BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18974_g3_i1 len=745 path=[4735:0-416 4734:417-744]

Length=745
                                                                      Score     E

ref|XP_009803809.1|  PREDICTED: uncharacterized protein LOC104249134  57.0    5e-07   
emb|CAN70691.1|  hypothetical protein VITISV_007578                   59.7    8e-07   Vitis vinifera
ref|XP_002298920.1|  hypothetical protein POPTR_0001s38840g           56.6    1e-06   Populus trichocarpa [western balsam poplar]
gb|ACB72463.1|  putative virus-specific-signaling-pathway regulat...  56.2    1e-06   Nicotiana tabacum [American tobacco]
gb|EYU45046.1|  hypothetical protein MIMGU_mgv1a015553mg              55.1    3e-06   
emb|CAN66572.1|  hypothetical protein VITISV_028160                   54.3    6e-06   Vitis vinifera
ref|XP_007213967.1|  hypothetical protein PRUPE_ppa012150mg           53.9    1e-05   
ref|XP_011082875.1|  PREDICTED: uncharacterized protein LOC105165527  53.1    2e-05   
ref|XP_008226226.1|  PREDICTED: uncharacterized protein LOC103325819  52.8    3e-05   
ref|XP_011045592.1|  PREDICTED: uncharacterized protein LOC105140446  52.0    4e-05   
ref|XP_002298919.1|  hypothetical protein POPTR_0001s38830g           49.7    7e-04   Populus trichocarpa [western balsam poplar]



>ref|XP_009803809.1| PREDICTED: uncharacterized protein LOC104249134 [Nicotiana sylvestris]
Length=141

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 43/68 (63%), Gaps = 6/68 (9%)
 Frame = +1

Query  118  MAAAIPENWASFAG---DDEFIRNNGDFSEVDSALLMSILDDTQGVVGEDYDDERLRSVI  288
            MA   PENW        DD  + N  + SE+DSA+LMS LD++Q    E  DDE+LRS I
Sbjct  1    MAYLAPENWPVCINVDTDDTDLLNQIEISEIDSAILMSFLDESQ---MEYCDDEKLRSAI  57

Query  289  QSLEAEID  312
            QSLEAE+D
Sbjct  58   QSLEAELD  65



>emb|CAN70691.1| hypothetical protein VITISV_007578 [Vitis vinifera]
Length=1223

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/68 (43%), Positives = 47/68 (69%), Gaps = 2/68 (3%)
 Frame = +1

Query  118  MAAAIPENWASFAGDDEFIRNNGDFSEVDSALLMSILDDTQGVVGEDYDDERLRSVIQSL  297
            MA  +PENW     D++ +    DFS++++ALL+S L+D+QG   +++DDE+L S+++SL
Sbjct  1    MARLVPENWVCIKADEDDVFKGIDFSKINNALLISFLEDSQG--DQEHDDEQLLSMMRSL  58

Query  298  EAEIDGRT  321
            E EI   T
Sbjct  59   ETEIHPNT  66



>ref|XP_002298920.1| hypothetical protein POPTR_0001s38840g [Populus trichocarpa]
 gb|EEE83725.1| hypothetical protein POPTR_0001s38840g [Populus trichocarpa]
Length=166

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 59/98 (60%), Gaps = 8/98 (8%)
 Frame = +1

Query  118  MAAAIPENWASFAGDDEFIRNNGDFSEVDSALLMSILDDTQGVVGEDYDDERLRSVIQSL  297
            MA+ +PEN +   GDD+F    G     D+ALLMS+L+++QG    + ++ERLRSVIQSL
Sbjct  1    MASLLPENISIKTGDDDF---KGIEGYDDNALLMSLLEESQG--DHESNEERLRSVIQSL  55

Query  298  EAEIDGRTAAVDDDYDFFTDSHHYHQSSFEDSDNNFKN  411
            EAEI+   + + D YD   D     +   ED+D  FK 
Sbjct  56   EAEIN--PSIMSDGYDTAMDPAEMPRDG-EDTDELFKT  90



>gb|ACB72463.1| putative virus-specific-signaling-pathway regulated protein [Nicotiana 
tabacum]
Length=141

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 42/68 (62%), Gaps = 6/68 (9%)
 Frame = +1

Query  118  MAAAIPENWASFAG---DDEFIRNNGDFSEVDSALLMSILDDTQGVVGEDYDDERLRSVI  288
            MA   PENW        DD  + N  + SE+DSA+LMS LD++Q       DDE+LRS I
Sbjct  1    MAYLAPENWPVCINVDTDDTDLLNQIEISEIDSAILMSFLDESQMKYC---DDEKLRSAI  57

Query  289  QSLEAEID  312
            QSLEAE+D
Sbjct  58   QSLEAELD  65



>gb|EYU45046.1| hypothetical protein MIMGU_mgv1a015553mg [Erythranthe guttata]
Length=153

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 43/65 (66%), Gaps = 5/65 (8%)
 Frame = +1

Query  118  MAAAIPENWASFAGDDEFIRNNGDFSEVDSALLMSILDDTQGVVGEDYDDERLRSVIQSL  297
            MA+ + ENW    G DE    + + S+++  LLMS+LD+T     ED DDERLR VI+SL
Sbjct  1    MASVVEENWDYVDGQDE--SEDLELSQINHNLLMSLLDETPI---EDCDDERLRKVIRSL  55

Query  298  EAEID  312
            EAEID
Sbjct  56   EAEID  60



>emb|CAN66572.1| hypothetical protein VITISV_028160 [Vitis vinifera]
Length=154

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 44/71 (62%), Gaps = 3/71 (4%)
 Frame = +1

Query  118  MAAAIPENWASFAGDDEFIRNNGDFSEVDSALLMSILDDTQGVVGEDYDDERLRSVIQSL  297
            MA ++PENW     D  F     + SE+++ALLMS+LD++QG   ++ D +RL S+IQSL
Sbjct  1    MAYSLPENWRCMNADHMF-EGIEEISEINTALLMSLLDESQG--DQEADTDRLTSMIQSL  57

Query  298  EAEIDGRTAAV  330
            E EI      +
Sbjct  58   EEEIHHHEVTI  68



>ref|XP_007213967.1| hypothetical protein PRUPE_ppa012150mg [Prunus persica]
 gb|EMJ15166.1| hypothetical protein PRUPE_ppa012150mg [Prunus persica]
Length=181

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 56/89 (63%), Gaps = 11/89 (12%)
 Frame = +1

Query  118  MAAAIPENWASFAGD----DEF--IRNNGDFSEVDSALLMSILDDTQGVVGEDYDDERLR  279
            MA+ + ENW+    +    D F      G  S + +ALLMS+L++TQG   +D+D+ERLR
Sbjct  1    MASLLAENWSCMNNNMDMNDHFPGAAGAGTSSNMSNALLMSLLEETQG--DQDHDEERLR  58

Query  280  SVIQSLEAEIDGRTAAVDDDYDFFTDSHH  366
            S+I++LE E+D  T+   +D++ F ++ H
Sbjct  59   SLIRALEVELDPTTS---EDHEIFMENPH  84



>ref|XP_011082875.1| PREDICTED: uncharacterized protein LOC105165527 [Sesamum indicum]
Length=174

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 47/77 (61%), Gaps = 6/77 (8%)
 Frame = +1

Query  118  MAAAIPENWASFAGDDEFIRNNGDFSEVDSALLMSILDDTQGVVGEDYDDERLRSVIQSL  297
            MA+ + ENW       +   N  + S+++ +LLMS+LD+TQ    +D DDERL  VI+SL
Sbjct  1    MASTVSENWEYMDSTHDCFENL-ELSQINHSLLMSLLDETQV---DDCDDERLTKVIRSL  56

Query  298  EAEID--GRTAAVDDDY  342
            EAEID  G   A D +Y
Sbjct  57   EAEIDSNGHDYAYDHNY  73



>ref|XP_008226226.1| PREDICTED: uncharacterized protein LOC103325819 [Prunus mume]
Length=182

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 55/90 (61%), Gaps = 12/90 (13%)
 Frame = +1

Query  118  MAAAIPENWASFAGDDEF-------IRNNGDFSEVDSALLMSILDDTQGVVGEDYDDERL  276
            MA+ + ENW+    + +            G  S + +ALLMS+L++TQG   +D+D+ERL
Sbjct  1    MASLLAENWSCMNNNMDMNDHLFPGAAGAGTSSNMSNALLMSLLEETQG--DQDHDEERL  58

Query  277  RSVIQSLEAEIDGRTAAVDDDYDFFTDSHH  366
            RS+I++LE E+D  T+   +D++ F ++ H
Sbjct  59   RSLIRALEVELDPTTS---EDHEIFMENPH  85



>ref|XP_011045592.1| PREDICTED: uncharacterized protein LOC105140446 [Populus euphratica]
Length=165

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 49/78 (63%), Gaps = 11/78 (14%)
 Frame = +1

Query  118  MAAAIPENWASFAGDDEFIRNNGDFSEVDSALLMSILDDTQGVVGEDYDDERLRSVIQSL  297
            MA+ +PEN +   GDD+     G F   D ALLMS+L+++QG    + ++ERLRSVIQSL
Sbjct  1    MASLLPENISIKTGDDDLKGIEG-FD--DDALLMSLLEESQG--DHESNEERLRSVIQSL  55

Query  298  EAEI------DGRTAAVD  333
            EAEI      DG   A+D
Sbjct  56   EAEINPSIMSDGYETAMD  73



>ref|XP_002298919.1| hypothetical protein POPTR_0001s38830g [Populus trichocarpa]
 gb|EEE83724.1| hypothetical protein POPTR_0001s38830g [Populus trichocarpa]
Length=234

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 6/68 (9%)
 Frame = +1

Query  121  AAAIPENWASFAGDDEFIRNNGDFSEVD--SALLMSILDDTQGVVGEDYDDERLRSVIQS  294
            ++++ ENW    GD +      + SE++  +  LMS+L++TQ    EDYD+ERL S+IQS
Sbjct  63   SSSVTENWVLINGDVDS-SGGSEVSEMNNSAGFLMSLLEETQS---EDYDNERLSSLIQS  118

Query  295  LEAEIDGR  318
            LEAEID +
Sbjct  119  LEAEIDPK  126



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1272215339102