +     APS+   
Sbjct  51    ------HHVDVDLASP---DQSVPFVLSFTDLTYSVKVRRKFTWRRSVSSDPGAPSEGIF  101

Query  611   ENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLES  790
              +  K LL+ I+GEAR+GEI+AVLGASGSGKSTLIDALANRIA+ SL G V +NGEVL S
Sbjct  102   SSKTKTLLNGITGEARDGEILAVLGASGSGKSTLIDALANRIAKGSLKGNVTLNGEVLNS  161

Query  791   KLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAA  970
             K+ K ISAYVMQDDLLFPMLTVEETLMF+AEFRLPRSLS+S+K  RVQALI+QLGL+ AA
Sbjct  162   KMQKAISAYVMQDDLLFPMLTVEETLMFAAEFRLPRSLSKSKKSLRVQALIDQLGLRNAA  221

Query  971   KTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQS  1150
              TVIGDEGHRG+SGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSA  V+KVL+RIAQS
Sbjct  222   NTVIGDEGHRGISGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTSALSVIKVLKRIAQS  281

Query  1151  GSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFA  1330
             GS+VIM++HQPSYR+L LLDRL+FLS+GQTVFSGSP+ LPRFF EFG+PIPE+ENR EFA
Sbjct  282   GSMVIMTLHQPSYRLLRLLDRLLFLSRGQTVFSGSPAMLPRFFAEFGHPIPEHENRTEFA  341

Query  1331  LDFIRELEQSPEGTKNLVDFNKSW-QRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGK  1507
             LD IRELE S  GT++LV+FNK + QRK  P S +           SLK+AISASIS+GK
Sbjct  342   LDLIRELEGSAGGTRSLVEFNKGFRQRKAEPRSQTGL---------SLKEAISASISKGK  392

Query  1508  LVSGATNINSTLS----PSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTG  1675
             LVSGAT    +       ++P FANPFWVE+ V+ KRSM NS R PELF +R GAV+VTG
Sbjct  393   LVSGATTTTHSSGSSPVSTIPTFANPFWVELAVLAKRSMTNSRRQPELFGIRLGAVLVTG  452

Query  1676  IILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRR  1855
              ILAT+FW+LD+SPKG+QERLG FAFAMSTTFYTCA+A+PVFLQER+IFMRETAYNAYRR
Sbjct  453   FILATMFWQLDNSPKGVQERLGCFAFAMSTTFYTCADALPVFLQERFIFMRETAYNAYRR  512

Query  1856  SSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFL  2035
             SSYVLSHS+++LPSL  LSLAFA  T+W VGL GG  GFLF+ L + ASFWAGSSFVTFL
Sbjct  513   SSYVLSHSLVALPSLIILSLAFAAITFWGVGLDGGLMGFLFYFLVILASFWAGSSFVTFL  572

Query  2036  SGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFD  2215
             SG++ +VM+ YT+VVAILAYF+LFSGFFINRDRIP YWIWFHY SLVKYP++ VL NEF 
Sbjct  573   SGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPGYWIWFHYISLVKYPYEAVLLNEFG  632

Query  2216  YPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVT  2395
              P KCFV+G+QIFD +PL AVP+ MK++LL  MSK+LG+ ITSSTCLTTG DIL+Q GVT
Sbjct  633   DPTKCFVRGVQIFDNTPLVAVPQGMKVRLLATMSKSLGMRITSSTCLTTGYDILQQQGVT  692

Query  2396  DINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             D+ KWNCLW+T+A GFFFR+LFYF+LL+GSKNKRR
Sbjct  693   DLTKWNCLWVTVAWGFFFRILFYFSLLLGSKNKRR  727



>ref|XP_010492119.1| PREDICTED: ABC transporter G family member 6 [Camelina sativa]
Length=728

 Score =   800 bits (2065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/722 (69%), Positives = 583/722 (81%), Gaps = 32/722 (4%)
 Frame = +2

Query  368   SVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFPFVLSFHNLSYSVK  547
             S S T  +LL  V ++         GG +D   + + D      S PFVLSF +L+YSVK
Sbjct  28    SSSPTFAQLLQNVDNTTRR------GGHHDQHHVDV-DLTSPDQSVPFVLSFTDLTYSVK  80

Query  548   VRRKMGVPAWLGRRTAAPSQVEND------VKVLLDDISGEAREGEIMAVLGASGSGKST  709
             VRRK     W  RR++ P    ++       K LL+ ISGEAR+GEI+AV+GASGSGKST
Sbjct  81    VRRKF---TW--RRSSDPGAPSSEGLFSSKTKTLLNGISGEARDGEIVAVMGASGSGKST  135

Query  710   LIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFr  889
             LIDALANRIA+ SL G V +NGEVL SK+ K ISAYVMQDDLLFPMLTVEETLMF+AEFR
Sbjct  136   LIDALANRIAKGSLKGNVTLNGEVLNSKMQKAISAYVMQDDLLFPMLTVEETLMFAAEFR  195

Query  890   lprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVL  1069
             LPRSLS+S+K  RVQALI+QLGL+ AA TVIGDEGHRG+SGGERRRVSIGIDIIHDPI+L
Sbjct  196   LPRSLSKSKKSLRVQALIDQLGLRNAANTVIGDEGHRGISGGERRRVSIGIDIIHDPILL  255

Query  1070  FLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFS  1249
             FLDEPTSGLDSTSA  V+KVL+RIAQSGS+VIM++HQPSYR+L LLDRL+FLS+GQTVFS
Sbjct  256   FLDEPTSGLDSTSALSVIKVLKRIAQSGSMVIMTLHQPSYRLLRLLDRLLFLSRGQTVFS  315

Query  1250  GSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSW-QRKFSPSS  1426
             GSP+ LPRFF EFG+PIPE+ENR EFALD IRELE S  GT++LV+FNK + QRK  P +
Sbjct  316   GSPAMLPRFFAEFGHPIPEHENRTEFALDLIRELEGSAGGTRSLVEFNKGFRQRKAEPRT  375

Query  1427  TSNRNNVFPNPKPSLKDAISASISRGKLVSGA--TNINSTLSP--SVPKFANPFWVEMVV  1594
              +           SLK+AISASIS+GKLVSGA  T   S  +P  ++P FANPFWVE+ V
Sbjct  376   QTGL---------SLKEAISASISKGKLVSGANTTTPGSGSNPVSTIPTFANPFWVELAV  426

Query  1595  IGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFY  1774
             + KRSM NS R PELF +R GAV+VTG ILAT+FW+LD+SPKG+QERLG FAFAMSTTFY
Sbjct  427   LAKRSMTNSRRQPELFGIRLGAVLVTGFILATMFWQLDNSPKGVQERLGCFAFAMSTTFY  486

Query  1775  TCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvgla  1954
             TCA+A+PVFLQER+IFMRETAYNAYRRSSYVLSHS+++LPSL  LSLAFA  T+W VGL 
Sbjct  487   TCADALPVFLQERFIFMRETAYNAYRRSSYVLSHSLVALPSLIILSLAFAAITFWGVGLD  546

Query  1955  ggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDR  2134
             GG  GFLF+ L + ASFWAGSSFVTFLSG++ +VM+ YT+VVAILAYF+LFSGFFINRDR
Sbjct  547   GGLMGFLFYFLVILASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDR  606

Query  2135  IPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNM  2314
             IP YWIWFHY SLVKYP++ VL NEF  P KCFV+G+QIFD +PL AVP  MK++LL  M
Sbjct  607   IPGYWIWFHYISLVKYPYEAVLLNEFGDPTKCFVRGVQIFDNTPLVAVPRGMKVRLLATM  666

Query  2315  SKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNK  2494
             SK+LG+ ITSSTCLTTG DIL+Q GVTD+ KWNCLW+T+A GFFFR+LFYF+LL+GSKNK
Sbjct  667   SKSLGMRITSSTCLTTGYDILQQQGVTDLTKWNCLWVTVAWGFFFRILFYFSLLLGSKNK  726

Query  2495  RR  2500
             RR
Sbjct  727   RR  728



>emb|CDX73549.1| BnaC08g24540D [Brassica napus]
Length=756

 Score =   799 bits (2064),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/675 (70%), Positives = 559/675 (83%), Gaps = 27/675 (4%)
 Frame = +2

Query  521   FHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGASGSG  700
             F +L+YSVK+ +K       G  ++    +E + K+LL+ ISGEA+EGE+MAVLGASGSG
Sbjct  94    FKDLTYSVKITKKFNPLPCCG--SSDGDGMEMNTKMLLNGISGEAKEGEMMAVLGASGSG  151

Query  701   KSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSA  880
             KSTLIDALANRIA+ESL G + +NGEVLES L KVISAYVMQDDLLFPMLTVEETLMFSA
Sbjct  152   KSTLIDALANRIAKESLHGAITLNGEVLESGLHKVISAYVMQDDLLFPMLTVEETLMFSA  211

Query  881   EFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDP  1060
             EFRLP SL + +K+ARVQALI+QLGL+ AA TVIGDEGHRGVSGGERRRVSIGIDIIHDP
Sbjct  212   EFRLPSSLPKKKKQARVQALIDQLGLRNAATTVIGDEGHRGVSGGERRRVSIGIDIIHDP  271

Query  1061  IVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQT  1240
             I+LFLDEPTSGLDSTSA++VVKVLQR+AQSGSIVIMS+HQPSYRIL LLD+L+FLS+G T
Sbjct  272   IILFLDEPTSGLDSTSAYIVVKVLQRVAQSGSIVIMSIHQPSYRILGLLDKLLFLSRGNT  331

Query  1241  VFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSP  1420
             V+SGSP+ LPRFF E+G+ IPENEN+ EFALD IRELE SPEGTK LVDF+K W+ K + 
Sbjct  332   VYSGSPTDLPRFFSEYGHIIPENENKTEFALDLIRELEDSPEGTKTLVDFHKQWRAKQTL  391

Query  1421  SSTSNRNNVFPNPKPSLKDAISASISRGKLVS---------------GATNINSTLSPSV  1555
             + T+   NV      SLKDAI ASISR KLVS               G TN+ ST     
Sbjct  392   NETTRNTNV------SLKDAIDASISREKLVSACRAGPEILRDRSSGGETNLKSTFQ---  442

Query  1556  PKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQER  1735
               FANPFW E++VI KRSM+NS R PELF +R GAV+VTG ILAT+F+KLD+SP+GIQER
Sbjct  443   -TFANPFWTEILVIAKRSMLNSRRQPELFGIRLGAVLVTGTILATMFYKLDNSPRGIQER  501

Query  1736  LGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflsl  1915
             LGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVL+H+IISLP+L  LS 
Sbjct  502   LGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLAHTIISLPALVILSA  561

Query  1916  afaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAY  2095
              FA TT+++VGLAGG  GF FF L + A+FWAGSSFVTFLSG++ +VMI +T+VVAILAY
Sbjct  562   TFAATTFFSVGLAGGSEGFFFFFLTILAAFWAGSSFVTFLSGVVSHVMIGFTVVVAILAY  621

Query  2096  FVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKA  2275
             F+LFSGFFI RDRIP YW+WFHY SLVKYP++GVLQNEF+   KCFV+GIQ+FD SPL  
Sbjct  622   FLLFSGFFIARDRIPLYWLWFHYLSLVKYPYEGVLQNEFEDSTKCFVRGIQMFDSSPLGQ  681

Query  2276  VPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrl  2455
             VP+A+K+ LL++MS  LG N+T+ TC+TTG DIL++ G+T+++KWNCLWIT+A GF FR+
Sbjct  682   VPDAVKISLLKSMSGVLGFNVTAETCVTTGVDILRKQGITEMSKWNCLWITVAWGFLFRV  741

Query  2456  lfyfallIGSKNKRR  2500
             LFYF LLIGSKNKRR
Sbjct  742   LFYFTLLIGSKNKRR  756



>ref|XP_009412596.1| PREDICTED: ABC transporter G family member 6-like [Musa acuminata 
subsp. malaccensis]
Length=759

 Score =   799 bits (2064),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/724 (67%), Positives = 584/724 (81%), Gaps = 24/724 (3%)
 Frame = +2

Query  374   SMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYD------PVPYPSSFP--FVLSFHN  529
             ++TLG+L   VGD+   + ++G      H VL+L +         + SS P  FVL+F N
Sbjct  45    AVTLGQLFKHVGDAHSGEGDDGDAAPPPHHVLELDEFSAGAGGGDHLSSRPPTFVLAFTN  104

Query  530   LSYSVKVRRKMGVPAWLGRRTA-------APSQVENDVKVLLDDISGEAREGEIMAVLGA  688
             LSYSVK  RKM +  +   R A       AP +  +  K LL+ ISGEAREGEI AVLGA
Sbjct  105   LSYSVKRPRKMSL--FQRNRLATDPVAALAPPEAFSRTKTLLNSISGEAREGEIFAVLGA  162

Query  689   SGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETL  868
             SGSGKSTLIDALANRI R+SL G++ +NGE L+ +LLKVISAYVMQDDLL+PMLTVEETL
Sbjct  163   SGSGKSTLIDALANRIVRDSLQGSITLNGEKLDGRLLKVISAYVMQDDLLYPMLTVEETL  222

Query  869   MFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDI  1048
             MFSAEFRLPRSLS S+KK+RVQALI+QLGL++AAKT+IGDE HRGVSGGERRRVSIGIDI
Sbjct  223   MFSAEFRLPRSLSVSKKKSRVQALIDQLGLRSAAKTIIGDEIHRGVSGGERRRVSIGIDI  282

Query  1049  IHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLS  1228
             IHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIA SGSIVIMSVHQPSYRIL LLDRL+FLS
Sbjct  283   IHDPIILFLDEPTSGLDSTSAFMVVKVLQRIAHSGSIVIMSVHQPSYRILCLLDRLLFLS  342

Query  1229  KGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQR  1408
             +GQTV+SG P  L RFF +FG+PIP+NEN  EFALD IRELE +P G ++LV+FNKS Q 
Sbjct  343   RGQTVYSGPPEGLHRFFSDFGHPIPDNENPTEFALDLIRELEGTPAGARSLVEFNKSRQD  402

Query  1409  KFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWVEM  1588
             +      + R+++      SL DAI ASISRGKLVSG T   +T + SV K+ANPFW+EM
Sbjct  403   EQPALVPAARSSL------SLNDAIGASISRGKLVSGTTE-GTTSASSVQKYANPFWIEM  455

Query  1589  VVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTT  1768
              V+ KRS  N+ RMPELFA+R  AV++TG ILATIFW+LD+SPKG+QERLGFFA AMST 
Sbjct  456   GVLTKRSFTNTKRMPELFAIRLAAVLLTGFILATIFWRLDNSPKGVQERLGFFAIAMSTM  515

Query  1769  FYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvg  1948
             FYTCA+A+P+FLQER IFMRETAYNAYRRSSYVLSH+I+  P L  LS+AFA+TTY+AVG
Sbjct  516   FYTCADALPIFLQERNIFMRETAYNAYRRSSYVLSHAIVGFPPLILLSVAFALTTYFAVG  575

Query  1949  laggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINR  2128
             LAGG  GF+FF+L + ASFWAGS FVTFLSG++ +VM+ YT+VVAILAYF+LFSGFFINR
Sbjct  576   LAGGMQGFVFFVLIILASFWAGSGFVTFLSGVVTHVMLGYTVVVAILAYFLLFSGFFINR  635

Query  2129  DRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQ  2308
             DRI  YWIWFHY SLVKYP++ V+QNEFD   KCFV+G+Q+FD +PL  +P+A+KL++L+
Sbjct  636   DRIHDYWIWFHYLSLVKYPYEAVMQNEFDDRHKCFVRGVQMFDNTPLGVLPDAIKLRVLK  695

Query  2309  NMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSK  2488
             +MS +LG+NITS TC+TTG DILKQ  +T ++KW+CLW+T+A GF FR LFY +LL+GS+
Sbjct  696   SMSNSLGVNITSRTCITTGTDILKQQSITQLSKWDCLWVTVAWGFLFRFLFYISLLLGSR  755

Query  2489  NKRR  2500
             NKRR
Sbjct  756   NKRR  759



>gb|KFK36825.1| hypothetical protein AALP_AA4G176400 [Arabis alpina]
Length=713

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/673 (68%), Positives = 553/673 (82%), Gaps = 13/673 (2%)
 Frame = +2

Query  497   SSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQV----ENDVKVLLDDISGEAREG  664
             ++ PFVLSF NL+Y+V VR K+       +R     ++    +   K LLD+ISG+ R+G
Sbjct  49    TTVPFVLSFDNLTYNVSVRPKLEFQNLTPQRNTEDPELALTGKPSTKTLLDNISGKTRDG  108

Query  665   EIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFP  844
             EIMAVLGASGSGKSTLIDALANRIA+ SL GTVK+NGE L+S++LK+ISAYVMQDDLLFP
Sbjct  109   EIMAVLGASGSGKSTLIDALANRIAKGSLEGTVKLNGETLQSRMLKIISAYVMQDDLLFP  168

Query  845   MLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerr  1024
             MLTVEETLMF+A+FRLPRSL + +KK RVQALI+QLG++ AA T+IGDEGHRG+SGGERR
Sbjct  169   MLTVEETLMFAADFRLPRSLPKWKKKLRVQALIDQLGIRNAATTIIGDEGHRGISGGERR  228

Query  1025  rvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNL  1204
             RVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVV VL++IAQSGSIVIMS+HQPS+R+L L
Sbjct  229   RVSIGIDIIHDPILLFLDEPTSGLDSTSAFMVVNVLKKIAQSGSIVIMSIHQPSHRVLCL  288

Query  1205  LDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLV  1384
             LDRLIFLS+G TV+SGSP SLPRFF +FG+PIPENEN  EFALDFIRELE S  GT+ LV
Sbjct  289   LDRLIFLSRGHTVYSGSPVSLPRFFADFGSPIPENENITEFALDFIRELEGSATGTRALV  348

Query  1385  DFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSP-SVPK  1561
             +FNK WQ    PSS        P+P  +LK+AI+ASISRGKLVSG  +I +T +  +VP 
Sbjct  349   EFNKRWQEMTPPSS--------PHPNLTLKEAIAASISRGKLVSGGESIGTTTTILAVPA  400

Query  1562  FANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLG  1741
             FANP W+E+  + +RSM+NS R PELF ++  AV VTG ILAT+FW+LD+SPKGI+ERLG
Sbjct  401   FANPMWIEIKTLSQRSMLNSRRQPELFGIKLVAVFVTGFILATVFWRLDNSPKGIRERLG  460

Query  1742  FFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslaf  1921
             FF+FAMST +YTCA+A+P FL+ERYIFMRETAYN YRRSSYVLSH+I+S P L  L+LAF
Sbjct  461   FFSFAMSTMYYTCAQALPEFLEERYIFMRETAYNTYRRSSYVLSHAIVSFPGLIVLTLAF  520

Query  1922  aVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFV  2101
             A+ T+WAVGL GG  G LF+ L + ASFW+GSSFVTFLSG+I NVM+ YT+VVAILAYF+
Sbjct  521   AIPTFWAVGLDGGPMGLLFYCLIILASFWSGSSFVTFLSGVIPNVMVGYTIVVAILAYFL  580

Query  2102  LFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVP  2281
             LF GFFIN++RIP YWIWFHY SLVKYP++ VLQNEF    KCFV+G+Q FD +PL+ +P
Sbjct  581   LFCGFFINKNRIPDYWIWFHYLSLVKYPYEAVLQNEFSDATKCFVRGVQTFDNTPLEELP  640

Query  2282  EAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllf  2461
               MKL +L  +S++LG NITSSTCLTTG DIL    V  ++KW+CL++T+A GFFFR LF
Sbjct  641   YDMKLSMLDTVSQSLGKNITSSTCLTTGADILMHQSVNQLSKWHCLFVTVAFGFFFRALF  700

Query  2462  yfallIGSKNKRR  2500
             YF+LL+GSKNKRR
Sbjct  701   YFSLLLGSKNKRR  713



>ref|XP_009144100.1| PREDICTED: ABC transporter G family member 1-like [Brassica rapa]
Length=755

 Score =   793 bits (2047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/627 (73%), Positives = 534/627 (85%), Gaps = 10/627 (2%)
 Frame = +2

Query  641   ISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYV  820
             ISGE R+GEIMAVLGASGSGKSTLIDALANRIA+ SL GTVK+NGE L+S+ LKVISAYV
Sbjct  132   ISGETRDGEIMAVLGASGSGKSTLIDALANRIAKGSLKGTVKLNGETLQSRTLKVISAYV  191

Query  821   MQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghr  1000
             MQDDLLFPMLTVEETLMF+AEFRLPRSL +S+KK RVQALIEQLG++ AAKT+IGDEGHR
Sbjct  192   MQDDLLFPMLTVEETLMFAAEFRLPRSLPKSKKKLRVQALIEQLGIKNAAKTIIGDEGHR  251

Query  1001  gvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQ  1180
             G+SGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSA+MVVKVL+RIAQSGSIVIMS+HQ
Sbjct  252   GISGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTSAYMVVKVLKRIAQSGSIVIMSIHQ  311

Query  1181  PSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQS  1360
             PS+R+L LL+RLIFLS+G TVFSGSP SLPRFF EFG+PIPENENR EFALD IRELE S
Sbjct  312   PSHRVLGLLNRLIFLSRGNTVFSGSPGSLPRFFAEFGSPIPENENRTEFALDLIRELEGS  371

Query  1361  PEGTKNLVDFNKSWQRKFSPSSTSNRNNVF-----PNPKPSLKDAISASISRGKLVSGAT  1525
               GT+ L++FNK WQ        +NR         P P  +LK+AI+ASISRGKLVSG  
Sbjct  372   AGGTRGLIEFNKKWQEM---KKENNRQPPLTPPASPYPNLTLKEAIAASISRGKLVSGGE  428

Query  1526  NINSTLSP--SVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFW  1699
             +  +T +   +VP FAN  W+E+V + KRSM+NS R PELF +R  +VV+TG ILAT+FW
Sbjct  429   SATATAATTLTVPAFANSIWIEIVTLSKRSMLNSRRQPELFGIRLASVVITGFILATVFW  488

Query  1700  KLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHs  1879
             ++D+SPKG+QERLGFFAFAMST FYTCAEA+PVFLQERYIFMRETAYNAYRRSSYVLSH+
Sbjct  489   RIDNSPKGVQERLGFFAFAMSTMFYTCAEALPVFLQERYIFMRETAYNAYRRSSYVLSHA  548

Query  1880  iislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVM  2059
             I++ PSL FLS+AFA TT+WAVGL GG  GFLF+ L + ASFW+GSSFVTFLSGI+ +VM
Sbjct  549   IVAFPSLIFLSVAFAATTFWAVGLDGGPMGFLFYCLIILASFWSGSSFVTFLSGIVPHVM  608

Query  2060  IAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVK  2239
             + YT+VVAILAYF+LFSGFFINR+RIP YWIWFHY SLVKYP++ VLQNEF    KCFV+
Sbjct  609   LGYTIVVAILAYFLLFSGFFINRNRIPDYWIWFHYMSLVKYPYEAVLQNEFSDATKCFVR  668

Query  2240  GIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCL  2419
             G+QIFD +PL  +PE MKL+LL ++S++LG  I+SSTCLTTG DIL Q GVT ++KWNCL
Sbjct  669   GVQIFDNTPLGVLPEGMKLRLLDSVSRSLGTTISSSTCLTTGADILTQQGVTQLSKWNCL  728

Query  2420  WITIAlgfffrllfyfallIGSKNKRR  2500
              IT+  GFFFR LFYF LL+GSKNKRR
Sbjct  729   LITVGFGFFFRALFYFCLLLGSKNKRR  755



>ref|XP_009406965.1| PREDICTED: ABC transporter G family member 6-like [Musa acuminata 
subsp. malaccensis]
Length=759

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/724 (68%), Positives = 580/724 (80%), Gaps = 22/724 (3%)
 Frame = +2

Query  374   SMTLGELLHRVGD--SAGEKLNNGVGGANDHRVLQLYDPVPYPSS--------FPFVLSF  523
             S+TLG+L  RVGD  S G    N    + +H VL+L +      +         PFVL+F
Sbjct  43    SITLGQLFKRVGDAHSGGGVTENDGYASPEHHVLELDEFAAEGGAGDHLASRPVPFVLAF  102

Query  524   HNLSYSVKVRRKMGV--PAWLGRRTAA---PSQVENDVKVLLDDISGEAREGEIMAVLGA  688
              +LSYSVK  RKM +     L    AA   P +  +  K LL+ ISGEAREGEI AVLGA
Sbjct  103   TDLSYSVKKNRKMSLFRTNGLAVDPAAGLPPMEAISGTKTLLNSISGEAREGEIFAVLGA  162

Query  689   SGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETL  868
             SGSGKSTLIDALANRI RESL G++ +NGE LE +LLKVISAYVMQDDLL+PMLTVEETL
Sbjct  163   SGSGKSTLIDALANRIVRESLQGSITLNGEKLEGRLLKVISAYVMQDDLLYPMLTVEETL  222

Query  869   MFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDI  1048
             MFSAEFRLPRSLS S+KK+RVQALI+QLGL++AAKT+IGDE HRGVSGGERRRVSIGIDI
Sbjct  223   MFSAEFRLPRSLSASKKKSRVQALIDQLGLRSAAKTIIGDEIHRGVSGGERRRVSIGIDI  282

Query  1049  IHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLS  1228
             IHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIA SGSIVIMSVHQPSYRIL LLDRL+FLS
Sbjct  283   IHDPIILFLDEPTSGLDSTSAFMVVKVLQRIAHSGSIVIMSVHQPSYRILCLLDRLLFLS  342

Query  1229  KGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQR  1408
             +GQTV+SG P  +PRFF +FG+PIP+NEN  EFALD IRE E +P+G K LVDFNKS Q 
Sbjct  343   RGQTVYSGPPDGIPRFFADFGHPIPDNENPTEFALDLIRESEGTPDGAKPLVDFNKSRQN  402

Query  1409  KFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWVEM  1588
                  +T+  ++V      SLKDAISASISRGKLVSGAT+  +T + SV K ANPFW+EM
Sbjct  403   TQLALTTAEESSV------SLKDAISASISRGKLVSGATD-RTTSASSVQKHANPFWIEM  455

Query  1589  VVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTT  1768
              V+ KRS  N+ RMPELFA+R GAV+VTG ILATIFW+LD+SPKG+QERLGFFA AMST 
Sbjct  456   AVLTKRSFTNTKRMPELFAIRLGAVLVTGFILATIFWRLDNSPKGVQERLGFFAIAMSTM  515

Query  1769  FYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvg  1948
             FYTCA+A+PVFLQER IFMRETAYNAYRRSSYVLSH+I+  P L  LS+AF++TT++AVG
Sbjct  516   FYTCADALPVFLQERNIFMRETAYNAYRRSSYVLSHAIVGFPPLILLSIAFSLTTFFAVG  575

Query  1949  laggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINR  2128
             LAGG  GFLFF+L V ASFWAGS FVTFLSG++ +VM+ YT+VVAILAYF+LFSGFFI R
Sbjct  576   LAGGTQGFLFFVLIVLASFWAGSGFVTFLSGVVTHVMLGYTVVVAILAYFLLFSGFFITR  635

Query  2129  DRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQ  2308
             DRI  YWIWFHY SLVKYP++ V+QNEFD   KCF +G+Q+FD +PL  +P+ MKL +L+
Sbjct  636   DRIHDYWIWFHYMSLVKYPYEAVMQNEFDDSHKCFARGVQMFDNTPLGGLPDVMKLNVLK  695

Query  2309  NMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSK  2488
             +MS +LG NIT +TC+TTG DILKQ  +T ++KW CLW+T+A GF FR LFY ALL+GS+
Sbjct  696   SMSNSLGANITGTTCITTGTDILKQQSITQLDKWECLWVTVAWGFLFRFLFYIALLLGSR  755

Query  2489  NKRR  2500
             NKRR
Sbjct  756   NKRR  759



>ref|XP_003558198.1| PREDICTED: ABC transporter G family member 16-like [Brachypodium 
distachyon]
Length=788

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/733 (64%), Positives = 570/733 (78%), Gaps = 21/733 (3%)
 Frame = +2

Query  359   PRHSVSMTLGELLHRVGDSAGE-------------KLNNGVGGANDHRVLQLYDPVPYPS  499
             P    S TL +LL RV ++  +             +L     G+      +L       +
Sbjct  58    PTKQSSFTLAQLLKRVNEARSDVSSPNSSPSHYTIELGGSAPGSTGSDGSELTAHAGVGT  117

Query  500   SFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAV  679
               PFVL F +L+YSVK R+K      L  R AA  +    +K LLD+ISGEAREGEIMAV
Sbjct  118   LLPFVLKFTDLTYSVKQRKKGPCLPALPFRAAAEPEAPR-MKTLLDNISGEAREGEIMAV  176

Query  680   LGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVE  859
             LGASGSGKSTLIDALANRI +ESL G+V +NGE +++ LLKVISAYVMQDDLL+PMLTVE
Sbjct  177   LGASGSGKSTLIDALANRIRKESLHGSVTLNGESMDNNLLKVISAYVMQDDLLYPMLTVE  236

Query  860   ETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsig  1039
             ETLMFSAEFRLPRSL    KK RVQALI+QLGL+ AA T+IGDEGHRGVSGGERRRVSIG
Sbjct  237   ETLMFSAEFRLPRSLPTKEKKKRVQALIDQLGLRNAANTIIGDEGHRGVSGGERRRVSIG  296

Query  1040  iDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLI  1219
             +DIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGS+V+MS+HQPSYRIL LLDRL+
Sbjct  297   VDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSVVVMSIHQPSYRILGLLDRLL  356

Query  1220  FLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKS  1399
             FLS+GQTV+ G P +L  FF +FG PI +NEN  EFALD +RELE  P+G ++LV+ NKS
Sbjct  357   FLSRGQTVYYGPPGALSSFFHDFGKPIHDNENPTEFALDLVRELETMPDGARDLVEHNKS  416

Query  1400  WQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPS------VPK  1561
             WQ++  P    + ++    P  SLK+AISASISRGKLVSGAT+ N T+S S      V K
Sbjct  417   WQKRMGPK-MKHHDDDGEKPSLSLKEAISASISRGKLVSGATDGNVTVSSSASPESAVSK  475

Query  1562  FANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLG  1741
             FANPFWVEM V+ +R+ +N+ R PE+F +R GAV++TG ILATIFW+LDDSPKG++ERLG
Sbjct  476   FANPFWVEMGVLTRRAFLNTKRTPEIFVIRLGAVLITGFILATIFWRLDDSPKGVEERLG  535

Query  1742  FFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslaf  1921
             FFA AMST FYTC++A+PVFL ERYIF+RETAYNAYRRSSYVLSH+I+  PSL  LSLAF
Sbjct  536   FFAIAMSTMFYTCSDALPVFLNERYIFLRETAYNAYRRSSYVLSHTIVGFPSLIVLSLAF  595

Query  1922  aVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFV  2101
             AVTT++AVGLAGG  GF FF+  V ASFWAGS F TFLSG++ NVM+ + +VV+ LAYF+
Sbjct  596   AVTTFFAVGLAGGVDGFFFFVAIVLASFWAGSGFATFLSGVVTNVMLGFPVVVSTLAYFL  655

Query  2102  LFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVP  2281
             LFSGFFINRDRIP YW+WFHYASLVKYP++ V+ NEF  P +CFV+G+Q+FD +PL  + 
Sbjct  656   LFSGFFINRDRIPKYWLWFHYASLVKYPYEAVMINEFSDPSRCFVRGVQMFDNTPLSILS  715

Query  2282  EAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllf  2461
              A+K+++L+ MS +LGINI +STC+TTGPD LKQ  V D+ KW CLWIT+A GF FR+LF
Sbjct  716   PAVKVRVLRAMSSSLGINIGTSTCITTGPDFLKQQAVNDLTKWECLWITVAWGFLFRILF  775

Query  2462  yfallIGSKNKRR  2500
             Y ALL+GS+NKRR
Sbjct  776   YIALLLGSRNKRR  788



>gb|KFK36826.1| hypothetical protein AALP_AA4G176500 [Arabis alpina]
Length=691

 Score =   779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/672 (66%), Positives = 538/672 (80%), Gaps = 15/672 (2%)
 Frame = +2

Query  497   SSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQV----ENDVKVLLDDISGEAREG  664
             +S PFVLSF NL+Y V V  K+     + RR    S++    +   K LLD+ISGE R+G
Sbjct  31    TSVPFVLSFDNLTYKVSVPWKLEFRNLITRRKTEDSELALAEKPSSKTLLDNISGETRDG  90

Query  665   EIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFP  844
             EIMAVLGASGSGKSTLIDALANRIA+ SL G VK+NGE L+S++LKVISAYVMQDDLL+P
Sbjct  91    EIMAVLGASGSGKSTLIDALANRIAKGSLEGAVKLNGETLQSRMLKVISAYVMQDDLLYP  150

Query  845   MLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerr  1024
             MLTVEETLMF+AEFR+PRSL +S+KK RVQALI+QLG++ AA+T+IGDEGHRG+SGGERR
Sbjct  151   MLTVEETLMFAAEFRMPRSLPKSKKKLRVQALIDQLGIRNAAQTIIGDEGHRGISGGERR  210

Query  1025  rvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNL  1204
             RVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVV VL++IAQSGSIVIMS+HQPS+R+L L
Sbjct  211   RVSIGIDIIHDPILLFLDEPTSGLDSTSAFMVVNVLKKIAQSGSIVIMSIHQPSHRVLCL  270

Query  1205  LDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLV  1384
             LDRLIFLS+GQTV+SGSP+SLPRFF +FG PIP+NEN  EF LD IRE E S  GT+ LV
Sbjct  271   LDRLIFLSRGQTVYSGSPASLPRFFADFGKPIPQNENITEFTLDLIREFEGSATGTRALV  330

Query  1385  DFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKF  1564
             +FNK WQ    PSS+        +P  +LK+AI+ASISRGKLVSG  +  +T +  VP F
Sbjct  331   EFNKKWQEMTPPSSS--------HPNLTLKEAIAASISRGKLVSGGQSGGATTTLVVPAF  382

Query  1565  ANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGF  1744
             ANP W+E+  + KRSM+NS R PE FA++  +VV+T  ILAT+FW LD+SP+GIQERLGF
Sbjct  383   ANPIWIEIKTLSKRSMLNSCRQPEFFAIKLASVVITAFILATVFWGLDNSPQGIQERLGF  442

Query  1745  FAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafa  1924
             FAFAMST +YTC EA+P FLQERYIFMRETAYN YRRSSYVLSH+I+S P L  L++AFA
Sbjct  443   FAFAMSTMYYTCVEALPDFLQERYIFMRETAYNTYRRSSYVLSHAIVSFPGLIVLTVAFA  502

Query  1925  VTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVL  2104
               T+WAVGL GGF  +   +L  +   W GSSFVTFLS I+ N+M+ YT+ VAILAYF+L
Sbjct  503   AMTFWAVGLDGGFLFYCLIILASY---WLGSSFVTFLSAIVPNLMLGYTISVAILAYFLL  559

Query  2105  FSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPE  2284
             FSGFFINR+RIP YWIWFHY SLVKY ++ VLQNEF   +KCFV+G+Q FD +PL+ +P 
Sbjct  560   FSGFFINRNRIPDYWIWFHYMSLVKYSYEAVLQNEFSDANKCFVRGVQTFDNTPLEELPY  619

Query  2285  AMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfy  2464
              MKL LL  +S++LG  ITSSTCLTT  DI+   GVT ++KW+ L IT+A+GFF R+LFY
Sbjct  620   EMKLNLLDTVSQSLGTTITSSTCLTTSADIMTHQGVTQLSKWHWLLITVAVGFFLRVLFY  679

Query  2465  fallIGSKNKRR  2500
               LL+GSKNKRR
Sbjct  680   LCLLLGSKNKRR  691



>ref|XP_004984786.1| PREDICTED: ABC transporter G family member 16-like [Setaria italica]
Length=794

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/741 (63%), Positives = 578/741 (78%), Gaps = 29/741 (4%)
 Frame = +2

Query  362   RHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSS-------------  502
             +   S TL +LL RV ++  +  +      + H  ++L   VP  +              
Sbjct  55    KQQQSFTLAQLLKRVNEARSDASSPTSSPTHSHYTIELGGSVPGSTGSDLSEHMHGGGRG  114

Query  503   -----FPFVLSFHNLSYSVKVRRKMG-VPAWLGRRTAA-PSQVEN-DVKVLLDDISGEAR  658
                   PFVL F +L+YSVK R+K   +PA   RR    P++ E   +K LLD+ISGEAR
Sbjct  115   GDGPLLPFVLKFTDLTYSVKQRKKGSCLPALPFRRGGGEPAEPEAPRMKTLLDNISGEAR  174

Query  659   EGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLL  838
             EGEIMAVLGASGSGKSTLIDALANRI +ESL G+V +NGE L+S LLKVISAYVMQDDLL
Sbjct  175   EGEIMAVLGASGSGKSTLIDALANRIVKESLHGSVTLNGESLDSNLLKVISAYVMQDDLL  234

Query  839   FPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsgge  1018
             +PMLTVEETLMF+AEFRLPRSL    KK RVQALI+QLGL+ AA T+IGDEGHRGVSGGE
Sbjct  235   YPMLTVEETLMFAAEFRLPRSLPTKEKKKRVQALIDQLGLRNAAGTIIGDEGHRGVSGGE  294

Query  1019  rrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRIL  1198
             RRRVSIG+DIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGS+V+MS+HQPSYRIL
Sbjct  295   RRRVSIGVDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSVVVMSIHQPSYRIL  354

Query  1199  NLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKN  1378
              LLDRL+FLS+GQTV+ G P +LP FF +FG PIP NEN  EFALD IRELE  P+G ++
Sbjct  355   GLLDRLLFLSRGQTVYYGPPGALPSFFDDFGKPIPGNENPTEFALDLIRELETMPDGARD  414

Query  1379  LVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTL-----  1543
             LV+ N+ WQ + +P +  + +     P  SLK+AISASISRGKLVSGAT+ + ++     
Sbjct  415   LVEHNRKWQMRMAPKA-KHHDGRGEKPSLSLKEAISASISRGKLVSGATDGSVSVHSGEP  473

Query  1544  --SPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSP  1717
               + +V KFANPFW+EM V+ +R+ +N+ R PE+F +R  AV+VTG ILATIFW+LDDSP
Sbjct  474   LPAAAVSKFANPFWIEMGVLTRRAFINTKRTPEIFIIRLAAVLVTGFILATIFWRLDDSP  533

Query  1718  KGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislps  1897
             KG+QERLGFFA AMST FYTC++A+PVFL ERYIF+RETAYNAYRRSSYVLSH+I+  PS
Sbjct  534   KGVQERLGFFAIAMSTMFYTCSDALPVFLNERYIFLRETAYNAYRRSSYVLSHTIVGFPS  593

Query  1898  laflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLV  2077
             L  LSLAFA+TT++AVGLAGG  GF FF+  V ASFWAGS F TFLSG++ NVM+ Y +V
Sbjct  594   LIVLSLAFALTTFFAVGLAGGAEGFFFFVAIVLASFWAGSGFATFLSGVVTNVMLGYPVV  653

Query  2078  VAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFD  2257
             V+ LAYF+LFSGFFINRDRIP YWIWFHY SLVKYP++ V+QNEF  P +CFV+G+Q+FD
Sbjct  654   VSTLAYFLLFSGFFINRDRIPRYWIWFHYLSLVKYPYEAVMQNEFSDPGRCFVRGVQMFD  713

Query  2258  GSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAl  2437
              +PL A+P  +K+++L+ MS++LG++I ++TC+TTGPD L Q  VTD+ KW+CLWIT+A 
Sbjct  714   NTPLAALPGVLKVRVLRAMSQSLGVDIGTATCITTGPDFLAQQAVTDLTKWDCLWITVAW  773

Query  2438  gfffrllfyfallIGSKNKRR  2500
             GF FR+LFY +LL+GS+NKRR
Sbjct  774   GFLFRILFYISLLLGSRNKRR  794



>emb|CDY02906.1| BnaC04g25800D [Brassica napus]
Length=1285

 Score =   798 bits (2062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/726 (67%), Positives = 584/726 (80%), Gaps = 35/726 (5%)
 Frame = +2

Query  359   PRHSV----SMTLGELLHRVGD----SAGEK--LNNGVGGANDHRVLQLYDPVPYPSSFP  508
             P HS+    S+TLG+LL  V D      G++  L++  G        Q YD +  P   P
Sbjct  583   PYHSMEIGSSLTLGQLLKNVSDVRKVDVGDETPLHSSQGD-------QDYDDLMRP--VP  633

Query  509   FVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGA  688
             FVLSF+NL+Y+V VRRK  +   + RR+ + S+     K LLD+ISGE R+GEI+AVLGA
Sbjct  634   FVLSFNNLTYNVSVRRKFDL---IPRRSLSSSKT----KTLLDNISGETRDGEILAVLGA  686

Query  689   SGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETL  868
             SGSGKSTLIDALANRIA+ SL G V +NGE L+S+ LKVISAYVMQDDLLFPMLTVEETL
Sbjct  687   SGSGKSTLIDALANRIAKGSLKGKVTLNGEPLQSRTLKVISAYVMQDDLLFPMLTVEETL  746

Query  869   MFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDI  1048
             MF+AEFRLPRSL +S+KK RVQ LIEQLG++ AA T+IGDEGHRG+SGGERRRVSIGIDI
Sbjct  747   MFAAEFRLPRSLPKSKKKLRVQTLIEQLGIKNAANTIIGDEGHRGISGGERRRVSIGIDI  806

Query  1049  IHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLS  1228
             IHDPIVLFLDEPTSGLDSTSAFMVV VL++IA+SGSIVIMS+HQPS+R+L LL+RLIFLS
Sbjct  807   IHDPIVLFLDEPTSGLDSTSAFMVVNVLKKIAESGSIVIMSIHQPSHRVLGLLNRLIFLS  866

Query  1229  KGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQ-  1405
             +G+TVFSGSP+SLP FF  FG+P+PENEN+ EFALD IRELE S  GT+ LV+FNK WQ 
Sbjct  867   RGKTVFSGSPASLPGFFARFGSPVPENENQTEFALDLIRELEGSAGGTRGLVEFNKRWQE  926

Query  1406  -RKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWV  1582
              +  SP ++       PNP  +LK+AISASISRGKLVSG      +   S   FANPFW+
Sbjct  927   MKNLSPPAS-------PNPNLTLKEAISASISRGKLVSGGGGGGGSSVASHGGFANPFWI  979

Query  1583  EMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMS  1762
             E+  + +RS++NS R PELF  R   V++TG ILAT+FW+LD+SPKG+QERLGFFAFAMS
Sbjct  980   EIKTLTERSILNSRRQPELFGTRLVTVLITGFILATVFWRLDNSPKGVQERLGFFAFAMS  1039

Query  1763  TTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWA  1942
             T FYTCA+A+PVFLQERYIFMRETAYNAYRRSSYVLSH+++SLPSL FLSLAFA TT+WA
Sbjct  1040  TMFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAVVSLPSLIFLSLAFAATTFWA  1099

Query  1943  vglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFI  2122
             VGL GG  GFLF+ L +FASFW+GSSFVTFLSG++ +VM+ YT+VVAILAYF+LFSGFFI
Sbjct  1100  VGLEGGPMGFLFYCLIIFASFWSGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFI  1159

Query  2123  NRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKL  2302
             NRDRIP YW+WFHY SLVKYP++ VLQNEF  P +CFV+G+Q+FD +PL  +   MKL+L
Sbjct  1160  NRDRIPQYWLWFHYLSLVKYPYEAVLQNEFSDPMECFVRGVQMFDNTPLGQLSYGMKLRL  1219

Query  2303  LQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIG  2482
             L ++S+++G+ IT STCLTTG DILKQ GVT+++KW+CL +TI  GFFFR+LFY  LL G
Sbjct  1220  LDSVSRSIGMRITGSTCLTTGADILKQQGVTELSKWSCLLVTIGFGFFFRVLFYLCLLFG  1279

Query  2483  SKNKRR  2500
             SKNKRR
Sbjct  1280  SKNKRR  1285


 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/582 (60%), Positives = 449/582 (77%), Gaps = 26/582 (4%)
 Frame = +2

Query  482   PVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEARE  661
             P+P  S     L+F++L+Y V + R+ G  +       +P+QV    K LL+ I+GE +E
Sbjct  17    PIPLLS-----LAFNDLTYKVTLPRRFGFRS-----RRSPAQV----KTLLNGITGETKE  62

Query  662   GEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLF  841
             GEI+A+LGASGSGKSTLIDALA RI+  SL GTV +NGE L+S++L+VISAYVMQDDLLF
Sbjct  63    GEILAILGASGSGKSTLIDALAGRISEGSLKGTVTLNGEALQSRVLQVISAYVMQDDLLF  122

Query  842   PMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsgger  1021
             PMLTV+ETLMF+AEFRLPRSL +S+K+ RV+ LI+QLGL+T   T+IGDEGHRGVSGGER
Sbjct  123   PMLTVQETLMFAAEFRLPRSLPKSKKRDRVETLIDQLGLRTVKNTMIGDEGHRGVSGGER  182

Query  1022  rrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILN  1201
             RRVSIG DIIHDPIVLFLDEPTSGLDSTSAFMVV+VL++IA SGSIV MS+HQPS RI+ 
Sbjct  183   RRVSIGTDIIHDPIVLFLDEPTSGLDSTSAFMVVQVLKKIACSGSIVFMSIHQPSCRIME  242

Query  1202  LLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNL  1381
              LDRL+ LS GQ VFS SP++LP FF EFG PIP+ EN  EF LD I++LE S EG + L
Sbjct  243   FLDRLLVLSSGQCVFSDSPATLPLFFSEFGRPIPDKENNAEFTLDLIKDLEGSSEGARRL  302

Query  1382  VDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPK  1561
             V+FN+SWQ+K    S    +N  P     L + I+ASI+RGKLV+ + N       S   
Sbjct  303   VEFNRSWQQKKLRGSQEPHHNSSP-----LIETINASITRGKLVTTSYN-------SKAS  350

Query  1562  FANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLG  1741
             + NP+WVE +++ KR M+N  R PEL   R   V++TG +LAT++W++DDSP+G+QERL 
Sbjct  351   YVNPWWVETLILAKRYMINWTRTPELIGTRVFIVMMTGFLLATVYWRVDDSPRGVQERLS  410

Query  1742  FFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslaf  1921
             FF+FAM+T FY+CA+ +P F+QERYIFMRETA+NAYRRSSYV+SHS+++LP L  LS+ F
Sbjct  411   FFSFAMATMFYSCADGLPAFIQERYIFMRETAHNAYRRSSYVISHSLVTLPHLFALSVGF  470

Query  1922  aVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFV  2101
             A TT+W VGL GG +GF+++LL +FASFW+G SFVTF+SG+I NVM++Y +    L+Y +
Sbjct  471   AATTFWFVGLNGGIAGFIYYLLIIFASFWSGCSFVTFVSGVIPNVMMSYMVTFGYLSYCL  530

Query  2102  LFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDK  2227
             LFSGF+INRDRI  YWIW HY SL+KYP++ VL NEFD P +
Sbjct  531   LFSGFYINRDRIHLYWIWIHYISLLKYPYEAVLHNEFDDPSR  572



>emb|CDX74853.1| BnaA05g05990D [Brassica napus]
Length=617

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/620 (73%), Positives = 524/620 (85%), Gaps = 13/620 (2%)
 Frame = +2

Query  671   MAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPML  850
             MAVLGASGSGKSTLIDALANRIA+ SL GTVK+NGE L+S+ LKVISAYVMQDDLLFPML
Sbjct  1     MAVLGASGSGKSTLIDALANRIAKGSLKGTVKLNGETLQSRTLKVISAYVMQDDLLFPML  60

Query  851   TVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrv  1030
             TVEETLMF+AEFRLPRSL +S+KK RVQALIEQLG++ AAKT+IGDEGHRG+SGGERRRV
Sbjct  61    TVEETLMFAAEFRLPRSLPKSKKKLRVQALIEQLGIKNAAKTIIGDEGHRGISGGERRRV  120

Query  1031  sigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLD  1210
             SIGIDIIHDPI+LFLDEPTSGLDSTSA+MVVKVL+RIAQSGSIVIMS+HQPS+R+L LL+
Sbjct  121   SIGIDIIHDPILLFLDEPTSGLDSTSAYMVVKVLKRIAQSGSIVIMSIHQPSHRVLGLLN  180

Query  1211  RLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDF  1390
             RLIFLS+G TVFSGSP SLPRFF EFG+PIPENENR EFALD IRELE S  GT+ L++F
Sbjct  181   RLIFLSRGNTVFSGSPGSLPRFFAEFGSPIPENENRTEFALDLIRELEGSAGGTRGLIEF  240

Query  1391  NKSWQRKFSPSSTSNRNNVF-----PNPKPSLKDAISASISRGKLVSGATN-----INST  1540
             NK WQ        +NR         P P  +LK+AI+ASISRGKLVSG  +       + 
Sbjct  241   NKKWQEM---KKENNRQPPLTPPASPYPNLTLKEAIAASISRGKLVSGGESAAISTSTAA  297

Query  1541  LSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPK  1720
              + +VP FAN  W+E+V + KRSM+NS R PELF +R  +VV+TG ILAT+FW++D+SPK
Sbjct  298   TTLTVPAFANSIWIEIVTLSKRSMLNSRRQPELFGIRLASVVITGFILATVFWRIDNSPK  357

Query  1721  GIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpsl  1900
             G+QERLGFFAFAMST FYTCAEA+PVFLQERYIFMRETAYNAYRRSSYVLSH+I++ PSL
Sbjct  358   GVQERLGFFAFAMSTMFYTCAEALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVAFPSL  417

Query  1901  aflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVV  2080
              FLS+AFA TT+WAVGL GG  GFLF+ L + ASFW+GSSFVTFLSGI+ +VM+ YT+VV
Sbjct  418   IFLSVAFAATTFWAVGLDGGPMGFLFYCLIILASFWSGSSFVTFLSGIVPHVMLGYTIVV  477

Query  2081  AILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDG  2260
             AILAYF+LFSGFFINR+RIP YWIWFHY SLVKYP++ VLQNEF    KCFV+G+QIFD 
Sbjct  478   AILAYFLLFSGFFINRNRIPDYWIWFHYMSLVKYPYEAVLQNEFSDATKCFVRGVQIFDN  537

Query  2261  SPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlg  2440
             +PL  +PE MKL+LL ++S++LG  I+SSTCLTTG DIL Q GVT ++KWNCL IT+  G
Sbjct  538   TPLGVLPEGMKLRLLDSVSRSLGTTISSSTCLTTGADILTQQGVTQLSKWNCLLITVGFG  597

Query  2441  fffrllfyfallIGSKNKRR  2500
             FFFR LFYF LL+GSKNKRR
Sbjct  598   FFFRALFYFCLLLGSKNKRR  617



>ref|XP_006480523.1| PREDICTED: ABC transporter G family member 20-like [Citrus sinensis]
Length=679

 Score =   776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/665 (68%), Positives = 546/665 (82%), Gaps = 10/665 (2%)
 Frame = +2

Query  515   LSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGASG  694
             LSF NLSY V+V +++ +P +  +   A SQ E + K+LLD+ISG+AREGEIMA+LGASG
Sbjct  22    LSFDNLSYRVQVSKQLQLP-FFWKAKFAGSQ-EPNTKLLLDNISGQAREGEIMAILGASG  79

Query  695   SGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMF  874
             +GK+TL+DALA RI +ESL G V +NGEVLESKLLK+ISAYVMQDDLLFPMLTVEETLMF
Sbjct  80    AGKTTLMDALAGRIEKESLQGAVTLNGEVLESKLLKIISAYVMQDDLLFPMLTVEETLMF  139

Query  875   SAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIH  1054
             +AEFRLPRS+++++K+ RV+ALI QLGL++AAKT IGDE HRGVSGGERRRVSIGI IIH
Sbjct  140   AAEFRLPRSVTKTKKQERVEALISQLGLRSAAKTFIGDERHRGVSGGERRRVSIGIHIIH  199

Query  1055  DPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKG  1234
             DPI+L LDEPTSGLDSTSAFMVV VLQRIA+SGSIVIMS+HQPSYRIL+LLDRLI LS G
Sbjct  200   DPILLLLDEPTSGLDSTSAFMVVNVLQRIAKSGSIVIMSIHQPSYRILSLLDRLIILSHG  259

Query  1235  QTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSP-EGTKNLVDFNKSWQRK  1411
             Q+V++ +PS+L +FF EFG+P+PENEN+ EFALD +RELE+S  +G  +LV+FN+SWQ  
Sbjct  260   QSVYNETPSNLAQFFAEFGHPVPENENKIEFALDLMRELEESSSDGITSLVEFNESWQ--  317

Query  1412  FSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNIN--STLSPSVPKFANPFWVE  1585
                 +  N N V  N   SLKDAI ASIS+GKLVS    I+  S L+ SV  FANPFW+E
Sbjct  318   ---VTKKNGNKVPENANVSLKDAIKASISKGKLVSAGETISDGSNLTSSVQTFANPFWIE  374

Query  1586  MVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMST  1765
              +VI KR + NS RMPELF +RFG+V+VTG ILAT+FWKL DSPKG  +RLGFFAFAM+T
Sbjct  375   TIVISKRLLTNSRRMPELFGIRFGSVLVTGFILATLFWKLQDSPKGALKRLGFFAFAMTT  434

Query  1766  TFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAv  1945
              FY CA  IP  LQER IF+RET+YN YR SSYV +HS++S+P +  LS+ FAVTT+WAV
Sbjct  435   IFYICAREIPALLQERDIFIRETSYNTYRHSSYVFAHSLVSMPPITTLSITFAVTTFWAV  494

Query  1946  glaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFIN  2125
             GL+GGFSGFLFF + +FASFWAGSSF+ F++G++ +++I +T+VVAIL YF+LF GF+I 
Sbjct  495   GLSGGFSGFLFFFITIFASFWAGSSFMAFIAGLVSHIIIGFTIVVAILGYFLLFCGFYIP  554

Query  2126  RDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLL  2305
             RD IPPYWIWFHY SLVKYPFQGVLQNEF  P KCFV G+Q+FD +P + +P   K+KLL
Sbjct  555   RDEIPPYWIWFHYVSLVKYPFQGVLQNEFGDPSKCFVSGVQVFDDTPFEGLPFDTKIKLL  614

Query  2306  QNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGS  2485
             +NMS  LG NITSSTC+TTG  +L+Q GVTDI+KW C WIT+A GF FR+LFYF LL GS
Sbjct  615   ENMSNVLGHNITSSTCVTTGMKLLEQKGVTDISKWKCFWITVAFGFLFRVLFYFTLLFGS  674

Query  2486  KNKRR  2500
             KNKRR
Sbjct  675   KNKRR  679



>ref|XP_006428968.1| hypothetical protein CICLE_v10011234mg [Citrus clementina]
 gb|ESR42208.1| hypothetical protein CICLE_v10011234mg [Citrus clementina]
Length=674

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/665 (68%), Positives = 546/665 (82%), Gaps = 10/665 (2%)
 Frame = +2

Query  515   LSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGASG  694
             LSF NLSY V+V +++ +P +  +   A SQ E + K+LLD+ISG+AREGEIMA+LGASG
Sbjct  17    LSFDNLSYRVQVSKQLQLP-FFWKAKFAGSQ-EPNTKLLLDNISGQAREGEIMAILGASG  74

Query  695   SGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMF  874
             +GK+TL+DALA RI +ESL G V +NGEVLESKLLK+ISAYVMQDDLLFPMLTVEETLMF
Sbjct  75    AGKTTLMDALAGRIEKESLQGAVTLNGEVLESKLLKIISAYVMQDDLLFPMLTVEETLMF  134

Query  875   SAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIH  1054
             +AEFRLPRS+++++K+ RV+ALI QLGL++AAKT IGDE HRGVSGGERRRVSIGI IIH
Sbjct  135   AAEFRLPRSVTKTKKQERVEALISQLGLRSAAKTFIGDERHRGVSGGERRRVSIGIHIIH  194

Query  1055  DPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKG  1234
             DPI+L LDEPTSGLDSTSAFMVV VLQRIA+SGSIVIMS+HQPSYRIL+LLDRLI LS G
Sbjct  195   DPILLLLDEPTSGLDSTSAFMVVNVLQRIAKSGSIVIMSIHQPSYRILSLLDRLIILSHG  254

Query  1235  QTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSP-EGTKNLVDFNKSWQRK  1411
             Q+V++ +PS+L +FF EFG+P+PENEN+ EFALD +RELE+S  +G  +LV+FN+SWQ  
Sbjct  255   QSVYNETPSNLAQFFAEFGHPVPENENKIEFALDLMRELEESSSDGITSLVEFNESWQ--  312

Query  1412  FSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNIN--STLSPSVPKFANPFWVE  1585
                 +  N N V  N   SLKDAI ASIS+GKLVS    I+  S L+ SV  FANPFW+E
Sbjct  313   ---VTKKNGNKVPENANVSLKDAIKASISKGKLVSAGETISDGSNLTSSVQTFANPFWIE  369

Query  1586  MVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMST  1765
              +VI KR + NS RMPELF +RFG+V+VTG ILAT+FWKL DSPKG  +RLGFFAFAM+T
Sbjct  370   TIVISKRLLTNSRRMPELFGIRFGSVLVTGFILATLFWKLQDSPKGALKRLGFFAFAMTT  429

Query  1766  TFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAv  1945
              FY CA  IP  LQER IF+RET+YN YR SSYV +HS++S+P +  LS+ FAVTT+WAV
Sbjct  430   IFYICAREIPALLQERDIFIRETSYNTYRHSSYVFAHSLVSMPPITTLSITFAVTTFWAV  489

Query  1946  glaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFIN  2125
             GL+GGFSGFLFF + +FASFWAGSSF+ F++G++ +++I +T+VVAIL YF+LF GF+I 
Sbjct  490   GLSGGFSGFLFFFITIFASFWAGSSFMAFIAGLVSHIIIGFTIVVAILGYFLLFCGFYIP  549

Query  2126  RDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLL  2305
             RD IPPYWIWFHY SLVKYPFQGVLQNEF  P KCFV G+Q+FD +P + +P   K+KLL
Sbjct  550   RDEIPPYWIWFHYVSLVKYPFQGVLQNEFGDPSKCFVSGVQVFDDTPFEGLPFDTKIKLL  609

Query  2306  QNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGS  2485
             +NMS  LG NITSSTC+TTG  +L+Q GVTDI+KW C WIT+A GF FR+LFYF LL GS
Sbjct  610   ENMSNVLGNNITSSTCVTTGMKLLEQKGVTDISKWKCFWITVAFGFLFRVLFYFTLLFGS  669

Query  2486  KNKRR  2500
             KNKRR
Sbjct  670   KNKRR  674



>emb|CDX76122.1| BnaA04g03860D [Brassica napus]
Length=1282

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/726 (67%), Positives = 588/726 (81%), Gaps = 37/726 (5%)
 Frame = +2

Query  359   PRHSV----SMTLGELLHRVGD----SAGEK--LNNGVGGANDHRVLQLYDPVPYPSSFP  508
             P HS+    S+TLG+LL  V D     AG++  L++  G        Q YD +  P   P
Sbjct  582   PYHSMEIGSSLTLGQLLKNVSDVRKVDAGDETPLHSSQGD-------QDYDDLMRP--VP  632

Query  509   FVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGA  688
             FVLSF+NL+Y+V VRRK  +   + RR+ + S+     K LLD+ISGE R+GEI+AVLGA
Sbjct  633   FVLSFNNLTYNVSVRRKFNL---IPRRSLSSSKT----KTLLDNISGETRDGEILAVLGA  685

Query  689   SGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETL  868
             SGSGKSTLIDALANRIA+ SL G V +NGE L+S+ LKVISAYVMQDDLLFPMLTVEETL
Sbjct  686   SGSGKSTLIDALANRIAKGSLKGKVTLNGEPLQSRTLKVISAYVMQDDLLFPMLTVEETL  745

Query  869   MFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDI  1048
             MF+AEFRLPRSL +S+KK RVQ LIEQLG++ AA T+IGDEGHRG+SGGERRRVSIGIDI
Sbjct  746   MFAAEFRLPRSLPKSKKKLRVQTLIEQLGIKNAANTIIGDEGHRGISGGERRRVSIGIDI  805

Query  1049  IHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLS  1228
             IHDPIVLFLDEPTSGLDSTSAFMVV VL++IA+SGSIVIMS+HQPS+R+L LL+RLIFLS
Sbjct  806   IHDPIVLFLDEPTSGLDSTSAFMVVNVLKKIAESGSIVIMSIHQPSHRVLGLLNRLIFLS  865

Query  1229  KGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQ-  1405
             +G+TVFSGSP+SLP FF  FG+P+PENEN+ EFALD IRELE S  GT+ LV+FNK WQ 
Sbjct  866   RGKTVFSGSPASLPGFFARFGSPVPENENQTEFALDLIRELEGSAGGTRGLVEFNKRWQE  925

Query  1406  -RKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWV  1582
              +  SP ++       PNP  +LK+AISASISRGKLVSG    +S +S     FANPFW+
Sbjct  926   MKNRSPPAS-------PNPNLTLKEAISASISRGKLVSGGGGGSSVVSHG--GFANPFWI  976

Query  1583  EMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMS  1762
             E+  + +RS++NS R PELF  R  AV+VTG ILAT+FW+LD+SPKG+QERLGFFAFAMS
Sbjct  977   EIKTLTERSILNSRRQPELFGTRLAAVLVTGFILATVFWRLDNSPKGVQERLGFFAFAMS  1036

Query  1763  TTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWA  1942
             T FYTCA+A+PVFLQERYIFMRETAYNAYRRSSYVLSH+++SLPSL FLSLAFA TT+WA
Sbjct  1037  TMFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAVVSLPSLVFLSLAFASTTFWA  1096

Query  1943  vglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFI  2122
             VGL GG  GFLF+ L +FASFW+GSSFVTFLSG++ +VM+ YT+VVAILAYF+LFSGFFI
Sbjct  1097  VGLEGGPMGFLFYCLIIFASFWSGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFI  1156

Query  2123  NRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKL  2302
             NRDRIP YW+WFHY SLVKYP++ VLQNEF  P +CFV+G+Q+FD +PL  +   MKL+L
Sbjct  1157  NRDRIPQYWLWFHYLSLVKYPYEAVLQNEFSDPMECFVRGVQMFDNTPLGQLSYGMKLRL  1216

Query  2303  LQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIG  2482
             L ++S+++G+ ITSSTCLTTG DIL+Q GVT+++KW+CL +T+  GFFFR LFY  LL G
Sbjct  1217  LDSVSRSIGMRITSSTCLTTGADILRQQGVTELSKWSCLLVTVGFGFFFRALFYLCLLFG  1276

Query  2483  SKNKRR  2500
             SKNKRR
Sbjct  1277  SKNKRR  1282


 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/586 (60%), Positives = 451/586 (77%), Gaps = 23/586 (4%)
 Frame = +2

Query  464   VLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDI  643
             V+ ++ P   P   P VL+F++L+Y V + R+ G  +       +P+QV    K LL+ I
Sbjct  7     VISVHSPETRP--LPLVLAFNDLTYKVTLPRRFGFRS-----RRSPAQV----KTLLNGI  55

Query  644   SGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVM  823
             +GE  EGEI+A+LGASGSGKSTLIDALA RI+  SL GTV +NGE L+S++L+VISAYVM
Sbjct  56    TGETNEGEILAILGASGSGKSTLIDALAGRISEGSLKGTVTLNGEALQSRMLQVISAYVM  115

Query  824   QDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrg  1003
             QDDLLFPMLTV+ETLMF+AEFRLPRSL +S+K+ RV+ LI+QLGL+T   T+IGDEGHRG
Sbjct  116   QDDLLFPMLTVQETLMFAAEFRLPRSLPKSKKRDRVETLIDQLGLRTVKNTMIGDEGHRG  175

Query  1004  vsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQP  1183
             VSGGERRRVSIG DIIHDPIVLFLDEPTSGLDST AFMVV+VL++IA SGSIV+MS+HQP
Sbjct  176   VSGGERRRVSIGTDIIHDPIVLFLDEPTSGLDSTCAFMVVQVLKKIACSGSIVVMSIHQP  235

Query  1184  SYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSP  1363
             S RI+  LDRL+ LS GQ VFS SP++LP FF EFG PIP+ EN  EF LD I++LE + 
Sbjct  236   SCRIMEFLDRLLVLSSGQCVFSDSPATLPLFFSEFGRPIPDKENNAEFTLDLIKDLEGTS  295

Query  1364  EGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTL  1543
              GT  LV+FN+SWQ+K    S    +N  P     L++ I+ASI+RGKLV+ + N     
Sbjct  296   GGTSRLVEFNRSWQQKKLRGSQEPHHNSSP-----LRETINASITRGKLVTTSYN-----  345

Query  1544  SPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKG  1723
               S   + NP+WVE +++ KR M+N  R PEL   R   V++TG +LAT++W++DDSP+G
Sbjct  346   --SKASYVNPWWVETLILAKRYMINWTRTPELIGTRVFIVMMTGFLLATVYWRVDDSPRG  403

Query  1724  IQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpsla  1903
             +QERL FF+FAM+T FY+CA+ +P F+QERYIFMRETA+NAYRRSSYV+SHS+++LP L 
Sbjct  404   VQERLSFFSFAMATMFYSCADGLPTFIQERYIFMRETAHNAYRRSSYVISHSLVTLPHLF  463

Query  1904  flslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVA  2083
              LS+ FA TT+W VGL GG +GF+++LL +FASFW+G SFVTF+SG+I NVM++Y +   
Sbjct  464   ALSVGFAATTFWFVGLNGGLAGFIYYLLIIFASFWSGCSFVTFVSGVIPNVMMSYMVTFG  523

Query  2084  ILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYP  2221
              L+Y +LFSGF+INRDRI  YWIW HY SL+KYP++ VL NEFD P
Sbjct  524   YLSYCLLFSGFYINRDRIHLYWIWIHYISLLKYPYEAVLHNEFDDP  569



>ref|XP_002468066.1| hypothetical protein SORBIDRAFT_01g038970 [Sorghum bicolor]
 gb|EER95064.1| hypothetical protein SORBIDRAFT_01g038970 [Sorghum bicolor]
Length=796

 Score =   779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/746 (63%), Positives = 580/746 (78%), Gaps = 33/746 (4%)
 Frame = +2

Query  359   PRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSS------------  502
             P    S TL +LL RV ++  +  +      + H  ++L   VP  +             
Sbjct  52    PAKQSSFTLAQLLKRVNEARSDASSPTSSPTHSHYTIELGGSVPGSTGSDLSERMRGGDR  111

Query  503   --------FPFVLSFHNLSYSVKVRRKM-GVPAW-LGRRTAAPSQVE-NDVKVLLDDISG  649
                      PFVL F +L+YSVK R+K   +PA   GR    P++ E   +K LLD+ISG
Sbjct  112   DRGSDGTLLPFVLKFTDLTYSVKQRKKGPCLPALPFGRGGREPTEPEVPRMKTLLDNISG  171

Query  650   EAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQD  829
             EAREGEIMAVLGASGSGKSTLIDALANRI +ESL G+V +NGE L+S LLKVISAYVMQD
Sbjct  172   EAREGEIMAVLGASGSGKSTLIDALANRIVKESLHGSVTLNGESLDSNLLKVISAYVMQD  231

Query  830   DLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvs  1009
             DLL+PMLTVEETLMF+AEFRLPRSL    KK RVQALI+QLGL+ AA T+IGDEGHRGVS
Sbjct  232   DLLYPMLTVEETLMFAAEFRLPRSLPTKEKKKRVQALIDQLGLRNAANTIIGDEGHRGVS  291

Query  1010  ggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSY  1189
             GGERRRVSIG+DIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGS+V+MS+HQPSY
Sbjct  292   GGERRRVSIGVDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSVVVMSIHQPSY  351

Query  1190  RILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEG  1369
             RIL LLDRL+FLS+GQTV+ GSP +LP FF +FG PIP NEN  EFALD IRELE  P+G
Sbjct  352   RILGLLDRLLFLSRGQTVYYGSPRALPSFFNDFGKPIPGNENPTEFALDLIRELETMPQG  411

Query  1370  TKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTL--  1543
              ++LV+ NK WQ + +P +  + +     P  SLK+AISASISRGKLVSGAT+ + ++  
Sbjct  412   ARDLVEHNKKWQTRMAPKA-KHHDGHGEKPSLSLKEAISASISRGKLVSGATDGSVSVHS  470

Query  1544  -----SPSVP--KFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWK  1702
                  +P+ P  KFANPFWVEM V+ +R+ +++ R PE+F +R  AV+VTG ILATIFW+
Sbjct  471   PGMLAAPAAPVSKFANPFWVEMGVLTRRAFLSTKRTPEIFIIRLAAVMVTGFILATIFWR  530

Query  1703  LDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsi  1882
             LDDSPKG++ERLGFFA AMST FYTC++++PVFL ERYIF+RETAYNAYRRSSYVLSH+I
Sbjct  531   LDDSPKGVEERLGFFAIAMSTMFYTCSDSLPVFLNERYIFLRETAYNAYRRSSYVLSHTI  590

Query  1883  islpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMI  2062
             +  PSL  LS AFA+TT++AVGLAGG  GF FF+  V ASFWAGS F TFLSG++ NVM+
Sbjct  591   VGFPSLIVLSFAFALTTFFAVGLAGGADGFFFFVAIVLASFWAGSGFATFLSGVVTNVML  650

Query  2063  AYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKG  2242
              + +VV+ LAYF+LFSGFFINRDRIP YW+WFHY SLVKYP++ V+QNEF  P +CFV+G
Sbjct  651   GFPVVVSTLAYFLLFSGFFINRDRIPKYWLWFHYLSLVKYPYEAVMQNEFSDPTRCFVRG  710

Query  2243  IQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLW  2422
             +Q+FD +PL A+P  +K+++L+ MS++LG++I ++TC+TTGPD L+Q  VTD+ KW+CLW
Sbjct  711   VQMFDNTPLAALPGVLKVRVLRAMSQSLGVDIGTNTCITTGPDFLRQQAVTDLTKWDCLW  770

Query  2423  ITIAlgfffrllfyfallIGSKNKRR  2500
             IT+A GF FR+LFY +LL+GS+NKRR
Sbjct  771   ITVAWGFLFRILFYISLLLGSRNKRR  796



>gb|ACN28499.1| unknown [Zea mays]
Length=747

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/742 (63%), Positives = 576/742 (78%), Gaps = 30/742 (4%)
 Frame = +2

Query  359   PRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSS------------  502
             P    S TL +LL RV ++  +  +      + H  ++L   VP  +             
Sbjct  8     PAKQSSFTLAQLLKRVNEARSDASSPTSSPTHSHYTIELGGSVPGSTGSDLSERIGGGGG  67

Query  503   ----FPFVLSFHNLSYSVKVRRKMG--VPAWLGRRTAA-PSQVE-NDVKVLLDDISGEAR  658
                  PFVL F +L+YSVK +RK G  +P    RR A  P++ E + +K LLD+ISGEAR
Sbjct  68    DGPLLPFVLKFTDLTYSVK-QRKRGPCLPVLPFRRGAGEPAEPEVSRMKTLLDNISGEAR  126

Query  659   EGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLL  838
             EGEIMAVLGASGSGKSTLIDALANRI +ESL G+V +NGE L+S LLKVISAYVMQDDLL
Sbjct  127   EGEIMAVLGASGSGKSTLIDALANRIVKESLRGSVTLNGESLDSNLLKVISAYVMQDDLL  186

Query  839   FPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsgge  1018
             +PMLTVEETLMF+AEFRLPRSL    KK RVQALI+QLGL+ AA T+IGDEGHRGVSGGE
Sbjct  187   YPMLTVEETLMFAAEFRLPRSLPTKEKKKRVQALIDQLGLRNAANTIIGDEGHRGVSGGE  246

Query  1019  rrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRIL  1198
             RRRVSIG+DIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGS+V+MS+HQPSYRIL
Sbjct  247   RRRVSIGVDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSVVVMSIHQPSYRIL  306

Query  1199  NLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKN  1378
              LLDRL+FLS+GQTV+ G P +LP FF +FG PIP NEN  EFALD IRELE  P+G  +
Sbjct  307   GLLDRLLFLSRGQTVYYGPPGALPSFFNDFGKPIPGNENPTEFALDLIRELETMPDGATD  366

Query  1379  LVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNIN--------  1534
             LV+ NK WQ + +P +  + +     P  SLK+AISASISRGKLVSGAT+ +        
Sbjct  367   LVEHNKKWQMRTAPKA-KHHDGHGEKPSLSLKEAISASISRGKLVSGATDGSVSVHSAGE  425

Query  1535  STLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDS  1714
             S  + +V KFANPFWVEM V+ +R+ +N+ R PE+F +R  AV+VTG ILATIFW+LDDS
Sbjct  426   SAPAAAVSKFANPFWVEMGVLTRRAFLNTKRTPEIFIIRLAAVMVTGFILATIFWRLDDS  485

Query  1715  PKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislp  1894
             PKG+QERLGFFA AMST FYTC++++PVFL ERYIF+RETAYNAYRRSSYVLSH+I+  P
Sbjct  486   PKGVQERLGFFAIAMSTMFYTCSDSLPVFLNERYIFLRETAYNAYRRSSYVLSHTIVGFP  545

Query  1895  slaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTL  2074
             SL  LS AFA+TT++AVGLAGG  GF FF+  V ASFWAGS F TFLSG++ NVM+ + +
Sbjct  546   SLIVLSFAFALTTFFAVGLAGGADGFFFFVAIVLASFWAGSGFATFLSGVVTNVMLGFPV  605

Query  2075  VVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIF  2254
             VV+ LAYF+LFSGFFINRDRIP YW+WFHY SLVKYP++ V+QNEF  P +CFV+G+Q+F
Sbjct  606   VVSTLAYFLLFSGFFINRDRIPRYWLWFHYLSLVKYPYEAVMQNEFSDPTRCFVRGVQMF  665

Query  2255  DGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIA  2434
             D +PL  +P  +K+++L+ MS++LG++I ++TC+TTGPD L Q  VTD+ KW+CLWIT+A
Sbjct  666   DNTPLAVLPAVLKVRVLRAMSQSLGVDIGTATCITTGPDFLAQQAVTDLTKWDCLWITVA  725

Query  2435  lgfffrllfyfallIGSKNKRR  2500
              GF FR+LFY +LL+GS+NKRR
Sbjct  726   WGFLFRILFYISLLLGSRNKRR  747



>gb|AEP23076.1| ATP-binding cassette protein subfamily G member 5 [Lolium perenne]
Length=793

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/753 (63%), Positives = 573/753 (76%), Gaps = 29/753 (4%)
 Frame = +2

Query  320   PRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPS  499
             P+Q   +      P    S TL +LL RV D+  +  ++    +  H  ++L   VP  +
Sbjct  44    PQQGAMMAPEPSPPTKHSSSTLAQLLKRVNDARSDAASSANS-SPSHYTIELGASVPGST  102

Query  500   S------------------FPFVLSFHNLSYSVKVRRKM-GVPAWLGRRTAAPSQVENDV  622
                                 PFVL F +L+YSVK R+K   +PA    R  A       +
Sbjct  103   GSDSGRTSHAGVGGDVGALLPFVLKFTDLTYSVKQRKKGPCLPALPFGRGDATEPEAPRM  162

Query  623   KVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLK  802
             K LLD+ISGEAREGEIMAVLGASGSGKSTLIDALANRI +ESL G+V +NGE +++ LLK
Sbjct  163   KTLLDNISGEAREGEIMAVLGASGSGKSTLIDALANRIRKESLHGSVTLNGESMDNNLLK  222

Query  803   VISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVI  982
             VISAYVMQDDLL+PMLTVEETLMFSAEFRLPRSL    KK RVQALI+QLGL+ AA T+I
Sbjct  223   VISAYVMQDDLLYPMLTVEETLMFSAEFRLPRSLPGKEKKKRVQALIDQLGLRNAANTII  282

Query  983   GDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIV  1162
             GDEGHRGVSGGERRRVSIG+DIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGS+V
Sbjct  283   GDEGHRGVSGGERRRVSIGVDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSVV  342

Query  1163  IMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFI  1342
             +MS+HQPSYRIL LLDRL+FLS+GQTV+ G P SL  FF +FG PI +NEN  EFALD +
Sbjct  343   VMSIHQPSYRILGLLDRLLFLSRGQTVYYGPPGSLSSFFHDFGKPIHDNENPTEFALDLV  402

Query  1343  RELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGA  1522
             RELE  PEG  +LV+ NKSWQ++  P      +     P  SLK+AISASISRGKLVSGA
Sbjct  403   RELETMPEGASDLVEHNKSWQKRMGPKIKHADDG--GKPSLSLKEAISASISRGKLVSGA  460

Query  1523  TNINSTL-------SPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGII  1681
             T+ N T+         +V KFANPFW+EM V+ +R+ +N+ R PE+F +R GAV++TG I
Sbjct  461   TDGNVTVPSELSAPDSAVTKFANPFWIEMGVLTRRAFINTKRTPEIFVIRLGAVLITGFI  520

Query  1682  LATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSS  1861
             LATIFW+LDDSPKG++ERLGFFA AMST FYTC++A+PVFL ERYIF+RETAYNAYRRSS
Sbjct  521   LATIFWRLDDSPKGVEERLGFFAIAMSTMFYTCSDALPVFLNERYIFLRETAYNAYRRSS  580

Query  1862  YVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSG  2041
             YVLSH+++  PSL  LS AFAVTT++AVGLAGG  GF FF+  V ASFWAGS F TFLSG
Sbjct  581   YVLSHTVVGFPSLIVLSFAFAVTTFFAVGLAGGAQGFFFFVAIVLASFWAGSGFATFLSG  640

Query  2042  IIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYP  2221
             ++ NV + + +VV+ LAYF+LFSGFFINRDRIP YW+WFHYASLVKYP++ V+ NEF  P
Sbjct  641   VVTNVQLGFPVVVSTLAYFLLFSGFFINRDRIPKYWLWFHYASLVKYPYEAVMMNEFSDP  700

Query  2222  DKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDI  2401
              +CFV+G+Q+FD +PL  +P  +K++LL+ MS +LGINI ++TC+TTGPD L+Q  VTD+
Sbjct  701   ARCFVRGVQMFDNTPLAVLPVPLKVRLLRAMSSSLGINIGTNTCITTGPDFLRQQAVTDL  760

Query  2402  NKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
              KW+CLWIT+A GF FR+LFY AL++GS+NKRR
Sbjct  761   TKWDCLWITVAWGFLFRILFYIALVLGSRNKRR  793



>gb|EMS46278.1| ABC transporter G family member 16 [Triticum urartu]
Length=747

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/735 (64%), Positives = 568/735 (77%), Gaps = 27/735 (4%)
 Frame = +2

Query  374   SMTLGELLHRVGDSA-----------------GEKLNNGVGGANDHRVLQLYDPVPYPSS  502
             S TL +LL RV D+                  G  +    G  ++H  L          +
Sbjct  14    SSTLAQLLKRVNDARSDASSPNSSPSHYTIELGASMPGSTGSESEHTSLTGVGVGVGDGT  73

Query  503   F-PFVLSFHNLSYSVKVRRKM-GVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMA  676
               PFVL F +L+YSVK R+K   +PA   RR  A  +    +K LLD+ISGEAREGEIMA
Sbjct  74    LLPFVLKFTDLTYSVKQRKKGPCLPALPFRRGDAEPEAPR-MKTLLDNISGEAREGEIMA  132

Query  677   VLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTV  856
             VLGASGSGKSTLIDALANRI +ESL G+V +NGE +++ LLKVISAYVMQDDLL+PMLTV
Sbjct  133   VLGASGSGKSTLIDALANRIRKESLHGSVTLNGESMDNNLLKVISAYVMQDDLLYPMLTV  192

Query  857   EETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsi  1036
             EETLMFSAEFRLPRSL    KK RVQALI+QLGL+ AA T+IGDEGHRGVSGGERRRVSI
Sbjct  193   EETLMFSAEFRLPRSLPTKEKKKRVQALIDQLGLRNAANTIIGDEGHRGVSGGERRRVSI  252

Query  1037  giDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRL  1216
             G+DIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGS+V+MS+HQPSYRIL LLDRL
Sbjct  253   GVDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSVVVMSIHQPSYRILGLLDRL  312

Query  1217  IFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNK  1396
             +FLS+GQTV+ G P SL  FF +FG PI +NEN  EFALD +RELE  P G  +LV+ NK
Sbjct  313   LFLSRGQTVYYGPPGSLSSFFSDFGKPIHDNENPTEFALDLVRELETMPNGACDLVEHNK  372

Query  1397  SWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINST-------LSPSV  1555
             SWQ++  P      +     P  SL++AISASISRGKLVSGAT+ N T        + +V
Sbjct  373   SWQKRMGPKMKHADDGNGGKPSLSLQEAISASISRGKLVSGATDGNVTVPSPSSAPASAV  432

Query  1556  PKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQER  1735
              KFANPFW+EM V+ +R+ +N+ R PE+F +R GAV++TG ILATIFW+LDDSPKG++ER
Sbjct  433   AKFANPFWIEMGVLTRRAFLNTKRTPEIFVIRLGAVLITGFILATIFWRLDDSPKGVEER  492

Query  1736  LGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflsl  1915
             LGFFA AMST FYTC++A+PVFL ERYIF+RETAYNAYRRSSYVLSH+I+  PSL  LSL
Sbjct  493   LGFFAIAMSTMFYTCSDALPVFLNERYIFLRETAYNAYRRSSYVLSHTIVGFPSLIVLSL  552

Query  1916  afaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAY  2095
             AFAVTT++AVGLAGG  GF FF+  V ASFWAGS F TFLSG++ NV + + +VV+ LAY
Sbjct  553   AFAVTTFFAVGLAGGAEGFFFFVAIVLASFWAGSGFATFLSGVVTNVQLGFPVVVSTLAY  612

Query  2096  FVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKA  2275
             F+LFSGFFINRDRIP YW+WFHYASLVKYP++ V+ NEF  P +CFV+G+Q+FD +PL  
Sbjct  613   FLLFSGFFINRDRIPKYWLWFHYASLVKYPYEAVMINEFSDPGRCFVRGVQMFDNTPLSV  672

Query  2276  VPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrl  2455
             +P A+K+++L+ MS +LGINI ++TC+TTGPD LKQ  VTD+ KW+CLWIT+A GF FR+
Sbjct  673   LPPAIKVRVLRAMSSSLGINIGTATCITTGPDFLKQQAVTDLTKWDCLWITVAWGFLFRI  732

Query  2456  lfyfallIGSKNKRR  2500
             LFY +LL+GS+NKRR
Sbjct  733   LFYISLLLGSRNKRR  747



>ref|NP_001151504.1| ATPase, coupled to transmembrane movement of substances [Zea 
mays]
 gb|ACG43107.1| ATPase, coupled to transmembrane movement of substances [Zea 
mays]
Length=790

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/742 (63%), Positives = 576/742 (78%), Gaps = 30/742 (4%)
 Frame = +2

Query  359   PRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSS------------  502
             P    S TL +LL RV ++  +  +      + H  ++L   VP  +             
Sbjct  51    PAKQSSFTLAQLLKRVNEARSDASSPTSSPTHSHYTIELGGSVPGSTGSDLSERIGGGGG  110

Query  503   ----FPFVLSFHNLSYSVKVRRKMG--VPAWLGRRTAA-PSQVE-NDVKVLLDDISGEAR  658
                  PFVL F +L+YSVK +RK G  +P    RR A  P++ E + +K LLD+ISGEAR
Sbjct  111   DGPLLPFVLKFTDLTYSVK-QRKRGPCLPVLPFRRGAGEPAEPEVSRMKTLLDNISGEAR  169

Query  659   EGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLL  838
             EGEIMAVLGASGSGKSTLIDALANRI +ESL G+V +NGE L+S LLKVISAYVMQDDLL
Sbjct  170   EGEIMAVLGASGSGKSTLIDALANRIVKESLRGSVTLNGESLDSNLLKVISAYVMQDDLL  229

Query  839   FPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsgge  1018
             +PMLTVEETLMF+AEFRLPRSL    KK RVQALI+QLGL+ AA T+IGDEGHRGVSGGE
Sbjct  230   YPMLTVEETLMFAAEFRLPRSLPTKEKKKRVQALIDQLGLRNAANTIIGDEGHRGVSGGE  289

Query  1019  rrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRIL  1198
             RRRVSIG+DIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGS+V+MS+HQPSYRIL
Sbjct  290   RRRVSIGVDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSVVVMSIHQPSYRIL  349

Query  1199  NLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKN  1378
              LLDRL+FLS+GQTV+ G P +LP FF +FG PIP NEN  EFALD IRELE  P+G  +
Sbjct  350   GLLDRLLFLSRGQTVYYGPPGALPSFFNDFGKPIPGNENPTEFALDLIRELETMPDGATD  409

Query  1379  LVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNIN--------  1534
             LV+ NK WQ + +P +  + +     P  SLK+AISASISRGKLVSGAT+ +        
Sbjct  410   LVEHNKKWQMRTAPKA-KHHDGHGEKPSLSLKEAISASISRGKLVSGATDGSVSVHSAGE  468

Query  1535  STLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDS  1714
             S  + +V KFANPFWVEM V+ +R+ +N+ R PE+F +R  AV+VTG ILATIFW+LDDS
Sbjct  469   SAPAAAVSKFANPFWVEMGVLTRRAFLNTKRTPEIFIIRLAAVMVTGFILATIFWRLDDS  528

Query  1715  PKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislp  1894
             PKG+QERLGFFA AMST FYTC++++PVFL ERYIF+RETAYNAYRRSSYVLSH+I+  P
Sbjct  529   PKGVQERLGFFAIAMSTMFYTCSDSLPVFLNERYIFLRETAYNAYRRSSYVLSHTIVGFP  588

Query  1895  slaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTL  2074
             SL  LS AFA+TT++AVGLAGG  GF FF+  V ASFWAGS F TFLSG++ NVM+ + +
Sbjct  589   SLIVLSFAFALTTFFAVGLAGGADGFFFFVAIVLASFWAGSGFATFLSGVVTNVMLGFPV  648

Query  2075  VVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIF  2254
             VV+ LAYF+LFSGFFINRDRIP YW+WFHY SLVKYP++ V+QNEF  P +CFV+G+Q+F
Sbjct  649   VVSTLAYFLLFSGFFINRDRIPRYWLWFHYLSLVKYPYEAVMQNEFSDPTRCFVRGVQMF  708

Query  2255  DGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIA  2434
             D +PL  +P  +K+++L+ MS++LG++I ++TC+TTGPD L Q  VTD+ KW+CLWIT+A
Sbjct  709   DNTPLAVLPAVLKVRVLRAMSQSLGVDIGTATCITTGPDFLAQQAVTDLTKWDCLWITVA  768

Query  2435  lgfffrllfyfallIGSKNKRR  2500
              GF FR+LFY +LL+GS+NKRR
Sbjct  769   WGFLFRILFYISLLLGSRNKRR  790



>tpg|DAA44748.1| TPA: ATPase, coupled to transmembrane movement of substance [Zea 
mays]
Length=841

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/742 (63%), Positives = 576/742 (78%), Gaps = 30/742 (4%)
 Frame = +2

Query  359   PRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSS------------  502
             P    S TL +LL RV ++  +  +      + H  ++L   VP  +             
Sbjct  102   PAKQSSFTLAQLLKRVNEARSDASSPTSSPTHSHYTIELGGSVPGSTGSDLSERIGGGGG  161

Query  503   ----FPFVLSFHNLSYSVKVRRKMG--VPAWLGRRTAA-PSQVE-NDVKVLLDDISGEAR  658
                  PFVL F +L+YSVK +RK G  +P    RR A  P++ E + +K LLD+ISGEAR
Sbjct  162   DGPLLPFVLKFTDLTYSVK-QRKRGPCLPVLPFRRGAGEPAEPEVSRMKTLLDNISGEAR  220

Query  659   EGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLL  838
             EGEIMAVLGASGSGKSTLIDALANRI +ESL G+V +NGE L+S LLKVISAYVMQDDLL
Sbjct  221   EGEIMAVLGASGSGKSTLIDALANRIVKESLRGSVTLNGESLDSNLLKVISAYVMQDDLL  280

Query  839   FPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsgge  1018
             +PMLTVEETLMF+AEFRLPRSL    KK RVQALI+QLGL+ AA T+IGDEGHRGVSGGE
Sbjct  281   YPMLTVEETLMFAAEFRLPRSLPTKEKKKRVQALIDQLGLRNAANTIIGDEGHRGVSGGE  340

Query  1019  rrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRIL  1198
             RRRVSIG+DIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGS+V+MS+HQPSYRIL
Sbjct  341   RRRVSIGVDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSVVVMSIHQPSYRIL  400

Query  1199  NLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKN  1378
              LLDRL+FLS+GQTV+ G P +LP FF +FG PIP NEN  EFALD IRELE  P+G  +
Sbjct  401   GLLDRLLFLSRGQTVYYGPPGALPSFFNDFGKPIPGNENPTEFALDLIRELETMPDGATD  460

Query  1379  LVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNIN--------  1534
             LV+ NK WQ + +P +  + +     P  SLK+AISASISRGKLVSGAT+ +        
Sbjct  461   LVEHNKKWQMRTAPKA-KHHDGHGEKPSLSLKEAISASISRGKLVSGATDGSVSVHSAGE  519

Query  1535  STLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDS  1714
             S  + +V KFANPFWVEM V+ +R+ +N+ R PE+F +R  AV+VTG ILATIFW+LDDS
Sbjct  520   SAPAAAVSKFANPFWVEMGVLTRRAFLNTKRTPEIFIIRLAAVMVTGFILATIFWRLDDS  579

Query  1715  PKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislp  1894
             PKG+QERLGFFA AMST FYTC++++PVFL ERYIF+RETAYNAYRRSSYVLSH+I+  P
Sbjct  580   PKGVQERLGFFAIAMSTMFYTCSDSLPVFLNERYIFLRETAYNAYRRSSYVLSHTIVGFP  639

Query  1895  slaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTL  2074
             SL  LS AFA+TT++AVGLAGG  GF FF+  V ASFWAGS F TFLSG++ NVM+ + +
Sbjct  640   SLIVLSFAFALTTFFAVGLAGGADGFFFFVAIVLASFWAGSGFATFLSGVVTNVMLGFPV  699

Query  2075  VVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIF  2254
             VV+ LAYF+LFSGFFINRDRIP YW+WFHY SLVKYP++ V+QNEF  P +CFV+G+Q+F
Sbjct  700   VVSTLAYFLLFSGFFINRDRIPRYWLWFHYLSLVKYPYEAVMQNEFSDPTRCFVRGVQMF  759

Query  2255  DGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIA  2434
             D +PL  +P  +K+++L+ MS++LG++I ++TC+TTGPD L Q  VTD+ KW+CLWIT+A
Sbjct  760   DNTPLAVLPAVLKVRVLRAMSQSLGVDIGTATCITTGPDFLAQQAVTDLTKWDCLWITVA  819

Query  2435  lgfffrllfyfallIGSKNKRR  2500
              GF FR+LFY +LL+GS+NKRR
Sbjct  820   WGFLFRILFYISLLLGSRNKRR  841



>emb|CBI32651.3| unnamed protein product [Vitis vinifera]
Length=628

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/721 (67%), Positives = 542/721 (75%), Gaps = 116/721 (16%)
 Frame = +2

Query  338   LQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDH-RVLQLYDPVPYPSSFPFV  514
             L+ +  + +  VS TLGELL RVGD+  +    G    + H RV+ L D +P+P SFPFV
Sbjct  8     LRHMEMKSKLRVSPTLGELLKRVGDARDD--TPGCQTTSSHQRVIDLNDAIPHPRSFPFV  65

Query  515   LSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGASG  694
             LSFHNLSYSVKV  K                 ++ +KVLL+DISGEAREGEIM VLGASG
Sbjct  66    LSFHNLSYSVKVETK-----------------DSGMKVLLNDISGEAREGEIMGVLGASG  108

Query  695   SGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMF  874
             SGKSTLIDALA+RIA++SL G+V +N EVLESKLLKVISAYVMQDDLLFPMLTVEETLMF
Sbjct  109   SGKSTLIDALADRIAKDSLKGSVTLNDEVLESKLLKVISAYVMQDDLLFPMLTVEETLMF  168

Query  875   SAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIH  1054
             SAEFRLPRSLS S+KKARVQALI+QLGL++AAKTVIGDEGHRGVSGGERRRVSIGIDIIH
Sbjct  169   SAEFRLPRSLSSSKKKARVQALIDQLGLRSAAKTVIGDEGHRGVSGGERRRVSIGIDIIH  228

Query  1055  DPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKG  1234
             DPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMS+HQPSYRIL LLDRLIFLS+G
Sbjct  229   DPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLDRLIFLSRG  288

Query  1235  QTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQRKF  1414
              TV+SGSPSSLP FF EFG+PIPE ENR EFALD IRELE SP GTK LV+FN       
Sbjct  289   NTVYSGSPSSLPLFFAEFGHPIPETENRTEFALDLIRELEGSPGGTKTLVEFN-------  341

Query  1415  SPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWVEMVV  1594
                                         +GKL                         MVV
Sbjct  342   ----------------------------KGKL-------------------------MVV  348

Query  1595  IGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFY  1774
             +GKRS+ NS RMPELF +R GAV+VTGIILATIF +LD SPKG+QERLGFFAFAMSTTFY
Sbjct  349   LGKRSLKNSKRMPELFGIRLGAVLVTGIILATIFLQLDSSPKGVQERLGFFAFAMSTTFY  408

Query  1775  TCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvgla  1954
             TCAEAIPVFLQERYIFMRETAYNAYRRSSYVL+HSIIS+P+L FLS AFA TTYWAVGLA
Sbjct  409   TCAEAIPVFLQERYIFMRETAYNAYRRSSYVLAHSIISIPALVFLSFAFAATTYWAVGLA  468

Query  1955  ggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDR  2134
             GG SGFLFF   +FASFWAGSSFVTFLSG++ +VM+ YT+VVAILAYF+LFSGFFI+R+R
Sbjct  469   GGVSGFLFFFFMIFASFWAGSSFVTFLSGVVSHVMLGYTVVVAILAYFLLFSGFFISRNR  528

Query  2135  IPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNM  2314
             IPPYWIWFHY SLVKYP++GVL NEF+ P                               
Sbjct  529   IPPYWIWFHYISLVKYPYEGVLHNEFEDP-------------------------------  557

Query  2315  SKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNK  2494
                  +NITSSTC+TTG D+LKQ GVTDI+KWNCLWIT+ALGFFFR +FY  LL GSKNK
Sbjct  558   -----MNITSSTCVTTGSDVLKQQGVTDISKWNCLWITLALGFFFRFMFYLTLLFGSKNK  612

Query  2495  R  2497
             R
Sbjct  613   R  613



>ref|XP_010534454.1| PREDICTED: ABC transporter G family member 18-like [Tarenaya 
hassleriana]
Length=727

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/709 (63%), Positives = 564/709 (80%), Gaps = 12/709 (2%)
 Frame = +2

Query  380   TLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRK  559
             TL +LL   G    E  ++G G A  H V+ L  P   P   PFVL+F NL+YSV++ +K
Sbjct  29    TLRQLLKDSGSVMKE--DDGDGEAPVHHVVDLDAPETPP--VPFVLAFDNLTYSVRLHQK  84

Query  560   MGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIA  739
               +P+   RR++AP      VK LL DISGEA +GEI+AV G SG+GKSTLIDALA RIA
Sbjct  85    FDLPSLFSRRSSAP------VKALLRDISGEACDGEILAVFGGSGAGKSTLIDALAGRIA  138

Query  740   RESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrk  919
               SLGGTV +NGE L+S++LK ISAYVMQ+DLLFPMLTVEETLMF+AEFRLPRSL +S+K
Sbjct  139   EGSLGGTVTLNGEPLQSRMLKTISAYVMQNDLLFPMLTVEETLMFAAEFRLPRSLPKSKK  198

Query  920   karVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLD  1099
             K RVQALI+QLGL+ AA TVIGDEGHRGVSGGERRRVSIGIDIIHDPI+L LDEPTSGLD
Sbjct  199   KDRVQALIDQLGLKDAAGTVIGDEGHRGVSGGERRRVSIGIDIIHDPIILLLDEPTSGLD  258

Query  1100  STSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFF  1279
             STSAFMVV+VL+RIAQSGSIV+MS+HQPSYRI+ LLDRLI LS+GQTVFSGSP+SLPRF 
Sbjct  259   STSAFMVVQVLKRIAQSGSIVMMSIHQPSYRIVELLDRLIILSRGQTVFSGSPASLPRFL  318

Query  1280  QEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNN--VFP  1453
              EFG+PIPE EN  EFALD IRELE SPEG K LV+F++ WQ +      S R    + P
Sbjct  319   SEFGHPIPEKENIAEFALDLIRELEGSPEGNKGLVEFHRKWQEEKLSLCQSARATPRITP  378

Query  1454  NPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMP  1633
             +   SLK+AI+ S+SRGKLVSG+   N      +  +ANP W+E +++ KR  +N  RMP
Sbjct  379   HQGLSLKEAINVSVSRGKLVSGSGGANPNSMAKISSYANPSWLETLILAKRYAINWSRMP  438

Query  1634  ELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQER  1813
             EL  +R   V +TG +LAT++W++DD+P+G+QERLGFFAFAM+T FY CA+ +PVF+QER
Sbjct  439   ELIGVRLATVFITGFLLATVYWRVDDTPRGVQERLGFFAFAMATMFYCCADNLPVFIQER  498

Query  1814  YIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfv  1993
             YIF++ETA+NAYR SSYV+SHS++SLP L  LS+AFA TT+++VGL+GGF GFL++ L +
Sbjct  499   YIFLKETAHNAYRISSYVISHSLVSLPQLFALSVAFAATTFFSVGLSGGFDGFLYYCLII  558

Query  1994  fasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASL  2173
             +ASFW+GSSFVTF+SG++ NVMI+Y + +A L+Y +LF+GF+INRDRIPPYWIW+HY SL
Sbjct  559   YASFWSGSSFVTFVSGVVPNVMISYMVTIAFLSYCLLFAGFYINRDRIPPYWIWYHYISL  618

Query  2174  VKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTC  2353
             +KYP++ VLQNEF  P +C+++GIQ+FD + L  VPE+MK+KLL  +S  LG+ IT STC
Sbjct  619   LKYPYEAVLQNEFSGPSRCYIRGIQVFDNTILAEVPESMKVKLLGTLSSALGMEITESTC  678

Query  2354  LTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             L TG ++L+Q G+T ++KW+CLW T+A GFFFR LFYF+LL+GSKNKRR
Sbjct  679   LRTGSELLRQQGITQLDKWDCLWATVAWGFFFRTLFYFSLLLGSKNKRR  727



>ref|XP_009402343.1| PREDICTED: ABC transporter G family member 6-like [Musa acuminata 
subsp. malaccensis]
Length=754

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/730 (66%), Positives = 571/730 (78%), Gaps = 38/730 (5%)
 Frame = +2

Query  374   SMTLGELLHRVGDSAGEKLNNGVG---GANDHRVLQL--YDPVPY----PSSFPFVLSFH  526
             S+TLG+L  RVG++       GVG    +  H V+ +  +D            P VL+F 
Sbjct  42    SVTLGQLFKRVGEAHS---GGGVGDEDASQPHHVVAMGEFDGAGGGGLASRPLPIVLTFT  98

Query  527   NLSYSVKVRRKMGVPAWLGRRT----------AAPSQVENDVKVLLDDISGEAREGEIMA  676
             NLSYSVK  R M    +L R++          A P       K LLD ISGEAREGEI A
Sbjct  99    NLSYSVKTARNM----FLFRKSRLAMDPAAGLATPDAFSGS-KTLLDSISGEAREGEIFA  153

Query  677   VLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTV  856
             VLGASGSGKSTLIDALANRIARESL G++ +N E L+ +LLKVISAYVMQDDLLFPMLTV
Sbjct  154   VLGASGSGKSTLIDALANRIARESLQGSITLNDEKLDDQLLKVISAYVMQDDLLFPMLTV  213

Query  857   EETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsi  1036
             EETLMFSAEFRLPRSLS S+KK+RVQALI+QLGL+T+AKT+IGDE HRGVSGGERRRVSI
Sbjct  214   EETLMFSAEFRLPRSLSASKKKSRVQALIDQLGLRTSAKTIIGDEIHRGVSGGERRRVSI  273

Query  1037  giDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRL  1216
             GIDIIHDPI+LFLDEPTSGLDSTSAFMV KVLQRIA SGSIVIMSVHQPSYRIL LLDRL
Sbjct  274   GIDIIHDPIILFLDEPTSGLDSTSAFMVTKVLQRIAHSGSIVIMSVHQPSYRILCLLDRL  333

Query  1217  IFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNK  1396
             +FLS+GQTV+SG P  L  FF +FG+PIP NEN  EFALD IRELE +P G ++LVDFNK
Sbjct  334   LFLSRGQTVYSGPPDGLRGFFSDFGHPIPANENPTEFALDLIRELEGTPTGARSLVDFNK  393

Query  1397  SWQRKFSPSSTSNRNNVFPNPKPSL--KDAISASISRGKLVSGATNINSTLSPSVPKFAN  1570
             + Q        S R  V    KPSL   DAISASISRGKLVSGAT   +  +PSV  +AN
Sbjct  394   AHQ--------SVRLAVAAADKPSLSLNDAISASISRGKLVSGATE-GAPSAPSVQNYAN  444

Query  1571  PFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFA  1750
             PFW+E+ V+ KRS  NS RMPELF +R GAV+VTG ILATIFW+LD+SP+G+QERLGFFA
Sbjct  445   PFWIEVGVLTKRSFTNSKRMPELFGVRLGAVLVTGFILATIFWRLDNSPRGVQERLGFFA  504

Query  1751  FAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVT  1930
              AMST FYTCA+A+PVFLQER IFMRETA+NAYRRSSYVLSH+I+  P L  LS+AFA T
Sbjct  505   IAMSTMFYTCADALPVFLQERNIFMRETAHNAYRRSSYVLSHTIVGFPPLVLLSIAFAST  564

Query  1931  TYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFS  2110
             T++AVGLAG   GF+FF+L V ASFWAGS FVTFLSG++ ++M+   +V+++LAYF+LFS
Sbjct  565   TFFAVGLAGSMQGFVFFVLIVLASFWAGSGFVTFLSGVVTHIMLGCAVVLSVLAYFLLFS  624

Query  2111  GFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAM  2290
             GFFI+R RIP YWIWFHY SLVKYP++ V+QNEFD P KCFV+G+Q+FD +P   +PEA+
Sbjct  625   GFFIDRTRIPDYWIWFHYLSLVKYPYEAVMQNEFDDPRKCFVRGVQMFDNTPFGGLPEAI  684

Query  2291  KLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfa  2470
             KL +L+++S +LG++ITS TC+TTG +IL+Q  VT ++KW+CLWI +A GFFFR LFY +
Sbjct  685   KLNVLKSISSSLGVSITSQTCITTGTNILEQQSVTQLSKWDCLWIAVAWGFFFRFLFYIS  744

Query  2471  llIGSKNKRR  2500
             LL+GS+NKRR
Sbjct  745   LLLGSRNKRR  754



>gb|KFK36824.1| hypothetical protein AALP_AA4G176300 [Arabis alpina]
Length=713

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/673 (67%), Positives = 542/673 (81%), Gaps = 13/673 (2%)
 Frame = +2

Query  497   SSFPFVLSFHNLSYSVKVRRKMGVPAWLGRR-TAAPSQV---ENDVKVLLDDISGEAREG  664
             ++ P VLSF NL+Y+V VR K+G    + RR T  P  V       K LLD+ISG  R+G
Sbjct  49    TTVPLVLSFDNLTYNVSVRPKLGFRNLISRRKTDNPELVLTGRPSTKTLLDNISGRTRDG  108

Query  665   EIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFP  844
             EIMAVLGASGSGKSTLIDALANRIA+ SL GTVK+NGE L+S++LK+ISAYVMQDDLLFP
Sbjct  109   EIMAVLGASGSGKSTLIDALANRIAKGSLEGTVKLNGENLQSRMLKIISAYVMQDDLLFP  168

Query  845   MLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerr  1024
             MLTVEETLMF+AEFRLPRSL + +KK RVQALI+QLG+  AA T+IGDEGHRG+SGGERR
Sbjct  169   MLTVEETLMFAAEFRLPRSLPKLKKKLRVQALIDQLGITNAATTIIGDEGHRGISGGERR  228

Query  1025  rvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNL  1204
             RVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVV VL++IAQSGSIVIMS+HQPS+R+L L
Sbjct  229   RVSIGIDIIHDPILLFLDEPTSGLDSTSAFMVVNVLKKIAQSGSIVIMSIHQPSHRVLCL  288

Query  1205  LDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLV  1384
             LDRLIFLS G TV+SGSP S PRFF + G+PIP NEN  EFALDFIRELE S  GT+ LV
Sbjct  289   LDRLIFLSHGHTVYSGSPVSFPRFFADLGSPIPANENIAEFALDFIRELEGSAGGTRALV  348

Query  1385  DFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSP-SVPK  1561
             +FNK WQ    PSS        P+   +LK+AISASISRGKLVSG  +I +T +   VP 
Sbjct  349   EFNKKWQEMTPPSS--------PHSNLTLKEAISASISRGKLVSGGESIGTTTTALVVPA  400

Query  1562  FANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLG  1741
             FANP W+E+  + +RSM+NS R P+LF ++  AV +T  IL+T+FW+LD+S  GI E LG
Sbjct  401   FANPMWIEIKTLSQRSMLNSRRQPKLFGVKVVAVFITAFILSTVFWRLDNSRNGIGEHLG  460

Query  1742  FFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslaf  1921
             FFA+AMST + TCA+A+P  LQERYIFMRETAYNAYRRSSYVLSH+I+S P L  L+LAF
Sbjct  461   FFAYAMSTMYTTCAQALPELLQERYIFMRETAYNAYRRSSYVLSHAIVSFPGLMVLTLAF  520

Query  1922  aVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFV  2101
             AV T+WAVGL GG +G LF+ L + ASFW+GSSFVTFLSG+I NVM+ YT+V+AILAYF+
Sbjct  521   AVLTFWAVGLDGGPTGLLFYCLIILASFWSGSSFVTFLSGVIPNVMVGYTIVIAILAYFL  580

Query  2102  LFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVP  2281
             LFSGFFINR+RIP YWIWFHY SLVKYP++ VLQNEF    KCFV+G+Q FD +PL+ + 
Sbjct  581   LFSGFFINRNRIPDYWIWFHYISLVKYPYEAVLQNEFSDATKCFVRGVQTFDNTPLEELS  640

Query  2282  EAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllf  2461
               MKL +L+ +S++LG +ITSSTCLTTG DIL    V  ++KW+CL++T+A GFFFR LF
Sbjct  641   YDMKLSMLETVSQSLGKSITSSTCLTTGADILTHQSVNQLSKWHCLFVTVAFGFFFRALF  700

Query  2462  yfallIGSKNKRR  2500
             YF+LL+GSKNKRR
Sbjct  701   YFSLLLGSKNKRR  713



>gb|EPS67070.1| abc transporter family protein [Genlisea aurea]
Length=696

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/711 (65%), Positives = 563/711 (79%), Gaps = 32/711 (5%)
 Frame = +2

Query  374   SMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFPFVLSFHNLSYSVKVR  553
             S TLGELL R   S  E++           VL + +P P      F+LSF +L+Y+VK R
Sbjct  15    SHTLGELLQR--QSPEEEI-----------VLDVDEPPP-----AFLLSFTDLNYAVKAR  56

Query  554   RKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANR  733
              K  VP W   ++++ SQ+    KVLL+ ISGEAREGEI AVLG SGSGKSTLIDALA R
Sbjct  57    WKGIVPDWCFGKSSSSSQLP---KVLLNGISGEAREGEITAVLGGSGSGKSTLIDALAGR  113

Query  734   IARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrs  913
             I R+SL G+VK+NGE LES LLK ISAYVMQDDLLFPMLTVEETL F+AEFRLP+++S+S
Sbjct  114   ICRKSLAGSVKLNGEALESGLLKTISAYVMQDDLLFPMLTVEETLTFAAEFRLPKAMSKS  173

Query  914   rkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSG  1093
             +KK+RV AL+++LGL  AA T+IGDEG RGVSGGERRRVSIG DIIHDPIVLFLDEPTSG
Sbjct  174   QKKSRVNALMQRLGLLAAANTIIGDEGRRGVSGGERRRVSIGTDIIHDPIVLFLDEPTSG  233

Query  1094  LDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPR  1273
             LDSTSAFMVVKVL+ +AQSGS+VIMS+HQPSYRI+ LLD LI LS+GQTVFS SP+S+P 
Sbjct  234   LDSTSAFMVVKVLKTVAQSGSVVIMSIHQPSYRIVRLLDHLIILSRGQTVFSDSPASIPV  293

Query  1274  FFQEFGNPIPENENRCEFALDFIRELEQSP-EGTKNLVDFNKSWQRKFSPSSTSNRNNVF  1450
             FF EFGNPIP +E++ EFALD IRELE S   GT+NL DFN++W RK S      +    
Sbjct  294   FFAEFGNPIPADEDKIEFALDLIRELENSGGAGTENLRDFNRNWNRKKSKKKKKKKKKSD  353

Query  1451  PNPKPSLKDAI-SASISRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLR  1627
                K  LKDAI +ASIS+GKL+SGA++          KF NP W E+++IG RS+  S R
Sbjct  354   AIDKILLKDAIKAASISKGKLLSGASD---------KKFQNPIWKEILIIGNRSLTISRR  404

Query  1628  MPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQ  1807
              PELF  RF AV+VTG ILAT++ +LDDSP+GIQERLGFFAFAMSTTFYTCAE++P+FL 
Sbjct  405   SPELFFTRFAAVIVTGTILATVYRRLDDSPRGIQERLGFFAFAMSTTFYTCAESMPIFLL  464

Query  1808  ERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffll  1987
             ERYIF+RET++++YRRSSYVLSH+  S+P LA LSL+FA T +WAVGL+GG  GFLFF  
Sbjct  465   ERYIFLRETSHHSYRRSSYVLSHAAASVPPLAVLSLSFAATIFWAVGLSGGARGFLFFSG  524

Query  1988  fvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYA  2167
              + A+FWAG+SFVTFLSG+I +++++YT+V A+L Y+VLFSGFF+ RDRIP YW WFHY 
Sbjct  525   SMMAAFWAGTSFVTFLSGVIADLLMSYTVVAAVLGYWVLFSGFFVGRDRIPGYWTWFHYL  584

Query  2168  SLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSS  2347
             SLVKYPFQGV+QNEFD P KCFV+G+++FD SPL+ VPE++K+KLL+++  TLG+NIT+S
Sbjct  585   SLVKYPFQGVVQNEFDRPYKCFVRGVEVFDQSPLRLVPESVKVKLLESVGSTLGMNITAS  644

Query  2348  TCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             TCL TG D+LKQ GVTDI KW+CLWIT+  GFFFRLLFYFALLI S N +R
Sbjct  645   TCLITGSDVLKQAGVTDIGKWDCLWITVCWGFFFRLLFYFALLIRSNNNKR  695



>gb|EYU19905.1| hypothetical protein MIMGU_mgv1a026629mg [Erythranthe guttata]
Length=666

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/719 (64%), Positives = 547/719 (76%), Gaps = 75/719 (10%)
 Frame = +2

Query  374   SMTLGELLHRVGDSAGEKLNNGVGGAND--HRVLQLYDPV----PYPSSFPFVLSFHNLS  535
             S TLG+LL RVGD   E     V G     H+VL + D          S PFVLSF N++
Sbjct  11    SATLGQLLKRVGDVRKE-----VTGDETPVHQVLDVNDGGGGIGSMSQSLPFVLSFSNIT  65

Query  536   YSVKVRRKMGVPAWLGRRTAAPSQVENDV-----KVLLDDISGEAREGEIMAVLGASGSG  700
             YS+KVRRK+   +   RR  A   V  +      K +L+DISGEAR+GEIMAV+GASGSG
Sbjct  66    YSIKVRRKVTPQSLFRRRPTAADPVSGETLFSATKTILNDISGEARDGEIMAVMGASGSG  125

Query  701   KSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSA  880
             KSTLIDALANR+A+ SL G V +NGE LES+LLKVISAYVMQDDLLFPMLTVEETLMF+A
Sbjct  126   KSTLIDALANRMAKGSLKGGVTLNGEQLESRLLKVISAYVMQDDLLFPMLTVEETLMFAA  185

Query  881   EFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDP  1060
             EFRLPR+LS+S+KK RVQALI+QLGL+ AA TVIGDEGHRGVSGGERRRVSIG DIIHDP
Sbjct  186   EFRLPRTLSKSKKKLRVQALIDQLGLRNAANTVIGDEGHRGVSGGERRRVSIGTDIIHDP  245

Query  1061  IVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQT  1240
             I+LFLDEPTSGLDSTSA+MVVKVLQRIAQSGSIVIMS+HQPSYRIL LLDR+IFLS+GQT
Sbjct  246   ILLFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLDRMIFLSRGQT  305

Query  1241  VFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSP  1420
             V+SG PS+LP +F +FG+PIP+NEN+ + +                        + K   
Sbjct  306   VYSGPPSNLPVYFSDFGHPIPDNENKTDIS------------------------RGKLVS  341

Query  1421  SSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIG  1600
              +T+N                            +T +N      VP FANP W+EM V+ 
Sbjct  342   GATTN----------------------------STAVNRL----VPTFANPSWIEMAVLS  369

Query  1601  KRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTC  1780
             KRS  NS RMPELF +R GAV+VTG ILAT+FW+LD+SP+G+QERLGFFAFAMSTTFYTC
Sbjct  370   KRSFTNSRRMPELFGVRLGAVMVTGFILATMFWRLDNSPRGVQERLGFFAFAMSTTFYTC  429

Query  1781  AEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglagg  1960
             A+A+PVFLQERY+FMRETAYNAYRRSSYV+SHS+++LPSL FLSLAFA TT+WA    G 
Sbjct  430   ADALPVFLQERYVFMRETAYNAYRRSSYVVSHSLVALPSLLFLSLAFAATTFWA---VGL  486

Query  1961  fsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIP  2140
               GF F+ L +FASFWAGSSFVTFLSG++ +VM+ YT+VVAILAYF+LFSGFFINRDRIP
Sbjct  487   DGGFFFYFLIIFASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIP  546

Query  2141  PYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSK  2320
              YWIWFHY SLVKYP++ VLQNEF+ P KCFV+GIQIFD +PL +VP A+K+KLL  MS 
Sbjct  547   AYWIWFHYLSLVKYPYEAVLQNEFEDPVKCFVRGIQIFDNTPLGSVPNALKVKLLDGMSS  606

Query  2321  TLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKR  2497
             +LG+ ITS+TC+TTG DIL+Q G+TD+ KW+CLW+T+A GF FR+LFY +LL GSKNKR
Sbjct  607   SLGLKITSTTCVTTGADILQQQGITDLTKWSCLWVTVAWGFLFRVLFYLSLLAGSKNKR  665



>emb|CBI25312.3| unnamed protein product [Vitis vinifera]
Length=663

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/729 (67%), Positives = 561/729 (77%), Gaps = 90/729 (12%)
 Frame = +2

Query  323   RQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGAND--HRVLQLYDPVPYP  496
             RQ ME +ELT       S TLG LL  VGD   E     V G     H+VL++ +    P
Sbjct  22    RQTMEDEELTVSS-SGPSPTLGHLLKCVGDVRKE-----VTGDETPVHQVLEMGEANMEP  75

Query  497   SSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMA  676
              S PFVLSF NL+YSV VRRKM +PA + RRT+        +  LL+DISGEAR+GEI+A
Sbjct  76    RSLPFVLSFSNLTYSVNVRRKMALPA-IFRRTS-------QLGTLLNDISGEARDGEILA  127

Query  677   VLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTV  856
             VLGASGSGKSTLIDALANRIA+ SL G V +NGE LES+LLKVISAYVMQDDLL+PMLTV
Sbjct  128   VLGASGSGKSTLIDALANRIAKGSLKGAVTLNGEALESRLLKVISAYVMQDDLLYPMLTV  187

Query  857   EETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsi  1036
             EETLMF+AEFRLPR+LS+S+KKARV+ALI+QLGL+ AAKTVIGDEGHRGVSGGERRRVSI
Sbjct  188   EETLMFAAEFRLPRTLSKSKKKARVEALIDQLGLRNAAKTVIGDEGHRGVSGGERRRVSI  247

Query  1037  giDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRL  1216
             GIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRIL LLDRL
Sbjct  248   GIDIIHDPIILFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILGLLDRL  307

Query  1217  IFLSKGQTVFSGSPSSLPRFFQEFGNPI-PENENRCEFALDFIRELEQSPEGTKNLVDFN  1393
             IFLS+GQTV+SG P +LP FF EFG+PI P+NENR EFALD IRELE SP GTK+LV+FN
Sbjct  308   IFLSRGQTVYSGPPMNLPLFFAEFGHPIPPDNENRTEFALDLIRELEGSPGGTKSLVEFN  367

Query  1394  KSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANP  1573
             K WQ       T+N             DA S S+                   VP FAN 
Sbjct  368   KQWQ-------TTN-------------DASSTSL-------------------VPTFANS  388

Query  1574  FWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAF  1753
             FWVEM V+ KRS+ NS RMPELF +R GAV++TG ILATI+W+LD+SPKG QERLGFFAF
Sbjct  389   FWVEMAVLSKRSITNSRRMPELFGIRLGAVLITGFILATIYWQLDNSPKGAQERLGFFAF  448

Query  1754  AMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTT  1933
             AMSTTFYTCA+A+PVFLQERYIF+RETAYNAYRRSSYVLSHS+ SLP+L FLS AFA TT
Sbjct  449   AMSTTFYTCADALPVFLQERYIFLRETAYNAYRRSSYVLSHSLTSLPALIFLSFAFAATT  508

Query  1934  YWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSG  2113
             ++AVGL GG SGFLF+ L +FASFWAG+SFVTFLSG++ +VM+ YT+VVA+LAYF+LFSG
Sbjct  509   FFAVGLDGGLSGFLFYFLIIFASFWAGNSFVTFLSGVVPHVMLGYTIVVALLAYFLLFSG  568

Query  2114  FFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMK  2293
             FFINR+RIP YWIWFHY SLVKYP++GVLQNEF+ P KC+                    
Sbjct  569   FFINRNRIPSYWIWFHYVSLVKYPYEGVLQNEFNDPAKCY--------------------  608

Query  2294  LKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfal  2473
                           ITSSTC+TTG DILKQ G+TD++KWNCLW+T+A GFFFR+LFYFAL
Sbjct  609   --------------ITSSTCVTTGVDILKQQGITDLSKWNCLWVTVAWGFFFRILFYFAL  654

Query  2474  lIGSKNKRR  2500
             L+GSKNKRR
Sbjct  655   LMGSKNKRR  663



>ref|XP_007027151.1| ABC transporter G family member 2 [Theobroma cacao]
 gb|EOY07653.1| ABC transporter G family member 2 [Theobroma cacao]
Length=709

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/725 (62%), Positives = 559/725 (77%), Gaps = 20/725 (3%)
 Frame = +2

Query  332   MELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYD-PVPYPSSFP  508
             MELQ+ +   + S S TL  LL R         +   G ++DH+VL + +     P+  P
Sbjct  1     MELQQFSSEAQFSSSPTLEHLLKR---------DEITGKSDDHQVLDIPNTSSSIPALAP  51

Query  509   FVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGA  688
             F+LSF+NL+Y VKV  K   P        +P   +N  K LL+DI+GEAREGEIMA+LGA
Sbjct  52    FLLSFNNLTYDVKVGPKSTFPCCGNTTIVSP---DNKTKSLLNDITGEAREGEIMAILGA  108

Query  689   SGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETL  868
             SGSGKSTLIDALAN+I R SL G+V +NGE LES LLKVISAYVMQDDLLFPMLTVEETL
Sbjct  109   SGSGKSTLIDALANKIDRHSLKGSVTLNGEALESGLLKVISAYVMQDDLLFPMLTVEETL  168

Query  869   MFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDI  1048
             MFSAEFRLPRSLS+S+KKARVQALI+QLGL+ AAKTVIGDEGHRGVSGGERRRVSIGIDI
Sbjct  169   MFSAEFRLPRSLSKSKKKARVQALIDQLGLRNAAKTVIGDEGHRGVSGGERRRVSIGIDI  228

Query  1049  IHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLS  1228
             IHDPI+LFLDEPTSGLDSTSA+MVVKVLQRIAQSGSIVIMSVHQPS RI+ LLD LIFLS
Sbjct  229   IHDPILLFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSVHQPSSRIIGLLDSLIFLS  288

Query  1229  KGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQR  1408
              GQT++SGSP++LPRFF EFG+P PEN N  EFALDFIRELE++P GT+ LV+FNKSWQ 
Sbjct  289   HGQTLYSGSPANLPRFFNEFGHPFPENGNPSEFALDFIRELEETPFGTQKLVEFNKSWQA  348

Query  1409  KFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGA-TNINSTLSPSVPKFANPFWVE  1585
               + +S ++       P  +L+DAI  SISRGKLV+GA   I+  L+  VP FANPFWVE
Sbjct  349   SMNSNSNASN-----KPNLALRDAIKRSISRGKLVTGAVATIDVNLTSLVPSFANPFWVE  403

Query  1586  MVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMST  1765
             ++V+ KR + NS R+PE+F +R GA+++TGIILAT+FW++D+SP+G+QERLG  A ++ST
Sbjct  404   VLVLFKRLVTNSRRIPEVFGVRLGAIIITGIILATMFWQIDNSPRGVQERLGCIAISIST  463

Query  1766  TFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAv  1945
               YTC    P F++ERYIFMRETAYNAYRRSSYVL+ S IS+PSL  LSL F+  T+WA+
Sbjct  464   IVYTCTTEAPEFIKERYIFMRETAYNAYRRSSYVLARSFISIPSLIILSLVFSTITFWAI  523

Query  1946  glaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFIN  2125
             G +GG SGF F+ L   A+FWAGSSFV FL+G+  +  I++ + +A  +YF+ F GF ++
Sbjct  524   GFSGGLSGFFFYFLTTLATFWAGSSFVAFLAGLFPDFFISFVIAIATTSYFLFFCGFLVS  583

Query  2126  RDRIPPYWIWFHYASLVKYPFQGVLQNEF-DYPDKCFVKGIQIFDGSPLKAVPEAMKLKL  2302
             RDR+P YWIWFHY SLVKYP++ +LQNEF   P KCF +G QIF+ + L A+P ++K  L
Sbjct  584   RDRLPKYWIWFHYTSLVKYPYEALLQNEFLQDPSKCFARGAQIFEQTTLGALPTSLKNDL  643

Query  2303  LQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIG  2482
             L +M   LG+N+T STC+  G DI+K  G+TD+NKWNC+WIT+A GFF+R+LF   LL G
Sbjct  644   LTSMGNVLGMNVTGSTCILMGKDIVKLQGLTDLNKWNCVWITMAWGFFYRILFNLTLLFG  703

Query  2483  SKNKR  2497
             SKNKR
Sbjct  704   SKNKR  708



>ref|XP_007027150.1| ABC transporter G family member 2 [Theobroma cacao]
 gb|EOY07652.1| ABC transporter G family member 2 [Theobroma cacao]
Length=686

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/667 (67%), Positives = 534/667 (80%), Gaps = 10/667 (1%)
 Frame = +2

Query  506   PFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLG  685
             PFVLSF+NL+Y VKV RK   P +   R  +    EN+ + LL DISGEAREGEIMA+LG
Sbjct  28    PFVLSFNNLNYDVKVGRKSWFPFYRKNRNVSS---ENETRSLLKDISGEAREGEIMAILG  84

Query  686   ASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEET  865
             ASGSGKSTLIDALANRIA+ SL G++ +NGEVL S +LKVISAYVMQDDLLFPMLTVEET
Sbjct  85    ASGSGKSTLIDALANRIAKHSLMGSITLNGEVLGSGILKVISAYVMQDDLLFPMLTVEET  144

Query  866   LMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiD  1045
             LMFSAEFRLPRSLS+S+KKARVQALI+QLGL++AAKTVIGDEGHRGVSGGERRRVSIGID
Sbjct  145   LMFSAEFRLPRSLSKSKKKARVQALIDQLGLRSAAKTVIGDEGHRGVSGGERRRVSIGID  204

Query  1046  IIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFL  1225
             IIHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMS+HQPS RIL LLDRLI L
Sbjct  205   IIHDPILLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSSRILGLLDRLIIL  264

Query  1226  SKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQ  1405
             S GQ ++S SP++L +FF +FG+PIPE EN  EFALDFIRELE +P GT+NLV+FNKSWQ
Sbjct  265   SHGQALYSSSPANLSQFFSDFGHPIPEKENPSEFALDFIRELEGAPSGTQNLVEFNKSWQ  324

Query  1406  RKFSPSSTSNRNNVFPN-PKPSLKDAISASISRGKLVSGATNINS-TLSPSVPKFANPFW  1579
                  + T+  +N+  N P  +LKDAIS SISRGKLVSGA   +    S SVP FANPFW
Sbjct  325   -----TLTNVNDNIASNRPSLALKDAISRSISRGKLVSGAIATSDLDHSSSVPSFANPFW  379

Query  1580  VEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAM  1759
             +E++V+ +R + NS RMP  F +R G ++VTGI+LAT+FW+LDDSP G+QERLG  A ++
Sbjct  380   IEVLVLSRRLLTNSRRMPAKFGVRLGTIMVTGIVLATMFWQLDDSPSGVQERLGCIAISI  439

Query  1760  STTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYW  1939
             +  F+ C   +P F+QERYIFMRETAYNAYRRSSYVL+ S+I +P L  LSL F++ T+W
Sbjct  440   AAIFFNCITEVPTFIQERYIFMRETAYNAYRRSSYVLARSLIHIPLLFILSLFFSIITFW  499

Query  1940  AvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFF  2119
             AVGLAGG SGFLFF     ASFWAGSSF  FLSG++ +V +A+ + +AI++YF+   GF 
Sbjct  500   AVGLAGGLSGFLFFFFTTLASFWAGSSFAAFLSGLVPDVFLAFVIGIAIVSYFLFLCGFL  559

Query  2120  INRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLK  2299
             ++RDRIP YWIW HY SLVKYP++ +LQNEF  P KCF +G+Q+FD S L  +P + K  
Sbjct  560   VSRDRIPKYWIWLHYTSLVKYPYEALLQNEFLDPTKCFARGVQLFDQSALGTLPTSTKND  619

Query  2300  LLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallI  2479
             LL +M   LG NITSSTCLTTG DIL Q G+T ++KWN +WI IA GFFFR+LFY  LL 
Sbjct  620   LLSSMGNVLGRNITSSTCLTTGKDILMQQGITKLSKWNRVWIIIAWGFFFRILFYLTLLF  679

Query  2480  GSKNKRR  2500
             GSK+KR+
Sbjct  680   GSKSKRK  686



>ref|XP_002312057.2| hypothetical protein POPTR_0008s04780g [Populus trichocarpa]
 gb|EEE89424.2| hypothetical protein POPTR_0008s04780g [Populus trichocarpa]
Length=679

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/686 (68%), Positives = 535/686 (78%), Gaps = 27/686 (4%)
 Frame = +2

Query  257   MSQASSRD-DMSTASSDLPFLGPRQAMELQELTRRPRHS---VSMTLGELLHRVGDSAGE  424
             MS+  + D   S  S  +PF     +M+      +P  S    S TLG+LL  VGD   E
Sbjct  1     MSRVVAEDYSPSRDSGTMPFYTQSISMDFTNHHPQPPFSSTATSPTLGQLLKNVGDLRRE  60

Query  425   KLNNGVGGANDHRVLQLYDP-VPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAP  601
                NG      H+VL+L    +  P S PFVLSF+NL YSVKVRRK  + + L  R    
Sbjct  61    ATGNG-SETPVHQVLELGSTNLEVPRSIPFVLSFNNLKYSVKVRRKFRLRSILPSRNIHR  119

Query  602   SQVEND------------VKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARE  745
             +    D             K LL+DISGEAR+GEI+AVLGASGSGKSTLIDALANRIA+ 
Sbjct  120   TGATTDSDPVGGESLSTTTKTLLNDISGEARDGEILAVLGASGSGKSTLIDALANRIAKG  179

Query  746   SLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkka  925
             SL GT  +NGEVLES++LKVISAYVMQDDLLFPMLTVEETLMF+AEFRLPRSLS S+K+ 
Sbjct  180   SLKGTKTLNGEVLESRMLKVISAYVMQDDLLFPMLTVEETLMFAAEFRLPRSLSNSKKRL  239

Query  926   rVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDST  1105
             RVQALIEQLGL+ AAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDST
Sbjct  240   RVQALIEQLGLKNAAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPIILFLDEPTSGLDST  299

Query  1106  SAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQE  1285
             SAFMVVKVLQRIAQSGSIVIMSVHQPSYRIL LLDRLIFLS+GQTV+SGSP SLP +F +
Sbjct  300   SAFMVVKVLQRIAQSGSIVIMSVHQPSYRILGLLDRLIFLSRGQTVYSGSPMSLPVYFSD  359

Query  1286  FGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQR-KFSPSSTSNRNNVFPNPK  1462
             FG+PIP++ENR E+ALD IRELE SP GTK+LV+FNKSW   K S +     +       
Sbjct  360   FGHPIPDSENRTEYALDLIRELEGSPGGTKSLVEFNKSWHDLKLSRNGRGEPD----GGG  415

Query  1463  PSLKDAISASISRGKLVSGATNINSTLSPS--VPKFANPFWVEMVVIGKRSMVNSLRMPE  1636
              SLK+AISA+IS+GKLVSGATN N  +SP+  VP FANP W EM V+ +RS +NS R+PE
Sbjct  416   LSLKEAISAAISKGKLVSGATN-NDAISPNSMVPTFANPVWKEMAVLSRRSFMNSRRVPE  474

Query  1637  LFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERY  1816
             LF +R GAVVVTG ILAT+FW+LD SPKG+QERLGFFAFAMSTTFYTCA+A+PVFLQERY
Sbjct  475   LFGVRLGAVVVTGFILATVFWQLDSSPKGVQERLGFFAFAMSTTFYTCADALPVFLQERY  534

Query  1817  IFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvf  1996
             IFMRETAYNAYRRSSYVLSH ++ LPSL FLS AFA TT+WAVGL GGFSGFLF+ L +F
Sbjct  535   IFMRETAYNAYRRSSYVLSHGLVVLPSLIFLSFAFAATTFWAVGLDGGFSGFLFYFLIIF  594

Query  1997  asfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLV  2176
             ASFWAGSSFVTFLSG++ +VM+ Y +VVAILAYF+LFSGFFINRDRIP YWIWFHY SLV
Sbjct  595   ASFWAGSSFVTFLSGVVPHVMLGYIIVVAILAYFLLFSGFFINRDRIPSYWIWFHYLSLV  654

Query  2177  KYPFQGVLQNEFDYPDKCFVKGIQIF  2254
             KYP++ VLQNEF    + F KG   F
Sbjct  655   KYPYEAVLQNEFS-DAQVFRKGCPDF  679



>dbj|BAF00471.1| ABC transporter - like protein [Arabidopsis thaliana]
Length=708

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/727 (61%), Positives = 558/727 (77%), Gaps = 22/727 (3%)
 Frame = +2

Query  320   PRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPS  499
             PR + E+ +++    +  S TLGELL    DS G K   G      H +L L  P     
Sbjct  2     PRVSAEILDISHTGGNE-SPTLGELLKDFNDS-GRKKYPGENAPTQH-ILDL-APAAETR  57

Query  500   SFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAV  679
             S PF+LSF+NLSY+V +RR+        R+TA+       VK LLDDI+GEAR+GEI+AV
Sbjct  58    SVPFLLSFNNLSYNVVLRRRFDFSR---RKTAS-------VKTLLDDITGEARDGEILAV  107

Query  680   LGASGSGKSTLIDALANRIARESLGGTVKMNGE-VLESKLLKVISAYVMQDDLLFPMLTV  856
             LG SG+GKSTLIDALA R+A +SL GTV +NGE VL+S+LLKVISAYVMQDDLLFPMLTV
Sbjct  108   LGGSGAGKSTLIDALAGRVAEDSLKGTVTLNGEKVLQSRLLKVISAYVMQDDLLFPMLTV  167

Query  857   EETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsi  1036
             +ETLMF++EFRLPRSL +S+K  RV+ LI+QLGL+ AA TVIGDEGHRGVSGGERRRVSI
Sbjct  168   KETLMFASEFRLPRSLPKSKKMERVETLIDQLGLRNAADTVIGDEGHRGVSGGERRRVSI  227

Query  1037  giDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRL  1216
             GIDIIHDPI+LFLDEPTSGLDST+AFMVV+VL+RIAQSGS+VIMS+HQPS RI+ LLDRL
Sbjct  228   GIDIIHDPILLFLDEPTSGLDSTNAFMVVQVLKRIAQSGSVVIMSIHQPSARIIGLLDRL  287

Query  1217  IFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNK  1396
             I LS G++VF+GSP SLP FF  FG PIPE EN  EFALD IRELE S EGT++LV+FN+
Sbjct  288   IILSHGKSVFNGSPVSLPSFFSSFGRPIPEKENITEFALDVIRELEGSSEGTRDLVEFNE  347

Query  1397  SWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPF  1576
              WQ+  +  +T+         + SLK+AI+AS+SRGKLVSG++  N     +V  +ANP 
Sbjct  348   KWQQNQTARATTQ-------SRVSLKEAIAASVSRGKLVSGSSGANPISMETVSSYANPP  400

Query  1577  WVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFA  1756
               E  ++ KR + N +R PEL  MR G V+VTG++LAT++W+LD++P+G QER+GFFAF 
Sbjct  401   LAETFILAKRYIKNWIRTPELIGMRIGTVMVTGLLLATVYWRLDNTPRGAQERMGFFAFG  460

Query  1757  MSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTY  1936
             MST FY CA+ IPVF+QERYIF+RET +NAYR SSYV+SH+++SLP L  LS+AFA TT+
Sbjct  461   MSTMFYCCADNIPVFIQERYIFLRETTHNAYRTSSYVISHALVSLPQLLALSIAFAATTF  520

Query  1937  WAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGF  2116
             W VGL+GG   F ++ L ++A+FW+GSS VTF+SG+I NVM++Y + +A L+Y +L  GF
Sbjct  521   WTVGLSGGLESFFYYCLVIYAAFWSGSSIVTFISGLIPNVMMSYMVTIAYLSYCLLLGGF  580

Query  2117  FINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKL  2296
             +INRDRIP YWIWFHY SL+KYP++ VL NEFD P +CFVKG+Q+FDG+ L  V   MK+
Sbjct  581   YINRDRIPLYWIWFHYISLLKYPYEAVLINEFDDPSRCFVKGVQVFDGTLLAEVSHVMKV  640

Query  2297  KLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfall  2476
             KLL  +S +LG  IT STCL TGPD+L Q G+T ++KW+CLWIT+A G FFR+LFY +LL
Sbjct  641   KLLDTLSGSLGTKITESTCLRTGPDLLMQQGITQLSKWDCLWITLAWGLFFRILFYLSLL  700

Query  2477  IGSKNKR  2497
              GSKNKR
Sbjct  701   FGSKNKR  707



>ref|NP_191071.1| ABC transporter G family member 18 [Arabidopsis thaliana]
 sp|Q9M2V5.1|AB18G_ARATH RecName: Full=ABC transporter G family member 18; Short=ABC transporter 
ABCG.18; Short=AtABCG18; AltName: Full=Probable white-brown 
complex homolog protein 18; Short=AtWBC18 [Arabidopsis 
thaliana]
 emb|CAB82706.1| ABC transporter-like protein [Arabidopsis thaliana]
 gb|AEE79341.1| ABC transporter G family member 18 [Arabidopsis thaliana]
Length=708

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/727 (61%), Positives = 558/727 (77%), Gaps = 22/727 (3%)
 Frame = +2

Query  320   PRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPS  499
             PR + E+ +++    +  S TLGELL    DS G K   G      H +L L  P     
Sbjct  2     PRVSAEILDISHTGGNE-SPTLGELLKDFNDS-GRKKYPGENAPTQH-ILDL-APAAETR  57

Query  500   SFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAV  679
             S PF+LSF+NLSY+V +RR+        R+TA+       VK LLDDI+GEAR+GEI+AV
Sbjct  58    SVPFLLSFNNLSYNVVLRRRFDFSR---RKTAS-------VKTLLDDITGEARDGEILAV  107

Query  680   LGASGSGKSTLIDALANRIARESLGGTVKMNGE-VLESKLLKVISAYVMQDDLLFPMLTV  856
             LG SG+GKSTLIDALA R+A +SL GTV +NGE VL+S+LLKVISAYVMQDDLLFPMLTV
Sbjct  108   LGGSGAGKSTLIDALAGRVAEDSLKGTVTLNGEKVLQSRLLKVISAYVMQDDLLFPMLTV  167

Query  857   EETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsi  1036
             +ETLMF++EFRLPRSL +S+K  RV+ LI+QLGL+ AA TVIGDEGHRGVSGGERRRVSI
Sbjct  168   KETLMFASEFRLPRSLPKSKKMERVETLIDQLGLRNAADTVIGDEGHRGVSGGERRRVSI  227

Query  1037  giDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRL  1216
             GIDIIHDPI+LFLDEPTSGLDST+AFMVV+VL+RIAQSGS+VIMS+HQPS RI+ LLDRL
Sbjct  228   GIDIIHDPILLFLDEPTSGLDSTNAFMVVQVLKRIAQSGSVVIMSIHQPSARIIGLLDRL  287

Query  1217  IFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNK  1396
             I LS G++VF+GSP SLP FF  FG PIPE EN  EFALD IRELE S EGT++LV+FN+
Sbjct  288   IILSHGKSVFNGSPVSLPSFFSSFGRPIPEKENITEFALDVIRELEGSSEGTRDLVEFNE  347

Query  1397  SWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPF  1576
              WQ+  +  +T+         + SLK+AI+AS+SRGKLVSG++  N     +V  +ANP 
Sbjct  348   KWQQNQTARATTQ-------SRVSLKEAIAASVSRGKLVSGSSGANPISMETVSSYANPP  400

Query  1577  WVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFA  1756
               E  ++ KR + N +R PEL  MR G V+VTG++LAT++W+LD++P+G QER+GFFAF 
Sbjct  401   LAETFILAKRYIKNWIRTPELIGMRIGTVMVTGLLLATVYWRLDNTPRGAQERMGFFAFG  460

Query  1757  MSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTY  1936
             MST FY CA+ IPVF+QERYIF+RET +NAYR SSYV+SH+++SLP L  LS+AFA TT+
Sbjct  461   MSTMFYCCADNIPVFIQERYIFLRETTHNAYRTSSYVISHALVSLPQLLALSIAFAATTF  520

Query  1937  WAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGF  2116
             W VGL+GG   F ++ L ++A+FW+GSS VTF+SG+I NVM++Y + +A L+Y +L  GF
Sbjct  521   WTVGLSGGLESFFYYCLIIYAAFWSGSSIVTFISGLIPNVMMSYMVTIAYLSYCLLLGGF  580

Query  2117  FINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKL  2296
             +INRDRIP YWIWFHY SL+KYP++ VL NEFD P +CFVKG+Q+FDG+ L  V   MK+
Sbjct  581   YINRDRIPLYWIWFHYISLLKYPYEAVLINEFDDPSRCFVKGVQVFDGTLLAEVSHVMKV  640

Query  2297  KLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfall  2476
             KLL  +S +LG  IT STCL TGPD+L Q G+T ++KW+CLWIT+A G FFR+LFY +LL
Sbjct  641   KLLDTLSGSLGTKITESTCLRTGPDLLMQQGITQLSKWDCLWITLAWGLFFRILFYLSLL  700

Query  2477  IGSKNKR  2497
              GSKNKR
Sbjct  701   FGSKNKR  707



>ref|XP_002878018.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54277.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=708

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/727 (61%), Positives = 555/727 (76%), Gaps = 22/727 (3%)
 Frame = +2

Query  320   PRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPS  499
             PR + E+ +L+    +  S TLGELL    DS  +K       A  H +L L  P     
Sbjct  2     PRVSAEILDLSLTGGNQ-SPTLGELLKDFNDSGRKKYPGE--NAPTHHILDL-APAAETR  57

Query  500   SFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAV  679
             S PF+LSF+NLSY+V +RR+        R+TA+       VK LLDD++GEA +GEI+AV
Sbjct  58    SVPFLLSFNNLSYNVVLRRRFDFSR---RKTAS-------VKTLLDDVTGEACDGEILAV  107

Query  680   LGASGSGKSTLIDALANRIARESLGGTVKMNGE-VLESKLLKVISAYVMQDDLLFPMLTV  856
             LG SG+GKSTLIDALA R+A +SL GTV +NGE VL+S+LLKVISAYVMQDDLLFPMLTV
Sbjct  108   LGGSGAGKSTLIDALAGRVAEDSLRGTVTLNGEKVLQSRLLKVISAYVMQDDLLFPMLTV  167

Query  857   EETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsi  1036
             +ETLMF++EFRLPRSL  S+K  RV+ LI+QLGL+ AA TVIGDEGHRGVSGGERRRVSI
Sbjct  168   KETLMFASEFRLPRSLPESKKMERVETLIDQLGLRNAADTVIGDEGHRGVSGGERRRVSI  227

Query  1037  giDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRL  1216
             GIDIIHDPI+LFLDEPTSGLDST+AFMVV+VL+RIAQSGSIVIMS+HQPS RI++LLDRL
Sbjct  228   GIDIIHDPILLFLDEPTSGLDSTNAFMVVQVLKRIAQSGSIVIMSIHQPSARIIDLLDRL  287

Query  1217  IFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNK  1396
             I LS G++VF+GSP+SLP FF  FG PIPE EN  EFALD IRELE S EGT+ LV+FN+
Sbjct  288   IILSHGKSVFNGSPASLPSFFSNFGRPIPEKENITEFALDVIRELEGSSEGTRGLVEFNE  347

Query  1397  SWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPF  1576
              WQ+  S  +T+           SLK+AI+AS+SRGKLVSG++  N     +V  +ANP 
Sbjct  348   KWQQNQSARATTQSG-------VSLKEAITASVSRGKLVSGSSGANPVSMETVSSYANPP  400

Query  1577  WVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFA  1756
               E  ++ KR + N +R PEL  MR   V+VTG++LATI+W+LD++P+G QER+GFFAF 
Sbjct  401   LAETFILAKRYIRNWIRTPELIGMRIATVMVTGLLLATIYWRLDNTPRGAQERMGFFAFG  460

Query  1757  MSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTY  1936
             MST FY CA+ IPVF+QERYIF+RET +NAYR SSYV+SH+++SLP L  LS+AFA TT+
Sbjct  461   MSTMFYCCADNIPVFIQERYIFLRETTHNAYRTSSYVISHALVSLPQLLALSIAFAATTF  520

Query  1937  WAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGF  2116
             W VGL+GG   F ++ L ++A+FW+GSS VTF+SG+I NVM++Y   +A L+Y +L  GF
Sbjct  521   WTVGLSGGLESFYYYCLIIYAAFWSGSSIVTFISGLIPNVMMSYMATIAYLSYCLLLGGF  580

Query  2117  FINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKL  2296
             +INRDRIP YWIWFHY SL+KYP++ VL NEFD P +CFVKG+Q+FDG+ L  VP  MK+
Sbjct  581   YINRDRIPLYWIWFHYISLLKYPYEAVLINEFDDPSRCFVKGVQVFDGTLLAEVPHTMKV  640

Query  2297  KLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfall  2476
             KLL  +S +LG  IT STCL TGPD+L Q G+T ++KW+CLWIT+A G FFR+LFYF LL
Sbjct  641   KLLDTLSSSLGTKITESTCLRTGPDLLMQQGITQLSKWDCLWITLAWGLFFRILFYFTLL  700

Query  2477  IGSKNKR  2497
              GSKNKR
Sbjct  701   FGSKNKR  707



>ref|XP_010504355.1| PREDICTED: ABC transporter G family member 18-like [Camelina 
sativa]
Length=708

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/727 (61%), Positives = 555/727 (76%), Gaps = 22/727 (3%)
 Frame = +2

Query  320   PRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPS  499
             PR + E  +++    +  S TLGELL    DS  +K  +    A  H +L L  P     
Sbjct  2     PRVSAETSDISLAGGNE-SPTLGELLKDFTDSGRKK--HSCEDAPTHHILDL-APTSETR  57

Query  500   SFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAV  679
               PF+L+F+NL+Y+V +RR+ G      ++TA+        K LLDD+SGEA +GEI+AV
Sbjct  58    PVPFLLAFNNLNYNVVLRRRFGFSQ---QKTAS-------TKTLLDDVSGEACDGEILAV  107

Query  680   LGASGSGKSTLIDALANRIARESLGGTVKMNGE-VLESKLLKVISAYVMQDDLLFPMLTV  856
             LG SG+GKSTLIDALA R+A +SL GTV +NGE VL+S+LLKVISAYVMQDDLLFPMLTV
Sbjct  108   LGGSGAGKSTLIDALAGRVAEDSLKGTVTLNGENVLQSRLLKVISAYVMQDDLLFPMLTV  167

Query  857   EETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsi  1036
             +ETLMF++EFRLPRSLS+S+K  RV+ LI+QLGL+ AA TVIGDEGHRGVSGGERRRVSI
Sbjct  168   KETLMFASEFRLPRSLSKSKKMERVETLIDQLGLRNAANTVIGDEGHRGVSGGERRRVSI  227

Query  1037  giDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRL  1216
             GIDIIHDPI+LFLDEPTSGLDST+AFMVV+VL+RIAQSGSIVIM++HQPS RI++LLDRL
Sbjct  228   GIDIIHDPILLFLDEPTSGLDSTNAFMVVQVLKRIAQSGSIVIMTIHQPSARIVDLLDRL  287

Query  1217  IFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNK  1396
             I LS+G+TVF+GSP+SLP +F +FG P+PE EN  EFALD IRELE   EG + LV+FN+
Sbjct  288   IILSRGKTVFNGSPTSLPSYFSDFGRPVPEKENIIEFALDVIRELEGPSEGNRGLVEFNE  347

Query  1397  SWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPF  1576
              WQ+  S  +T       P    SLK+AI+AS+SRGKLVSG++  N      V  + NP 
Sbjct  348   KWQQNQSTRAT-------PQNGLSLKEAITASVSRGKLVSGSSGANPISMERVSSYVNPP  400

Query  1577  WVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFA  1756
               E  ++ KR M N +R PEL A R   V+VTG++LATI+W+LD++P+G QER+GFFAF 
Sbjct  401   LTETFILAKRYMRNWIRTPELIATRIATVMVTGLLLATIYWRLDNTPRGAQERMGFFAFG  460

Query  1757  MSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTY  1936
             MST FY CA+ IPVF+QERYIF+RET YNAYR SSYV+SH+++SLP L  LS+AFA TT+
Sbjct  461   MSTMFYCCADNIPVFIQERYIFLRETTYNAYRTSSYVISHALVSLPQLLALSIAFAATTF  520

Query  1937  WAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGF  2116
             W VGL GG   F ++ L ++A+FW+GSSFVTF+SGI+ NVM++Y + +A L+Y +L  GF
Sbjct  521   WTVGLTGGLENFFYYCLIIYAAFWSGSSFVTFISGIVPNVMMSYMVTIAYLSYCLLLGGF  580

Query  2117  FINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKL  2296
             FINRDRIP YWIWFHY SL+KYP++ VL NEFD P +CFVKG+Q+FDG+ L  VP AMK+
Sbjct  581   FINRDRIPFYWIWFHYISLLKYPYEAVLMNEFDDPSRCFVKGVQVFDGTLLAEVPHAMKV  640

Query  2297  KLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfall  2476
             KLL  +S +LG  IT STCL TG D+L Q G+T ++KW+CLWIT A G FFR+LFYF+LL
Sbjct  641   KLLDTLSGSLGTKITESTCLRTGTDLLMQQGITQLSKWDCLWITFAWGLFFRILFYFSLL  700

Query  2477  IGSKNKR  2497
              GSKNKR
Sbjct  701   FGSKNKR  707



>ref|XP_010427259.1| PREDICTED: ABC transporter G family member 18 [Camelina sativa]
Length=708

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/727 (61%), Positives = 557/727 (77%), Gaps = 22/727 (3%)
 Frame = +2

Query  320   PRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPS  499
             PR + E+ +++    +  S TLGELL    DS G K ++G   A  H +L L  P     
Sbjct  2     PRVSAEISDMSLAGGNE-SPTLGELLKDFTDS-GRKKHSG-EDAPSHHILDL-APTSETR  57

Query  500   SFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAV  679
               PF+L+F+NL+Y+V +RR+ G      ++TA+        K LLDD+SGEA +GEI+AV
Sbjct  58    PVPFLLAFNNLNYNVVLRRRFGFSQ---QKTAS-------TKTLLDDVSGEACDGEILAV  107

Query  680   LGASGSGKSTLIDALANRIARESLGGTVKMNGE-VLESKLLKVISAYVMQDDLLFPMLTV  856
             LG SG+GKSTLIDALA R+A +SL GTV +NGE VL+S+LLKVISAYVMQDDLLFPMLTV
Sbjct  108   LGGSGAGKSTLIDALAGRVAEDSLKGTVTLNGEKVLQSRLLKVISAYVMQDDLLFPMLTV  167

Query  857   EETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsi  1036
             +ETLMF++EFRLPRSLS+S+K  RV+ LI+QLGL+ A  TVIGDEGHRGVSGGERRRVSI
Sbjct  168   KETLMFASEFRLPRSLSKSKKMERVETLIDQLGLRNATNTVIGDEGHRGVSGGERRRVSI  227

Query  1037  giDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRL  1216
             GIDIIHDPI+LFLDEPTSGLDST+AFMVV+VL+RIAQSGSIVIMS+HQPS RI++LLDRL
Sbjct  228   GIDIIHDPILLFLDEPTSGLDSTNAFMVVQVLKRIAQSGSIVIMSIHQPSARIVDLLDRL  287

Query  1217  IFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNK  1396
             I LS+G++VF+GSP+SLP +F +FG P+PE EN  EFALD +RELE S EG + LV+FN+
Sbjct  288   IILSRGKSVFNGSPTSLPSYFSDFGRPVPEKENIIEFALDVVRELEGSSEGNRGLVEFNE  347

Query  1397  SWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPF  1576
              WQ+  S  +T       P    SLK+AI+AS+SRGKLVSG++  +      V  + NP 
Sbjct  348   KWQQNQSARAT-------PQNGLSLKEAITASVSRGKLVSGSSGASPISMERVSSYVNPP  400

Query  1577  WVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFA  1756
               E  ++ KR M N +R PEL A R   V+VTG++LATI+W+LD++P+G QER+GFFAF 
Sbjct  401   LTETFILAKRYMRNWIRTPELIATRIATVMVTGLLLATIYWRLDNTPRGAQERMGFFAFG  460

Query  1757  MSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTY  1936
             MST FY CA+ IPVF+QERYIF+RET +NAYR SSYV+SH++++LP L  LS+AFA TT+
Sbjct  461   MSTMFYCCADNIPVFIQERYIFLRETTHNAYRTSSYVISHALVALPQLLALSIAFAATTF  520

Query  1937  WAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGF  2116
             W VGL GG   F F+ L ++A FW+GSSFVTF+SGI+ NVMI+Y + +A L+Y +L  GF
Sbjct  521   WTVGLTGGLENFFFYCLIIYAGFWSGSSFVTFISGIVPNVMISYMVTIAYLSYCLLLGGF  580

Query  2117  FINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKL  2296
             FINRDRIP YWIWFHY SL+KYP++ VL NEFD P +CFVKG+Q+FDG+ L  VP AMK+
Sbjct  581   FINRDRIPFYWIWFHYISLLKYPYEAVLINEFDDPSRCFVKGVQVFDGTLLAEVPHAMKV  640

Query  2297  KLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfall  2476
             KLL  +S +LG  IT STCL TG D+L Q G+T ++KW+CLWIT A G FFR+LFYF+LL
Sbjct  641   KLLDTLSGSLGTKITESTCLRTGTDLLMQQGITQLSKWDCLWITFAWGLFFRILFYFSLL  700

Query  2477  IGSKNKR  2497
              GSKNKR
Sbjct  701   FGSKNKR  707



>ref|XP_003564558.1| PREDICTED: ABC transporter G family member 6-like [Brachypodium 
distachyon]
Length=752

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/702 (65%), Positives = 550/702 (78%), Gaps = 27/702 (4%)
 Frame = +2

Query  419   GEKLNNGVGGANDHRVLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRR---  589
             G ++++   GA   R +Q            F L+F +L+YSV+  R    P+  G R   
Sbjct  70    GGRVDDSNAGAAVGRAIQ------------FRLTFSDLTYSVRRAR----PSGHGLRLLP  113

Query  590   -----TAAPSQVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLG  754
                  TAA +      + LLD +SGEAREGEI+AV+GASGSGKSTLIDALANRI+R SL 
Sbjct  114   LHRVSTAAAAPDAQQTRALLDGVSGEAREGEILAVMGASGSGKSTLIDALANRISRGSLK  173

Query  755   GTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQ  934
             G+V +NGE L   +LK +SAYVMQDDLLFPMLTV ETL F+A+FRLPRSLS ++K+ARVQ
Sbjct  174   GSVTLNGEPLTGNVLKSMSAYVMQDDLLFPMLTVTETLSFAADFRLPRSLSPAKKRARVQ  233

Query  935   ALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAF  1114
             AL++QLGL+ AA T+IGDEGHRGVSGGERRRVSIG DIIHDPI+LFLDEPTSGLDSTSAF
Sbjct  234   ALVDQLGLRAAANTIIGDEGHRGVSGGERRRVSIGTDIIHDPILLFLDEPTSGLDSTSAF  293

Query  1115  MVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGN  1294
             MVVKVL+RIA+SGSIVI S+HQPS RIL LLDRLI LS G+TVFSG+PS+LP +F EFG 
Sbjct  294   MVVKVLRRIAESGSIVITSIHQPSQRILGLLDRLILLSGGRTVFSGAPSALPPYFAEFGF  353

Query  1295  PIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLK  1474
             P+P+NENR EFALD IRE E SP GTK LVDF+++W+   +  ++S     +  P  SLK
Sbjct  354   PVPDNENRAEFALDLIREFESSPTGTKPLVDFHRTWKLMHAGDTSSTGARPWEQPTMSLK  413

Query  1475  DAISASISRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRF  1654
             +AI ASISRGKLVSGA +++ T   S+  +ANPFWVEM V+ +RS +N+ RMPELF +R 
Sbjct  414   EAIGASISRGKLVSGAADVSHT---SMHTYANPFWVEMKVLTRRSAINTRRMPELFLIRL  470

Query  1655  GAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRET  1834
             GAVVVTG ILAT+F++LD SPKG QERLGFFAFAMST FYTCA+A+PVFLQERY+F+RET
Sbjct  471   GAVVVTGGILATVFFRLDQSPKGAQERLGFFAFAMSTMFYTCADALPVFLQERYVFLRET  530

Query  1835  AYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAG  2014
             AY AYRR+SYVLS++I+S P L  LSLAFA+TT++AVGLAGG SGF F+ L + ASFWAG
Sbjct  531   AYGAYRRASYVLSNAIVSFPPLVVLSLAFALTTFFAVGLAGGASGFAFYALAILASFWAG  590

Query  2015  SSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQG  2194
             S FVTFLSG+I +VMI YT+VVAILAYF+LFSGFFINRDRIP YW+WFHY SLVKYPF+G
Sbjct  591   SGFVTFLSGVIPHVMIGYTVVVAILAYFLLFSGFFINRDRIPAYWLWFHYLSLVKYPFEG  650

Query  2195  VLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDI  2374
             VLQNEF    +CFV+G QIFD SPL A+PEA+K ++L ++S  LG+ I   TC+  G  +
Sbjct  651   VLQNEFGRGGECFVRGAQIFDNSPLGALPEAVKARVLASISAALGVAIGPETCVANGRSV  710

Query  2375  LKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             L Q  VT + KW CL +T A GF FRLLFYF+L++GSKNKRR
Sbjct  711   LVQAAVTQLGKWECLLVTAAWGFLFRLLFYFSLVLGSKNKRR  752



>ref|XP_006428973.1| hypothetical protein CICLE_v10013485mg [Citrus clementina]
 ref|XP_006480708.1| PREDICTED: ABC transporter G family member 20-like [Citrus sinensis]
 gb|ESR42213.1| hypothetical protein CICLE_v10013485mg [Citrus clementina]
Length=703

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/685 (64%), Positives = 528/685 (77%), Gaps = 35/685 (5%)
 Frame = +2

Query  452   NDHRVLQLYDPV-PYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKV  628
             + H+V+ L +   P  ++ PFVLSF+NLSY V                        + K+
Sbjct  52    DQHQVIDLSNASSPASTTHPFVLSFNNLSYGV------------------------NSKL  87

Query  629   LLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVI  808
             LLDDISG AREGEIMA+LGASG+GKSTLIDALA RI +ESL GTV +NG VLES+LLK+I
Sbjct  88    LLDDISGVAREGEIMAILGASGAGKSTLIDALAGRIEKESLKGTVTLNGAVLESRLLKII  147

Query  809   SAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGD  988
             SAYVMQD+LLFPMLTVEETLMFSAE RLPRS+S+ RK+ RV+ALI+QLGL++AAKT IGD
Sbjct  148   SAYVMQDELLFPMLTVEETLMFSAECRLPRSVSKKRKRERVEALIDQLGLRSAAKTFIGD  207

Query  989   eghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIM  1168
             E HRGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAF VVKVL  IA+SGS+VIM
Sbjct  208   EQHRGVSGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTSAFKVVKVLGEIAKSGSVVIM  267

Query  1169  SVHQPSYRILNLLDRLIFLSKGQTVFSGSPSS-LPRFFQEFGNPIPENENRCEFALDFIR  1345
             S+HQPSYRI +LL+RLIFLS GQTV+SG+P++    FF EFG+PIPENEN CEF+LD IR
Sbjct  268   SIHQPSYRIFSLLNRLIFLSHGQTVYSGTPATDFSLFFAEFGHPIPENENPCEFSLDLIR  327

Query  1346  ELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGAT  1525
             ELE++P G  +LV FNKSWQ   +P   S+ ++    P   L+DAI ASISRGKLVS   
Sbjct  328   ELEEAPSGISSLVQFNKSWQMTRNPKMASDTDH---QPDVDLEDAIEASISRGKLVSAGK  384

Query  1526  NINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKL  1705
             N N      V  F NPFW EM+ + KRS  NS RMPELF  R GA +V   +LAT++W+L
Sbjct  385   NKN------VQTFVNPFWTEMLFLSKRSNTNSRRMPELFGTRLGAQLVIACVLATLYWQL  438

Query  1706  DDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsii  1885
             DDSPKG + RL F AFAM+T FY CA  IP  LQER IF+RET+YNAYR SSYVL+H++ 
Sbjct  439   DDSPKGTRLRLAFVAFAMTTIFYNCAREIPALLQERNIFIRETSYNAYRVSSYVLAHALA  498

Query  1886  slpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIA  2065
             S+PS+  LSL FA+TT+WAVGLAGGFSGFLFF + +FAS+WAG+SF+ F++G I N+ I 
Sbjct  499   SIPSMITLSLVFALTTFWAVGLAGGFSGFLFFFITMFASYWAGTSFMAFVAGFIPNIQIG  558

Query  2066  YTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGI  2245
             +T+VVAIL   +LF GF+I+ D IP YWIWFHY SLVKYPFQG LQNE+  P++CF+ G+
Sbjct  559   FTIVVAILGLSLLFCGFYISHDEIPSYWIWFHYVSLVKYPFQGALQNEYGDPNRCFLTGL  618

Query  2246  QIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWI  2425
             Q FDG+P   +P + K++LLQ+MS  LG NIT STCLTTG  IL+Q G+TDI+KW C+WI
Sbjct  619   QFFDGTPFDGLPNSTKIELLQSMSNVLGRNITGSTCLTTGMKILEQKGITDISKWKCIWI  678

Query  2426  TIAlgfffrllfyfallIGSKNKRR  2500
              +A GF FR+LFYF LL GSKNKRR
Sbjct  679   LVAFGFLFRVLFYFTLLFGSKNKRR  703



>gb|KHN02392.1| ABC transporter G family member 2 [Glycine soja]
Length=561

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/564 (77%), Positives = 492/564 (87%), Gaps = 7/564 (1%)
 Frame = +2

Query  821   MQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghr  1000
             MQDDLLFPMLTVEETLMF+AEFRLPRS S+S+KKARVQALI+QLGL++AA TVIGDEGHR
Sbjct  1     MQDDLLFPMLTVEETLMFAAEFRLPRSFSKSKKKARVQALIDQLGLRSAASTVIGDEGHR  60

Query  1001  gvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQ  1180
             GVSGGERRRVSIG DIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMS+HQ
Sbjct  61    GVSGGERRRVSIGTDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQ  120

Query  1181  PSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQS  1360
             PSYRIL+LLD LIFLS G TVFSGSP++LP FF EFG+PIPENENR EFALD IRELEQ 
Sbjct  121   PSYRILSLLDHLIFLSHGNTVFSGSPANLPAFFSEFGHPIPENENRTEFALDLIRELEQE  180

Query  1361  PEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATN---I  1531
               GTK+LVDFNKSWQ K + +    +N    + K SLKDAISASISRGKLVSG       
Sbjct  181   ATGTKSLVDFNKSWQLK-NKNQAQAQNEY--DSKLSLKDAISASISRGKLVSGTNGNGRN  237

Query  1532  NSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDD  1711
             NST   SVP FAN FW+EM+VIGKRS+ NS RMPELF +R GAV+VTG ILATIFW LDD
Sbjct  238   NSTALVSVPAFANSFWMEMLVIGKRSLTNSRRMPELFGIRLGAVLVTGAILATIFWHLDD  297

Query  1712  SPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiisl  1891
             SPKG+QER+GFFAFAMSTTFYTCAEA+PVFLQERYIFMRETA+NAYRRSSY L+H+IISL
Sbjct  298   SPKGVQERVGFFAFAMSTTFYTCAEAMPVFLQERYIFMRETAHNAYRRSSYALAHAIISL  357

Query  1892  pslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYT  2071
             PSL FLSLAFA TT+WAVG+ GG SGFLF+ + + ASFWAG+SFVTFLSG++ +VMI +T
Sbjct  358   PSLLFLSLAFAATTFWAVGMTGGTSGFLFYFITILASFWAGNSFVTFLSGVVSHVMIGFT  417

Query  2072  LVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPD-KCFVKGIQ  2248
             +VVAILAYF+LFSGFFI+RDRIPPYWIWFHY SLVKYP++GVLQNEFD    +CFV+GIQ
Sbjct  418   VVVAILAYFLLFSGFFISRDRIPPYWIWFHYLSLVKYPYEGVLQNEFDVRSPRCFVRGIQ  477

Query  2249  IFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWIT  2428
             +F+ +PL  VPEA+K++LL++MS+TLG+NIT STC+ TG D+LKQ G+T + KWNCLWIT
Sbjct  478   MFENTPLGMVPEALKVELLKSMSQTLGMNITRSTCVVTGEDVLKQQGITQLTKWNCLWIT  537

Query  2429  IAlgfffrllfyfallIGSKNKRR  2500
             +A GFFFR LFY ALL GS+NKRR
Sbjct  538   LAWGFFFRFLFYLALLFGSRNKRR  561



>dbj|BAJ97356.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=757

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/700 (65%), Positives = 550/700 (79%), Gaps = 26/700 (4%)
 Frame = +2

Query  431   NNGVGGANDHRVLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRK----------MGVPAWL  580
             +N  GG    R +Q            F L+F +L+YSV+  R           + V    
Sbjct  74    DNNAGGEAPGRTIQ------------FRLAFTDLTYSVRRARHGGDGGGGGPCLPVQRRS  121

Query  581   GRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGT  760
              R TAAP       K LL  +SGEA+EGEI+AV+GASGSGKSTLIDALANRI+R++L G+
Sbjct  122   DRVTAAPDAHAPRTKALLAGVSGEAKEGEILAVMGASGSGKSTLIDALANRISRDALKGS  181

Query  761   VKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQAL  940
             V +NGE L   +LK +SAYVMQDDLLFPMLTV ETL F+A+FRLPRSL  ++K+ARV AL
Sbjct  182   VTLNGEPLTGNILKSMSAYVMQDDLLFPMLTVTETLSFAADFRLPRSLCAAKKRARVHAL  241

Query  941   IEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMV  1120
             I+QLGL+ AA T+IGDEGHRGVSGGERRRVSIG DIIHDPI+LFLDEPTSGLDSTSAFMV
Sbjct  242   IDQLGLRAAANTIIGDEGHRGVSGGERRRVSIGTDIIHDPILLFLDEPTSGLDSTSAFMV  301

Query  1121  VKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPI  1300
             VKVL+RIA+SGSIVI S+HQPS RIL LLDRLI LS G TVFSG+PS+LP +F EFG+P+
Sbjct  302   VKVLRRIAESGSIVITSIHQPSQRILGLLDRLILLSGGHTVFSGAPSALPTYFAEFGHPV  361

Query  1301  PENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDA  1480
             P++ENR EFALD IRELE SP GTK LV+F+++W  K   ++ S+    +  P  SLK+A
Sbjct  362   PDDENRAEFALDLIRELEASPTGTKPLVEFHRTW--KLMHAARSDDAAAWA-PTMSLKEA  418

Query  1481  ISASISRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGA  1660
             ISASISRGKLVSGA +++S  + S+  +ANPFWVEM V+ KRS +N+ RMPELF +R GA
Sbjct  419   ISASISRGKLVSGA-DVSSGEAASMHTYANPFWVEMKVLTKRSAINTRRMPELFLIRLGA  477

Query  1661  VVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAY  1840
             VVVTG+ILAT+F+KLD SPKG QERLGFFAFAMST FYTCA+A+PVFLQERY+F+RETAY
Sbjct  478   VVVTGVILATVFFKLDQSPKGAQERLGFFAFAMSTMFYTCADALPVFLQERYVFLRETAY  537

Query  1841  NAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSS  2020
              AYR  SYVLS++I+S P L  LSLAFA+TT++AVGLAGG SGF F+ L + ASFWAGS 
Sbjct  538   GAYRHVSYVLSNAIVSFPPLVVLSLAFALTTFFAVGLAGGASGFAFYTLAILASFWAGSG  597

Query  2021  FVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVL  2200
             FVTFLSG+I +VMI YT+VVAILAYF+LFSGFFINRDRIP YW+WFHY SLVKYPF+GVL
Sbjct  598   FVTFLSGVIPHVMIGYTVVVAILAYFLLFSGFFINRDRIPAYWLWFHYLSLVKYPFEGVL  657

Query  2201  QNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILK  2380
             QNEF    +CFV+G QIFD SPL A+PEA+K ++L ++S  LG+ I + TC+ TG  +L+
Sbjct  658   QNEFARGGECFVRGAQIFDNSPLGALPEAVKERVLASISSALGVGIGADTCVATGRSVLR  717

Query  2381  QTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             Q  VT + KW CL +T A GFFFR+LFYF+L++GSKNKRR
Sbjct  718   QAAVTQLGKWECLLVTAAWGFFFRILFYFSLVLGSKNKRR  757



>ref|XP_006290668.1| hypothetical protein CARUB_v10016759mg [Capsella rubella]
 gb|EOA23566.1| hypothetical protein CARUB_v10016759mg [Capsella rubella]
Length=708

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/709 (61%), Positives = 543/709 (77%), Gaps = 21/709 (3%)
 Frame = +2

Query  374   SMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPSSFPFVLSFHNLSYSVKVR  553
             S TLGELL    DS  +K       A  HR+L L  P       PF+L+F+ LSY+V +R
Sbjct  19    SPTLGELLKDFTDSGRKKYPGE--DAPSHRILDL-APTAETQPVPFLLAFNKLSYNVVLR  75

Query  554   RKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANR  733
             R+ G      R   A +      K LLDD+SGEA +G+I+AVLG SG+GKSTLIDALA R
Sbjct  76    RRFG----FSRGKTAST------KTLLDDVSGEACDGQILAVLGGSGAGKSTLIDALAGR  125

Query  734   IARESLGGTVKMNGE-VLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsr  910
             +A +SL GTV +NGE VL+S+LLKVISAYVMQDDLLFPMLTV+ETLMF++EFRLPRSLS+
Sbjct  126   VAEDSLKGTVTLNGEKVLQSRLLKVISAYVMQDDLLFPMLTVKETLMFASEFRLPRSLSK  185

Query  911   srkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTS  1090
             S+K  RV+ LI+QLGL+ AA TVIGDEGHRGVSGGERRRVSIGIDIIHDPI+LFLDEPTS
Sbjct  186   SKKMERVEVLIDQLGLRNAANTVIGDEGHRGVSGGERRRVSIGIDIIHDPILLFLDEPTS  245

Query  1091  GLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLP  1270
             GLDST+AFMVV+VL+RIAQSGSIVIMS+HQPS RI++LLDRLI LS+G++VF+GSP+SLP
Sbjct  246   GLDSTNAFMVVQVLKRIAQSGSIVIMSIHQPSARIVDLLDRLIILSRGKSVFNGSPTSLP  305

Query  1271  RFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVF  1450
              +F EFG PIPE EN  EFALD IRELE S EG + LV+FN+ WQ+  S   T       
Sbjct  306   SYFSEFGRPIPEKENITEFALDVIRELEGSSEGNRGLVEFNEKWQQNQSARVT-------  358

Query  1451  PNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRM  1630
             P    SL+++I+AS+SRGKLVSG++  N      V  + N    E  ++ KR M N +R 
Sbjct  359   PQSGLSLEESITASVSRGKLVSGSSGANPVSMERVSSYVNSPLTEAFILAKRYMRNWIRT  418

Query  1631  PELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQE  1810
             PEL  MR G V+VTG++LAT++W+LD++P+G QER+GFFAFAMST FY CA+ IPVF+QE
Sbjct  419   PELIGMRMGTVMVTGLLLATVYWRLDNTPRGAQERMGFFAFAMSTMFYCCADNIPVFIQE  478

Query  1811  RYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllf  1990
             +YIF+RET +NAYR SSYV+SH+++SLP L  LS+AFA TT+W VGL+GG   F ++ L 
Sbjct  479   QYIFLRETTHNAYRTSSYVISHALVSLPQLLALSIAFAATTFWTVGLSGGLENFFYYCLI  538

Query  1991  vfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYAS  2170
             ++A FW+GSSFVTF+SGI+ NVM++Y + ++ L+Y +L  GFFINRDRIP YWIWFHY S
Sbjct  539   IYAGFWSGSSFVTFISGIVPNVMMSYMVTISYLSYCLLLGGFFINRDRIPLYWIWFHYIS  598

Query  2171  LVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSST  2350
             L+KYP++ VL NEFD P +CFVKG+Q+FDG+ L  VP  MK+KLL  +S +LG  IT ST
Sbjct  599   LLKYPYEAVLINEFDDPSRCFVKGVQVFDGTLLAEVPHVMKVKLLDTLSGSLGTKITEST  658

Query  2351  CLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKR  2497
             CL TG D+L Q G+T ++KW+CLWIT A G FFR+LFY +LL GSKNKR
Sbjct  659   CLRTGTDLLMQQGITQLSKWDCLWITFAWGLFFRILFYLSLLFGSKNKR  707



>ref|XP_004970499.1| PREDICTED: ABC transporter G family member 16-like [Setaria italica]
Length=755

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/680 (67%), Positives = 534/680 (79%), Gaps = 22/680 (3%)
 Frame = +2

Query  488   PYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVEND------VKVLLDDISG  649
             P   S  F LSF  L YSV+ ++  G     GR    P Q   D       + LLD +SG
Sbjct  89    PIGRSVQFRLSFTGLIYSVRAKQPGG-----GRPGLLPLQRRPDRVNAVCTRALLDGVSG  143

Query  650   EAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQD  829
             EAREGEI+AV+GASGSGKSTLIDALANRI+R +L G V +NGE +   +LK ISAYVMQD
Sbjct  144   EAREGEILAVMGASGSGKSTLIDALANRISRGALKGAVTLNGEPITGNILKSISAYVMQD  203

Query  830   DLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvs  1009
             DLLFPMLTV ETL F+AEFRLPR LS ++K+ARVQALI+QLGL+ AA T+IGDEGHRGVS
Sbjct  204   DLLFPMLTVTETLSFAAEFRLPRVLSPAKKRARVQALIDQLGLRAAANTIIGDEGHRGVS  263

Query  1010  ggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSY  1189
             GGERRRVSIG DIIHDPI+LFLDEPTSGLDSTSAFMVVKVL+RIA+SGSIVI S+HQPS 
Sbjct  264   GGERRRVSIGTDIIHDPILLFLDEPTSGLDSTSAFMVVKVLRRIAESGSIVITSIHQPSQ  323

Query  1190  RILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEG  1369
             RIL LLDRLI LS G+TVFSG PS+LP +F EFG P+P++ENR EFALD IRE E SP G
Sbjct  324   RILGLLDRLILLSGGRTVFSGPPSALPSYFAEFGFPVPDDENRAEFALDLIREFESSPTG  383

Query  1370  TKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPS---LKDAISASISRGKLVSGATNINST  1540
             TK LVDF+++WQR  +PS         P   PS   LK+AISASISRGKLVSG+      
Sbjct  384   TKPLVDFHRTWQRTHAPSPG------LPGADPSSMSLKEAISASISRGKLVSGSDVAGE-  436

Query  1541  LSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPK  1720
              + SV  +ANPFWVEM V+ +RS +N+ RMPELF +R GAVVVTG ILAT+F++LD SPK
Sbjct  437   -AASVRTYANPFWVEMKVLTRRSAINTRRMPELFLIRLGAVVVTGAILATVFFRLDQSPK  495

Query  1721  GIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpsl  1900
             G QERLGFFAFAMST FYTCA+A+PVFLQERY+F+RETAY AYRR+SYVLS+SI+S P L
Sbjct  496   GAQERLGFFAFAMSTMFYTCADALPVFLQERYVFLRETAYGAYRRASYVLSNSIVSFPPL  555

Query  1901  aflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVV  2080
               LSL+FA+TT++AVGLAGG  GF F+ L + ASFWAGS FVTFLSG+I +VMI YT+VV
Sbjct  556   VVLSLSFALTTFFAVGLAGGLPGFAFYTLAILASFWAGSGFVTFLSGVIPHVMIGYTVVV  615

Query  2081  AILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDG  2260
             AILAYF+LFSGFFINRDRIP YWIWFHY SLVKYPF+GVLQNEF    +CFV+G QIFD 
Sbjct  616   AILAYFLLFSGFFINRDRIPGYWIWFHYLSLVKYPFEGVLQNEFGRSGECFVRGAQIFDN  675

Query  2261  SPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlg  2440
             SPL A+P+A+K ++L ++S  LG+ I   TC+ TG  +L+Q  VT + KW CL +T A G
Sbjct  676   SPLAALPDAVKARVLASISSALGVGIGVDTCVVTGRGVLQQAAVTQLGKWECLLVTAAWG  735

Query  2441  fffrllfyfallIGSKNKRR  2500
             F FRL FYF+L++GSKNKRR
Sbjct  736   FLFRLFFYFSLVLGSKNKRR  755



>ref|NP_001049746.1| Os03g0281900 [Oryza sativa Japonica Group]
 sp|Q8H8V7.1|AB5G_ORYSJ RecName: Full=ABC transporter G family member 5; Short=ABC transporter 
ABCG.5; Short=OsABCG5; AltName: Full=Protein REDUCED 
CULM NUMBER 1; AltName: Full=White-brown complex homolog 
protein 5; Short=OsWBC5 [Oryza sativa Japonica Group]
 gb|AAN64474.1| putative ATP-binding-cassette transporter protein [Oryza sativa 
Japonica Group]
 gb|ABF95316.1| ABC transporter family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11660.1| Os03g0281900 [Oryza sativa Japonica Group]
 gb|EAZ26487.1| hypothetical protein OsJ_10379 [Oryza sativa Japonica Group]
Length=787

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/737 (61%), Positives = 556/737 (75%), Gaps = 37/737 (5%)
 Frame = +2

Query  374   SMTLGELLHRVGDS-----------------AGEKLNNGVGGANDHRVLQLYDPVPYPSS  502
             S+TL +LL RV D+                  G K  +    ++DH      D       
Sbjct  60    SVTLAQLLKRVNDARSGSSTPISSPRYTIELGGSKPESVSSESDDH---HSDDGGSEGQP  116

Query  503   FPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVL  682
                VL F +L+YSVK RRK     +  RR AA       ++ LLD ISGEAR+GEIMAVL
Sbjct  117   RALVLKFTDLTYSVKQRRKGSCLPF--RRAAADEPELPAMRTLLDGISGEARDGEIMAVL  174

Query  683   GASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEE  862
             GASGSGKSTLIDALANRIA+ESL G+V +NGE ++S LLKVISAYV Q+DLL+PMLTVEE
Sbjct  175   GASGSGKSTLIDALANRIAKESLHGSVTINGESIDSNLLKVISAYVRQEDLLYPMLTVEE  234

Query  863   TLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigi  1042
             TLMF+AEFRLPRSL    KK RV+ LI+QLGL+ AA T+IGDEGHRGVSGGERRRVSIG+
Sbjct  235   TLMFAAEFRLPRSLPTREKKKRVKELIDQLGLKRAANTIIGDEGHRGVSGGERRRVSIGV  294

Query  1043  DIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIF  1222
             DIIH+PI+LFLDEPTSGLDSTSAFMVV VL+ IAQSGS+V+MS+HQPSYRIL LLDRL+F
Sbjct  295   DIIHNPIMLFLDEPTSGLDSTSAFMVVTVLKAIAQSGSVVVMSIHQPSYRILGLLDRLLF  354

Query  1223  LSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSW  1402
             LS+G+TV+ G PS LP FF +FG PIP+NEN  EFALD I+E+E   EGTK L + N +W
Sbjct  355   LSRGKTVYYGPPSELPPFFLDFGKPIPDNENPTEFALDLIKEMETETEGTKRLAEHNAAW  414

Query  1403  QRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVP--------  1558
             Q K               P  SLK+AISASISRGKLVSGAT+   +++ S          
Sbjct  415   QLKHHGEGRGYGGK----PGMSLKEAISASISRGKLVSGATDGTVSVAASDHSAPPPSSS  470

Query  1559  ---KFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQ  1729
                KF NPFW+EM V+ +R+ +N+ R PE+F +R  AV+VTG ILATIFW+LD+SPKG+Q
Sbjct  471   SVSKFVNPFWIEMGVLTRRAFINTKRTPEVFIIRLAAVLVTGFILATIFWRLDESPKGVQ  530

Query  1730  ERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslafl  1909
             ERLGFFA AMST +YTC++A+PVFL ERYIF+RETAYNAYRRSSYVLSH+I+  PSL  L
Sbjct  531   ERLGFFAIAMSTMYYTCSDALPVFLSERYIFLRETAYNAYRRSSYVLSHTIVGFPSLVVL  590

Query  1910  slafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAIL  2089
             S AFA+TT+++VGLAGG +GF +F+  V ASFWAGS F TFLSG++ +VM+ + +V++ L
Sbjct  591   SFAFALTTFFSVGLAGGVNGFFYFVAIVLASFWAGSGFATFLSGVVTHVMLGFPVVLSTL  650

Query  2090  AYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPL  2269
             AYF+LFSGFFINRDRIP YW+WFHY SLVKYP++ V+QNEF  P +CFV+G+Q+FD +PL
Sbjct  651   AYFLLFSGFFINRDRIPRYWLWFHYISLVKYPYEAVMQNEFGDPTRCFVRGVQMFDNTPL  710

Query  2270  KAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfff  2449
              A+P A+K+++LQ+MS +LG+NI + TC+TTGPD LKQ  +TD  KW CLWIT+A GF F
Sbjct  711   AALPAAVKVRVLQSMSASLGVNIGTGTCITTGPDFLKQQAITDFGKWECLWITVAWGFLF  770

Query  2450  rllfyfallIGSKNKRR  2500
             R+LFY +LL+GS+NKRR
Sbjct  771   RILFYISLLLGSRNKRR  787



>sp|B8ALI0.1|AB5G_ORYSI RecName: Full=ABC transporter G family member 5; Short=ABC transporter 
ABCG.5; Short=OsABCG5; AltName: Full=White-brown complex 
homolog protein 5; Short=OsWBC5 [Oryza sativa Indica 
Group]
 gb|EEC74989.1| hypothetical protein OsI_11044 [Oryza sativa Indica Group]
Length=787

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/737 (61%), Positives = 556/737 (75%), Gaps = 37/737 (5%)
 Frame = +2

Query  374   SMTLGELLHRVGDS-----------------AGEKLNNGVGGANDHRVLQLYDPVPYPSS  502
             S+TL +LL RV D+                  G K  +    ++DH      D       
Sbjct  60    SVTLAQLLKRVNDARSGSSTPISSPRYTIELGGSKPESVSSESDDH---HSDDGGSEGQP  116

Query  503   FPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVL  682
                VL F +L+YSVK RRK     +  RR AA       ++ LLD ISGEAR+GEIMAVL
Sbjct  117   RALVLKFTDLTYSVKQRRKGSCLPF--RRAAADEPELPAMRTLLDGISGEARDGEIMAVL  174

Query  683   GASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEE  862
             GASGSGKSTLIDALANRIA+ESL G+V +NGE ++S LLKVISAYV Q+DLL+PMLTVEE
Sbjct  175   GASGSGKSTLIDALANRIAKESLHGSVTINGESIDSNLLKVISAYVRQEDLLYPMLTVEE  234

Query  863   TLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigi  1042
             TLMF+AEFRLPRSL    KK RV+ LI+QLGL+ AA T+IGDEGHRGVSGGERRRVSIG+
Sbjct  235   TLMFAAEFRLPRSLPTREKKKRVKELIDQLGLKRAANTIIGDEGHRGVSGGERRRVSIGV  294

Query  1043  DIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIF  1222
             DIIH+PI+LFLDEPTSGLDSTSAFMVV VL+ IAQSGS+V+MS+HQPSYRIL LLDRL+F
Sbjct  295   DIIHNPIMLFLDEPTSGLDSTSAFMVVTVLKAIAQSGSVVVMSIHQPSYRILGLLDRLLF  354

Query  1223  LSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSW  1402
             LS+G+TV+ G PS LP FF +FG PIP+NEN  EFALD I+E+E   EGTK L + N +W
Sbjct  355   LSRGKTVYYGPPSELPPFFLDFGKPIPDNENPTEFALDLIKEMETETEGTKRLAEHNAAW  414

Query  1403  QRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVP--------  1558
             Q K               P  SLK+AISASISRGKLVSGAT+   +++ S          
Sbjct  415   QLKHHGEGRGYGGK----PGMSLKEAISASISRGKLVSGATDGTMSVAASDHSAPPPSSS  470

Query  1559  ---KFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQ  1729
                KF NPFW+EM V+ +R+ +N+ R PE+F +R  AV+VTG ILATIFW+LD+SPKG+Q
Sbjct  471   SVSKFVNPFWIEMGVLTRRAFINTKRTPEVFIIRLAAVLVTGFILATIFWRLDESPKGVQ  530

Query  1730  ERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslafl  1909
             ERLGFFA AMST +YTC++A+PVFL ERYIF+RETAYNAYRRSSYVLSH+I+  PSL  L
Sbjct  531   ERLGFFAIAMSTMYYTCSDALPVFLSERYIFLRETAYNAYRRSSYVLSHTIVGFPSLVVL  590

Query  1910  slafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAIL  2089
             S AFA+TT+++VGLAGG +GF +F+  V ASFWAGS F TFLSG++ +VM+ + +V++ L
Sbjct  591   SFAFALTTFFSVGLAGGVNGFFYFVAIVLASFWAGSGFATFLSGVVTHVMLGFPVVLSTL  650

Query  2090  AYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPL  2269
             AYF+LFSGFFINRDRIP YW+WFHY SLVKYP++ V+QNEF  P +CFV+G+Q+FD +PL
Sbjct  651   AYFLLFSGFFINRDRIPRYWLWFHYISLVKYPYEAVMQNEFGDPTRCFVRGVQMFDNTPL  710

Query  2270  KAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfff  2449
              A+P A+K+++LQ+MS +LG+NI + TC+TTGPD LKQ  +TD  KW CLWIT+A GF F
Sbjct  711   AALPAAVKVRVLQSMSASLGVNIGTGTCITTGPDFLKQQAITDFGKWECLWITVAWGFLF  770

Query  2450  rllfyfallIGSKNKRR  2500
             R+LFY +LL+GS+NKRR
Sbjct  771   RILFYISLLLGSRNKRR  787



>emb|CDM84867.1| unnamed protein product [Triticum aestivum]
Length=757

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/711 (64%), Positives = 547/711 (77%), Gaps = 30/711 (4%)
 Frame = +2

Query  443   GGANDHRVLQLYDPVPYPS--------------SFPFVLSFHNLSYSVKVRRK-------  559
             G  +D  V  L  P P P+              +  F L+F +L+YSV+  R        
Sbjct  52    GTDDDGSVFSLPMPQPAPAGVGDSNAGGEGPGRTIQFRLAFTDLTYSVRRARHGGDGVGG  111

Query  560   ----MGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALA  727
                 + V     R TAAP       K LL  +SGEA+EGEI+AV+GASGSGKSTLIDALA
Sbjct  112   GGLCLPVQRRSDRVTAAPDAHAPRTKALLAGVSGEAKEGEILAVMGASGSGKSTLIDALA  171

Query  728   NRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprsls  907
             NRI+R++L G+V +NGE L   +LK +SAYVMQDDLLFPMLTV ETL F+A+FRLPRSL 
Sbjct  172   NRISRDALKGSVTLNGEPLTGNILKSMSAYVMQDDLLFPMLTVTETLSFAADFRLPRSLC  231

Query  908   rsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPT  1087
              ++K+ARV ALI+QLGL+ AA T+IGDEGHRGVSGGERRRVSIG DIIHDPI+LFLDEPT
Sbjct  232   AAKKRARVHALIDQLGLRAAANTIIGDEGHRGVSGGERRRVSIGTDIIHDPILLFLDEPT  291

Query  1088  SGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSL  1267
             SGLDSTSAFMVVKVL+RIAQSGSIVI S+HQPS RIL LLDRLI LS G TVFSG+PS+L
Sbjct  292   SGLDSTSAFMVVKVLRRIAQSGSIVITSIHQPSQRILGLLDRLILLSGGHTVFSGAPSAL  351

Query  1268  PRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNV  1447
             P +F EFG P+P++ENR EFALD IRELE SP GTK L DF+++W+   +    +     
Sbjct  352   PTYFAEFGYPVPDDENRAEFALDLIRELEASPTGTKPLADFHRTWKLMHAARDDAAAWA-  410

Query  1448  FPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLR  1627
                P  SLK+AISASISRGKLVSGA ++++  + S+  +ANPFWVEM V+ KRS +N+ R
Sbjct  411   ---PTMSLKEAISASISRGKLVSGA-DVSTGEAASMHTYANPFWVEMKVLTKRSAINTRR  466

Query  1628  MPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQ  1807
             MPELF +R GAVVVTG ILAT+F+KLD SPKG QERLGFFAFAMST FYTCA+A+PVFLQ
Sbjct  467   MPELFLIRLGAVVVTGAILATVFFKLDQSPKGAQERLGFFAFAMSTMFYTCADALPVFLQ  526

Query  1808  ERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffll  1987
             ERY+F+RETAY AYR  SYVLS++I+S P L  LSLAFA+TT++AVGLAGG SGF F+ L
Sbjct  527   ERYVFLRETAYGAYRHVSYVLSNAIVSFPPLVVLSLAFALTTFFAVGLAGGASGFAFYTL  586

Query  1988  fvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYA  2167
              + ASFWAGS FVTFLSG+I +VMI YT+VVAILAYF+LFSGFFINRDRIP YW+WFHY 
Sbjct  587   AILASFWAGSGFVTFLSGVIPHVMIGYTVVVAILAYFLLFSGFFINRDRIPAYWLWFHYL  646

Query  2168  SLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSS  2347
             SLVKYPF+GVLQNEF    +CFV+G QIFD SPL A+PEA+K ++L ++S  LG+ I + 
Sbjct  647   SLVKYPFEGVLQNEFARGGECFVRGAQIFDNSPLGALPEAVKERVLASISSALGVGIGAD  706

Query  2348  TCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             TC+ TG  +L+Q  VT + KW CL +T A GFFFR+LFYF+L++GSKNKRR
Sbjct  707   TCVATGRSVLRQAAVTQLGKWECLLVTAAWGFFFRILFYFSLVLGSKNKRR  757



>ref|XP_010068854.1| PREDICTED: ABC transporter G family member 6-like [Eucalyptus 
grandis]
Length=657

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/716 (64%), Positives = 551/716 (77%), Gaps = 79/716 (11%)
 Frame = +2

Query  374   SMTLGELLHRVGDSAGEKLNNGVGG---ANDHRVL--QLYDPVPYPSSFPFVLSFHNLSY  538
             +++  +LL RVGD+   K+  G GG    + H+ L   L +    P S PFVL F+NL+Y
Sbjct  14    TLSSAQLLKRVGDA--RKVVTGDGGETPVHHHQALAVNLSNASLEPRSLPFVLQFNNLNY  71

Query  539   SVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLID  718
             SVKVRRK      L  RT          KVLL+DIS EA +GEI+AVLGASGSGKSTL+D
Sbjct  72    SVKVRRKS-----LFTRT----------KVLLNDISWEAHDGEILAVLGASGSGKSTLVD  116

Query  719   ALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlpr  898
             ALANRIA+ SL G+V +NGE LES+LLKVISAYVMQDDLLFP+LTVEETLMF+AEFRLPR
Sbjct  117   ALANRIAKGSLKGSVTLNGEPLESRLLKVISAYVMQDDLLFPLLTVEETLMFAAEFRLPR  176

Query  899   slsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLD  1078
             +LS+S+K+ RVQALI+QLGL  AAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPI+LFLD
Sbjct  177   TLSKSKKRMRVQALIDQLGLWNAAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPIILFLD  236

Query  1079  EPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSP  1258
             EPTSGLDSTSA+MVVKVLQRIAQSGSIV+M+VHQPSYRIL L DRL+FLS+GQTV+SGSP
Sbjct  237   EPTSGLDSTSAYMVVKVLQRIAQSGSIVVMTVHQPSYRILGLFDRLLFLSRGQTVYSGSP  296

Query  1259  SSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQ--RKFSPSSTS  1432
              SLP FF EFG+PIPENENR EFALD IRELE SP GT++LV+FNKSWQ  ++ + +S  
Sbjct  297   MSLPLFFSEFGHPIPENENRTEFALDLIRELEGSPGGTRSLVEFNKSWQSMKQGARNSEP  356

Query  1433  NRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSM  1612
             +RN +      SLK+AI ASISRGKLVSGATN +++ +  VP FANPFW+EM V+ KRS+
Sbjct  357   DRNGL------SLKEAIGASISRGKLVSGATN-DASPASMVPTFANPFWIEMAVLSKRSI  409

Query  1613  VNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAI  1792
              NS RMP  F +R GAV+VTG ILAT+FW+LD+SPKG+QERLGFFAF+MST FYTCA+A+
Sbjct  410   TNSRRMPGHFGIRLGAVLVTGFILATMFWQLDNSPKGVQERLGFFAFSMSTIFYTCADAL  469

Query  1793  PVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgf  1972
              VFLQERYIFMRETAYNAYRR SYVLSHS+ +LP+L  L+LAF+ TT++AVGL GG SGF
Sbjct  470   SVFLQERYIFMRETAYNAYRRWSYVLSHSLTALPALVLLALAFSATTFFAVGLDGGLSGF  529

Query  1973  lffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWI  2152
             LF+ L +FASFWAGSSFV FLSG++ +VM+ YT+VV ILAYF+LF               
Sbjct  530   LFYFLIIFASFWAGSSFVIFLSGVVPHVMLGYTIVVGILAYFLLF---------------  574

Query  2153  WFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGI  2332
                                      C        D +PL  VP+A+KLKLL  +S TLG+
Sbjct  575   -------------------------C--------DNTPLGVVPDALKLKLLSTISSTLGM  601

Query  2333  NITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
              IT+STCLTTG  IL+Q GVTD++KW+CLW+T+A GF FR+LFYF+LL+GSKNKRR
Sbjct  602   KITASTCLTTGTGILQQQGVTDLSKWSCLWVTVAWGFLFRILFYFSLLLGSKNKRR  657



>ref|XP_008657087.1| PREDICTED: ABC transporter G family member 16-like [Zea mays]
 gb|AFW84654.1| hypothetical protein ZEAMMB73_004093 [Zea mays]
Length=743

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/668 (66%), Positives = 532/668 (80%), Gaps = 10/668 (1%)
 Frame = +2

Query  509   FVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGA  688
             F L+F +L+YSV+ ++        G             + LLD +SG+AREGEI+AV+GA
Sbjct  82    FRLAFSSLTYSVRAKQHGRGGPGPGLLPLQRRSDRVTTRALLDGVSGDAREGEILAVMGA  141

Query  689   SGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETL  868
             SGSGKSTLIDALA+RI+R++L G V +NGE L   +LK ISAYVMQDDLLFPMLTV ETL
Sbjct  142   SGSGKSTLIDALAHRISRDALKGAVTLNGEPLTGAVLKSISAYVMQDDLLFPMLTVAETL  201

Query  869   MFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDI  1048
              F+AEFRLPR+LS ++K+ARVQALI+QLGL+ AA T+IGDEGHRGVSGGERRRVSIG DI
Sbjct  202   SFAAEFRLPRALSPAKKRARVQALIDQLGLRAAAGTIIGDEGHRGVSGGERRRVSIGTDI  261

Query  1049  IHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLS  1228
             IHDPI+LFLDEPTSGLDSTSAFMVVKVL+RIA+SGSIVI S+HQPS RIL LLDRLI LS
Sbjct  262   IHDPILLFLDEPTSGLDSTSAFMVVKVLRRIAESGSIVITSIHQPSQRILGLLDRLILLS  321

Query  1229  KGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQ-  1405
              G+TVFSG PS+LP +F EFG P+P++ENR EFALD IRELE SP GTK LVDF ++WQ 
Sbjct  322   GGRTVFSGPPSALPSYFAEFGFPVPDDENRAEFALDLIRELESSPTGTKPLVDFQRTWQL  381

Query  1406  ---RKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPF  1576
                R  SP++             SLK+AISASISRGKLVSG+       + SV  +ANPF
Sbjct  382   MHARTTSPAAAQGDGG----SAMSLKEAISASISRGKLVSGSDVAGE--AASVRTYANPF  435

Query  1577  WVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFA  1756
             WVEM V+ KRS +N+ RMPELF +R GAVVVTG ILAT+F++LD SPKG QERLGFFAFA
Sbjct  436   WVEMKVLTKRSAINTRRMPELFLIRLGAVVVTGAILATVFFRLDQSPKGAQERLGFFAFA  495

Query  1757  MSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTY  1936
             MST +YTCA+A+PVFLQERY+F+RETAY AYRR+SYVLS++++S P L  LSLAFA+TT+
Sbjct  496   MSTMYYTCADALPVFLQERYVFLRETAYGAYRRASYVLSNALVSFPPLVVLSLAFALTTF  555

Query  1937  WAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGF  2116
             +AVGLAGG  GF F+ L + ASFWAGS FVTFLSG+I +VMI YT+VVAILAYF+LFSGF
Sbjct  556   FAVGLAGGVPGFAFYTLAILASFWAGSGFVTFLSGVIPHVMIGYTVVVAILAYFLLFSGF  615

Query  2117  FINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKL  2296
             FI RDRIPPYWIWFHY SL+KYPF+GVLQNEF    +CFV+G QIFD SPL  +P+A+K 
Sbjct  616   FITRDRIPPYWIWFHYLSLIKYPFEGVLQNEFGRGGECFVRGAQIFDNSPLAGLPDAVKA  675

Query  2297  KLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfall  2476
             ++L ++S  LG+ I + TC+ TG  +L+Q  VT + KW CL +T+A GF FR+LFYF+L+
Sbjct  676   RVLASISSALGVGIGADTCVVTGRGVLQQAAVTQLGKWECLLVTMAWGFLFRILFYFSLV  735

Query  2477  IGSKNKRR  2500
             +GSKNKRR
Sbjct  736   LGSKNKRR  743



>emb|CDX67624.1| BnaA07g16640D [Brassica napus]
Length=707

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/727 (60%), Positives = 556/727 (76%), Gaps = 23/727 (3%)
 Frame = +2

Query  320   PRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPS  499
             PR +   QE++ +  +  S TLGELL    D  G++  +    A+ H +L L  P   P 
Sbjct  2     PRVSATSQEISPQGGNE-SPTLGELLKHFDD--GDRKKHSGEEASFHHILDLASPELRP-  57

Query  500   SFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAV  679
               PF+LSF+NLSY VKVRR+    +       AP      VK LLD +SGEA  G+I+AV
Sbjct  58    -VPFLLSFNNLSYDVKVRRRFNFSS------PAP------VKTLLDGVSGEACNGDILAV  104

Query  680   LGASGSGKSTLIDALANRIARESLGGTVKMNGE-VLESKLLKVISAYVMQDDLLFPMLTV  856
             LGASG+GKSTLIDALA R++  +L GTV +NGE +L+++LLKVISAYVMQDDLLFPMLTV
Sbjct  105   LGASGAGKSTLIDALAGRVS--NLRGTVTLNGEKILQTRLLKVISAYVMQDDLLFPMLTV  162

Query  857   EETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsi  1036
             EETLMF++EFRLPRSLS+S+K  RV+ LI+QLGL+ AA T+IGDEGHRGVSGGERRRVSI
Sbjct  163   EETLMFASEFRLPRSLSKSKKTERVETLIDQLGLRNAADTIIGDEGHRGVSGGERRRVSI  222

Query  1037  giDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRL  1216
             GIDIIHDPIVLFLDEPTSGLDST+AFMVV+VL+RIA+SGSIVIMS+HQPS R+++LLDRL
Sbjct  223   GIDIIHDPIVLFLDEPTSGLDSTNAFMVVQVLRRIARSGSIVIMSIHQPSARVIDLLDRL  282

Query  1217  IFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNK  1396
             I LS+G++VF+GSP+SLP F  +FG+P+PE EN  EF LD +R+LE S EG + LV+FN+
Sbjct  283   IILSRGKSVFNGSPTSLPTFLSDFGHPVPEKENITEFTLDLVRKLEGSTEGARELVEFNE  342

Query  1397  SWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPF  1576
              WQ   S  +T       P    SLK++I+AS+SRGKLVSG+T+ N     SV  +AN  
Sbjct  343   KWQHNQSARATPMTT---PYQALSLKESITASVSRGKLVSGSTSSNPISMESVSSYANSP  399

Query  1577  WVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFA  1756
              VE  ++ KR M N +R PEL   R   V+VTG++LAT++W+LD++P+G QER+ F A+ 
Sbjct  400   LVETFILAKRYMKNWMRTPELMGTRIATVMVTGLLLATVYWRLDNTPRGAQERMSFVAYG  459

Query  1757  MSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTY  1936
             MST FY CA+++P F+QER+IF+RET  NAYR SSYV+SHS++SLP L  LS+AFA TT+
Sbjct  460   MSTMFYVCADSVPAFIQERFIFLRETTRNAYRTSSYVISHSLVSLPQLLALSIAFAATTF  519

Query  1937  WAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGF  2116
             W VGL+GG   F F+ L ++A FW+GSSFVTF+SG++ NVMI++ + +A L+Y +L  GF
Sbjct  520   WTVGLSGGLESFFFYCLIIYAGFWSGSSFVTFVSGLVPNVMISFMITIAYLSYCLLMGGF  579

Query  2117  FINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKL  2296
             +INRDRIP YWIWFHY SL+KYP++ VL NEFD P +CFV+G+Q+FDG+ L  VPEAMK+
Sbjct  580   YINRDRIPIYWIWFHYISLLKYPYEAVLINEFDDPSRCFVRGVQVFDGTLLAKVPEAMKV  639

Query  2297  KLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfall  2476
             KLL  MS +LG NIT STCL TGPD+L Q G++ ++KW+CLWIT+A G FFR+LFYF+LL
Sbjct  640   KLLDTMSDSLGTNITESTCLRTGPDLLLQQGISQLSKWDCLWITLAWGLFFRILFYFSLL  699

Query  2477  IGSKNKR  2497
              GSKNKR
Sbjct  700   FGSKNKR  706



>ref|XP_008674853.1| PREDICTED: ABC transporter G family member 16 [Zea mays]
 tpg|DAA56944.1| TPA: hypothetical protein ZEAMMB73_747644 [Zea mays]
Length=761

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/677 (65%), Positives = 533/677 (79%), Gaps = 14/677 (2%)
 Frame = +2

Query  509   FVLSFHNLSYSVKVRRKMGVPAW-LGRRTAAPSQVEND------VKVLLDDISGEAREGE  667
             F L+F NL+YSV+ +++   P+  L  R  A +            + LLD +SGEAREGE
Sbjct  86    FRLAFSNLTYSVRAKQRRRGPSLPLQSRVTAAAAAAAPDARAPRTRALLDGVSGEAREGE  145

Query  668   IMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPM  847
             I+AV+GASGSGKSTLIDALANRI+R++L G V +NGE L   ++K ISAYVMQDDLLFP 
Sbjct  146   ILAVMGASGSGKSTLIDALANRISRDALKGAVTLNGEPLVGDIIKSISAYVMQDDLLFPT  205

Query  848   LTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrr  1027
             LTV ETL F+AEFRLPR+L  ++K+ARVQALI+QLGL+ AA T+IGDEGHRGVSGGERRR
Sbjct  206   LTVTETLSFAAEFRLPRALPPAKKRARVQALIDQLGLRAAADTIIGDEGHRGVSGGERRR  265

Query  1028  vsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLL  1207
             VSIG DIIHDPI+LFLDEPTSGLDSTSAFMVVKVL+RIA+SGSIVI S+HQPS RIL LL
Sbjct  266   VSIGTDIIHDPILLFLDEPTSGLDSTSAFMVVKVLRRIAESGSIVITSIHQPSQRILGLL  325

Query  1208  DRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVD  1387
             DRLI LS GQTVFSG PS+LP +F EFG P+P++ENR EFALD IRE E SP GTK LVD
Sbjct  326   DRLILLSGGQTVFSGPPSALPSYFAEFGFPVPDDENRAEFALDLIREFESSPTGTKPLVD  385

Query  1388  FNKSWQ----RKFSPSSTSNRNNVFPNPKPS--LKDAISASISRGKLVSGATNINSTLSP  1549
             F+++WQ    R     S            P+  LK+AISASISRGKLV G+  +    + 
Sbjct  386   FHRTWQHMHARSHGQGSAGAAGQTLAATAPTMPLKEAISASISRGKLVLGSDGVAGE-AA  444

Query  1550  SVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQ  1729
             SV  +ANPFWVEM V+ KRS +N+ RMPELF +R GAVVVTG ILAT+F++LD SPKG Q
Sbjct  445   SVRTYANPFWVEMKVLTKRSAINTRRMPELFLIRLGAVVVTGAILATVFFRLDQSPKGAQ  504

Query  1730  ERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslafl  1909
             ERLGFFAFAMST FYTCA+A+PVFLQERY+F+RETAY AYRR+SYVLS++I+S P +  L
Sbjct  505   ERLGFFAFAMSTMFYTCADALPVFLQERYVFLRETAYGAYRRASYVLSNAIVSFPPIVVL  564

Query  1910  slafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAIL  2089
             SLAFA TT++AVGLAGG SGF F+ L + ASFWAGS FVTFLSG+I +VMI YT+VVAIL
Sbjct  565   SLAFAFTTFFAVGLAGGVSGFAFYTLAILASFWAGSGFVTFLSGVIPHVMIGYTVVVAIL  624

Query  2090  AYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPL  2269
             AYF+LF+GFFINRDRIP YWIWFHY SL+KYPF+GVLQNEF    +CFV+G Q+FD SPL
Sbjct  625   AYFLLFTGFFINRDRIPAYWIWFHYLSLIKYPFEGVLQNEFGRGGECFVRGAQMFDNSPL  684

Query  2270  KAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfff  2449
               +P+A+K ++L ++S  LG+ I + TC+ TG  +L Q  VT + KW CL +T+A GF F
Sbjct  685   AGLPDAVKGRVLASISSALGVRIGADTCVVTGRGVLHQAAVTQLGKWECLLVTMAWGFLF  744

Query  2450  rllfyfallIGSKNKRR  2500
             R+LFYF+L++GSKNKRR
Sbjct  745   RILFYFSLVLGSKNKRR  761



>ref|XP_002456598.1| hypothetical protein SORBIDRAFT_03g039110 [Sorghum bicolor]
 gb|EES01718.1| hypothetical protein SORBIDRAFT_03g039110 [Sorghum bicolor]
Length=745

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/667 (66%), Positives = 534/667 (80%), Gaps = 10/667 (1%)
 Frame = +2

Query  509   FVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQV-ENDVKVLLDDISGEAREGEIMAVLG  685
             F L F +L+YSV+ +++   P  L +      +V     + LLD +SGEAREGEI+AV+G
Sbjct  86    FRLVFSSLTYSVRAKQRGRGPGGLPQLQRRSDRVTAAATRALLDGVSGEAREGEILAVMG  145

Query  686   ASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEET  865
             ASGSGKSTLIDALANRI+R++L G V +NGE L   ++K ISAYVMQDDLLFPMLTV ET
Sbjct  146   ASGSGKSTLIDALANRISRDALKGAVTLNGEPLTGTVIKSISAYVMQDDLLFPMLTVTET  205

Query  866   LMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiD  1045
             L F+AEFRLPR+LS ++K+ARVQALI+ LGL+ AA T+IGDEGHRGVSGGERRRVSIG D
Sbjct  206   LSFAAEFRLPRALSPAKKRARVQALIDHLGLRAAANTIIGDEGHRGVSGGERRRVSIGTD  265

Query  1046  IIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFL  1225
             IIHDPI+LFLDEPTSGLDSTSAFMVVKVL+RIA+SGSIVI S+HQPS RIL LLDRLI L
Sbjct  266   IIHDPILLFLDEPTSGLDSTSAFMVVKVLRRIAESGSIVITSIHQPSQRILGLLDRLILL  325

Query  1226  SKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQ  1405
             S G+TVFSG PS+LP +F EFG P+P++ENR EFALD IRE E SP GTK LVDF+++WQ
Sbjct  326   SGGRTVFSGPPSALPSYFAEFGFPVPDDENRAEFALDLIREFESSPTGTKPLVDFHRAWQ  385

Query  1406  RKF--SPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFW  1579
             +    SP   S   +     + SLK+AISASISRGKLVSG+       + S+  +ANPFW
Sbjct  386   QMHARSPGPVSAAAD-----QMSLKEAISASISRGKLVSGSDVAGE--AASMHTYANPFW  438

Query  1580  VEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAM  1759
             VEM V+ KRS +N+ RMPELF +R  AVVVTG ILAT+F++LD SPKG QERLGFFAFAM
Sbjct  439   VEMKVLTKRSAINTRRMPELFLIRLAAVVVTGAILATVFFRLDQSPKGAQERLGFFAFAM  498

Query  1760  STTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYW  1939
             ST FYTCA+A+PVFL ERY+F+RETAY AYRR+SYVLS++I+S P+L  LSLAFA TT++
Sbjct  499   STMFYTCADALPVFLNERYVFLRETAYGAYRRASYVLSNAIVSFPALVVLSLAFAFTTFF  558

Query  1940  AvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFF  2119
             AVGLAGG  GF F+ L + ASFWAGS FVTFLSG+I +VMI YT+VVAILAYF+LFSGFF
Sbjct  559   AVGLAGGVPGFAFYTLAILASFWAGSGFVTFLSGVIPHVMIGYTVVVAILAYFLLFSGFF  618

Query  2120  INRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLK  2299
             INRDRIP YWIWFHY SL+KYPF+GVLQNEF    +CFV+G QIFD SPL A+P+A+K +
Sbjct  619   INRDRIPAYWIWFHYLSLIKYPFEGVLQNEFARSGECFVRGAQIFDNSPLAALPDAVKAR  678

Query  2300  LLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallI  2479
             +L ++S  LG+ I + TC+ TG  +L +  VT + KW CL +T+A GF FR+LFYF+L++
Sbjct  679   VLASISSALGVGIGADTCVVTGRGVLHEVAVTQLGKWECLLVTMAWGFLFRILFYFSLVL  738

Query  2480  GSKNKRR  2500
             GSKNKRR
Sbjct  739   GSKNKRR  745



>ref|XP_009103951.1| PREDICTED: ABC transporter G family member 18-like [Brassica 
rapa]
Length=707

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/727 (60%), Positives = 555/727 (76%), Gaps = 23/727 (3%)
 Frame = +2

Query  320   PRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPS  499
             PR +   QE++    +  S TLGELL    D  G++  +    A+ H +L L  P   P 
Sbjct  2     PRVSATSQEISPHGGNE-SPTLGELLKYFDD--GDRKKHSGEEASFHHILDLASPELRP-  57

Query  500   SFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAV  679
               PF+LSF+NLSY VKVRR+    +       AP      VK LLD +SGEA  G+I+AV
Sbjct  58    -VPFLLSFNNLSYDVKVRRRFNFSS------PAP------VKTLLDGVSGEACNGDILAV  104

Query  680   LGASGSGKSTLIDALANRIARESLGGTVKMNGE-VLESKLLKVISAYVMQDDLLFPMLTV  856
             LGASG+GKSTLIDALA R++  +L GTV +NGE +L+++LLKVISAYVMQDDLLFPMLTV
Sbjct  105   LGASGAGKSTLIDALAGRVS--NLRGTVTLNGEKILQTRLLKVISAYVMQDDLLFPMLTV  162

Query  857   EETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsi  1036
             +ETLMF++EFRLPRSLS+S+K  RV+ LI+QLGL+ AA T+IGDEGHRGVSGGERRRVSI
Sbjct  163   KETLMFASEFRLPRSLSKSKKTERVETLIDQLGLRNAADTIIGDEGHRGVSGGERRRVSI  222

Query  1037  giDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRL  1216
             GIDIIHDPIVLFLDEPTSGLDST+AFMVV+VL+RIA+SGSIVIMS+HQPS R+++LLDRL
Sbjct  223   GIDIIHDPIVLFLDEPTSGLDSTNAFMVVQVLRRIARSGSIVIMSIHQPSARVIDLLDRL  282

Query  1217  IFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNK  1396
             I LS+G++VF+GSP+SLP F  +FG+P+PE EN  EF LD +R+LE S EG + LV+FN+
Sbjct  283   IILSRGKSVFNGSPTSLPTFLSDFGHPVPEKENITEFTLDLVRKLEGSTEGARELVEFNE  342

Query  1397  SWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPF  1576
              WQ   S  +T       P    SLK++I+AS+SRGKLVSG+T+ N     SV  +AN  
Sbjct  343   KWQHNQSARATPMTT---PYQALSLKESITASVSRGKLVSGSTSSNPISMESVSSYANSP  399

Query  1577  WVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFA  1756
              VE  ++ KR M N +R PEL   R   V+VTG++LAT++W+LD++P+G QER+ F A+ 
Sbjct  400   LVETFILAKRYMKNWMRTPELMGTRIATVMVTGLLLATVYWRLDNTPRGAQERMSFVAYG  459

Query  1757  MSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTY  1936
             MST FY CA+++P F+QER+IF+RET  NAYR SSYV+SHS++SLP L  LS+AFA TT+
Sbjct  460   MSTMFYVCADSVPAFIQERFIFLRETTRNAYRTSSYVISHSLVSLPQLLALSIAFAATTF  519

Query  1937  WAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGF  2116
             W VGL+GG   F F+ L ++A FW+GSSFVTF+SG++ NVMI++ + +A L+Y +L  GF
Sbjct  520   WTVGLSGGLESFFFYCLIIYAGFWSGSSFVTFVSGLVPNVMISFMITIAYLSYCLLMGGF  579

Query  2117  FINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKL  2296
             +INRDRIP YWIWFHY SL+KYP++ VL NEFD P +CFV+G+Q+FDG+ L  VPEAMK+
Sbjct  580   YINRDRIPIYWIWFHYISLLKYPYEAVLINEFDDPFRCFVRGVQVFDGTLLAKVPEAMKV  639

Query  2297  KLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfall  2476
             KLL  MS +LG NIT STCL TGPD+L Q G++ ++KW+CLWIT+A G FFR+LFYF+LL
Sbjct  640   KLLDTMSDSLGTNITESTCLRTGPDLLLQQGISQLSKWDCLWITLAWGLFFRILFYFSLL  699

Query  2477  IGSKNKR  2497
              GSKNKR
Sbjct  700   FGSKNKR  706



>ref|XP_006403491.1| hypothetical protein EUTSA_v10010159mg [Eutrema salsugineum]
 gb|ESQ44944.1| hypothetical protein EUTSA_v10010159mg [Eutrema salsugineum]
Length=716

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/730 (59%), Positives = 558/730 (76%), Gaps = 20/730 (3%)
 Frame = +2

Query  320   PRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPS  499
             PR + E QE++    +  S TLGELL     S  +  ++G   A+ H +L L  P P   
Sbjct  2     PRVSAESQEISLHGSNE-SPTLGELLKNFEHSDRKNKDSG-RDASTHHILDL--PSPDAP  57

Query  500   SFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAV  679
               PF+L+F NLSYSV++RR+    + L RR   P+      K LLDD+SGEA  G+I+AV
Sbjct  58    PVPFLLAFENLSYSVELRRRFNFSSLLSRREPTPA------KTLLDDVSGEACNGDILAV  111

Query  680   LGASGSGKSTLIDALANRIARESLGGTVKMNGE-VLESKLLKVISAYVMQDDLLFPMLTV  856
             LGASG+GKSTLIDALA R+   SL G+V +NGE +L+S+LLKVISAYVMQDDLLFPMLTV
Sbjct  112   LGASGAGKSTLIDALAGRL--NSLRGSVTLNGEKILKSRLLKVISAYVMQDDLLFPMLTV  169

Query  857   EETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsi  1036
             +ETLMF++EFRLPRSL +S+K  RVQALI+QLGL+ A  T+IGDEGHRGVSGGERRRVSI
Sbjct  170   KETLMFASEFRLPRSLPKSKKMERVQALIDQLGLRNAENTIIGDEGHRGVSGGERRRVSI  229

Query  1037  giDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRL  1216
             GIDIIHDPI+LFLDEPTSGLDST+AFMVV+VL+RIA+SGSIVIMS+HQPS RI++LLDRL
Sbjct  230   GIDIIHDPILLFLDEPTSGLDSTNAFMVVQVLKRIAKSGSIVIMSIHQPSSRIVDLLDRL  289

Query  1217  IFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNK  1396
             I LS+G++VF+GSP+ LP FF +FG PIPE EN  EFALD IR+LE + +GT+ LV+FN+
Sbjct  290   IILSRGKSVFNGSPAKLPSFFSDFGFPIPEKENTTEFALDLIRQLEGTSQGTRELVEFNE  349

Query  1397  SWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSP---SVPKFA  1567
              WQ      +T       P    SLK++I+AS+SRGKLVSG+++  + L P   SV  +A
Sbjct  350   KWQHNQPARATPQTT---PYQALSLKESINASVSRGKLVSGSSS-GTNLIPMELSVSSYA  405

Query  1568  NPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFF  1747
             NP  +E  ++ KR + N +R PEL   R   V+VTG++LATI+W+LD++P+G QER+GFF
Sbjct  406   NPPLIETFILAKRYVKNWIRTPELIGTRIATVMVTGLLLATIYWRLDNTPRGAQERMGFF  465

Query  1748  AFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaV  1927
             AF MST FY CA+ IPVF+QERY+F+RET +NAYR SSYV+SHS++SLP L  LS+AFA 
Sbjct  466   AFGMSTMFYVCADNIPVFIQERYVFLRETTHNAYRTSSYVISHSLVSLPQLLALSIAFAA  525

Query  1928  TTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLF  2107
             TT+W VGL+GG + FL++ L ++ASFW GSS V+F+SG++ NVMI+Y + +A L+Y VL 
Sbjct  526   TTFWTVGLSGGLNSFLYYCLIIYASFWCGSSVVSFISGLVPNVMISYMITIAYLSYCVLL  585

Query  2108  SGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEA  2287
              GF+INRDRIP YWIWFHY S++KYP++  L NEFD P +CFV+G Q+FDG+ L  V + 
Sbjct  586   GGFYINRDRIPFYWIWFHYISVLKYPYEAGLINEFDDPSRCFVEGGQVFDGTLLAGVSDV  645

Query  2288  MKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyf  2467
             MK+KLL  +SK+LG  IT +TCL TG D+L Q G+T ++KW+CLWIT A G FFR+LFYF
Sbjct  646   MKVKLLDTLSKSLGTKITETTCLRTGSDLLMQQGITQLSKWDCLWITFAWGLFFRILFYF  705

Query  2468  allIGSKNKR  2497
             +LL G+KNKR
Sbjct  706   SLLFGNKNKR  715



>ref|XP_007027152.1| ABC transporter G family member 2 [Theobroma cacao]
 gb|EOY07654.1| ABC transporter G family member 2 [Theobroma cacao]
Length=664

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/685 (65%), Positives = 539/685 (79%), Gaps = 44/685 (6%)
 Frame = +2

Query  452   NDHRVLQLYDPVPYPSSFP-FVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKV  628
             N H++L++ +     S    FVLSF+NL+Y+V+   K   P     +T   S+ E++ K 
Sbjct  22    NQHQILEIPNSFSSSSPSNRFVLSFNNLTYTVEAGPKTLFP--FNGKTVTVSR-ESNTKT  78

Query  629   LLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVI  808
             +L D+SGEAREGEIMA+LGASGSGKSTLIDALANRIA+ SL G+V +NGEV ES LLKVI
Sbjct  79    ILKDVSGEAREGEIMAILGASGSGKSTLIDALANRIAKHSLKGSVTLNGEVFESGLLKVI  138

Query  809   SAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGD  988
             SAYVMQDDLLFPMLTVEETLMFSAEFRLPRSLS S+KKARVQALI+QLGL++AAKTVIGD
Sbjct  139   SAYVMQDDLLFPMLTVEETLMFSAEFRLPRSLSTSKKKARVQALIDQLGLRSAAKTVIGD  198

Query  989   eghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIM  1168
             EGHRGVSGGERRRVSIGIDIIHDP++LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIV+M
Sbjct  199   EGHRGVSGGERRRVSIGIDIIHDPVLLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVLM  258

Query  1169  SVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRE  1348
             SVHQPSYRIL LLDRLIFLS+GQT++SGSP++L  FF++FG+PIPENEN  EFALDFIRE
Sbjct  259   SVHQPSYRILCLLDRLIFLSQGQTLYSGSPANLSEFFRDFGHPIPENENPAEFALDFIRE  318

Query  1349  LEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATN  1528
             LE++P                                      AI+ SISRGKLVS ATN
Sbjct  319   LEETPY-------------------------------------AINRSISRGKLVSQATN  341

Query  1529  -INSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKL  1705
              +N T   SV  FANPFW+E++V+ KR  +NS RMPE+F ++  A+V+TGII+A++FW+L
Sbjct  342   DLNPT--SSVSSFANPFWIELLVLLKRLSINSRRMPEVFGIQLAAIVITGIIVASMFWQL  399

Query  1706  DDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsii  1885
             DDSP+G+QERLG FAF +STTFYTCA  +P F+QER+IFMRETAYN YR SSYVL+ S+I
Sbjct  400   DDSPRGMQERLGCFAFVVSTTFYTCAHEVPEFIQERFIFMRETAYNTYRCSSYVLARSLI  459

Query  1886  slpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIA  2065
             S+PSL  LS+AF   T+W VGLAGGF GF+F LL +FASFWAGSSFV FLS ++ +V+++
Sbjct  460   SIPSLITLSIAFVTITFWTVGLAGGFPGFVFLLLTIFASFWAGSSFVAFLSALVSDVLVS  519

Query  2066  YTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGI  2245
             + +VVA LAYF LFSGFF++R+R+P YW+WFHY S+VKYP++ VL NEF  P KCF +G+
Sbjct  520   FVVVVATLAYFTLFSGFFVSRNRLPGYWLWFHYLSIVKYPYEAVLLNEFRDPTKCFTRGV  579

Query  2246  QIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWI  2425
             QIFD +PL  +P ++++ LL+ +   LG NIT STCLTTG DIL Q GVT++NKWNC WI
Sbjct  580   QIFDDTPLGKLPVSLQIDLLKTVGNALGTNITGSTCLTTGRDILLQQGVTELNKWNCFWI  639

Query  2426  TIAlgfffrllfyfallIGSKNKRR  2500
              I  GFFFR+LFY  LL GSKNKR+
Sbjct  640   AIGWGFFFRILFYLTLLFGSKNKRK  664



>ref|XP_003561756.1| PREDICTED: ABC transporter G family member 6-like [Brachypodium 
distachyon]
Length=751

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/745 (59%), Positives = 556/745 (75%), Gaps = 19/745 (3%)
 Frame = +2

Query  317   GPRQAMELQELTRRPRHSVS---MTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPV  487
             GPR  +        PR S S    TL +L+      +     +  G  + H V+ +   V
Sbjct  9     GPRNHILPSSSAGDPRSSDSSGVTTLDQLVALRSRGSVTTATSSAGDTSRHLVVDVQPTV  68

Query  488   PYPS--SFPFVLSFHNLSYSVKV--------RRKMGVPAWLGRRTAAPSQVENDVKVLLD  637
              +    +  FVL+FH+L+YSVK         R  + V      R     +       LLD
Sbjct  69    DFVCRPAVHFVLAFHDLTYSVKRPRSSFHRRRDNVNVEETGAARHGEQGRARAAKNTLLD  128

Query  638   DISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAY  817
              ISGEAREGEI+AVLGASG+GKSTLIDALA RI RESL G V +NG+ L+S+LL+VISAY
Sbjct  129   GISGEAREGEILAVLGASGAGKSTLIDALAGRIQRESLRGAVTLNGDALDSRLLRVISAY  188

Query  818   VMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDegh  997
             VMQDDLL+PMLTV ETLM+SAEFRLPRSL+ S+K++RVQALI+QLGL+ AA T+IGDEG 
Sbjct  189   VMQDDLLYPMLTVAETLMYSAEFRLPRSLAASKKRSRVQALIDQLGLRAAADTIIGDEGR  248

Query  998   rgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVH  1177
             RGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQRIA SGS+V+MSVH
Sbjct  249   RGVSGGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAFMVVKVLQRIAHSGSVVVMSVH  308

Query  1178  QPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQ  1357
             QPSYRIL LLDRL+FLS+G+TV+ G+P++LP FF EFG+PIP+ EN  EFALD IRELE 
Sbjct  309   QPSYRILGLLDRLLFLSRGRTVYYGAPAALPLFFSEFGHPIPDGENPAEFALDHIRELES  368

Query  1358  SPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINS  1537
             + +GTK LV  +KSWQ K  P S +        P  SLK+AIS SI+RGKLVSG +  + 
Sbjct  369   TQDGTKELVQLSKSWQEK--PLSRAVSAASSDKPSLSLKEAISLSIARGKLVSGTSTGSP  426

Query  1538  TLSPS---VPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLD  1708
              ++ +   V  +ANP+W E+ V+ +R+  N+ R PELF +R GAVVVTG +LATIFW+LD
Sbjct  427   EVAAATTEVATYANPWWAEVWVLTRRAFTNTRRTPELFLIRLGAVVVTGFVLATIFWRLD  486

Query  1709  DSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiis  1888
             ++PKG+ ER GFFA AMST FYT A+A+PVFL ERYIF+RETA+NAYRRSSY LS++I++
Sbjct  487   NTPKGVNERFGFFAIAMSTMFYTSADALPVFLIERYIFLRETAHNAYRRSSYTLSNAIVA  546

Query  1889  lpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAY  2068
              P L FLSLAF   T++AVGLAGG  GF+FF L V ASFWAGS FVTFLSG++ +V+I Y
Sbjct  547   FPPLVFLSLAFTAITFFAVGLAGGAEGFVFFALIVLASFWAGSGFVTFLSGVVPHVIIGY  606

Query  2069  TLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDY-PDKCFVKGI  2245
             T+VVA+LAYF+LFSGFF+ RDRIP YWIWFHY SL+KYP++ V+QNEF   P KCF++G+
Sbjct  607   TVVVAMLAYFLLFSGFFVTRDRIPDYWIWFHYLSLIKYPYEAVMQNEFGADPSKCFMRGV  666

Query  2246  QIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWI  2425
             Q+FDG+P+  +P A ++ +L  MSK++ I+  S++C+TTG DIL +  V  + KWNCLW 
Sbjct  667   QMFDGTPMGKLPVATQVTVLNAMSKSMKIDFNSTSCITTGTDILAKQAVNQLGKWNCLWA  726

Query  2426  TIAlgfffrllfyfallIGSKNKRR  2500
             T+A GF FR+LFY  L++GS+NKRR
Sbjct  727   TVAWGFLFRVLFYLTLVLGSRNKRR  751



>ref|NP_191070.1| ABC transporter G family member 17 [Arabidopsis thaliana]
 sp|Q9M2V6.1|AB17G_ARATH RecName: Full=ABC transporter G family member 17; Short=ABC transporter 
ABCG.17; Short=AtABCG17; AltName: Full=Probable white-brown 
complex homolog protein 17; Short=AtWBC17 [Arabidopsis 
thaliana]
 emb|CAB82705.1| ABC transporter-like protein [Arabidopsis thaliana]
 gb|AEE79340.1| ABC transporter G family member 17 [Arabidopsis thaliana]
Length=662

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/665 (62%), Positives = 531/665 (80%), Gaps = 23/665 (3%)
 Frame = +2

Query  506   PFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLG  685
             PFVL+F++L+Y+V ++++ G+     R   +P+++    K LL+ I+GEA+EGEI+A+LG
Sbjct  19    PFVLAFNDLTYNVTLQQRFGL-----RFGHSPAKI----KTLLNGITGEAKEGEILAILG  69

Query  686   ASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEET  865
             ASG+GKSTLIDALA +IA  SL GTV +NGE L+S+LL+VISAYVMQ+DLLFPMLTVEET
Sbjct  70    ASGAGKSTLIDALAGQIAEGSLKGTVTLNGEALQSRLLRVISAYVMQEDLLFPMLTVEET  129

Query  866   LMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiD  1045
             LMF+AEFRLPRSLS+S+K+ RV+ LI+QLGL T   TVIGDEGHRGVSGGERRRVSIG D
Sbjct  130   LMFAAEFRLPRSLSKSKKRNRVETLIDQLGLTTVKNTVIGDEGHRGVSGGERRRVSIGTD  189

Query  1046  IIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFL  1225
             IIHDPIVLFLDEPTSGLDSTSAFMVV+VL++IA+SGSIVIMS+HQPS RI+  LDR+I L
Sbjct  190   IIHDPIVLFLDEPTSGLDSTSAFMVVQVLKKIARSGSIVIMSIHQPSGRIMEFLDRVIVL  249

Query  1226  SKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQ  1405
             S GQ VFS SP++LP FF EFG+PIPE EN  EF LD I++LE SPEGT+ LV+FN++WQ
Sbjct  250   SSGQIVFSDSPATLPLFFSEFGSPIPEKENIAEFTLDLIKDLEGSPEGTRGLVEFNRNWQ  309

Query  1406  -RKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWV  1582
              RK   S   + N+       SL +AI+ASISRGKLVS       T   S+P + NP+WV
Sbjct  310   HRKLRVSQEPHHNS------SSLGEAINASISRGKLVS-------TSYRSIPSYVNPWWV  356

Query  1583  EMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMS  1762
             E V++ KR M+N  R PEL   R   V++TG +LAT++WK+DDSP+G+QERL FF+FAM+
Sbjct  357   ETVILAKRYMINWTRTPELIGTRVFIVMMTGFLLATVYWKVDDSPRGVQERLSFFSFAMA  416

Query  1763  TTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWA  1942
             T FY+CA+ +P F+QERYIF+RETA+NAYRRSSYV+SHS+++LP L  LS+ FA TT+W 
Sbjct  417   TMFYSCADGLPAFIQERYIFLRETAHNAYRRSSYVISHSLVTLPHLFALSIGFAATTFWF  476

Query  1943  vglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFI  2122
             VGL GG +GF+++L+ +FASFW+G SFVTF+SG+I NVM++Y +    L+Y +LFSGF++
Sbjct  477   VGLNGGLAGFIYYLMIIFASFWSGCSFVTFVSGVIPNVMMSYMVTFGYLSYCLLFSGFYV  536

Query  2123  NRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKL  2302
             NRDRI  YWIW HY SL+KYP++ VL NEFD P +CFV+G Q+FD + ++ V E  K KL
Sbjct  537   NRDRIHLYWIWIHYISLLKYPYEAVLHNEFDDPSRCFVRGNQVFDNTIMEGVSETTKAKL  596

Query  2303  LQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIG  2482
             L+ MS  LG+ +T STCLTTG D+LKQ G+  ++KW CLW+T+A GFFFR+LFYF+LL+G
Sbjct  597   LETMSGYLGMELTESTCLTTGSDLLKQHGIEQLDKWGCLWVTLAWGFFFRILFYFSLLLG  656

Query  2483  SKNKR  2497
             SKNKR
Sbjct  657   SKNKR  661



>ref|XP_004960315.1| PREDICTED: ABC transporter G family member 16-like [Setaria italica]
Length=690

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/695 (62%), Positives = 538/695 (77%), Gaps = 18/695 (3%)
 Frame = +2

Query  449   ANDHRVLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTA---------AP  601
             A+ H V+ +    P  +  P+VLSF +LSYSV  R+  G+   L  R +         AP
Sbjct  3     ASGHAVVDIDAAKPALAPVPYVLSFADLSYSV--RKGGGLAGCLPSRASSSRLVASADAP  60

Query  602   --SQVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNG  775
               S      K LL+ +SGEA  GE++A++GASGSGKSTL+DALA RIARESL G+V +NG
Sbjct  61    PSSSGSRHTKTLLNGVSGEACAGELLAIMGASGSGKSTLVDALAGRIARESLRGSVTLNG  120

Query  776   EVLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLG  955
             E L+ + L+ ISAYVMQDDLL+PMLTV ETL F+AEFRLPR+LS  +K+ARV ALI+QLG
Sbjct  121   EPLQGRRLRAISAYVMQDDLLYPMLTVRETLHFAAEFRLPRALSPEKKRARVDALIDQLG  180

Query  956   LQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQ  1135
             L  AA T+IGDEGHRGVSGGERRRVSIG DIIHDPI+LFLDEPTSGLDS SAFMVV+VL+
Sbjct  181   LARAADTIIGDEGHRGVSGGERRRVSIGTDIIHDPILLFLDEPTSGLDSASAFMVVQVLR  240

Query  1136  RIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENEN  1315
             RIAQSGS+ IM++HQPS RIL +LD L+ LS+G+TV++G+P+ L  FF EFG PIP+NEN
Sbjct  241   RIAQSGSVAIMTIHQPSARILGILDHLLLLSRGRTVYAGTPAGLKPFFAEFGAPIPDNEN  300

Query  1316  RCEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASI  1495
               EFALD IRE E+ P+G   L DFN  WQ     +S++++++   +  P L+ AI+ S+
Sbjct  301   PAEFALDTIREYERQPDGAAALADFNAKWQNN---ASSTDKDSKLMSTMP-LELAIAESV  356

Query  1496  SRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTG  1675
             SRGKLV+  +   S +S +VP FANP W E+ V+ KRS  N+ RMPELFAMR G ++VTG
Sbjct  357   SRGKLVA-GSGSGSPVSGTVPTFANPLWTEVWVLIKRSFTNTARMPELFAMRLGTIMVTG  415

Query  1676  IILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRR  1855
              ILATIFW+LDD+PKG+QERLGFFA AMST FY CA+A+PVF+QER+I++RETA+NAYRR
Sbjct  416   FILATIFWRLDDTPKGVQERLGFFAMAMSTMFYVCADALPVFVQERHIYLRETAHNAYRR  475

Query  1856  SSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFL  2035
              SYVL+++ ++ P L  LSLAFAVTT+WAVGLAGG S FLFF+L + ASFWAGS FVTFL
Sbjct  476   ISYVLANAAVAFPPLVLLSLAFAVTTFWAVGLAGGASSFLFFVLTILASFWAGSGFVTFL  535

Query  2036  SGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFD  2215
             S ++ +VM+ YT+VVAILAYF+LFSGFFI RDRIP YWIWFHY SLVKYP+Q VLQNEF 
Sbjct  536   SAVVPHVMLGYTVVVAILAYFLLFSGFFITRDRIPGYWIWFHYLSLVKYPYQAVLQNEFG  595

Query  2216  YPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVT  2395
                +CF +G+++FDGSP+  +PEA+KLK+L+ +S TLG N+T++TC+TTG D+L    VT
Sbjct  596   GAARCFSRGVELFDGSPIGRLPEAVKLKVLEAISATLGTNVTANTCVTTGADVLALQAVT  655

Query  2396  DINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             DI KW CL +T+A GF FR LFY  LL+ SKNKR+
Sbjct  656   DIGKWKCLLVTVACGFLFRALFYVVLLVSSKNKRK  690



>emb|CDX73404.1| BnaC08g25990D [Brassica napus]
Length=789

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/735 (60%), Positives = 558/735 (76%), Gaps = 30/735 (4%)
 Frame = +2

Query  308   PFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPV  487
             P   PR + E QE++         TLGELL       G++  N    A+ H +L L  P 
Sbjct  79    PVTMPRVSAESQEISFD--GGSEPTLGELLKDF--DGGDRKKNSGEDASTHHILDLTSPE  134

Query  488   PYPSSFPFVLSFHNLSYSVKVRRKM----GVPAWLGRRTAAPSQVENDVKVLLDDISGEA  655
               P   PF+LSF+NLSY +  RR+     G PA               VK LL+D+SGEA
Sbjct  135   IRP--VPFLLSFNNLSYDIVHRRRFDFSRGKPA--------------SVKTLLNDVSGEA  178

Query  656   REGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGE-VLESKLLKVISAYVMQDD  832
              +G+I+AVLGASG+GKSTLIDALA R++  SL GTV +NGE +L+++LLKVISAYVMQDD
Sbjct  179   CDGDILAVLGASGAGKSTLIDALAGRVS--SLRGTVTLNGEKILQTRLLKVISAYVMQDD  236

Query  833   LLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsg  1012
             LLFPMLTV+ETLMF++EFRLPRSLS+S+K  RVQ LI+QLGL+ AA T+IGDEGHRGVSG
Sbjct  237   LLFPMLTVKETLMFASEFRLPRSLSKSKKMERVQTLIDQLGLRNAADTIIGDEGHRGVSG  296

Query  1013  gerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYR  1192
             GERRRVSIGIDIIHDPI+LFLDEPTSGLDST+AFMVV+VL+RIA+SGSIVIM++HQPS R
Sbjct  297   GERRRVSIGIDIIHDPILLFLDEPTSGLDSTNAFMVVQVLKRIARSGSIVIMTIHQPSAR  356

Query  1193  ILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGT  1372
             +L+LLDRLI LS+G+ VFSGSP+SLP+F  +FG+PIPE EN  EFALD +R+LE S EGT
Sbjct  357   VLDLLDRLIILSRGKNVFSGSPTSLPQFLSDFGHPIPEKENITEFALDLVRQLEGSSEGT  416

Query  1373  KNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPS  1552
             + LV FN+ WQ+  S  +T       P    SLK++I+AS+SRGKLVSG+T+ N     S
Sbjct  417   RELVKFNEKWQQNQSARATPMTT---PYQALSLKESITASVSRGKLVSGSTSSNPISMDS  473

Query  1553  VPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQE  1732
             V  +ANP  VE  ++ KR M N +R PEL   R   V+VTG++LATI+W+LD++P+G QE
Sbjct  474   VSSYANPPLVETFILAKRYMKNWIRTPELLGTRIATVMVTGLLLATIYWRLDNTPRGAQE  533

Query  1733  RLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslafls  1912
             R+ FFAF MST FY CA+ +PVFLQER+IF+RET  NAYR SSYV+SHS++SLP L  LS
Sbjct  534   RMAFFAFGMSTMFYVCADNVPVFLQERFIFLRETTRNAYRTSSYVISHSLVSLPQLLALS  593

Query  1913  lafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILA  2092
             +AFA TT+W VGL+GG   FL++ L ++A FW+GSSFVTF+SG++ NVMI++ + +A L+
Sbjct  594   IAFAATTFWTVGLSGGLESFLYYCLIIYAGFWSGSSFVTFVSGLVPNVMISFMITIAYLS  653

Query  2093  YFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLK  2272
             Y +L  GF+INRDRIP YWIWFHY SL+KYP++ VL NEFD P +CFV+G+Q+FDG+ L 
Sbjct  654   YCLLLGGFYINRDRIPVYWIWFHYISLLKYPYEAVLINEFDDPSRCFVRGVQVFDGTLLA  713

Query  2273  AVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffr  2452
              VP+AMK+KLL  +S +LG  IT STCL TGPD+L Q G++ ++KW+CLWIT+A G FFR
Sbjct  714   KVPDAMKVKLLDTLSSSLGTTITESTCLRTGPDLLMQQGISQLSKWDCLWITLAWGLFFR  773

Query  2453  llfyfallIGSKNKR  2497
             +LFYF+LL GSKNKR
Sbjct  774   ILFYFSLLFGSKNKR  788



>gb|EAY76412.1| hypothetical protein OsI_04343 [Oryza sativa Indica Group]
Length=749

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/678 (65%), Positives = 532/678 (78%), Gaps = 18/678 (3%)
 Frame = +2

Query  509   FVLSFHNLSYSVKVRRK-------------MGVPAWLGRRTAA-PSQVENDVKVLLDDIS  646
             F L+F +L+YSV+  R+             + +     R TAA P    +  +VLLD I+
Sbjct  76    FRLAFTSLTYSVRAARRARPGGGDGGGGFRLPLQNRCDRVTAAAPDAHSSRARVLLDGIT  135

Query  647   GEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQ  826
             GEAREGEI+AV+GASGSGKSTLIDALANRI+R++L G+V +NGE L   ++K ISAYVMQ
Sbjct  136   GEAREGEILAVMGASGSGKSTLIDALANRISRDALKGSVTLNGEPLTGNVIKSISAYVMQ  195

Query  827   DDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgv  1006
             DDLLFPMLTV ETL F+AEFRLPR+L  ++K+ RV  LIEQLGL+ AA T+IGDEGHRGV
Sbjct  196   DDLLFPMLTVAETLSFAAEFRLPRALPAAKKRTRVLELIEQLGLRAAADTIIGDEGHRGV  255

Query  1007  sggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPS  1186
             SGGERRRVSIG DIIHDPI+LFLDEPTSGLDSTSAFMVV+VL+ IA+SGSIVI S+HQPS
Sbjct  256   SGGERRRVSIGTDIIHDPILLFLDEPTSGLDSTSAFMVVQVLRNIAESGSIVITSIHQPS  315

Query  1187  YRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPE  1366
              RIL LLDRLI LS G+TVFSG PS++P +F EFG P+P++ENR EFALD IRE E  P 
Sbjct  316   QRILGLLDRLILLSGGRTVFSGPPSAIPAYFAEFGYPVPDDENRAEFALDLIREFESLPA  375

Query  1367  GTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLS  1546
             GT  LV FNK+WQ     ++  N N+    P  SLK+AISASISRGKLVSG+       +
Sbjct  376   GTGQLVSFNKTWQ--VMHAARHNPNDDPWAPTMSLKEAISASISRGKLVSGSDVAGE--A  431

Query  1547  PSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGI  1726
              S+  +ANPFWVEM V+ KRS +N+ RMPELF +R GAVV+TG ILAT+F+KLD SPKG 
Sbjct  432   ASMHTYANPFWVEMKVLAKRSAINTRRMPELFLIRLGAVVITGAILATVFYKLDQSPKGA  491

Query  1727  QERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaf  1906
             QERLGFFAFAMST FYTCA+A+PVFL ERYIF+RETAY AYRR+SYVLS++I+S P L  
Sbjct  492   QERLGFFAFAMSTMFYTCADALPVFLHERYIFLRETAYGAYRRTSYVLSNAIVSFPPLVV  551

Query  1907  lslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAI  2086
             LSLAFA TT++AVGLAGG SGF F+ L + ASFWAGS FVTFLSG+I +VMI YT+VVAI
Sbjct  552   LSLAFAFTTFFAVGLAGGVSGFAFYTLAILASFWAGSGFVTFLSGVIPHVMIGYTVVVAI  611

Query  2087  LAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSP  2266
             LAYF+LFSGFFINRDRIP YWIWFHY SLVKYPF+GVLQNEF    +C+V+G Q+FD SP
Sbjct  612   LAYFLLFSGFFINRDRIPDYWIWFHYLSLVKYPFEGVLQNEFGRGGECYVRGTQMFDNSP  671

Query  2267  LKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgff  2446
             L  +P+ +K ++L ++   LG+ I  +TC+ TG ++L++  VT + KW CL +T A GFF
Sbjct  672   LAVLPDTVKTRVLASIGTALGVKIGPNTCVMTGHNVLREAAVTQLGKWECLLVTAAWGFF  731

Query  2447  frllfyfallIGSKNKRR  2500
             FRLLFYF+L++GSKNKRR
Sbjct  732   FRLLFYFSLVLGSKNKRR  749



>ref|XP_006292545.1| hypothetical protein CARUB_v10018780mg [Capsella rubella]
 gb|EOA25443.1| hypothetical protein CARUB_v10018780mg [Capsella rubella]
Length=664

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/666 (62%), Positives = 530/666 (80%), Gaps = 19/666 (3%)
 Frame = +2

Query  500   SFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAV  679
             S PFVL+F++L+Y+V + ++ G+     R   +P+Q+    K LL+ I+GEA +GEI+AV
Sbjct  17    SVPFVLAFNDLTYNVTLHQRFGL-----RFGHSPAQI----KTLLNGITGEAHDGEILAV  67

Query  680   LGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVE  859
             LGASG+GKSTLIDALA RIA  SL GTV +NGE L+S++L+VISAYVMQ+DLLFPMLTVE
Sbjct  68    LGASGAGKSTLIDALAGRIAEGSLRGTVTLNGEALQSRVLRVISAYVMQEDLLFPMLTVE  127

Query  860   ETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsig  1039
             ETLMF+AEFRLPRSLS+S+K+ RV+ LI+QLGL+T   T+IGDEGHRGVSGGERRRVSIG
Sbjct  128   ETLMFAAEFRLPRSLSKSKKRDRVETLIDQLGLRTVKNTLIGDEGHRGVSGGERRRVSIG  187

Query  1040  iDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLI  1219
              DIIHDPIVLFLDEPTSGLDSTSAFMVV+VL+RIA+SGSIVIMS+HQPS RI++ LDR+I
Sbjct  188   TDIIHDPIVLFLDEPTSGLDSTSAFMVVQVLKRIARSGSIVIMSIHQPSGRIMDFLDRII  247

Query  1220  FLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKS  1399
              LS GQ+VFS SP++LP FF EFG PIP+ EN  EF LD I+ELE S EGT+ LV FN++
Sbjct  248   VLSSGQSVFSDSPAALPLFFSEFGYPIPDKENNAEFTLDLIKELEGSSEGTRGLVQFNQN  307

Query  1400  WQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFW  1579
             WQ+K    S    +N       SL++AI+ SISRGKLVS +T+ +S     +P + NP+W
Sbjct  308   WQQKIFRVSQEPHHN-----SSSLREAINKSISRGKLVSTSTSYSS-----IPSYVNPWW  357

Query  1580  VEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAM  1759
             VE +++ +R M+N  R PEL   R   V++TG +LAT++WK+DDSP+G+QERL FF+FAM
Sbjct  358   VETIILARRYMINWTRTPELIGTRVFIVMMTGFLLATVYWKVDDSPRGVQERLSFFSFAM  417

Query  1760  STTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYW  1939
             +T FY+CA+ +P F+QERYIFMRETA+NAYRRSSYV+SHS+++LP L  LS+ FA TT+W
Sbjct  418   ATMFYSCADGLPAFIQERYIFMRETAHNAYRRSSYVISHSLVTLPHLFALSIGFAATTFW  477

Query  1940  AvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFF  2119
              VGL GG +GF+++LL +FASFW+G SFVTF+SG+I NVM++Y +    L+Y +LFSGF+
Sbjct  478   FVGLNGGLAGFIYYLLIIFASFWSGCSFVTFVSGVIPNVMMSYMVTFGYLSYCLLFSGFY  537

Query  2120  INRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLK  2299
             INRDRI  YWIW HY SL+KYP++ VL NEFD P +CFV+G Q+FD + ++ V E  K K
Sbjct  538   INRDRIHLYWIWIHYISLLKYPYEAVLHNEFDDPSRCFVRGNQVFDNTLMEGVSETTKDK  597

Query  2300  LLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallI  2479
             LL  +S  LG+ +T STCL TG D+LKQ G+  ++KW CLW+T+A GFFFR+LFYF+LL+
Sbjct  598   LLDTLSSYLGMELTESTCLRTGSDLLKQHGIEQLDKWGCLWVTLAWGFFFRILFYFSLLL  657

Query  2480  GSKNKR  2497
             GSKNKR
Sbjct  658   GSKNKR  663



>ref|NP_191073.1| ABC transporter G family member 19 [Arabidopsis thaliana]
 sp|Q9M3D6.1|AB19G_ARATH RecName: Full=ABC transporter G family member 19; Short=ABC transporter 
ABCG.19; Short=AtABCG19; AltName: Full=White-brown 
complex homolog protein 19; Short=AtWBC19 [Arabidopsis thaliana]
 emb|CAB75747.1| ABC transporter-like protein [Arabidopsis thaliana]
 gb|AAK76606.1| putative ABC transporter protein [Arabidopsis thaliana]
 gb|AAL85118.1| putative ABC transporter protein [Arabidopsis thaliana]
 gb|AEE79343.1| ABC transporter G family member 19 [Arabidopsis thaliana]
Length=725

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/712 (60%), Positives = 540/712 (76%), Gaps = 18/712 (3%)
 Frame = +2

Query  374   SMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYD-PVPYPSSFPFVLSFHNLSYSVKV  550
             S TL ELL      +  K ++G G  +D     + D    Y    P+VL+F+NL Y V +
Sbjct  27    SPTLDELLKDC--DSFRKGDSGDGVKSDDPAHHIIDVEALYVKPVPYVLNFNNLQYDVTL  84

Query  551   RRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALAN  730
             RR+ G               +N VK LLDD+SGEA +G+I+AVLGASG+GKSTLIDALA 
Sbjct  85    RRRFGFSR------------QNGVKTLLDDVSGEASDGDILAVLGASGAGKSTLIDALAG  132

Query  731   RIARESLGGTVKMNGE-VLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprsls  907
             R+A  SL G+V +NGE VL+S+LLKVISAYVMQDDLLFPMLTV+ETLMF++EFRLPRSLS
Sbjct  133   RVAEGSLRGSVTLNGEKVLQSRLLKVISAYVMQDDLLFPMLTVKETLMFASEFRLPRSLS  192

Query  908   rsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPT  1087
             +S+K  RV+ALI+QLGL+ AA TVIGDEGHRGVSGGERRRVSIGIDIIHDPIVLFLDEPT
Sbjct  193   KSKKMERVEALIDQLGLRNAANTVIGDEGHRGVSGGERRRVSIGIDIIHDPIVLFLDEPT  252

Query  1088  SGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSL  1267
             SGLDST+AFMVV+VL+RIAQSGSIVIMS+HQPS RI+ LLDRLI LS+G++VF+GSP+SL
Sbjct  253   SGLDSTNAFMVVQVLKRIAQSGSIVIMSIHQPSARIVELLDRLIILSRGKSVFNGSPASL  312

Query  1268  PRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQR-KFSPSSTSNRNN  1444
             P FF +FG PIPE EN  EFALD +RELE S EGTK LVDFN+ WQ+ K S   ++ + N
Sbjct  313   PGFFSDFGRPIPEKENISEFALDLVRELEGSNEGTKALVDFNEKWQQNKISLIQSAPQTN  372

Query  1445  VFPNPKP-SLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNS  1621
                  +  SLK+AI+AS+SRGKLVSG++  N T   +V  +ANP   E  ++ KR M N 
Sbjct  373   KLDQDRSLSLKEAINASVSRGKLVSGSSRSNPTSMETVSSYANPSLFETFILAKRYMKNW  432

Query  1622  LRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVF  1801
             +RMPEL   R   V+VTG +LAT++WKLD +P+G QERL  FAF + T FY C + +PVF
Sbjct  433   IRMPELVGTRIATVMVTGCLLATVYWKLDHTPRGAQERLTLFAFVVPTMFYCCLDNVPVF  492

Query  1802  LQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflff  1981
             +QERYIF+RET +NAYR SSYV+SHS++SLP L   SL F+  T+W VGL+GG  GF+F+
Sbjct  493   IQERYIFLRETTHNAYRTSSYVISHSLVSLPQLLAPSLVFSAITFWTVGLSGGLEGFVFY  552

Query  1982  llfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFH  2161
              L ++ASFW+GSS VTF+SG++ N+M+ Y + +  LAY +L SGF++NRDRIP YW WFH
Sbjct  553   CLLIYASFWSGSSVVTFISGVVPNIMLCYMVSITYLAYCLLLSGFYVNRDRIPFYWTWFH  612

Query  2162  YASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINIT  2341
             Y S++KYP++ VL NEFD P +CFV+G+Q+FD + L  V ++ K+KLL+ +SK+L   IT
Sbjct  613   YISILKYPYEAVLINEFDDPSRCFVRGVQVFDSTLLGGVSDSGKVKLLETLSKSLRTKIT  672

Query  2342  SSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKR  2497
              STCL TG D+L Q G+T ++KW+CLWIT A G FFR+LFYFALL GS+NKR
Sbjct  673   ESTCLRTGSDLLAQQGITQLSKWDCLWITFASGLFFRILFYFALLFGSRNKR  724



>ref|NP_001044732.1| Os01g0836600 [Oryza sativa Japonica Group]
 dbj|BAB89748.1| putative ATP-binding cassette transporter ABCG2 [Oryza sativa 
Japonica Group]
 dbj|BAF06646.1| Os01g0836600 [Oryza sativa Japonica Group]
 gb|EAZ14071.1| hypothetical protein OsJ_03996 [Oryza sativa Japonica Group]
Length=749

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/678 (65%), Positives = 532/678 (78%), Gaps = 18/678 (3%)
 Frame = +2

Query  509   FVLSFHNLSYSVKVRRK-------------MGVPAWLGRRTAA-PSQVENDVKVLLDDIS  646
             F L+F +L+YSV+  R+             + +     R TAA P    +  +VLLD I+
Sbjct  76    FRLAFTSLTYSVRAARRARPGGGDGGGGFRLPLQNRCDRVTAAAPDAHSSRARVLLDGIT  135

Query  647   GEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQ  826
             GEAREGEI+AV+GASGSGKSTLIDALANRI+R++L G+V +NGE L   ++K ISAYVMQ
Sbjct  136   GEAREGEILAVMGASGSGKSTLIDALANRISRDALKGSVTLNGEPLTGNVIKSISAYVMQ  195

Query  827   DDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgv  1006
             DDLLFPMLTV ETL F+AEFRLPR+L  ++K+ RV  LIEQLGL+ AA T+IGDEGHRGV
Sbjct  196   DDLLFPMLTVAETLSFAAEFRLPRALPAAKKRTRVLELIEQLGLRAAADTIIGDEGHRGV  255

Query  1007  sggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPS  1186
             SGGERRRVSIG DIIHDPI+LFLDEPTSGLDSTSAFMVV+VL+ IA+SGSIVI S+HQPS
Sbjct  256   SGGERRRVSIGTDIIHDPILLFLDEPTSGLDSTSAFMVVQVLRNIAESGSIVITSIHQPS  315

Query  1187  YRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPE  1366
              RIL LLDRLI LS G+TVFSG PS++P +F EFG P+P++ENR EFALD IRE E  P 
Sbjct  316   QRILGLLDRLILLSGGRTVFSGPPSAIPAYFAEFGYPVPDDENRAEFALDLIREFESLPA  375

Query  1367  GTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLS  1546
             GT  LV FNK+WQ     ++  N N+    P  SLK+AISASISRGKLVSG+       +
Sbjct  376   GTGQLVSFNKTWQ--VMHAARHNPNDDPWAPTMSLKEAISASISRGKLVSGSDVAGE--A  431

Query  1547  PSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGI  1726
              S+  +ANPFWVEM V+ KRS +N+ RMPELF +R GAVV+TG ILAT+F+KLD SPKG 
Sbjct  432   ASMHTYANPFWVEMKVLTKRSAINTRRMPELFLIRLGAVVITGAILATVFYKLDQSPKGA  491

Query  1727  QERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaf  1906
             QERLGFFAFAMST FYTCA+A+PVFL ERYIF+RETAY AYRR+SYVLS++I+S P L  
Sbjct  492   QERLGFFAFAMSTMFYTCADALPVFLHERYIFLRETAYGAYRRTSYVLSNAIVSFPPLVV  551

Query  1907  lslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAI  2086
             LSLAFA TT++AVGLAGG SGF F+ L + ASFWAGS FVTFLSG+I +VMI YT+VVAI
Sbjct  552   LSLAFAFTTFFAVGLAGGVSGFAFYTLAILASFWAGSGFVTFLSGVIPHVMIGYTVVVAI  611

Query  2087  LAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSP  2266
             LAYF+LFSGFFINRDRIP YWIWFHY SLVKYPF+GVLQNEF    +C+V+G Q+FD SP
Sbjct  612   LAYFLLFSGFFINRDRIPDYWIWFHYLSLVKYPFEGVLQNEFGRGGECYVRGTQMFDNSP  671

Query  2267  LKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgff  2446
             L  +P+ +K ++L ++   LG+ I  +TC+ TG ++L++  VT + KW CL +T A GFF
Sbjct  672   LAVLPDTVKTRVLASIGTALGVKIGPNTCVMTGHNVLREAAVTQLGKWECLLVTAAWGFF  731

Query  2447  frllfyfallIGSKNKRR  2500
             FRLLFYF+L++GSKNKRR
Sbjct  732   FRLLFYFSLVLGSKNKRR  749



>ref|XP_006292173.1| hypothetical protein CARUB_v10018379mg [Capsella rubella]
 gb|EOA25071.1| hypothetical protein CARUB_v10018379mg [Capsella rubella]
Length=725

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/717 (60%), Positives = 540/717 (75%), Gaps = 28/717 (4%)
 Frame = +2

Query  374   SMTLGELLH-----RVGDSA-GEKLNNGVGGANDHRVLQLYDPVPYPSSFPFVLSFHNLS  535
             S TL ELL      R GD+  G K ++      D   L L  PVP      FVL+F+NL 
Sbjct  27    SPTLDELLKDCDSFRKGDTGDGVKSDDPAHHVIDVEALHL-KPVP------FVLAFNNLE  79

Query  536   YSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLI  715
             Y V +RR+ G     G            VK LLDD+SGEA +G+I+AVLGASG+GKSTLI
Sbjct  80    YDVTLRRRFGFSGRSG------------VKTLLDDVSGEACDGDILAVLGASGAGKSTLI  127

Query  716   DALANRIARESLGGTVKMNGE-VLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrl  892
             DALA R+A  SL G+V +NGE VL+S+LLKVISAYVMQDDLLFPMLTV+ETLMF++EFRL
Sbjct  128   DALAGRVAEGSLRGSVTLNGEKVLQSRLLKVISAYVMQDDLLFPMLTVKETLMFASEFRL  187

Query  893   prslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLF  1072
             PRSLS+ +K  RV+ LI+QLGL+ AA TVIGDEGHRGVSGGERRRVSIGIDIIHDPIVLF
Sbjct  188   PRSLSKLKKMERVETLIDQLGLRNAANTVIGDEGHRGVSGGERRRVSIGIDIIHDPIVLF  247

Query  1073  LDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSG  1252
             LDEPTSGLDST+AFMVV+VL+RIAQSGSIVIMS+HQPS RI+ LLDRLI LS+G++VF+G
Sbjct  248   LDEPTSGLDSTNAFMVVQVLKRIAQSGSIVIMSIHQPSARIVELLDRLIILSRGKSVFNG  307

Query  1253  SPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQR-KFSPSST  1429
             SP+SLP FF +FG PIPE EN  EF LD +RELE S EGT++LV+FN+ WQR K S S  
Sbjct  308   SPASLPGFFSDFGRPIPEKENITEFTLDLVRELEGSTEGTRSLVEFNEKWQRNKLSLSQC  367

Query  1430  SNRNNVFP-NPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKR  1606
             + + N+   +   +LK+AI+ S+SRGKLVSG++  N T   +V  +ANP   E  ++ KR
Sbjct  368   APQTNMLELDHTLTLKEAINVSVSRGKLVSGSSRANLTSMETVSSYANPSLFETFILAKR  427

Query  1607  SMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAE  1786
              M N +RMPEL   R   V+VTG +LAT++WKLD SP+G QERL  FAF + T FY C +
Sbjct  428   YMKNWMRMPELVGTRIATVMVTGFLLATVYWKLDHSPRGAQERLTLFAFVVPTMFYCCLD  487

Query  1787  AIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfs  1966
              +PVF+QERYIF+RET +NAYR SSYV+SHS++SLP L   SL F+  T+W VGL+GG  
Sbjct  488   NVPVFIQERYIFLRETTHNAYRTSSYVISHSLVSLPQLLAPSLVFSAITFWTVGLSGGLE  547

Query  1967  gflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPY  2146
             GF F+ L ++ASFW+GSS VTF+SG++ N+M++Y + ++ LAY +L SGF++NRDRIP Y
Sbjct  548   GFFFYCLIIYASFWSGSSVVTFISGVVPNIMLSYMVAISYLAYCLLLSGFYVNRDRIPIY  607

Query  2147  WIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTL  2326
             W WFHY SL+KYP++ VL NEFD P +CFVKG+Q+FD + L  V E+ K+KLL+ + K+L
Sbjct  608   WTWFHYISLLKYPYEAVLINEFDDPSRCFVKGVQVFDSTLLGGVSESGKVKLLETLGKSL  667

Query  2327  GINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKR  2497
                IT STCL TG D L+Q G+T+++KW CLWIT A G FFR+LFYFALL+GS+NKR
Sbjct  668   QTRITESTCLRTGSDFLEQQGITELSKWECLWITFASGLFFRILFYFALLLGSRNKR  724



>ref|XP_010504358.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
19-like [Camelina sativa]
Length=731

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/717 (60%), Positives = 538/717 (75%), Gaps = 28/717 (4%)
 Frame = +2

Query  374   SMTLGELLH-----RVGDSA-GEKLNNGVGGANDHRVLQLYDPVPYPSSFPFVLSFHNLS  535
             S TL ELL      R GDS   EK ++      D   L L  PVP      FVL+F+NL 
Sbjct  33    SPTLDELLKDCDSFRKGDSGDSEKSDDPAHYVIDVEALHL-KPVP------FVLAFNNLE  85

Query  536   YSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLI  715
             Y V + R+ G               ++ VK LLDD+SGEA +G+I+AVLGASG+GKSTLI
Sbjct  86    YDVILGRRFGFSR------------QSGVKTLLDDVSGEACDGDILAVLGASGAGKSTLI  133

Query  716   DALANRIARESLGGTVKMNGE-VLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrl  892
             DALA R+A  SL G+V +NGE VL+++LLKVISAYVMQDDLLFPMLTV+ETLMF++EFRL
Sbjct  134   DALAGRVAEGSLRGSVTLNGEKVLQTRLLKVISAYVMQDDLLFPMLTVKETLMFASEFRL  193

Query  893   prslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLF  1072
             P SLS+S+K  RV+ALI+QLGL+ AA TVIGDEGHRGVSGGERRRVSIGIDIIHDPIVLF
Sbjct  194   PISLSKSKKMERVEALIDQLGLRNAANTVIGDEGHRGVSGGERRRVSIGIDIIHDPIVLF  253

Query  1073  LDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSG  1252
             LDEPTSGLDST+AFMVV+VL+RIAQSGSIVIMS+HQPS RI+ LLDRLI LS+G++VF+G
Sbjct  254   LDEPTSGLDSTNAFMVVQVLKRIAQSGSIVIMSIHQPSARIVELLDRLIILSRGKSVFNG  313

Query  1253  SPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQR-KFSPSST  1429
             SP+SLP FF +FG PIPE EN  EFALD +RELE S EGT++LVDFN+ WQ+ K S S +
Sbjct  314   SPASLPGFFSDFGRPIPEKENITEFALDLVRELEGSTEGTRSLVDFNEKWQQNKLSFSQS  373

Query  1430  SNRNNVFPNPKP-SLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKR  1606
             +   N+F    P +LK+AI+AS+SRGKLVSG +  N     +V  +ANP   E  ++ KR
Sbjct  374   APHTNMFELDSPLTLKEAINASVSRGKLVSGTSRANLVSMETVSSYANPSLFETFILAKR  433

Query  1607  SMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAE  1786
              M N +RMPEL   R   V+VTG +LAT++WKLD +P+G QERL  FAF + T FY C +
Sbjct  434   YMKNWMRMPELVGTRIATVMVTGFLLATVYWKLDHTPRGAQERLTLFAFVVPTMFYCCLD  493

Query  1787  AIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfs  1966
              +PVF+QERYIF+RET +N YR SSYV+SHS++SLP L   SL F+  T+W VGL+G   
Sbjct  494   NVPVFIQERYIFLRETTHNTYRTSSYVISHSLVSLPQLIAPSLVFSTITFWTVGLSGXLE  553

Query  1967  gflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPY  2146
             GF F+ L ++ASFW+GSS VTF+SG++ N+M++Y + ++ LAY +L SGF++NRDRIP Y
Sbjct  554   GFYFYCLLIYASFWSGSSVVTFISGVVPNIMLSYMVAISYLAYCLLLSGFYVNRDRIPVY  613

Query  2147  WIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTL  2326
             W WFHY SL+KYP++ VL NEFD P +CFVKG+Q+FD + L  V ++ K+KLL+ +  +L
Sbjct  614   WTWFHYISLLKYPYEAVLINEFDDPSRCFVKGVQVFDSTLLGGVSDSGKVKLLETLGNSL  673

Query  2327  GINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKR  2497
                IT STCL TG D+L Q G+T+++KW CLWIT A G FFR+LFYFALL GS+NKR
Sbjct  674   KTRITESTCLRTGSDLLAQQGITELSKWECLWITFASGLFFRILFYFALLFGSRNKR  730



>ref|XP_009116211.1| PREDICTED: ABC transporter G family member 18-like [Brassica 
rapa]
 ref|XP_009116212.1| PREDICTED: ABC transporter G family member 18-like [Brassica 
rapa]
Length=708

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/731 (59%), Positives = 557/731 (76%), Gaps = 30/731 (4%)
 Frame = +2

Query  320   PRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPS  499
             PR + E QE++         TLGELL       G++       A+ H +L L  P   P 
Sbjct  2     PRVSAESQEISFD--GGSEPTLGELLKDF--DVGDRKKTSGEDASTHHILDLTSPETRP-  56

Query  500   SFPFVLSFHNLSYSVKVRRKM----GVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGE  667
               PF+LSF+NLSY +  RR+     G PA               VK LL+D+SGEA +G+
Sbjct  57    -VPFLLSFNNLSYDIVHRRRFDFSRGKPA--------------SVKTLLNDVSGEACDGD  101

Query  668   IMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGE-VLESKLLKVISAYVMQDDLLFP  844
             I+AVLGASG+GKSTLIDALA R++  SL GTV +NGE +L+++LLKVISAYVMQDDLLFP
Sbjct  102   ILAVLGASGAGKSTLIDALAGRVS--SLRGTVTLNGEKILQTRLLKVISAYVMQDDLLFP  159

Query  845   MLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerr  1024
             MLTV+ETLMF++EFRLPRSLS+S+K  RVQ LI++LGL+ AA T+IGDEGHRGVSGGERR
Sbjct  160   MLTVKETLMFASEFRLPRSLSKSKKMERVQTLIDKLGLRNAADTIIGDEGHRGVSGGERR  219

Query  1025  rvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNL  1204
             RVSIGIDIIHDPI+LFLDEPTSGLDST+AFMVV+VL+RIA+SGSIVIM++HQPS R+L+L
Sbjct  220   RVSIGIDIIHDPILLFLDEPTSGLDSTNAFMVVQVLKRIARSGSIVIMTIHQPSARVLDL  279

Query  1205  LDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLV  1384
             LDRLI LS+G+ VFSGSP+SLP+F  +FG+PIPE EN  EFALD +R+LE S EGT+ LV
Sbjct  280   LDRLIILSRGENVFSGSPTSLPQFLSDFGHPIPEKENITEFALDLVRQLEGSSEGTRELV  339

Query  1385  DFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKF  1564
             +FN+ WQ+  S  +T       P    SLK++I+AS+SRGKLVSG+T+ +     SV  +
Sbjct  340   EFNEKWQQNHSARATPMTT---PYQALSLKESITASVSRGKLVSGSTSSDPISMDSVSSY  396

Query  1565  ANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGF  1744
             ANP  VE  ++ KR M N +R PEL   R   V+VTG++LATI+W+LD++P+G QER+ F
Sbjct  397   ANPPLVETFILAKRYMKNWIRTPELIGTRIATVMVTGLLLATIYWRLDNTPRGAQERMAF  456

Query  1745  FAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafa  1924
             FAF MST FY CA+ +PVFL+ER+IF+RE+  NAYR SSYV+SHS++SLP L  LS+AFA
Sbjct  457   FAFGMSTMFYVCADNVPVFLKERFIFLRESTRNAYRISSYVISHSLVSLPQLLALSIAFA  516

Query  1925  VTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVL  2104
              TT+W VGL+GG   FL++ L ++A FW+GSSFVTF+SG++ NVMI++ + +A L+Y +L
Sbjct  517   ATTFWTVGLSGGLESFLYYCLIIYAGFWSGSSFVTFVSGLVPNVMISFMITIAYLSYCLL  576

Query  2105  FSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPE  2284
               GF+INRDRIP YWIWFHY SL+KYP++ VL NEFD P +CFV+G+Q+FDG+ L  VP+
Sbjct  577   LGGFYINRDRIPVYWIWFHYISLLKYPYEAVLINEFDDPSRCFVRGVQVFDGTLLAKVPD  636

Query  2285  AMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfy  2464
             AMK+KLL  +S +LG  IT STCL TGPD+L Q G++ ++KW+CLWIT+A G FFR+LFY
Sbjct  637   AMKVKLLDTLSSSLGTTITESTCLRTGPDLLMQQGISQLSKWDCLWITLAWGLFFRILFY  696

Query  2465  fallIGSKNKR  2497
             F+LL GSKNKR
Sbjct  697   FSLLFGSKNKR  707



>emb|CDY40201.1| BnaA09g34830D [Brassica napus]
Length=708

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/731 (59%), Positives = 558/731 (76%), Gaps = 30/731 (4%)
 Frame = +2

Query  320   PRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPS  499
             PR + E QE++    +    TLGELL       G++  N    A+ H +L L  P   P 
Sbjct  2     PRVSAESQEISFDGGNEP--TLGELLKDF--DGGDRKKNSGEDASTHHILDLTSPETRP-  56

Query  500   SFPFVLSFHNLSYSVKVRRKM----GVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGE  667
               PF+LSF+NLSY +  RR+     G PA               VK LL+D+SGEA +G+
Sbjct  57    -VPFLLSFNNLSYDIVHRRRFDFSRGKPA--------------SVKPLLNDVSGEACDGD  101

Query  668   IMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGE-VLESKLLKVISAYVMQDDLLFP  844
             I+AVLGASG+GKSTLIDALA R+   SL GTV +NGE +L+++LLKVISAYVMQDDLLFP
Sbjct  102   ILAVLGASGAGKSTLIDALAGRVG--SLRGTVTLNGEKILQTRLLKVISAYVMQDDLLFP  159

Query  845   MLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerr  1024
             MLTV+ETLMF++EFRLPRSLS+S+K  RVQ LI++LGL+ AA T+IGDEGHRGVSGGERR
Sbjct  160   MLTVKETLMFASEFRLPRSLSKSKKMERVQTLIDKLGLRNAADTIIGDEGHRGVSGGERR  219

Query  1025  rvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNL  1204
             RVSIGIDIIHDPI+LFLDEPTSGLDST+AFMVV+VL+RIA+SGSIVIM++HQPS R+L+L
Sbjct  220   RVSIGIDIIHDPILLFLDEPTSGLDSTNAFMVVQVLKRIARSGSIVIMTIHQPSARVLDL  279

Query  1205  LDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLV  1384
             LDRLI LS+G+ VFSGSP+SLP+F  +FG+PIPE EN  EFALD +R+LE S EGT+ LV
Sbjct  280   LDRLIILSRGENVFSGSPTSLPQFLSDFGHPIPEKENITEFALDLVRQLEGSSEGTRELV  339

Query  1385  DFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKF  1564
             +FN+ WQ+  S  +T       P    SLK++I+AS+SRGKLVSG+T+ +     SV  +
Sbjct  340   EFNEKWQQNHSARATPMTT---PYQALSLKESITASVSRGKLVSGSTSSDPISMDSVSSY  396

Query  1565  ANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGF  1744
             ANP  VE  ++ KR M N +R PEL   R   V+VTG++LATI+W+LD++P+G QER+ F
Sbjct  397   ANPPLVETFILAKRYMKNWIRTPELIGTRIATVMVTGLLLATIYWRLDNTPRGAQERMAF  456

Query  1745  FAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafa  1924
             FAF MST FY CA+ +PVFL+ER+IF+RE+  NAYR SSYV+SHS++SLP L  LS+AFA
Sbjct  457   FAFGMSTMFYVCADNVPVFLKERFIFLRESTRNAYRISSYVISHSLVSLPQLLALSIAFA  516

Query  1925  VTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVL  2104
              TT+W VGL+GG   FL++ L ++A FW+GSSFVTF+SG++ NVMI++ + +A L+Y +L
Sbjct  517   ATTFWTVGLSGGLESFLYYCLIIYAGFWSGSSFVTFVSGLVPNVMISFMITIAYLSYCLL  576

Query  2105  FSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPE  2284
               GF+INRDRIP YWIWFHY SL+KYP++ VL NEFD P +CFV+G+Q+FDG+ L  +P+
Sbjct  577   LGGFYINRDRIPVYWIWFHYISLLKYPYEAVLINEFDDPSRCFVRGVQVFDGTLLAKMPD  636

Query  2285  AMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfy  2464
             AMK+KLL  +S +LG  IT STCL TGPD+L Q G++ ++KW+CLWIT+A G FFR+LFY
Sbjct  637   AMKVKLLDTLSNSLGTTITESTCLRTGPDLLMQQGISQLSKWDCLWITLAWGLFFRILFY  696

Query  2465  fallIGSKNKR  2497
             F+LL GSKNKR
Sbjct  697   FSLLFGSKNKR  707



>ref|XP_010427258.1| PREDICTED: ABC transporter G family member 17 [Camelina sativa]
Length=662

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/666 (62%), Positives = 527/666 (79%), Gaps = 21/666 (3%)
 Frame = +2

Query  500   SFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAV  679
             S PFVL+F++L+YSV ++++ G+     R   +P+Q+    K LL+ I+G+A EGEI+AV
Sbjct  17    SVPFVLAFNDLTYSVILQKRFGL-----RFGHSPAQI----KTLLNGITGDANEGEILAV  67

Query  680   LGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVE  859
             LGASG+GKSTLIDALA RI   SL GTV +NGE L+S++L+VISAYVMQ+DL+FPMLTVE
Sbjct  68    LGASGAGKSTLIDALAGRIKEGSLKGTVTLNGEALQSRVLRVISAYVMQEDLMFPMLTVE  127

Query  860   ETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsig  1039
             ETLMF+AEFRLPRSLS+S+K+ RV+ LI+QLGL+T   T+IGDEGHRGVSGGERRRVSIG
Sbjct  128   ETLMFAAEFRLPRSLSKSKKRDRVETLIDQLGLRTVKNTLIGDEGHRGVSGGERRRVSIG  187

Query  1040  iDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLI  1219
              DIIHDPI+LFLDEPTSGLDSTSAFMVV+VL+RIA+SGSIVIMS+HQPS RI+  LDR+I
Sbjct  188   TDIIHDPILLFLDEPTSGLDSTSAFMVVQVLKRIARSGSIVIMSIHQPSCRIMEFLDRII  247

Query  1220  FLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKS  1399
              LS GQ+VFS SP++LP FF EFG PIP+ EN  EF LD I+ELE S EGT+ LV+FNK+
Sbjct  248   VLSSGQSVFSDSPATLPLFFSEFGYPIPDKENNAEFTLDLIKELEGSSEGTRALVEFNKN  307

Query  1400  WQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFW  1579
             WQ+K         +N       SL++AI+ASISRGKLVS       T   S+P + NP+W
Sbjct  308   WQQKKLRVRQEPHHN-----SSSLREAINASISRGKLVS-------TSFSSIPSYVNPWW  355

Query  1580  VEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAM  1759
             +E V++ KR M+N  R PEL   R   V++TG +LAT++WK+DDSP+G+QERL FF+FAM
Sbjct  356   IETVILAKRYMINWTRTPELIGTRVFIVMMTGFLLATVYWKVDDSPRGVQERLSFFSFAM  415

Query  1760  STTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYW  1939
             +T FY+CA+ +P F+QERYIF+RETA+NAYRRSSYV+SHS+++LP L  LS+ FA TT+W
Sbjct  416   ATMFYSCADGLPAFIQERYIFLRETAHNAYRRSSYVISHSLVTLPHLFVLSIGFAATTFW  475

Query  1940  AvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFF  2119
              VGL GG SGF+++LL +FASFW+G SFVTF+SG+I NVM++Y +    L+Y +LFSGF+
Sbjct  476   FVGLNGGLSGFIYYLLIIFASFWSGCSFVTFVSGVIPNVMMSYMVTFGYLSYCLLFSGFY  535

Query  2120  INRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLK  2299
             INRDRI  YWIW HY SL+KYP++ VL NEFD P +CFV+G QIFD + ++ V E  K K
Sbjct  536   INRDRIHLYWIWIHYISLLKYPYEAVLHNEFDDPSRCFVRGNQIFDDTLMEGVSETTKGK  595

Query  2300  LLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallI  2479
             LL  +S  LG+ +T STCL TG D+LKQ G+  ++KW CLW+T+A GFFFR+LFYF+LL+
Sbjct  596   LLDTVSSYLGMELTESTCLRTGSDLLKQHGIEQLDKWGCLWVTLAWGFFFRILFYFSLLL  655

Query  2480  GSKNKR  2497
             GSKNKR
Sbjct  656   GSKNKR  661



>gb|ABB97036.1| ABC transporter-like protein [Brassica rapa]
Length=708

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/731 (60%), Positives = 557/731 (76%), Gaps = 30/731 (4%)
 Frame = +2

Query  320   PRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPS  499
             PR + E QE++         TLGELL       G++  N    A+ H +L L  P   P 
Sbjct  2     PRVSAESQEISFD--GGSEPTLGELLKDF--DGGDRKKNSGEDASTHHILDLTSPETRP-  56

Query  500   SFPFVLSFHNLSYSVKVRRKM----GVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGE  667
               PF+LSF+NLSY +  RR+     G PA               VK LL+D+SGEA +G+
Sbjct  57    -VPFLLSFNNLSYDIVNRRRFDFSRGKPA--------------SVKPLLNDVSGEACDGD  101

Query  668   IMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGE-VLESKLLKVISAYVMQDDLLFP  844
             I+AVLGASG+GKSTLIDALA R+   SL GTV +NGE +L+++LLKVISAYVMQDDLLFP
Sbjct  102   ILAVLGASGAGKSTLIDALAGRVG--SLRGTVTLNGEKILQTRLLKVISAYVMQDDLLFP  159

Query  845   MLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerr  1024
             MLTV+ETLMF++EFRLPRSLS+S+K  RVQ LI+QLGL+ AA T+IGDEGHRGVSGGERR
Sbjct  160   MLTVKETLMFASEFRLPRSLSKSKKMERVQTLIDQLGLRDAADTIIGDEGHRGVSGGERR  219

Query  1025  rvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNL  1204
             RVSIGIDIIHDPI+LFLDEPTSGLDST+AFMVV+VL+RIA+SGSIVIM++HQPS R+L+L
Sbjct  220   RVSIGIDIIHDPILLFLDEPTSGLDSTNAFMVVQVLKRIARSGSIVIMTIHQPSGRVLDL  279

Query  1205  LDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLV  1384
             LDRLI LS+G+ VFSGSP+SLP+F  +FG+PIPE EN  EFALD +R+LE + EGT+ LV
Sbjct  280   LDRLIILSRGENVFSGSPTSLPQFLSDFGHPIPEKENITEFALDLVRQLEGAGEGTRELV  339

Query  1385  DFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKF  1564
             +FN+ WQ+  S  +T       P    SLK++I+AS+SRGKLVSG+T+ +     SV  +
Sbjct  340   EFNEKWQQNQSARATPMTT---PYQALSLKESITASVSRGKLVSGSTSSDPISMDSVSSY  396

Query  1565  ANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGF  1744
             ANP  VE  ++ KR M N +R PEL   R   V+VTG++LATI+W+LD++P+G QER+ F
Sbjct  397   ANPPLVETFILAKRYMKNWIRTPELIGTRIATVMVTGLLLATIYWRLDNTPRGAQERMAF  456

Query  1745  FAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafa  1924
             FAF MST FY CA+ +PVFL+ER+IF+RE+  NAYR SSYV+SHS++SLP L  LS+AFA
Sbjct  457   FAFGMSTMFYVCADNVPVFLKERFIFLRESTRNAYRISSYVISHSLVSLPQLLALSIAFA  516

Query  1925  VTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVL  2104
              TT+W VGL+GG   FL++ L ++A FW+GSSFVTF+SG++ NVMI++ + +A L+Y +L
Sbjct  517   ATTFWTVGLSGGLESFLYYCLIIYAGFWSGSSFVTFVSGLVPNVMISFMITIAYLSYCLL  576

Query  2105  FSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPE  2284
               GF+INRDRIP YWIWFHY SL+KYP++ VL NEFD P +CFV+G+Q+FDG+ L  VP+
Sbjct  577   LGGFYINRDRIPVYWIWFHYISLLKYPYEAVLINEFDDPSRCFVRGVQVFDGTLLAKVPD  636

Query  2285  AMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfy  2464
             AMK+KLL  +S +LG  IT STCL TGPD+L Q G++ ++KW+CLWIT+A G FFR+LFY
Sbjct  637   AMKVKLLDTLSSSLGTTITESTCLRTGPDLLLQQGISQLSKWDCLWITLAWGLFFRILFY  696

Query  2465  fallIGSKNKR  2497
             F+LL GSKNKR
Sbjct  697   FSLLFGSKNKR  707



>ref|XP_010504354.1| PREDICTED: ABC transporter G family member 17-like [Camelina 
sativa]
Length=662

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/667 (62%), Positives = 529/667 (79%), Gaps = 23/667 (3%)
 Frame = +2

Query  500   SFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAV  679
             S  F+L+F++LSY+V ++++ G+     R   +P+Q+    K LL+ I+GEA EGEI+AV
Sbjct  17    SVQFILAFNDLSYNVILQKRFGL-----RFGHSPAQI----KTLLNGITGEAYEGEILAV  67

Query  680   LGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVE  859
             LGASG+GKSTLIDALA RI   SL GTV +NGE ++S+LL+VISAYVMQ+DL+FPMLTVE
Sbjct  68    LGASGAGKSTLIDALAGRIEEGSLKGTVTLNGEAVQSRLLRVISAYVMQEDLMFPMLTVE  127

Query  860   ETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsig  1039
             ETLMF+AEFRLPRSLS+S+K+ RV+ LI+QLGL+T   T+IGDEGHRGVSGGERRRVSIG
Sbjct  128   ETLMFAAEFRLPRSLSKSKKRDRVETLIDQLGLRTVKNTLIGDEGHRGVSGGERRRVSIG  187

Query  1040  iDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLI  1219
              DIIHDPI+LFLDEPTSGLDSTSAFMVV+VL+RIA+SGSIVIMS+HQPS RI+  LDR+I
Sbjct  188   TDIIHDPILLFLDEPTSGLDSTSAFMVVQVLKRIARSGSIVIMSIHQPSCRIMEYLDRII  247

Query  1220  FLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKS  1399
              LS GQ+VFS SP++LP FF EFG PIP+ EN  EF LD I+ELE S EGT+ LV+FN+ 
Sbjct  248   VLSSGQSVFSDSPATLPLFFSEFGYPIPDKENNAEFTLDLIKELEGSSEGTRGLVEFNRF  307

Query  1400  WQ-RKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPF  1576
             WQ +K   S   +RN+       SL++AI+ASISRGKLVS       T   S+P + NP+
Sbjct  308   WQQKKLRVSQEPHRNS------SSLREAINASISRGKLVS-------TSFSSIPSYVNPW  354

Query  1577  WVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFA  1756
             W+E V++ KR ++N  R PEL   R   V++TG +LAT++WK+DDSP+G+QERL FF+FA
Sbjct  355   WIETVILAKRYLINWTRTPELIGTRVFIVMMTGFLLATVYWKVDDSPRGVQERLSFFSFA  414

Query  1757  MSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTY  1936
             M+T FY+CA+ +P F+QERYIF+RETA+NAYRRSSYV+SHS+++LP L  LS+ FA TT+
Sbjct  415   MATMFYSCADGLPAFIQERYIFLRETAHNAYRRSSYVISHSLVTLPHLFVLSIGFAATTF  474

Query  1937  WAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGF  2116
             W VGL GG +GF+++LL +FASFW+G SFVTF+SG+I NVMI+Y +    L+Y +LFSGF
Sbjct  475   WFVGLNGGLAGFIYYLLIIFASFWSGCSFVTFVSGVIPNVMISYMVTFGYLSYCLLFSGF  534

Query  2117  FINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKL  2296
             +INRDRI  YWIW HY SL+KYP++ VL NEFD P +CFV+G Q+FD + ++ V E+ K 
Sbjct  535   YINRDRIHLYWIWIHYISLLKYPYEAVLHNEFDDPSRCFVRGNQVFDDTLMEGVSESTKA  594

Query  2297  KLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfall  2476
             KLL  MS  LG+ +T STCL TG D+LKQ G+  ++KW CLW+T+A GFFFR+LFYF+LL
Sbjct  595   KLLDTMSSYLGMELTESTCLRTGSDLLKQHGIEQLDKWGCLWVTLAWGFFFRILFYFSLL  654

Query  2477  IGSKNKR  2497
             +GSKNKR
Sbjct  655   LGSKNKR  661



>ref|XP_002878017.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54276.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=662

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/665 (62%), Positives = 526/665 (79%), Gaps = 23/665 (3%)
 Frame = +2

Query  506   PFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLG  685
             PFVL+F++L+Y+V ++++ G+     R   +P+++    K LL+ I+GEA EGEI+A+LG
Sbjct  19    PFVLAFNDLTYNVTLQQRFGL-----RFGHSPAKI----KTLLNGITGEANEGEILAILG  69

Query  686   ASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEET  865
             ASG+GKSTLIDALA +IA  SL GTV +NGE L+S++L+VISAYVMQ+DLLFPMLTVEET
Sbjct  70    ASGAGKSTLIDALAGQIAEGSLKGTVTLNGEALQSRVLRVISAYVMQEDLLFPMLTVEET  129

Query  866   LMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiD  1045
             LMF+AEFRLPRS S S+K+ RV+ LI+QLGL T   TVIGDEGHRGVSGGERRRVSIG D
Sbjct  130   LMFAAEFRLPRSFSNSKKRNRVETLIDQLGLTTVKNTVIGDEGHRGVSGGERRRVSIGTD  189

Query  1046  IIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFL  1225
             IIHDPI+LF DEPTSGLDSTSAFMVV+VL+RIA+SGSIVIMS+HQPS RI+  LD +I L
Sbjct  190   IIHDPIILFFDEPTSGLDSTSAFMVVQVLKRIARSGSIVIMSIHQPSGRIMEFLDHIIVL  249

Query  1226  SKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQ  1405
             S GQ+VFS SP+++P FF EFG+PIP+ EN  EF LD I+ELE+S EGT+ LV+FNK+WQ
Sbjct  250   SSGQSVFSDSPATIPLFFSEFGSPIPDKENNAEFTLDLIKELEESSEGTRGLVEFNKNWQ  309

Query  1406  RKFSPSSTSNRNNVFPN-PKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWV  1582
             +K        R N  P+    SL +AI+ASISRGKLV+       T   S+P + NP+WV
Sbjct  310   QK------KLRVNQEPHHSSSSLGEAINASISRGKLVT-------TSYSSIPSYVNPWWV  356

Query  1583  EMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMS  1762
             E V++ KR M+N  R PEL   R   V++TG +LAT++WK+DDSP+G+QERL FF+FAM+
Sbjct  357   ETVILAKRYMINWTRTPELIGTRVFIVMMTGFLLATVYWKVDDSPRGVQERLSFFSFAMA  416

Query  1763  TTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWA  1942
             T FY+CA+ +P F+QERYIF+RETA+NAYRRSSYV+SHS+++LP L  LS+ FA TT+W 
Sbjct  417   TMFYSCADGLPAFIQERYIFLRETAHNAYRRSSYVISHSLVTLPHLFALSIGFAATTFWF  476

Query  1943  vglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFI  2122
             VGL GG +GF+++LL +FASFW+G SFVTF+SG+I NVM++Y +    L+Y +LFSGF+I
Sbjct  477   VGLNGGLAGFIYYLLIIFASFWSGCSFVTFVSGVIPNVMMSYMVTFGYLSYCLLFSGFYI  536

Query  2123  NRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKL  2302
             NRDRI  YWIW HY SL+KYP++ VL NEFD P +CFV+G Q+FD + ++ V E  K KL
Sbjct  537   NRDRIHLYWIWIHYISLLKYPYEAVLHNEFDDPSRCFVRGNQVFDNTIIEGVSETTKAKL  596

Query  2303  LQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIG  2482
             L+ MS  LG+ +T STCL TG D+LKQ G+  ++KW CLW+T+A GFFFR+LFYF+LL+G
Sbjct  597   LETMSSYLGMELTESTCLRTGSDLLKQHGIEQLDKWGCLWVTLAWGFFFRILFYFSLLLG  656

Query  2483  SKNKR  2497
             SKNKR
Sbjct  657   SKNKR  661



>ref|XP_009139198.1| PREDICTED: ABC transporter G family member 18-like [Brassica 
rapa]
Length=699

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/727 (59%), Positives = 551/727 (76%), Gaps = 31/727 (4%)
 Frame = +2

Query  320   PRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYDPVPYPS  499
             PR A E QE++       S TLGELL  + D  G +  +    A+ H VL L  P   P 
Sbjct  2     PRVAAESQEISLDG-GCESPTLGELLKDLED--GHRKKDSGEDASVHHVLDLASPETRP-  57

Query  500   SFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAV  679
               PF+LSF+NL + VK           G+  +        VK LL+D+SGE  +G+I+AV
Sbjct  58    -VPFLLSFNNLCFDVK-----------GKAAS--------VKTLLNDVSGEVCDGDILAV  97

Query  680   LGASGSGKSTLIDALANRIARESLGGTVKMNGE-VLESKLLKVISAYVMQDDLLFPMLTV  856
             LGASG+GKSTLIDALA R++  SL GTV +NGE +L+S+LLKVISAYVMQDDLLFPMLTV
Sbjct  98    LGASGAGKSTLIDALAGRVS--SLRGTVTLNGEKLLKSQLLKVISAYVMQDDLLFPMLTV  155

Query  857   EETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsi  1036
             +ETLMF++EFRLPRSLS+S+K ARV+ALI QLGL+ AA T+IG+EGHRGVSGGERRRVSI
Sbjct  156   KETLMFASEFRLPRSLSKSKKMARVEALINQLGLRNAADTIIGNEGHRGVSGGERRRVSI  215

Query  1037  giDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRL  1216
             GIDIIHDPIVLFLDEPTSGLDST+AFMVV+VL+RIA+SGS+VIMS+HQPS RI++LLDRL
Sbjct  216   GIDIIHDPIVLFLDEPTSGLDSTNAFMVVQVLKRIARSGSMVIMSIHQPSARIIDLLDRL  275

Query  1217  IFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNK  1396
             I LS+G++VFSGSP+SLP+F  +FG+P+P  EN  EFALD +RELE S +GT+ LV+FN+
Sbjct  276   IILSRGKSVFSGSPTSLPQFLSDFGHPVPGKENITEFALDLVRELEGSTKGTEELVEFNE  335

Query  1397  SWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPF  1576
              WQ+  SP +T       P    SLK++I+ S+SRGKLVSG+T+ N  +S     +AN  
Sbjct  336   KWQQNQSPRATPMTT---PYKALSLKESITTSVSRGKLVSGSTSSNP-ISMETVSYANTP  391

Query  1577  WVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFA  1756
              VE  ++ KR M N  R PEL   R   V+VTG+ILATI+W+LD++P+G QER+ FF+FA
Sbjct  392   LVETYILSKRYMKNWSRTPELIITRLATVLVTGLILATIYWRLDNTPRGAQERIAFFSFA  451

Query  1757  MSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTY  1936
             MST FYTCA+ +PVF+ ERYIF+RET +NAYR  SYV+SH ++SLP L  LS+AFAVTT+
Sbjct  452   MSTMFYTCADNLPVFIHERYIFLRETTHNAYRTYSYVISHVLVSLPQLLALSIAFAVTTF  511

Query  1937  WAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGF  2116
             W VGL+GG   FL++ L ++A+FW+GSSFVTF+SG+I NVMI++ + ++ L+Y +L  GF
Sbjct  512   WTVGLSGGLESFLYYCLIIYAAFWSGSSFVTFISGLIPNVMISFMVTISYLSYCLLMGGF  571

Query  2117  FINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKL  2296
             FINRDRIP YWIWFHY SL+KYP++ VL NEFD P +CFV+G+Q+FDG+    VP+A+K+
Sbjct  572   FINRDRIPGYWIWFHYISLMKYPYEAVLINEFDDPSRCFVRGVQVFDGTLFAKVPDAIKV  631

Query  2297  KLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfall  2476
             K+   +  +LG  I  STCL TGPD+L Q G++ ++KW+CLWIT A G FFR+LFY +LL
Sbjct  632   KMFDTLGNSLGTKIKESTCLRTGPDLLLQQGISQLSKWDCLWITFAWGIFFRILFYLSLL  691

Query  2477  IGSKNKR  2497
              G+KNKR
Sbjct  692   FGNKNKR  698



>ref|XP_006649877.1| PREDICTED: ABC transporter G family member 6-like [Oryza brachyantha]
Length=760

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/679 (61%), Positives = 530/679 (78%), Gaps = 22/679 (3%)
 Frame = +2

Query  509   FVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDV----------KVLLDDISGEAR  658
             FVL+FH+L+Y+V   R++             + VE D           + LLD +SGEAR
Sbjct  89    FVLAFHDLTYNVGRPRRV-------VFRRRSTHVETDATTTRGGGARARALLDGVSGEAR  141

Query  659   EGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLL  838
             EGEIMAVLGASG+GK+TLIDALA+RI R+SL G V +NGE L  + L+VISAYVMQDDLL
Sbjct  142   EGEIMAVLGASGAGKTTLIDALADRIRRDSLRGAVTLNGEALGGRPLQVISAYVMQDDLL  201

Query  839   FPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsgge  1018
             +PMLTV ETLM+SAEFRLPRSLS S+K +RVQALI+QLGL+ AA T+IGDEG RGVSGGE
Sbjct  202   YPMLTVAETLMYSAEFRLPRSLSTSKKASRVQALIDQLGLRAAANTIIGDEGRRGVSGGE  261

Query  1019  rrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRIL  1198
             RRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQ IAQSGS+VIMS+HQPSYRI+
Sbjct  262   RRRVSIGIDIIHDPIILFLDEPTSGLDSTSAFMVVKVLQGIAQSGSVVIMSIHQPSYRII  321

Query  1199  NLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKN  1378
              LLDRL+FLS+G+TV+ G P+ LP FF +FG+PIP+ +N  EFALD +R+LE SP+G   
Sbjct  322   GLLDRLLFLSRGRTVYYGPPAGLPLFFSDFGHPIPDGQNPAEFALDHVRQLESSPKGADE  381

Query  1379  LVDFNKSWQRKFSPSSTSNRNNVFPNPKPS--LKDAISASISRGKLVSGATNINSTLSPS  1552
             LV+F+ SWQ+K    + S       + KPS  LK+AI  SI+RGKLVSG ++  +  + +
Sbjct  382   LVEFSNSWQKKPVARAVSAAARTGHHDKPSLPLKEAIRMSIARGKLVSGTSDSGTAAAST  441

Query  1553  --VPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGI  1726
               V  +ANP+WVE+ V+ +R+  N+ R PELF +R G VVVT  ILAT+FW+LD +PKG+
Sbjct  442   AEVATYANPWWVEVWVLARRAFTNTRRTPELFLIRLGTVVVTAFILATVFWRLDSTPKGV  501

Query  1727  QERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaf  1906
              ER GFFA A+ST FYT A+A+PVFL ERYI++RETA+NAYRRSSYVLS++I+S P L  
Sbjct  502   NERFGFFAIAISTMFYTSADALPVFLIERYIYLRETAHNAYRRSSYVLSNAIVSFPPLVV  561

Query  1907  lslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAI  2086
             LSLAFA+ T++AVGLAGG  GFLFF+L V ASFWAGS FVTFLSG++ +V+I YT+VV +
Sbjct  562   LSLAFALITFFAVGLAGGAGGFLFFVLIVLASFWAGSGFVTFLSGVVRHVIIGYTVVVGL  621

Query  2087  LAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEF-DYPDKCFVKGIQIFDGS  2263
             LAYF+L SGFF+ RDRIP YW W HY SL+KYP++ V+QNEF   P +CF++G+Q+FDG+
Sbjct  622   LAYFLLLSGFFVTRDRIPSYWTWLHYLSLIKYPYEAVMQNEFGGEPGRCFMRGVQMFDGT  681

Query  2264  PLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgf  2443
             P+ A+P   K+ +L  MS+++G++  SS+C+TTGPDIL +  V ++ KW+CLW+T+A GF
Sbjct  682   PIGALPAETKVSVLNAMSRSMGVDFNSSSCITTGPDILARQAVAELGKWSCLWVTVAWGF  741

Query  2444  ffrllfyfallIGSKNKRR  2500
              FR LFY  L++GS+N+RR
Sbjct  742   LFRALFYLTLVVGSRNRRR  760



>gb|EAY89510.1| hypothetical protein OsI_11045 [Oryza sativa Indica Group]
Length=765

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/688 (60%), Positives = 528/688 (77%), Gaps = 31/688 (5%)
 Frame = +2

Query  509   FVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDV-------------KVLLDDISG  649
             FVL+FH+L+Y+V   R+M    W  RR+     VE D               +LLD +SG
Sbjct  85    FVLAFHDLTYNVGRPRRMAF--W--RRS---RHVETDATTARGGAARAREGALLLDGVSG  137

Query  650   EAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQD  829
             EAREGEIMAVLGASG+GK+TLIDALA+RI R+SL G V +NGE L  ++LKVISAYVMQD
Sbjct  138   EAREGEIMAVLGASGAGKTTLIDALADRIQRDSLRGAVTLNGEPLGGRMLKVISAYVMQD  197

Query  830   DLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvs  1009
             DLL+PMLTV ETLM+SAEFRLPRSLS S+K  RVQ LI+QLGL+ AA T+IGDEG RGVS
Sbjct  198   DLLYPMLTVAETLMYSAEFRLPRSLSASKKATRVQELIDQLGLRAAANTIIGDEGRRGVS  257

Query  1010  ggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSY  1189
             GGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQ IA+SGS+VIMS+HQPSY
Sbjct  258   GGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAFMVVKVLQGIAKSGSVVIMSIHQPSY  317

Query  1190  RILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEG  1369
             RI+ L+DRL+FLS+G+TV+ G P+SLP FF EFG+PIP+ +N  EFALD +R+LE  PEG
Sbjct  318   RIIGLIDRLMFLSRGRTVYYGPPASLPLFFSEFGHPIPDGQNPVEFALDHVRQLEAIPEG  377

Query  1370  TKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPS--LKDAISASISRGKLVSGATNINS--  1537
             T  LV+F+K+W+ K    + S+      + KPS  LK+AI  SI+RGKLVSGAT      
Sbjct  378   TDELVEFSKAWREKALARAVSSAACTGRHDKPSLPLKEAIRMSIARGKLVSGATTSTGDN  437

Query  1538  ------TLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFW  1699
                     +  V  +ANP+W E+ V+ +R+  N+ R PELF +R   VVVT  ILAT+FW
Sbjct  438   GTAAAAASTAKVATYANPWWAEVWVLARRAFTNTRRTPELFLIRLATVVVTAFILATVFW  497

Query  1700  KLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHs  1879
             +LD++PKG+ ER GFFA A+ST FYT A+A+PVFL ERYI++RETA+NAYRRSSY +S++
Sbjct  498   RLDNTPKGVNERFGFFAIAVSTMFYTSADALPVFLVERYIYLRETAHNAYRRSSYTVSNA  557

Query  1880  iislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVM  2059
             I++ P L  LSLAF   T++AVGLAGG  GFLFF L V ASFWAGS FVTFLSG++ +V+
Sbjct  558   IVAFPPLVALSLAFTAITFFAVGLAGGAGGFLFFALIVLASFWAGSGFVTFLSGVVPHVI  617

Query  2060  IAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDY-PDKCFV  2236
             I YT+VVA LAYF+L SGFFI RDRIP YWIW HY SL+KYP++ V+QNEF     +CF+
Sbjct  618   IGYTVVVAGLAYFLLLSGFFITRDRIPSYWIWLHYLSLIKYPYEAVMQNEFGAEAGRCFM  677

Query  2237  KGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNC  2416
             +G+Q+FDG+P+  +P   K+++L+ MS+++G+ + S +C+TTGPDIL +  VT++ KW+C
Sbjct  678   RGVQMFDGTPMARLPVETKVRVLEAMSRSMGLELNSGSCITTGPDILARQAVTELGKWSC  737

Query  2417  LWITIAlgfffrllfyfallIGSKNKRR  2500
             LW+T+A GF FR LFY  L++GS+N+RR
Sbjct  738   LWVTVAWGFLFRALFYLTLVLGSRNRRR  765



>gb|AAN64479.1| putative ATP-binding-cassette transporter protein [Oryza sativa 
Japonica Group]
 gb|ABF95318.1| ABC transporter family protein, putative [Oryza sativa Japonica 
Group]
Length=765

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/688 (60%), Positives = 529/688 (77%), Gaps = 31/688 (5%)
 Frame = +2

Query  509   FVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDV-------------KVLLDDISG  649
             FVL+FH+L+Y+V   R+M    W  RR+     VE D               +LLD +SG
Sbjct  85    FVLAFHDLTYNVGRPRRMAF--W--RRS---RHVETDATTARGGGARAREGALLLDGVSG  137

Query  650   EAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQD  829
             EAREGEIMAVLGASG+GK+TLIDALA+RI R+SL G V +NGE L  ++LKVISAYVMQD
Sbjct  138   EAREGEIMAVLGASGAGKTTLIDALADRIQRDSLRGAVTLNGEPLGGRMLKVISAYVMQD  197

Query  830   DLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvs  1009
             DLL+PMLTV ETLM+SAEFRLPRSLS S+K  RVQ LI+QLGL+ AA T+IGDEG RGVS
Sbjct  198   DLLYPMLTVAETLMYSAEFRLPRSLSASKKATRVQELIDQLGLRAAANTIIGDEGRRGVS  257

Query  1010  ggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSY  1189
             GGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTSAFMVVKVLQ IA+SGS+VIMS+HQPSY
Sbjct  258   GGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAFMVVKVLQGIAKSGSVVIMSIHQPSY  317

Query  1190  RILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEG  1369
             RI+ L+DRL+FLS+G+TV+ G P+SLP FF EFG+PIP+ +N  EFALD +R+LE  PEG
Sbjct  318   RIIGLIDRLMFLSRGRTVYYGPPASLPLFFSEFGHPIPDGQNPVEFALDHVRQLEAIPEG  377

Query  1370  TKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPS--LKDAISASISRGKLVSGATN-----  1528
             T  LV+F+K+W+ K    + S+      + KPS  LK+AI  SI+RGKLVSGAT      
Sbjct  378   TDELVEFSKAWREKALARAVSSAACTGRHDKPSLPLKEAIRMSIARGKLVSGATTSTGDN  437

Query  1529  ---INSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFW  1699
                  +  +  V  +ANP+W E+ V+ +R+  N+ R PELF +R   VVVT  ILAT+FW
Sbjct  438   GTAAAAASTAKVATYANPWWAEVWVLARRAFTNTRRTPELFLIRLATVVVTAFILATVFW  497

Query  1700  KLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHs  1879
             +LD++PKG+ ER GFFA A+ST FYT A+A+PVFL ERYI++RETA+NAYRRSSY +S++
Sbjct  498   RLDNTPKGVNERFGFFAIAVSTMFYTSADALPVFLVERYIYLRETAHNAYRRSSYTVSNA  557

Query  1880  iislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVM  2059
             I++ P L  LSLAF   T++AVGLAGG  GFLFF L V ASFWAGS FVTFLSG++ +V+
Sbjct  558   IVAFPPLVALSLAFTAITFFAVGLAGGAGGFLFFALIVLASFWAGSGFVTFLSGVVPHVI  617

Query  2060  IAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDY-PDKCFV  2236
             I YT+VVA LAYF+L SGFFI RDRIP YWIW HY SL+KYP++ V+QNEF     +CF+
Sbjct  618   IGYTVVVAGLAYFLLLSGFFITRDRIPSYWIWLHYLSLIKYPYEAVMQNEFGAEAGRCFM  677

Query  2237  KGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNC  2416
             +G+Q+FDG+P+  +P   K+++L+ MS+++G+ + S +C+TTGPDIL +  VT++ KW+C
Sbjct  678   RGVQMFDGTPMARLPVETKVRVLEAMSRSMGLELNSGSCITTGPDILARQAVTELGKWSC  737

Query  2417  LWITIAlgfffrllfyfallIGSKNKRR  2500
             LW+T+A GF FR LFY  L++GS+N+RR
Sbjct  738   LWVTVAWGFLFRALFYLTLVLGSRNRRR  765



>ref|XP_004960311.1| PREDICTED: ABC transporter G family member 16-like [Setaria italica]
Length=694

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/676 (64%), Positives = 534/676 (79%), Gaps = 21/676 (3%)
 Frame = +2

Query  506   PFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQ-----------VENDVKVLLDDISGE  652
             P+VL+F +LSYSVK   K G    LG   + PS               + K LLD ISGE
Sbjct  29    PYVLNFTDLSYSVK---KGG--GLLGCLPSRPSNRLASADAPPAAPAGNTKTLLDGISGE  83

Query  653   AREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDD  832
             A  GE+ AV+GASGSGKSTL+DALA RIARESL G+V +NGE L+ + L+ ISAYVMQDD
Sbjct  84    ACAGELFAVMGASGSGKSTLVDALAGRIARESLHGSVTLNGEPLQGRRLRAISAYVMQDD  143

Query  833   LLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsg  1012
             LL+PMLTV ETL F+AEFRLPR+LS+ +K+ARV ALI+QLGL  AA T+IGDEGHRGVSG
Sbjct  144   LLYPMLTVRETLHFAAEFRLPRALSQEKKRARVDALIDQLGLTRAADTIIGDEGHRGVSG  203

Query  1013  gerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYR  1192
             GERRRVSIG DIIHDPI+LFLDEPTSGLDS SAFMVV+VL+RIAQSGS+VIM++HQPS R
Sbjct  204   GERRRVSIGTDIIHDPILLFLDEPTSGLDSASAFMVVQVLRRIAQSGSVVIMTIHQPSAR  263

Query  1193  ILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGT  1372
             IL +LDRL+ LS+G+TV++G+P+ L  FF EFG PIP+NEN  EFALD IRE E+ P+G 
Sbjct  264   ILGILDRLLLLSRGRTVYAGTPAGLKPFFAEFGAPIPDNENPAEFALDTIREYERQPDGA  323

Query  1373  KNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPS  1552
               L DFN  WQ      S++++++   +  P L+ AI+ S+SRGKLV+  +   S +S +
Sbjct  324   AALADFNAKWQNN---GSSTDKDSKLMSTMP-LELAIAESVSRGKLVA-GSGSGSAVSGT  378

Query  1553  VPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQE  1732
             VP FANP W E+ V+ KRS  N+ RMPELFAMR G ++VTG ILATIFW+LDD+PKG+QE
Sbjct  379   VPTFANPPWTEVWVLIKRSFTNTARMPELFAMRLGTIMVTGFILATIFWRLDDTPKGVQE  438

Query  1733  RLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslafls  1912
             RLGFFA AMST FY CA+A+PVF+QER+I++RETA+NAYRR SYVL+++ ++ P L  LS
Sbjct  439   RLGFFAMAMSTMFYVCADALPVFVQERHIYLRETAHNAYRRISYVLANAAVAFPPLVLLS  498

Query  1913  lafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILA  2092
             LAFAVTT+WAVGLAGG S FLFF+L + ASFWAGS FVTFLS ++ +VM+ YT+VVAILA
Sbjct  499   LAFAVTTFWAVGLAGGASSFLFFVLIILASFWAGSGFVTFLSAVVPHVMLGYTVVVAILA  558

Query  2093  YFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLK  2272
             YF+LFSGFFINRDRIP YWIWFHY SLVKYP+Q VLQNEF    +CF +GI++FDG+P+ 
Sbjct  559   YFLLFSGFFINRDRIPDYWIWFHYLSLVKYPYQAVLQNEFRDASRCFSRGIEMFDGTPVG  618

Query  2273  AVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffr  2452
              + EA+KLK+L  +SKTLG N+T+STC+TTG D+L Q  VTDI+KW CL +T+A GFFFR
Sbjct  619   RMSEAVKLKVLDAISKTLGSNMTASTCVTTGADVLVQQAVTDISKWKCLLVTVAWGFFFR  678

Query  2453  llfyfallIGSKNKRR  2500
              LFY  LL+GSKNKR+
Sbjct  679   ALFYVVLLVGSKNKRK  694



>gb|KDO47516.1| hypothetical protein CISIN_1g048028mg [Citrus sinensis]
Length=592

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/611 (67%), Positives = 493/611 (81%), Gaps = 20/611 (3%)
 Frame = +2

Query  671   MAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPML  850
             MA+LGASG+GK+TL+DALA RI +ESL G V +NGEVLESKLLK+ISAYVMQDDLLFPML
Sbjct  1     MAILGASGAGKTTLMDALAGRIEKESLQGAVTLNGEVLESKLLKIISAYVMQDDLLFPML  60

Query  851   TVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrv  1030
             TVEETLMF+AEFRLPRS+++++K+ RV+ALI QLGL++AAKT IGDE HRGVSGGERRRV
Sbjct  61    TVEETLMFAAEFRLPRSVTKTKKQERVEALINQLGLRSAAKTFIGDERHRGVSGGERRRV  120

Query  1031  sigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLD  1210
             SIGI IIHDPI+LFLDEPTSGLDSTSAFMVV VLQRIA+SGSIVIMS+HQPSYRIL+LLD
Sbjct  121   SIGIHIIHDPILLFLDEPTSGLDSTSAFMVVNVLQRIAKSGSIVIMSIHQPSYRILSLLD  180

Query  1211  RLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSP-EGTKNLVD  1387
             RLI LS GQ+V++ +PS+L +FF EFG+P+PENEN+ EFALD +RELE+S  +G  +LV+
Sbjct  181   RLIILSHGQSVYNETPSNLAQFFAEFGHPVPENENKIEFALDLMRELEESSSDGITSLVE  240

Query  1388  FNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFA  1567
             FN+SWQ        S +   F    PS         S G          S L+ SV  FA
Sbjct  241   FNESWQVTKRMEIKSRKTPTFHLKMPS---------SDG----------SNLTSSVQTFA  281

Query  1568  NPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFF  1747
             NPFW+E +VI KR + NS RMPELF +RFG+V+VTG ILAT+FWKL DSPKG  +RLGFF
Sbjct  282   NPFWIETIVISKRLLTNSRRMPELFGIRFGSVLVTGFILATLFWKLQDSPKGALKRLGFF  341

Query  1748  AFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaV  1927
             AFAM+T FY CA  IP  LQER IF+RET+YN YR SSYV +HS++S+P +  LS+ FAV
Sbjct  342   AFAMTTIFYICAREIPALLQERDIFIRETSYNTYRHSSYVFAHSLVSMPPITTLSITFAV  401

Query  1928  TTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLF  2107
             TT+WAVGL+GGFSGFLFF + +FASFWAGSSF+ F++G++ +++I +T+VVAIL YF+LF
Sbjct  402   TTFWAVGLSGGFSGFLFFFITIFASFWAGSSFMAFIAGLVSHIIIGFTIVVAILGYFLLF  461

Query  2108  SGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEA  2287
              GF+I RD IPPYWIWFHY SLVKYPFQGVLQNEF  P KCFV G+Q+FD +P + +P  
Sbjct  462   CGFYIPRDEIPPYWIWFHYVSLVKYPFQGVLQNEFGDPSKCFVSGVQVFDDTPFEGLPFD  521

Query  2288  MKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyf  2467
              K+KLL+NMS  LG NITSSTC+TTG  +L+Q GVTDI+KW C WIT+A GF FR+LFYF
Sbjct  522   TKIKLLENMSNVLGNNITSSTCVTTGMKLLEQKGVTDISKWKCFWITVAFGFLFRVLFYF  581

Query  2468  allIGSKNKRR  2500
              LL GSKNKRR
Sbjct  582   TLLFGSKNKRR  592



>ref|XP_006651261.1| PREDICTED: ABC transporter G family member 16-like [Oryza brachyantha]
Length=836

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/727 (60%), Positives = 545/727 (75%), Gaps = 22/727 (3%)
 Frame = +2

Query  362   RHSVSMTLGELLHRVGDS--------AGEKLNNGVGGANDHRV------LQLYDPVPYPS  499
             +HS S+TL +LL RV D+        +  +    +GG+    V          D      
Sbjct  57    KHS-SVTLAQLLKRVNDARSGSSTPISSPRYTIELGGSKRESVSSESEDRHSDDGGSEGP  115

Query  500   SFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAV  679
               PFVL F +L+Y VK R+K     +  RR  A  ++   +K LLD ISGEAR+GEIMAV
Sbjct  116   PLPFVLKFTDLTYRVKQRKKGSCLPF--RRAEAEPELPA-MKTLLDGISGEARDGEIMAV  172

Query  680   LGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVE  859
             LGASGSGKSTLIDALANRIA+ESL G+V +NG+ +ES LLKVIS    Q+ LL+PMLTVE
Sbjct  173   LGASGSGKSTLIDALANRIAKESLHGSVTLNGDSVESNLLKVISPSSRQEALLYPMLTVE  232

Query  860   ETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsig  1039
             ETLMF+AEFRLPRSL    KK RV+ALI QLGL  AA T+IGDEGHRGVSGGERRRVSIG
Sbjct  233   ETLMFAAEFRLPRSLPTREKKKRVKALINQLGLDRAANTIIGDEGHRGVSGGERRRVSIG  292

Query  1040  iDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLI  1219
             +DIIHDPIVLFLDEPTSGLDSTSAFMVV+VL+ IAQSGS+VIMS+HQPSYRIL LLDRL+
Sbjct  293   VDIIHDPIVLFLDEPTSGLDSTSAFMVVRVLKSIAQSGSVVIMSIHQPSYRILGLLDRLL  352

Query  1220  FLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKS  1399
             FLS+G+TV+ G PS LP FF +FG+PIP+NEN  EFALD I+E+E   EGTK L D N +
Sbjct  353   FLSRGKTVYYGPPSQLPPFFIDFGHPIPDNENPTEFALDLIKEMETQTEGTKRLADHNTA  412

Query  1400  WQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFW  1579
             WQ+  + +                     A+      VS A++ +S   PSV KF NPFW
Sbjct  413   WQKHHAMAGGPIPPPXXXXXXXXXXXXXXAT---DGTVSVASD-HSARPPSVSKFVNPFW  468

Query  1580  VEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAM  1759
             +EM V+ +R+ +N+ R PE+F +R  AV+VTG ILATIFW+LD+SPKG+QERLGFFA AM
Sbjct  469   IEMGVLTRRAFINTKRTPEVFIIRLAAVLVTGFILATIFWRLDESPKGVQERLGFFAIAM  528

Query  1760  STTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYW  1939
             ST +YTC++A+PVFL ERYIF+RETAYNAYRRSSYVLSH+I+  PSL  LS AFA+TT++
Sbjct  529   STMYYTCSDALPVFLSERYIFLRETAYNAYRRSSYVLSHTIVGFPSLVVLSFAFALTTFF  588

Query  1940  AvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFF  2119
             +VGLAGG  GF FF+  V ASFWAGS F TFLSG++ +VM+ + +V++ LAYF+LFSGFF
Sbjct  589   SVGLAGGVDGFFFFVAIVLASFWAGSGFATFLSGVVTHVMLGFPVVLSTLAYFLLFSGFF  648

Query  2120  INRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLK  2299
             INRDRIP YW+WFHY SLVKYP++ V+QNEF  P +CFV+G+Q+FD +PL A+P A+K++
Sbjct  649   INRDRIPRYWLWFHYISLVKYPYEAVMQNEFGDPTRCFVRGVQMFDNTPLAALPGAVKVR  708

Query  2300  LLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallI  2479
             +LQ+MS +LG++I + TC+TTGPD LKQ  +TD  KW CLWIT+A GF FR+LFY +LL+
Sbjct  709   VLQSMSSSLGVDIGTGTCITTGPDFLKQQAITDFGKWECLWITVAWGFLFRILFYISLLL  768

Query  2480  GSKNKRR  2500
             GS+NKRR
Sbjct  769   GSRNKRR  775



>ref|XP_002440493.1| hypothetical protein SORBIDRAFT_09g001900 [Sorghum bicolor]
 gb|EES18923.1| hypothetical protein SORBIDRAFT_09g001900 [Sorghum bicolor]
Length=714

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/682 (63%), Positives = 525/682 (77%), Gaps = 22/682 (3%)
 Frame = +2

Query  506   PFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDV----------KVLLDDISGEA  655
             P+VL F +LSYSVK R        L  R  +      D           K LLD ISGEA
Sbjct  38    PYVLRFTDLSYSVKKRGGGLGLGCLPTRRPSNRLASLDAPTTTTTTTNTKTLLDGISGEA  97

Query  656   REGEIMAVLGASGSGKSTLIDALANRIARESL-GGTVKMNGEVLESKLLKVISAYVMQDD  832
             REGE+ AV+GASGSGKSTL+DALA RIAR+SL GG   +NGE L  + L+ ISAYVMQDD
Sbjct  98    REGELFAVMGASGSGKSTLVDALAGRIARDSLRGGGATLNGEPLHGRRLRAISAYVMQDD  157

Query  833   LLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsg  1012
             LL+PMLTV ETL+F+AEFRLPR+L   RK+ARV AL++QLGL  AA T+IGDEGHRGVSG
Sbjct  158   LLYPMLTVRETLLFAAEFRLPRALPADRKRARVDALVDQLGLARAADTIIGDEGHRGVSG  217

Query  1013  gerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYR  1192
             GERRRVSIG DI+HDPIVLFLDEPTSGLDS SAFMVV+VL+RIAQSGS+VIM++HQPS R
Sbjct  218   GERRRVSIGTDIVHDPIVLFLDEPTSGLDSASAFMVVQVLRRIAQSGSVVIMTIHQPSAR  277

Query  1193  ILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGT  1372
             IL +LDRL+ LS+G+TV++G+P+ L  FF EFG PIP+NEN  EFALD IRE E+SP+G 
Sbjct  278   ILGILDRLLLLSRGRTVYAGTPAGLKPFFSEFGTPIPDNENPAEFALDTIREYERSPDGA  337

Query  1373  KNLVDFNKSWQRKFSPSSTS------NRNNVFPNPKPSLKDAISASISRGKLVSGATNIN  1534
               L DFN  WQ   S SS +      N N + P     L+ AI+ S+SRGKLV+G+    
Sbjct  338   APLADFNVKWQHGSSASSGAGVDKDNNNNKLMP-----LELAIAESVSRGKLVAGSGGTG  392

Query  1535  STLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDS  1714
                + +VP FANP W E+ V+ KRS  N+ RMPELF MR G ++VTG ILATIFW+LDD+
Sbjct  393   GGSAVTVPTFANPPWTEVWVLIKRSFTNTGRMPELFVMRLGTIMVTGFILATIFWRLDDT  452

Query  1715  PKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislp  1894
             PKG+QERLGFFA  MST FY CA+A+PVF+QER+I++RETA+NAYRR SYVL++++++ P
Sbjct  453   PKGVQERLGFFAMGMSTMFYVCADALPVFVQERHIYLRETAHNAYRRISYVLANAVVAFP  512

Query  1895  slaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTL  2074
              L FLSLAFAVTT+WAVGLAGG   FLFF+L + ASFWAGS FVTFLS ++ +VM+ YT+
Sbjct  513   PLVFLSLAFAVTTFWAVGLAGGAPSFLFFVLIILASFWAGSGFVTFLSAVVPHVMLGYTV  572

Query  2075  VVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIF  2254
             VVAILAYF+LFSGFFINRDRIP YWIWFHY SLVKYP+Q VLQNEF    +CF +G+Q+F
Sbjct  573   VVAILAYFLLFSGFFINRDRIPDYWIWFHYLSLVKYPYQAVLQNEFSDASRCFSRGVQMF  632

Query  2255  DGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIA  2434
             DG+P+  + E +KLK+L+ +S+TLG N+T++TC+TTG D+L    VTDI KW CL +T+A
Sbjct  633   DGTPIGHMAEGVKLKVLEAISRTLGTNMTATTCVTTGADVLASQAVTDIGKWKCLLVTVA  692

Query  2435  lgfffrllfyfallIGSKNKRR  2500
              GFFFR LFY  LL+GSKNKR+
Sbjct  693   WGFFFRALFYVVLLVGSKNKRK  714



>ref|XP_010096686.1| ABC transporter G family member 6 [Morus notabilis]
 gb|EXB65354.1| ABC transporter G family member 6 [Morus notabilis]
Length=689

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/693 (61%), Positives = 538/693 (78%), Gaps = 21/693 (3%)
 Frame = +2

Query  437   GVG-GANDHRVLQLYDPVPYP-SSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQV  610
             G G G ++H VL + +    P     F+L F+NL+YSVKVR K    + + RRTA P + 
Sbjct  13    GAGVGTSEHHVLNVDERSQKPIKPLSFLLCFNNLTYSVKVRPKFTFSSLIARRTAEPEK-  71

Query  611   ENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLES  790
                 + +L+ ISGEAR+GEI+A+LGASGSGK+TL+DALANRI +ESL GTV +NGEVLES
Sbjct  72    ----RTILNSISGEARDGEILAILGASGSGKTTLLDALANRIEKESLKGTVSLNGEVLES  127

Query  791   KLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAA  970
             +L K I AYVMQDDLLFPMLTVEETL F+AEFRLPR+L  S+KKARVQ LI+QLGL++AA
Sbjct  128   RLWKAIVAYVMQDDLLFPMLTVEETLGFAAEFRLPRTLEESKKKARVQDLIDQLGLRSAA  187

Query  971   KTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQS  1150
             KT+IGDEG RGVSGGERRRVSIGIDIIH PI+LFLDEPTSGLDSTSAF VV VL+ IA+ 
Sbjct  188   KTIIGDEGRRGVSGGERRRVSIGIDIIHGPILLFLDEPTSGLDSTSAFTVVNVLKNIARG  247

Query  1151  GSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFA  1330
             GS+V+MSVHQPSYRI+ LLD+LIFLSKGQ V+ GSP +LP F  +FG PIP+N N  EF 
Sbjct  248   GSVVVMSVHQPSYRIIGLLDKLIFLSKGQVVYRGSPINLPLFCSKFGRPIPDNANPVEFM  307

Query  1331  LDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKL  1510
             LD I ELE S  G   LVD N +   K S  + + +++V      SL +A++  IS+GKL
Sbjct  308   LDLISELEDSTNGISTLVDLNNT--GKSSERADAEKSDVV----SSLTEALNLGISKGKL  361

Query  1511  VSGATNINSTLSPSVPK-FANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILA  1687
             VS   NIN++   +V K FANPFW EM+V+ KRSM NS R PE+FA R   ++ TG +LA
Sbjct  362   VS--DNINTS---NVKKTFANPFWTEMLVLYKRSMTNSRRTPEIFAARLITILTTGFLLA  416

Query  1688  TIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYV  1867
             TI+W+LDDSPKGI+ERLGFFAFA+S+T+++  + +PVFLQER+IFMRETAYNAYRRSSYV
Sbjct  417   TIYWQLDDSPKGIRERLGFFAFAISSTYFSSCQYLPVFLQERFIFMRETAYNAYRRSSYV  476

Query  1868  LSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGII  2047
             LSH+   L  L  LSLAF++TT+WAVGL GG SGFLF+ L ++ASFWAG+SF  F+SG++
Sbjct  477   LSHAFAVLLPLFILSLAFSMTTFWAVGLTGGISGFLFYFLIIYASFWAGNSFAVFVSGLV  536

Query  2048  YNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDK  2227
              ++++ YT+V+A+ AYF+L SGFFINR+RIPPYWIWFHY SL+KYP++ ++++EFD P K
Sbjct  537   PHILLGYTVVIAVSAYFLLLSGFFINRNRIPPYWIWFHYVSLIKYPYEALMRSEFDDPTK  596

Query  2228  CFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGI--NITSSTCLTTGPDILKQTGVTDI  2401
             CF +G ++FD +P + +    K ++L ++S + G   N+TSSTCLTTG D+LK+ G+TD+
Sbjct  597   CFRRGSEMFDDTPFRNISGDTKERMLGSLSASSGTNYNVTSSTCLTTGLDVLKEQGITDL  656

Query  2402  NKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             NKW  L I +A GFF+R LFY +LL+GSKNKR+
Sbjct  657   NKWMYLLIIVAWGFFYRFLFYLSLLLGSKNKRK  689



>ref|XP_010516068.1| PREDICTED: ABC transporter G family member 19-like isoform X2 
[Camelina sativa]
Length=712

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/667 (62%), Positives = 523/667 (78%), Gaps = 15/667 (2%)
 Frame = +2

Query  506   PFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLG  685
             PFVL+F+NL Y V + R+ G      RR+         VK LLDD+SGEA +G+I+AVLG
Sbjct  57    PFVLAFNNLEYDVILGRRFG----FSRRSG--------VKTLLDDVSGEACDGDILAVLG  104

Query  686   ASGSGKSTLIDALANRIARESLGGTVKMNGE-VLESKLLKVISAYVMQDDLLFPMLTVEE  862
             ASG+GKSTLIDALA R+A+ SL G+V +NGE VL+++LLKVISAYVMQ+DLLFPMLTV+E
Sbjct  105   ASGAGKSTLIDALAGRVAQGSLKGSVTLNGEKVLQTRLLKVISAYVMQEDLLFPMLTVKE  164

Query  863   TLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigi  1042
             TLMF++EFRLPRSLS+S+K  RV+ALI+QLGL+ AA TVIGDEGHRGVSGGERRRVSIGI
Sbjct  165   TLMFASEFRLPRSLSKSKKMERVEALIDQLGLRNAANTVIGDEGHRGVSGGERRRVSIGI  224

Query  1043  DIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIF  1222
             DIIHDPIVLFLDEPTSGLDST+AFMVV+VL+RIAQSGSIVIMS+HQPS RI+ LLDRLI 
Sbjct  225   DIIHDPIVLFLDEPTSGLDSTNAFMVVQVLKRIAQSGSIVIMSIHQPSARIVELLDRLII  284

Query  1223  LSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSW  1402
             LS+G++VF+GSP+SLP FF +FG PIPE EN  EFALD +RELE S E T++LVDFN+ W
Sbjct  285   LSRGKSVFNGSPASLPGFFADFGRPIPEKENITEFALDLVRELEGSTERTRSLVDFNEKW  344

Query  1403  QR-KFSPSSTSNRNNVFPNPKP-SLKDAISASISRGKLVSGATNINSTLSPSVPKFANPF  1576
             Q+ K S S ++   N+F    P +LK+AI+AS+SRGKLVSG++        +V  +ANP 
Sbjct  345   QQNKLSFSQSAPHTNMFELDSPLTLKEAINASVSRGKLVSGSSRGTLVSMETVSSYANPS  404

Query  1577  WVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFA  1756
               E  ++ KR M N +RMPEL   R  +V+VTG +LAT++WKLD +P+G QERL  FAF 
Sbjct  405   LFETFILAKRYMKNWMRMPELVGTRIASVMVTGFLLATVYWKLDHTPRGAQERLTLFAFV  464

Query  1757  MSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTY  1936
             + T FY C + +PVF+QERYIF+RET +NAYR SSYV+SHS++SLP L   SL F+  T+
Sbjct  465   VPTMFYCCLDNVPVFIQERYIFLRETTHNAYRTSSYVISHSLVSLPQLIAPSLVFSTITF  524

Query  1937  WAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGF  2116
             W VGL+GG  GF F+ L ++ASFW+GSS VTF+SG++ N+M++Y + ++ LAY +L SGF
Sbjct  525   WTVGLSGGLEGFYFYCLLIYASFWSGSSVVTFISGVVPNIMLSYMVAISYLAYCLLLSGF  584

Query  2117  FINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKL  2296
             ++NRDRIP YW WFHY SL+KYP++ VL NEFD P +CFVKG+Q+FD + L  V  + K+
Sbjct  585   YVNRDRIPVYWTWFHYISLLKYPYEAVLINEFDDPSRCFVKGVQVFDSTLLGGVSASGKV  644

Query  2297  KLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfall  2476
             KLL+ +  +L   IT STCL TG D+L Q G+T+++KW CLWIT A G FFR+LFYFALL
Sbjct  645   KLLETLGNSLKTRITESTCLRTGSDLLAQQGITELSKWECLWITFASGLFFRILFYFALL  704

Query  2477  IGSKNKR  2497
              GS+NKR
Sbjct  705   FGSRNKR  711



>ref|XP_006403492.1| hypothetical protein EUTSA_v10010176mg [Eutrema salsugineum]
 gb|ESQ44945.1| hypothetical protein EUTSA_v10010176mg [Eutrema salsugineum]
Length=662

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/671 (61%), Positives = 524/671 (78%), Gaps = 23/671 (3%)
 Frame = +2

Query  488   PYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGE  667
             P     PF+L+F +L Y+V V R+ G+         +P+QV    K LL+ I+GEA EGE
Sbjct  13    PETRPVPFILAFKDLIYNVTVHRRFGL-----HFGHSPAQV----KTLLNGITGEANEGE  63

Query  668   IMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPM  847
             I+AVLGASG+GKSTLIDALA RIA  SL GTV +N E L+S++LKVISAYVMQDDLLFPM
Sbjct  64    ILAVLGASGAGKSTLIDALAGRIAEGSLKGTVTLNREPLQSRMLKVISAYVMQDDLLFPM  123

Query  848   LTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrr  1027
             LTVEETLMF+AEFRLPRSL++S+K+ RV+ LI+QLGL+T   T+IGDEGHRG+SGGE+RR
Sbjct  124   LTVEETLMFAAEFRLPRSLTKSKKRERVETLIDQLGLRTVRNTLIGDEGHRGISGGEKRR  183

Query  1028  vsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLL  1207
             VSIG DIIHDPIVLFLDEPTSGLDST+AFMVV+VL+ IA SGSIVIMS+HQPS RI+  L
Sbjct  184   VSIGTDIIHDPIVLFLDEPTSGLDSTNAFMVVQVLKSIASSGSIVIMSIHQPSCRIMEFL  243

Query  1208  DRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVD  1387
             DR+I LS GQ+VFS SP++LP FF EFG PIP  EN  EF LD I+ELE S +GT+ LV+
Sbjct  244   DRIIVLSSGQSVFSDSPATLPFFFLEFGRPIPYKENNAEFTLDLIKELEGSSQGTRGLVE  303

Query  1388  FNKSWQ-RKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKF  1564
             FN++WQ +K   S   +RN+       SLK+AI+ASISRGKLVS       T   S+P +
Sbjct  304   FNRNWQQKKLRVSQEPHRNS------SSLKEAINASISRGKLVS-------TSYSSIPSY  350

Query  1565  ANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGF  1744
              NP+W+E +++ KR M+N  R PEL   R   V++TG +LAT++WK+D+SP+G+QERL F
Sbjct  351   VNPWWIETILLAKRYMINWTRTPELIGTRVFIVMMTGFLLATVYWKVDNSPRGVQERLSF  410

Query  1745  FAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafa  1924
             F+FAM+T FY+CA+ +P F+QERYIF+RETA+NAYRRSSYV+SHS+++LP L  LS+ FA
Sbjct  411   FSFAMATMFYSCADGLPAFIQERYIFLRETAHNAYRRSSYVISHSLVTLPHLFALSIGFA  470

Query  1925  VTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVL  2104
              TT+W VGL GG +GF+++LL +FASFW+G SFVTF+SG+I NVM++Y +    L+Y +L
Sbjct  471   ATTFWFVGLNGGVAGFIYYLLIIFASFWSGCSFVTFVSGVIPNVMMSYMVTFGYLSYCLL  530

Query  2105  FSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPE  2284
             FSGF+INRDRI PYWIW HY SL+KYP++ VL NEFD P +CFV+G Q+FDG+ ++ V  
Sbjct  531   FSGFYINRDRIHPYWIWIHYISLLKYPYEAVLHNEFDDPSRCFVRGNQVFDGTLMEGVSA  590

Query  2285  AMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfy  2464
               K K+L+ MS  LG+ +T S CL TG ++LKQ G+  ++KW CLW+T+A GFFFR+LFY
Sbjct  591   TTKEKILETMSSYLGMELTESRCLRTGSELLKQQGIQQLDKWGCLWVTLAWGFFFRILFY  650

Query  2465  fallIGSKNKR  2497
             F+LL+GSKNKR
Sbjct  651   FSLLLGSKNKR  661



>ref|XP_010427269.1| PREDICTED: ABC transporter G family member 19-like isoform X1 
[Camelina sativa]
Length=713

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/718 (59%), Positives = 536/718 (75%), Gaps = 29/718 (4%)
 Frame = +2

Query  374   SMTLGELLH-----RVGDSA-GEKLNNGVGGANDHRVLQLYDPVPYPSSFPFVLSFHNLS  535
             S TL ELL      R GDS   EK ++      D   L L  PVP      FVL+F+NL 
Sbjct  14    SPTLDELLKDCDSFRKGDSPDSEKSDDPAHHVIDVEALHL-KPVP------FVLAFNNLE  66

Query  536   YSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLI  715
             Y V + R+ G      RR+         VK LLDD+SGEA +G+I+AVLGASG+GKSTLI
Sbjct  67    YDVILGRRFG----FSRRSG--------VKTLLDDVSGEACDGDILAVLGASGAGKSTLI  114

Query  716   DALANRIARESLGGTVKMNGE-VLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrl  892
             DALA R+A+ SL G+V +NGE VL+++LLKVISAYVMQDDLLFPMLTV+ETLMF++EFRL
Sbjct  115   DALAGRVAQGSLKGSVTLNGEKVLQTRLLKVISAYVMQDDLLFPMLTVKETLMFASEFRL  174

Query  893   prslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLF  1072
             PRSLS+S+K  RV+ALI+QLGL+ AA TVIGDEGHRGVSGGERRRVSIGIDIIHDPIVLF
Sbjct  175   PRSLSKSKKMERVEALIDQLGLRNAANTVIGDEGHRGVSGGERRRVSIGIDIIHDPIVLF  234

Query  1073  LDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSG  1252
             LDEPTSGLDST+AFMVV+VL+RIAQSGSIVIMS+HQPS RI+ LLDRLI LS+G++VF+G
Sbjct  235   LDEPTSGLDSTNAFMVVQVLKRIAQSGSIVIMSIHQPSARIVELLDRLIILSRGKSVFNG  294

Query  1253  SPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQR-KFSPSST  1429
             SP+SLP FF +FG PIPE EN  EFALD +RELE S E T++LVDFN+ WQ+ K S S +
Sbjct  295   SPASLPGFFADFGRPIPEKENITEFALDLVRELEGSTERTRSLVDFNEKWQQNKLSFSQS  354

Query  1430  SNRNNVFPNPKP-SLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKR  1606
             +   N+F    P +LK+AI+AS+SRGKLVSG++  N     +V  +ANP   E  ++ KR
Sbjct  355   APHTNMFELDSPLTLKEAINASVSRGKLVSGSSRDNVISMETVSSYANPSLFETFILAKR  414

Query  1607  SMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAE  1786
              M N +RMPEL   R   V+VTG +LAT++WKLD +P+G  ERL  FAF + T FY C +
Sbjct  415   YMKNWMRMPELVGTRIATVMVTGFLLATVYWKLDHTPRGALERLTLFAFVVPTMFYCCLD  474

Query  1787  AIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfs  1966
              +PVF+QERYIF+RET +NAYR SSYV+SHS+++LP L   SL F+  T+W VGL+GG  
Sbjct  475   NVPVFIQERYIFLRETTHNAYRTSSYVISHSLVTLPQLIVPSLVFSTITFWTVGLSGGGL  534

Query  1967  gflffllfvfasf-WAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPP  2143
                +F   +  +  W+GSS VTF+SG++ N+M++Y + ++ LAY +L SGF++NRDRIP 
Sbjct  535   EGFYFYCLIIYASFWSGSSVVTFISGVVPNIMLSYMVAISYLAYCLLLSGFYVNRDRIPV  594

Query  2144  YWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKT  2323
             YW WFHY SL+KYP++ VL NEFD P +CFV G+Q+FD + L  V ++ K+KLL+ + K+
Sbjct  595   YWTWFHYISLLKYPYEAVLINEFDDPSRCFVTGVQVFDNTLLGGVSDSGKIKLLETLGKS  654

Query  2324  LGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKR  2497
             L   IT STCL TG D+L Q G+T+++KW CLWIT A G FFR+LFYFALL GS+NKR
Sbjct  655   LNTRITESTCLRTGSDLLAQQGITELSKWECLWITFASGLFFRILFYFALLFGSRNKR  712



>gb|KDO42779.1| hypothetical protein CISIN_1g007474mg [Citrus sinensis]
Length=602

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/611 (67%), Positives = 489/611 (80%), Gaps = 10/611 (2%)
 Frame = +2

Query  671   MAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPML  850
             MA+LGASG+GKSTLIDALA RI +ESL GTV +NG VLES+LLK+ISAYVMQD+LLFPML
Sbjct  1     MAILGASGAGKSTLIDALAGRIEKESLKGTVTLNGAVLESRLLKIISAYVMQDELLFPML  60

Query  851   TVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrv  1030
             TVEETLMFSAE RLPRS+S+ RK+ RV+ALI+QLGL++AAKT IGDE HRGVSGGERRRV
Sbjct  61    TVEETLMFSAECRLPRSVSKKRKRERVEALIDQLGLRSAAKTFIGDEQHRGVSGGERRRV  120

Query  1031  sigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLD  1210
             SIGIDIIHDPI+LFLDEPTSGLDSTSAF VVKVL  IA+SGS+VIMS+HQPSYRI +LL+
Sbjct  121   SIGIDIIHDPILLFLDEPTSGLDSTSAFKVVKVLGEIAKSGSVVIMSIHQPSYRIFSLLN  180

Query  1211  RLIFLSKGQTVFSGSPSS-LPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVD  1387
             RLIFLS GQTV+SG+P++    FF EFG+PIPENEN CEF+LD IRELE++P G  +LV 
Sbjct  181   RLIFLSHGQTVYSGTPATDFSLFFAEFGHPIPENENPCEFSLDLIRELEETPSGISSLVQ  240

Query  1388  FNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFA  1567
             FNKSWQ   +P   S+ +     P   L+DAI ASISRGKLVS   N N      V  F 
Sbjct  241   FNKSWQMTRNPKMASDTDR---QPDVDLEDAIEASISRGKLVSAGKNKN------VQTFV  291

Query  1568  NPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFF  1747
             NPFW EM+ + KRS  NS RMPELF  R GA +V   +LAT++W+LDDSPKG + RL F 
Sbjct  292   NPFWTEMLFLSKRSNTNSRRMPELFGTRLGAQLVIACVLATLYWQLDDSPKGTRLRLAFV  351

Query  1748  AFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaV  1927
             AFAM+T FY CA  IP  LQER IF+RET+YNAYR SSYVL+H++ S+PS+  LSL FA+
Sbjct  352   AFAMTTIFYNCAREIPALLQERNIFIRETSYNAYRVSSYVLAHALASIPSMITLSLVFAL  411

Query  1928  TTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLF  2107
             TT+WAVGLAGGFSGFLFF + +FAS+WAG+SF+ F++G I N+ I +T+VVAIL   +LF
Sbjct  412   TTFWAVGLAGGFSGFLFFFITMFASYWAGTSFMAFVAGFIPNIQIGFTIVVAILGLSLLF  471

Query  2108  SGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEA  2287
              GF+I+ D IP YWIWFHY SLVKYPFQG LQNE+  P++CF+ G+Q FDG+P   +P +
Sbjct  472   CGFYISHDEIPSYWIWFHYVSLVKYPFQGALQNEYGDPNRCFLTGLQFFDGTPFDGLPNS  531

Query  2288  MKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyf  2467
              K++LLQ+MS  LG NIT STCLTTG  IL+Q G+TDI+KW C+WI +A GF FR+LFYF
Sbjct  532   TKIELLQSMSNVLGRNITGSTCLTTGMKILEQKGITDISKWKCIWILVAFGFLFRVLFYF  591

Query  2468  allIGSKNKRR  2500
              LL GSKNKRR
Sbjct  592   TLLFGSKNKRR  602



>ref|XP_010516066.1| PREDICTED: ABC transporter G family member 17-like [Camelina 
sativa]
Length=662

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/666 (61%), Positives = 524/666 (79%), Gaps = 21/666 (3%)
 Frame = +2

Query  500   SFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAV  679
             S  F+L+F++LSY+V ++++ G+     R   +P+Q+    K LL+ I+GEA EGEI+AV
Sbjct  17    SVQFILAFNDLSYNVILQKRFGL-----RFGHSPAQI----KTLLNGITGEAYEGEILAV  67

Query  680   LGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVE  859
             LGASG+GKSTLIDALA RI   SL GTV +NGE  +S+LL+VISAYVMQ+DL+FPMLTVE
Sbjct  68    LGASGAGKSTLIDALAGRIEEGSLKGTVTLNGEAFQSRLLRVISAYVMQEDLMFPMLTVE  127

Query  860   ETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsig  1039
             ETLMF+AEFRLPRSLS+S+K+ RV+ LI+QLGL+T   T+IGDEGHRGVSGGERRRVSIG
Sbjct  128   ETLMFAAEFRLPRSLSKSKKRDRVETLIDQLGLRTVKNTLIGDEGHRGVSGGERRRVSIG  187

Query  1040  iDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLI  1219
              DIIH PI+LFLDEPTSGLDSTSAFMVV+VL+RIA+SGSIVIMS+HQPS R++  LDR+I
Sbjct  188   TDIIHGPILLFLDEPTSGLDSTSAFMVVQVLKRIARSGSIVIMSIHQPSCRVMEYLDRII  247

Query  1220  FLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKS  1399
              LS GQ+VFS SP++LP FF EFG PIP  EN  EF LD I+ELE S EGT+ LV+FNK+
Sbjct  248   VLSSGQSVFSDSPATLPLFFSEFGYPIPVKENNAEFTLDLIKELEGSSEGTRGLVEFNKN  307

Query  1400  WQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFW  1579
             WQ+K         +N       +L++AI+ASISRGKLVS       T   S+P + NP+W
Sbjct  308   WQQKKLRVRQEPHHN-----SSTLREAINASISRGKLVS-------TSFSSIPSYVNPWW  355

Query  1580  VEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAM  1759
             +E V++ KR M+N  R PEL   R   V++TG +LAT++WK+DDSP+G+QERL FF+FAM
Sbjct  356   IETVILAKRYMINWTRTPELIGTRVFIVMMTGFLLATVYWKVDDSPRGVQERLSFFSFAM  415

Query  1760  STTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYW  1939
             +T FY+CA+ +P F+QERYIF+RETA+NAYRRSSYV+SHS+++LP L  LS+ FA TT+W
Sbjct  416   ATMFYSCADGLPAFIQERYIFLRETAHNAYRRSSYVISHSLVTLPHLFVLSIGFAATTFW  475

Query  1940  AvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFF  2119
              VGL GG +GF+++LL +FASFW+G SFVTF+SG+I NVM++Y +    L+Y +LFSGF+
Sbjct  476   FVGLNGGLAGFIYYLLIIFASFWSGCSFVTFVSGVIPNVMMSYMVTFGYLSYCLLFSGFY  535

Query  2120  INRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLK  2299
             INRDRI  YWIW HY SL+KYP++ VL NEFD P +CFV+G Q+FD + ++ V E+ K K
Sbjct  536   INRDRIHLYWIWIHYISLLKYPYEAVLHNEFDDPSRCFVRGNQVFDDTLMEGVSESTKAK  595

Query  2300  LLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallI  2479
             LL  MS  LG+ +T STCL TG D+LKQ G+  ++KW CLW+T+A GFFFR+LFYF+LL+
Sbjct  596   LLDTMSSYLGMELTESTCLRTGSDLLKQHGIEQLDKWGCLWVTLAWGFFFRILFYFSLLL  655

Query  2480  GSKNKR  2497
             GSKNKR
Sbjct  656   GSKNKR  661



>ref|XP_004987055.1| PREDICTED: ABC transporter G family member 16-like [Setaria italica]
Length=758

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/673 (64%), Positives = 526/673 (78%), Gaps = 14/673 (2%)
 Frame = +2

Query  509   FVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGA  688
             FVL+F +L+YSVK  R     ++   R           + LLD ISG AREGEI+AVLGA
Sbjct  91    FVLAFDDLTYSVKRPRS----SFRLSRHEGTGADGARTRALLDGISGAAREGEILAVLGA  146

Query  689   SGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLLFPMLTVEETL  868
             SG+GKSTLIDALA RI RESL G V +NGE ++ +LL+VISAYVMQDDLL+PMLTV ETL
Sbjct  147   SGAGKSTLIDALAGRIQRESLRGAVALNGEAMDGRLLRVISAYVMQDDLLYPMLTVAETL  206

Query  869   MFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDI  1048
             M+SAEFRLP SLS S+K++RVQALI+QLGL+ AA T+IGDEG RGVSGGERRRVSIGIDI
Sbjct  207   MYSAEFRLPSSLSASKKRSRVQALIDQLGLRAAADTIIGDEGRRGVSGGERRRVSIGIDI  266

Query  1049  IHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLS  1228
             IHDPI+LFLDEPTSGLDSTSAFMVVKVLQ IAQSGS+VIMS+HQPSYRIL LLDRL+FLS
Sbjct  267   IHDPIILFLDEPTSGLDSTSAFMVVKVLQHIAQSGSVVIMSIHQPSYRILGLLDRLLFLS  326

Query  1229  KGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQR  1408
             +G+TV+ G P+ LP FF EFG+PIP+ EN  EFALD IRELE +P GTK LV+F+KSWQ 
Sbjct  327   RGRTVYYGPPAGLPPFFLEFGHPIPDGENPAEFALDTIRELEGTPNGTKELVEFSKSWQE  386

Query  1409  KFSPSSTSNRNNVFPNPKPS--LKDAISASISRGKLV------SGATNINSTLSPSVPKF  1564
             K   S T +  +  P  KPS  LK+AI  SI+RGKLV       G  +  S  +  V  +
Sbjct  387   K-PLSRTISAASSGPEHKPSLTLKEAIGLSIARGKLVSGTSPGGGGGSSTSASTAKVATY  445

Query  1565  ANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGF  1744
             ANP+WVE+ V+ +R+  N+ R PELF +R G V VT  ILAT+FW+LD++PKG+ ER GF
Sbjct  446   ANPWWVEVWVLTRRAFTNTRRTPELFLIRLGTVTVTAFILATVFWRLDNTPKGVNERFGF  505

Query  1745  FAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafa  1924
             FA  MST FYT A+A+PVFL ERYIF+RETA+NAYRRSSY LS++I++LP L  LSLAFA
Sbjct  506   FAIGMSTMFYTSADALPVFLVERYIFLRETAHNAYRRSSYTLSNAIVALPPLVLLSLAFA  565

Query  1925  VTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVL  2104
               T++AVGLAGG  GF FF L V ASFWAGS FVTFLS ++ +V+I YT+VVA+LAYF+L
Sbjct  566   GITFFAVGLAGGAQGFAFFALIVLASFWAGSGFVTFLSAVVPHVIIGYTVVVAVLAYFLL  625

Query  2105  FSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDY-PDKCFVKGIQIFDGSPLKAVP  2281
             FSGFF+ RDRIP YWIWFHY SL+KYP+Q V+QNEF   P +CF++G+Q+FDG+P+  +P
Sbjct  626   FSGFFVTRDRIPSYWIWFHYLSLIKYPYQAVMQNEFGADPGRCFMRGVQMFDGTPMGRLP  685

Query  2282  EAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllf  2461
             EA K+ +L  MS+++ ++  SS+C+T GPD+L +  VTD+ KW CLWIT+A GF FR+LF
Sbjct  686   EATKVNVLNAMSRSMRVDFNSSSCITAGPDVLAKQAVTDLGKWACLWITVAWGFVFRVLF  745

Query  2462  yfallIGSKNKRR  2500
             Y  LL+GS+NKRR
Sbjct  746   YLTLLLGSRNKRR  758



>ref|NP_001145981.1| uncharacterized protein LOC100279509 [Zea mays]
 gb|ACF79516.1| unknown [Zea mays]
 gb|ACF86381.1| unknown [Zea mays]
 gb|ACL52975.1| unknown [Zea mays]
 gb|ACL53194.1| unknown [Zea mays]
 gb|ACR35947.1| unknown [Zea mays]
 gb|ACR36444.1| unknown [Zea mays]
 gb|AFW82807.1| hypothetical protein ZEAMMB73_743489 [Zea mays]
 gb|AFW82808.1| hypothetical protein ZEAMMB73_743489 [Zea mays]
Length=712

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/696 (61%), Positives = 536/696 (77%), Gaps = 34/696 (5%)
 Frame = +2

Query  482   PVPYPSSFPFVLSFHNLSYSVKVRRKMGVPA----WLGRRTAA---------PSQVENDV  622
             P+P P+  P+VL F +LSYS++ +R  G+      W   R A+          +    + 
Sbjct  28    PLPQPT-VPYVLRFTDLSYSIR-KRGSGLGCLPSRWPSNRLASLDAPASSATAASATRNT  85

Query  623   KVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESL-GGTVKMNGEVLESKLL  799
             K LLD ISGEARE E+ AV+GASGSGKSTL+DALA RIAR+SL GG   +NGE L+ + L
Sbjct  86    KTLLDGISGEARERELFAVMGASGSGKSTLLDALAGRIARDSLRGGGATLNGEPLQGRRL  145

Query  800   KVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTV  979
             + ISAYVMQDDLL+PMLTV ETL+F+AEFRLPR+L   RK+ARV AL++QLGL  AA T+
Sbjct  146   RAISAYVMQDDLLYPMLTVRETLLFAAEFRLPRALPADRKRARVDALVDQLGLARAADTI  205

Query  980   IGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSI  1159
             IGDE HRGVSGGERRRVSIG DIIHDPI+LFLDEPTSGLDS SAFMVV+VL+RIA+SGS+
Sbjct  206   IGDEAHRGVSGGERRRVSIGTDIIHDPILLFLDEPTSGLDSASAFMVVQVLRRIARSGSV  265

Query  1160  VIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDF  1339
             VIM+VHQPS RIL +LDRL+ LS+G+TV++G+P+ L  FF +FG PIP+NEN  EFALD 
Sbjct  266   VIMTVHQPSARILAILDRLLLLSRGRTVYAGTPAGLKPFFADFGAPIPDNENPAEFALDT  325

Query  1340  IRELEQSPEGTKNLVDFNKSWQRKFSPSST---------SNRNNVFPNPKPSLKDAISAS  1492
             IRE E+ P+G   L DFN  WQ   S +ST          + + + P     L+ AI+ S
Sbjct  326   IREYERCPDGAAPLADFNVKWQNGSSSTSTFDNNNDDDNDSSSKLMP-----LELAIAES  380

Query  1493  ISRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVT  1672
             +SRGKLV+G    ++  + SVP FANP W E+ V+ KRS  N+ RMPELF MR G ++VT
Sbjct  381   VSRGKLVAG----SAVTASSVPTFANPPWTEVWVLIKRSFTNTGRMPELFVMRLGTIMVT  436

Query  1673  GIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYR  1852
             G ILATIFW+LDD+PKG+QERLGFFA AMST FY CA+A+PVF+QER+I++RETA+NAYR
Sbjct  437   GFILATIFWRLDDTPKGVQERLGFFAMAMSTMFYVCADALPVFVQERHIYLRETAHNAYR  496

Query  1853  RSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTF  2032
             R SYVL++++++ P L FLSLAFAVTT+WAVGLAGG   FLFF+L + ASFWAGS FVTF
Sbjct  497   RISYVLANAVVAFPPLVFLSLAFAVTTFWAVGLAGGAPSFLFFVLIILASFWAGSGFVTF  556

Query  2033  LSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEF  2212
             LS ++ +VM+ YT+VVAILAYF+LFSGFFINRDRIP YWIWFHY SLVKYP+Q VLQNEF
Sbjct  557   LSAVVPHVMLGYTVVVAILAYFLLFSGFFINRDRIPDYWIWFHYLSLVKYPYQAVLQNEF  616

Query  2213  DYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGV  2392
                 +CF +G+++F+G+P+  + E +KLK+LQ +S+TLG N+T++TC+TTG D+L Q  V
Sbjct  617   RDASRCFSRGVEMFEGTPIGHMTEPVKLKVLQAISRTLGSNMTATTCVTTGADVLAQQAV  676

Query  2393  TDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             TDI KW CL +T+A GFFFR LFY  LL+GSKNKR+
Sbjct  677   TDIGKWKCLLVTVAWGFFFRALFYVVLLVGSKNKRK  712



>ref|XP_008648601.1| PREDICTED: ABC transporter G family member 16 [Zea mays]
 gb|AFW74829.1| hypothetical protein ZEAMMB73_134485 [Zea mays]
Length=714

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/680 (62%), Positives = 520/680 (76%), Gaps = 25/680 (4%)
 Frame = +2

Query  509   FVLSFHNLSYSVKVRRKMGVPAWLGRR----------TAAPSQVENDVKVLLDDISGEAR  658
             +VL F +LSYSVK +R  G+   L RR            AP+  +   K LLD ISGEAR
Sbjct  44    YVLRFTDLSYSVK-KRGGGLGCLLPRRRPSNRLASSDAPAPAPSDTTTKTLLDGISGEAR  102

Query  659   EGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDDLL  838
             +GE++AV+GASGSGKSTL+DALA RIAR SL G V +NGE L+ + L+ ISA+VMQDDLL
Sbjct  103   DGELLAVMGASGSGKSTLVDALAGRIARGSLRGGVTLNGEPLQGRRLRAISAHVMQDDLL  162

Query  839   FPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsgge  1018
              PMLTV ETL F+AEFRLPR+L   RK+ARV AL++QLGL  AA T+IGDE  RGVSGGE
Sbjct  163   HPMLTVRETLRFAAEFRLPRALPADRKRARVDALVDQLGLARAADTIIGDEARRGVSGGE  222

Query  1019  rrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRIL  1198
             RRRVSIG DIIHDPI+LFLDEPTSGLDS SAFMVV+VL+RIA+SGS+VIM+VHQPS RIL
Sbjct  223   RRRVSIGTDIIHDPILLFLDEPTSGLDSASAFMVVQVLRRIARSGSVVIMTVHQPSARIL  282

Query  1199  NLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKN  1378
              +LDRL+ LS+G+TV++G+P+ L  FF  FG PIP+NEN  EFALD IRE E SP G   
Sbjct  283   GILDRLLLLSRGRTVYAGTPAGLKPFFAAFGAPIPDNENPAEFALDTIREYESSPGGAAP  342

Query  1379  LVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPS--  1552
             L DFN  WQR            + P     L+ AI+ S+SRGKLV+G+            
Sbjct  343   LADFNVKWQRG---GDAPAEGKLMP-----LELAIAESVSRGKLVAGSGRPGGGGGGGAA  394

Query  1553  ----VPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPK  1720
                 VP FANP W E+ V+ KRS  N+ RMPELF MR G ++VTG ILATIFW+LDDSPK
Sbjct  395   TGSSVPTFANPPWTEVWVLIKRSFTNTGRMPELFLMRLGTIMVTGFILATIFWRLDDSPK  454

Query  1721  GIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpsl  1900
             G+QERLGFFA AMSTTFY CA+A+PVF+QER+I++RETA+NAYRR+SYVL++++++ P L
Sbjct  455   GVQERLGFFAMAMSTTFYVCADALPVFVQERHIYLRETAHNAYRRASYVLANAVVAFPPL  514

Query  1901  aflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVV  2080
               LSLAFAVTT+WAVGLAGG   FLFF+L + ASFWAGS FVTFLS ++ +VM+ YT+VV
Sbjct  515   VLLSLAFAVTTFWAVGLAGGGPSFLFFVLIILASFWAGSGFVTFLSAVVPHVMLGYTVVV  574

Query  2081  AILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDG  2260
             AILAYF+LFSGFFINRDRIP YWIWFHY SLVKYP+Q VLQNEF    +CF +G+++F+G
Sbjct  575   AILAYFLLFSGFFINRDRIPDYWIWFHYLSLVKYPYQAVLQNEFSDASRCFTRGVEMFEG  634

Query  2261  SPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlg  2440
             +P+  + EA+KLK++Q +S TLG N+T++TC+TTG D+L Q  VTDI KWNCL +T+A G
Sbjct  635   TPIAHMTEAVKLKVMQAISDTLGSNLTANTCVTTGADVLAQQAVTDIGKWNCLLVTVAWG  694

Query  2441  fffrllfyfallIGSKNKRR  2500
             FFFR LFY  LL+ SKNKR+
Sbjct  695   FFFRALFYVVLLVSSKNKRK  714



>ref|XP_010503151.1| PREDICTED: ABC transporter G family member 19-like [Camelina 
sativa]
Length=715

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/667 (62%), Positives = 522/667 (78%), Gaps = 15/667 (2%)
 Frame = +2

Query  506   PFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLG  685
             PFVL+F+NL Y V +R+  G      R+++        VK L+DD+SGEA +G+I+AVLG
Sbjct  60    PFVLAFNNLEYDVTLRQGFG----FSRKSS--------VKTLVDDVSGEACDGDILAVLG  107

Query  686   ASGSGKSTLIDALANRIARESLGGTVKMNGE-VLESKLLKVISAYVMQDDLLFPMLTVEE  862
             ASG+GKSTLIDALA R+A   L G+V +NGE +L+S+LLKVISAYVMQDDLLFPMLTV+E
Sbjct  108   ASGAGKSTLIDALAGRVAETRLKGSVTLNGEKILQSRLLKVISAYVMQDDLLFPMLTVKE  167

Query  863   TLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigi  1042
             TL+F++EFRLPR+LS+S+K  RV+ LI+QLGL+ A  TVIGDEGHRGVSGGERRRVSIGI
Sbjct  168   TLVFASEFRLPRTLSKSKKMERVETLIDQLGLRNAVDTVIGDEGHRGVSGGERRRVSIGI  227

Query  1043  DIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIF  1222
             DIIHDPIVLFLDEPTSGLDST+AFMVV+VL+RIA+SGSIVIMS+HQPS RI+ LLDRLI 
Sbjct  228   DIIHDPIVLFLDEPTSGLDSTNAFMVVQVLKRIAKSGSIVIMSIHQPSARIVELLDRLII  287

Query  1223  LSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSW  1402
             LS+G++VF+GSP SL RFF +FG+PIPE EN  EFALD IR+LE S EGTK LV+FNK W
Sbjct  288   LSRGKSVFNGSPESLSRFFSDFGHPIPEKENITEFALDLIRQLEVSTEGTKELVEFNKKW  347

Query  1403  QRKFSPSSTSNRN--NVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPF  1576
             ++     S S R      P+   SLK+AI+AS+SRGKLVSG + +N     S+  +ANP 
Sbjct  348   EQNKLKLSQSARATPQTTPHQGLSLKEAINASVSRGKLVSGTSAVNPIAMESISSYANPS  407

Query  1577  WVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFA  1756
             + E +++ KR M N +RMPEL   R   V+VT I+LAT++W LD++P+G QER  FFAF 
Sbjct  408   FFETLILAKRYMKNWIRMPELMGTRIAMVMVTAILLATVYWNLDNTPRGAQERSTFFAFV  467

Query  1757  MSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTY  1936
             + T FY C + IPVF+QERYIF+RET +NAYR SSYV+SHS++SLP L   SL FA  T+
Sbjct  468   VPTMFYCCLDNIPVFIQERYIFLRETTHNAYRTSSYVISHSLVSLPQLIAPSLVFASITF  527

Query  1937  WAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGF  2116
             W VGL+GG  GFLF+ L ++ASFW+GSS VTF+SG++ N+MI+Y + +A +AY +L SGF
Sbjct  528   WTVGLSGGLEGFLFYSLIIYASFWSGSSIVTFISGVVPNIMISYMVTIAYVAYCLLLSGF  587

Query  2117  FINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKL  2296
             ++NRDRIP YWIWFHY S +KYP++ VL NEFD P +CFVKG+Q+FDG+ L  V  + K+
Sbjct  588   YVNRDRIPVYWIWFHYISPLKYPYEAVLINEFDDPLRCFVKGVQVFDGTLLGGVSYSRKI  647

Query  2297  KLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfall  2476
             KLL+ +S++L   IT STCL TG  +L Q G+T ++KW+CLWIT+A G FFR+LFYFALL
Sbjct  648   KLLETLSRSLKTKITESTCLKTGSKLLAQQGITQLSKWDCLWITLASGLFFRILFYFALL  707

Query  2477  IGSKNKR  2497
              GS+NKR
Sbjct  708   FGSRNKR  714



>ref|XP_006403489.1| hypothetical protein EUTSA_v10010975mg [Eutrema salsugineum]
 gb|ESQ44942.1| hypothetical protein EUTSA_v10010975mg [Eutrema salsugineum]
Length=727

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/708 (59%), Positives = 534/708 (75%), Gaps = 13/708 (2%)
 Frame = +2

Query  380   TLGELLHRVGDSAGEKLNNGVGGANDHRVLQLYD-PVPYPSSFPFVLSFHNLSYSVKVRR  556
             TL ELL        +  N+ V  ++DH    + +    +    PFVL+F+NL Y+V + R
Sbjct  30    TLFELLKDCDSFRKDDPNSVVTRSDDHLPHHVINVEALHVQRVPFVLAFNNLQYNVTLHR  89

Query  557   KMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRI  736
             +          + +     + VK LLDDISGEA +G+I+AVLGASG+GKSTLIDALA R+
Sbjct  90    RF---------SFSRRSSTSTVKTLLDDISGEACDGDILAVLGASGAGKSTLIDALAGRV  140

Query  737   ARESLGGTVKMNGE-VLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrs  913
             A+ESL G+V +NGE VL+S+LLKVISAY+MQDDLLFPMLTV+ETLMF++EFRLPRSLS S
Sbjct  141   AKESLRGSVTLNGENVLQSRLLKVISAYMMQDDLLFPMLTVKETLMFASEFRLPRSLSNS  200

Query  914   rkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSG  1093
             +K  RVQALI+QLGL+ AA T+IGDEGHRGVSGGERRRVSIGIDIIHDPIVLFLDEPTSG
Sbjct  201   KKMERVQALIDQLGLRNAADTLIGDEGHRGVSGGERRRVSIGIDIIHDPIVLFLDEPTSG  260

Query  1094  LDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPR  1273
             LDST+AFMVV+VL+RIAQSGSIV+MS+HQPS RIL+ LDRLI LS+G++VF+G P+SLP 
Sbjct  261   LDSTNAFMVVQVLKRIAQSGSIVMMSIHQPSARILDFLDRLIILSRGKSVFNGCPASLPS  320

Query  1274  FFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFP  1453
             FF +FG PIPE EN  EFALD IRELE+S EGT  LV+FN+ WQ+K   +  + +     
Sbjct  321   FFSDFGRPIPERENITEFALDLIRELEKSNEGTSQLVEFNEKWQKKQLLARATTQTA--S  378

Query  1454  NPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMP  1633
             +   SLK+AI AS+SRGKLVSG++  N     +V  +ANP   E  ++ KR M N +R P
Sbjct  379   HQGLSLKEAIDASVSRGKLVSGSSKSNLMSMETVSSYANPSLFETFILAKRYMKNWIRTP  438

Query  1634  ELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQER  1813
             EL   R   V+VTG +LAT++WKLD++P+G  ERL FFAF   T FY C + +PVF+QER
Sbjct  439   ELVGTRIATVMVTGFLLATVYWKLDNTPRGAHERLTFFAFVTPTMFYCCLDNVPVFIQER  498

Query  1814  YIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfv  1993
             YIF+RET +NAYR SSYV+SHS++SLP L   S+ FA  T+W V L+GG  GF F+ L +
Sbjct  499   YIFLRETMHNAYRTSSYVISHSLMSLPQLIAPSIVFASITFWTVDLSGGLQGFFFYCLII  558

Query  1994  fasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASL  2173
             FASFW+GSS VTF+SG++ N+M+ Y + ++ LAY +L SGF++NRDRIP YW+WFHY S+
Sbjct  559   FASFWSGSSVVTFISGVLPNIMLCYMVAISYLAYCLLLSGFYVNRDRIPSYWMWFHYISV  618

Query  2174  VKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTC  2353
             +KYP++ VL NEFD   +CFVKG+Q+FDG+ +  V ++ K+KLL+ + ++L   IT STC
Sbjct  619   LKYPYEAVLINEFDDSSRCFVKGVQVFDGTLIGGVSDSGKVKLLETLGRSLRTRITESTC  678

Query  2354  LTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKR  2497
             LTTG D+L Q G+T ++KW+CLWIT+A G FFR+LFY ALL GSKNKR
Sbjct  679   LTTGSDLLSQQGITQLSKWDCLWITLACGLFFRILFYIALLFGSKNKR  726



>gb|EAY96335.1| hypothetical protein OsI_18238 [Oryza sativa Indica Group]
Length=699

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/678 (63%), Positives = 532/678 (78%), Gaps = 18/678 (3%)
 Frame = +2

Query  506   PFVLSFHNLSYSVKVRRKMGVPAWLGR-----------RTAAPSQVENDVKVLLDDISGE  652
             P++LSF +LSYSV+ +   GV + L                AP+  +   K LLD ISGE
Sbjct  27    PYLLSFTDLSYSVR-KGGGGVLSCLPSSRRRRHSNRLASADAPAPPDAPTKALLDGISGE  85

Query  653   AREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDD  832
             AR+GE+ AV+GASGSGKSTL+DALA RIARESL G V++NGE L  + L+ ISAYVMQDD
Sbjct  86    ARDGELFAVMGASGSGKSTLVDALAGRIARESLRGAVELNGEPLHGRRLRAISAYVMQDD  145

Query  833   LLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsg  1012
             LL+PMLTV ETL+F+AEFRLPR+LS  +K+ARV ALI+QLGL  AA T+IGDE HRGVSG
Sbjct  146   LLYPMLTVRETLLFAAEFRLPRALSPDKKRARVDALIDQLGLARAADTIIGDEAHRGVSG  205

Query  1013  gerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYR  1192
             GERRRVSIG DI+HDPI+LFLDEPTSGLDS SAFMVV+VL+RIAQSGS+VIM++HQPS R
Sbjct  206   GERRRVSIGTDIVHDPILLFLDEPTSGLDSASAFMVVQVLRRIAQSGSVVIMTIHQPSAR  265

Query  1193  ILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGT  1372
             ILN+LDRL+ LS+G+TV++G+P+ L  FF EFG+PIP+NEN  EFALD IRELE  P+G 
Sbjct  266   ILNILDRLLLLSRGRTVYAGTPAGLKPFFSEFGDPIPDNENPAEFALDTIRELEHQPDGA  325

Query  1373  KNLVDFNKSWQRKFS--PSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLS  1546
               L DFN  WQ   +  P++ S  +     P   L+ AI+ S+SRGKLV+  +   +  S
Sbjct  326   APLADFNVKWQSMHAALPAADSKDSKRCTMP---LELAITESVSRGKLVA-GSGSGTASS  381

Query  1547  PSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGI  1726
              SVP FANP  VE+ V+ KRS  N+ RMPELF MR G ++VTG ILATIFW+LDD+PKG+
Sbjct  382   TSVPTFANPLSVEVWVLMKRSFTNTGRMPELFVMRLGTIMVTGFILATIFWRLDDTPKGV  441

Query  1727  QERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaf  1906
             QERLGFFA AMST FY CA+A+PVF+QER+I++RETA+NAYRR SYV ++++++ P L F
Sbjct  442   QERLGFFAMAMSTMFYVCADALPVFVQERHIYLRETAHNAYRRLSYVFANAVVAFPPLVF  501

Query  1907  lslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAI  2086
             LSLAFAVTT++AVGLAGG   FLFF+L + ASFWAGS FVTFLS ++ +VM+ YT+VVAI
Sbjct  502   LSLAFAVTTFFAVGLAGGGGSFLFFVLIILASFWAGSGFVTFLSAVVPHVMLGYTVVVAI  561

Query  2087  LAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSP  2266
             LAYF+LFSGFFINRDRIP YWIWFHY SLVKYP+Q VLQNEF    +CF +G+++FDG+P
Sbjct  562   LAYFLLFSGFFINRDRIPSYWIWFHYLSLVKYPYQAVLQNEFRDATRCFSRGVEMFDGTP  621

Query  2267  LKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgff  2446
             + A+  A+KLK+L  +SKTLG N+T++TC+TTG D+L Q  VTDI KW CL +T+A GFF
Sbjct  622   IGAMSRAVKLKVLDAISKTLGTNMTANTCVTTGADVLAQQAVTDIGKWKCLLVTVAWGFF  681

Query  2447  frllfyfallIGSKNKRR  2500
             FR LFY  LL+GSKNKRR
Sbjct  682   FRALFYVVLLVGSKNKRR  699



>gb|EEE62138.1| hypothetical protein OsJ_16925 [Oryza sativa Japonica Group]
Length=699

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/678 (63%), Positives = 531/678 (78%), Gaps = 18/678 (3%)
 Frame = +2

Query  506   PFVLSFHNLSYSVKVRRKMGVPAWLGR-----------RTAAPSQVENDVKVLLDDISGE  652
             P++LSF +LSYSV+ +   GV + L                AP+  +   K LLD ISGE
Sbjct  27    PYLLSFTDLSYSVR-KGGGGVLSCLPSSRRRRHSNRLASADAPAPPDAPTKALLDGISGE  85

Query  653   AREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDD  832
             AR+GE+ AV+GASGSGKSTL+DALA RIARESL G V++NGE L  + L+ ISAYVMQDD
Sbjct  86    ARDGELFAVMGASGSGKSTLVDALAGRIARESLRGAVELNGEPLHGRRLRAISAYVMQDD  145

Query  833   LLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsg  1012
             LL+PMLTV ETL+F+AEFRLPR+LS  +K+ARV ALI+QLGL  AA T+IGDE HRGVSG
Sbjct  146   LLYPMLTVRETLLFAAEFRLPRALSPDKKRARVDALIDQLGLARAADTIIGDEAHRGVSG  205

Query  1013  gerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYR  1192
             GERRRVSIG DI+HDPI+LFLDEPTSGLDS SAFMVV+VL+RIAQSGS+VIM++HQPS R
Sbjct  206   GERRRVSIGTDIVHDPILLFLDEPTSGLDSASAFMVVQVLRRIAQSGSVVIMTIHQPSAR  265

Query  1193  ILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGT  1372
             ILN+LDRL+ LS+G+TV++G+P  L  FF EFG+PIP+NEN  EFALD IRELE  P+G 
Sbjct  266   ILNILDRLLLLSRGRTVYAGTPVGLKPFFSEFGDPIPDNENPAEFALDTIRELEHQPDGA  325

Query  1373  KNLVDFNKSWQRKFS--PSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLS  1546
               L DFN  WQ   +  P++ S  +     P   L+ AI+ S+SRGKLV+  +   +  S
Sbjct  326   APLADFNVKWQSMHAALPAADSKDSKRCTMP---LELAITESVSRGKLVA-GSGSGTASS  381

Query  1547  PSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGI  1726
              SVP FANP  VE+ V+ KRS  N+ RMPELF MR G ++VTG ILATIFW+LDD+PKG+
Sbjct  382   TSVPTFANPLSVEVWVLMKRSFTNTGRMPELFVMRLGTIMVTGFILATIFWRLDDTPKGV  441

Query  1727  QERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaf  1906
             QERLGFFA AMST FY CA+A+PVF+QER+I++RETA+NAYRR SYV ++++++ P L F
Sbjct  442   QERLGFFAMAMSTMFYVCADALPVFVQERHIYLRETAHNAYRRLSYVFANAVVAFPPLVF  501

Query  1907  lslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAI  2086
             LSLAFAVTT++AVGLAGG   FLFF+L + ASFWAGS FVTFLS ++ +VM+ YT+VVAI
Sbjct  502   LSLAFAVTTFFAVGLAGGGGSFLFFVLIILASFWAGSGFVTFLSAVVPHVMLGYTVVVAI  561

Query  2087  LAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSP  2266
             LAYF+LFSGFFINRDRIP YWIWFHY SLVKYP+Q VLQNEF    +CF +G+++FDG+P
Sbjct  562   LAYFLLFSGFFINRDRIPSYWIWFHYLSLVKYPYQAVLQNEFRDATRCFSRGVEMFDGTP  621

Query  2267  LKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgff  2446
             + A+  A+KLK+L  +SKTLG N+T++TC+TTG D+L Q  VTDI KW CL +T+A GFF
Sbjct  622   IGAMSRAVKLKVLDAISKTLGTNMTANTCVTTGADVLAQQAVTDIGKWKCLLVTVAWGFF  681

Query  2447  frllfyfallIGSKNKRR  2500
             FR LFY  LL+GSKNKRR
Sbjct  682   FRALFYVVLLVGSKNKRR  699



>ref|NP_001054490.2| Os05g0120200 [Oryza sativa Japonica Group]
 dbj|BAF16404.2| Os05g0120200 [Oryza sativa Japonica Group]
Length=745

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/678 (63%), Positives = 531/678 (78%), Gaps = 18/678 (3%)
 Frame = +2

Query  506   PFVLSFHNLSYSVKVRRKMGVPAWLGR-----------RTAAPSQVENDVKVLLDDISGE  652
             P++LSF +LSYSV+ +   GV + L                AP+  +   K LLD ISGE
Sbjct  27    PYLLSFTDLSYSVR-KGGGGVLSCLPSSRRRRHSNRLASADAPAPPDAPTKALLDGISGE  85

Query  653   AREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDD  832
             AR+GE+ AV+GASGSGKSTL+DALA RIARESL G V++NGE L  + L+ ISAYVMQDD
Sbjct  86    ARDGELFAVMGASGSGKSTLVDALAGRIARESLRGAVELNGEPLHGRRLRAISAYVMQDD  145

Query  833   LLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsg  1012
             LL+PMLTV ETL+F+AEFRLPR+LS  +K+ARV ALI+QLGL  AA T+IGDE HRGVSG
Sbjct  146   LLYPMLTVRETLLFAAEFRLPRALSPDKKRARVDALIDQLGLARAADTIIGDEAHRGVSG  205

Query  1013  gerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYR  1192
             GERRRVSIG DI+HDPI+LFLDEPTSGLDS SAFMVV+VL+RIAQSGS+VIM++HQPS R
Sbjct  206   GERRRVSIGTDIVHDPILLFLDEPTSGLDSASAFMVVQVLRRIAQSGSVVIMTIHQPSAR  265

Query  1193  ILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGT  1372
             ILN+LDRL+ LS+G+TV++G+P  L  FF EFG+PIP+NEN  EFALD IRELE  P+G 
Sbjct  266   ILNILDRLLLLSRGRTVYAGTPVGLKPFFSEFGDPIPDNENPAEFALDTIRELEHQPDGA  325

Query  1373  KNLVDFNKSWQRKFS--PSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLS  1546
               L DFN  WQ   +  P++ S  +     P   L+ AI+ S+SRGKLV+  +   +  S
Sbjct  326   APLADFNVKWQSMHAALPAADSKDSKRCTMP---LELAITESVSRGKLVA-GSGSGTASS  381

Query  1547  PSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGI  1726
              SVP FANP  VE+ V+ KRS  N+ RMPELF MR G ++VTG ILATIFW+LDD+PKG+
Sbjct  382   TSVPTFANPLSVEVWVLMKRSFTNTGRMPELFVMRLGTIMVTGFILATIFWRLDDTPKGV  441

Query  1727  QERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaf  1906
             QERLGFFA AMST FY CA+A+PVF+QER+I++RETA+NAYRR SYV ++++++ P L F
Sbjct  442   QERLGFFAMAMSTMFYVCADALPVFVQERHIYLRETAHNAYRRLSYVFANAVVAFPPLVF  501

Query  1907  lslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAI  2086
             LSLAFAVTT++AVGLAGG   FLFF+L + ASFWAGS FVTFLS ++ +VM+ YT+VVAI
Sbjct  502   LSLAFAVTTFFAVGLAGGGGSFLFFVLIILASFWAGSGFVTFLSAVVPHVMLGYTVVVAI  561

Query  2087  LAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSP  2266
             LAYF+LFSGFFINRDRIP YWIWFHY SLVKYP+Q VLQNEF    +CF +G+++FDG+P
Sbjct  562   LAYFLLFSGFFINRDRIPSYWIWFHYLSLVKYPYQAVLQNEFRDATRCFSRGVEMFDGTP  621

Query  2267  LKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgff  2446
             + A+  A+KLK+L  +SKTLG N+T++TC+TTG D+L Q  VTDI KW CL +T+A GFF
Sbjct  622   IGAMSRAVKLKVLDAISKTLGTNMTANTCVTTGADVLAQQAVTDIGKWKCLLVTVAWGFF  681

Query  2447  frllfyfallIGSKNKRR  2500
             FR LFY  LL+GSKNKRR
Sbjct  682   FRALFYVVLLVGSKNKRR  699



>ref|XP_010430990.1| PREDICTED: ABC transporter G family member 19-like [Camelina 
sativa]
Length=941

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/667 (62%), Positives = 521/667 (78%), Gaps = 15/667 (2%)
 Frame = +2

Query  506   PFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLG  685
             PFVL+F+NL Y V +R+  G      R+++        VK LLDD+SGEA +G+I+AVLG
Sbjct  286   PFVLAFNNLQYDVTLRQGFG----FSRKSS--------VKTLLDDVSGEACDGDILAVLG  333

Query  686   ASGSGKSTLIDALANRIARESLGGTVKMNGE-VLESKLLKVISAYVMQDDLLFPMLTVEE  862
             ASG+GKSTLIDALA R+A  SL G+V +NGE +L+S+LLKVISAYVMQDDLLFPMLTV E
Sbjct  334   ASGAGKSTLIDALAGRVAERSLRGSVTLNGEKILQSRLLKVISAYVMQDDLLFPMLTVRE  393

Query  863   TLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigi  1042
             TL+F++EFRLPR LS+++K  RV+ LI+QLGL+ A  TVIGDEGHRGVSGGERRRVSIGI
Sbjct  394   TLVFASEFRLPRVLSKAKKMERVETLIDQLGLRNAVDTVIGDEGHRGVSGGERRRVSIGI  453

Query  1043  DIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIF  1222
             DIIHDPIVLFLDEPTSGLDST+AFMVV+VL+RIA+SGSIVIMS+HQPS RI++LLDRLI 
Sbjct  454   DIIHDPIVLFLDEPTSGLDSTNAFMVVQVLKRIAKSGSIVIMSIHQPSARIVDLLDRLII  513

Query  1223  LSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSW  1402
             LS+G++VFSGSP+SLPRFF +FG+PIPE EN  EFALD IR+ E S EGTK LV+FNK W
Sbjct  514   LSRGKSVFSGSPTSLPRFFSDFGHPIPEKENITEFALDLIRQFEGSTEGTKELVEFNKKW  573

Query  1403  QRKFSPSSTSNRN--NVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPF  1576
             ++     S S R      P+   SLK+AI AS+SRGKLVSG +  N     S+  +ANP 
Sbjct  574   EQNKLKLSQSARATPQTTPHQGLSLKEAIKASVSRGKLVSGTSGFNPIAIESIASYANPS  633

Query  1577  WVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFA  1756
             + E +++ KR + N +RMPEL   R   V+VT I+LAT++W LD++P+G QER  FFAF 
Sbjct  634   FFETLILAKRYIKNWIRMPELMGTRIAMVMVTAILLATVYWNLDNTPRGAQERSTFFAFV  693

Query  1757  MSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTY  1936
             + T FY C + IPVF+QERYIF+RET +NAYR SSYV+SHS++SLP L   SL FA  T+
Sbjct  694   VPTMFYCCLDNIPVFIQERYIFLRETTHNAYRTSSYVISHSLVSLPQLIAPSLVFASITF  753

Query  1937  WAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGF  2116
             W VGL+GG  GF F+ L ++ASFW+GSS VTF+SG++ N+MI+Y + +A +AY +L SGF
Sbjct  754   WTVGLSGGLEGFFFYSLIIYASFWSGSSVVTFISGVVPNIMISYMVTIAYVAYCLLLSGF  813

Query  2117  FINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKL  2296
             ++NRDRIP YWIWFHY S +KYP++ VL NEFD P +CFVKG+Q+FDG+ L  V  + K+
Sbjct  814   YVNRDRIPFYWIWFHYISPLKYPYEAVLINEFDDPLRCFVKGVQVFDGTLLGGVSYSRKI  873

Query  2297  KLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfall  2476
             KLL+ +S++L   IT STCL TG ++L Q G+T ++KW+CLWIT+A G FFR+LFYFALL
Sbjct  874   KLLETLSRSLKTKITESTCLKTGSNLLAQQGITQLSKWDCLWITLASGLFFRILFYFALL  933

Query  2477  IGSKNKR  2497
              GS+NKR
Sbjct  934   FGSRNKR  940



>dbj|BAA90508.1| unnamed protein product [Oryza sativa]
Length=705

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/677 (63%), Positives = 530/677 (78%), Gaps = 18/677 (3%)
 Frame = +2

Query  506   PFVLSFHNLSYSVKVRRKMGVPAWLGR-----------RTAAPSQVENDVKVLLDDISGE  652
             P++LSF +LSYSV+ +   GV + L                AP+  +   K LLD ISGE
Sbjct  27    PYLLSFTDLSYSVR-KGGGGVLSCLPSSRRRRHSNRLASADAPAPPDAPTKALLDGISGE  85

Query  653   AREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVMQDD  832
             AR+GE+ AV+GASGSGKSTL+DALA RIARESL G V++NGE L  + L+ ISAYVMQDD
Sbjct  86    ARDGELFAVMGASGSGKSTLVDALAGRIARESLRGAVELNGEPLHGRRLRAISAYVMQDD  145

Query  833   LLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsg  1012
             LL+PMLTV ETL+F+AEFRLPR+LS  +K+ARV ALI+QLGL  AA T+IGDE HRGVSG
Sbjct  146   LLYPMLTVRETLLFAAEFRLPRALSPDKKRARVDALIDQLGLARAADTIIGDEAHRGVSG  205

Query  1013  gerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYR  1192
             GERRRVSIG DI+HDPI+LFLDEPTSGLDS SAFMVV+VL+RIAQSGS+VIM++HQPS R
Sbjct  206   GERRRVSIGTDIVHDPILLFLDEPTSGLDSASAFMVVQVLRRIAQSGSVVIMTIHQPSAR  265

Query  1193  ILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGT  1372
             ILN+LDRL+ LS+G+TV++G+P  L  FF EFG+PIP+NEN  EFALD IRELE  P+G 
Sbjct  266   ILNILDRLLLLSRGRTVYAGTPVGLKPFFSEFGDPIPDNENPAEFALDTIRELEHQPDGA  325

Query  1373  KNLVDFNKSWQRKFS--PSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLS  1546
               L DFN  WQ   +  P++ S  +     P   L+ AI+ S+SRGKLV+  +   +  S
Sbjct  326   APLADFNVKWQSMHAALPAADSKDSKRCTMP---LELAITESVSRGKLVA-GSGSGTASS  381

Query  1547  PSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGI  1726
              SVP FANP  VE+ V+ KRS  N+ RMPELF MR G ++VTG ILATIFW+LDD+PKG+
Sbjct  382   TSVPTFANPLSVEVWVLMKRSFTNTGRMPELFVMRLGTIMVTGFILATIFWRLDDTPKGV  441

Query  1727  QERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaf  1906
             QERLGFFA AMST FY CA+A+PVF+QER+I++RETA+NAYRR SYV ++++++ P L F
Sbjct  442   QERLGFFAMAMSTMFYVCADALPVFVQERHIYLRETAHNAYRRLSYVFANAVVAFPPLVF  501

Query  1907  lslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAI  2086
             LSLAFAVTT++AVGLAGG   FLFF+L + ASFWAGS FVTFLS ++ +VM+ YT+VVAI
Sbjct  502   LSLAFAVTTFFAVGLAGGGGSFLFFVLIILASFWAGSGFVTFLSAVVPHVMLGYTVVVAI  561

Query  2087  LAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSP  2266
             LAYF+LFSGFFINRDRIP YWIWFHY SLVKYP+Q VLQNEF    +CF +G+++FDG+P
Sbjct  562   LAYFLLFSGFFINRDRIPSYWIWFHYLSLVKYPYQAVLQNEFRDATRCFSRGVEMFDGTP  621

Query  2267  LKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgff  2446
             + A+  A+KLK+L  +SKTLG N+T++TC+TTG D+L Q  VTDI KW CL +T+A GFF
Sbjct  622   IGAMSRAVKLKVLDAISKTLGTNMTANTCVTTGADVLAQQAVTDIGKWKCLLVTVAWGFF  681

Query  2447  frllfyfallIGSKNKR  2497
             FR LFY  LL+GSKNKR
Sbjct  682   FRALFYVVLLVGSKNKR  698



>gb|EAY96333.1| hypothetical protein OsI_18236 [Oryza sativa Indica Group]
Length=680

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/684 (61%), Positives = 520/684 (76%), Gaps = 10/684 (1%)
 Frame = +2

Query  452   NDHRVLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVL  631
              D  VL + D     +  P+ L+F +LSY+V  RR   +P      T AP       K L
Sbjct  6     GDCVVLDIDDAAAQSTPVPYALTFTDLSYTVGSRRAGLLPPL---PTDAPP-----AKAL  57

Query  632   LDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVIS  811
             LD ISGEAR+GE++AV+GASGSGKSTL+DALA RIAR SL G V++NGE L  + ++ IS
Sbjct  58    LDGISGEARDGEVLAVMGASGSGKSTLLDALAGRIARGSLRGRVELNGEALHGRRVRAIS  117

Query  812   AYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDe  991
             AYVMQDDLL+PMLTV ETLMF+AEFRLPR+LS  +K+ARV ALI QLGL  AA T++GDE
Sbjct  118   AYVMQDDLLYPMLTVRETLMFAAEFRLPRALSPDKKRARVDALIGQLGLARAADTIVGDE  177

Query  992   ghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMS  1171
              HRGVSGGERRRVSIG DI+HDPI+LFLDEPTSGLDS SAFMVV+VL+RIAQSGS+++M+
Sbjct  178   AHRGVSGGERRRVSIGTDIVHDPILLFLDEPTSGLDSASAFMVVQVLRRIAQSGSVIVMT  237

Query  1172  VHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIREL  1351
             +HQPS RILN+LDRL+ LS+G+TV++GSPS L  FF  FG PIP+NEN  EFALD IREL
Sbjct  238   IHQPSARILNILDRLLLLSRGRTVYAGSPSGLKPFFSVFGYPIPDNENLVEFALDTIREL  297

Query  1352  EQSPEGTKNLVDFNKSWQRKFSPS-STSNRNNVFPNPKPSLKDAISASISRGKLVSGATN  1528
             E  P+G   LV F+  WQ        T +  +        L+ AI+ S+SRGKLV+  + 
Sbjct  298   EHQPDGAAMLVKFSSRWQSSLGALLDTKDDKDRSQRCTMPLELAIAESVSRGKLVA-GSG  356

Query  1529  INSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLD  1708
               +  S SVP +ANP++VE+ V+ KR+  N+ RMPELF MR G ++VTG ILATIFW+LD
Sbjct  357   SGTLSSTSVPTYANPWYVEVWVLMKRAFTNTRRMPELFVMRLGTIMVTGFILATIFWRLD  416

Query  1709  DSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiis  1888
             D+PKG+QERLGFFA AMST FY CA+A+PVF+QER+I++RETA+NAYRR SYV++++ ++
Sbjct  417   DTPKGVQERLGFFAMAMSTMFYVCADALPVFVQERHIYLRETAHNAYRRLSYVVANTAVA  476

Query  1889  lpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAY  2068
              P L  LSLAFAVTT++AV L+GG + F FF L V ASFWAGS FVTFLS ++ +VM+ Y
Sbjct  477   FPPLVVLSLAFAVTTFFAVRLSGGGASFAFFALTVLASFWAGSGFVTFLSAVVPHVMLGY  536

Query  2069  TLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQ  2248
             T+VVAILAYF+LFSGFFINRDRIP YWIWFHY SLVKYP+Q VLQNEF    +CF +G++
Sbjct  537   TVVVAILAYFLLFSGFFINRDRIPSYWIWFHYLSLVKYPYQAVLQNEFRDAARCFSRGVE  596

Query  2249  IFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWIT  2428
             +FDG+P+ A+ +A+KLK+L  +  TLG  +T+ TC+ TG D+L Q  VTDI +W CL +T
Sbjct  597   MFDGTPIGAMSKAVKLKVLDAIGATLGAPLTAETCVVTGADVLAQQAVTDIGRWKCLLVT  656

Query  2429  IAlgfffrllfyfallIGSKNKRR  2500
             +A GFFFR LFY  L  GSKNKRR
Sbjct  657   VAFGFFFRFLFYIVLHFGSKNKRR  680



>ref|XP_002878020.1| hypothetical protein ARALYDRAFT_906929 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54279.1| hypothetical protein ARALYDRAFT_906929 [Arabidopsis lyrata subsp. 
lyrata]
Length=728

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/717 (60%), Positives = 532/717 (74%), Gaps = 25/717 (3%)
 Frame = +2

Query  374   SMTLGELLH-----RVGDSAGEKLNNGVGGANDHRVLQLYD-PVPYPSSFPFVLSFHNLS  535
             S TL ELL      R GD  G       G  +D     + D    Y    P+VL+F+NL 
Sbjct  27    SPTLDELLKDCDSFRKGDPGG-------GVKSDDPAHHIIDVEALYVKPVPYVLAFNNLE  79

Query  536   YSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLI  715
             Y V +RR+            +  +    VK LL  +SGEA +G+I+AVLGASG+GKSTLI
Sbjct  80    YDVILRRRF---------DFSRRRSSASVKTLLGGVSGEACDGDILAVLGASGAGKSTLI  130

Query  716   DALANRIARESLGGTVKMNGE-VLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrl  892
             DALA R+A  SL GTV +NGE VL+S+LLKVISAYVMQDDLLFPMLTV+ETLMF++EFRL
Sbjct  131   DALAGRVAEGSLRGTVTLNGEKVLQSRLLKVISAYVMQDDLLFPMLTVKETLMFASEFRL  190

Query  893   prslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLF  1072
             PRSLS+S+K  RV+ALI+QLGL+ AA TVIGDEGHRGVSGGERRRVSIGIDIIHDPIVLF
Sbjct  191   PRSLSKSKKMERVEALIDQLGLRNAANTVIGDEGHRGVSGGERRRVSIGIDIIHDPIVLF  250

Query  1073  LDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSG  1252
             LDEPTSGLDST+AFMVV+VL+RIAQSGSIVIMS+HQPS RI+ LLDRLI LS+G++VF+G
Sbjct  251   LDEPTSGLDSTNAFMVVQVLKRIAQSGSIVIMSIHQPSARIVELLDRLIILSRGKSVFNG  310

Query  1253  SPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQR-KFS-PSS  1426
             SP+ LP FF +FG PIPE EN  EFALD +RELE S EGTK LVDFN+ WQ+ K S   S
Sbjct  311   SPAILPGFFSDFGRPIPEKENITEFALDLVRELEGSKEGTKALVDFNEKWQQNKISLIQS  370

Query  1427  TSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTLSPSVPKFANPFWVEMVVIGKR  1606
                 N + P+   SLK+AI+AS+SRGKLVSG++  N T   +V  +ANP   E  ++ KR
Sbjct  371   APQTNELEPDRALSLKEAINASVSRGKLVSGSSRSNPTSMETVSSYANPSLFETFILAKR  430

Query  1607  SMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAE  1786
              M N +RMPEL   R   V+VTG +LAT++WKLD +P+G QERL  FAF + T FY C +
Sbjct  431   YMKNWIRMPELVGTRIATVMVTGSLLATVYWKLDHTPRGAQERLTLFAFVVPTMFYCCLD  490

Query  1787  AIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfs  1966
              +PVF+QERYIF+RET +NAYR SSYV+SHS++SLP L   SL F+  T+W VGL+GG  
Sbjct  491   NVPVFIQERYIFLRETTHNAYRTSSYVISHSLVSLPQLIAPSLVFSAITFWTVGLSGGLE  550

Query  1967  gflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPY  2146
             GF F+ L ++ASFW+GSS VTF+SG++ ++M+ Y + +  LAY +L SGF++NRDRIP Y
Sbjct  551   GFFFYCLLIYASFWSGSSVVTFISGVVPHIMLCYMVAITYLAYCLLLSGFYVNRDRIPFY  610

Query  2147  WIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTL  2326
             W WFHY SL+KYP++ VL NEFD P +CFVKG+Q+FD + L  V  + K+KLL+ +S +L
Sbjct  611   WTWFHYISLLKYPYEAVLINEFDDPSRCFVKGVQVFDSTLLGGVSHSGKVKLLETLSDSL  670

Query  2327  GINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKR  2497
                IT STCL TG D+L Q G+T ++KW+CLWIT A G FFR+LFYFALL GS+NKR
Sbjct  671   RTRITESTCLRTGSDLLAQQGITQLSKWDCLWITFASGLFFRILFYFALLFGSRNKR  727



>ref|NP_001054488.2| Os05g0120000 [Oryza sativa Japonica Group]
 gb|EEE62136.1| hypothetical protein OsJ_16923 [Oryza sativa Japonica Group]
 dbj|BAF16402.2| Os05g0120000 [Oryza sativa Japonica Group]
Length=680

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/684 (61%), Positives = 520/684 (76%), Gaps = 10/684 (1%)
 Frame = +2

Query  452   NDHRVLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVL  631
              D  VL + D     +  P+ L+F +LSY+V  RR   +P      T AP       K L
Sbjct  6     GDCVVLDIDDAAAQSTPVPYALTFTDLSYTVGSRRAGLLPPL---PTDAPP-----AKAL  57

Query  632   LDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVIS  811
             LD ISGEAR+GE++AV+GASGSGKSTL+DALA RIAR SL G V++NGE L  + ++ IS
Sbjct  58    LDGISGEARDGEVLAVMGASGSGKSTLLDALAGRIARGSLRGRVELNGEALHGRRVRAIS  117

Query  812   AYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDe  991
             AYVMQDD+L+PMLTV ETLMF+AEFRLPR+LS  +K+ARV ALI QLGL  AA T++GDE
Sbjct  118   AYVMQDDVLYPMLTVRETLMFAAEFRLPRALSPDKKRARVDALIGQLGLARAADTIVGDE  177

Query  992   ghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMS  1171
              HRGVSGGERRRVSIG DI+HDPI+LFLDEPTSGLDS SAFMVV+VL+RIAQSGS+++M+
Sbjct  178   AHRGVSGGERRRVSIGTDIVHDPILLFLDEPTSGLDSASAFMVVQVLRRIAQSGSVIVMT  237

Query  1172  VHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIREL  1351
             +HQPS RILN+LDRL+ LS+G+TV++GSPS L  FF  FG PIP+NEN  EFALD IREL
Sbjct  238   IHQPSARILNILDRLLLLSRGRTVYAGSPSGLKPFFSVFGYPIPDNENLVEFALDTIREL  297

Query  1352  EQSPEGTKNLVDFNKSWQRKFSPS-STSNRNNVFPNPKPSLKDAISASISRGKLVSGATN  1528
             E  P+G   LV F+  WQ        T +  +        L+ AI+ S+SRGKLV+  + 
Sbjct  298   EHQPDGAAMLVKFSSRWQSSLGALLDTKDDKDRSQRCTMPLELAIAESVSRGKLVA-GSG  356

Query  1529  INSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLD  1708
               +  S SVP +ANP++VE+ V+ KR+  N+ RMPELF MR G ++VTG ILATIFW+LD
Sbjct  357   SGTLSSTSVPTYANPWYVEVWVLMKRAFTNTRRMPELFVMRLGTIMVTGFILATIFWRLD  416

Query  1709  DSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiis  1888
             D+PKG+QERLGFFA AMST FY CA+A+PVF+QER+I++RETA+NAYRR SYV++++ ++
Sbjct  417   DTPKGVQERLGFFAMAMSTMFYVCADALPVFVQERHIYLRETAHNAYRRLSYVVANTAVA  476

Query  1889  lpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAY  2068
              P L  LSLAFAVTT++AV L+GG + F FF L V ASFWAGS FVTFLS ++ +VM+ Y
Sbjct  477   FPPLVVLSLAFAVTTFFAVRLSGGGASFAFFALTVLASFWAGSGFVTFLSAVVPHVMLGY  536

Query  2069  TLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQ  2248
             T+VVAILAYF+LFSGFFINRDRIP YWIWFHY SLVKYP+Q VLQNEF    +CF +G++
Sbjct  537   TVVVAILAYFLLFSGFFINRDRIPSYWIWFHYLSLVKYPYQAVLQNEFRDAARCFSRGVE  596

Query  2249  IFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWIT  2428
             +FDG+P+ A+ +A+KLK+L  +  TLG  +T+ TC+ TG D+L Q  VTDI +W CL +T
Sbjct  597   MFDGTPIGAMSKAVKLKVLDAIGATLGAPLTAETCVVTGADVLAQQAVTDIGRWKCLLVT  656

Query  2429  IAlgfffrllfyfallIGSKNKRR  2500
             +A GFFFR LFY  L  GSKNKRR
Sbjct  657   VAFGFFFRFLFYIVLHFGSKNKRR  680



>emb|CDY65003.1| BnaAnng19960D [Brassica napus]
Length=714

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/728 (58%), Positives = 539/728 (74%), Gaps = 23/728 (3%)
 Frame = +2

Query  338   LQELTRRPRHSVSM---TLGELLHRVGDSAGEKLNNGVGGAND--HRVLQLYDPVPYPSS  502
             +Q     P  ++S+   TL ELL        E+ ++ V  ++D  H ++ +     +   
Sbjct  1     MQRALEEPHCTISVGSPTLVELLTDCDSFRKEEDSSSVARSDDPAHSIIDV--EAFHVKP  58

Query  503   FPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVL  682
               FVL+F+NL Y+V  RR      W        S   + VK LLDD+SGEA +G I+AVL
Sbjct  59    VRFVLAFNNLQYNVTFRR------WFDFSRPRSS---DTVKTLLDDVSGEACDGNILAVL  109

Query  683   GASGSGKSTLIDALANRIARESLGGTVKMNGE-VLESKLLKVISAYVMQDDLLFPMLTVE  859
             GASG+GKSTLIDALA R+A+ESL G V +NGE VLES+LLKVISAYVMQDDLLFPMLTV+
Sbjct  110   GASGAGKSTLIDALAGRVAKESLRGFVTLNGENVLESQLLKVISAYVMQDDLLFPMLTVK  169

Query  860   ETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsig  1039
             ETLMF++EFRLPRS  +S+K  RVQALI+QLGL+ AA TVIGDEGHRGVSGGERRRVSIG
Sbjct  170   ETLMFASEFRLPRSFPKSKKMERVQALIDQLGLRNAADTVIGDEGHRGVSGGERRRVSIG  229

Query  1040  iDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLI  1219
             IDIIHDPIVLFLDEPTSGLDS++AFMVV+VL+RIAQSGSIV+MS+HQPS RI++LLDRLI
Sbjct  230   IDIIHDPIVLFLDEPTSGLDSSNAFMVVQVLKRIAQSGSIVVMSIHQPSTRIIDLLDRLI  289

Query  1220  FLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKS  1399
              LS+G+ VFSGSP+SLP FF   G+ IPE EN  EFALD +R+LE S EGT+ LV+FN+ 
Sbjct  290   ILSRGKNVFSGSPASLPNFFSNLGHTIPEKENITEFALDVVRKLEGSTEGTRELVEFNEK  349

Query  1400  WQRKFSPSSTSNRNNVFPNPKP-SLKDAISASISRGKLVSGATNI-NSTLSPSVPKFANP  1573
             WQ+     S S R    P P   SLK+AI  S+SRGKLVSG++   N T   +V  + NP
Sbjct  350   WQQSNLGLSQSAR----PTPHGLSLKEAIIESVSRGKLVSGSSGAANFTSMETVSSYTNP  405

Query  1574  FWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAF  1753
                E  ++ KR M N +RMPEL   R   V+VT  +LAT++WKLD++P+G QERL FFAF
Sbjct  406   SLFETFILAKRYMRNWIRMPELLGTRIAIVMVTAFLLATVYWKLDNTPRGAQERLTFFAF  465

Query  1754  AMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTT  1933
              + TTFY C + +PVF+QERYIF+RET  NAYR SSYV+SHS++SLP L   SL F+  T
Sbjct  466   VVPTTFYLCLDNVPVFIQERYIFLRETTRNAYRTSSYVISHSLVSLPQLIAPSLVFSSIT  525

Query  1934  YWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSG  2113
             +W VGL GG  GF+F+ L ++ASFW+GSS VTF+SG++ ++M++Y + +A +AY +L SG
Sbjct  526   FWTVGLRGGLEGFVFYCLIIYASFWSGSSVVTFISGLVPHIMLSYMVTIAYVAYCLLLSG  585

Query  2114  FFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMK  2293
             F++ RDRIP YWIWFHY S +KYP++ VL NEFD P +CFVKG+Q+F+G+ L  V +  K
Sbjct  586   FYVVRDRIPSYWIWFHYISPIKYPYEAVLINEFDDPSRCFVKGVQVFEGTLLGGVSDKKK  645

Query  2294  LKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfal  2473
             ++LL+ +S++L   IT STCL TG D+L Q G+T ++KW+CLWIT+A G FFR+LFYFAL
Sbjct  646   VELLETLSRSLSTRITQSTCLRTGSDLLSQQGITQLSKWDCLWITLASGLFFRILFYFAL  705

Query  2474  lIGSKNKR  2497
             L GSKNKR
Sbjct  706   LFGSKNKR  713



>ref|XP_002439184.1| hypothetical protein SORBIDRAFT_09g001940 [Sorghum bicolor]
 gb|EES17614.1| hypothetical protein SORBIDRAFT_09g001940 [Sorghum bicolor]
Length=710

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/685 (61%), Positives = 523/685 (76%), Gaps = 23/685 (3%)
 Frame = +2

Query  506   PFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQV------------------ENDVKVL  631
             P+VL F +LSYSV+ R K G    L   ++   ++                      K L
Sbjct  29    PYVLHFADLSYSVRTRSKGGGGGLLPSSSSGHRRLVASAATPPPPAPTSSGSSSRRTKTL  88

Query  632   LDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVIS  811
             LD +SG AR GE++AV+GASGSGKSTL+DALA RIAR+SL G V +NGE L+ + L+ IS
Sbjct  89    LDGVSGAARAGELLAVMGASGSGKSTLLDALAGRIARDSLRGAVTLNGEPLQGRRLRAIS  148

Query  812   AYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDe  991
             A+VMQDDLL+ MLTV ETL F+AEFRLPR+LS  RK+ARV AL++QLGL  AA T+IGDE
Sbjct  149   AHVMQDDLLYAMLTVRETLRFAAEFRLPRALSAERKRARVDALVDQLGLSRAADTIIGDE  208

Query  992   ghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMS  1171
             GHRGVSGGERRRVSIG DIIHDPI+LFLDEPTSGLDS SAFMVV+VL+R+AQSGS+V+M+
Sbjct  209   GHRGVSGGERRRVSIGTDIIHDPILLFLDEPTSGLDSASAFMVVQVLRRVAQSGSVVVMT  268

Query  1172  VHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIREL  1351
             +HQPS RIL +LD L+ LS+G+TV++G+P+ L  FF EFG P+P+NEN  EFALD IRE 
Sbjct  269   IHQPSTRILGILDSLLLLSRGRTVYAGTPAGLKPFFAEFGAPVPDNENPAEFALDTIREY  328

Query  1352  EQSPEGTKNLVDFNKSWQRKFSPS--STSNRNNVFPNPKPSLKDAISASISRGKLVSGAT  1525
             E  P+G   + DFN  WQ   S S  +  N NN   N    L+ AI+ S+SRGKLV+G+ 
Sbjct  329   EHQPDGAAPIADFNVKWQHSSSASFAAVDNNNN---NKLMPLELAIAESVSRGKLVAGSG  385

Query  1526  NINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKL  1705
                   + +VP FANP W E+ V+ KRS  N+ RMPELF MR G ++VTG ILATIFW+L
Sbjct  386   GTGGGSAVTVPTFANPPWTEVWVLIKRSFTNTGRMPELFVMRLGTIMVTGFILATIFWRL  445

Query  1706  DDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsii  1885
             DD+PKG+QERLGFFA AMST FY CA+A+PVF+QER+I++RETA+NAYRR SYVL+++++
Sbjct  446   DDTPKGVQERLGFFAMAMSTMFYVCADALPVFVQERHIYLRETAHNAYRRISYVLANAVV  505

Query  1886  slpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIA  2065
             + P L  LSLAFAVTT+WAVGLAGG S FLFF+L V AS WAGS FVTFLS ++ +VM+ 
Sbjct  506   AFPPLVLLSLAFAVTTFWAVGLAGGASSFLFFVLIVLASLWAGSGFVTFLSAVVPHVMLG  565

Query  2066  YTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGI  2245
             YT+VVAILAYF+LFSGFFI RDRIP YWIWFHY SLVKYP+Q VLQNEF    +CF +G+
Sbjct  566   YTVVVAILAYFLLFSGFFITRDRIPDYWIWFHYLSLVKYPYQAVLQNEFGAASRCFSRGV  625

Query  2246  QIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWI  2425
             ++FDG+P+  +PEAMK+K+L+ +S TLG N+T+ TC+ TG D+L Q  V DI+KW CL +
Sbjct  626   EMFDGTPIGRMPEAMKMKVLEAISATLGTNVTADTCVVTGADVLAQQAVMDISKWKCLLV  685

Query  2426  TIAlgfffrllfyfallIGSKNKRR  2500
             T+A GFFFR+LFY  LL+GSKNKR+
Sbjct  686   TVAWGFFFRVLFYVVLLVGSKNKRK  710



>ref|XP_009124228.1| PREDICTED: ABC transporter G family member 19-like [Brassica 
rapa]
Length=757

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/732 (58%), Positives = 544/732 (74%), Gaps = 24/732 (3%)
 Frame = +2

Query  329   AMELQELTRRPRHSVSM---TLGELLHRVGDSAGEKLNNGVGGAND--HRVLQLYDPVPY  493
             A+++Q     P  ++S+   TL ELL        E+ ++ V  ++D  H ++ +     +
Sbjct  40    ALKMQRALEEPHCTISVGSPTLVELLTDCDSFRKEEDSSSVARSDDPAHSIIDV--EALH  97

Query  494   PSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIM  673
                  FVL+F+NL Y+V  RR      W        S   + VK LLDD+SGEA +G I+
Sbjct  98    VKPVRFVLAFNNLEYNVTFRR------WFDFSRPRSS---DTVKTLLDDVSGEACDGNIL  148

Query  674   AVLGASGSGKSTLIDALANRIARESLGGTVKMNGE-VLESKLLKVISAYVMQDDLLFPML  850
             AVLGASG+GKSTLIDALA R+A+ESL G+V +NGE VLES+LLKVISAYVMQDDLLFPML
Sbjct  149   AVLGASGAGKSTLIDALAGRVAKESLKGSVTLNGENVLESQLLKVISAYVMQDDLLFPML  208

Query  851   TVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrv  1030
             TV+ETLMF++EFRLPRS  +S+K  RVQALI+QLGL+ AA TVIGDEGHRGVSGGERRRV
Sbjct  209   TVKETLMFASEFRLPRSFPKSKKMERVQALIDQLGLRNAADTVIGDEGHRGVSGGERRRV  268

Query  1031  sigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLD  1210
             SIGIDIIHDPIVLFLDEPTSGLDS++AFMVV+VL+RIAQSGSIV+MS+HQPS RI++LLD
Sbjct  269   SIGIDIIHDPIVLFLDEPTSGLDSSNAFMVVQVLKRIAQSGSIVVMSIHQPSTRIIDLLD  328

Query  1211  RLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDF  1390
             RLI LS+G+ VFSGSP+SLP FF   G+ IPE EN  EFALD +R+LE S EGT+ LV+F
Sbjct  329   RLIILSRGKNVFSGSPASLPNFFSNLGHTIPEKENITEFALDVVRKLEGSTEGTRELVEF  388

Query  1391  NKSWQRKFSPSSTSNRNNVFPNPKP-SLKDAISASISRGKLVSGATNINSTLS--PSVPK  1561
             N+ WQ+     S S R    P P   SLK+AI  S+SRGKLVSG+++  + L+   +V  
Sbjct  389   NEKWQQSNLGLSQSAR----PTPHGLSLKEAIIESVSRGKLVSGSSSGATYLTSMETVSS  444

Query  1562  FANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLG  1741
             + NP   E  ++ KR M N +RMPEL   R   V+VT  +LAT++WKLD++P+G QE+L 
Sbjct  445   YTNPSLFETFILAKRYMRNWIRMPELLGTRIAIVMVTAFLLATVYWKLDNTPRGAQEKLT  504

Query  1742  FFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslaf  1921
             FFAF + TTFY C + +PVF+QERYIF+RET  NAYR SSYV+SHS++SLP L   SL F
Sbjct  505   FFAFVVPTTFYLCLDNVPVFIQERYIFLRETTRNAYRTSSYVISHSLVSLPQLIAPSLVF  564

Query  1922  aVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFV  2101
             +  T+W VGL GG  GF+F+ L ++ASFW+GSS VTF+SG++ ++M++Y + +A +AY +
Sbjct  565   SSITFWTVGLHGGLEGFVFYCLIIYASFWSGSSVVTFISGLVPHIMLSYMVTIAYVAYCL  624

Query  2102  LFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVP  2281
             L SGF++ RDRIP YWIWFHY S +KYP++ VL NEFD   +CFVKG+Q+F+G+ L  V 
Sbjct  625   LLSGFYVVRDRIPSYWIWFHYISPIKYPYEAVLINEFDDKSRCFVKGVQVFEGTLLGGVS  684

Query  2282  EAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllf  2461
             +  K++LL+ +S++L   IT STCL TG D+L Q G+T ++KW+CLWIT+A G FFR+LF
Sbjct  685   DMKKVELLETLSRSLSTRITQSTCLRTGSDLLSQQGITQLSKWDCLWITLASGLFFRILF  744

Query  2462  yfallIGSKNKR  2497
             YFALL GSKNKR
Sbjct  745   YFALLFGSKNKR  756



>ref|XP_006480709.1| PREDICTED: ABC transporter G family member 20-like [Citrus sinensis]
Length=736

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/758 (56%), Positives = 550/758 (73%), Gaps = 49/758 (6%)
 Frame = +2

Query  284   MSTASSD---LPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGA-  451
             MS AS+D   L F+  +  +ELQ   R  R +              S+G  +N  +    
Sbjct  7     MSPASADDNPLLFINQKPNVELQNQNRSRRFT-------------GSSGRSINKELESEP  53

Query  452   -NDHRVLQLYDPVPYPS--------SFPFVLSFHNLSYSVKVRRKM--GVPAWLGRRTAA  598
              ND+  +   D +PY +        ++P +LSF+NLSYSVKV +K+   +P + G +   
Sbjct  54    INDYSSVISID-MPYSNGSSSNELPNYPLLLSFNNLSYSVKVGQKLLPDLP-FFGSQDDV  111

Query  599   PSQVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGE  778
                     K+LLDDISG AREGEI A+LGASGS K+TL+DA+A RI+++ L GTV +NGE
Sbjct  112   -----KKTKLLLDDISGVAREGEITAILGASGSSKTTLMDAIAGRISKQRLKGTVTLNGE  166

Query  779   VLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGL  958
             VL SKLLK+ISAYVMQDDLL+ MLT+EETLMFSAEFRLPRSLS+ +K+ RV ALI+QLGL
Sbjct  167   VLGSKLLKIISAYVMQDDLLYSMLTIEETLMFSAEFRLPRSLSKEKKRKRVDALIDQLGL  226

Query  959   QTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQR  1138
             ++AA T+IGDE HRGVSGGERRRVSIG+DIIHDPI+LFLDEP SGLDSTSAF VVKVL++
Sbjct  227   RSAAMTIIGDEQHRGVSGGERRRVSIGVDIIHDPILLFLDEPISGLDSTSAFNVVKVLKQ  286

Query  1139  IAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENR  1318
             IA+SGSIVIMS+HQPS+RIL+LLDRLIFLS GQ V S +PS+L +FF  FG+ IPENEN+
Sbjct  287   IAKSGSIVIMSIHQPSHRILSLLDRLIFLSNGQAVCSEAPSNLSQFFGAFGHRIPENENQ  346

Query  1319  CEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASIS  1498
              EFALD IR+LE SP G   LV+FNKS Q        S R+     PK  LKDAI ASI 
Sbjct  347   AEFALDLIRDLEDSPGGVSTLVEFNKSRQ-------YSKRD--LDEPKCELKDAIKASIV  397

Query  1499  RGKLVSGAT----NINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVV  1666
             +GKLV+  T    +I S L+ SV  +ANPFW+EM+++ KR M+NS RMPELF +RF  V 
Sbjct  398   KGKLVTTGTASNDDIGSDLTSSVQTYANPFWIEMMILSKRLMINSRRMPELFVVRFATVF  457

Query  1667  VTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNA  1846
                +I A ++W+LD+SP+G Q R+GFF F ++  F+ C+  IPVFLQER IF+RETAYNA
Sbjct  458   AAAVITAGLYWQLDNSPRGTQGRIGFFGFGITLIFFQCSREIPVFLQERQIFIRETAYNA  517

Query  1847  YRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFV  2026
             YR SSY+L+HS++ +PS+  LSL FA TT+WAVGLAGGFSGFLFF + +  SFW GSSF+
Sbjct  518   YRVSSYLLAHSLVPIPSMIILSLVFAATTFWAVGLAGGFSGFLFFFIIICISFWVGSSFI  577

Query  2027  TFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQN  2206
               +SG++ +VM+ + +V  +L YF++FSG +I RD++  +W+  HY SLVKYPFQ +LQN
Sbjct  578   ALISGLVSHVMVGFIIVACLLGYFLVFSGAYIPRDQMRSFWVLLHYTSLVKYPFQSILQN  637

Query  2207  EF-DYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQ  2383
             E+ D   KCFV+G+Q F+ +    +PE++K+KLL++M   LG NIT S+CL TG  IL+ 
Sbjct  638   EYGDDSTKCFVRGVQFFEDTIFVHLPESVKIKLLKSMGHVLGKNITGSSCLATGGKILEH  697

Query  2384  TGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKR  2497
             +G TDI+KWNC W+T+  G  FR+LFYF LL+GSKNKR
Sbjct  698   SGATDISKWNCFWLTVGFGVLFRVLFYFILLLGSKNKR  735



>ref|XP_009139199.1| PREDICTED: ABC transporter G family member 17 [Brassica rapa]
Length=662

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/678 (60%), Positives = 521/678 (77%), Gaps = 23/678 (3%)
 Frame = +2

Query  464   VLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDI  643
             V+ ++ P   P   P VL+F++L+Y V + R+ G          +P+QV    K LL+ I
Sbjct  7     VISVHSPGTRP--LPLVLAFNDLTYKVTLPRRFGFRF-----RRSPAQV----KTLLNGI  55

Query  644   SGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKLLKVISAYVM  823
             +GE  EGEI+A+LGASGSGKSTLIDALA RI+  SL G V +NGE L+S++L+VISAYVM
Sbjct  56    TGETNEGEILAILGASGSGKSTLIDALAGRISEGSLKGKVTLNGEALQSRMLQVISAYVM  115

Query  824   QDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrg  1003
             QDDLLFPMLTV+ETLMF+AEFRLPRSL +S+K+ RV+ LI+QLGL+T   T+IGDEGHRG
Sbjct  116   QDDLLFPMLTVQETLMFAAEFRLPRSLPKSKKRDRVETLIDQLGLRTVKNTMIGDEGHRG  175

Query  1004  vsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQP  1183
             VSGGERRRVSIG DIIHDPIVLFLDEPTSGLDST AFMVV+VL++IA SGSIV+MS+HQP
Sbjct  176   VSGGERRRVSIGTDIIHDPIVLFLDEPTSGLDSTCAFMVVQVLKQIACSGSIVVMSIHQP  235

Query  1184  SYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSP  1363
             S RI+ LLDRL+ LS GQ VFS SP++LP FF EFG PIP+ EN  EF LD I++LE + 
Sbjct  236   SCRIMELLDRLLVLSSGQCVFSDSPATLPLFFSEFGRPIPDKENNAEFTLDLIKDLEGTS  295

Query  1364  EGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASISRGKLVSGATNINSTL  1543
              GT  LV+FN+SWQ+K    S    +N  P     L++ I+ASI+RGKLV+ + N     
Sbjct  296   GGTSRLVEFNRSWQQKKLRVSQEPHHNSSP-----LRETINASITRGKLVTTSYN-----  345

Query  1544  SPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKG  1723
               S   + NP+WVE +++ KR M+N  R PEL   R   V++TG +LAT++W++DDSP+G
Sbjct  346   --SKASYVNPWWVETLILAKRYMINWTRTPELIGTRVFIVMMTGFLLATVYWRVDDSPRG  403

Query  1724  IQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpsla  1903
             +QERL FF+FAM+T FY+CA+ +P F+QERYIFMRETA+NAYRRSSYV+SHS+++LP L 
Sbjct  404   VQERLSFFSFAMATMFYSCADGLPTFIQERYIFMRETAHNAYRRSSYVISHSLVTLPHLF  463

Query  1904  flslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVA  2083
              LS+ FA TT+W VGL GG +GF+++LL +FASFW+G SFVTF+SG+I NVM++Y +   
Sbjct  464   ALSVGFAATTFWFVGLNGGLAGFIYYLLIIFASFWSGCSFVTFVSGVIPNVMMSYMVTFG  523

Query  2084  ILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGS  2263
              L+Y +LFSGF+INRDRI  YWIW HY SL+KYP++ VL NEFD P +CFV+G Q+FD +
Sbjct  524   YLSYCLLFSGFYINRDRIHLYWIWIHYISLLKYPYEAVLHNEFDDPSRCFVRGNQVFDNT  583

Query  2264  PLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgf  2443
              ++ VPE+MK KLL+ M   LG+ +T STCL TG ++LKQ G+  ++KW CLW+T+A GF
Sbjct  584   FMEGVPESMKEKLLETMGSYLGMELTESTCLRTGSELLKQHGIEQLDKWGCLWVTLAWGF  643

Query  2444  ffrllfyfallIGSKNKR  2497
             FFR+LFYF+L  GSKNKR
Sbjct  644   FFRILFYFSLSFGSKNKR  661



>emb|CDY37656.1| BnaC04g29980D [Brassica napus]
Length=713

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/728 (58%), Positives = 541/728 (74%), Gaps = 24/728 (3%)
 Frame = +2

Query  338   LQELTRRPRHSVSM---TLGELLHRVGDSAGEKLNNGVGGAND--HRVLQLYDPVPYPSS  502
             +Q     P  ++S+   TL ELL    DS  ++ ++ V  ++D  H ++ +      P  
Sbjct  1     MQRAFEEPHCAISVGSPTLVELLTDC-DSFRKEESSSVARSDDPVHSIIDVEALHVKPVR  59

Query  503   FPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVL  682
             F  VL+F+ L Y+V  RR      W        S   + VK LLDD+SGEA +G I+AVL
Sbjct  60    F--VLAFNKLEYNVTFRR------WFDFSRPRSS---DTVKTLLDDVSGEACDGNILAVL  108

Query  683   GASGSGKSTLIDALANRIARESLGGTVKMNGE-VLESKLLKVISAYVMQDDLLFPMLTVE  859
             GASG+GKSTLIDALA R+A+ESL G+V +NGE VL+S+LLKVISAYVMQDDLLFPMLTV+
Sbjct  109   GASGAGKSTLIDALAGRVAKESLRGSVTLNGENVLQSQLLKVISAYVMQDDLLFPMLTVK  168

Query  860   ETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsig  1039
             ETLMF++EFRLPRS  +S+K  RVQALI+QLGL+ AA TVIGDEGHRGVSGGERRRVSIG
Sbjct  169   ETLMFASEFRLPRSFPKSKKMERVQALIDQLGLRNAADTVIGDEGHRGVSGGERRRVSIG  228

Query  1040  iDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLI  1219
             IDIIHDPIVLFLDEPTSGLDS++AFMVV+VL+RIAQSGS+V+MS+HQPS RI++LLDRLI
Sbjct  229   IDIIHDPIVLFLDEPTSGLDSSNAFMVVQVLKRIAQSGSVVVMSIHQPSTRIIDLLDRLI  288

Query  1220  FLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKS  1399
              LS+G+ VFSGSP+SLPRFF   G+ IPE EN  EFALD +R+LE S EGT+ LV+FN+ 
Sbjct  289   ILSRGKNVFSGSPASLPRFFSNLGHTIPEKENITEFALDLVRKLEGSTEGTRELVEFNEK  348

Query  1400  WQRKFSPSSTSNRNNVFPNPKP-SLKDAISASISRGKLVSGATN-INSTLSPSVPKFANP  1573
             WQ+     S S R    P P+  SLK+AI  S+SRGKLVSG++   N T   +V  + NP
Sbjct  349   WQQDSCGLSQSAR----PTPQGLSLKEAIIESVSRGKLVSGSSGATNFTSMETVSSYTNP  404

Query  1574  FWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAF  1753
                E  ++ KR M N +RMPEL   R   V+VT  +LAT++WKLD++P+G QERL FFAF
Sbjct  405   SLFETFILAKRYMRNWIRMPELLGTRIAIVMVTAFLLATVYWKLDNTPRGAQERLTFFAF  464

Query  1754  AMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTT  1933
              + TTFY C + +PVF+QERYIF+RET  NAYR SSYV+SHS++SLP L   SL F+  T
Sbjct  465   VVPTTFYLCLDNVPVFIQERYIFLRETTRNAYRTSSYVISHSLVSLPQLIAPSLVFSTIT  524

Query  1934  YWAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSG  2113
             +W VGL GG  G++F+ L ++ASFW+GSS VTF+SG++ ++M++Y + +A +AY +L SG
Sbjct  525   FWTVGLRGGLEGYVFYCLIIYASFWSGSSVVTFISGLVPHIMLSYMVTIAYVAYCLLLSG  584

Query  2114  FFINRDRIPPYWIWFHYASLVKYPFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMK  2293
             F++ RDRIP YWIWFHY S +KYP++ VL NEFD P +CFVKG+Q+F+G+ L  V +  K
Sbjct  585   FYVVRDRIPSYWIWFHYISPIKYPYEAVLINEFDDPSRCFVKGVQVFEGTLLGGVSDMKK  644

Query  2294  LKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDINKWNCLWITIAlgfffrllfyfal  2473
             ++LL+ +S++L   IT STCL TGP  L Q G+  ++KW+CLWIT+A G FFR+LFYFAL
Sbjct  645   VELLETLSRSLSTRITQSTCLRTGPGFLSQQGIPQLSKWDCLWITLASGLFFRILFYFAL  704

Query  2474  lIGSKNKR  2497
             L GSKNKR
Sbjct  705   LFGSKNKR  712



>ref|XP_006428974.1| hypothetical protein CICLE_v10011167mg [Citrus clementina]
 gb|ESR42214.1| hypothetical protein CICLE_v10011167mg [Citrus clementina]
Length=730

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/758 (56%), Positives = 550/758 (73%), Gaps = 49/758 (6%)
 Frame = +2

Query  284   MSTASSD---LPFLGPRQAMELQELTRRPRHSVSMTLGELLHRVGDSAGEKLNNGVGGA-  451
             MS AS+D   L F+  +  +ELQ   R  R +              S+G  +N  +    
Sbjct  1     MSPASADDNPLLFINQKPNVELQNQNRSRRFT-------------GSSGRSINKELESEP  47

Query  452   -NDHRVLQLYDPVPYPS--------SFPFVLSFHNLSYSVKVRRKM--GVPAWLGRRTAA  598
              ND+  +   D +PY +        ++P +LSF+NLSYSVKV +K+   +P + G +   
Sbjct  48    INDYSSVISID-MPYSNGSSSNELPNYPLLLSFNNLSYSVKVGQKLLPDLP-FFGSQDDV  105

Query  599   PSQVENDVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGE  778
                     K+LLDDISG AREGEI A+LGASGS K+TL+DA+A RI+++ L GTV +NGE
Sbjct  106   -----KKTKLLLDDISGVAREGEITAILGASGSSKTTLMDAIAGRISKQRLKGTVTLNGE  160

Query  779   VLESKLLKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGL  958
             VL SKLLK+ISAYVMQDDLL+ MLT+EETLMFSAEFRLPRSLS+ +K+ RV ALI+QLGL
Sbjct  161   VLGSKLLKIISAYVMQDDLLYSMLTIEETLMFSAEFRLPRSLSKEKKRKRVDALIDQLGL  220

Query  959   QTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQR  1138
             ++AA T+IGDE HRGVSGGERRRVSIG+DIIHDPI+LFLDEP SGLDSTSAF VVKVL++
Sbjct  221   RSAAMTIIGDEQHRGVSGGERRRVSIGVDIIHDPILLFLDEPISGLDSTSAFNVVKVLKQ  280

Query  1139  IAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENR  1318
             IA+SGSIVIMS+HQPS+RIL+LLDRLIFLS GQ V S +PS+L +FF  FG+ IPENEN+
Sbjct  281   IAKSGSIVIMSIHQPSHRILSLLDRLIFLSNGQAVCSEAPSNLSQFFGAFGHRIPENENQ  340

Query  1319  CEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPSLKDAISASIS  1498
              EFALD IR+LE SP G   LV+FNKS Q        S R+     PK  LKDAI ASI 
Sbjct  341   AEFALDLIRDLEDSPGGVSTLVEFNKSRQ-------YSKRD--LDEPKCELKDAIKASIV  391

Query  1499  RGKLVSGAT----NINSTLSPSVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVV  1666
             +GKLV+  T    +I S L+ SV  +ANPFW+EM+++ KR M+NS RMPELF +RF  V 
Sbjct  392   KGKLVTTGTASNDDIGSDLTSSVQTYANPFWIEMMILSKRLMINSRRMPELFVVRFATVF  451

Query  1667  VTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNA  1846
                +I A ++W+LD+SP+G Q R+GFF F ++  F+ C+  IPVFLQER IF+RETAYNA
Sbjct  452   AAAVITAGLYWQLDNSPRGTQGRIGFFGFGITLIFFQCSREIPVFLQERQIFIRETAYNA  511

Query  1847  YRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFV  2026
             YR SSY+L+HS++ +PS+  LSL FA TT+WAVGLAGGFSGFLFF + +  SFW GSSF+
Sbjct  512   YRVSSYLLAHSLVPIPSMIILSLVFAATTFWAVGLAGGFSGFLFFFIIICISFWVGSSFI  571

Query  2027  TFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQN  2206
               +SG++ +VM+ + +V  +L YF++FSG +I RD++  +W+  HY SLVKYPFQ +LQN
Sbjct  572   ALISGLVSHVMVGFIIVACLLGYFLVFSGAYIPRDQMRSFWVLLHYTSLVKYPFQSILQN  631

Query  2207  EF-DYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQ  2383
             E+ D   KCFV+G+Q F+ +    +PE++K+KLL++M   LG NIT S+CL TG  IL+ 
Sbjct  632   EYGDDSTKCFVRGVQFFEDTIFVHLPESVKIKLLKSMGHVLGKNITGSSCLATGGKILEH  691

Query  2384  TGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKR  2497
             +G TDI+KWNC W+T+  G  FR+LFYF LL+GSKNKR
Sbjct  692   SGATDISKWNCFWLTVGFGVLFRVLFYFILLLGSKNKR  729



>ref|XP_010516067.1| PREDICTED: ABC transporter G family member 19-like isoform X1 
[Camelina sativa]
Length=744

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/699 (59%), Positives = 525/699 (75%), Gaps = 47/699 (7%)
 Frame = +2

Query  506   PFVLSFHNLSYSVKVRRKMGVPAWLGRRTAAPSQVENDVKVLLDDISGEAREGEIMAVLG  685
             PFVL+F+NL Y V + R+ G      RR+         VK LLDD+SGEA +G+I+AVLG
Sbjct  57    PFVLAFNNLEYDVILGRRFG----FSRRSG--------VKTLLDDVSGEACDGDILAVLG  104

Query  686   ASGSGKSTLIDALANRIARESLGGTVKMNGE-VLESKLLKVISAYVMQDDLLFPMLTVEE  862
             ASG+GKSTLIDALA R+A+ SL G+V +NGE VL+++LLKVISAYVMQ+DLLFPMLTV+E
Sbjct  105   ASGAGKSTLIDALAGRVAQGSLKGSVTLNGEKVLQTRLLKVISAYVMQEDLLFPMLTVKE  164

Query  863   TLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigi  1042
             TLMF++EFRLPRSLS+S+K  RV+ALI+QLGL+ AA TVIGDEGHRGVSGGERRRVSIGI
Sbjct  165   TLMFASEFRLPRSLSKSKKMERVEALIDQLGLRNAANTVIGDEGHRGVSGGERRRVSIGI  224

Query  1043  DIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIF  1222
             DIIHDPIVLFLDEPTSGLDST+AFMVV+VL+RIAQSGSIVIMS+HQPS RI+ LLDRLI 
Sbjct  225   DIIHDPIVLFLDEPTSGLDSTNAFMVVQVLKRIAQSGSIVIMSIHQPSARIVELLDRLII  284

Query  1223  LSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSW  1402
             LS+G++VF+GSP+SLP FF +FG PIPE EN  EFALD +RELE S E T++LVDFN+ W
Sbjct  285   LSRGKSVFNGSPASLPGFFADFGRPIPEKENITEFALDLVRELEGSTERTRSLVDFNEKW  344

Query  1403  QR-KFSPSSTSNRNNVFPNPKP-SLKDAISASISRGKLVSGATNINSTLSPSVPKFANPF  1576
             Q+ K S S ++   N+F    P +LK+AI+AS+SRGKLVSG++        +V  +ANP 
Sbjct  345   QQNKLSFSQSAPHTNMFELDSPLTLKEAINASVSRGKLVSGSSRGTLVSMETVSSYANPS  404

Query  1577  WVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFA  1756
               E  ++ KR M N +RMPEL   R  +V+VTG +LAT++WKLD +P+G QERL  FAF 
Sbjct  405   LFETFILAKRYMKNWMRMPELVGTRIASVMVTGFLLATVYWKLDHTPRGAQERLTLFAFV  464

Query  1757  MSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLSHsiislpslaflslafaVTTY  1936
             + T FY C + +PVF+QERYIF+RET +NAYR SSYV+SHS++SLP L   SL F+  T+
Sbjct  465   VPTMFYCCLDNVPVFIQERYIFLRETTHNAYRTSSYVISHSLVSLPQLIAPSLVFSTITF  524

Query  1937  WAvglaggfsgflffllfvfasfWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGF  2116
             W VGL+GG  GF F+ L ++ASFW+GSS VTF+SG++ N+M++Y + ++ LAY +L SGF
Sbjct  525   WTVGLSGGLEGFYFYCLLIYASFWSGSSVVTFISGVVPNIMLSYMVAISYLAYCLLLSGF  584

Query  2117  FINRDRIPPYW--------------------------------IWFHYASLVKYPFQGVL  2200
             ++NRDRIP YW                                 WFHY SL+KYP++ VL
Sbjct  585   YVNRDRIPVYWTWFHYMVAISYLGYCLLLSGFYANRYRIPVYWTWFHYISLLKYPYEAVL  644

Query  2201  QNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILK  2380
              NEFD P +CFV G+Q+FD + L  V ++ K+KLL+ + K+L + IT STCL TG D+L 
Sbjct  645   INEFDDPSRCFVTGVQVFDNTLLGGVSDSGKIKLLEILGKSLKMRITESTCLRTGSDLLA  704

Query  2381  QTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKR  2497
             Q G+T+++KW CLWIT+A G F R+LFYFALL GS+NKR
Sbjct  705   QQGITELSKWECLWITVASGLFLRILFYFALLFGSRNKR  743



>ref|XP_009403872.1| PREDICTED: ABC transporter G family member 20-like [Musa acuminata 
subsp. malaccensis]
Length=728

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/692 (61%), Positives = 534/692 (77%), Gaps = 21/692 (3%)
 Frame = +2

Query  443   GGANDHRVLQLYDPVPYPSSFPFVLSFHNLSYSVKVRRKMGVPAWLGRRTAA--PSQVEN  616
             GG +D   L   D V     F FVL+F NLSYSV   R++        R AA  P Q   
Sbjct  52    GGDDDPSYLD--DLVVELPQFHFVLAFCNLSYSVWRSRRISC-----HRIAAADPEQPPA  104

Query  617   DVKVLLDDISGEAREGEIMAVLGASGSGKSTLIDALANRIARESLGGTVKMNGEVLESKL  796
               +VLLD I+GE R GEI+AVLGASGSGKST IDALA+RI R SL G++ +NGE L+S L
Sbjct  105   GRRVLLDSITGEVRTGEILAVLGASGSGKSTFIDALADRIERTSLQGSITLNGENLDSGL  164

Query  797   LKVISAYVMQDDLLFPMLTVEETLMFSAEFrlprslsrsrkkarVQALIEQLGLQTAAKT  976
             LKVISAYVMQDDLLFPMLTVEETLMF+AE RLPRS S SRK+ RVQAL++QLGL++AAKT
Sbjct  165   LKVISAYVMQDDLLFPMLTVEETLMFAAELRLPRSFSASRKRERVQALVDQLGLRSAAKT  224

Query  977   VIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLQRIAQSGS  1156
             +IGDEGHRGVSGGERRRVSIG DIIHDP++LFLDEPTSGLDSTSAFMVVKVLQ+IA+SGS
Sbjct  225   IIGDEGHRGVSGGERRRVSIGTDIIHDPVILFLDEPTSGLDSTSAFMVVKVLQKIARSGS  284

Query  1157  IVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEFGNPIPENENRCEFALD  1336
             IV+MSVHQPSYRIL LLDRL+FL +GQTV+SG P  LP FF++FG PIPE EN  EFALD
Sbjct  285   IVVMSVHQPSYRILTLLDRLLFLCRGQTVYSGPPHDLPGFFRQFGRPIPEGENATEFALD  344

Query  1337  FIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKP-SLKDAISASISRGKLV  1513
               REL+ +  G   LVDFN+ WQ +  PS+      V  +  P SL+DA+  S+S G+LV
Sbjct  345   LARELQDTNAGAAALVDFNRRWQTR--PSAL-----VAADITPLSLRDAMRISVSHGRLV  397

Query  1514  SGATNINSTLSP--SVPKFANPFWVEMVVIGKRSMVNSLRMPELFAMRFGAVVVTGIILA  1687
              G+ ++   ++P  S+ KFANP W E++V+ KR+ +N  RMPE+FA+R G V+V+  IL 
Sbjct  398   -GSVSVADNVAPASSLQKFANPAWKEVLVLSKRAFMNMRRMPEIFAIRLGTVLVSAFILG  456

Query  1688  TIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYV  1867
             TIFW+L +SPK + ERLGFFA  ++T F+TCA+A+PVF+QERYIFMRETAYNAYRRSSYV
Sbjct  457   TIFWRLGESPKDVTERLGFFAIGITTVFFTCADALPVFIQERYIFMRETAYNAYRRSSYV  516

Query  1868  LSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfasfWAGSSFVTFLSGII  2047
             LS++I+ +P+L  LS+AFA +T++AVGLAGG  G +FF L + ASFWAGS FVTFLSG++
Sbjct  517   LSNAIVGIPALILLSVAFAASTFFAVGLAGGGEGLIFFFLIILASFWAGSGFVTFLSGVL  576

Query  2048  YNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKYPFQGVLQNEF-DYPD  2224
              +V++ YT+  AIL+Y++LFSGFFINR+RIP YWIWFHY S++KY ++G LQNEF     
Sbjct  577   SHVVLGYTVAAAILSYYLLFSGFFINRNRIPHYWIWFHYLSMLKYAYEGALQNEFGGESS  636

Query  2225  KCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTTGPDILKQTGVTDIN  2404
             KCF +G+Q+FDG+ + ++P   K+++L  +SKTL +N+TS +C+ TGPD+L+Q  +  +N
Sbjct  637   KCFSRGVQMFDGTSIGSLPMETKVQVLGAISKTLQMNLTSDSCIVTGPDVLQQQSINQLN  696

Query  2405  KWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             KW CL +T+  GF FR+LFY  LL+ S+NKRR
Sbjct  697   KWECLLVTVGWGFLFRILFYITLLLSSRNKRR  728



>gb|KDO67830.1| hypothetical protein CISIN_1g037973mg, partial [Citrus sinensis]
Length=525

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/526 (73%), Positives = 445/526 (85%), Gaps = 9/526 (2%)
 Frame = +2

Query  929   VQALIEQLGLQTAAKTVIGDeghrgvsggerrrvsigiDIIHDPIVLFLDEPTSGLDSTS  1108
             VQALI+QLGL+ AAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPI+LFLDEPTSGLDSTS
Sbjct  7     VQALIDQLGLRNAAKTVIGDEGHRGVSGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTS  66

Query  1109  AFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLIFLSKGQTVFSGSPSSLPRFFQEF  1288
             A+MVVKVLQRIAQSGSIVIMS+HQPSYRIL LLDR+IFLS+GQTV+SGSP +LP FF EF
Sbjct  67    AYMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLDRMIFLSRGQTVYSGSPMNLPHFFDEF  126

Query  1289  GNPIPENENRCEFALDFIRELEQSPEGTKNLVDFNKSWQRKFSPSSTSNRNNVFPNPKPS  1468
             G+PIPENENR EFALD IRELE SP GTK+LV+FNK+WQ       + N N    +   S
Sbjct  127   GHPIPENENRTEFALDLIRELEGSPGGTKSLVEFNKTWQNM---KQSRNTNAHSDSQGLS  183

Query  1469  LKDAISASISRGKLVSGATNINSTLSPS--VPKFANPFWVEMVVIGKRSMVNSLRMPELF  1642
             LK+AISASISRGKLVSGATN N   SP+  VP FANP W EMVV+ +RS+ NS RMPELF
Sbjct  184   LKEAISASISRGKLVSGATN-NDASSPTSMVPNFANPAWKEMVVLSQRSVTNSRRMPELF  242

Query  1643  AMRFGAVVVTGIILATIFWKLDDSPKGIQERLGFFAFAMSTTFYTCAEAIPVFLQERYIF  1822
              +R GAV+VTG ILATIFW+LD SPKG+QERLGFFAFAMSTTFYTCA+A+PVFLQERYIF
Sbjct  243   GIRAGAVIVTGFILATIFWQLDSSPKGVQERLGFFAFAMSTTFYTCADALPVFLQERYIF  302

Query  1823  MRETAYNAYRRSSYVLSHsiislpslaflslafaVTTYWAvglaggfsgflffllfvfas  2002
             MRETA+NAYRRSSYVLSH++ SLP+L FLS AF+  T+WAVGL GGF  +   +   F  
Sbjct  303   MRETAHNAYRRSSYVLSHTLTSLPALVFLSFAFSAITFWAVGLDGGFFFYFLMMFASF--  360

Query  2003  fWAGSSFVTFLSGIIYNVMIAYTLVVAILAYFVLFSGFFINRDRIPPYWIWFHYASLVKY  2182
              WAG+SFVTFLSG++ +VM+ YT+VVAILAYF+LFSGFFI RDRIPPYWIWFHY SLVKY
Sbjct  361   -WAGNSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFITRDRIPPYWIWFHYLSLVKY  419

Query  2183  PFQGVLQNEFDYPDKCFVKGIQIFDGSPLKAVPEAMKLKLLQNMSKTLGINITSSTCLTT  2362
             P++ VLQ+EF  P KCFV+G+QIFD +PL AVP AMK++LL+ + +TL + IT+STCLTT
Sbjct  420   PYEAVLQSEFGNPVKCFVRGVQIFDNTPLAAVPTAMKVRLLETLGRTLNMRITTSTCLTT  479

Query  2363  GPDILKQTGVTDINKWNCLWITIAlgfffrllfyfallIGSKNKRR  2500
             G DIL +  V  ++KW+CLWIT+A GFFFR LFYF+LL+GSKNKRR
Sbjct  480   GVDILDKEAVNQLSKWSCLWITVAWGFFFRFLFYFSLLLGSKNKRR  525



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8386468565232