BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18963_g4_i1 len=934 path=[1019:0-886 1906:887-933]

Length=934
                                                                      Score     E

ref|XP_009604912.1|  PREDICTED: LOB domain-containing protein 30-...    213   2e-63   
ref|XP_009795320.1|  PREDICTED: LOB domain-containing protein 30        213   3e-63   
ref|XP_006339770.1|  PREDICTED: LOB domain-containing protein 18-...    212   3e-63   
emb|CDP17781.1|  unnamed protein product                                209   4e-62   
ref|XP_010692269.1|  PREDICTED: LOB domain-containing protein 18        207   2e-61   
ref|XP_004306912.1|  PREDICTED: LOB domain-containing protein 30-...    207   2e-61   
ref|XP_006445237.1|  hypothetical protein CICLE_v10021992mg             207   2e-61   
ref|XP_011034497.1|  PREDICTED: LOW QUALITY PROTEIN: LOB domain-c...    206   7e-61   
ref|XP_002279521.1|  PREDICTED: LOB domain-containing protein 18        205   1e-60   Vitis vinifera
gb|ABK28616.1|  unknown                                                 204   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002511730.1|  LOB domain-containing protein, putative            204   2e-60   Ricinus communis
ref|NP_191933.1|  protein JAGGED LATERAL ORGANS                         204   2e-60   Arabidopsis thaliana [mouse-ear cress]
emb|CBI38861.3|  unnamed protein product                                205   2e-60   
ref|NP_001132370.1|  putative LOB domain-containing family protein      205   2e-60   Zea mays [maize]
gb|KDP28744.1|  hypothetical protein JCGZ_14515                         204   2e-60   
ref|XP_002301295.2|  hypothetical protein POPTR_0002s15000g             204   3e-60   Populus trichocarpa [western balsam poplar]
ref|XP_009400358.1|  PREDICTED: LOB domain-containing protein 18-...    204   3e-60   
ref|XP_011017499.1|  PREDICTED: LOB domain-containing protein 18-...    203   5e-60   
ref|XP_010917989.1|  PREDICTED: LOB domain-containing protein 18-...    203   6e-60   
ref|XP_010426737.1|  PREDICTED: LOB domain-containing protein 30        202   1e-59   
ref|XP_010056297.1|  PREDICTED: LOB domain-containing protein 18-...    202   1e-59   
emb|CDY54923.1|  BnaAnng13580D                                          201   1e-59   
ref|XP_009128476.1|  PREDICTED: LOB domain-containing protein 30-...    201   1e-59   
ref|XP_002320063.1|  LOB domain protein 18                              202   2e-59   Populus trichocarpa [western balsam poplar]
ref|XP_009111504.1|  PREDICTED: LOB domain-containing protein 30        201   3e-59   
gb|KHG13125.1|  LOB domain-containing 18 -like protein                  201   3e-59   
ref|XP_006396221.1|  hypothetical protein EUTSA_v10028937mg             201   4e-59   
ref|XP_010906049.1|  PREDICTED: LOB domain-containing protein 18-...    201   6e-59   
ref|XP_002875043.1|  LOB domain protein 30                              200   6e-59   
ref|XP_008798540.1|  PREDICTED: LOB domain-containing protein 18        200   6e-59   
ref|XP_010276364.1|  PREDICTED: LOB domain-containing protein 30-...    201   7e-59   
emb|CDY69735.1|  BnaCnng65080D                                          199   9e-59   
ref|XP_010456310.1|  PREDICTED: LOB domain-containing protein 30-...    199   1e-58   
ref|XP_006288584.1|  hypothetical protein CARUB_v10001875mg             199   2e-58   
ref|XP_010228877.1|  PREDICTED: LOB domain-containing protein 30-...    199   2e-58   
ref|XP_007218850.1|  hypothetical protein PRUPE_ppa010383mg             198   6e-58   
ref|XP_008232676.1|  PREDICTED: LOB domain-containing protein 18        198   8e-58   
ref|NP_001167808.1|  uncharacterized protein LOC100381506               198   8e-58   Zea mays [maize]
ref|XP_003521944.1|  PREDICTED: LOB domain-containing protein 18-...    197   1e-57   
ref|XP_009379266.1|  PREDICTED: LOB domain-containing protein 18        197   1e-57   
ref|XP_008343190.1|  PREDICTED: LOB domain-containing protein 30        197   1e-57   
ref|XP_004145058.1|  PREDICTED: LOB domain-containing protein 18-...    197   2e-57   
ref|XP_004510942.1|  PREDICTED: LOB domain-containing protein 18-...    196   2e-57   
ref|XP_004231166.1|  PREDICTED: LOB domain-containing protein 30        196   5e-57   
ref|XP_011094569.1|  PREDICTED: LOB domain-containing protein 18        192   5e-57   
ref|XP_004985011.1|  PREDICTED: LOB domain-containing protein 18-...    196   6e-57   
ref|NP_001049546.1|  Os03g0246900                                       196   9e-57   Oryza sativa Japonica Group [Japonica rice]
gb|EAY89242.1|  hypothetical protein OsI_10739                          196   9e-57   Oryza sativa Indica Group [Indian rice]
ref|XP_010277398.1|  PREDICTED: LOB domain-containing protein 30-...    195   1e-56   
ref|XP_006649734.1|  PREDICTED: LOB domain-containing protein 18-...    195   1e-56   
ref|XP_003517057.1|  PREDICTED: LOB domain-containing protein 18-...    194   1e-56   
ref|XP_010092844.1|  hypothetical protein L484_022439                   194   1e-56   
ref|XP_004986691.1|  PREDICTED: LOB domain-containing protein 18-...    194   2e-56   
ref|XP_008776002.1|  PREDICTED: LOB domain-containing protein 18-...    193   4e-56   
gb|EPS64174.1|  hypothetical protein M569_10607                         189   4e-56   
ref|XP_009391108.1|  PREDICTED: LOB domain-containing protein 18-...    192   7e-56   
ref|XP_006397723.1|  hypothetical protein EUTSA_v10001791mg             192   1e-55   
ref|XP_002465559.1|  hypothetical protein SORBIDRAFT_01g041130          192   2e-55   Sorghum bicolor [broomcorn]
ref|XP_011093197.1|  PREDICTED: LOB domain-containing protein 18-...    191   2e-55   
ref|XP_006851815.1|  hypothetical protein AMTR_s00041p00044170          190   2e-55   
emb|CDY18932.1|  BnaC04g04180D                                          190   6e-55   
ref|XP_009386566.1|  PREDICTED: LOB domain-containing protein 30-...    191   6e-55   
gb|KEH19039.1|  LOB domain protein                                      189   9e-55   
ref|XP_007139994.1|  hypothetical protein PHAVU_008G075900g             189   1e-54   
ref|XP_002880178.1|  hypothetical protein ARALYDRAFT_483677             190   1e-54   
ref|XP_006295913.1|  hypothetical protein CARUB_v10025050mg             189   2e-54   
ref|XP_010508173.1|  PREDICTED: LOB domain-containing protein 18        189   2e-54   
emb|CDY68635.1|  BnaAnng27870D                                          189   2e-54   
ref|NP_850436.1|  LOB domain-containing protein 18                      189   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009142334.1|  PREDICTED: LOB domain-containing protein 18-...    189   3e-54   
ref|XP_010506484.1|  PREDICTED: LOB domain-containing protein 18        189   3e-54   
ref|XP_010544656.1|  PREDICTED: LOB domain-containing protein 18-...    188   3e-54   
gb|KFK37335.1|  hypothetical protein AALP_AA4G243200                    188   4e-54   
ref|XP_008659582.1|  PREDICTED: LOB domain-containing protein 30-...    188   4e-54   
emb|CDY57109.1|  BnaC04g56960D                                          188   5e-54   
gb|EYU30570.1|  hypothetical protein MIMGU_mgv1a013332mg                186   9e-54   
ref|XP_003552342.1|  PREDICTED: LOB domain-containing protein 18-...    187   1e-53   
ref|XP_006662199.1|  PREDICTED: LOB domain-containing protein 18-...    187   1e-53   
ref|XP_009143140.1|  PREDICTED: LOB domain-containing protein 18        186   2e-53   
ref|XP_009389181.1|  PREDICTED: LOB domain-containing protein 18-...    185   3e-53   
gb|KFK30604.1|  hypothetical protein AALP_AA6G003400                    184   1e-52   
ref|XP_002467307.1|  hypothetical protein SORBIDRAFT_01g024400          184   4e-52   Sorghum bicolor [broomcorn]
ref|XP_010544655.1|  PREDICTED: LOB domain-containing protein 18-...    182   4e-52   
ref|XP_011090856.1|  PREDICTED: LOB domain-containing protein 19        180   2e-51   
ref|XP_003534608.1|  PREDICTED: LOB domain-containing protein 18-...    181   2e-51   
ref|XP_010053892.1|  PREDICTED: LOB domain-containing protein 30-...    181   2e-51   
gb|KHM98881.1|  LOB domain-containing protein 18                        181   2e-51   
ref|XP_008460130.1|  PREDICTED: LOB domain-containing protein 19        179   8e-51   
ref|XP_007220875.1|  hypothetical protein PRUPE_ppa017589mg             179   1e-50   
ref|XP_010277396.1|  PREDICTED: LOB domain-containing protein 19-...    178   1e-50   
ref|XP_010092842.1|  hypothetical protein L484_022437                   179   1e-50   
ref|XP_004145059.1|  PREDICTED: LOB domain-containing protein 31-...    178   1e-50   
ref|XP_008232675.1|  PREDICTED: LOB domain-containing protein 19        178   2e-50   
ref|XP_003521945.2|  PREDICTED: LOB domain-containing protein 19-...    177   3e-50   
ref|XP_007134896.1|  hypothetical protein PHAVU_010G084900g             176   4e-50   
ref|XP_002273687.2|  PREDICTED: LOB domain-containing protein 19        176   5e-50   Vitis vinifera
ref|NP_001176038.1|  Os10g0162600                                       178   6e-50   
gb|EAY77788.1|  hypothetical protein OsI_32828                          178   6e-50   Oryza sativa Indica Group [Indian rice]
ref|XP_002320729.2|  hypothetical protein POPTR_0014s06580g             175   6e-50   Populus trichocarpa [western balsam poplar]
ref|XP_010276387.1|  PREDICTED: LOB domain-containing protein 19-...    176   7e-50   
ref|XP_009379264.1|  PREDICTED: LOB domain-containing protein 19        176   1e-49   
gb|KHG05660.1|  LOB domain-containing 19 -like protein                  174   2e-49   
ref|XP_011034467.1|  PREDICTED: LOB domain-containing protein 19        173   4e-49   
ref|XP_008345767.1|  PREDICTED: LOB domain-containing protein 19        174   4e-49   
ref|XP_006490937.1|  PREDICTED: LOB domain-containing protein 31-...    174   5e-49   
ref|XP_007052037.1|  LOB domain-containing protein 31                   173   5e-49   
ref|XP_004306913.1|  PREDICTED: LOB domain-containing protein 31-...    174   6e-49   
ref|XP_009803301.1|  PREDICTED: LOB domain-containing protein 19-...    174   6e-49   
ref|XP_010523689.1|  PREDICTED: LOB domain-containing protein 18-...    174   6e-49   
ref|XP_010056298.1|  PREDICTED: LOB domain-containing protein 19        174   6e-49   
ref|XP_006445238.1|  hypothetical protein CICLE_v10022291mg             173   7e-49   
gb|ACJ85221.1|  unknown                                                 173   8e-49   Medicago truncatula
ref|XP_009347042.1|  PREDICTED: LOB domain-containing protein 19-...    173   1e-48   
gb|EMS62575.1|  hypothetical protein TRIUR3_25587                       174   1e-48   
ref|XP_002511729.1|  LOB domain-containing protein, putative            172   1e-48   Ricinus communis
gb|KHN40140.1|  LOB domain-containing protein 31                        172   2e-48   
ref|XP_002302539.1|  hypothetical protein POPTR_0002s14970g             172   2e-48   Populus trichocarpa [western balsam poplar]
ref|XP_004492639.1|  PREDICTED: LOB domain-containing protein 18-...    172   3e-48   
ref|XP_009628901.1|  PREDICTED: LOB domain-containing protein 19-...    172   3e-48   
gb|EYU32001.1|  hypothetical protein MIMGU_mgv1a024257mg                171   4e-48   
ref|XP_009789949.1|  PREDICTED: LOB domain-containing protein 19        169   5e-48   
ref|XP_003571705.1|  PREDICTED: LOB domain-containing protein 30-...    172   8e-48   
ref|XP_011017497.1|  PREDICTED: LOB domain-containing protein 19-...    170   1e-47   
ref|XP_004134346.1|  PREDICTED: LOB domain-containing protein 18-...    170   2e-47   
gb|ADE76152.1|  unknown                                                 170   2e-47   
ref|XP_004510943.1|  PREDICTED: LOB domain-containing protein 31-...    169   3e-47   
ref|XP_006339769.1|  PREDICTED: LOB domain-containing protein 18-...    167   5e-47   
ref|XP_008438149.1|  PREDICTED: LOB domain-containing protein 18        169   5e-47   
ref|XP_004155866.1|  PREDICTED: LOB domain-containing protein 18-...    170   1e-46   
emb|CDP17780.1|  unnamed protein product                                165   8e-46   
ref|XP_009604914.1|  PREDICTED: LOB domain-containing protein 19-...    164   1e-45   
ref|XP_010523197.1|  PREDICTED: LOB domain-containing protein 31        164   1e-45   
ref|XP_009398866.1|  PREDICTED: LOB domain-containing protein 30-...    167   1e-45   
gb|EMT10533.1|  hypothetical protein F775_04528                         165   2e-45   
ref|XP_003623721.1|  LOB domain-containing protein                      165   3e-45   
gb|EYU32002.1|  hypothetical protein MIMGU_mgv1a022726mg                160   5e-45   
ref|XP_010424034.1|  PREDICTED: LOB domain-containing protein 30-...    162   5e-45   
ref|XP_010512839.1|  PREDICTED: LOB domain-containing protein 19        162   8e-45   
ref|XP_006289084.1|  hypothetical protein CARUB_v10002489mg             163   1e-44   
ref|NP_182065.1|  LOB domain-containing protein 19                      161   2e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882012.1|  predicted protein                                  161   2e-44   
ref|XP_006296305.1|  hypothetical protein CARUB_v10025477mg             161   2e-44   
ref|XP_009102075.1|  PREDICTED: LOB domain-containing protein 20-...    163   2e-44   
ref|XP_010692268.1|  PREDICTED: LOB domain-containing protein 19        162   2e-44   
ref|XP_006299263.1|  hypothetical protein CARUB_v10015417mg             163   3e-44   
ref|NP_191932.4|  LOB domain-containing protein 31                      162   3e-44   Arabidopsis thaliana [mouse-ear cress]
gb|KFK37803.1|  hypothetical protein AALP_AA3G031300                    163   3e-44   
ref|XP_010506483.1|  PREDICTED: LOB domain-containing protein 19        160   3e-44   
ref|NP_187026.1|  LOB domain-containing protein 20                      163   3e-44   Arabidopsis thaliana [mouse-ear cress]
emb|CDY29956.1|  BnaC01g40520D                                          163   3e-44   
gb|KDP28745.1|  hypothetical protein JCGZ_14516                         161   5e-44   
ref|XP_010419557.1|  PREDICTED: LOB domain-containing protein 31-...    161   5e-44   
ref|XP_010485728.1|  PREDICTED: LOB domain-containing protein 20        162   5e-44   
ref|XP_010426727.1|  PREDICTED: LOB domain-containing protein 31-...    160   5e-44   
ref|XP_002882305.1|  LOB domain protein 20                              162   5e-44   
ref|XP_010513804.1|  PREDICTED: LOB domain-containing protein 20-...    162   6e-44   
gb|KFK30603.1|  hypothetical protein AALP_AA6G003300                    160   6e-44   
ref|XP_001779579.1|  predicted protein                                  157   7e-44   
ref|XP_006397722.1|  hypothetical protein EUTSA_v10001778mg             160   7e-44   
ref|XP_008467063.1|  PREDICTED: LOB domain-containing protein 18-...    157   1e-43   
ref|XP_006408269.1|  hypothetical protein EUTSA_v10021301mg             162   1e-43   
emb|CDX74209.1|  BnaA03g28380D                                          161   1e-43   
ref|XP_010463835.1|  PREDICTED: LOB domain-containing protein 20-...    161   2e-43   
ref|XP_010549704.1|  PREDICTED: LOB domain-containing protein 20        160   2e-43   
ref|XP_001772946.1|  predicted protein                                  155   3e-43   
ref|XP_009142333.1|  PREDICTED: LOB domain-containing protein 19-...    157   3e-43   
emb|CDX92049.1|  BnaC03g33510D                                          160   3e-43   
ref|XP_001759142.1|  predicted protein                                  156   6e-43   
ref|XP_001763572.1|  predicted protein                                  155   6e-43   
emb|CDY57108.1|  BnaC04g56950D                                          157   7e-43   
gb|EAZ15392.1|  hypothetical protein OsJ_30803                          158   8e-43   Oryza sativa Japonica Group [Japonica rice]
gb|KHN40565.1|  LOB domain-containing protein 16                        154   8e-43   
ref|XP_007052036.1|  LOB domain-containing protein 18, putative         160   8e-43   
ref|XP_006396220.1|  hypothetical protein EUTSA_v10028924mg             158   8e-43   
emb|CDY37038.1|  BnaA04g26160D                                          156   9e-43   
ref|XP_004229819.1|  PREDICTED: LOB domain-containing protein 19        155   1e-42   
ref|XP_002271115.1|  PREDICTED: LOB domain-containing protein 20        158   1e-42   Vitis vinifera
ref|XP_010524360.1|  PREDICTED: LOB domain-containing protein 19        156   2e-42   
ref|XP_011070190.1|  PREDICTED: LOB domain-containing protein 20        157   2e-42   
ref|XP_009353184.1|  PREDICTED: LOB domain-containing protein 20-...    157   2e-42   
emb|CDP18379.1|  unnamed protein product                                157   2e-42   
gb|KFK37334.1|  hypothetical protein AALP_AA4G243100                    156   2e-42   
ref|XP_010918824.1|  PREDICTED: LOB domain-containing protein 14-...    157   4e-42   
emb|CBI31238.3|  unnamed protein product                                157   4e-42   
gb|EYU30336.1|  hypothetical protein MIMGU_mgv1a012147mg                157   4e-42   
ref|XP_004289919.1|  PREDICTED: LOB domain-containing protein 16-...    155   4e-42   
ref|XP_008391783.1|  PREDICTED: LOB domain-containing protein 20        157   4e-42   
ref|XP_004136784.1|  PREDICTED: LOB domain-containing protein 20-...    155   5e-42   
ref|XP_009366531.1|  PREDICTED: LOB domain-containing protein 20-...    156   5e-42   
ref|XP_007050346.1|  Lateral organ boundaries-domain 16                 155   6e-42   
ref|XP_007203508.1|  hypothetical protein PRUPE_ppa024802mg             156   8e-42   
ref|XP_010266765.1|  PREDICTED: LOB domain-containing protein 20        155   1e-41   
ref|XP_003536931.1|  PREDICTED: LOB domain-containing protein 29-...    155   1e-41   
ref|XP_007144924.1|  hypothetical protein PHAVU_007G195000g             155   2e-41   
ref|XP_008244133.1|  PREDICTED: LOB domain-containing protein 20        155   2e-41   
gb|KEH23896.1|  LOB domain protein                                      154   2e-41   
ref|XP_002319718.2|  hypothetical protein POPTR_0013s06070g             154   2e-41   Populus trichocarpa [western balsam poplar]
ref|XP_003541340.1|  PREDICTED: LOB domain-containing protein 29-...    154   2e-41   
ref|XP_010904567.1|  PREDICTED: LOB domain-containing protein 29-...    154   2e-41   
ref|XP_008794315.1|  PREDICTED: LOB domain-containing protein 29-...    154   2e-41   
ref|XP_003554283.1|  PREDICTED: LOB domain-containing protein 16-...    154   3e-41   
ref|XP_002302057.1|  LOB domain protein 16                              154   3e-41   Populus trichocarpa [western balsam poplar]
ref|XP_008235713.1|  PREDICTED: LOB domain-containing protein 16        153   3e-41   
ref|XP_010262592.1|  PREDICTED: LOB domain-containing protein 33-...    154   3e-41   
ref|XP_009367705.1|  PREDICTED: LOB domain-containing protein 16        153   3e-41   
ref|XP_003623743.1|  LOB domain-containing protein                      153   3e-41   
ref|XP_011028776.1|  PREDICTED: LOB domain-containing protein 16-...    154   3e-41   
ref|XP_007199359.1|  hypothetical protein PRUPE_ppa025349mg             153   3e-41   
ref|XP_010679216.1|  PREDICTED: LOB domain-containing protein 16-...    154   3e-41   
gb|KCW47777.1|  hypothetical protein EUGRSUZ_K01522                     154   3e-41   
gb|KDP21329.1|  hypothetical protein JCGZ_21800                         154   3e-41   
ref|XP_004152037.1|  PREDICTED: LOB domain-containing protein 16-...    154   4e-41   
ref|XP_010036253.1|  PREDICTED: LOB domain-containing protein 20        154   4e-41   
emb|CDY68561.1|  BnaCnng59550D                                          152   4e-41   
ref|XP_010918779.1|  PREDICTED: LOB domain-containing protein 16-...    152   4e-41   
ref|XP_008787394.1|  PREDICTED: LOB domain-containing protein 16-...    152   4e-41   
gb|KDO66074.1|  hypothetical protein CISIN_1g042813mg                   154   4e-41   
ref|XP_006443492.1|  hypothetical protein CICLE_v10021843mg             154   4e-41   
gb|KHN10727.1|  LOB domain-containing protein 29                        153   5e-41   
gb|KGN57934.1|  hypothetical protein Csa_3G398920                       154   5e-41   
ref|XP_009616196.1|  PREDICTED: LOB domain-containing protein 20        154   5e-41   
ref|XP_006435636.1|  hypothetical protein CICLE_v10033354mg             153   5e-41   
gb|KDO85851.1|  hypothetical protein CISIN_1g041368mg                   149   5e-41   
ref|XP_009779769.1|  PREDICTED: LOB domain-containing protein 20        154   6e-41   
ref|XP_004495114.1|  PREDICTED: LOB domain-containing protein 29-...    153   6e-41   
ref|XP_009133536.1|  PREDICTED: LOB domain-containing protein 16-...    153   6e-41   
ref|XP_002525698.1|  LOB domain-containing protein, putative            153   6e-41   Ricinus communis
ref|XP_010524043.1|  PREDICTED: LOB domain-containing protein 16        153   7e-41   
ref|XP_010274825.1|  PREDICTED: LOB domain-containing protein 29        153   7e-41   
ref|XP_009354924.1|  PREDICTED: LOB domain-containing protein 16-...    153   7e-41   
ref|XP_006347838.1|  PREDICTED: LOB domain-containing protein 20-...    153   8e-41   
ref|XP_010935757.1|  PREDICTED: LOB domain-containing protein 16-...    152   9e-41   
ref|XP_008775957.1|  PREDICTED: LOB domain-containing protein 29-...    152   1e-40   
ref|XP_004493763.1|  PREDICTED: LOB domain-containing protein 16-...    152   1e-40   
ref|XP_003536930.1|  PREDICTED: LOB domain-containing protein 16-...    152   1e-40   
ref|XP_010262268.1|  PREDICTED: LOB domain-containing protein 29        152   1e-40   
ref|XP_010677793.1|  PREDICTED: LOB domain-containing protein 20        153   1e-40   
ref|XP_010933093.1|  PREDICTED: LOB domain-containing protein 16-...    151   1e-40   
gb|EPS72981.1|  hypothetical protein M569_01776                         149   1e-40   
emb|CDY07237.1|  BnaCnng02520D                                          151   1e-40   
ref|XP_009143138.1|  PREDICTED: LOB domain-containing protein 19-...    151   1e-40   
ref|XP_010111894.1|  hypothetical protein L484_009778                   152   1e-40   
ref|XP_007162525.1|  hypothetical protein PHAVU_001G159300g             152   2e-40   
ref|XP_003521280.1|  PREDICTED: LOB domain-containing protein 16-...    152   2e-40   
gb|AGP76338.1|  ARL1                                                    148   2e-40   
gb|KDP39658.1|  hypothetical protein JCGZ_02678                         153   2e-40   
emb|CDP03724.1|  unnamed protein product                                151   2e-40   
ref|XP_010911440.1|  PREDICTED: LOB domain-containing protein 20        151   2e-40   
ref|XP_009398033.1|  PREDICTED: LOB domain-containing protein 29        151   2e-40   
ref|XP_009771981.1|  PREDICTED: LOB domain-containing protein 14-...    152   2e-40   
ref|XP_003553372.1|  PREDICTED: LOB domain-containing protein 20-...    152   2e-40   
ref|NP_001106033.1|  rootless concerning crown and seminal roots1       152   2e-40   Zea mays [maize]
ref|XP_008443307.1|  PREDICTED: LOB domain-containing protein 20        152   2e-40   
gb|KHN34589.1|  LOB domain-containing protein 20                        152   2e-40   
ref|XP_007030005.1|  LOB domain-containing protein 20                   152   2e-40   
gb|KEH42567.1|  lateral organ boundaries (LOB) domain protein           152   2e-40   
ref|XP_002465851.1|  hypothetical protein SORBIDRAFT_01g046990          152   2e-40   Sorghum bicolor [broomcorn]
gb|AGP76337.1|  ARL1                                                    148   3e-40   
gb|AGP76336.1|  ARL1                                                    148   3e-40   
ref|XP_002263559.1|  PREDICTED: LOB domain-containing protein 16        150   3e-40   Vitis vinifera
ref|XP_010522164.1|  PREDICTED: LOB domain-containing protein 29        150   3e-40   
emb|CDP03725.1|  unnamed protein product                                151   3e-40   
gb|KDP26558.1|  hypothetical protein JCGZ_17716                         151   3e-40   
ref|XP_004493764.1|  PREDICTED: LOB domain-containing protein 29-...    150   3e-40   
ref|XP_009111506.1|  PREDICTED: LOB domain-containing protein 31        151   3e-40   
ref|XP_009617764.1|  PREDICTED: LOB domain-containing protein 29-...    151   3e-40   
gb|AGP76326.1|  ARL1                                                    147   3e-40   
gb|AFK37396.1|  unknown                                                 151   4e-40   
ref|XP_009591020.1|  PREDICTED: LOB domain-containing protein 16-...    150   4e-40   
ref|XP_002316271.1|  LOB domain protein 33                              150   4e-40   Populus trichocarpa [western balsam poplar]
gb|KHN25184.1|  LOB domain-containing protein 20                        151   4e-40   
gb|KHN03863.1|  LOB domain-containing protein 16                        152   4e-40   
ref|NP_191378.1|  protein ASYMMETRIC LEAVES 2-LIKE 16                   150   4e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011080296.1|  PREDICTED: LOB domain-containing protein 29        151   4e-40   
ref|XP_003518033.2|  PREDICTED: LOB domain-containing protein 20-...    151   4e-40   
ref|XP_007144925.1|  hypothetical protein PHAVU_007G195100g             150   4e-40   
ref|XP_009617763.1|  PREDICTED: LOB domain-containing protein 16-...    150   4e-40   
ref|XP_008777051.1|  PREDICTED: LOB domain-containing protein 20        151   4e-40   
emb|CAN75719.1|  hypothetical protein VITISV_037620                     151   4e-40   Vitis vinifera
emb|CDY14831.1|  BnaC04g48280D                                          151   5e-40   
gb|KEH23888.1|  LOB domain protein                                      150   5e-40   
ref|XP_007199390.1|  hypothetical protein PRUPE_ppa025889mg             151   5e-40   
emb|CDY47969.1|  BnaA04g24470D                                          151   5e-40   
ref|XP_002872962.1|  LOB domain protein 31                              150   5e-40   
ref|XP_002300786.2|  hypothetical protein POPTR_0002s04200g             150   6e-40   
ref|XP_006411500.1|  hypothetical protein EUTSA_v10017158mg             151   6e-40   
ref|XP_004985692.1|  PREDICTED: LOB domain-containing protein 16-...    151   6e-40   
gb|KFK37092.1|  hypothetical protein AALP_AA4G212100                    151   6e-40   
gb|EYU46475.1|  hypothetical protein MIMGU_mgv1a026613mg                151   6e-40   
ref|XP_011034296.1|  PREDICTED: LOB domain-containing protein 20        150   6e-40   
gb|KHG26762.1|  LOB domain-containing 20 -like protein                  151   6e-40   
ref|XP_011028777.1|  PREDICTED: LOB domain-containing protein 29        150   6e-40   
ref|XP_006351689.1|  PREDICTED: LOB domain-containing protein 29-...    151   6e-40   
ref|XP_011002633.1|  PREDICTED: LOB domain-containing protein 29-...    150   6e-40   
gb|KCW49803.1|  hypothetical protein EUGRSUZ_K03284                     150   7e-40   
ref|XP_004231253.1|  PREDICTED: LOB domain-containing protein 20        150   8e-40   
ref|XP_007162526.1|  hypothetical protein PHAVU_001G159400g             151   8e-40   
ref|XP_008787549.1|  PREDICTED: LOB domain-containing protein 14-...    150   8e-40   
ref|XP_002263533.1|  PREDICTED: LOB domain-containing protein 29        150   8e-40   
ref|XP_010517768.1|  PREDICTED: LOB domain-containing protein 16-...    150   9e-40   
ref|XP_010496906.1|  PREDICTED: LOB domain-containing protein 30-...    149   9e-40   
ref|XP_009781596.1|  PREDICTED: LOB domain-containing protein 16        149   9e-40   
emb|CDY22562.1|  BnaC03g23720D                                          150   9e-40   
ref|XP_006649406.1|  PREDICTED: LOB domain-containing protein 6-like    151   9e-40   
ref|XP_004242534.1|  PREDICTED: LOB domain-containing protein 16        149   1e-39   
gb|EYU17906.1|  hypothetical protein MIMGU_mgv1a020441mg                150   1e-39   
ref|XP_011026012.1|  PREDICTED: LOB domain-containing protein 16        149   1e-39   
ref|XP_002534416.1|  LOB domain-containing protein, putative            150   1e-39   
ref|XP_008235796.1|  PREDICTED: LOB domain-containing protein 29-...    150   1e-39   
ref|XP_003573219.1|  PREDICTED: LOB domain-containing protein 29-...    149   1e-39   
ref|XP_002521022.1|  LOB domain-containing protein, putative            149   1e-39   
gb|ACG45473.1|  ramosa 2                                                150   1e-39   
ref|NP_001173268.1|  Os03g0149100                                       150   1e-39   
ref|XP_010679217.1|  PREDICTED: LOB domain-containing protein 29        149   1e-39   
ref|XP_002306833.1|  LOB domain protein 16                              149   1e-39   
ref|XP_010506068.1|  PREDICTED: LOB domain-containing protein 16 ...    150   2e-39   
ref|XP_010427729.1|  PREDICTED: LOB domain-containing protein 29        149   2e-39   
gb|EEC74526.1|  hypothetical protein OsI_10033                          150   2e-39   
ref|XP_009142837.1|  PREDICTED: LOB domain-containing protein 16        150   2e-39   
ref|XP_003572959.1|  PREDICTED: LOB domain-containing protein 16        149   2e-39   
gb|KHN44982.1|  LOB domain-containing protein 16                        149   2e-39   
ref|XP_010067432.1|  PREDICTED: LOB domain-containing protein 29        149   2e-39   
gb|KHN05749.1|  LOB domain-containing protein 20                        149   2e-39   
ref|XP_010516469.1|  PREDICTED: LOB domain-containing protein 29-...    149   2e-39   
gb|AGP76327.1|  ARL1                                                    146   2e-39   
ref|XP_011083017.1|  PREDICTED: LOB domain-containing protein 16-...    149   2e-39   
ref|XP_002878193.1|  lateral organ boundaries-domain 29, lob doma...    149   2e-39   
ref|XP_006292973.1|  hypothetical protein CARUB_v10019250mg             149   2e-39   
ref|XP_009382150.1|  PREDICTED: LOB domain-containing protein 29-...    149   2e-39   
ref|XP_010504778.1|  PREDICTED: LOB domain-containing protein 29-...    149   2e-39   
ref|XP_002879985.1|  hypothetical protein ARALYDRAFT_903598             149   2e-39   
gb|KDO68482.1|  hypothetical protein CISIN_1g027399mg                   149   2e-39   
gb|EAZ25592.1|  hypothetical protein OsJ_09419                          149   2e-39   
ref|XP_003541339.1|  PREDICTED: LOB domain-containing protein 16-...    149   2e-39   
ref|XP_003537147.1|  PREDICTED: LOB domain-containing protein 20-...    149   2e-39   
gb|KHN02521.1|  LOB domain-containing protein 29                        148   3e-39   
ref|XP_006443870.1|  hypothetical protein CICLE_v10023341mg             149   3e-39   
ref|XP_002277994.1|  PREDICTED: LOB domain-containing protein 33        148   3e-39   
ref|XP_010111895.1|  hypothetical protein L484_009779                   149   3e-39   
ref|NP_565973.1|  LOB domain-containing protein 16                      149   3e-39   
ref|NP_001062526.1|  Os08g0563400                                       148   3e-39   
ref|XP_006402799.1|  hypothetical protein EUTSA_v10006226mg             149   3e-39   
emb|CDY64515.1|  BnaC04g52730D                                          149   3e-39   
ref|XP_004247346.1|  PREDICTED: LOB domain-containing protein 29        149   3e-39   
ref|XP_006659712.1|  PREDICTED: LOB domain-containing protein 17-...    148   3e-39   
ref|XP_006443871.1|  hypothetical protein CICLE_v10024416mg             148   3e-39   
gb|KDO68483.1|  hypothetical protein CISIN_1g040761mg                   148   4e-39   
ref|XP_010524042.1|  PREDICTED: LOB domain-containing protein 29-...    149   4e-39   
ref|XP_009142063.1|  PREDICTED: LOB domain-containing protein 16-...    149   4e-39   
ref|XP_010935865.1|  PREDICTED: LOB domain-containing protein 29-...    149   4e-39   
ref|XP_004954418.1|  PREDICTED: LOB domain-containing protein 16-...    148   4e-39   
ref|XP_008461877.1|  PREDICTED: LOB domain-containing protein 16        148   4e-39   
ref|XP_008679157.1|  PREDICTED: LOB domain-containing protein 16-...    148   4e-39   
ref|XP_011080023.1|  PREDICTED: LOB domain-containing protein 16-...    147   5e-39   
emb|CDX71962.1|  BnaC08g29120D                                          148   5e-39   
ref|XP_006296375.1|  hypothetical protein CARUB_v10025548mg             148   5e-39   
ref|XP_002454795.1|  hypothetical protein SORBIDRAFT_04g037550          147   6e-39   
ref|XP_010508576.1|  PREDICTED: LOB domain-containing protein 16-...    148   6e-39   
emb|CDY14832.1|  BnaC04g48290D                                          147   6e-39   
ref|XP_004492662.1|  PREDICTED: LOW QUALITY PROTEIN: LOB domain-c...    147   6e-39   
emb|CDY70198.1|  BnaAnng32930D                                          148   7e-39   
ref|XP_002444564.1|  hypothetical protein SORBIDRAFT_07g023810          147   7e-39   
emb|CDY00547.1|  BnaC04g23780D                                          147   7e-39   
ref|XP_004309740.1|  PREDICTED: LOB domain-containing protein 20-...    148   7e-39   
ref|XP_004489657.1|  PREDICTED: LOB domain-containing protein 20-...    147   8e-39   
ref|XP_009367776.1|  PREDICTED: LOB domain-containing protein 14-...    148   8e-39   
gb|AAC19294.1|  F6N15.25 gene product                                   147   8e-39   
ref|XP_004974249.1|  PREDICTED: LOB domain-containing protein 29-...    147   8e-39   
ref|XP_008794314.1|  PREDICTED: LOB domain-containing protein 16-...    146   1e-38   
emb|CDY06048.1|  BnaA09g37320D                                          147   1e-38   
ref|XP_009142064.1|  PREDICTED: LOB domain-containing protein 17        146   1e-38   
ref|NP_001048543.1|  Os02g0820500                                       147   1e-38   
ref|XP_010039235.1|  PREDICTED: LOB domain-containing protein 16        149   1e-38   
ref|XP_009386252.1|  PREDICTED: LOB domain-containing protein 29-...    147   1e-38   
ref|XP_004289920.1|  PREDICTED: LOB domain-containing protein 17-...    147   1e-38   
ref|XP_008801296.1|  PREDICTED: LOB domain-containing protein 16-...    145   1e-38   
ref|XP_010524910.1|  PREDICTED: LOB domain-containing protein 29-...    147   2e-38   
ref|XP_010039047.1|  PREDICTED: LOB domain-containing protein 29-...    147   2e-38   
ref|XP_003562079.1|  PREDICTED: LOB domain-containing protein 6-like    147   2e-38   
emb|CDY47970.1|  BnaA04g24480D                                          148   2e-38   
ref|XP_007009269.1|  LOB domain-containing protein 29                   147   2e-38   
ref|XP_006352833.1|  PREDICTED: LOB domain-containing protein 16-...    145   2e-38   
gb|AGP76333.1|  ARL1                                                    143   2e-38   
gb|AGP76332.1|  ARL1                                                    143   2e-38   
ref|XP_008447445.1|  PREDICTED: LOB domain-containing protein 29-...    147   2e-38   
ref|XP_007151760.1|  hypothetical protein PHAVU_004G072500g             147   2e-38   
ref|XP_004152038.1|  PREDICTED: LOB domain-containing protein 29-...    147   2e-38   
ref|XP_006648133.1|  PREDICTED: LOB domain-containing protein 16-...    146   2e-38   
ref|XP_006588674.1|  PREDICTED: LOB domain-containing protein 16-...    145   2e-38   
dbj|BAJ99718.1|  predicted protein                                      145   3e-38   
ref|XP_009420450.1|  PREDICTED: LOB domain-containing protein 29-...    145   3e-38   
gb|EAZ25108.1|  hypothetical protein OsJ_08903                          145   3e-38   
ref|XP_009777806.1|  PREDICTED: LOB domain-containing protein 16-...    144   4e-38   
ref|XP_009138972.1|  PREDICTED: LOB domain-containing protein 29        145   4e-38   
gb|AFK41082.1|  unknown                                                 145   5e-38   
ref|XP_004289921.1|  PREDICTED: LOB domain-containing protein 29-...    144   6e-38   
ref|XP_009413156.1|  PREDICTED: LOB domain-containing protein 14-...    145   8e-38   
ref|XP_009354925.1|  PREDICTED: LOB domain-containing protein 29-...    145   8e-38   
ref|XP_008385141.1|  PREDICTED: LOB domain-containing protein 29-...    145   9e-38   
gb|EMS57434.1|  hypothetical protein TRIUR3_01477                       143   1e-37   
ref|XP_006351642.1|  PREDICTED: LOB domain-containing protein 16-...    144   1e-37   
emb|CDX88974.1|  BnaA04g02120D                                          144   1e-37   
gb|KDP44920.1|  hypothetical protein JCGZ_01420                         144   1e-37   
ref|XP_009400671.1|  PREDICTED: LOB domain-containing protein 16-...    143   1e-37   
gb|AFP44688.1|  hypothetical protein                                    146   1e-37   
ref|XP_006411501.1|  hypothetical protein EUTSA_v10017903mg             143   2e-37   
ref|XP_004163162.1|  PREDICTED: LOB domain-containing protein 29-...    143   2e-37   
ref|XP_009392817.1|  PREDICTED: LOB domain-containing protein 16-...    142   2e-37   
ref|XP_004150342.1|  PREDICTED: LOB domain-containing protein 29-...    142   2e-37   
gb|EMT14513.1|  hypothetical protein F775_02052                         143   2e-37   
ref|NP_001238198.1|  uncharacterized protein LOC100527324               143   3e-37   
ref|XP_010524923.1|  PREDICTED: LOB domain-containing protein 16-...    143   3e-37   
ref|XP_010326442.1|  PREDICTED: LOB domain-containing protein 16-...    143   3e-37   
ref|NP_850370.4|  LOB domain-containing protein 17                      143   4e-37   
ref|XP_008235795.1|  PREDICTED: LOB domain-containing protein 29-...    142   4e-37   
ref|XP_007200091.1|  hypothetical protein PRUPE_ppa019939mg             142   5e-37   
ref|XP_001775373.1|  predicted protein                                  138   5e-37   
ref|XP_001760316.1|  predicted protein                                  138   6e-37   
gb|EMS59302.1|  hypothetical protein TRIUR3_07751                       142   6e-37   
ref|XP_010506070.1|  PREDICTED: LOB domain-containing protein 17-...    143   6e-37   
ref|XP_004160273.1|  PREDICTED: LOW QUALITY PROTEIN: LOB domain-c...    143   7e-37   
ref|XP_010256834.1|  PREDICTED: LOB domain-containing protein 29-...    143   7e-37   
gb|KEH25566.1|  LOB domain protein                                      142   8e-37   
gb|EMT05213.1|  hypothetical protein F775_22967                         142   9e-37   
ref|XP_002524207.1|  LOB domain-containing protein, putative            142   1e-36   
ref|XP_008461694.1|  PREDICTED: LOB domain-containing protein 33-...    141   1e-36   
emb|CDY15375.1|  BnaC04g42480D                                          140   2e-36   
ref|XP_010516468.1|  PREDICTED: LOB domain-containing protein 16-...    140   2e-36   
ref|XP_006596617.1|  PREDICTED: LOB domain-containing protein 33-...    140   2e-36   
gb|KHN20912.1|  LOB domain-containing protein 33                        141   2e-36   
ref|XP_010508574.1|  PREDICTED: LOB domain-containing protein 17-...    141   2e-36   
ref|XP_011076841.1|  PREDICTED: LOB domain-containing protein 25-...    140   3e-36   
emb|CDY35378.1|  BnaA03g19820D                                          137   3e-36   
ref|XP_009398387.1|  PREDICTED: LOB domain-containing protein 17-...    140   3e-36   
ref|XP_007141403.1|  hypothetical protein PHAVU_008G192500g             140   3e-36   
ref|XP_006402800.1|  hypothetical protein EUTSA_v10006423mg             140   3e-36   
ref|XP_010504777.1|  PREDICTED: LOB domain-containing protein 16-...    140   4e-36   
ref|XP_009394732.1|  PREDICTED: LOB domain-containing protein 29        140   4e-36   
ref|XP_009116510.1|  PREDICTED: LOB domain-containing protein 29-...    140   4e-36   
ref|XP_002468500.1|  hypothetical protein SORBIDRAFT_01g047000          139   4e-36   
ref|XP_002973794.1|  hypothetical protein SELMODRAFT_59642              136   4e-36   
ref|XP_010427728.1|  PREDICTED: LOB domain-containing protein 16-...    140   4e-36   
ref|XP_009417378.1|  PREDICTED: LOB domain-containing protein 20        140   5e-36   
ref|XP_004490916.1|  PREDICTED: LOB domain-containing protein 33-...    139   5e-36   
ref|XP_002881844.1|  hypothetical protein ARALYDRAFT_346041             140   5e-36   
ref|XP_010543775.1|  PREDICTED: LOB domain-containing protein 33-...    139   5e-36   
ref|XP_008447245.1|  PREDICTED: LOB domain-containing protein 29        139   5e-36   
gb|EYU19933.1|  hypothetical protein MIMGU_mgv1a022039mg                139   6e-36   
ref|XP_007050344.1|  Lateral organ boundaries domain family protein     140   6e-36   
ref|XP_010517770.1|  PREDICTED: LOB domain-containing protein 17-...    140   6e-36   
ref|XP_006289422.1|  hypothetical protein CARUB_v10002921mg             139   6e-36   
tpg|DAA43384.1|  TPA: rootless concerning crown and seminal roots1      140   6e-36   
ref|XP_009388133.1|  PREDICTED: LOB domain-containing protein 29-...    140   7e-36   
gb|ABO21030.1|  rootless concerning crown and seminal lateral roots     140   7e-36   
ref|NP_196226.1|  LOB domain-containing protein 33                      138   8e-36   
ref|XP_006410263.1|  hypothetical protein EUTSA_v10017299mg             138   9e-36   
ref|NP_001106034.1|  RTCS-like1                                         139   9e-36   
ref|XP_010473920.1|  PREDICTED: LOB domain-containing protein 14        138   9e-36   
ref|XP_009141174.1|  PREDICTED: LOB domain-containing protein 14-...    137   1e-35   
ref|XP_006292407.1|  hypothetical protein CARUB_v10018619mg             139   1e-35   
ref|XP_010510211.1|  PREDICTED: LOB domain-containing protein 14        137   2e-35   
gb|KHN45191.1|  LOB domain-containing protein 16                        139   2e-35   
ref|XP_002873236.1|  predicted protein                                  137   2e-35   
ref|NP_180689.1|  LOB domain-containing protein 14                      137   2e-35   
ref|XP_009354970.1|  PREDICTED: LOB domain-containing protein 29-...    137   2e-35   
ref|XP_011017498.1|  PREDICTED: LOB domain-containing protein 19-...    135   2e-35   
gb|KFK25000.1|  hypothetical protein AALP_AA8G053400                    137   2e-35   
ref|XP_008382885.1|  PREDICTED: LOB domain-containing protein 29-...    137   3e-35   
ref|XP_010111893.1|  hypothetical protein L484_009777                   136   3e-35   
emb|CDY19098.1|  BnaA04g18380D                                          138   4e-35   
gb|AAN87738.1|  Hypothetical protein                                    139   4e-35   
ref|XP_004147712.1|  PREDICTED: LOB domain-containing protein 33-...    137   4e-35   
ref|XP_002879319.1|  LOB domain protein 14                              136   4e-35   
ref|XP_006295930.1|  hypothetical protein CARUB_v10025067mg             137   4e-35   
ref|XP_010096608.1|  hypothetical protein L484_025355                   138   4e-35   
emb|CDP00128.1|  unnamed protein product                                137   5e-35   
ref|XP_004161921.1|  PREDICTED: LOB domain-containing protein 33-...    137   5e-35   
ref|NP_001048970.1|  Os03g0149000                                       136   5e-35   
gb|EEC74525.1|  hypothetical protein OsI_10032                          136   6e-35   
gb|KEH42569.1|  LOB domain protein                                      137   6e-35   
emb|CDX98901.1|  BnaC09g49340D                                          135   7e-35   
ref|XP_004985693.1|  PREDICTED: LOB domain-containing protein 16-...    135   7e-35   
ref|XP_006486402.1|  PREDICTED: LOB domain-containing protein 33-...    133   8e-35   
ref|XP_007221130.1|  hypothetical protein PRUPE_ppa018815mg             137   8e-35   
ref|XP_010691088.1|  PREDICTED: LOB domain-containing protein 33-...    137   9e-35   
ref|XP_008233676.1|  PREDICTED: LOB domain-containing protein 33        137   9e-35   
ref|NP_001106046.1|  LOC100125645                                       135   1e-34   
ref|XP_003553141.1|  PREDICTED: LOB domain-containing protein 29-...    136   1e-34   
ref|XP_004308845.1|  PREDICTED: LOB domain-containing protein 29-...    137   1e-34   
ref|XP_009345549.1|  PREDICTED: LOB domain-containing protein 33-...    136   1e-34   
ref|XP_009122213.1|  PREDICTED: LOB domain-containing protein 33        135   1e-34   
ref|XP_006649405.1|  PREDICTED: LOB domain-containing protein 16-...    135   1e-34   
ref|XP_003616452.1|  LOB domain-containing protein                      135   1e-34   
ref|XP_008352160.1|  PREDICTED: LOB domain-containing protein 33-...    136   2e-34   
ref|XP_006576098.1|  PREDICTED: LOB domain-containing protein 33-...    135   2e-34   
ref|XP_010414141.1|  PREDICTED: LOB domain-containing protein 14-...    135   2e-34   
gb|KHN41112.1|  LOB domain-containing protein 33                        135   2e-34   
emb|CDY60434.1|  BnaA10g30420D                                          134   2e-34   
ref|XP_011098429.1|  PREDICTED: LOB domain-containing protein 25        134   4e-34   
ref|XP_010491153.1|  PREDICTED: LOB domain-containing protein 33-...    134   4e-34   



>ref|XP_009604912.1| PREDICTED: LOB domain-containing protein 30-like [Nicotiana tomentosiformis]
Length=266

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 147/215 (68%), Gaps = 32/215 (15%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCVAGCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+T+C
Sbjct  43   ACKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTIC  102

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppp----------  575
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAELSYLQAHLA+L++PTPPP           
Sbjct  103  YEAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATLELPTPPPQPPSQQPQTLL  162

Query  574  pPMSAMNIADLSTAS----PAYDTLSSLFDPTSSMVQpaawppppPMQQ-------TRHL  428
            PP  A++IADL TA     PA   LSSLFDP   MVQ     P   MQQ        R  
Sbjct  163  PPQPALSIADLPTAGTSILPAAYDLSSLFDP---MVQ-----PSWAMQQPRPPPMDPRQF  214

Query  427  GGAANRdpaadgmssssppagsGVLQELTRHLMRR  323
            GG A         ++         LQEL R L+ R
Sbjct  215  GGGARAPVEMSPSTTGGGSGD---LQELARELLHR  246



>ref|XP_009795320.1| PREDICTED: LOB domain-containing protein 30 [Nicotiana sylvestris]
Length=273

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 149/218 (68%), Gaps = 36/218 (17%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCVAGCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+T+C
Sbjct  48   ACKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTIC  107

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpp------------  581
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAELSYLQAHLA+L++PTPP            
Sbjct  108  YEAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATLELPTPPPQPPSQQPQTLL  167

Query  580  pppPMSAMNIADLSTASP-----AYDTLSSLFDPTSSMVQpaawppppPMQQ-------T  437
            PP P +A++I DL TA P     AYD LSSLFDP   MVQ     P   MQQ        
Sbjct  168  PPQPAAALSITDLPTAGPSILPAAYD-LSSLFDP---MVQ-----PSWAMQQPRPTPMDP  218

Query  436  RHLGGAANRdpaadgmssssppagsGVLQELTRHLMRR  323
            RH G  A         ++         LQEL R L+ R
Sbjct  219  RHYGSGARAPVEMSPSTTGGGSGD---LQELARELLHR  253



>ref|XP_006339770.1| PREDICTED: LOB domain-containing protein 18-like [Solanum tuberosum]
Length=264

 Score =   212 bits (540),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 148/206 (72%), Gaps = 18/206 (9%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCVAGCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+T+C
Sbjct  46   ACKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTIC  105

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAM----  557
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAELSYLQAHLA+L++PTPPP PP   M    
Sbjct  106  YEAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATLELPTPPPLPPPQTMLQQP  165

Query  556  --NIADLSTASP----AYDTLSSLFDPT--SSMVQpaawppppPMQQTRHLGGAANRdpa  401
               IADL TA P    AYD LSSLFDP    S V     PPPP     RH GGA ++   
Sbjct  166  PLTIADLPTAGPSLPAAYD-LSSLFDPMVQPSWVLQQPRPPPPLPLDPRHFGGARSQVDM  224

Query  400  adgmssssppagsGVLQELTRHLMRR  323
            +              LQEL R L+ R
Sbjct  225  SPSTGGGGGD-----LQELARELLHR  245



>emb|CDP17781.1| unnamed protein product [Coffea canephora]
Length=241

 Score =   209 bits (531),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 149/204 (73%), Gaps = 20/204 (10%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCVAGCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+T+C
Sbjct  28   ACKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTIC  87

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPM-------  566
            +EAQARLRDPV+GCVAHIFA+QQQVVNLQAELSYLQ HLA+L++P PPPP          
Sbjct  88   YEAQARLRDPVFGCVAHIFALQQQVVNLQAELSYLQGHLATLELPPPPPPSAQPQPIIAP  147

Query  565  SAMNIADLSTAS---PAYDTLSSLFDPTSSMVQpaawppppPMQQTRHLGGAANRdpaad  395
             ++ IADL T S   PA   LSSLFDP   +        P  MQQ R +   +++  AA 
Sbjct  148  PSLTIADLPTGSSSAPATYDLSSLFDPVVQL--------PWTMQQPRQMD--SHQFGAAR  197

Query  394  gmssssppagsGVLQELTRHLMRR  323
              + +S  AG+G LQEL R L+ R
Sbjct  198  APAEASSSAGTGDLQELARELLHR  221



>ref|XP_010692269.1| PREDICTED: LOB domain-containing protein 18 [Beta vulgaris subsp. 
vulgaris]
Length=245

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 129/150 (86%), Gaps = 10/150 (7%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+T+C
Sbjct  33   ACKFLRRKCVVGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTIC  92

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSA-----  560
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAEL+YLQAHLA+L+VPTPPPPPP        
Sbjct  93   YEAQARLRDPVYGCVAHIFALQQQVVNLQAELTYLQAHLATLEVPTPPPPPPQPLMPPPQ  152

Query  559  MNIADLSTAS--PAYDTLSSLFDPTSSMVQ  476
            ++IADL +AS  PA   LSSLFDP   MVQ
Sbjct  153  LSIADLPSASTVPATYDLSSLFDP---MVQ  179



>ref|XP_004306912.1| PREDICTED: LOB domain-containing protein 30-like [Fragaria vesca 
subsp. vesca]
Length=244

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 128/148 (86%), Gaps = 8/148 (5%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCVAGCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLLHHIP HKR DAV+TVC
Sbjct  34   ACKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLHHIPAHKRPDAVLTVC  93

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptppppp----PMSAM  557
            FEAQARL+DPVYGCVAHIFA+QQQVVNLQAE+SYLQAHLA++++P+PPPPP        +
Sbjct  94   FEAQARLKDPVYGCVAHIFALQQQVVNLQAEISYLQAHLATMELPSPPPPPPPLIAQPQL  153

Query  556  NIADLSTAS-PAYDTLSSLFDPTSSMVQ  476
            +IADL +A  PA   LSSLF+P   MVQ
Sbjct  154  SIADLPSAPMPATYDLSSLFEP---MVQ  178



>ref|XP_006445237.1| hypothetical protein CICLE_v10021992mg [Citrus clementina]
 ref|XP_006491458.1| PREDICTED: LOB domain-containing protein 18-like [Citrus sinensis]
 gb|ESR58477.1| hypothetical protein CICLE_v10021992mg [Citrus clementina]
 gb|KDO85852.1| hypothetical protein CISIN_1g036534mg [Citrus sinensis]
Length=237

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 132/170 (78%), Gaps = 11/170 (6%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+T+C
Sbjct  37   ACKFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTIC  96

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV----ptpppppPMSA-  560
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAELSYLQAHLA+L++    P PP    M+A 
Sbjct  97   YEAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATLELPSPPPPPPSQNQMTAP  156

Query  559  -MNIADLSTAS--PAYDTLSSLFDPTSSMVQpaawppppPMQQTRHLGGA  419
             ++I+ L +AS  PA   LS+LFDP   MVQPA W         R  GG 
Sbjct  157  PLSISGLPSASSMPATYDLSTLFDP---MVQPAPWAMQQRQMDPRQFGGG  203



>ref|XP_011034497.1| PREDICTED: LOW QUALITY PROTEIN: LOB domain-containing protein 
18 [Populus euphratica]
Length=245

 Score =   206 bits (523),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 143/208 (69%), Gaps = 23/208 (11%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+T+C
Sbjct  36   ACKFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTIC  95

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ-----VptpppppPMSA  560
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAELSYLQAHLA+L+      P PP       
Sbjct  96   YEAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLAALEVPSPPPPPPPTLVTPPP  155

Query  559  MNIADLSTAS--PAYDTLSSLFDPTSSMVQpaawppppPMQQTRHLGGAANRdpaadgms  386
            ++IADL +AS  PA   LSSLFDP   M+Q    P    MQQ R +           G S
Sbjct  156  LSIADLPSASSIPAAYDLSSLFDP---MMQ----PSWSNMQQQRQMD------TRQFGDS  202

Query  385  sssppagsGVLQELTRHLMRR---PPQG  311
              S     G LQ L R L+ R   PP G
Sbjct  203  GGSSGTSGGDLQALARELLHRRGSPPPG  230



>ref|XP_002279521.1| PREDICTED: LOB domain-containing protein 18 [Vitis vinifera]
Length=251

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 132/170 (78%), Gaps = 19/170 (11%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFD +QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+T+C
Sbjct  32   ACKFLRRKCVVGCIFAPYFDPEQGAAHFAAVHKVFGASNVSKLLGHIPVHKRLDAVVTIC  91

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV--------ptpppppP  569
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAELSYLQAHLA+L++        P PP    
Sbjct  92   YEAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATLELPSPPPPPPPPPPVMVT  151

Query  568  MSAMNIADLSTAS---PAYDTLSSLFDPTSSMVQpaawppppPMQQTRHL  428
              +++I+DL +AS   P YD LSSLFDP   MVQ    P   PMQQ R +
Sbjct  152  PPSLSISDLPSASSMPPTYD-LSSLFDP---MVQ----PSSWPMQQHRQI  193



>gb|ABK28616.1| unknown [Arabidopsis thaliana]
Length=229

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 118/147 (80%), Gaps = 7/147 (5%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCVAGCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLLHH+P HKR DAV+++C
Sbjct  20   ACKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLHHVPEHKRPDAVVSIC  79

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV-------ptpppppPM  566
            FEAQARLRDP+YGCV+HI ++QQQVV+LQ ELSYLQAHLA+L++               +
Sbjct  80   FEAQARLRDPIYGCVSHIVSLQQQVVSLQTELSYLQAHLATLELPQPQPPQVPVSSSGSL  139

Query  565  SAMNIADLSTASPAYDTLSSLFDPTSS  485
             A++I DL T SP+   LSS+F+P  S
Sbjct  140  QALSITDLPTISPSVYDLSSIFEPVMS  166



>ref|XP_002511730.1| LOB domain-containing protein, putative [Ricinus communis]
 gb|EEF50399.1| LOB domain-containing protein, putative [Ricinus communis]
Length=247

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 121/147 (82%), Gaps = 8/147 (5%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+T+C
Sbjct  30   ACKFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTIC  89

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ------VptpppppPMS  563
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAELSYLQAHLA+L+       P P    P  
Sbjct  90   YEAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATLELPSPPPPPPPQSLVPPP  149

Query  562  AMNIADLSTAS--PAYDTLSSLFDPTS  488
             ++IADL +AS  PA   LSSLFDP +
Sbjct  150  PLSIADLPSASSVPATYDLSSLFDPMT  176



>ref|NP_191933.1| protein JAGGED LATERAL ORGANS [Arabidopsis thaliana]
 sp|O81323.1|LBD30_ARATH RecName: Full=LOB domain-containing protein 30; AltName: Full=ASYMMETRIC 
LEAVES 2-like protein 19; Short=AS2-like protein 
19 [Arabidopsis thaliana]
 gb|AAL27613.1|AF432232_1 LOB DOMAIN 30 [Arabidopsis thaliana]
 gb|AAC19300.1| F6N15.4 gene product [Arabidopsis thaliana]
 emb|CAB80780.1| predicted protein of unknown function [Arabidopsis thaliana]
 gb|ABE66037.1| LOB domain protein 30/lateral organ boundaries domain protein 
30 [Arabidopsis thaliana]
 gb|ABH04514.1| At4g00220 [Arabidopsis thaliana]
 dbj|BAH10563.1| ASYMMETRIC LEAVES2-like 19 protein [Arabidopsis thaliana]
 gb|AEE81839.1| LOB domain-containing protein 30 [Arabidopsis thaliana]
Length=228

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 122/147 (83%), Gaps = 7/147 (5%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCVAGCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLLHH+P HKR DAV+++C
Sbjct  20   ACKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLHHVPEHKRPDAVVSIC  79

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptppppp-------PM  566
            FEAQARLRDP+YGCV+HI ++QQQVV+LQ ELSYLQAHLA+L++P P PP         +
Sbjct  80   FEAQARLRDPIYGCVSHIVSLQQQVVSLQTELSYLQAHLATLELPQPQPPQVPVSSSGSL  139

Query  565  SAMNIADLSTASPAYDTLSSLFDPTSS  485
             A++I DL T SP+   LSS+F+P  S
Sbjct  140  QALSITDLPTISPSVYDLSSIFEPVMS  166



>emb|CBI38861.3| unnamed protein product [Vitis vinifera]
Length=264

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 135/174 (78%), Gaps = 16/174 (9%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFD +QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+T+C
Sbjct  45   ACKFLRRKCVVGCIFAPYFDPEQGAAHFAAVHKVFGASNVSKLLGHIPVHKRLDAVVTIC  104

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV--------ptpppppP  569
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAELSYLQAHLA+L++        P PP    
Sbjct  105  YEAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATLELPSPPPPPPPPPPVMVT  164

Query  568  MSAMNIADLSTAS---PAYDTLSSLFDPTSSMVQpaawppppPMQ-QTRHLGGA  419
              +++I+DL +AS   P YD LSSLFDP   MVQP++WP     Q   R  GG+
Sbjct  165  PPSLSISDLPSASSMPPTYD-LSSLFDP---MVQPSSWPMQQHRQIDPRQFGGS  214



>ref|NP_001132370.1| putative LOB domain-containing family protein [Zea mays]
 gb|ACF81185.1| unknown [Zea mays]
 gb|AFW88995.1| putative LOB domain-containing family protein [Zea mays]
 gb|AIB05953.1| LOB transcription factor, partial [Zea mays]
Length=265

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 121/145 (83%), Gaps = 8/145 (6%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL  IPPHKRLDAV+T+C
Sbjct  46   ACKFLRRKCVSGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLQIPPHKRLDAVVTIC  105

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV------ptpppppPMS  563
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAEL+YLQAHLA+L++      P PP  P   
Sbjct  106  YEAQARLRDPVYGCVAHIFALQQQVVNLQAELTYLQAHLATLELPSPPPLPAPPQMPMPG  165

Query  562  AMNIADL--STASPAYDTLSSLFDP  494
              +IADL  ST+ P    LS+LFDP
Sbjct  166  PFSIADLPSSTSVPTTVDLSTLFDP  190



>gb|KDP28744.1| hypothetical protein JCGZ_14515 [Jatropha curcas]
Length=243

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 122/148 (82%), Gaps = 9/148 (6%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+T+C
Sbjct  31   ACKFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTIC  90

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV-------ptpppppPM  566
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAEL+YLQAHLA+L+V       P PP     
Sbjct  91   YEAQARLRDPVYGCVAHIFALQQQVVNLQAELTYLQAHLATLEVPSPPPPPPPPPALVTP  150

Query  565  SAMNIADLSTAS--PAYDTLSSLFDPTS  488
              ++I+DL +AS  PA   LSSLFDP +
Sbjct  151  LPLSISDLPSASSMPATYDLSSLFDPIT  178



>ref|XP_002301295.2| hypothetical protein POPTR_0002s15000g [Populus trichocarpa]
 gb|EEE80568.2| hypothetical protein POPTR_0002s15000g [Populus trichocarpa]
Length=244

 Score =   204 bits (519),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 129/152 (85%), Gaps = 13/152 (9%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKR DAV+T+C
Sbjct  36   ACKFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPAHKRPDAVVTIC  95

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMS-----A  560
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAELSYLQAHLA+++VP+PPPPPP +      
Sbjct  96   YEAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLAAMEVPSPPPPPPPALVTSPP  155

Query  559  MNIADLSTASP----AYDTLSSLFDPTSSMVQ  476
             +IADL +AS     AYD LSSLFDP   MVQ
Sbjct  156  FSIADLPSASSIPGAAYD-LSSLFDP---MVQ  183



>ref|XP_009400358.1| PREDICTED: LOB domain-containing protein 18-like [Musa acuminata 
subsp. malaccensis]
Length=241

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 127/145 (88%), Gaps = 8/145 (6%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+T+C
Sbjct  41   ACKFLRRKCVTGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPAHKRLDAVVTIC  100

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAM----  557
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAELSYLQAHLA+L++P+PPPPPP  ++    
Sbjct  101  YEAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATLELPSPPPPPPPPSLVASM  160

Query  556  --NIADLSTAS--PAYDTLSSLFDP  494
              +I+DL +A+  P+   LS+LFDP
Sbjct  161  PFSISDLPSAANLPSTVDLSALFDP  185



>ref|XP_011017499.1| PREDICTED: LOB domain-containing protein 18-like [Populus euphratica]
Length=244

 Score =   203 bits (517),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 121/150 (81%), Gaps = 10/150 (7%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKR DAV+T+C
Sbjct  36   ACKFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPAHKRPDAVVTIC  95

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV-----ptpppppPMSA  560
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAELSYLQAHLA+++V     P PP       
Sbjct  96   YEAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLAAMEVPSPPPPPPPALVTPPP  155

Query  559  MNIADLSTAS--PAYDTLSSLFDPTSSMVQ  476
             +IADL + S  PA   LSSLFDP   MVQ
Sbjct  156  FSIADLPSTSSIPAAYDLSSLFDP---MVQ  182



>ref|XP_010917989.1| PREDICTED: LOB domain-containing protein 18-like [Elaeis guineensis]
Length=239

 Score =   203 bits (516),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 121/142 (85%), Gaps = 5/142 (4%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+T+C
Sbjct  37   ACKFLRRKCVSGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPAHKRLDAVVTIC  96

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV---ptpppppPMSAMN  554
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAELSYLQAHLA+L++   P PP        +
Sbjct  97   YEAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATLELPSPPPPPQLGAPPPFS  156

Query  553  IADLSTAS--PAYDTLSSLFDP  494
            I++L ++S  PA   LS+LFDP
Sbjct  157  ISNLPSSSNLPATVDLSTLFDP  178



>ref|XP_010426737.1| PREDICTED: LOB domain-containing protein 30 [Camelina sativa]
Length=225

 Score =   202 bits (513),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 116/144 (81%), Gaps = 4/144 (3%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCVAGCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKR DAV+++C
Sbjct  19   ACKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPEHKRPDAVVSIC  78

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV----ptpppppPMSAM  557
            FEAQARLRDP+YGCV+HI ++QQQVV+LQ ELSYLQAHLA+L++            + A+
Sbjct  79   FEAQARLRDPIYGCVSHIVSLQQQVVSLQTELSYLQAHLATLELPQPMAPVSSSGSLQAL  138

Query  556  NIADLSTASPAYDTLSSLFDPTSS  485
            +I DL T SP+   LSS F+P  S
Sbjct  139  SITDLPTISPSLYDLSSFFEPVMS  162



>ref|XP_010056297.1| PREDICTED: LOB domain-containing protein 18-like [Eucalyptus 
grandis]
 gb|KCW72963.1| hypothetical protein EUGRSUZ_E01414 [Eucalyptus grandis]
Length=244

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 124/146 (85%), Gaps = 7/146 (5%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP H+RLDAV+T+C
Sbjct  36   ACKFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHRRLDAVVTIC  95

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSA-----  560
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAELSYLQAHL +L++P P PPPP        
Sbjct  96   YEAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLTTLELPVPLPPPPPPPAMGPQ  155

Query  559  MNIADLSTAS--PAYDTLSSLFDPTS  488
            ++IADL +AS  PA   LSSLFDP +
Sbjct  156  LSIADLPSASSIPATYDLSSLFDPMA  181



>emb|CDY54923.1| BnaAnng13580D [Brassica napus]
Length=224

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 122/145 (84%), Gaps = 5/145 (3%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDSDQGA+ FA+VHKVFGASNVSKLLHHIP HKR DAV+++C
Sbjct  18   ACKFLRRKCVPGCIFAPYFDSDQGAAHFAAVHKVFGASNVSKLLHHIPEHKRADAVVSIC  77

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSA-----  560
            FEAQ+RLRDP+YGCV+HI ++QQQVV+LQ ELSY+QAHLA+L++P PPP    S+     
Sbjct  78   FEAQSRLRDPIYGCVSHIVSLQQQVVSLQNELSYVQAHLATLELPQPPPATVTSSGSLPP  137

Query  559  MNIADLSTASPAYDTLSSLFDPTSS  485
            ++I+DL T +P+   LS +F+P SS
Sbjct  138  LSISDLPTITPSMYDLSPIFEPMSS  162



>ref|XP_009128476.1| PREDICTED: LOB domain-containing protein 30-like [Brassica rapa]
Length=224

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 122/145 (84%), Gaps = 5/145 (3%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDSDQGA+ FA+VHKVFGASNVSKLLHHIP HKR DAV+++C
Sbjct  18   ACKFLRRKCVPGCIFAPYFDSDQGAAHFAAVHKVFGASNVSKLLHHIPEHKRADAVVSIC  77

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSA-----  560
            FEAQ+RLRDP+YGCV+HI ++QQQVV+LQ ELSY+QAHLA+L++P PPP    S+     
Sbjct  78   FEAQSRLRDPIYGCVSHIVSLQQQVVSLQNELSYVQAHLATLELPQPPPATVTSSGSLPP  137

Query  559  MNIADLSTASPAYDTLSSLFDPTSS  485
            ++I+DL T +P+   LS +F+P SS
Sbjct  138  LSISDLPTITPSMYDLSPIFEPMSS  162



>ref|XP_002320063.1| LOB domain protein 18 [Populus trichocarpa]
 gb|EEE98378.1| LOB domain protein 18 [Populus trichocarpa]
Length=246

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 119/144 (83%), Gaps = 7/144 (5%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+T+C
Sbjct  37   ACKFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTIC  96

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ-----VptpppppPMSA  560
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAELSYLQAHLA+L+      P PP       
Sbjct  97   YEAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLAALEVPSPPPPPPPTLVTPPP  156

Query  559  MNIADLSTAS--PAYDTLSSLFDP  494
            ++IADL +AS  PA   LS LFDP
Sbjct  157  LSIADLPSASSIPAAYDLSCLFDP  180



>ref|XP_009111504.1| PREDICTED: LOB domain-containing protein 30 [Brassica rapa]
 emb|CDY07236.1| BnaCnng02510D [Brassica napus]
Length=224

 Score =   201 bits (510),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 123/145 (85%), Gaps = 5/145 (3%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCVAGCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL H+P HKR DAV+++C
Sbjct  18   ACKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLQHVPEHKRADAVVSIC  77

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSA-----  560
            FEAQARLRDP+YGCV+HI ++QQQVV+LQ ELSY+QAHLA+L++P PPP P  S+     
Sbjct  78   FEAQARLRDPIYGCVSHIVSLQQQVVSLQTELSYVQAHLATLELPQPPPAPVTSSGSPPP  137

Query  559  MNIADLSTASPAYDTLSSLFDPTSS  485
            ++I+DL T +P+   LS +F+P SS
Sbjct  138  LSISDLPTITPSLYELSPIFEPMSS  162



>gb|KHG13125.1| LOB domain-containing 18 -like protein [Gossypium arboreum]
Length=252

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 124/172 (72%), Gaps = 13/172 (8%)
 Frame = -1

Query  898  KFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVCFE  719
            KFLRRKCV GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+T+CFE
Sbjct  40   KFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTICFE  99

Query  718  AQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV--------ptpppppPMS  563
            AQARLRDPVYGCVAHIFA+QQQVVNLQAELSYLQAHL +L++        P         
Sbjct  100  AQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLTTLELPSPPPPPPPPSQTLVAAP  159

Query  562  AMNIADLSTAS--PAYDTLSSLFDPTSSMVQpaawppppPMQQTRHLGGAAN  413
             ++I+DL +AS  PA   LSSLFDP   MV   +W         R  GG  +
Sbjct  160  PLSISDLPSASSVPATYDLSSLFDP---MVAQTSWAMQQRQIDPRQYGGTGS  208



>ref|XP_006396221.1| hypothetical protein EUTSA_v10028937mg [Eutrema salsugineum]
 gb|ESQ37674.1| hypothetical protein EUTSA_v10028937mg [Eutrema salsugineum]
Length=230

 Score =   201 bits (510),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 124/145 (86%), Gaps = 5/145 (3%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCVAGCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLLHH+P HKR DAV+++C
Sbjct  22   ACKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLHHVPEHKRPDAVVSIC  81

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSA-----  560
            FEAQARLRDP+YGC++HI ++QQQVV+LQ ELSY+QAHLA+L++P PPP P  S+     
Sbjct  82   FEAQARLRDPIYGCISHIVSLQQQVVSLQTELSYVQAHLATLEMPQPPPAPVTSSGSPPP  141

Query  559  MNIADLSTASPAYDTLSSLFDPTSS  485
            ++I+DL T SP+   LSS+ +P ++
Sbjct  142  LSISDLPTISPSVYDLSSILEPMTT  166



>ref|XP_010906049.1| PREDICTED: LOB domain-containing protein 18-like [Elaeis guineensis]
Length=241

 Score =   201 bits (510),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 121/145 (83%), Gaps = 8/145 (6%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+T+C
Sbjct  34   ACKFLRRKCVSGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPAHKRLDAVVTIC  93

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV------ptpppppPMS  563
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAELSYLQAHLA+L++      P PP  P   
Sbjct  94   YEAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATLELPTPPPPPPPPQLPSPP  153

Query  562  AMNIADLSTA--SPAYDTLSSLFDP  494
              +I+DL ++   PA   LS+LFDP
Sbjct  154  PFSISDLPSSLNLPATVDLSALFDP  178



>ref|XP_002875043.1| LOB domain protein 30 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51302.1| LOB domain protein 30 [Arabidopsis lyrata subsp. lyrata]
Length=226

 Score =   200 bits (508),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 117/147 (80%), Gaps = 7/147 (5%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCVAGCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL H+P HKR DAV+++C
Sbjct  18   ACKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLQHVPEHKRPDAVVSIC  77

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV-------ptpppppPM  566
            FEAQARLRDP+YGCV+HI ++QQQVV+LQ ELSYLQAHLA+L++               +
Sbjct  78   FEAQARLRDPIYGCVSHIVSLQQQVVSLQTELSYLQAHLATLELPQPQPPQVPVSSSGSL  137

Query  565  SAMNIADLSTASPAYDTLSSLFDPTSS  485
             A++I DL + SP+   LSS+F+P  S
Sbjct  138  QALSITDLPSISPSVYDLSSIFEPVMS  164



>ref|XP_008798540.1| PREDICTED: LOB domain-containing protein 18, partial [Phoenix 
dactylifera]
Length=243

 Score =   200 bits (509),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 119/145 (82%), Gaps = 8/145 (6%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+T+C
Sbjct  33   ACKFLRRKCVSGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPAHKRLDAVVTIC  92

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ------VptpppppPMS  563
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAELSYLQAHLA+L+       P P       
Sbjct  93   YEAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATLELPSPPPPPPPLQLAAPP  152

Query  562  AMNIADLSTAS--PAYDTLSSLFDP  494
              +I++L ++S  PA   LS+LFDP
Sbjct  153  PFSISNLPSSSNLPATVDLSTLFDP  177



>ref|XP_010276364.1| PREDICTED: LOB domain-containing protein 30-like [Nelumbo nucifera]
Length=254

 Score =   201 bits (510),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 141/202 (70%), Gaps = 16/202 (8%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+T+C
Sbjct  34   ACKFLRRKCVSGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTIC  93

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ------VptpppppPMS  563
            +EAQ+RLRDPVYGCVAHIFA+QQQVVNLQAELSYLQAHLA+L+         PP      
Sbjct  94   YEAQSRLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLAALELPSPSPPQPPPALLTPP  153

Query  562  AMNIADLSTAS--PAYDTLSSLFDPTSSMVQpaawppppPMQQTRHLGGAANRdpaadgm  389
             ++I+DL +AS  PA   LS+LFDP     Q         ++Q     GA+ R+PA    
Sbjct  154  LLSISDLPSASTVPATFDLSTLFDPGVQPAQWVLQQQQMDIRQF----GASGRNPAESPP  209

Query  388  ssssppagsGVLQELTRHLMRR  323
            S+         LQ L R L++R
Sbjct  210  STGGGGD----LQALARELLQR  227



>emb|CDY69735.1| BnaCnng65080D [Brassica napus]
Length=224

 Score =   199 bits (507),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 121/145 (83%), Gaps = 5/145 (3%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDSDQGA+ FA+VHKVFGASNVSKLLHHIP HKR DAV+++C
Sbjct  18   ACKFLRRKCVPGCIFAPYFDSDQGAAHFAAVHKVFGASNVSKLLHHIPEHKRADAVVSIC  77

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSA-----  560
            FEAQ+RLRDP+YGCV+HI ++QQQVV+LQ ELSY+QAHLA+L++P PPP    S+     
Sbjct  78   FEAQSRLRDPIYGCVSHIVSLQQQVVSLQNELSYVQAHLATLELPQPPPATVTSSGSLPP  137

Query  559  MNIADLSTASPAYDTLSSLFDPTSS  485
            ++I+DL T +P+   LS + +P SS
Sbjct  138  LSISDLPTITPSMYDLSPILEPISS  162



>ref|XP_010456310.1| PREDICTED: LOB domain-containing protein 30-like [Camelina sativa]
Length=225

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 115/144 (80%), Gaps = 4/144 (3%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCVAGCIFAPYFD +QGA+ FA+VHKVFGASNVSKLL HIP HKR DAV+++C
Sbjct  19   ACKFLRRKCVAGCIFAPYFDFEQGAAHFAAVHKVFGASNVSKLLLHIPEHKRPDAVVSIC  78

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV----ptpppppPMSAM  557
            FEAQARLRDP+YGCV+HI ++QQQVV+LQ ELSYLQAHLA+L++            + A+
Sbjct  79   FEAQARLRDPIYGCVSHIVSLQQQVVSLQTELSYLQAHLATLELPQPMAPVSSSGSLQAL  138

Query  556  NIADLSTASPAYDTLSSLFDPTSS  485
            +I DL T SP+   LSS F+P  S
Sbjct  139  SITDLPTISPSLYDLSSFFEPVMS  162



>ref|XP_006288584.1| hypothetical protein CARUB_v10001875mg [Capsella rubella]
 gb|EOA21482.1| hypothetical protein CARUB_v10001875mg [Capsella rubella]
Length=231

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 119/148 (80%), Gaps = 8/148 (5%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCVAGCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL H+P HKR DAV+++C
Sbjct  22   ACKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHVPEHKRPDAVVSIC  81

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV--------ptpppppP  569
            FEAQARLRDP+YGCV+HI ++QQQV++LQ ELSYLQAHLA+L++        P      P
Sbjct  82   FEAQARLRDPIYGCVSHIVSLQQQVLSLQTELSYLQAHLATLELPQPQPPAVPVSSSGSP  141

Query  568  MSAMNIADLSTASPAYDTLSSLFDPTSS  485
            + A++I DL T SP+   LSS+F+P  S
Sbjct  142  LQALSITDLPTISPSVYDLSSIFEPVMS  169



>ref|XP_010228877.1| PREDICTED: LOB domain-containing protein 30-like [Brachypodium 
distachyon]
Length=260

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 124/155 (80%), Gaps = 12/155 (8%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL  IP HKRLDAV+T+C
Sbjct  29   ACKFLRRKCVSGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLQIPAHKRLDAVVTIC  88

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAM----  557
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAEL+YLQ HLA+L++P+PP P     M    
Sbjct  89   YEAQARLRDPVYGCVAHIFALQQQVVNLQAELTYLQTHLATLELPSPPIPAATPQMPTMA  148

Query  556  -----NIADLSTAS---PAYDTLSSLFDPTSSMVQ  476
                 +I+DL +++   P    LS+LFDP + + Q
Sbjct  149  PPGPFSISDLPSSTLNIPTTIDLSALFDPPAQLPQ  183



>ref|XP_007218850.1| hypothetical protein PRUPE_ppa010383mg [Prunus persica]
 gb|EMJ20049.1| hypothetical protein PRUPE_ppa010383mg [Prunus persica]
Length=252

 Score =   198 bits (503),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 126/167 (75%), Gaps = 11/167 (7%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+T+C
Sbjct  30   ACKFLRRKCVLGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTIC  89

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV------ptpppppPMS  563
            +EAQARLRDPVYGCVAHIFA+QQQVV+LQAELSYLQAHLA+L++      P PP      
Sbjct  90   YEAQARLRDPVYGCVAHIFALQQQVVSLQAELSYLQAHLATLELPSPPPPPPPPSIITPP  149

Query  562  AMNIADLSTAS---PAYDTLSSLFDPTSSMVQpaawppppPMQQTRH  431
             ++I+DL  A+   PA   LSSLF+P   ++Q         +   RH
Sbjct  150  PLSISDLPLAASSMPATYDLSSLFEPM--VIQQPWVVQHRALHDPRH  194



>ref|XP_008232676.1| PREDICTED: LOB domain-containing protein 18 [Prunus mume]
Length=256

 Score =   198 bits (503),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 120/146 (82%), Gaps = 9/146 (6%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+T+C
Sbjct  34   ACKFLRRKCVLGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTIC  93

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV------ptpppppPMS  563
            +EAQARLRDPVYGCVAHIFA+QQQVV+LQAELSYLQAHLA+L++      P PP      
Sbjct  94   YEAQARLRDPVYGCVAHIFALQQQVVSLQAELSYLQAHLATLELPSPPPPPPPPSIITPP  153

Query  562  AMNIADLSTAS---PAYDTLSSLFDP  494
             ++I+DL  A+   PA   LSSLF+P
Sbjct  154  PLSISDLPLAASSMPATYDLSSLFEP  179



>ref|NP_001167808.1| uncharacterized protein LOC100381506 [Zea mays]
 gb|ACN26128.1| unknown [Zea mays]
 tpg|DAA44372.1| TPA: putative LOB domain-containing family protein [Zea mays]
Length=260

 Score =   198 bits (503),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 120/145 (83%), Gaps = 8/145 (6%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL  IP HKRLDAV+T+C
Sbjct  37   ACKFLRRKCVSGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLQIPAHKRLDAVVTIC  96

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ------VptpppppPMS  563
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAEL+YLQAHLA+L+      +P PP  P   
Sbjct  97   YEAQARLRDPVYGCVAHIFALQQQVVNLQAELTYLQAHLATLELPAPPPLPAPPQMPMPG  156

Query  562  AMNIAD--LSTASPAYDTLSSLFDP  494
              +I+D  LST+ P    LS+LFDP
Sbjct  157  PFSISDLPLSTSVPTTVDLSALFDP  181



>ref|XP_003521944.1| PREDICTED: LOB domain-containing protein 18-like [Glycine max]
Length=251

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 115/148 (78%), Gaps = 11/148 (7%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL +IP +KRLDAV+T+C
Sbjct  37   ACKFLRRKCVPGCIFAPYFDSEQGATHFAAVHKVFGASNVSKLLLNIPVYKRLDAVVTIC  96

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV-----------ptppp  578
            +EAQARLRDPVYGCVAHIFA+QQQVV+LQAELSYLQ HLA+L++                
Sbjct  97   YEAQARLRDPVYGCVAHIFALQQQVVSLQAELSYLQGHLATLELPQPPPPPPPPSSPQAT  156

Query  577  ppPMSAMNIADLSTASPAYDTLSSLFDP  494
                  ++IA+L +  PA   LSSLFDP
Sbjct  157  TMAPPVISIAELPSTVPATYDLSSLFDP  184



>ref|XP_009379266.1| PREDICTED: LOB domain-containing protein 18 [Pyrus x bretschneideri]
 ref|XP_009347043.1| PREDICTED: LOB domain-containing protein 18-like [Pyrus x bretschneideri]
Length=253

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 130/170 (76%), Gaps = 15/170 (9%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+T+C
Sbjct  32   ACKFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTIC  91

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSA-----  560
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAELSYLQAHLA++++P+PPPPPP  +     
Sbjct  92   YEAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATMELPSPPPPPPPPSAAALI  151

Query  559  ----MNIADLSTA---SPAYDTLSSLFDPTSSMVQpaawppppPMQQTRH  431
                 +I+DL +A    PA   LSSLF+P   MV          +   RH
Sbjct  152  TPPQFSISDLPSAVSSMPASYDLSSLFEP---MVMQPWAMQQRALHDPRH  198



>ref|XP_008343190.1| PREDICTED: LOB domain-containing protein 30 [Malus domestica]
Length=253

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 130/170 (76%), Gaps = 15/170 (9%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+T+C
Sbjct  32   ACKFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTIC  91

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSA-----  560
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAELSYLQAHLA++++P+PPPPPP  +     
Sbjct  92   YEAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATMELPSPPPPPPPPSAAALI  151

Query  559  ----MNIADLSTA---SPAYDTLSSLFDPTSSMVQpaawppppPMQQTRH  431
                 +I+DL +A    PA   LSSLF+P   MV          +   RH
Sbjct  152  TPPQFSISDLPSAVSSMPASYDLSSLFEP---MVMQPWSMQQRALHDLRH  198



>ref|XP_004145058.1| PREDICTED: LOB domain-containing protein 18-like [Cucumis sativus]
 ref|XP_004153747.1| PREDICTED: LOB domain-containing protein 18-like [Cucumis sativus]
 ref|XP_004170755.1| PREDICTED: LOB domain-containing protein 18-like [Cucumis sativus]
 gb|KGN46236.1| hypothetical protein Csa_6G076840 [Cucumis sativus]
Length=240

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 121/148 (82%), Gaps = 11/148 (7%)
 Frame = -1

Query  898  KFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVCFE  719
            KFLRRKCV GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+T+C+E
Sbjct  34   KFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTICYE  93

Query  718  AQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV---------ptpppppPM  566
            AQARLRDPVYGCVAHIFA+QQQVV+LQAEL+YLQAHLA+L++         P PP  P  
Sbjct  94   AQARLRDPVYGCVAHIFALQQQVVSLQAELTYLQAHLATLELPSPPNPPPPPPPPSFPAQ  153

Query  565  SAMNIADLSTAS--PAYDTLSSLFDPTS  488
              ++I+DL +AS  PA   LSSLFDP +
Sbjct  154  PPLSISDLPSASSLPATYDLSSLFDPMA  181



>ref|XP_004510942.1| PREDICTED: LOB domain-containing protein 18-like [Cicer arietinum]
Length=230

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 116/148 (78%), Gaps = 11/148 (7%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC++GCIFAPYFDS+QGAS FA+VHKVFGASNVSKLL ++P HKRLDAVIT+C
Sbjct  27   ACKFLRRKCLSGCIFAPYFDSEQGASHFAAVHKVFGASNVSKLLQNVPVHKRLDAVITIC  86

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV-----------ptppp  578
            +EAQAR+RDPVYGCVAHIF +QQQVV+LQAELSYLQ H+A+ +V              P 
Sbjct  87   YEAQARMRDPVYGCVAHIFTLQQQVVSLQAELSYLQGHIATYEVPQPPKTSPPQATIAPS  146

Query  577  ppPMSAMNIADLSTASPAYDTLSSLFDP  494
               ++ + +A  S+ +PA   LSSLFDP
Sbjct  147  MVSLANLPLASSSSINPATYDLSSLFDP  174



>ref|XP_004231166.1| PREDICTED: LOB domain-containing protein 30 [Solanum lycopersicum]
Length=271

 Score =   196 bits (499),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 149/216 (69%), Gaps = 28/216 (13%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCVAGCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+T+C
Sbjct  43   ACKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVLTIC  102

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPM-------  566
            FEAQARLRDPVYGCVAHIFA+Q QV NLQAELSYLQAHL +L++PTPPP PP        
Sbjct  103  FEAQARLRDPVYGCVAHIFALQHQVANLQAELSYLQAHLTTLELPTPPPLPPPPPPPPQQ  162

Query  565  -------SAMNIADLSTASP----AYDTLSSLFDP----TSSMVQpaawppppPMQQTRH  431
                    ++ IADL TA P    AYD LSSLFDP     S  +Q    PPPP     RH
Sbjct  163  PQTMLHQPSLTIADLPTAGPSLPAAYD-LSSLFDPMVIQPSWAMQQQPRPPPPLPLDPRH  221

Query  430  LGGAANRdpaadgmssssppagsGVLQELTRHLMRR  323
             GGA      A    S S   G G LQEL R L+ R
Sbjct  222  FGGA-----RAPMDMSPSTGGGGGDLQELARELLHR  252



>ref|XP_011094569.1| PREDICTED: LOB domain-containing protein 18 [Sesamum indicum]
Length=161

 Score =   192 bits (489),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCVAGCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLLHHIP  KRLDAV+T+C
Sbjct  39   ACKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLHHIPVQKRLDAVVTIC  98

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV  593
            +EAQ+RLRDP+YGCVAHIFA+QQQVVNLQ ELSYLQAHLA+L++
Sbjct  99   YEAQSRLRDPIYGCVAHIFALQQQVVNLQTELSYLQAHLAALEL  142



>ref|XP_004985011.1| PREDICTED: LOB domain-containing protein 18-like [Setaria italica]
Length=259

 Score =   196 bits (497),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 119/145 (82%), Gaps = 8/145 (6%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL  IP +KRLDAV+T+C
Sbjct  36   ACKFLRRKCVSGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLQIPAYKRLDAVVTIC  95

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV------ptpppppPMS  563
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAEL+YLQAHLA+L++      P PP  P   
Sbjct  96   YEAQARLRDPVYGCVAHIFALQQQVVNLQAELTYLQAHLATLELPSPPPLPAPPQMPMPG  155

Query  562  AMNIADL--STASPAYDTLSSLFDP  494
              +I+DL  ST  P    LS+LFDP
Sbjct  156  PFSISDLPSSTNVPTTVDLSALFDP  180



>ref|NP_001049546.1| Os03g0246900 [Oryza sativa Japonica Group]
 gb|ABF94951.1| LOB domain protein 18, putative [Oryza sativa Japonica Group]
 dbj|BAF11460.1| Os03g0246900 [Oryza sativa Japonica Group]
 gb|EEE58693.1| hypothetical protein OsJ_10128 [Oryza sativa Japonica Group]
Length=275

 Score =   196 bits (498),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 120/146 (82%), Gaps = 9/146 (6%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL  IP HKR DAV+T+C
Sbjct  40   ACKFLRRKCVSGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLQIPAHKRPDAVVTIC  99

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ-------VptpppppPM  566
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAEL+YLQAHLA+L+       +P PP  P  
Sbjct  100  YEAQARLRDPVYGCVAHIFALQQQVVNLQAELTYLQAHLATLELPSPPPLMPAPPQMPMP  159

Query  565  SAMNIADL--STASPAYDTLSSLFDP  494
            +  +I+DL  ST+ P    LS+LFDP
Sbjct  160  APFSISDLPSSTSVPTTVDLSALFDP  185



>gb|EAY89242.1| hypothetical protein OsI_10739 [Oryza sativa Indica Group]
Length=276

 Score =   196 bits (498),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 120/146 (82%), Gaps = 9/146 (6%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL  IP HKR DAV+T+C
Sbjct  41   ACKFLRRKCVSGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLQIPAHKRPDAVVTIC  100

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ-------VptpppppPM  566
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAEL+YLQAHLA+L+       +P PP  P  
Sbjct  101  YEAQARLRDPVYGCVAHIFALQQQVVNLQAELTYLQAHLATLELPSPPPLMPAPPQMPMP  160

Query  565  SAMNIADL--STASPAYDTLSSLFDP  494
            +  +I+DL  ST+ P    LS+LFDP
Sbjct  161  APFSISDLPSSTSVPTTVDLSALFDP  186



>ref|XP_010277398.1| PREDICTED: LOB domain-containing protein 30-like [Nelumbo nucifera]
Length=256

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 118/143 (83%), Gaps = 6/143 (4%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+T+C
Sbjct  34   ACKFLRRKCVIGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTIC  93

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLAS--LQVptpppppPMSAMNI  551
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAELSYLQAHLA+  L  P PP       ++I
Sbjct  94   YEAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLAALELPSPPPPTLLAPPPLSI  153

Query  550  ADLSTAS--PAYDT--LSSLFDP  494
             DL +AS  PA  T  LS++ DP
Sbjct  154  TDLPSASSIPATATFNLSTILDP  176



>ref|XP_006649734.1| PREDICTED: LOB domain-containing protein 18-like [Oryza brachyantha]
Length=265

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 119/145 (82%), Gaps = 9/145 (6%)
 Frame = -1

Query  901  CKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVCF  722
            CKFLRRKCV+GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL  IP HKR DAV+T+C+
Sbjct  40   CKFLRRKCVSGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLQIPAHKRPDAVVTICY  99

Query  721  EAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ-------VptpppppPMS  563
            EAQARLRDPVYGCVAHIFA+QQQVVNLQAEL+YLQAHLA+L+       +P PP  P  +
Sbjct  100  EAQARLRDPVYGCVAHIFALQQQVVNLQAELTYLQAHLATLELPSPPPLMPAPPQMPMPA  159

Query  562  AMNIADL--STASPAYDTLSSLFDP  494
              +I+DL  ST+ P    LS+LFDP
Sbjct  160  PFSISDLPSSTSVPTTVDLSALFDP  184



>ref|XP_003517057.1| PREDICTED: LOB domain-containing protein 18-like [Glycine max]
 gb|KHN40139.1| LOB domain-containing protein 18 [Glycine soja]
Length=247

 Score =   194 bits (494),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 122/153 (80%), Gaps = 17/153 (11%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC+ GCIFAPYFDS++GA+ FA+VHKVFGASN+SKLL +IP HKRLDAV+T+C
Sbjct  29   ACKFLRRKCMPGCIFAPYFDSEEGATHFAAVHKVFGASNISKLLLNIPVHKRLDAVVTIC  88

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSA-----  560
            +EAQARLRDPVYGCVAHIFA+QQQV++LQAELSYLQ HLA+L++P PPPP    A     
Sbjct  89   YEAQARLRDPVYGCVAHIFALQQQVMSLQAELSYLQGHLATLELPQPPPPSSPQATTMAP  148

Query  559  ---MNIADL--------STASPAYDTLSSLFDP  494
               ++IA+         ST  P YD LSSLFDP
Sbjct  149  PPLISIAEFIPSSALASSTVPPTYD-LSSLFDP  180



>ref|XP_010092844.1| hypothetical protein L484_022439 [Morus notabilis]
 gb|EXB52662.1| hypothetical protein L484_022439 [Morus notabilis]
Length=243

 Score =   194 bits (494),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 117/146 (80%), Gaps = 9/146 (6%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+TVC
Sbjct  28   ACKFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTVC  87

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLAS-------LQVptpppppPM  566
            +EAQARLRDPVYGCVAHIFA+QQQVV+LQ ELSYLQAHLA+          P PP     
Sbjct  88   YEAQARLRDPVYGCVAHIFALQQQVVSLQTELSYLQAHLATLELPSPPPAPPPPPSSLNP  147

Query  565  SAMNIADLSTAS--PAYDTLSSLFDP  494
              ++IADL +AS  PA   LSSLF+P
Sbjct  148  PPLSIADLPSASSVPATYDLSSLFEP  173



>ref|XP_004986691.1| PREDICTED: LOB domain-containing protein 18-like [Setaria italica]
Length=262

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 122/146 (84%), Gaps = 10/146 (7%)
 Frame = -1

Query  901  CKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVCF  722
            CKFLRRKCV+GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL  IPPHKRLDAV+TVC+
Sbjct  38   CKFLRRKCVSGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLQIPPHKRLDAVVTVCY  97

Query  721  EAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPM--------  566
            EAQARLRDP+YGCV+HIFA+QQQVVNLQAEL+YLQ HL ++++PTPPP  P         
Sbjct  98   EAQARLRDPIYGCVSHIFALQQQVVNLQAELTYLQGHLTTMELPTPPPFAPQPQPPMPTN  157

Query  565  SAMNIAD--LSTASPAYDTLSSLFDP  494
            +A ++++  LS++ PA   LS+L DP
Sbjct  158  AAFSVSNLPLSSSVPATVDLSTLLDP  183



>ref|XP_008776002.1| PREDICTED: LOB domain-containing protein 18-like [Phoenix dactylifera]
Length=238

 Score =   193 bits (490),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 116/145 (80%), Gaps = 8/145 (6%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+T+C
Sbjct  31   ACKFLRRKCVSGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPAHKRLDAVVTIC  90

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLA------SLQVptpppppPMS  563
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAELSYLQAHLA         +P PP      
Sbjct  91   YEAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATLELPTPPPLPPPPQLSTPP  150

Query  562  AMNIADLSTASPAYDT--LSSLFDP  494
              +I+DL ++     T  LS+LFDP
Sbjct  151  PFSISDLPSSLNMSATVDLSTLFDP  175



>gb|EPS64174.1| hypothetical protein M569_10607, partial [Genlisea aurea]
Length=130

 Score =   189 bits (480),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCVAGCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKR+DAV+T+C
Sbjct  14   ACKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRVDAVVTIC  73

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV  593
            +EAQARLRDP+YGCV+HIF++QQQV+NLQAE+SYLQAHLAS+++
Sbjct  74   YEAQARLRDPIYGCVSHIFSLQQQVMNLQAEISYLQAHLASIEI  117



>ref|XP_009391108.1| PREDICTED: LOB domain-containing protein 18-like [Musa acuminata 
subsp. malaccensis]
Length=242

 Score =   192 bits (489),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 123/145 (85%), Gaps = 8/145 (6%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC+AGCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDA +T+C
Sbjct  42   ACKFLRRKCMAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPAHKRLDAAVTIC  101

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAM----  557
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAELSYLQAHLA+L++P+PPPP P   +    
Sbjct  102  YEAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATLELPSPPPPLPPPLVVAPI  161

Query  556  --NIADLSTAS--PAYDTLSSLFDP  494
               I+DL +A+  P    LS+LF+P
Sbjct  162  PFAISDLPSAANLPTAVDLSTLFNP  186



>ref|XP_006397723.1| hypothetical protein EUTSA_v10001791mg [Eutrema salsugineum]
 gb|ESQ39176.1| hypothetical protein EUTSA_v10001791mg [Eutrema salsugineum]
Length=262

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 122/158 (77%), Gaps = 19/158 (12%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QG++ FA+VHKVFGASNVSKLL HIP H+R DAV+T+C
Sbjct  39   ACKFLRRKCVPGCIFAPYFDSEQGSAYFAAVHKVFGASNVSKLLLHIPVHRRSDAVVTIC  98

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppp----------  575
            +EAQAR+RDP+YGCVAHIFA+QQQVVNLQAE+SYLQAHLASL++P P             
Sbjct  99   YEAQARIRDPIYGCVAHIFALQQQVVNLQAEVSYLQAHLASLELPQPQTRPAPLPQTQQQ  158

Query  574  ----pPMSAMNIADL-STASP---AYDTLSSLFDPTSS  485
                 P   ++I DL S+ SP    YD L+S+FD T+S
Sbjct  159  ALFFTPTPPLSITDLPSSVSPLPSTYD-LASIFDQTTS  195



>ref|XP_002465559.1| hypothetical protein SORBIDRAFT_01g041130 [Sorghum bicolor]
 gb|EER92557.1| hypothetical protein SORBIDRAFT_01g041130 [Sorghum bicolor]
Length=276

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 118/149 (79%), Gaps = 8/149 (5%)
 Frame = -1

Query  898  KFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVCFE  719
            KFLRRKCV+GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL  IP HKRLDAV+T+C+E
Sbjct  44   KFLRRKCVSGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLQIPAHKRLDAVVTICYE  103

Query  718  AQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLAS------LQVptpppppPMSAM  557
            AQARLRDPVYGCVAHIFA+QQQVVNLQAEL+YLQAHLA+        +P PP  P   A 
Sbjct  104  AQARLRDPVYGCVAHIFALQQQVVNLQAELTYLQAHLATLELPSPPPLPAPPQMPLPGAF  163

Query  556  NIADL--STASPAYDTLSSLFDPTSSMVQ  476
            +I+DL  ST+ P    LS+LFDP     Q
Sbjct  164  SISDLPSSTSVPTTVDLSALFDPPPQQPQ  192



>ref|XP_011093197.1| PREDICTED: LOB domain-containing protein 18-like [Sesamum indicum]
Length=245

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCVAGCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL H+P  KRLDAV+T+C
Sbjct  30   ACKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHVPVEKRLDAVVTIC  89

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EAQARLRDPVYGCVAHIFA+QQQVVNLQAELSYLQAHLA+L+
Sbjct  90   YEAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATLE  132



>ref|XP_006851815.1| hypothetical protein AMTR_s00041p00044170 [Amborella trichopoda]
 gb|ERN13282.1| hypothetical protein AMTR_s00041p00044170 [Amborella trichopoda]
Length=217

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GC+FAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+TVC
Sbjct  18   ACKFLRRKCVSGCVFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPAHKRLDAVVTVC  77

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV  593
            +EAQARLRDPVYGCVAHIFA+QQQV+NLQAEL+Y+QAHL+++++
Sbjct  78   YEAQARLRDPVYGCVAHIFALQQQVMNLQAELAYMQAHLSTMEL  121



>emb|CDY18932.1| BnaC04g04180D [Brassica napus]
Length=251

 Score =   190 bits (483),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 118/153 (77%), Gaps = 13/153 (8%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QG++ FA+VHKVFGASNVSKLL HIP H+R DAV+T+C
Sbjct  37   ACKFLRRKCVPGCIFAPYFDSEQGSAYFAAVHKVFGASNVSKLLLHIPVHRRADAVVTIC  96

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptppp-----------  578
            +EAQAR+RDP+YGCVA+IFA+QQQVVNLQAE+SYLQAHLASL++P P             
Sbjct  97   YEAQARIRDPIYGCVANIFALQQQVVNLQAEVSYLQAHLASLELPQPQTRPPPLTQPQPL  156

Query  577  -ppPMSAMNIADLSTASPAYDTLSSLFDPTSSM  482
               P   ++I DL  +   YD L+S+ DP +S 
Sbjct  157  FFTPPPPLSITDLPASVSPYD-LASIVDPPTSW  188



>ref|XP_009386566.1| PREDICTED: LOB domain-containing protein 30-like [Musa acuminata 
subsp. malaccensis]
Length=257

 Score =   191 bits (484),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 116/145 (80%), Gaps = 8/145 (6%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC+AGCIFAPYFD++QGA+ FA+VHKVFGASN SKLL HIP HKR DAVIT+C
Sbjct  46   ACKFLRRKCMAGCIFAPYFDAEQGAARFAAVHKVFGASNASKLLLHIPAHKRHDAVITIC  105

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLA------SLQVptpppppPMS  563
            +EAQARLRDPVYGCVAHIFA+QQQVV+LQAELSYLQAHLA          P PP     +
Sbjct  106  YEAQARLRDPVYGCVAHIFALQQQVVSLQAELSYLQAHLATLELPSPPPPPPPPSLLAPT  165

Query  562  AMNIADLSTAS--PAYDTLSSLFDP  494
              + +DL++AS  P+   LS++FDP
Sbjct  166  PFSTSDLTSASSLPSTGDLSTMFDP  190



>gb|KEH19039.1| LOB domain protein [Medicago truncatula]
Length=232

 Score =   189 bits (481),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 120/151 (79%), Gaps = 9/151 (6%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC+ GCIFAPYFDS+QGAS FA+VHKVFGASNVSKLL ++P HKRLDAVIT+C
Sbjct  26   ACKFLRRKCIPGCIFAPYFDSEQGASHFAAVHKVFGASNVSKLLQNVPVHKRLDAVITIC  85

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAMNIAD  545
            +EAQARLRDP++GCVAHIF +QQQV++LQAELSYLQ HLA+ +VP PP P P  A+ +  
Sbjct  86   YEAQARLRDPIFGCVAHIFTLQQQVMSLQAELSYLQGHLATYEVPQPPTPSPPQALPMVS  145

Query  544  L-------STASPAYDTLSSLFD--PTSSMV  479
            L       S+A P    LSSL++   TSS V
Sbjct  146  LANLPLAPSSAMPDTYDLSSLYEVPQTSSWV  176



>ref|XP_007139994.1| hypothetical protein PHAVU_008G075900g [Phaseolus vulgaris]
 gb|ESW11988.1| hypothetical protein PHAVU_008G075900g [Phaseolus vulgaris]
Length=225

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 121/149 (81%), Gaps = 12/149 (8%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC+ GCIFAPYFD++QG + FA+VHKVFGASNVSKLL  IP HKRLDAVIT+C
Sbjct  17   ACKFLRRKCIPGCIFAPYFDAEQGTNHFAAVHKVFGASNVSKLLLSIPVHKRLDAVITIC  76

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAM----  557
            +EAQ+RLRDPVYGCV+HIFA+QQQVVNLQAELSYLQ H A ++VP PPPPP   ++    
Sbjct  77   YEAQSRLRDPVYGCVSHIFALQQQVVNLQAELSYLQGHFAQMEVPHPPPPPLTQSVATPR  136

Query  556  -NIADLST------ASPAYDTLSSLFDPT  491
             +++DL +      A+  YD LSSLFDPT
Sbjct  137  FSVSDLPSTTAAAAATATYD-LSSLFDPT  164



>ref|XP_002880178.1| hypothetical protein ARALYDRAFT_483677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56437.1| hypothetical protein ARALYDRAFT_483677 [Arabidopsis lyrata subsp. 
lyrata]
Length=260

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 121/154 (79%), Gaps = 15/154 (10%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QG++ FA+VHKVFGASNVSKLL HIP H+R DAV+T+C
Sbjct  40   ACKFLRRKCVPGCIFAPYFDSEQGSAYFAAVHKVFGASNVSKLLLHIPVHRRSDAVVTIC  99

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptppp----------p  575
            +EAQAR+RDP+YGCVAHIFA+QQQVVNLQAE+SYLQAHLASL++P P             
Sbjct  100  YEAQARIRDPIYGCVAHIFALQQQVVNLQAEVSYLQAHLASLELPQPQTRPQPMPQPLFF  159

Query  574  pPMSAMNIADL-STASP---AYDTLSSLFDPTSS  485
             P   + I DL ++ SP    YD L+S+FD T+S
Sbjct  160  TPPPPLAITDLPASVSPLPSTYD-LASIFDQTTS  192



>ref|XP_006295913.1| hypothetical protein CARUB_v10025050mg [Capsella rubella]
 gb|EOA28811.1| hypothetical protein CARUB_v10025050mg [Capsella rubella]
Length=259

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 121/155 (78%), Gaps = 17/155 (11%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QG++ FA+VHKVFGASNVSKLL HIP H+R DAV+T+C
Sbjct  36   ACKFLRRKCVPGCIFAPYFDSEQGSAYFAAVHKVFGASNVSKLLLHIPVHRRSDAVVTIC  95

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptppp-----------  578
            +EAQAR+RDP+YGCVAHIFA+QQQVVNLQAE+SYLQAHLASL++P P             
Sbjct  96   YEAQARIRDPIYGCVAHIFALQQQVVNLQAEVSYLQAHLASLELPQPQTRPPPLSQPQPL  155

Query  577  -ppPMSAMNIADL-STASP---AYDTLSSLFDPTS  488
               P    +IADL ++ SP    YD L+S+FD T+
Sbjct  156  FFTPPPPFSIADLPASVSPLPSTYD-LASIFDQTT  189



>ref|XP_010508173.1| PREDICTED: LOB domain-containing protein 18 [Camelina sativa]
Length=264

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QG++ FA+VHKVFGASNVSKLL HIP H+R DAV+T+C
Sbjct  42   ACKFLRRKCVPGCIFAPYFDSEQGSAYFAAVHKVFGASNVSKLLLHIPVHRRSDAVVTIC  101

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV  593
            +EAQAR+RDP+YGCVAHIFA+QQQVVNLQAE+SYLQAHLASL++
Sbjct  102  YEAQARIRDPIYGCVAHIFALQQQVVNLQAEVSYLQAHLASLEL  145



>emb|CDY68635.1| BnaAnng27870D [Brassica napus]
Length=259

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QG++ FA+VHKVFGASNVSKLL HIP H+R DAV+T+C
Sbjct  37   ACKFLRRKCVPGCIFAPYFDSEQGSAYFAAVHKVFGASNVSKLLLHIPVHRRSDAVVTIC  96

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV  593
            +EAQAR+RDP+YGCVAHIFA+QQQVVNLQAE+SY+QAHLASL++
Sbjct  97   YEAQARIRDPIYGCVAHIFALQQQVVNLQAEVSYVQAHLASLEL  140



>ref|NP_850436.1| LOB domain-containing protein 18 [Arabidopsis thaliana]
 sp|O22131.2|LBD18_ARATH RecName: Full=LOB domain-containing protein 18; AltName: Full=ASYMMETRIC 
LEAVES 2-like protein 20; Short=AS2-like protein 
20 [Arabidopsis thaliana]
 gb|AAL38036.1|AF447891_1 LOB DOMAIN 18 [Arabidopsis thaliana]
 gb|AAB82622.2| expressed protein [Arabidopsis thaliana]
 gb|ABF82619.1| At2g45420 [Arabidopsis thaliana]
 dbj|BAH10564.1| ASYMMETRIC LEAVES2-like 20 protein [Arabidopsis thaliana]
 gb|AEC10551.1| LOB domain-containing protein 18 [Arabidopsis thaliana]
Length=262

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QG++ FA+VHKVFGASNVSKLL HIP H+R DAV+T+C
Sbjct  40   ACKFLRRKCVPGCIFAPYFDSEQGSAYFAAVHKVFGASNVSKLLLHIPVHRRSDAVVTIC  99

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV  593
            +EAQAR+RDP+YGCVAHIFA+QQQVVNLQAE+SYLQAHLASL++
Sbjct  100  YEAQARIRDPIYGCVAHIFALQQQVVNLQAEVSYLQAHLASLEL  143



>ref|XP_009142334.1| PREDICTED: LOB domain-containing protein 18-like [Brassica rapa]
Length=259

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QG++ FA+VHKVFGASNVSKLL HIP H+R DAV+T+C
Sbjct  37   ACKFLRRKCVPGCIFAPYFDSEQGSAYFAAVHKVFGASNVSKLLLHIPVHRRSDAVVTIC  96

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV  593
            +EAQAR+RDP+YGCVAHIFA+QQQVVNLQAE+SY+QAHLASL++
Sbjct  97   YEAQARIRDPIYGCVAHIFALQQQVVNLQAEVSYVQAHLASLEL  140



>ref|XP_010506484.1| PREDICTED: LOB domain-containing protein 18 [Camelina sativa]
Length=263

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QG+  FA+VHKVFGASNVSKLL HIP H+R DAV+T+C
Sbjct  41   ACKFLRRKCVPGCIFAPYFDSEQGSGYFAAVHKVFGASNVSKLLLHIPVHRRSDAVVTIC  100

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV  593
            +EAQAR+RDP+YGCVAHIFA+QQQVVNLQAE+SYLQAHLASL++
Sbjct  101  YEAQARIRDPIYGCVAHIFALQQQVVNLQAEVSYLQAHLASLEL  144



>ref|XP_010544656.1| PREDICTED: LOB domain-containing protein 18-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010544657.1| PREDICTED: LOB domain-containing protein 18-like isoform X3 [Tarenaya 
hassleriana]
Length=231

 Score =   188 bits (477),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 116/149 (78%), Gaps = 11/149 (7%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL  IP HKR DAVIT+ 
Sbjct  16   ACKFLRRKCVPGCIFAPYFDSEQGATYFAAVHKVFGASNVSKLLLQIPVHKRSDAVITIS  75

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ------VptpppppPMS  563
            +EA ARLRDPVYGCVA IFA+QQQVVNLQ ELS+LQAHLA+L+       P PPP     
Sbjct  76   YEAHARLRDPVYGCVAQIFALQQQVVNLQTELSFLQAHLATLEPPQLRPPPPPPPVVVPP  135

Query  562  AMNIADLS--TASP--AYDTLSSLFDPTS  488
             + I+DL   +ASP   YD LSS FDPT+
Sbjct  136  PLTISDLPVFSASPPTTYD-LSSFFDPTA  163



>gb|KFK37335.1| hypothetical protein AALP_AA4G243200 [Arabis alpina]
Length=262

 Score =   188 bits (478),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QG++ FA+VHKVFGASNVSKLL HIP H+R DAV+T+C
Sbjct  38   ACKFLRRKCVPGCIFAPYFDSEQGSAYFAAVHKVFGASNVSKLLLHIPVHRRSDAVVTIC  97

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EAQAR+RDP+YGCVAHIFA+QQQVVNLQ+E+SYLQAHLASL+
Sbjct  98   YEAQARIRDPIYGCVAHIFALQQQVVNLQSEVSYLQAHLASLE  140



>ref|XP_008659582.1| PREDICTED: LOB domain-containing protein 30-like [Zea mays]
 tpg|DAA46768.1| TPA: putative LOB domain-containing family protein [Zea mays]
 gb|AIB04527.1| LOB transcription factor, partial [Zea mays]
Length=245

 Score =   188 bits (477),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 110/124 (89%), Gaps = 3/124 (2%)
 Frame = -1

Query  901  CKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVCF  722
            CKFLRRKCV GC+FAPYFDS+QGA+ FA+VHKVFGASNVSKLL  +PPHKRLDAV+TVC+
Sbjct  38   CKFLRRKCVTGCVFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLQVPPHKRLDAVVTVCY  97

Query  721  EAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAMNIADL  542
            EAQAR+RDPVYGCV+H+FA+QQQVVNLQ EL+YLQ HL++++   PP PPP++A N   +
Sbjct  98   EAQARIRDPVYGCVSHVFALQQQVVNLQTELTYLQGHLSTME---PPTPPPLAAQNQMPM  154

Query  541  STAS  530
            +TA+
Sbjct  155  TTAA  158



>emb|CDY57109.1| BnaC04g56960D [Brassica napus]
Length=260

 Score =   188 bits (478),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QG++ FA+VHKVFGASN+SKLL HIP H+R DAV+T+C
Sbjct  38   ACKFLRRKCVPGCIFAPYFDSEQGSAYFAAVHKVFGASNISKLLLHIPVHRRSDAVVTIC  97

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV  593
            +EAQAR+RDP+YGCVAHIFA+QQQVVNLQAE+SY+QAHLASL++
Sbjct  98   YEAQARIRDPIYGCVAHIFALQQQVVNLQAEVSYVQAHLASLEL  141



>gb|EYU30570.1| hypothetical protein MIMGU_mgv1a013332mg [Erythranthe guttata]
Length=223

 Score =   186 bits (473),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 118/147 (80%), Gaps = 11/147 (7%)
 Frame = -1

Query  898  KFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVCFE  719
            KFLRRKC AGC+F+PYF+S+QGA+ FA+VHKVFGASNVSKLL HIP  KRLDAV+T+C+E
Sbjct  22   KFLRRKCAAGCVFSPYFESEQGAAHFAAVHKVFGASNVSKLLLHIPVQKRLDAVVTICYE  81

Query  718  AQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV-------ptpppppPMSA  560
            AQARLRDPVYGCVAHIFA+QQQVVNLQAELSYLQAHLA+ ++       P P  PPP + 
Sbjct  82   AQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLAAFEIPTPPPALPPPLTPPPPAL  141

Query  559  MNIADLSTASPAYDT----LSSLFDPT  491
            ++I+DL T S    T    LSS+FD T
Sbjct  142  LSISDLPTVSAVPSTYNHDLSSIFDST  168



>ref|XP_003552342.1| PREDICTED: LOB domain-containing protein 18-like [Glycine max]
Length=234

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 115/151 (76%), Gaps = 15/151 (10%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAPYFDS+QG S FA+VHKVFGASNVSKLL  IP H+RLD VIT+C
Sbjct  20   ACKFLRRKCVSGCIFAPYFDSEQGTSHFAAVHKVFGASNVSKLLLSIPVHRRLDTVITIC  79

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV--------ptpppppP  569
            +EAQ+R+RDPVYGCVAHIFA+QQQ+V+LQAELSYL  HLA +++        P      P
Sbjct  80   YEAQSRIRDPVYGCVAHIFALQQQLVSLQAELSYLHGHLAQMELPQPSPPPPPPQTTAAP  139

Query  568  MSAMNIADLSTASPA------YDTLSSLFDP  494
             S  +IADL  A+ A      YD LSSLFDP
Sbjct  140  PSGFSIADLPPATVAAVPATTYD-LSSLFDP  169



>ref|XP_006662199.1| PREDICTED: LOB domain-containing protein 18-like [Oryza brachyantha]
Length=240

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 108/140 (77%), Gaps = 14/140 (10%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL  IP H+RLDAV+T+C
Sbjct  38   ACKFLRRKCVQGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLQQIPAHRRLDAVVTIC  97

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAMNIAD  545
            +EAQARLRDPVYGCVAHIF +Q QV  LQ EL+YLQAHL++           M + N +D
Sbjct  98   YEAQARLRDPVYGCVAHIFHLQHQVAGLQTELNYLQAHLSA-----------MDSFNFSD  146

Query  544  LSTAS---PAYDTLSSLFDP  494
            L ++S   PA   LS LFDP
Sbjct  147  LPSSSSNVPATADLSVLFDP  166



>ref|XP_009143140.1| PREDICTED: LOB domain-containing protein 18 [Brassica rapa]
Length=253

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 117/151 (77%), Gaps = 13/151 (9%)
 Frame = -1

Query  898  KFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVCFE  719
            KFLRRKCV GCIFAPYFDS+QG++ FA+VHKVFGASNVSKLL HIP H+R DAV+T+C+E
Sbjct  41   KFLRRKCVPGCIFAPYFDSEQGSAYFAAVHKVFGASNVSKLLLHIPVHRRADAVVTICYE  100

Query  718  AQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppP----------  569
            AQAR+RDP+YGCVAHIFA+QQQVVNLQAE+SYLQ+HLASL++P P   PP          
Sbjct  101  AQARIRDPIYGCVAHIFALQQQVVNLQAEVSYLQSHLASLELPQPQTRPPPITQPQPLFF  160

Query  568  --MSAMNIADLSTASPAYDTLSSLFDPTSSM  482
                 ++I DL  +   YD L+++ DP +S 
Sbjct  161  TPPPPLSITDLPASVSPYD-LATIVDPPTSW  190



>ref|XP_009389181.1| PREDICTED: LOB domain-containing protein 18-like [Musa acuminata 
subsp. malaccensis]
Length=236

 Score =   185 bits (470),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYF+S+QGA+ FA+VHKVFGASN SKLL HIP HKRLDAV+T+C
Sbjct  30   ACKFLRRKCVTGCIFAPYFNSEQGAAHFAAVHKVFGASNASKLLLHIPAHKRLDAVVTIC  89

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV  593
            +EAQARLRDPVYGCVAHIFA+QQQVVNL AELS LQAHLA+L++
Sbjct  90   YEAQARLRDPVYGCVAHIFALQQQVVNLHAELSCLQAHLATLEL  133



>gb|KFK30604.1| hypothetical protein AALP_AA6G003400 [Arabis alpina]
Length=228

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 122/147 (83%), Gaps = 8/147 (5%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAP+FDS+QGA+ F++VHKVFGASNVSKLL+ +P HKR DAV+ +C
Sbjct  21   ACKFLRRKCVSGCIFAPHFDSEQGAAHFSAVHKVFGASNVSKLLNIVPEHKRPDAVVCIC  80

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSA-----  560
            FEA +RLRDPVYGCV+HI ++QQQV++LQ+ELSYLQAHLA+L++P PPP P  S+     
Sbjct  81   FEAHSRLRDPVYGCVSHIVSLQQQVLSLQSELSYLQAHLATLELPQPPPAPATSSCSPPP  140

Query  559  MNIADLS--TASPAYDTLSSLFDPTSS  485
             +I+DL   T S  YD LSS+F+P SS
Sbjct  141  FSISDLPTITTSSVYD-LSSIFEPMSS  166



>ref|XP_002467307.1| hypothetical protein SORBIDRAFT_01g024400 [Sorghum bicolor]
 gb|EER94305.1| hypothetical protein SORBIDRAFT_01g024400 [Sorghum bicolor]
Length=270

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 121/159 (76%), Gaps = 20/159 (13%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL  IPPHKRLDAV+TVC
Sbjct  37   ACKFLRRKCVTGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLQIPPHKRLDAVVTVC  96

Query  724  FEAQARLRDPVYGCVAHIFAIQQQ----------VVNLQAELSYLQAHLASLQVptpppp  575
            +EAQAR+RDPVYGCV+H+FA+QQQ          VVNLQ EL+YLQ HL+++++PTPPP 
Sbjct  97   YEAQARIRDPVYGCVSHVFALQQQVCMHMQRVHVVVNLQTELTYLQGHLSTIELPTPPPF  156

Query  574  pPMSAMN------IADLSTAS----PAYDTLSSLFDPTS  488
               + M       +++L +AS    P    +S++F+P +
Sbjct  157  GAQNQMPMTATFCVSNLPSASSNIIPGTVDVSTVFEPQT  195



>ref|XP_010544655.1| PREDICTED: LOB domain-containing protein 18-like isoform X1 [Tarenaya 
hassleriana]
Length=234

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 116/152 (76%), Gaps = 14/152 (9%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL  IP HKR DAVIT+ 
Sbjct  16   ACKFLRRKCVPGCIFAPYFDSEQGATYFAAVHKVFGASNVSKLLLQIPVHKRSDAVITIS  75

Query  724  FEAQARLRDPVYGCVAHIFAIQQQ---VVNLQAELSYLQAHLASLQ------Vptppppp  572
            +EA ARLRDPVYGCVA IFA+QQQ   VVNLQ ELS+LQAHLA+L+       P PPP  
Sbjct  76   YEAHARLRDPVYGCVAQIFALQQQVRSVVNLQTELSFLQAHLATLEPPQLRPPPPPPPVV  135

Query  571  PMSAMNIADLS--TASP--AYDTLSSLFDPTS  488
                + I+DL   +ASP   YD LSS FDPT+
Sbjct  136  VPPPLTISDLPVFSASPPTTYD-LSSFFDPTA  166



>ref|XP_011090856.1| PREDICTED: LOB domain-containing protein 19 [Sesamum indicum]
Length=201

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 112/143 (78%), Gaps = 3/143 (2%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDSDQG + FA+VH+VFGASN SKLL  IPPH+RLDAVIT+C
Sbjct  12   ACKFLRRKCVRGCIFAPYFDSDQGTAHFAAVHRVFGASNASKLLLRIPPHRRLDAVITLC  71

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptppppp--PMSAMNI  551
            +EA AR+RDPVYGCVAHIF +QQQVVNLQAEL+Y+QA +++LQ    PPP    +S+ NI
Sbjct  72   YEALARVRDPVYGCVAHIFTLQQQVVNLQAELAYIQARISTLQRSPLPPPQHPCLSSPNI  131

Query  550  ADLSTASPAYDTL-SSLFDPTSS  485
               S  +     L + +FDP+ S
Sbjct  132  RTSSELAGNSSCLQTGIFDPSQS  154



>ref|XP_003534608.1| PREDICTED: LOB domain-containing protein 18-like [Glycine max]
Length=232

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 116/151 (77%), Gaps = 15/151 (10%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC+ GCIFAPYFDS+QG S FA+VHKVFGASNVSKLL  IP H+RLD VIT+C
Sbjct  18   ACKFLRRKCIPGCIFAPYFDSEQGTSHFAAVHKVFGASNVSKLLLSIPVHRRLDTVITIC  77

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ----VptpppppPMSA-  560
            +EAQ+R+RDPVYGCV+HIFA+QQQVV+LQAELSYL  HLA ++     P  P P  M+A 
Sbjct  78   YEAQSRIRDPVYGCVSHIFALQQQVVSLQAELSYLHGHLAQMELPQPPPPLPLPQTMAAP  137

Query  559  ---MNIADLST------ASPAYDTLSSLFDP  494
                +IADL +      A+  YD LSSLFDP
Sbjct  138  PPGFSIADLPSATVAAAAATTYD-LSSLFDP  167



>ref|XP_010053892.1| PREDICTED: LOB domain-containing protein 30-like [Eucalyptus 
grandis]
Length=248

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 117/149 (79%), Gaps = 13/149 (9%)
 Frame = -1

Query  898  KFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVCFE  719
            KFLRRKC+ GC+FAPYFDS+QGA+ FA+VH+VFGASN SKLL +IP H+R DAV+ +C+E
Sbjct  31   KFLRRKCITGCVFAPYFDSEQGAAHFAAVHRVFGASNASKLLLNIPAHRRQDAVVAICYE  90

Query  718  AQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMS--------  563
            AQARLRDPVYGCVAHIFA+QQQVVNLQAELSYLQAHL  L++PT P PP +         
Sbjct  91   AQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLGPLELPTQPLPPLLPMQLPVAPH  150

Query  562  AMNIADLSTAS-----PAYDTLSSLFDPT  491
            +++IADL   S     PA   +SSLFDPT
Sbjct  151  SLSIADLPIPSASPSMPAQYDVSSLFDPT  179



>gb|KHM98881.1| LOB domain-containing protein 18 [Glycine soja]
Length=237

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 107/138 (78%), Gaps = 9/138 (7%)
 Frame = -1

Query  880  CVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVCFEAQARLR  701
            CV GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL +IP +KRLDAV+T+C+EAQARLR
Sbjct  33   CVPGCIFAPYFDSEQGATHFAAVHKVFGASNVSKLLLNIPVYKRLDAVVTICYEAQARLR  92

Query  700  DPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV---------ptpppppPMSAMNIA  548
            DPVYGCVAHIFA+QQQVV+LQAELSYLQ HLA+L++                    ++IA
Sbjct  93   DPVYGCVAHIFALQQQVVSLQAELSYLQGHLATLELPQPPPPPPSSPQATTMAPPVISIA  152

Query  547  DLSTASPAYDTLSSLFDP  494
            +L +  PA   LSSLFDP
Sbjct  153  ELPSTVPATYDLSSLFDP  170



>ref|XP_008460130.1| PREDICTED: LOB domain-containing protein 19 [Cucumis melo]
Length=228

 Score =   179 bits (454),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDSDQGA+ FA+VHKVFGASN SKLLH IPP KRLDA +T+C
Sbjct  32   ACKFLRRKCVKGCIFAPYFDSDQGAAHFAAVHKVFGASNASKLLHRIPPPKRLDACVTLC  91

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR+RDPVYGCV+ IF++QQQVVNLQAEL+Y+QA L++LQ
Sbjct  92   YEALARVRDPVYGCVSQIFSLQQQVVNLQAELAYIQAKLSTLQ  134



>ref|XP_007220875.1| hypothetical protein PRUPE_ppa017589mg [Prunus persica]
 gb|EMJ22074.1| hypothetical protein PRUPE_ppa017589mg [Prunus persica]
Length=232

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC+ GCIFAPYFDS+QG + FA+VHKVFGASN SKLL  IPPHKRLDAV+T+C
Sbjct  27   ACKFLRRKCIKGCIFAPYFDSEQGTAHFAAVHKVFGASNASKLLLRIPPHKRLDAVVTLC  86

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR+RDPVYGCV+HIF +QQQVVNLQAEL+Y+QA LA+LQ
Sbjct  87   YEALARVRDPVYGCVSHIFTLQQQVVNLQAELAYVQARLATLQ  129



>ref|XP_010277396.1| PREDICTED: LOB domain-containing protein 19-like [Nelumbo nucifera]
Length=203

 Score =   178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QGAS FA+VHKVFGASNVSKLL  IP  KRLDAV+T+C
Sbjct  18   ACKFLRRKCVKGCIFAPYFDSEQGASHFAAVHKVFGASNVSKLLLRIPVDKRLDAVVTIC  77

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV  593
            +EA AR+RDPVYGCV HIFA+QQQVVNLQAEL+Y+QA L ++++
Sbjct  78   YEALARIRDPVYGCVGHIFALQQQVVNLQAELAYIQAQLTNMEI  121



>ref|XP_010092842.1| hypothetical protein L484_022437 [Morus notabilis]
 gb|EXB52660.1| hypothetical protein L484_022437 [Morus notabilis]
Length=240

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFD+DQG + FA+VHKVFGASN SKLL  IPPHKRLDAV+++ 
Sbjct  24   ACKFLRRKCVKGCIFAPYFDADQGTAHFAAVHKVFGASNASKLLLRIPPHKRLDAVVSLS  83

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR+RDPVYGCVAHIFA+QQQVVNLQAEL+Y+QA L++LQ
Sbjct  84   YEALARIRDPVYGCVAHIFALQQQVVNLQAELAYVQARLSTLQ  126



>ref|XP_004145059.1| PREDICTED: LOB domain-containing protein 31-like [Cucumis sativus]
 ref|XP_004153748.1| PREDICTED: LOB domain-containing protein 31-like [Cucumis sativus]
 ref|XP_004160688.1| PREDICTED: LOB domain-containing protein 31-like [Cucumis sativus]
 gb|KGN46237.1| hypothetical protein Csa_6G076850 [Cucumis sativus]
Length=213

 Score =   178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDSDQGA+ FA+VHKVFGASN SKLLH IPP KRLDA +T+C
Sbjct  17   ACKFLRRKCVKGCIFAPYFDSDQGAAHFAAVHKVFGASNASKLLHRIPPPKRLDACVTLC  76

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR+RDPVYGCV+ IF++QQQVVNLQAEL+Y+QA L++LQ
Sbjct  77   YEALARVRDPVYGCVSQIFSLQQQVVNLQAELAYIQAKLSTLQ  119



>ref|XP_008232675.1| PREDICTED: LOB domain-containing protein 19 [Prunus mume]
Length=228

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC+ GCIFAPYFDS+QG + FA+VHKVFGASN SKLL  +PPHKRLDAV+T+C
Sbjct  24   ACKFLRRKCIKGCIFAPYFDSEQGTAHFAAVHKVFGASNASKLLLRVPPHKRLDAVVTLC  83

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR+RDPVYGCV+HIF +QQQVVNLQAEL+Y+QA LA+LQ
Sbjct  84   YEALARVRDPVYGCVSHIFTLQQQVVNLQAELAYVQARLATLQ  126



>ref|XP_003521945.2| PREDICTED: LOB domain-containing protein 19-like [Glycine max]
 gb|KHM98882.1| LOB domain-containing protein 31 [Glycine soja]
Length=212

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDSDQG + FA+VHKVFGASN SKLL  IP HKRLDAV+T+C
Sbjct  21   ACKFLRRKCVKGCIFAPYFDSDQGTAHFAAVHKVFGASNASKLLMRIPAHKRLDAVVTLC  80

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA +R RDPVYGCV H+FA+QQQV+NLQAEL+Y+QAHLA++Q
Sbjct  81   YEALSRARDPVYGCVGHLFALQQQVMNLQAELTYVQAHLATMQ  123



>ref|XP_007134896.1| hypothetical protein PHAVU_010G084900g [Phaseolus vulgaris]
 gb|ESW06890.1| hypothetical protein PHAVU_010G084900g [Phaseolus vulgaris]
Length=212

 Score =   176 bits (447),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDSDQG + FA+VHKVFGASN SKLL  IP HKRLDAV+T+C
Sbjct  18   ACKFLRRKCVKGCIFAPYFDSDQGTAHFAAVHKVFGASNASKLLMRIPAHKRLDAVVTLC  77

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR RDPVYGCV H+FA+QQQV+NLQAEL+Y+QA LA++Q
Sbjct  78   YEALARARDPVYGCVGHLFALQQQVMNLQAELTYVQARLATMQ  120



>ref|XP_002273687.2| PREDICTED: LOB domain-containing protein 19 [Vitis vinifera]
 emb|CBI38860.3| unnamed protein product [Vitis vinifera]
Length=194

 Score =   176 bits (446),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GC+FAPYFDSDQG + FA+VHKVFGASN SKLL  IP HKRLDAV+T+C
Sbjct  14   ACKFLRRKCVKGCVFAPYFDSDQGTAHFAAVHKVFGASNASKLLTGIPAHKRLDAVVTLC  73

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA ARLRDPVYGCVAH+F +QQQV+NLQAEL+++QA L++LQ
Sbjct  74   YEALARLRDPVYGCVAHVFTLQQQVMNLQAELAFIQARLSTLQ  116



>ref|NP_001176038.1| Os10g0162600 [Oryza sativa Japonica Group]
 gb|AAL77143.1|AC097447_9 Unknown protein [Oryza sativa Japonica Group]
 gb|AAP52248.1| LOB domain protein 31, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAD88525.1| LOB domain protein [Oryza sativa Japonica Group]
 dbj|BAH94766.1| Os10g0162600 [Oryza sativa Japonica Group]
Length=269

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 114/158 (72%), Gaps = 21/158 (13%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+ GA+ FA+VHKVFGASNVSKLL  IP H+RLDAV+T+C
Sbjct  36   ACKFLRRKCVQGCIFAPYFDSEAGAAHFAAVHKVFGASNVSKLLQQIPAHRRLDAVVTIC  95

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAM----  557
            +EAQARLRDPVYGCVAHIF +Q QV  LQ+EL+YLQ HL+++++P+PPP      +    
Sbjct  96   YEAQARLRDPVYGCVAHIFHLQHQVAGLQSELNYLQGHLSTMELPSPPPYVAGPTLAPPQ  155

Query  556  -------------NIADLSTAS----PAYDTLSSLFDP  494
                         N +DL ++S    P    LS+LFDP
Sbjct  156  PQPLMPMTAAANFNFSDLPSSSAANIPVTADLSTLFDP  193



>gb|EAY77788.1| hypothetical protein OsI_32828 [Oryza sativa Indica Group]
Length=269

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 114/158 (72%), Gaps = 21/158 (13%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+ GA+ FA+VHKVFGASNVSKLL  IP H+RLDAV+T+C
Sbjct  36   ACKFLRRKCVQGCIFAPYFDSEAGAAHFAAVHKVFGASNVSKLLQQIPAHRRLDAVVTIC  95

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAM----  557
            +EAQARLRDPVYGCVAHIF +Q QV  LQ+EL+YLQ HL+++++P+PPP      +    
Sbjct  96   YEAQARLRDPVYGCVAHIFHLQHQVAGLQSELNYLQGHLSTMELPSPPPYVAGPTLAPPQ  155

Query  556  -------------NIADLSTAS----PAYDTLSSLFDP  494
                         N +DL ++S    P    LS+LFDP
Sbjct  156  PQPLMPMTAAANFNFSDLPSSSAANIPVTADLSTLFDP  193



>ref|XP_002320729.2| hypothetical protein POPTR_0014s06580g [Populus trichocarpa]
 gb|EEE99044.2| hypothetical protein POPTR_0014s06580g [Populus trichocarpa]
Length=179

 Score =   175 bits (443),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLR+KCV GCIFAPYFD DQG + FA+VHKVFGASN SKLL  IP HKRLDAV+T+C
Sbjct  15   ACKFLRKKCVKGCIFAPYFDPDQGTAHFAAVHKVFGASNASKLLLRIPAHKRLDAVVTLC  74

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR+RDPVYGCV HIF +QQQV+NLQAEL+++QAHL++LQ
Sbjct  75   YEALARVRDPVYGCVGHIFTLQQQVLNLQAELAFIQAHLSTLQ  117



>ref|XP_010276387.1| PREDICTED: LOB domain-containing protein 19-like [Nelumbo nucifera]
Length=208

 Score =   176 bits (445),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QGAS FA+VHKVFGASNVSKLL  IP HKRLDAV+T+C
Sbjct  21   ACKFLRRKCVKGCIFAPYFDSEQGASHFAAVHKVFGASNVSKLLLRIPVHKRLDAVVTIC  80

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR+RDPVYGCV HIFA+QQQVVNLQAEL++++A L +++
Sbjct  81   YEAFARIRDPVYGCVGHIFALQQQVVNLQAELAFIKAQLTTME  123



>ref|XP_009379264.1| PREDICTED: LOB domain-containing protein 19 [Pyrus x bretschneideri]
Length=227

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC+ GCIFAPYFD++QG + FA+VHKVFGASN SKLL  IPPHKRLDAV+T+C
Sbjct  21   ACKFLRRKCIKGCIFAPYFDAEQGTAHFAAVHKVFGASNASKLLLRIPPHKRLDAVVTLC  80

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR+RDPVYGC +HIF +QQQVVNLQAEL+Y+QA L +LQ
Sbjct  81   YEALARVRDPVYGCASHIFTLQQQVVNLQAELAYVQARLGTLQ  123



>gb|KHG05660.1| LOB domain-containing 19 -like protein [Gossypium arboreum]
Length=186

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDSDQG + FA+VHKV+GASN SK+L  IP HKRLDAV+T+C
Sbjct  12   ACKFLRRKCVKGCIFAPYFDSDQGMAHFAAVHKVYGASNASKMLQRIPVHKRLDAVVTLC  71

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR+RDPVYGCV H+F +QQQVVNLQAEL+Y QA L++LQ
Sbjct  72   YEALARVRDPVYGCVGHLFTLQQQVVNLQAELAYTQARLSTLQ  114



>ref|XP_011034467.1| PREDICTED: LOB domain-containing protein 19 [Populus euphratica]
Length=179

 Score =   173 bits (438),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLR+KCV GCIFAPYFD DQG + FA+VHKVFGASN SKLL  IP HKRLDAV+T+C
Sbjct  15   ACKFLRKKCVKGCIFAPYFDPDQGTAHFAAVHKVFGASNASKLLLRIPAHKRLDAVVTLC  74

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR+RDPVYGCV HIF +QQQV+NLQAEL+++QA+L++LQ
Sbjct  75   YEALARVRDPVYGCVGHIFTLQQQVLNLQAELAFIQANLSTLQ  117



>ref|XP_008345767.1| PREDICTED: LOB domain-containing protein 19 [Malus domestica]
Length=228

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC+ GCIFAPYFD++QG + FA+VHKVFGASN SKLL  IPPHKRLDAV+T+ 
Sbjct  21   ACKFLRRKCIKGCIFAPYFDAEQGTAHFAAVHKVFGASNASKLLLRIPPHKRLDAVVTLS  80

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR+RDPVYGCV+HIF +QQQVVNLQAEL+Y+QA L +LQ
Sbjct  81   YEALARVRDPVYGCVSHIFTLQQQVVNLQAELAYVQARLGTLQ  123



>ref|XP_006490937.1| PREDICTED: LOB domain-containing protein 31-like [Citrus sinensis]
Length=207

 Score =   174 bits (440),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 90/103 (87%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GC+FAPYFD+DQG + FA+VHKVFGASN SKLL  IPPHKRLDAV+++C
Sbjct  14   ACKFLRRKCVKGCVFAPYFDADQGTTHFAAVHKVFGASNASKLLSRIPPHKRLDAVVSLC  73

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR RDP+YGCV HI A+QQQVVNLQAEL++ QA L+ LQ
Sbjct  74   YEAMARTRDPIYGCVGHIVALQQQVVNLQAELAFTQARLSILQ  116



>ref|XP_007052037.1| LOB domain-containing protein 31 [Theobroma cacao]
 gb|EOX96194.1| LOB domain-containing protein 31 [Theobroma cacao]
Length=203

 Score =   173 bits (439),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC+ GCIFAPYFDSDQG + FA+VHKVFGASN SK+L  IP H+R+DAV+T+C
Sbjct  12   ACKFLRRKCIKGCIFAPYFDSDQGTAHFAAVHKVFGASNASKMLLRIPAHRRVDAVVTLC  71

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR+RDPVYGCV HIF +QQQVVNLQAEL+Y+Q  L++LQ
Sbjct  72   YEALARVRDPVYGCVGHIFTLQQQVVNLQAELAYIQGRLSTLQ  114



>ref|XP_004306913.1| PREDICTED: LOB domain-containing protein 31-like [Fragaria vesca 
subsp. vesca]
Length=218

 Score =   174 bits (440),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC+ GCIFAPYFDSDQG + FA+VHKVFGASN SKLL  IP HKRLDAV+T+C
Sbjct  22   ACKFLRRKCLRGCIFAPYFDSDQGTAHFAAVHKVFGASNASKLLLRIPAHKRLDAVVTLC  81

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLAS  602
            +EA AR+RDPVYGCVAHIF +QQQVVNLQAEL+Y+QA LA+
Sbjct  82   YEALARVRDPVYGCVAHIFTLQQQVVNLQAELAYVQARLAT  122



>ref|XP_009803301.1| PREDICTED: LOB domain-containing protein 19-like [Nicotiana sylvestris]
Length=227

 Score =   174 bits (441),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDSDQG + FA+VHKVFGASN SKLL  IP HKRLDAV+T+C
Sbjct  40   ACKFLRRKCVRGCIFAPYFDSDQGTAHFAAVHKVFGASNASKLLLRIPAHKRLDAVVTLC  99

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR+RDP+YGCVAHIF +QQQVV+LQAEL+Y+QA L++LQ
Sbjct  100  YEALARVRDPIYGCVAHIFTLQQQVVSLQAELAYVQARLSTLQ  142



>ref|XP_010523689.1| PREDICTED: LOB domain-containing protein 18-like [Tarenaya hassleriana]
Length=228

 Score =   174 bits (441),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 110/145 (76%), Gaps = 6/145 (4%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAP+FD ++GA+ F++VHKVFGASNVSKLL  IP HKR DAV T+C
Sbjct  19   ACKFLRRKCVPGCIFAPHFDHEEGATYFSAVHKVFGASNVSKLLGQIPLHKRSDAVTTIC  78

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ----VptpppppPMSAM  557
            +EA ARL DPVYGC   IFA+QQQVVNLQ ELS+LQAHLA+L+     P PPP      +
Sbjct  79   YEAHARLSDPVYGCFTQIFALQQQVVNLQTELSHLQAHLATLEPPPPPPRPPPAVVPPPL  138

Query  556  NIADL--STASPAYDTLSSLFDPTS  488
             I+DL  ++ SP    LSS FDPT+
Sbjct  139  LISDLPENSGSPQPYDLSSSFDPTA  163



>ref|XP_010056298.1| PREDICTED: LOB domain-containing protein 19 [Eucalyptus grandis]
 gb|KCW72964.1| hypothetical protein EUGRSUZ_E01415 [Eucalyptus grandis]
Length=237

 Score =   174 bits (442),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GC+FAPYFD+DQG + FA+VH+VFGASN SKLL  +P H+RLDAV+T+C
Sbjct  34   ACKFLRRKCVRGCVFAPYFDADQGPAHFAAVHRVFGASNASKLLARVPAHRRLDAVVTLC  93

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR RDPVYGCV HIFA+QQQVVNLQAEL+Y+QA LASLQ
Sbjct  94   YEALARARDPVYGCVGHIFALQQQVVNLQAELAYVQARLASLQ  136



>ref|XP_006445238.1| hypothetical protein CICLE_v10022291mg [Citrus clementina]
 gb|ESR58478.1| hypothetical protein CICLE_v10022291mg [Citrus clementina]
Length=205

 Score =   173 bits (439),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 90/103 (87%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GC+FAPYFD+DQG + FA+VHKVFGASN SKLL  IPPHKRLDAV+++C
Sbjct  12   ACKFLRRKCVKGCVFAPYFDADQGTTHFAAVHKVFGASNASKLLSRIPPHKRLDAVVSLC  71

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR RDP+YGCV HI A+QQQVVNLQAEL++ QA L+ LQ
Sbjct  72   YEAMARTRDPIYGCVGHIVALQQQVVNLQAELAFTQARLSILQ  114



>gb|ACJ85221.1| unknown [Medicago truncatula]
 gb|AFK48871.1| unknown [Medicago truncatula]
 gb|KEH19042.1| lateral organ boundaries (LOB) domain protein [Medicago truncatula]
Length=216

 Score =   173 bits (439),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDSDQG   FA+VHKVFGASN SKLL  IP HKRLDAV+T+C
Sbjct  21   ACKFLRRKCVKGCIFAPYFDSDQGTVHFAAVHKVFGASNASKLLMRIPAHKRLDAVVTLC  80

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR RDPVYGCVAHIFA+QQQV++LQAEL+Y+QA LA++Q
Sbjct  81   YEALARARDPVYGCVAHIFALQQQVMSLQAELTYVQATLATMQ  123



>ref|XP_009347042.1| PREDICTED: LOB domain-containing protein 19-like [Pyrus x bretschneideri]
Length=227

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC+ GCIFAPYFD++QG + FA+VHKVFGASN SKLL  IPPHKRLDAV+T+C
Sbjct  21   ACKFLRRKCIKGCIFAPYFDAEQGTAHFAAVHKVFGASNASKLLLRIPPHKRLDAVVTLC  80

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR+RDPVYGC +HIF +QQQVVNLQAEL+Y+ A L +LQ
Sbjct  81   YEALARVRDPVYGCASHIFTLQQQVVNLQAELAYVHARLGTLQ  123



>gb|EMS62575.1| hypothetical protein TRIUR3_25587 [Triticum urartu]
Length=229

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 113/146 (77%), Gaps = 8/146 (5%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC   CIFAPYFDS+QG   F +VHKVFGASNVSK+L+  PPHKRLDA ITVC
Sbjct  26   ACKFLRRKCADDCIFAPYFDSEQGVEHFTAVHKVFGASNVSKILNQAPPHKRLDAAITVC  85

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptppppp------PMS  563
            +EA+ARLRDP+YGCV  IFA+QQ+V NLQAE+++LQAHL + Q P+PPP P        +
Sbjct  86   YEAKARLRDPIYGCVGDIFALQQRVANLQAEVAFLQAHLTTPQQPSPPPFPSPPYIPMTT  145

Query  562  AMNIADLSTASPAYDT--LSSLFDPT  491
              +I++L++ S   +T  LSSLFDP+
Sbjct  146  EFSISELASLSNVPNTVELSSLFDPS  171



>ref|XP_002511729.1| LOB domain-containing protein, putative [Ricinus communis]
 gb|EEF50398.1| LOB domain-containing protein, putative [Ricinus communis]
Length=203

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 106/139 (76%), Gaps = 3/139 (2%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC+ GCIFAPYFDSDQG + FA+VHKVFGASN SKLL  IP HKR DAV+T+C
Sbjct  10   ACKFLRRKCLKGCIFAPYFDSDQGTAHFAAVHKVFGASNASKLLLRIPAHKRFDAVVTLC  69

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAMNIAD  545
            +EA AR+RDPVYGCV H+F +QQQVV+LQAEL+Y+QA L++LQ    P  P  S    + 
Sbjct  70   YEALARVRDPVYGCVGHLFTLQQQVVSLQAELAYIQARLSTLQRHQHPSQPAQSHSQTSV  129

Query  544  LSTAS---PAYDTLSSLFD  497
            LS+++   P+   +S  FD
Sbjct  130  LSSSTSEMPSNSNMSMHFD  148



>gb|KHN40140.1| LOB domain-containing protein 31 [Glycine soja]
Length=214

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDSDQG + FA+VHKVFGASN SKLL  IP HKRLDAV+T+C
Sbjct  19   ACKFLRRKCVKGCIFAPYFDSDQGTAHFAAVHKVFGASNASKLLMRIPAHKRLDAVVTLC  78

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLAS  602
            +EA AR RDPVYGCV H+FA+QQQV+NLQAEL+Y+QA LA+
Sbjct  79   YEALARARDPVYGCVGHLFALQQQVMNLQAELTYVQARLAT  119



>ref|XP_002302539.1| hypothetical protein POPTR_0002s14970g [Populus trichocarpa]
 gb|EEE81812.1| hypothetical protein POPTR_0002s14970g [Populus trichocarpa]
Length=211

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFD DQG + FA+VHKVFGASN SKLL  IP HKRLDAV+T+C
Sbjct  14   ACKFLRRKCVKGCIFAPYFDPDQGTAHFAAVHKVFGASNASKLLLRIPTHKRLDAVVTLC  73

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA  R+RDPV+GCV HIF +QQQV+NLQAEL+Y+QAHL++LQ
Sbjct  74   YEALTRVRDPVHGCVGHIFTLQQQVMNLQAELAYIQAHLSTLQ  116



>ref|XP_004492639.1| PREDICTED: LOB domain-containing protein 18-like [Cicer arietinum]
Length=222

 Score =   172 bits (436),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 112/148 (76%), Gaps = 12/148 (8%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFD++ G + FA+VHKVFGASNVSKLL  IP +KRLDA I++C
Sbjct  20   ACKFLRRKCVQGCIFAPYFDAEHGTTHFAAVHKVFGASNVSKLLLGIPINKRLDAAISLC  79

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ------VptpppppPMS  563
            +EAQ RLRDPVYGCV HIF +QQQV++LQAE++YLQ+HL S +      +P P      +
Sbjct  80   YEAQTRLRDPVYGCVGHIFTLQQQVMSLQAEINYLQSHLTSTELTQPLLLPPPQAATAPA  139

Query  562  AMNIADLSTASPA-----YDTLSSLFDP  494
              ++ADL +A+ A     YD +S+LFDP
Sbjct  140  VFSLADLPSATAATMPVTYD-MSTLFDP  166



>ref|XP_009628901.1| PREDICTED: LOB domain-containing protein 19-like [Nicotiana tomentosiformis]
Length=213

 Score =   172 bits (435),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDSDQG + FA+VHKVFGASN SKLL  IP HKRLDAV+T+C
Sbjct  31   ACKFLRRKCVRGCIFAPYFDSDQGTAHFAAVHKVFGASNASKLLLRIPAHKRLDAVVTLC  90

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASL  599
            +EA AR+RDP+YGCVAHIF +QQQVV LQAEL+Y+QA L++L
Sbjct  91   YEALARVRDPIYGCVAHIFTLQQQVVTLQAELAYVQARLSTL  132



>gb|EYU32001.1| hypothetical protein MIMGU_mgv1a024257mg [Erythranthe guttata]
Length=209

 Score =   171 bits (433),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GC+FAPYFDS+QG + FA+VH+VFGASN SKLL  IPPH+RLDAVIT+C
Sbjct  23   ACKFLRRKCVRGCVFAPYFDSEQGTAHFAAVHRVFGASNASKLLLRIPPHRRLDAVITLC  82

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR+RDPVYGCV HIF +QQQ+VNLQAEL+Y QA +++ +
Sbjct  83   YEALARVRDPVYGCVGHIFTLQQQIVNLQAELAYTQARISTFR  125



>ref|XP_009789949.1| PREDICTED: LOB domain-containing protein 19 [Nicotiana sylvestris]
Length=161

 Score =   169 bits (429),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 102/130 (78%), Gaps = 3/130 (2%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACK+LRRKCV GCIFAPYFD++QG S FA+VHKVFGASN SKLL  IP +KRL+ VIT+C
Sbjct  8    ACKYLRRKCVKGCIFAPYFDTEQGMSHFAAVHKVFGASNASKLLLSIPANKRLETVITLC  67

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAMNIAD  545
            +EA AR+RDPVYGCVAHIF +QQQV+ LQAEL+Y+QA L++LQ  +       S  NI+ 
Sbjct  68   YEALARVRDPVYGCVAHIFTLQQQVLTLQAELAYVQARLSTLQSASSEVAATYS--NISS  125

Query  544  LSTASPAYDT  515
            +S   P +DT
Sbjct  126  VSM-DPLFDT  134



>ref|XP_003571705.1| PREDICTED: LOB domain-containing protein 30-like [Brachypodium 
distachyon]
Length=255

 Score =   172 bits (436),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 112/156 (72%), Gaps = 15/156 (10%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAPYF+++ GA+ FA+VHKVFGASNVSKLL  IP  KR DAV T+C
Sbjct  36   ACKFLRRKCVSGCIFAPYFNTENGAAHFAAVHKVFGASNVSKLLLQIPAPKRADAVFTIC  95

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASL---------QVptppppp  572
            +EAQAR+RDPVYGCV+H+F +QQQV NLQAEL+ LQAHLA+L               P  
Sbjct  96   YEAQARIRDPVYGCVSHVFNLQQQVANLQAELTCLQAHLATLGQVPAPPPFPQQPQMPMA  155

Query  571  PMSAMNIAD----LSTASPAYDTLSSLFDPTSSMVQ  476
              +  +I+D    L +  P+   LSSLFDP  SM+Q
Sbjct  156  TAAPFSISDLPLTLPSNIPSSVDLSSLFDP--SMMQ  189



>ref|XP_011017497.1| PREDICTED: LOB domain-containing protein 19-like isoform X1 [Populus 
euphratica]
Length=212

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFD DQG + FA+VHKVFGASN SKLL  IP HKRLDAV+T+C
Sbjct  15   ACKFLRRKCVKGCIFAPYFDPDQGTAHFAAVHKVFGASNASKLLLRIPAHKRLDAVVTLC  74

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA  R+RDPV+GCV HIF +QQQV+NLQAEL+Y+QA+L++LQ
Sbjct  75   YEALTRVRDPVHGCVGHIFTLQQQVMNLQAELAYIQAYLSTLQ  117



>ref|XP_004134346.1| PREDICTED: LOB domain-containing protein 18-like [Cucumis sativus]
 gb|KGN56593.1| hypothetical protein Csa_3G126090 [Cucumis sativus]
Length=231

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 108/155 (70%), Gaps = 12/155 (8%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC+  CIFAPYFDS+QG++ FA+VHKVFGASNVSK+L HIP HKRLDA IT+C
Sbjct  27   ACKFLRRKCMPECIFAPYFDSEQGSTHFAAVHKVFGASNVSKMLLHIPEHKRLDAAITIC  86

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLAS---------LQVptppppp  572
            +EAQAR+R+PV GCV+HIFA+QQQ   LQ E+SYLQA+LA+         LQ   P    
Sbjct  87   YEAQARVREPVLGCVSHIFALQQQAARLQIEISYLQAYLATSELPRSAPHLQAQPPALVK  146

Query  571  PMSAMNIADLSTASPAYDT---LSSLFDPTSSMVQ  476
              +  +I  L +  P++     LS L DP   + Q
Sbjct  147  KPTLSSIISLPSDCPSFPAESDLSLLLDPVEQVSQ  181



>gb|ADE76152.1| unknown [Picea sitchensis]
Length=219

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GC+FAPYFDSD+GA  FA+VHK+FGASNVSKLL HIP  +R +AV+T+ 
Sbjct  10   ACKFLRRKCVKGCVFAPYFDSDEGAENFAAVHKIFGASNVSKLLQHIPIPERSEAVVTIS  69

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLAS  602
            +EAQARLRDPVYGCVAHIFA+QQQV +LQAEL+++QA LAS
Sbjct  70   YEAQARLRDPVYGCVAHIFALQQQVASLQAELTFVQAQLAS  110



>ref|XP_004510943.1| PREDICTED: LOB domain-containing protein 31-like [Cicer arietinum]
Length=216

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 90/103 (87%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDSDQG   FA+VHKVFGASN SKLL  IP HKRLDAV+T+C
Sbjct  19   ACKFLRRKCVKGCIFAPYFDSDQGTVHFAAVHKVFGASNASKLLMRIPSHKRLDAVVTLC  78

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR RDP+YGCV HIFA+QQQV++LQAEL+Y+Q  LA++Q
Sbjct  79   YEALARSRDPLYGCVGHIFALQQQVMSLQAELTYVQHSLATMQ  121



>ref|XP_006339769.1| PREDICTED: LOB domain-containing protein 18-like [Solanum tuberosum]
Length=168

 Score =   167 bits (423),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QG + FA+VHKVFGASN SKLL  IPP+KRL+ V+T+C
Sbjct  12   ACKFLRRKCVKGCIFAPYFDSEQGMAHFAAVHKVFGASNASKLLLTIPPNKRLETVVTLC  71

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR+RDPVYGCV HIF++QQQ V LQAEL+Y+QA +++LQ
Sbjct  72   YEALARVRDPVYGCVGHIFSLQQQAVTLQAELAYVQARISTLQ  114



>ref|XP_008438149.1| PREDICTED: LOB domain-containing protein 18 [Cucumis melo]
Length=231

 Score =   169 bits (428),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 104/155 (67%), Gaps = 12/155 (8%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC   CIFAPYFDS+QG + FA+VHKVFGASNVSK+L HIP HKRLDA IT+C
Sbjct  27   ACKFLRRKCTPECIFAPYFDSEQGTTHFAAVHKVFGASNVSKMLLHIPEHKRLDAAITIC  86

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLAS---------LQVptppppp  572
            +EAQAR+R+PV GCVAHIFA+QQQ   LQ E+SYLQ +LA+         LQ   P    
Sbjct  87   YEAQARVREPVLGCVAHIFALQQQAARLQIEISYLQGYLATSELPRPAPHLQAQPPALVK  146

Query  571  PMSAMNIADLSTASPAYDT---LSSLFDPTSSMVQ  476
              +  +I  L +  P++     LS L DP     Q
Sbjct  147  KPTLSSIVSLPSDCPSFPAESDLSLLLDPVEQASQ  181



>ref|XP_004155866.1| PREDICTED: LOB domain-containing protein 18-like [Cucumis sativus]
Length=312

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 108/155 (70%), Gaps = 12/155 (8%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC+  CIFAPYFDS+QG++ FA+VHKVFGASNVSK+L HIP HKRLDA IT+C
Sbjct  108  ACKFLRRKCMPECIFAPYFDSEQGSTHFAAVHKVFGASNVSKMLLHIPEHKRLDAAITIC  167

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLAS---------LQVptppppp  572
            +EAQAR+R+PV GCV+HIFA+QQQ   LQ E+SYLQA+LA+         LQ   P    
Sbjct  168  YEAQARVREPVLGCVSHIFALQQQAARLQIEISYLQAYLATSELPRSAPHLQAQPPALVK  227

Query  571  PMSAMNIADLSTASPAY---DTLSSLFDPTSSMVQ  476
              +  +I  L +  P++     LS L DP   + Q
Sbjct  228  KPTLSSIISLPSDCPSFPAESDLSLLLDPVEQVSQ  262



>emb|CDP17780.1| unnamed protein product [Coffea canephora]
Length=201

 Score =   165 bits (417),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC+ GCIFAPYFD +QG + FA+VHKVFGASN SK+L  +P HKRLDAV+T+C
Sbjct  14   ACKFLRRKCLKGCIFAPYFDPEQGTAHFAAVHKVFGASNASKMLLRVPAHKRLDAVVTLC  73

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR+RDPVYGCV H+F +QQQVVNLQAEL+  QA L++LQ
Sbjct  74   YEALARIRDPVYGCVGHLFTLQQQVVNLQAELACAQARLSTLQ  116



>ref|XP_009604914.1| PREDICTED: LOB domain-containing protein 19-like [Nicotiana tomentosiformis]
Length=161

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 100/130 (77%), Gaps = 3/130 (2%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACK+LRRKCV GCIFAPYFD++QG + FA+VHKVFGASN SKLL  IP +KRL+ VIT+C
Sbjct  8    ACKYLRRKCVKGCIFAPYFDTEQGFAHFAAVHKVFGASNASKLLLSIPANKRLETVITLC  67

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAMNIAD  545
            +EA AR+RDPVYG VAHIF +QQQVV LQAEL+Y+QA L++LQ  +       S  NI  
Sbjct  68   YEALARVRDPVYGSVAHIFTLQQQVVTLQAELAYVQARLSTLQSASTEVAASYS--NILS  125

Query  544  LSTASPAYDT  515
            +S   P +DT
Sbjct  126  VSM-DPLFDT  134



>ref|XP_010523197.1| PREDICTED: LOB domain-containing protein 31 [Tarenaya hassleriana]
Length=171

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACK+LRRKCV GC+FAPYFDS+ G S+FA+VHKVFGASN +KLL  IPP  RLDA++T+ 
Sbjct  48   ACKYLRRKCVEGCVFAPYFDSEDGTSLFAAVHKVFGASNATKLLSPIPPSLRLDAILTLS  107

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR+RDPV+GCV+HIF++ QQVVNLQAEL+Y+QA L+++Q
Sbjct  108  YEATARVRDPVFGCVSHIFSLHQQVVNLQAELAYVQARLSAVQ  150



>ref|XP_009398866.1| PREDICTED: LOB domain-containing protein 30-like [Musa acuminata 
subsp. malaccensis]
Length=294

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACK ++RKCV GCIFAPYFD+++GA+ FA+VHK+FGASNVSKLL  IP  KR+DA+ T+C
Sbjct  20   ACKTMKRKCVKGCIFAPYFDAERGAARFAAVHKLFGASNVSKLLLQIPIDKRVDAIATLC  79

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EAQARLRDPVYGCVAHIFA+QQQVVNL+AELS LQ  L +LQ
Sbjct  80   YEAQARLRDPVYGCVAHIFALQQQVVNLRAELSILQTQLEALQ  122



>gb|EMT10533.1| hypothetical protein F775_04528 [Aegilops tauschii]
Length=229

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 112/146 (77%), Gaps = 8/146 (5%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC   CIFAPYF S+QG   F +VHKVFGASNVSK+L+  P HKR DA ITVC
Sbjct  26   ACKFLRRKCADDCIFAPYFGSEQGVEHFTAVHKVFGASNVSKILNQAPSHKRFDAAITVC  85

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAM----  557
            +EA+ARLRDP+YGCV  IFA+QQ+V NLQAE++ LQAHL +LQ P+PPP P +S M    
Sbjct  86   YEAKARLRDPIYGCVGDIFALQQRVANLQAEVASLQAHLTTLQQPSPPPFPSLSYMPMTT  145

Query  556  --NIADLSTASPAYDT--LSSLFDPT  491
              +I++L++ S   +T  LSSLFDP+
Sbjct  146  EFSISELASLSNVPNTVELSSLFDPS  171



>ref|XP_003623721.1| LOB domain-containing protein [Medicago truncatula]
 gb|AES79939.1| LOB domain protein [Medicago truncatula]
Length=237

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 111/157 (71%), Gaps = 14/157 (9%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GC+FAPYFDS+ G + FA+VHKVFGASNVSKLL  IP  +RLDA +++C
Sbjct  23   ACKFLRRKCVQGCVFAPYFDSEHGTTHFAAVHKVFGASNVSKLLLGIPTGRRLDAAVSLC  82

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLAS------LQVptpppppPMS  563
            +EAQ+RLRDP+YGCV HI A+QQQV++LQAELSYLQ+H+ S        +P P      +
Sbjct  83   YEAQSRLRDPIYGCVGHIVALQQQVMSLQAELSYLQSHINSSGLTQQPPLPPPQATAAPT  142

Query  562  AMNIADL----STASPAYDTLSSLFD----PTSSMVQ  476
              + ADL    +T  P    +S+LFD    P+ SM Q
Sbjct  143  VFSFADLPPTTATTMPVTYDMSTLFDSMGQPSFSMQQ  179



>gb|EYU32002.1| hypothetical protein MIMGU_mgv1a022726mg, partial [Erythranthe 
guttata]
Length=120

 Score =   160 bits (405),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCVAGCIFAPYFDS+QGA+ FA+VHKVFGAS+VSKLL HIPPHKRLDAV+T+C
Sbjct  37   ACKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASHVSKLLLHIPPHKRLDAVVTIC  96

Query  724  FEAQARLRDPVYGCVAHIFAIQQQ  653
            +EAQARLRDP+YGCVAHIFA+QQQ
Sbjct  97   YEAQARLRDPIYGCVAHIFALQQQ  120



>ref|XP_010424034.1| PREDICTED: LOB domain-containing protein 30-like [Camelina sativa]
Length=191

 Score =   162 bits (411),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 96/140 (69%), Gaps = 30/140 (21%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCVAGCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKR DAV+++C
Sbjct  19   ACKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPEHKRPDAVVSIC  78

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAMNIAD  545
            FEAQARLRDP+YGCV+HI ++QQQ                              A++I D
Sbjct  79   FEAQARLRDPIYGCVSHIVSLQQQ------------------------------ALSITD  108

Query  544  LSTASPAYDTLSSLFDPTSS  485
            L T SP+   LSS F+P  S
Sbjct  109  LPTISPSLYDLSSFFEPVMS  128



>ref|XP_010512839.1| PREDICTED: LOB domain-containing protein 19 [Camelina sativa]
Length=190

 Score =   162 bits (410),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GC+FAPYFD++QG + FA+VHKVFGASN SK+L  +P HKR DAV+T+C
Sbjct  20   ACKFLRRKCVKGCVFAPYFDAEQGTARFAAVHKVFGASNASKMLQRLPLHKRFDAVVTLC  79

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA ARLRDPVYG V H+F++Q QV+NLQAEL+++QA L++ Q
Sbjct  80   YEAMARLRDPVYGSVGHLFSLQHQVMNLQAELAHVQARLSTFQ  122



>ref|XP_006289084.1| hypothetical protein CARUB_v10002489mg [Capsella rubella]
 gb|EOA21982.1| hypothetical protein CARUB_v10002489mg [Capsella rubella]
Length=220

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+ CIFAPYFDS++G S FA+VHKVFGASN SKLL  IP  +RLDAV+T+ 
Sbjct  14   ACKFLRRKCVSECIFAPYFDSEEGTSHFAAVHKVFGASNASKLLMMIPASRRLDAVVTLS  73

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA ARLRDPVYGCV HIFA+Q QV+NLQ EL+Y+Q  L S+Q
Sbjct  74   YEALARLRDPVYGCVGHIFALQHQVMNLQVELAYVQTQLTSIQ  116



>ref|NP_182065.1| LOB domain-containing protein 19 [Arabidopsis thaliana]
 sp|O22132.1|LBD19_ARATH RecName: Full=LOB domain-containing protein 19; AltName: Full=ASYMMETRIC 
LEAVES 2-like protein 23; Short=AS2-like protein 
23 [Arabidopsis thaliana]
 gb|AAB82623.1| unknown protein [Arabidopsis thaliana]
 dbj|BAH10567.1| ASYMMETRIC LEAVES2-like 23 protein [Arabidopsis thaliana]
 gb|AEC10549.1| LOB domain-containing protein 19 [Arabidopsis thaliana]
Length=191

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GC+FAPYFD++QG + FA+VHKVFGASN SK+L  +P HKRLDAV+T+C
Sbjct  19   ACKFLRRKCVKGCVFAPYFDAEQGTARFAAVHKVFGASNASKMLLRLPLHKRLDAVVTLC  78

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR+RDPVYG V H+F++Q QV+NLQAEL+++QA L+++Q
Sbjct  79   YEAMARIRDPVYGSVGHLFSLQHQVMNLQAELAHVQARLSTIQ  121



>ref|XP_002882012.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58271.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=192

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GC+FAPYFD+DQG + FA+VHKVFGASN SK+L  +P HKRLDAV+T+C
Sbjct  20   ACKFLRRKCVKGCVFAPYFDADQGTARFAAVHKVFGASNASKMLLRLPLHKRLDAVVTLC  79

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
             EA ARLRDPVYG V H+F++Q QV+NLQAEL+++QA L++ Q
Sbjct  80   HEAMARLRDPVYGSVGHLFSLQHQVMNLQAELAHVQALLSTFQ  122



>ref|XP_006296305.1| hypothetical protein CARUB_v10025477mg [Capsella rubella]
 gb|EOA29203.1| hypothetical protein CARUB_v10025477mg [Capsella rubella]
Length=193

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GC+FAPYFD++QG + FA+VHKVFGASN SK+L  +P HKR DAV+T+C
Sbjct  20   ACKFLRRKCVKGCVFAPYFDAEQGTARFAAVHKVFGASNASKMLLRLPLHKRFDAVVTLC  79

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA ARLRDPVYG V H+F++Q QV+NLQAEL+++QA L++ Q
Sbjct  80   YEAMARLRDPVYGSVGHLFSLQHQVMNLQAELAHVQARLSTFQ  122



>ref|XP_009102075.1| PREDICTED: LOB domain-containing protein 20-like [Brassica rapa]
Length=275

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAP+F SDQGA+ FA+VHKVFGASNVSKLLHHIP ++R DAV+T+ 
Sbjct  56   ACKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLHHIPVNRRHDAVVTIS  115

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV  593
            +EAQARL DPVYGCV+ I A+QQQV +LQAELS +Q+ L + +V
Sbjct  116  YEAQARLSDPVYGCVSTILALQQQVASLQAELSLVQSQLINSRV  159



>ref|XP_010692268.1| PREDICTED: LOB domain-containing protein 19 [Beta vulgaris subsp. 
vulgaris]
Length=245

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACK+LRRKCV GC+FAPYFDS+QG + FA+VHKVFGASN SKLL  IP H+RLD V+T+C
Sbjct  33   ACKYLRRKCVKGCVFAPYFDSEQGTAHFAAVHKVFGASNASKLLLRIPAHRRLDTVVTLC  92

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA +R+RDP+YGCVAHIF +QQQV+++QAEL+++ A L++LQ
Sbjct  93   YEALSRVRDPIYGCVAHIFTLQQQVMSMQAELAFVHARLSTLQ  135



>ref|XP_006299263.1| hypothetical protein CARUB_v10015417mg [Capsella rubella]
 gb|EOA32161.1| hypothetical protein CARUB_v10015417mg [Capsella rubella]
Length=278

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAP+F SDQGA+ FA+VHKVFGASNVSKLLHHIP ++R DAV+T+ 
Sbjct  57   ACKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLHHIPVNRRHDAVVTIS  116

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV  593
            +EAQARL DPVYGCV+ I A+QQQV +LQAELS +Q+ L + +V
Sbjct  117  YEAQARLSDPVYGCVSTILALQQQVASLQAELSVVQSQLINSRV  160



>ref|NP_191932.4| LOB domain-containing protein 31 [Arabidopsis thaliana]
 sp|O81322.2|LBD31_ARATH RecName: Full=LOB domain-containing protein 31; AltName: Full=ASYMMETRIC 
LEAVES 2-like protein 22; Short=AS2-like protein 
22 [Arabidopsis thaliana]
 dbj|BAH10566.1| ASYMMETRIC LEAVES2-like 22 protein [Arabidopsis thaliana]
 gb|AEE81838.1| LOB domain-containing protein 31 [Arabidopsis thaliana]
Length=220

 Score =   162 bits (409),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCVA C+FAPYFDS +G S F +VHKVFGASN SKLL  IP  +RLDAV+T+ 
Sbjct  14   ACKFLRRKCVADCVFAPYFDSVEGTSHFTAVHKVFGASNASKLLMMIPASRRLDAVVTLT  73

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA ARLRDPVYGCV HIFA+Q QV+NLQAEL+Y+Q  L++LQ
Sbjct  74   YEALARLRDPVYGCVGHIFALQHQVMNLQAELAYVQTQLSTLQ  116



>gb|KFK37803.1| hypothetical protein AALP_AA3G031300 [Arabis alpina]
Length=279

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAP+F SDQGA+ FA+VHKVFGASNVSKLLHHIP ++R DAV+T+ 
Sbjct  59   ACKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLHHIPVNRRHDAVVTIS  118

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV  593
            +EAQARL DPVYGCV+ I A+QQQV +LQAELS +Q+ L + +V
Sbjct  119  YEAQARLSDPVYGCVSTILALQQQVASLQAELSLVQSQLINSRV  162



>ref|XP_010506483.1| PREDICTED: LOB domain-containing protein 19 [Camelina sativa]
Length=189

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GC+FAPYFD++QG + FA+VHKVFGASN SK+L  +P HKR DAV+T+C
Sbjct  19   ACKFLRRKCVKGCVFAPYFDAEQGTARFAAVHKVFGASNASKMLLRLPLHKRFDAVVTLC  78

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA ARLRDPVYG V H+F++Q QV+NLQAEL+++QA L++ Q
Sbjct  79   YEAMARLRDPVYGSVGHLFSLQHQVMNLQAELAHVQARLSTFQ  121



>ref|NP_187026.1| LOB domain-containing protein 20 [Arabidopsis thaliana]
 sp|Q9SRV3.1|LBD20_ARATH RecName: Full=LOB domain-containing protein 20; AltName: Full=ASYMMETRIC 
LEAVES 2-like protein 21; Short=AS2-like protein 
21 [Arabidopsis thaliana]
 gb|AAF00641.1|AC009540_18 unknown protein [Arabidopsis thaliana]
 dbj|BAC42909.1| unknown protein [Arabidopsis thaliana]
 gb|AAP40416.1| unknown protein [Arabidopsis thaliana]
 dbj|BAH10565.1| ASYMMETRIC LEAVES2-like 21 protein [Arabidopsis thaliana]
 gb|AEE73983.1| LOB domain-containing protein 20 [Arabidopsis thaliana]
Length=273

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAP+F SDQGA+ FA+VHKVFGASNVSKLLHHIP ++R DAV+T+ 
Sbjct  54   ACKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLHHIPVNRRHDAVVTIS  113

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV  593
            +EAQARL DPVYGCV+ I A+QQQV +LQAELS +Q+ L + +V
Sbjct  114  YEAQARLSDPVYGCVSTILALQQQVASLQAELSVVQSQLINSRV  157



>emb|CDY29956.1| BnaC01g40520D [Brassica napus]
Length=275

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAP+F SDQGA+ FA+VHKVFGASNVSKLLHHIP ++R DAV+T+ 
Sbjct  56   ACKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLHHIPVNRRHDAVVTIS  115

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV  593
            +EAQARL DPVYGCV+ I A+QQQV +LQAELS +Q+ L + +V
Sbjct  116  YEAQARLSDPVYGCVSTILALQQQVASLQAELSLVQSQLINSRV  159



>gb|KDP28745.1| hypothetical protein JCGZ_14516 [Jatropha curcas]
Length=228

 Score =   161 bits (408),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 88/103 (85%), Gaps = 5/103 (5%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC+ GCIFAPYFDSDQG + FA+VHKVFGASN SKLL  IP HKRLDAV+T+C
Sbjct  45   ACKFLRRKCLKGCIFAPYFDSDQGTAHFAAVHKVFGASNASKLLLRIPAHKRLDAVVTLC  104

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR+RDPVYGCV H+FA+QQ     QAEL+Y+QA L++LQ
Sbjct  105  YEALARVRDPVYGCVGHLFALQQ-----QAELAYIQARLSTLQ  142



>ref|XP_010419557.1| PREDICTED: LOB domain-containing protein 31-like [Camelina sativa]
Length=216

 Score =   161 bits (407),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC++ C+FAPYFDS++G S FA+VHKVFGASN SKLL  IP  +RLDAV+T+ 
Sbjct  14   ACKFLRRKCLSECVFAPYFDSEEGTSHFAAVHKVFGASNASKLLMMIPESRRLDAVVTLS  73

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA ARLRDPVYGCV HIFA+Q QV+NLQAEL+ +Q  L+SLQ
Sbjct  74   YEALARLRDPVYGCVGHIFALQHQVMNLQAELADVQTQLSSLQ  116



>ref|XP_010485728.1| PREDICTED: LOB domain-containing protein 20 [Camelina sativa]
Length=273

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAP+F SDQGA+ FA+VHKVFGASNVSKLLHHIP ++R DAV+T+ 
Sbjct  56   ACKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLHHIPVNRRHDAVVTIS  115

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV  593
            +EAQARL DPVYGCV+ I A+QQQV +LQAELS +Q+ L + +V
Sbjct  116  YEAQARLSDPVYGCVSTILALQQQVASLQAELSVVQSQLINSRV  159



>ref|XP_010426727.1| PREDICTED: LOB domain-containing protein 31-like [Camelina sativa]
Length=214

 Score =   160 bits (406),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC++ C+FAPYFDS++G S FA+VHKVFGASN SKLL  IP  +RLDAV+T+ 
Sbjct  14   ACKFLRRKCLSECVFAPYFDSEEGTSHFAAVHKVFGASNASKLLMMIPESRRLDAVVTLS  73

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA ARLRDPVYGCV HIFA+Q QV+NLQAEL+ +Q  L+SLQ
Sbjct  74   YEALARLRDPVYGCVGHIFALQHQVMNLQAELADVQTQLSSLQ  116



>ref|XP_002882305.1| LOB domain protein 20 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58564.1| LOB domain protein 20 [Arabidopsis lyrata subsp. lyrata]
Length=281

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAP+F SDQGA+ FA+VHKVFGASNVSKLLHHIP ++R DAV+T+ 
Sbjct  54   ACKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLHHIPVNRRHDAVVTIS  113

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV  593
            +EAQARL DPVYGCV+ I A+QQQV +LQAELS +Q+ L + +V
Sbjct  114  YEAQARLSDPVYGCVSTILALQQQVASLQAELSVVQSQLINSRV  157



>ref|XP_010513804.1| PREDICTED: LOB domain-containing protein 20-like [Camelina sativa]
Length=277

 Score =   162 bits (411),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAP+F SDQGA+ FA+VHKVFGASNVSKLLHHIP ++R DAV+T+ 
Sbjct  57   ACKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLHHIPVNRRHDAVVTIS  116

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV  593
            +EAQARL DPVYGCV+ I A+QQQV +LQAELS +Q+ L + +V
Sbjct  117  YEAQARLSDPVYGCVSTILALQQQVASLQAELSVVQSQLINSRV  160



>gb|KFK30603.1| hypothetical protein AALP_AA6G003300 [Arabis alpina]
Length=211

 Score =   160 bits (406),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCVA CIFAPYFDS++GA+ F +VHKVFGASN +KLL  +P  +RLDAV+T+ 
Sbjct  10   ACKFLRRKCVAECIFAPYFDSEEGAAHFTAVHKVFGASNAAKLLSTVPASQRLDAVVTLS  69

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA ARL DPVYGCV HIFA+Q QV+NLQAEL+Y Q HL++LQ
Sbjct  70   YEAFARLSDPVYGCVGHIFALQHQVMNLQAELAYFQTHLSALQ  112



>ref|XP_001779579.1| predicted protein [Physcomitrella patens]
 gb|EDQ55573.1| predicted protein [Physcomitrella patens]
Length=118

 Score =   157 bits (397),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYF ++QGA+ FA+VHKVFGASNV+KLL HIP  +R DAV+T+ 
Sbjct  19   ACKFLRRKCVRGCIFAPYFGAEQGAAKFAAVHKVFGASNVAKLLLHIPTPRRCDAVLTIS  78

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLA  605
            +EAQARL DPVYGCVA IF++QQQV +LQAEL+ +QA LA
Sbjct  79   YEAQARLSDPVYGCVATIFSLQQQVASLQAELAMVQAQLA  118



>ref|XP_006397722.1| hypothetical protein EUTSA_v10001778mg [Eutrema salsugineum]
 gb|ESQ39175.1| hypothetical protein EUTSA_v10001778mg [Eutrema salsugineum]
Length=193

 Score =   160 bits (404),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLR+KCV GC+FAPYFD++QG S FA+VHKVFGASN SK+L  +P +KRLDAV+T+C
Sbjct  19   ACKFLRKKCVRGCVFAPYFDAEQGTSRFAAVHKVFGASNASKMLQRLPLNKRLDAVVTLC  78

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA ARLRDPVYG V H+F +Q QV+NLQAEL+++QA L++ Q
Sbjct  79   YEALARLRDPVYGSVGHLFYLQHQVMNLQAELAHVQARLSTFQ  121



>ref|XP_008467063.1| PREDICTED: LOB domain-containing protein 18-like [Cucumis melo]
Length=117

 Score =   157 bits (396),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -1

Query  898  KFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVCFE  719
            KFLRRKCV GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+T+C+E
Sbjct  34   KFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTICYE  93

Query  718  AQARLRDPVYGCVAHIFAIQQQVV  647
            AQARLRDPVYGCVAHIFA+QQQV+
Sbjct  94   AQARLRDPVYGCVAHIFALQQQVI  117



>ref|XP_006408269.1| hypothetical protein EUTSA_v10021301mg [Eutrema salsugineum]
 gb|ESQ49722.1| hypothetical protein EUTSA_v10021301mg [Eutrema salsugineum]
Length=277

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAP+F SDQGA+ FA+VHKVFGASNVSKLLHHIP ++R DAV+T+ 
Sbjct  56   ACKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLHHIPVNRRHDAVVTIS  115

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV  593
            +EAQARL DPVYGCV+ I A+QQQV +LQAELS +Q+ L + +V
Sbjct  116  YEAQARLSDPVYGCVSTILALQQQVASLQAELSLVQSQLINSRV  159



>emb|CDX74209.1| BnaA03g28380D [Brassica napus]
Length=273

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC +GCIFAP+F SDQGA+ FA+VHKVFGASNVSKLLHHIP ++R DAV+T+ 
Sbjct  55   ACKFLRRKCASGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLHHIPVNRRHDAVVTIS  114

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV  593
            +EAQARL DPVYGCV+ I A+QQQV  LQAELS +Q+ L + +V
Sbjct  115  YEAQARLSDPVYGCVSTILALQQQVAALQAELSLVQSQLVNSRV  158



>ref|XP_010463835.1| PREDICTED: LOB domain-containing protein 20-like [Camelina sativa]
Length=277

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAP+F SDQGA+ FA+VHKVFGASNVSK LHHIP ++R DAV+T+ 
Sbjct  59   ACKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKFLHHIPVNRRHDAVVTIS  118

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV  593
            +EAQARL DPVYGCV+ I A+QQQV +LQAELS +Q+ L + +V
Sbjct  119  YEAQARLSDPVYGCVSTILALQQQVASLQAELSVVQSQLINSRV  162



>ref|XP_010549704.1| PREDICTED: LOB domain-containing protein 20 [Tarenaya hassleriana]
Length=263

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAP+F SDQGA+ FA+VHKVFGASNVSKLLHHIP ++R DAV+T+ 
Sbjct  47   ACKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLHHIPANRRHDAVVTIS  106

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAMNIAD  545
            +EAQARL DPVYGCV+ I A+QQQV +LQAE++ +Q  L + +V         S  +   
Sbjct  107  YEAQARLSDPVYGCVSTILALQQQVASLQAEMAVVQTQLINSRVAMADVMQQQSHHHHHH  166

Query  544  LSTASPAYDTLSS  506
            +    P Y   SS
Sbjct  167  MVMQQPEYSNNSS  179



>ref|XP_001772946.1| predicted protein [Physcomitrella patens]
 gb|EDQ62171.1| predicted protein [Physcomitrella patens]
Length=105

 Score =   155 bits (392),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYF ++QGA+ FA+VHKVFGASNV+KLL HIP  +R DAV+T+ 
Sbjct  6    ACKFLRRKCVRGCIFAPYFSAEQGAAKFAAVHKVFGASNVAKLLLHIPAPRRGDAVLTIS  65

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLA  605
            +EAQARL DPVYGCVA IFA+QQQV +LQAEL+ +Q  LA
Sbjct  66   YEAQARLSDPVYGCVATIFALQQQVASLQAELAMVQTQLA  105



>ref|XP_009142333.1| PREDICTED: LOB domain-containing protein 19-like [Brassica rapa]
Length=168

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GC+FAPYFD++QG + FA++HKVFGASN SK+L  +P HKRLDAV T+ 
Sbjct  21   ACKFLRRKCVSGCVFAPYFDAEQGTASFAAIHKVFGASNTSKMLLRLPLHKRLDAVATLG  80

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR+RDPVYGCV H+F++Q QV+NLQAE++++QA L+  Q
Sbjct  81   YEALARVRDPVYGCVGHLFSLQHQVMNLQAEIAHVQARLSMFQ  123



>emb|CDX92049.1| BnaC03g33510D [Brassica napus]
Length=267

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC +GCIFAP+F SDQGA+ FA+VHKVFGASNVSKLLHHIP ++R DAV+T+ 
Sbjct  54   ACKFLRRKCASGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLHHIPVNRRHDAVVTIS  113

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV  593
            +EAQARL DPVYGCV+ I A+QQQV  LQ+ELS +Q+ L + +V
Sbjct  114  YEAQARLSDPVYGCVSTILALQQQVAALQSELSLVQSQLVNSRV  157



>ref|XP_001759142.1| predicted protein [Physcomitrella patens]
 gb|EDQ76211.1| predicted protein [Physcomitrella patens]
Length=152

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYF ++QGA+ FA+VHKVFGASNV+KLL HIP  +R DAV+T+ 
Sbjct  7    ACKFLRRKCVRGCIFAPYFSAEQGAAKFAAVHKVFGASNVAKLLLHIPAPRRNDAVLTIS  66

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHL  608
            +EAQARL DPVYGCVA IFA+QQQV +LQAEL+ +Q  L
Sbjct  67   YEAQARLSDPVYGCVATIFALQQQVASLQAELTMMQTQL  105



>ref|XP_001763572.1| predicted protein [Physcomitrella patens]
 gb|EDQ71761.1| predicted protein [Physcomitrella patens]
Length=117

 Score =   155 bits (391),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYF ++QGA+ FA+VHK+FGASNV+KLL HIP  +R DAV+T+ 
Sbjct  4    ACKFLRRKCVRGCIFAPYFGAEQGAARFAAVHKIFGASNVAKLLLHIPVSRRCDAVLTIS  63

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EAQARL DPVYGCVA IFA+QQQV +LQAEL+ +QA L + Q
Sbjct  64   YEAQARLSDPVYGCVATIFALQQQVASLQAELAMVQAQLVNRQ  106



>emb|CDY57108.1| BnaC04g56950D [Brassica napus]
Length=178

 Score =   157 bits (396),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GC+FAPYFD++QG + FA++HKVFGASN SK+L  +P HKRLDAV T+ 
Sbjct  31   ACKFLRRKCVRGCVFAPYFDAEQGTASFAAIHKVFGASNTSKMLLRLPLHKRLDAVATLG  90

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR+RDPVYGCV H+F++Q QV+NLQAE++++QA L+  Q
Sbjct  91   YEALARVRDPVYGCVGHLFSLQHQVMNLQAEIAHVQARLSMFQ  133



>gb|EAZ15392.1| hypothetical protein OsJ_30803 [Oryza sativa Japonica Group]
Length=229

 Score =   158 bits (400),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 105/149 (70%), Gaps = 21/149 (14%)
 Frame = -1

Query  877  VAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVCFEAQARLRD  698
            V GCIFAPYFDS+ GA+ FA+VHKVFGASNVSKLL  IP H+RLDAV+T+C+EAQARLRD
Sbjct  5    VVGCIFAPYFDSEAGAAHFAAVHKVFGASNVSKLLQQIPAHRRLDAVVTICYEAQARLRD  64

Query  697  PVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAM-------------  557
            PVYGCVAHIF +Q QV  LQ+EL+YLQ HL+++++P+PPP      +             
Sbjct  65   PVYGCVAHIFHLQHQVAGLQSELNYLQGHLSTMELPSPPPYVAGPTLAPPQPQPLMPMTA  124

Query  556  ----NIADLSTAS----PAYDTLSSLFDP  494
                N +DL ++S    P    LS+LFDP
Sbjct  125  AANFNFSDLPSSSAANIPVTADLSTLFDP  153



>gb|KHN40565.1| LOB domain-containing protein 16 [Glycine soja]
Length=109

 Score =   154 bits (389),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAPYFDS+QG S FA+VHKVFGASNVSKLL  IP H+RLD VIT+C
Sbjct  22   ACKFLRRKCVSGCIFAPYFDSEQGTSHFAAVHKVFGASNVSKLLLSIPVHRRLDTVITIC  81

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVV  647
            +EAQ+R+RDPVYGCVAHIFA+QQQV+
Sbjct  82   YEAQSRIRDPVYGCVAHIFALQQQVI  107



>ref|XP_007052036.1| LOB domain-containing protein 18, putative [Theobroma cacao]
 gb|EOX96193.1| LOB domain-containing protein 18, putative [Theobroma cacao]
Length=292

 Score =   160 bits (404),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 72/83 (87%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = -1

Query  901  CKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVCF  722
            CKFLRRKCV GCIFAPYFDS+QGA+ FA+VHKVFGASNVSKLL HIP HKRLDAV+T+C+
Sbjct  30   CKFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTICY  89

Query  721  EAQARLRDPVYGCVAHIFAIQQQ  653
            EAQARLRDPVYGCVAHIFA+QQQ
Sbjct  90   EAQARLRDPVYGCVAHIFALQQQ  112



>ref|XP_006396220.1| hypothetical protein EUTSA_v10028924mg [Eutrema salsugineum]
 gb|ESQ37673.1| hypothetical protein EUTSA_v10028924mg [Eutrema salsugineum]
Length=237

 Score =   158 bits (400),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCVA CIFAPYFDS++G + FA+VHKVFGASN SKLL  IP  +RLDAV+T+ 
Sbjct  27   ACKFLRRKCVAECIFAPYFDSEEGTAHFAAVHKVFGASNASKLLFMIPASRRLDAVVTLS  86

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA ARL DPVYGCV HIFA+Q QV+NL+AEL+ +Q  L++LQ
Sbjct  87   YEALARLSDPVYGCVGHIFALQHQVMNLEAELAMVQTQLSTLQ  129



>emb|CDY37038.1| BnaA04g26160D [Brassica napus]
Length=178

 Score =   156 bits (395),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GC+FAPYFD++QG + FA++HKVFGASN SK+L  +P HKRLDAV T+ 
Sbjct  31   ACKFLRRKCVRGCVFAPYFDAEQGTASFAAIHKVFGASNTSKMLLRLPLHKRLDAVATLG  90

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR+RDPVYGCV H+F++Q QV+NLQAE++++QA L+  Q
Sbjct  91   YEALARVRDPVYGCVGHLFSLQHQVMNLQAEIAHVQARLSMFQ  133



>ref|XP_004229819.1| PREDICTED: LOB domain-containing protein 19 [Solanum lycopersicum]
Length=167

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFDS+QG + FA VHKVFGASN SKLL  IPP+KR + V+T+ 
Sbjct  10   ACKFLRRKCVKGCIFAPYFDSEQGMAHFAVVHKVFGASNTSKLLLTIPPNKRFETVVTLY  69

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLA  605
            FEA AR+RDPVYGCV HI ++QQQ V LQAEL+Y+QA ++
Sbjct  70   FEALARVRDPVYGCVGHIISLQQQAVTLQAELAYVQARIS  109



>ref|XP_002271115.1| PREDICTED: LOB domain-containing protein 20 [Vitis vinifera]
Length=238

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAP+F SDQGA+ FA+VHKVFGASNVSKLL HIP ++R DAV+T+ 
Sbjct  45   ACKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLLHIPVNRRHDAVVTIS  104

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAMNIAD  545
            +EAQARL DPVYGCV+ I A+QQQV +LQAEL+ +QA L + +                 
Sbjct  105  YEAQARLSDPVYGCVSTILALQQQVASLQAELAMVQAQLINSRFAVANAFQNSQQQQQHQ  164

Query  544  LSTASPAYDTLSS  506
            ++   PAY   S+
Sbjct  165  IAVLQPAYSNNST  177



>ref|XP_010524360.1| PREDICTED: LOB domain-containing protein 19 [Tarenaya hassleriana]
Length=204

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYFD ++G S FA+VHKVFGASN SK+L  +P +KRLDA +T+C
Sbjct  15   ACKFLRRKCVGGCIFAPYFDGEEGTSRFAAVHKVFGASNASKMLMKLPSNKRLDASVTLC  74

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA +RLRDPVYG V+ +F++Q QVV LQAEL+Y+QA L++ Q
Sbjct  75   YEALSRLRDPVYGPVSLLFSLQHQVVKLQAELAYIQARLSTFQ  117



>ref|XP_011070190.1| PREDICTED: LOB domain-containing protein 20 [Sesamum indicum]
Length=244

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAP+F SDQGA+ FA+VHKVFGASNVSKLL HIP ++R DAV+T+ 
Sbjct  41   ACKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLMHIPANRRHDAVVTIS  100

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHL  608
            +EAQARL DPVYGCV+ I A+QQQV +LQAELS +Q  L
Sbjct  101  YEAQARLSDPVYGCVSTIIALQQQVASLQAELSVVQTQL  139



>ref|XP_009353184.1| PREDICTED: LOB domain-containing protein 20-like [Pyrus x bretschneideri]
Length=246

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC++GCIFAP+F SDQGA+ FA+VHKVFGASNVSKLL HIP ++R DAV+T+ 
Sbjct  56   ACKFLRRKCISGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLLHIPLNRRHDAVVTIT  115

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHL  608
            +EAQARL DPVYGCV+ + A+QQQV +LQAEL+ +Q  L
Sbjct  116  YEAQARLSDPVYGCVSTVLALQQQVASLQAELATVQTQL  154



>emb|CDP18379.1| unnamed protein product [Coffea canephora]
Length=249

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC++GCIFAP+F SDQGA+ FA+VHKVFGASNVSKLL HIP ++R DAV+T+ 
Sbjct  51   ACKFLRRKCISGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLLHIPENRRNDAVVTIS  110

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHL  608
            +EAQARL DPVYGCV+ I A+QQQV +LQAEL+ +Q  L
Sbjct  111  YEAQARLSDPVYGCVSTILALQQQVASLQAELAVVQTQL  149



>gb|KFK37334.1| hypothetical protein AALP_AA4G243100 [Arabis alpina]
Length=213

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GC+FAPYFD+DQG + FA+VHKVFGASN SK+L  +P HKRLDAV+T+ 
Sbjct  20   ACKFLRRKCVKGCVFAPYFDADQGTTRFAAVHKVFGASNASKMLLRLPLHKRLDAVVTLS  79

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA AR+RDPVYG V H+F++Q QV+NLQAEL+++QA L++ Q
Sbjct  80   YEALARVRDPVYGSVGHLFSLQHQVMNLQAELAHVQACLSTFQ  122



>ref|XP_010918824.1| PREDICTED: LOB domain-containing protein 14-like [Elaeis guineensis]
Length=236

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYF  +QGA+ FA++HKVFGASNVSKLL H+P + R +A IT+ 
Sbjct  10   ACKFLRRKCVRGCIFAPYFCHEQGATHFAAIHKVFGASNVSKLLMHLPVNDRSEAAITIS  69

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQA  614
            +EAQARL+DP+YGCVAHIFA+QQQVVNLQA+L+ LQA
Sbjct  70   YEAQARLQDPIYGCVAHIFALQQQVVNLQAQLASLQA  106



>emb|CBI31238.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAP+F SDQGA+ FA+VHKVFGASNVSKLL HIP ++R DAV+T+ 
Sbjct  37   ACKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLLHIPVNRRHDAVVTIS  96

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAMNIAD  545
            +EAQARL DPVYGCV+ I A+QQQV +LQAEL+ +QA L + +                 
Sbjct  97   YEAQARLSDPVYGCVSTILALQQQVASLQAELAMVQAQLINSRFAVANAFQNSQQQQQHQ  156

Query  544  LSTASPAYDTLSS  506
            ++   PAY   S+
Sbjct  157  IAVLQPAYSNNST  169



>gb|EYU30336.1| hypothetical protein MIMGU_mgv1a012147mg [Erythranthe guttata]
Length=260

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAP+F SDQGA+ FA+VHKVFGASNVSKLL HIP ++R DAV+T+ 
Sbjct  47   ACKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLTHIPANRRQDAVVTIS  106

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHL  608
            +EAQARL DPVYGCV+ I A+QQQV +LQAELS +Q  L
Sbjct  107  YEAQARLSDPVYGCVSTIIALQQQVASLQAELSVVQTQL  145



>ref|XP_004289919.1| PREDICTED: LOB domain-containing protein 16-like [Fragaria vesca 
subsp. vesca]
Length=215

 Score =   155 bits (393),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/195 (45%), Positives = 118/195 (61%), Gaps = 3/195 (2%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC + CIFAPYF S+QG + FA++HKVFGASNVSKLL H+P H R +AV+T+ 
Sbjct  21   ACKFLRRKCASDCIFAPYFCSEQGPARFAAIHKVFGASNVSKLLLHVPVHDRCEAVVTIA  80

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAMNIAD  545
            +EAQAR+RDPVYGCVAHIFA+QQQV  LQA+L  ++A +A   +            N+  
Sbjct  81   YEAQARIRDPVYGCVAHIFALQQQVACLQAQLMQVKAQVAHQNLMDSRTMESQWQGNVNG  140

Query  544  LSTASPAYDTLSSLFDPTSSM--VQpaawppppPMQQTRHLGGAANRdpaadgmsssspp  371
            + T  P+Y +  +   P SS+  +  ++      MQ+T+    +      A     +   
Sbjct  141  V-TNFPSYPSYMNPISPQSSLDSIDHSSNDTINYMQETQSSSRSEEFPLQACSKKRAYNS  199

Query  370  agsGVLQELTRHLMR  326
               G LQEL   +MR
Sbjct  200  TELGELQELALRMMR  214



>ref|XP_008391783.1| PREDICTED: LOB domain-containing protein 20 [Malus domestica]
Length=254

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC++GCIFAP+F SDQGA+ FA+VHKVFGASNVSKLL HIP ++R DAV+T+ 
Sbjct  56   ACKFLRRKCISGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLLHIPLNRRHDAVVTIT  115

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHL  608
            +EAQARL DPVYGCV+ I A+QQQV +LQ EL+ +Q  L
Sbjct  116  YEAQARLSDPVYGCVSTILALQQQVASLQGELAMVQTQL  154



>ref|XP_004136784.1| PREDICTED: LOB domain-containing protein 20-like [Cucumis sativus]
 ref|XP_004159662.1| PREDICTED: LOB domain-containing protein 20-like [Cucumis sativus]
 gb|KGN59488.1| hypothetical protein Csa_3G822390 [Cucumis sativus]
Length=222

 Score =   155 bits (393),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 100/140 (71%), Gaps = 3/140 (2%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAP+F SDQGA+ FA+VHK+FGASNVSKLL HIP  +R DAV+T+ 
Sbjct  33   ACKFLRRKCVNGCIFAPHFASDQGAARFAAVHKIFGASNVSKLLLHIPVSRRNDAVVTIS  92

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAMNIAD  545
            +EAQARL DPVYGCV+ + A+QQQV +LQAEL+ +QA L S ++          +  +  
Sbjct  93   YEAQARLSDPVYGCVSTVLALQQQVASLQAELAAVQAQLISSRLAFAAAVQNSQSSQVGV  152

Query  544  LSTASPAYDTLSSLFDPTSS  485
            L    PAY   SS+   TS+
Sbjct  153  L---QPAYSNNSSISASTSA  169



>ref|XP_009366531.1| PREDICTED: LOB domain-containing protein 20-like [Pyrus x bretschneideri]
Length=232

 Score =   156 bits (394),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 99/140 (71%), Gaps = 10/140 (7%)
 Frame = -1

Query  901  CKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVCF  722
            CKFLRRKC++GCIFAP F SDQGA+ FA+VHKVFGASNVSKLL HIP ++R DAV+T+ +
Sbjct  59   CKFLRRKCISGCIFAPLFSSDQGAARFAAVHKVFGASNVSKLLLHIPLNRRHDAVVTISY  118

Query  721  EAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHL--------ASLQVptpppppPM  566
            EAQARL DPVYGCV+ I A+QQQV +LQAEL+ +Q  L        ++LQ+ +       
Sbjct  119  EAQARLSDPVYGCVSTILALQQQVASLQAELAMVQTQLINSRFAFASALQITSQQQQHEQ  178

Query  565  SAMNIADLSTASPAYDTLSS  506
               N+A +    PAY   SS
Sbjct  179  QQQNMALM--LQPAYSNNSS  196



>ref|XP_007050346.1| Lateral organ boundaries-domain 16 [Theobroma cacao]
 gb|EOX94503.1| Lateral organ boundaries-domain 16 [Theobroma cacao]
Length=204

 Score =   155 bits (392),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 100/141 (71%), Gaps = 2/141 (1%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC + CIFAPYF S+QG + FA++HKVFGASNVSKLL HIP H R +AV+T+ 
Sbjct  16   ACKFLRRKCASDCIFAPYFCSEQGPARFAAIHKVFGASNVSKLLLHIPAHDRCEAVVTIA  75

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAMNIAD  545
            +EAQAR+RDPVYGCVAHIFA+QQQV  LQA+L  ++A LA   + +          N++ 
Sbjct  76   YEAQARIRDPVYGCVAHIFALQQQVACLQAQLMQVKAQLAQNAMNSHNIESQWQG-NLSG  134

Query  544  LSTASPAYDTLSSLFDPTSSM  482
            L +  P Y +  +   P SS+
Sbjct  135  LPSI-PTYPSYMNPISPQSSL  154



>ref|XP_007203508.1| hypothetical protein PRUPE_ppa024802mg [Prunus persica]
 gb|EMJ04707.1| hypothetical protein PRUPE_ppa024802mg [Prunus persica]
Length=263

 Score =   156 bits (395),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC++GCIFAP+F SDQGA+ FA+VHKVFGASNVSKLL HIP ++R DAV+T+ 
Sbjct  56   ACKFLRRKCISGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLLHIPLNRRQDAVVTIS  115

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHL  608
            +EAQARL DPVYGCV+ I A+QQQV +LQAEL+ +Q  L
Sbjct  116  YEAQARLADPVYGCVSTILALQQQVASLQAELAMVQTQL  154



>ref|XP_010266765.1| PREDICTED: LOB domain-containing protein 20 [Nelumbo nucifera]
Length=236

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC++GCIFAPYF +DQGA+ FA+VHKVFGASNVSKLL H+P ++R D V+T+ 
Sbjct  43   ACKFLRRKCISGCIFAPYFGTDQGAARFAAVHKVFGASNVSKLLLHVPTNRRHDTVVTIS  102

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHL  608
            +EAQARL DPVYGCV+ I A+QQQV  LQAELS +Q  L
Sbjct  103  YEAQARLSDPVYGCVSTILALQQQVAALQAELSVVQEQL  141



>ref|XP_003536931.1| PREDICTED: LOB domain-containing protein 29-like [Glycine max]
 gb|KHN03864.1| LOB domain-containing protein 29 [Glycine soja]
Length=239

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GC+FAPYF  +QGA+ FA++HKVFGASNVSKLL H+P   R +A +T+ 
Sbjct  10   ACKFLRRKCVRGCVFAPYFCQEQGATHFAAIHKVFGASNVSKLLAHLPVSDRCEAAVTIS  69

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLA  605
            +EAQARL+DP+YGCV+HIFA+QQQVVNLQA+L+YL+   A
Sbjct  70   YEAQARLQDPIYGCVSHIFALQQQVVNLQAQLAYLKEQAA  109



>ref|XP_007144924.1| hypothetical protein PHAVU_007G195000g [Phaseolus vulgaris]
 gb|ESW16918.1| hypothetical protein PHAVU_007G195000g [Phaseolus vulgaris]
Length=238

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GC+FAPYF  +QGA+ FA++HKVFGASNVSKLL H+P   R +A +T+ 
Sbjct  10   ACKFLRRKCVRGCVFAPYFCHEQGATHFAAIHKVFGASNVSKLLAHLPVSDRCEAAVTIS  69

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLA  605
            +EAQARL+DP+YGCV+HIFA+QQQVVNLQA+L+YL+   A
Sbjct  70   YEAQARLQDPIYGCVSHIFALQQQVVNLQAQLAYLKEQAA  109



>ref|XP_008244133.1| PREDICTED: LOB domain-containing protein 20 [Prunus mume]
Length=259

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC++GCIFAP+F SDQGA+ FA+VHKVFGASNVSKLL HIP ++R DAV+T+ 
Sbjct  56   ACKFLRRKCISGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLLHIPLNRRQDAVVTIS  115

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHL  608
            +EAQARL DPVYGCV+ I A+QQQV +LQAEL+ +Q  L
Sbjct  116  YEAQARLADPVYGCVSTILALQQQVASLQAELAMVQTQL  154



>gb|KEH23896.1| LOB domain protein [Medicago truncatula]
Length=224

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GCIFAPYF  +QGA+ FA++HKVFGASNVSKLL H+P   R +A +T+ 
Sbjct  11   ACKFLRRKCVRGCIFAPYFCHEQGATHFAAIHKVFGASNVSKLLAHLPVTDRCEAAVTIS  70

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLA  605
            +EAQARL+DP+YGCVAHIFA+QQQVVNLQA+L++L+   A
Sbjct  71   YEAQARLQDPIYGCVAHIFALQQQVVNLQAQLAFLREQAA  110



>ref|XP_002319718.2| hypothetical protein POPTR_0013s06070g [Populus trichocarpa]
 gb|EEE95641.2| hypothetical protein POPTR_0013s06070g [Populus trichocarpa]
Length=233

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC++GCIFAP+F SDQGA+ FA+VHKVFGASNVSKLL HIP ++R +A++T+ 
Sbjct  44   ACKFLRRKCISGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLLHIPLNRRHEAIVTIS  103

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHL  608
            +EAQARL DPVYGCV+ I A+QQQV +LQAELS +Q  L
Sbjct  104  YEAQARLSDPVYGCVSTILALQQQVASLQAELSVVQTQL  142



>ref|XP_003541340.1| PREDICTED: LOB domain-containing protein 29-like [Glycine max]
 gb|KHN44981.1| LOB domain-containing protein 29 [Glycine soja]
Length=237

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GC+FAPYF  +QGA+ FA++HKVFGASNVSKLL H+P   R +A +T+ 
Sbjct  10   ACKFLRRKCVRGCVFAPYFCHEQGATHFAAIHKVFGASNVSKLLAHLPVSDRCEAAVTIS  69

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLA  605
            +EAQARL+DP+YGCV+HIFA+QQQVVNLQA+L+YL+   A
Sbjct  70   YEAQARLQDPIYGCVSHIFALQQQVVNLQAQLAYLKEQAA  109



>ref|XP_010904567.1| PREDICTED: LOB domain-containing protein 29-like [Elaeis guineensis]
Length=238

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GC+FAPYF  +QGA+ FA++HKVFGASNVSKLL H+P + R +A IT+ 
Sbjct  10   ACKFLRRKCVRGCVFAPYFCHEQGAAHFAAIHKVFGASNVSKLLMHLPVNDRSEAAITIS  69

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLA  605
            +EAQARL+DP+YGCVAHIFA+QQQVVNLQA+L+ L+A  A
Sbjct  70   YEAQARLQDPIYGCVAHIFALQQQVVNLQAQLASLKAQAA  109



>ref|XP_008794315.1| PREDICTED: LOB domain-containing protein 29-like [Phoenix dactylifera]
Length=236

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 96/137 (70%), Gaps = 13/137 (9%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GC+FAPYF  +QGA+ FA++HKVFGASNVSKLL H+P + R +A IT+ 
Sbjct  10   ACKFLRRKCVRGCVFAPYFCHEQGAAHFAAIHKVFGASNVSKLLMHLPVNDRSEAAITIS  69

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAMNIAD  545
            +EAQARL+DP+YGCVAHIFA+QQQVVNLQA+L+ L+A  A               +    
Sbjct  70   YEAQARLQDPIYGCVAHIFALQQQVVNLQAQLASLKAQAA-------------QGLGNGS  116

Query  544  LSTASPAYDTLSSLFDP  494
             +T +P  D L   F P
Sbjct  117  NATPTPQEDKLYQKFPP  133



>ref|XP_003554283.1| PREDICTED: LOB domain-containing protein 16-like [Glycine max]
 gb|KHN02522.1| LOB domain-containing protein 16 [Glycine soja]
Length=213

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC A CIFAPYF S+QG + FA++HKVFGASNVSKLL HIP H R +AV+T+ 
Sbjct  19   ACKFLRRKCAADCIFAPYFCSEQGPARFAAIHKVFGASNVSKLLLHIPAHDRCEAVVTIA  78

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLA  605
            +EAQAR+RDPVYGCV+HIFA+QQQV  LQA+L  ++A LA
Sbjct  79   YEAQARIRDPVYGCVSHIFALQQQVACLQAQLMQVKAQLA  118



>ref|XP_002302057.1| LOB domain protein 16 [Populus trichocarpa]
 gb|EEE81330.1| LOB domain protein 16 [Populus trichocarpa]
Length=213

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 102/146 (70%), Gaps = 6/146 (4%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC + CIFAPYF S+QG + FA++HKVFGASNVSKLL H+P   R +AV+T+ 
Sbjct  14   ACKFLRRKCASDCIFAPYFCSEQGTARFAAIHKVFGASNVSKLLLHVPVADRYEAVVTIA  73

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLA-----SLQVptpppppPMSA  560
            +EAQAR+RDPVYGCVAHIF++QQQV  LQA+L  ++A LA     S ++           
Sbjct  74   YEAQARIRDPVYGCVAHIFSLQQQVACLQAQLMQVKAQLAQNLIDSTRINIENTHHQWQG  133

Query  559  MNIADLSTASPAYDTLSSLFDPTSSM  482
             NI+ +S+  P+Y T  +   P SS+
Sbjct  134  NNISGVSSF-PSYQTYINPISPQSSL  158



>ref|XP_008235713.1| PREDICTED: LOB domain-containing protein 16 [Prunus mume]
Length=210

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 96/141 (68%), Gaps = 0/141 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC + CIFAPYF S+QG + FA++HKVFGASNVSKLL H+P H R +AV+T+ 
Sbjct  18   ACKFLRRKCASDCIFAPYFCSEQGPARFAAIHKVFGASNVSKLLLHVPVHDRCEAVVTIA  77

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAMNIAD  545
            +EAQAR+RDPVYGCVAHIFA+QQQV  LQA+L  ++A LA   +               +
Sbjct  78   YEAQARIRDPVYGCVAHIFALQQQVACLQAQLMQVKAQLAHQSLVDSRNIESTQWPGNVN  137

Query  544  LSTASPAYDTLSSLFDPTSSM  482
              T  P Y +  +   P SS+
Sbjct  138  GVTNFPNYPSYMNPISPQSSL  158



>ref|XP_010262592.1| PREDICTED: LOB domain-containing protein 33-like [Nelumbo nucifera]
Length=223

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC  GC+FAPYF  +QGA+ FA++HKVFGASNVSKLL H+P H R +A IT+ 
Sbjct  10   ACKFLRRKCSNGCVFAPYFCYEQGANHFAAIHKVFGASNVSKLLSHLPVHNRSEAAITIS  69

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASL  599
            +EA AR+RDP+YGCVAHI A+QQQVVNLQ E+ +L+  +A+L
Sbjct  70   YEALARMRDPIYGCVAHILALQQQVVNLQEEIEFLENQVANL  111



>ref|XP_009367705.1| PREDICTED: LOB domain-containing protein 16 [Pyrus x bretschneideri]
Length=212

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 102/160 (64%), Gaps = 3/160 (2%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC   CIFAPYF S+QG + FA++HKVFGASNVSKLL H+P H R +AV+T+ 
Sbjct  19   ACKFLRRKCAPDCIFAPYFCSEQGPARFAAIHKVFGASNVSKLLLHVPVHDRCEAVVTIA  78

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLA--SLQVptpppppPMSAMNI  551
            +EAQAR+RDPVYGCV HIFA+QQQV  LQA+L   +A LA  SL               I
Sbjct  79   YEAQARIRDPVYGCVGHIFALQQQVACLQAQLMQAKAQLAHQSLVDSRNMESTQWQGNGI  138

Query  550  ADLSTAS-PAYDTLSSLFDPTSSMVQpaawppppPMQQTR  434
             + S  S P+Y +  +   P SS+   A       MQ+ +
Sbjct  139  GNGSVTSFPSYSSYMNPISPQSSLDSIANSDIAMNMQEIQ  178



>ref|XP_003623743.1| LOB domain-containing protein [Medicago truncatula]
 gb|AES79961.1| LOB domain protein [Medicago truncatula]
Length=197

 Score =   153 bits (386),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 89/104 (86%), Gaps = 2/104 (2%)
 Frame = -1

Query  904  ACKFLRRKCVAGC-IFAPYFDSD-QGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVIT  731
            ACKFLRRKCV GC IFAPYF+S  QG++ FA+VHKVFGASN +KLL  IP HKRLDAV+T
Sbjct  15   ACKFLRRKCVKGCCIFAPYFESSGQGSAHFAAVHKVFGASNAAKLLTRIPVHKRLDAVVT  74

Query  730  VCFEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASL  599
            +C+EA AR  DPVYGCVAH+FA+QQQVV LQAEL+Y+QA L+ L
Sbjct  75   LCYEALARATDPVYGCVAHLFALQQQVVELQAELAYVQARLSIL  118



>ref|XP_011028776.1| PREDICTED: LOB domain-containing protein 16-like [Populus euphratica]
Length=217

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 102/146 (70%), Gaps = 6/146 (4%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC + CIFAPYF S+QG + FA++HKVFGASNVSKLL H+P   R +AV+T+ 
Sbjct  18   ACKFLRRKCASDCIFAPYFCSEQGTARFAAIHKVFGASNVSKLLLHVPVADRYEAVVTIA  77

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLA-----SLQVptpppppPMSA  560
            +EAQAR+RDPVYGCVAHIF++QQQV  LQA+L  ++A LA     S ++           
Sbjct  78   YEAQARIRDPVYGCVAHIFSLQQQVACLQAQLMQVKAQLAQNLIDSTRINIEKTHHQWQG  137

Query  559  MNIADLSTASPAYDTLSSLFDPTSSM  482
             NI+ +S+  P+Y T  +   P SS+
Sbjct  138  NNISGVSSF-PSYQTYINPISPQSSL  162



>ref|XP_007199359.1| hypothetical protein PRUPE_ppa025349mg [Prunus persica]
 gb|EMJ00558.1| hypothetical protein PRUPE_ppa025349mg [Prunus persica]
Length=210

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 96/141 (68%), Gaps = 0/141 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC + CIFAPYF S+QG + FA++HKVFGASNVSKLL H+P H R +AV+T+ 
Sbjct  18   ACKFLRRKCASDCIFAPYFCSEQGPARFAAIHKVFGASNVSKLLLHVPVHDRCEAVVTIA  77

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAMNIAD  545
            +EAQAR+RDPVYGCVAHIFA+QQQV  LQA+L  ++A LA   +               +
Sbjct  78   YEAQARIRDPVYGCVAHIFALQQQVACLQAQLMQVRAQLAHQSLVDSRNIESTQWPGNVN  137

Query  544  LSTASPAYDTLSSLFDPTSSM  482
              T  P Y +  +   P SS+
Sbjct  138  GVTNFPNYPSYMNPISPQSSL  158



>ref|XP_010679216.1| PREDICTED: LOB domain-containing protein 16-like [Beta vulgaris 
subsp. vulgaris]
Length=224

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC + CIFAPYF S+QG + FA++HKVFGASNVSKLL H+P H+R +AV+T+ 
Sbjct  11   ACKFLRRKCASDCIFAPYFCSEQGPARFAAIHKVFGASNVSKLLLHLPVHERCEAVVTIA  70

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLAS  602
            +EAQAR+RDPVYGCVAHIFA+QQQV  LQA+L  ++  LA+
Sbjct  71   YEAQARIRDPVYGCVAHIFALQQQVAYLQAQLMQVKGQLAN  111



>gb|KCW47777.1| hypothetical protein EUGRSUZ_K01522 [Eucalyptus grandis]
Length=230

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC+ GCIFAPYF SDQGA+ FA+VH VFGASNVSKLL HIP +KR DAV+T+ 
Sbjct  12   ACKFLRRKCIHGCIFAPYFGSDQGAAKFAAVHMVFGASNVSKLLLHIPVNKRQDAVVTIT  71

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLAS  602
            +EAQARL DPVYGCV+ I A+QQQV  LQAELS +Q  L S
Sbjct  72   YEAQARLADPVYGCVSTILALQQQVATLQAELSLVQTQLMS  112



>gb|KDP21329.1| hypothetical protein JCGZ_21800 [Jatropha curcas]
Length=219

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 98/141 (70%), Gaps = 2/141 (1%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC + CIFAPYF SDQG + FA++HKVFGASNVSKLL H+P   R +AV+T+ 
Sbjct  17   ACKFLRRKCASNCIFAPYFCSDQGPARFAAIHKVFGASNVSKLLLHVPVADRCEAVVTIA  76

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAM--NI  551
            +EAQAR+RDPVYGCVAHIFA+QQQV  LQA+L  ++A LA     T       +    N+
Sbjct  77   YEAQARIRDPVYGCVAHIFALQQQVACLQAQLMQVKAQLAQNMADTSRNNSMENQWQGNV  136

Query  550  ADLSTASPAYDTLSSLFDPTS  488
              + ++ P Y   ++  +P S
Sbjct  137  YGIPSSCPNYSNHNNYMNPIS  157



>ref|XP_004152037.1| PREDICTED: LOB domain-containing protein 16-like [Cucumis sativus]
 ref|XP_004165236.1| PREDICTED: LOB domain-containing protein 16-like [Cucumis sativus]
Length=229

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCVA CIFAPYF S+QGA+ FA++HKVFGASNVSKLL H+P H R +AV+T+ 
Sbjct  20   ACKFLRRKCVADCIFAPYFCSEQGAARFAAIHKVFGASNVSKLLLHVPVHDRCEAVVTIA  79

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLAS  602
            +EAQAR+ DPVYGCVAHIFA+QQQV  LQ +L + +A LA 
Sbjct  80   YEAQARIHDPVYGCVAHIFALQQQVAYLQTQLMHAKAQLAE  120



>ref|XP_010036253.1| PREDICTED: LOB domain-containing protein 20 [Eucalyptus grandis]
Length=258

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC+ GCIFAPYF SDQGA+ FA+VH VFGASNVSKLL HIP +KR DAV+T+ 
Sbjct  40   ACKFLRRKCIHGCIFAPYFGSDQGAAKFAAVHMVFGASNVSKLLLHIPVNKRQDAVVTIT  99

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLAS  602
            +EAQARL DPVYGCV+ I A+QQQV  LQAELS +Q  L S
Sbjct  100  YEAQARLADPVYGCVSTILALQQQVATLQAELSLVQTQLMS  140



>emb|CDY68561.1| BnaCnng59550D [Brassica napus]
Length=188

 Score =   152 bits (385),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GC+FAPYFD++QG + FA+VHKVFGASN SK+L  +P +KR DAV T+C
Sbjct  18   ACKFLRRKCVSGCVFAPYFDAEQGTATFAAVHKVFGASNASKMLLRLPLNKRHDAVSTLC  77

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA ARL DPVYG V H+F++Q QV+NLQAE++++QA L++ Q
Sbjct  78   YEALARLSDPVYGSVGHLFSLQHQVMNLQAEIAHVQARLSTFQ  120



>ref|XP_010918779.1| PREDICTED: LOB domain-containing protein 16-like [Elaeis guineensis]
Length=189

 Score =   152 bits (385),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC A CIFAPYF S+QGA+ FA++HKVFGASNVSKLL H+P H R +AV+++ 
Sbjct  7    ACKFLRRKCTADCIFAPYFGSEQGAARFAAIHKVFGASNVSKLLLHVPLHDRCEAVVSIA  66

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLA  605
            +EAQARL+DPVYGCV HIFA+QQQV +LQ +L   +A LA
Sbjct  67   YEAQARLKDPVYGCVGHIFALQQQVASLQLQLMQAKAQLA  106



>ref|XP_008787394.1| PREDICTED: LOB domain-containing protein 16-like [Phoenix dactylifera]
Length=196

 Score =   152 bits (385),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC + CIFAPYF+SDQG + FA++HK+FGASNVSKLL H+P   R +AV+T+ 
Sbjct  11   ACKFLRRKCASDCIFAPYFNSDQGPARFAAIHKIFGASNVSKLLLHVPLLDRCEAVVTIA  70

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLA  605
            +EAQAR+RDPVYGCVAHIFA+QQQV  LQA+L  L+A LA
Sbjct  71   YEAQARIRDPVYGCVAHIFALQQQVAILQAQLMQLKAQLA  110



>gb|KDO66074.1| hypothetical protein CISIN_1g042813mg [Citrus sinensis]
Length=250

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -1

Query  901  CKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVCF  722
            CKFLRRKCV+GCIFAP+F SDQGA+ FA+VHKVFGASNVSKLL HIP ++R DAV+T+ +
Sbjct  44   CKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLLHIPVNRRQDAVVTISY  103

Query  721  EAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHL  608
            EAQARL DPVYGCV+ I A+QQQV +LQAEL+ +Q  L
Sbjct  104  EAQARLSDPVYGCVSTILALQQQVASLQAELTMVQNQL  141



>ref|XP_006443492.1| hypothetical protein CICLE_v10021843mg [Citrus clementina]
 ref|XP_006479165.1| PREDICTED: LOB domain-containing protein 20-like [Citrus sinensis]
 gb|ESR56732.1| hypothetical protein CICLE_v10021843mg [Citrus clementina]
Length=250

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -1

Query  901  CKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVCF  722
            CKFLRRKCV+GCIFAP+F SDQGA+ FA+VHKVFGASNVSKLL HIP ++R DAV+T+ +
Sbjct  44   CKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLLHIPVNRRQDAVVTISY  103

Query  721  EAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHL  608
            EAQARL DPVYGCV+ I A+QQQV +LQAEL+ +Q  L
Sbjct  104  EAQARLSDPVYGCVSTILALQQQVASLQAELTMVQNQL  141



>gb|KHN10727.1| LOB domain-containing protein 29 [Glycine soja]
Length=212

 Score =   153 bits (386),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GC+FAPYF  +QG + FA++HKVFGASNVSKLL H+P   R +A +T+ 
Sbjct  10   ACKFLRRKCVRGCVFAPYFCHEQGVTHFAAIHKVFGASNVSKLLAHLPVSDRCEATVTIS  69

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQ  617
            +EAQARL+DP+YGCVAHIFA+Q+QVVNLQA+L+YL+
Sbjct  70   YEAQARLQDPIYGCVAHIFALQEQVVNLQAQLAYLR  105



>gb|KGN57934.1| hypothetical protein Csa_3G398920 [Cucumis sativus]
Length=241

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCVA CIFAPYF S+QGA+ FA++HKVFGASNVSKLL H+P H R +AV+T+ 
Sbjct  32   ACKFLRRKCVADCIFAPYFCSEQGAARFAAIHKVFGASNVSKLLLHVPVHDRCEAVVTIA  91

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLAS  602
            +EAQAR+ DPVYGCVAHIFA+QQQV  LQ +L + +A LA 
Sbjct  92   YEAQARIHDPVYGCVAHIFALQQQVAYLQTQLMHAKAQLAE  132



>ref|XP_009616196.1| PREDICTED: LOB domain-containing protein 20 [Nicotiana tomentosiformis]
Length=247

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC++GCIFAP++ SDQGA+ FA+VHKVFGASNVSKLL HIP ++R DAV+T+ 
Sbjct  42   ACKFLRRKCISGCIFAPHYGSDQGAARFAAVHKVFGASNVSKLLLHIPANRRHDAVVTIT  101

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHL  608
            +EAQARL DPVYGCV+ I A+QQQV +LQAEL+ +Q  L
Sbjct  102  YEAQARLSDPVYGCVSTILALQQQVASLQAELAVVQTQL  140



>ref|XP_006435636.1| hypothetical protein CICLE_v10033354mg [Citrus clementina]
 gb|ESR48876.1| hypothetical protein CICLE_v10033354mg [Citrus clementina]
Length=227

 Score =   153 bits (387),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 93/138 (67%), Gaps = 0/138 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRR+C   CIFAPYF  DQ A+ FA+VHKVFGASNVSKLL H+P H R DA IT+ 
Sbjct  10   ACKFLRRRCTNDCIFAPYFCYDQAAAHFAAVHKVFGASNVSKLLLHLPVHNRSDAAITIS  69

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAMNIAD  545
            +EA AR+ DP+YGCVAHIFA+QQQV NLQ E+  L+ H+A+  V         +      
Sbjct  70   YEALARMHDPIYGCVAHIFALQQQVANLQEEIEMLENHMANNLVGAVFSGGSQTPNEPCS  129

Query  544  LSTASPAYDTLSSLFDPT  491
             S  SP  + +++L+ P 
Sbjct  130  QSYFSPQLEAMNTLYYPN  147



>gb|KDO85851.1| hypothetical protein CISIN_1g041368mg [Citrus sinensis]
Length=102

 Score =   149 bits (376),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GC+FAPYFD+DQG + FA+VHKVFGASN SKLL  IPPHKRLDAV+++C
Sbjct  14   ACKFLRRKCVKGCVFAPYFDADQGTTHFAAVHKVFGASNASKLLSRIPPHKRLDAVVSLC  73

Query  724  FEAQARLRDPVYGCVAHIFAIQQQV  650
            +EA AR RDP+YGCV HI A+QQQV
Sbjct  74   YEAMARTRDPIYGCVGHIVALQQQV  98



>ref|XP_009779769.1| PREDICTED: LOB domain-containing protein 20 [Nicotiana sylvestris]
Length=247

 Score =   154 bits (388),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC++GCIFAP++ SDQGA+ FA+VHKVFGASNVSKLL HIP ++R DAV+T+ 
Sbjct  42   ACKFLRRKCISGCIFAPHYGSDQGAARFAAVHKVFGASNVSKLLLHIPANRRHDAVVTIT  101

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHL  608
            +EAQARL DPVYGCV+ I A+QQQV +LQAEL+ +Q  L
Sbjct  102  YEAQARLSDPVYGCVSTILALQQQVASLQAELAVVQTQL  140



>ref|XP_004495114.1| PREDICTED: LOB domain-containing protein 29-like [Cicer arietinum]
Length=229

 Score =   153 bits (387),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC+ GC+FAPYF  +QGA+ FA++HKVFGASNVSKLL H+P   R +A +T+ 
Sbjct  12   ACKFLRRKCIRGCVFAPYFCHEQGATHFAAIHKVFGASNVSKLLAHLPLTDRCEAAVTIS  71

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQ  617
            +EAQARL+DP+YGCV+HIFA+QQQVVNLQ +L+YL+
Sbjct  72   YEAQARLQDPIYGCVSHIFALQQQVVNLQTQLAYLK  107



>ref|XP_009133536.1| PREDICTED: LOB domain-containing protein 16-like [Brassica rapa]
Length=238

 Score =   153 bits (387),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC++ CIFAPYF S+QGA  FA++HKVFGASNVSKLL  +P H R +AV+T+ 
Sbjct  18   ACKFLRRKCLSDCIFAPYFSSEQGAERFAAIHKVFGASNVSKLLLKVPIHDRCEAVVTIA  77

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAMNIAD  545
            +EAQARL DPVYGCV+HIF++QQQV  LQA++  ++AH+A  Q          +      
Sbjct  78   YEAQARLHDPVYGCVSHIFSLQQQVAYLQAQVMQMKAHIAGHQTSAAEGTHQFTTWQQTS  137

Query  544  LSTASPAYDT  515
             S    AY T
Sbjct  138  GSPIDSAYST  147



>ref|XP_002525698.1| LOB domain-containing protein, putative [Ricinus communis]
 gb|EEF36681.1| LOB domain-containing protein, putative [Ricinus communis]
Length=240

 Score =   153 bits (387),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC+ GCIFAP+F SDQGA+ FA+VHKVFGASNVSKLL HIP ++R +AV+T+ 
Sbjct  45   ACKFLRRKCINGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLLHIPVNRRHEAVVTIS  104

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHL  608
            +EAQARL DPVYGCV+ I A+QQQV +LQAEL+ +Q  L
Sbjct  105  YEAQARLSDPVYGCVSTILALQQQVASLQAELTMVQTQL  143



>ref|XP_010524043.1| PREDICTED: LOB domain-containing protein 16 [Tarenaya hassleriana]
Length=223

 Score =   153 bits (386),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC + CIFAPYF SDQG + FA++H+VFGASNVSKLLH +P H R +AV+++ 
Sbjct  14   ACKFLRRKCASDCIFAPYFSSDQGPARFAAIHRVFGASNVSKLLHSVPVHDRCEAVVSIA  73

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLAS  602
            +EAQARL DPVYGCVAHIFA+QQQV  LQA+L  L+A L S
Sbjct  74   YEAQARLSDPVYGCVAHIFALQQQVAFLQAQLMQLKAQLIS  114



>ref|XP_010274825.1| PREDICTED: LOB domain-containing protein 29 [Nelumbo nucifera]
Length=240

 Score =   153 bits (387),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GC+FAPYF  +QGA+ FA++HKVFGASNVSKLL H+P   R +A +T+ 
Sbjct  10   ACKFLRRKCVKGCVFAPYFCHEQGATHFAAIHKVFGASNVSKLLAHLPVTDRCEAAVTIS  69

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLA  605
            +EAQARL+DP+YGCV+HIFA+QQQVVNLQA+L+ L+A  A
Sbjct  70   YEAQARLQDPIYGCVSHIFALQQQVVNLQAQLASLKAQAA  109



>ref|XP_009354924.1| PREDICTED: LOB domain-containing protein 16-like [Pyrus x bretschneideri]
Length=233

 Score =   153 bits (386),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 99/142 (70%), Gaps = 1/142 (1%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC + CIFAPYF S+QG + FA++HKVFGASNVSKLL H+P H R +AV+T+ 
Sbjct  42   ACKFLRRKCASDCIFAPYFCSEQGPARFAAIHKVFGASNVSKLLLHVPAHDRCEAVVTIA  101

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAMNIAD  545
            +EAQAR+RDPVYGCVAHIF++QQQV  LQA+L  ++A LA   +               +
Sbjct  102  YEAQARIRDPVYGCVAHIFSLQQQVACLQAQLMQVKAQLAHQNLIDSRNMESTQWQGNVN  161

Query  544  LSTAS-PAYDTLSSLFDPTSSM  482
             S +S P+Y +  +   P SS+
Sbjct  162  GSVSSFPSYPSYVNPISPQSSL  183



>ref|XP_006347838.1| PREDICTED: LOB domain-containing protein 20-like [Solanum tuberosum]
Length=241

 Score =   153 bits (387),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC+ GC+FAPYF SDQGA+ FA+VHKVFGASNVSKLL HIP ++R DAV+T+ 
Sbjct  39   ACKFLRRKCINGCVFAPYFGSDQGAARFAAVHKVFGASNVSKLLLHIPANRRQDAVVTIT  98

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAMNIAD  545
            +EAQARL DPVYGCV+ I A+QQQV +LQ+EL+ +Q  + + +         +S      
Sbjct  99   YEAQARLSDPVYGCVSTILALQQQVASLQSELAIVQTQIMNSRYAMANAYHNISQQQEQH  158

Query  544  LSTASPAY  521
            ++   P+Y
Sbjct  159  IAILQPSY  166



>ref|XP_010935757.1| PREDICTED: LOB domain-containing protein 16-like [Elaeis guineensis]
Length=196

 Score =   152 bits (383),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC + CIFAPYF+SDQG + FA++HK+FGASNVSKLL H+P   R +AV+T+ 
Sbjct  11   ACKFLRRKCASDCIFAPYFNSDQGPARFAAIHKIFGASNVSKLLLHVPLPDRCEAVVTIA  70

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLA  605
            +EAQAR+RDPVYGCVAHIFA+QQQV  L+A+L  L+A LA
Sbjct  71   YEAQARIRDPVYGCVAHIFALQQQVAILEAQLMQLKAQLA  110



>ref|XP_008775957.1| PREDICTED: LOB domain-containing protein 29-like [Phoenix dactylifera]
Length=234

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 96/137 (70%), Gaps = 12/137 (9%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GC+FAPYF  +QGA+ FA++HKVFGASNVSKLL H+P + R +A I++ 
Sbjct  10   ACKFLRRKCVRGCVFAPYFCHEQGAAHFAAIHKVFGASNVSKLLTHLPVNDRSEAAISMS  69

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAMNIAD  545
            +EAQARL+DP+YGCVAHIFA+QQQVVNLQA+L+ L+A  A               +    
Sbjct  70   YEAQARLQDPIYGCVAHIFALQQQVVNLQAQLASLKAQAA------------QEGLGNGS  117

Query  544  LSTASPAYDTLSSLFDP  494
             +T +P  D L   F P
Sbjct  118  RATLTPQEDKLCKKFPP  134



>ref|XP_004493763.1| PREDICTED: LOB domain-containing protein 16-like [Cicer arietinum]
Length=219

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC + CIFAPYF S+QG + FA++HKVFGASNVSKLL HIP H+R +AV+T+ 
Sbjct  14   ACKFLRRKCASDCIFAPYFCSEQGPARFAAIHKVFGASNVSKLLLHIPAHERCEAVVTIA  73

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLA  605
            +EAQAR+RDPVYGCV+HIFA+QQQV  LQA+L  +++ L+
Sbjct  74   YEAQARIRDPVYGCVSHIFALQQQVACLQAQLMQVKSQLS  113



>ref|XP_003536930.1| PREDICTED: LOB domain-containing protein 16-like isoform X1 [Glycine 
max]
Length=213

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV  CIFAPYF S+QGA+ FA++HKVFGASNVSKLL  IP H R +A++T+ 
Sbjct  19   ACKFLRRKCVTDCIFAPYFCSEQGAAKFAAIHKVFGASNVSKLLLRIPAHGRFEAILTIA  78

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHL  608
            +EAQARLRDPVYGCV+HIFA+QQQV  LQA++  ++A L
Sbjct  79   YEAQARLRDPVYGCVSHIFALQQQVACLQAQVMQMKAQL  117



>ref|XP_010262268.1| PREDICTED: LOB domain-containing protein 29 [Nelumbo nucifera]
Length=232

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GC+FAPYF  +QGA+ FA++HKVFGASNVSKLL H+P   R +A +T+ 
Sbjct  10   ACKFLRRKCVRGCVFAPYFCHEQGATHFAAIHKVFGASNVSKLLAHLPVTDRCEAAVTIS  69

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLA  605
            +EAQARL+DP+YGCV+HIFA+QQQVVNLQA+L+ L+A  A
Sbjct  70   YEAQARLQDPIYGCVSHIFALQQQVVNLQAQLATLKAQAA  109



>ref|XP_010677793.1| PREDICTED: LOB domain-containing protein 20 [Beta vulgaris subsp. 
vulgaris]
Length=262

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC +GCIFAP+F SDQGA+ FA+VHKVFGASNVSKLL HIP ++R DAV+T+ 
Sbjct  39   ACKFLRRKCTSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLLHIPMNRRQDAVVTIS  98

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHL  608
            +EAQARL DPVYGCV+ I A+QQQV  +QAEL+ +Q+ +
Sbjct  99   YEAQARLSDPVYGCVSTILALQQQVATMQAELAMVQSQV  137



>ref|XP_010933093.1| PREDICTED: LOB domain-containing protein 16-like [Elaeis guineensis]
Length=193

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC A C+FAPYF S++GA+ FA++HKVFGASNV+KLL H+PP  R +AV+T+ 
Sbjct  11   ACKFLRRKCAADCVFAPYFCSEEGAARFAAIHKVFGASNVTKLLLHVPPADRCEAVVTIA  70

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLA  605
            +EAQARLRDPVYGCV HIFA+QQQV NLQ +L   +A L+
Sbjct  71   YEAQARLRDPVYGCVGHIFALQQQVANLQLQLLQAKAQLS  110



>gb|EPS72981.1| hypothetical protein M569_01776, partial [Genlisea aurea]
Length=144

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC++GC+FA +F SDQGA+ FA+VHKVFGASNVSKLL H+P ++R DAV+T+C
Sbjct  27   ACKFLRRKCMSGCVFASHFSSDQGAAKFAAVHKVFGASNVSKLLTHVPVNRRNDAVVTIC  86

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQV  593
            +EAQARL DPVYGCV+ I A+Q QV +LQ ELS +Q  L + ++
Sbjct  87   YEAQARLSDPVYGCVSTILALQHQVGSLQRELSMVQTQLMNTRI  130



>emb|CDY07237.1| BnaCnng02520D [Brassica napus]
Length=193

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCVA CIFAPYFD+++G + FA+VHKVFGASN SKLL  IP ++R +AV T+ 
Sbjct  14   ACKFLRRKCVAECIFAPYFDAEEGTAHFAAVHKVFGASNTSKLLLMIPANRRPEAVATLS  73

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA ARLRDPVYGCV HIFA+Q QV++LQ EL+ ++ HL +L+
Sbjct  74   YEALARLRDPVYGCVGHIFALQHQVMSLQEELAVVKTHLTTLE  116



>ref|XP_009143138.1| PREDICTED: LOB domain-containing protein 19-like [Brassica rapa]
 emb|CDX74738.1| BnaA05g04840D [Brassica napus]
Length=188

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GC+FAPYFD++QG + FA+VHKVFGASN SK+L  +P +KR +AV T+C
Sbjct  18   ACKFLRRKCVSGCVFAPYFDAEQGTATFAAVHKVFGASNASKMLLRLPLNKRHEAVSTLC  77

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQ  596
            +EA ARLRDPVYG V H+ ++Q QV+NLQAE++++QA L++ Q
Sbjct  78   YEALARLRDPVYGSVGHLLSLQHQVMNLQAEIAHVQARLSAFQ  120



>ref|XP_010111894.1| hypothetical protein L484_009778 [Morus notabilis]
 gb|EXC31928.1| hypothetical protein L484_009778 [Morus notabilis]
Length=227

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GCIFAPYF  +QGA+ FA++HKVFGASNVSKLL H+P   R +A +T+ 
Sbjct  10   ACKFLRRKCVSGCIFAPYFCHEQGATHFAAIHKVFGASNVSKLLSHLPVTDRCEAAVTIS  69

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQ  617
            +EAQARL+DP+YGCV+HIFA+QQQVVNLQA+L+ L+
Sbjct  70   YEAQARLQDPIYGCVSHIFALQQQVVNLQAQLASLK  105



>ref|XP_007162525.1| hypothetical protein PHAVU_001G159300g [Phaseolus vulgaris]
 gb|ESW34519.1| hypothetical protein PHAVU_001G159300g [Phaseolus vulgaris]
Length=212

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC A CIFAPYF S+QG + FA++HKVFGASNVSKLL HIP H R +AV+T+ 
Sbjct  19   ACKFLRRKCAADCIFAPYFCSEQGPARFAAIHKVFGASNVSKLLLHIPAHDRCEAVVTIA  78

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHL  608
            +EAQAR+RDPVYGCV+HIFA+QQQV  LQA+L  ++A L
Sbjct  79   YEAQARIRDPVYGCVSHIFALQQQVACLQAQLMQVKAQL  117



>ref|XP_003521280.1| PREDICTED: LOB domain-containing protein 16-like [Glycine max]
Length=213

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRR+C + CIFAPYF S+QG + FA++HKVFGASNVSKLL HIP H R +AV+T+ 
Sbjct  19   ACKFLRRRCASDCIFAPYFCSEQGPARFAAIHKVFGASNVSKLLLHIPAHDRCEAVVTIT  78

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHL  608
            +EAQAR+RDPVYGCV+HIFA+QQQV  LQA+L  ++A L
Sbjct  79   YEAQARIRDPVYGCVSHIFALQQQVARLQAQLMQVKAQL  117



>gb|AGP76338.1| ARL1, partial [Oryza granulata]
Length=118

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GC+FAPYF  +QGA+ FA++HKVFGASNVSKLL H+P   R +A +T+ 
Sbjct  10   ACKFLRRKCVRGCVFAPYFCHEQGAAHFAAIHKVFGASNVSKLLAHLPLADRPEAAVTIS  69

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLA  605
            +EAQARLRDP+YGCVAHIFA+QQQV+ LQA+L+ L+A  A
Sbjct  70   YEAQARLRDPIYGCVAHIFALQQQVMTLQAQLASLKAQAA  109



>gb|KDP39658.1| hypothetical protein JCGZ_02678 [Jatropha curcas]
Length=259

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC++GCIFAP+F SDQGA+ FA+VHKVFGASNVSKLL HIP ++R +AV+T+ 
Sbjct  50   ACKFLRRKCISGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLLHIPVNRRHEAVVTIS  109

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHL  608
            +EAQARL DPVYGCV+ I A+QQQV +LQAEL+ +Q  L
Sbjct  110  YEAQARLSDPVYGCVSTILALQQQVASLQAELAMVQTQL  148



>emb|CDP03724.1| unnamed protein product [Coffea canephora]
Length=203

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 97/141 (69%), Gaps = 1/141 (1%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKC A CIFAPYF S+QG + FA++HKVFGASNVSKLL H+P   R +AV+T+ 
Sbjct  11   ACKFLRRKCAADCIFAPYFCSEQGPARFAAIHKVFGASNVSKLLLHVPVPDRCEAVVTIA  70

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAMNIAD  545
            +EAQAR+RDPVYGCVAHIFA+QQQV  LQA+L   +A LA   + +          N+A 
Sbjct  71   YEAQARIRDPVYGCVAHIFALQQQVAYLQAQLMQARAQLAHTMIDSSRSAENHWPNNMAA  130

Query  544  LSTASPAYDTLSSLFDPTSSM  482
            +      Y T ++   P SS+
Sbjct  131  MGPFQ-TYPTYANSISPQSSI  150



>ref|XP_010911440.1| PREDICTED: LOB domain-containing protein 20, partial [Elaeis 
guineensis]
Length=206

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 98/132 (74%), Gaps = 1/132 (1%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV+GC+FAP+F ++QGA+ FA+VHKVFGASNVSKLL H+P  +R DAV+T+C
Sbjct  34   ACKFLRRKCVSGCLFAPHFGTEQGAARFAAVHKVFGASNVSKLLAHVPAGRRGDAVLTIC  93

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLASLQVptpppppPMSAMNIAD  545
            +EAQARL DPVYGCV+ I ++QQQV  LQAE+S +++ L + ++         S   +  
Sbjct  94   YEAQARLADPVYGCVSTILSLQQQVAALQAEISIVRSQLINTRLAVAGALHQGS-QQVQH  152

Query  544  LSTASPAYDTLS  509
            ++   PAY + S
Sbjct  153  IAVLQPAYSSNS  164



>ref|XP_009398033.1| PREDICTED: LOB domain-containing protein 29 [Musa acuminata subsp. 
malaccensis]
Length=214

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GC+FAPYF  +QGA+ FA++HKVFGASN SK+L H+P   R +A ITV 
Sbjct  10   ACKFLRRKCVRGCVFAPYFCHEQGAAHFAAIHKVFGASNFSKILMHLPVADRSEAAITVS  69

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLA  605
            +EAQARL+DPVYGCVAHIFA+QQQVVNLQA+LS L+A  A
Sbjct  70   YEAQARLQDPVYGCVAHIFALQQQVVNLQAQLSSLRAQAA  109



>ref|XP_009771981.1| PREDICTED: LOB domain-containing protein 14-like [Nicotiana sylvestris]
Length=233

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = -1

Query  904  ACKFLRRKCVAGCIFAPYFDSDQGASVFASVHKVFGASNVSKLLHHIPPHKRLDAVITVC  725
            ACKFLRRKCV GC+FAPYF  +QGA+ F+++HKVFGASNVSKLL HIP   R +A +T+ 
Sbjct  11   ACKFLRRKCVKGCVFAPYFCYEQGATHFSAIHKVFGASNVSKLLAHIPMTDRGEAAVTIA  70

Query  724  FEAQARLRDPVYGCVAHIFAIQQQVVNLQAELSYLQAHLA  605
            +EAQARL+DP+YGCV+HIFA+QQQVVNLQA+L+ L+   A
Sbjct  71   YEAQARLQDPIYGCVSHIFALQQQVVNLQAQLASLKEQAA  110



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1985022489692