BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18963_g2_i1 len=1015 path=[3459:0-480 2682:481-718 1906:719-765
1953:766-789 4615:790-1014]

Length=1015
                                                                      Score     E

ref|XP_009604912.1|  PREDICTED: LOB domain-containing protein 30-...    298   4e-96   
ref|XP_009795320.1|  PREDICTED: LOB domain-containing protein 30        293   5e-94   
emb|CDP17781.1|  unnamed protein product                                282   3e-90   
gb|KHG13125.1|  LOB domain-containing 18 -like protein                  278   1e-88   
ref|XP_006445237.1|  hypothetical protein CICLE_v10021992mg             277   1e-88   
ref|XP_006339770.1|  PREDICTED: LOB domain-containing protein 18-...    277   5e-88   
ref|XP_002301295.2|  hypothetical protein POPTR_0002s15000g             271   3e-86   Populus trichocarpa [western balsam poplar]
ref|XP_003521944.1|  PREDICTED: LOB domain-containing protein 18-...    272   4e-86   
ref|XP_011017499.1|  PREDICTED: LOB domain-containing protein 18-...    269   3e-85   
gb|KDP28744.1|  hypothetical protein JCGZ_14515                         268   1e-84   
ref|XP_003517057.1|  PREDICTED: LOB domain-containing protein 18-...    265   2e-83   
ref|XP_002511730.1|  LOB domain-containing protein, putative            264   4e-83   Ricinus communis
ref|XP_010692269.1|  PREDICTED: LOB domain-containing protein 18        263   5e-83   
ref|XP_004231166.1|  PREDICTED: LOB domain-containing protein 30        262   4e-82   
ref|XP_002279521.1|  PREDICTED: LOB domain-containing protein 18        259   2e-81   Vitis vinifera
ref|XP_004145058.1|  PREDICTED: LOB domain-containing protein 18-...    259   3e-81   
emb|CBI38861.3|  unnamed protein product                                259   4e-81   
ref|XP_011093197.1|  PREDICTED: LOB domain-containing protein 18-...    257   1e-80   
ref|XP_010092844.1|  hypothetical protein L484_022439                   254   2e-79   
gb|KHM98881.1|  LOB domain-containing protein 18                        253   4e-79   
ref|XP_009379266.1|  PREDICTED: LOB domain-containing protein 18        253   7e-79   
ref|XP_008232676.1|  PREDICTED: LOB domain-containing protein 18        253   8e-79   
ref|XP_010056297.1|  PREDICTED: LOB domain-containing protein 18-...    253   8e-79   
ref|XP_007218850.1|  hypothetical protein PRUPE_ppa010383mg             253   8e-79   
ref|XP_011034497.1|  PREDICTED: LOW QUALITY PROTEIN: LOB domain-c...    249   3e-77   
ref|XP_002320063.1|  LOB domain protein 18                              248   4e-77   Populus trichocarpa [western balsam poplar]
ref|XP_008343190.1|  PREDICTED: LOB domain-containing protein 30        248   5e-77   
ref|XP_010508173.1|  PREDICTED: LOB domain-containing protein 18        248   6e-77   
ref|XP_010276364.1|  PREDICTED: LOB domain-containing protein 30-...    247   2e-76   
ref|XP_009142334.1|  PREDICTED: LOB domain-containing protein 18-...    246   5e-76   
emb|CDY57109.1|  BnaC04g56960D                                          246   5e-76   
ref|XP_004306912.1|  PREDICTED: LOB domain-containing protein 30-...    245   8e-76   
emb|CDY68635.1|  BnaAnng27870D                                          244   2e-75   
ref|XP_010506484.1|  PREDICTED: LOB domain-containing protein 18        244   3e-75   
ref|XP_010906049.1|  PREDICTED: LOB domain-containing protein 18-...    243   3e-75   
ref|XP_006397723.1|  hypothetical protein EUTSA_v10001791mg             244   3e-75   
ref|XP_010917989.1|  PREDICTED: LOB domain-containing protein 18-...    241   3e-74   
ref|XP_004510942.1|  PREDICTED: LOB domain-containing protein 18-...    240   5e-74   
ref|XP_008798540.1|  PREDICTED: LOB domain-containing protein 18        240   6e-74   
ref|XP_006295913.1|  hypothetical protein CARUB_v10025050mg             240   8e-74   
ref|NP_850436.1|  LOB domain-containing protein 18                      240   9e-74   Arabidopsis thaliana [mouse-ear cress]
gb|KEH19039.1|  LOB domain protein                                      238   2e-73   
ref|XP_008776002.1|  PREDICTED: LOB domain-containing protein 18-...    235   4e-72   
ref|XP_010228877.1|  PREDICTED: LOB domain-containing protein 30-...    235   1e-71   
ref|XP_002880178.1|  hypothetical protein ARALYDRAFT_483677             234   2e-71   
ref|XP_010277398.1|  PREDICTED: LOB domain-containing protein 30-...    234   2e-71   
ref|XP_003534608.1|  PREDICTED: LOB domain-containing protein 18-...    233   4e-71   
emb|CDY18932.1|  BnaC04g04180D                                          232   9e-71   
ref|XP_007139994.1|  hypothetical protein PHAVU_008G075900g             231   1e-70   
ref|XP_009400358.1|  PREDICTED: LOB domain-containing protein 18-...    230   3e-70   
gb|KFK37335.1|  hypothetical protein AALP_AA4G243200                    229   1e-69   
ref|XP_009391108.1|  PREDICTED: LOB domain-containing protein 18-...    228   2e-69   
ref|XP_009143140.1|  PREDICTED: LOB domain-containing protein 18        228   3e-69   
ref|XP_003552342.1|  PREDICTED: LOB domain-containing protein 18-...    228   4e-69   
ref|XP_006288584.1|  hypothetical protein CARUB_v10001875mg             223   2e-67   
ref|NP_001132370.1|  putative LOB domain-containing family protein      223   4e-67   Zea mays [maize]
ref|XP_006649734.1|  PREDICTED: LOB domain-containing protein 18-...    223   4e-67   
ref|NP_001167808.1|  uncharacterized protein LOC100381506               223   4e-67   Zea mays [maize]
ref|XP_010053892.1|  PREDICTED: LOB domain-containing protein 30-...    221   2e-66   
gb|ABK28616.1|  unknown                                                 220   2e-66   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191933.1|  protein JAGGED LATERAL ORGANS                         220   3e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004985011.1|  PREDICTED: LOB domain-containing protein 18-...    221   3e-66   
ref|XP_002875043.1|  LOB domain protein 30                              219   6e-66   
ref|NP_001049546.1|  Os03g0246900                                       220   9e-66   Oryza sativa Japonica Group [Japonica rice]
gb|EAY89242.1|  hypothetical protein OsI_10739                          220   1e-65   Oryza sativa Indica Group [Indian rice]
ref|XP_007052036.1|  LOB domain-containing protein 18, putative         220   2e-65   
ref|XP_010544656.1|  PREDICTED: LOB domain-containing protein 18-...    218   2e-65   
ref|XP_002465559.1|  hypothetical protein SORBIDRAFT_01g041130          219   2e-65   Sorghum bicolor [broomcorn]
gb|EYU30570.1|  hypothetical protein MIMGU_mgv1a013332mg                216   6e-65   
ref|XP_010426737.1|  PREDICTED: LOB domain-containing protein 30        215   2e-64   
ref|XP_009386566.1|  PREDICTED: LOB domain-containing protein 30-...    213   2e-63   
ref|XP_010456310.1|  PREDICTED: LOB domain-containing protein 30-...    212   2e-63   
ref|XP_010544655.1|  PREDICTED: LOB domain-containing protein 18-...    213   2e-63   
ref|XP_009111504.1|  PREDICTED: LOB domain-containing protein 30        211   6e-63   
ref|XP_009389181.1|  PREDICTED: LOB domain-containing protein 18-...    211   1e-62   
ref|XP_006396221.1|  hypothetical protein EUTSA_v10028937mg             209   6e-62   
ref|XP_004986691.1|  PREDICTED: LOB domain-containing protein 18-...    209   9e-62   
ref|XP_004492639.1|  PREDICTED: LOB domain-containing protein 18-...    207   1e-61   
ref|XP_006662199.1|  PREDICTED: LOB domain-containing protein 18-...    205   3e-60   
gb|EPS64174.1|  hypothetical protein M569_10607                         201   4e-60   
ref|XP_006851815.1|  hypothetical protein AMTR_s00041p00044170          204   4e-60   
ref|XP_009128476.1|  PREDICTED: LOB domain-containing protein 30-...    204   4e-60   
emb|CDY54923.1|  BnaAnng13580D                                          204   4e-60   
gb|KFK30604.1|  hypothetical protein AALP_AA6G003400                    203   7e-60   
ref|XP_003623721.1|  LOB domain-containing protein                      203   1e-59   
ref|XP_011094569.1|  PREDICTED: LOB domain-containing protein 18        199   3e-59   
ref|XP_002467307.1|  hypothetical protein SORBIDRAFT_01g024400          202   8e-59   Sorghum bicolor [broomcorn]
emb|CDY69735.1|  BnaCnng65080D                                          200   1e-58   
ref|NP_001176038.1|  Os10g0162600                                       201   2e-58   
gb|EAY77788.1|  hypothetical protein OsI_32828                          201   2e-58   Oryza sativa Indica Group [Indian rice]
ref|XP_010523689.1|  PREDICTED: LOB domain-containing protein 18-...    197   2e-57   
ref|XP_008659582.1|  PREDICTED: LOB domain-containing protein 30-...    196   5e-57   
ref|XP_003571705.1|  PREDICTED: LOB domain-containing protein 30-...    195   2e-56   
gb|EMS62575.1|  hypothetical protein TRIUR3_25587                       192   2e-55   
ref|XP_010276387.1|  PREDICTED: LOB domain-containing protein 19-...    191   3e-55   
ref|XP_004134346.1|  PREDICTED: LOB domain-containing protein 18-...    191   3e-55   
ref|XP_010277396.1|  PREDICTED: LOB domain-containing protein 19-...    189   7e-55   
ref|XP_008438149.1|  PREDICTED: LOB domain-containing protein 18        190   9e-55   
ref|XP_004155866.1|  PREDICTED: LOB domain-containing protein 18-...    191   4e-54   
gb|EMT10533.1|  hypothetical protein F775_04528                         186   3e-53   
ref|XP_003521945.2|  PREDICTED: LOB domain-containing protein 19-...    185   6e-53   
ref|XP_007220875.1|  hypothetical protein PRUPE_ppa017589mg             185   7e-53   
ref|XP_008232675.1|  PREDICTED: LOB domain-containing protein 19        184   1e-52   
ref|XP_002320729.2|  hypothetical protein POPTR_0014s06580g             183   1e-52   Populus trichocarpa [western balsam poplar]
ref|XP_004306913.1|  PREDICTED: LOB domain-containing protein 31-...    183   2e-52   
ref|XP_011090856.1|  PREDICTED: LOB domain-containing protein 19        183   2e-52   
ref|XP_002273687.2|  PREDICTED: LOB domain-containing protein 19        182   3e-52   Vitis vinifera
ref|XP_007052037.1|  LOB domain-containing protein 31                   182   5e-52   
gb|EAZ15392.1|  hypothetical protein OsJ_30803                          182   6e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011034467.1|  PREDICTED: LOB domain-containing protein 19        181   6e-52   
gb|KHG05660.1|  LOB domain-containing 19 -like protein                  181   7e-52   
ref|XP_009803301.1|  PREDICTED: LOB domain-containing protein 19-...    182   7e-52   
ref|XP_010092842.1|  hypothetical protein L484_022437                   183   7e-52   
ref|XP_009379264.1|  PREDICTED: LOB domain-containing protein 19        182   8e-52   
ref|XP_007134896.1|  hypothetical protein PHAVU_010G084900g             182   8e-52   
ref|XP_002302539.1|  hypothetical protein POPTR_0002s14970g             181   1e-51   Populus trichocarpa [western balsam poplar]
ref|XP_009628901.1|  PREDICTED: LOB domain-containing protein 19-...    181   2e-51   
ref|XP_006490937.1|  PREDICTED: LOB domain-containing protein 31-...    181   2e-51   
ref|XP_006445238.1|  hypothetical protein CICLE_v10022291mg             181   2e-51   
ref|XP_008345767.1|  PREDICTED: LOB domain-containing protein 19        181   3e-51   
ref|XP_002511729.1|  LOB domain-containing protein, putative            179   4e-51   Ricinus communis
ref|XP_009347042.1|  PREDICTED: LOB domain-containing protein 19-...    180   7e-51   
ref|XP_011017497.1|  PREDICTED: LOB domain-containing protein 19-...    179   7e-51   
ref|XP_010424034.1|  PREDICTED: LOB domain-containing protein 30-...    179   7e-51   
gb|KHN40140.1|  LOB domain-containing protein 31                        179   8e-51   
gb|EYU32001.1|  hypothetical protein MIMGU_mgv1a024257mg                179   1e-50   
gb|ACJ85221.1|  unknown                                                 179   2e-50   Medicago truncatula
ref|XP_009789949.1|  PREDICTED: LOB domain-containing protein 19        176   2e-50   
ref|XP_010056298.1|  PREDICTED: LOB domain-containing protein 19        177   9e-50   
emb|CDP17780.1|  unnamed protein product                                176   1e-49   
ref|XP_009398866.1|  PREDICTED: LOB domain-containing protein 30-...    178   2e-49   
ref|XP_009604914.1|  PREDICTED: LOB domain-containing protein 19-...    174   2e-49   
ref|XP_010692268.1|  PREDICTED: LOB domain-containing protein 19        176   2e-49   
ref|XP_006339769.1|  PREDICTED: LOB domain-containing protein 18-...    174   2e-49   
ref|XP_008460130.1|  PREDICTED: LOB domain-containing protein 19        176   3e-49   
ref|XP_004145059.1|  PREDICTED: LOB domain-containing protein 31-...    175   4e-49   
ref|XP_004510943.1|  PREDICTED: LOB domain-containing protein 31-...    175   5e-49   
ref|XP_008467063.1|  PREDICTED: LOB domain-containing protein 18-...    170   1e-48   
gb|KHN40565.1|  LOB domain-containing protein 16                        168   1e-47   
ref|NP_182065.1|  LOB domain-containing protein 19                      170   1e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006296305.1|  hypothetical protein CARUB_v10025477mg             170   2e-47   
ref|XP_010506483.1|  PREDICTED: LOB domain-containing protein 19        169   2e-47   
gb|ADE76152.1|  unknown                                                 170   4e-47   
gb|KDP28745.1|  hypothetical protein JCGZ_14516                         170   6e-47   
gb|EYU32002.1|  hypothetical protein MIMGU_mgv1a022726mg                166   6e-47   
ref|XP_006289084.1|  hypothetical protein CARUB_v10002489mg             169   8e-47   
ref|NP_191932.4|  LOB domain-containing protein 31                      169   9e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010512839.1|  PREDICTED: LOB domain-containing protein 19        167   2e-46   
ref|XP_001779579.1|  predicted protein                                  165   2e-46   
gb|KFK30603.1|  hypothetical protein AALP_AA6G003300                    168   2e-46   
ref|XP_006396220.1|  hypothetical protein EUTSA_v10028924mg             168   2e-46   
ref|XP_010918824.1|  PREDICTED: LOB domain-containing protein 14-...    168   3e-46   
ref|XP_001763572.1|  predicted protein                                  164   3e-46   
ref|XP_002882012.1|  predicted protein                                  167   3e-46   
ref|XP_010904567.1|  PREDICTED: LOB domain-containing protein 29-...    168   3e-46   
ref|XP_001772946.1|  predicted protein                                  162   8e-46   
ref|XP_008794315.1|  PREDICTED: LOB domain-containing protein 29-...    167   9e-46   
ref|XP_010426727.1|  PREDICTED: LOB domain-containing protein 31-...    166   9e-46   
ref|XP_010419557.1|  PREDICTED: LOB domain-containing protein 31-...    166   1e-45   
ref|XP_009142333.1|  PREDICTED: LOB domain-containing protein 19-...    164   1e-45   
ref|XP_002271115.1|  PREDICTED: LOB domain-containing protein 20        166   2e-45   Vitis vinifera
ref|XP_010413062.1|  PREDICTED: LOB domain-containing protein 18-...    164   2e-45   
ref|XP_010266765.1|  PREDICTED: LOB domain-containing protein 20        166   2e-45   
ref|XP_010524360.1|  PREDICTED: LOB domain-containing protein 19        165   2e-45   
ref|XP_010496906.1|  PREDICTED: LOB domain-containing protein 30-...    164   2e-45   
emb|CDY07237.1|  BnaCnng02520D                                          164   2e-45   
emb|CDY57108.1|  BnaC04g56950D                                          164   3e-45   
emb|CDY37038.1|  BnaA04g26160D                                          163   4e-45   
ref|XP_003536931.1|  PREDICTED: LOB domain-containing protein 29-...    165   4e-45   
ref|XP_009366531.1|  PREDICTED: LOB domain-containing protein 20-...    165   5e-45   
ref|XP_009111506.1|  PREDICTED: LOB domain-containing protein 31        164   6e-45   
emb|CBI31238.3|  unnamed protein product                                165   6e-45   
ref|XP_009353184.1|  PREDICTED: LOB domain-containing protein 20-...    165   6e-45   
ref|XP_001759142.1|  predicted protein                                  162   6e-45   
ref|XP_003623743.1|  LOB domain-containing protein                      163   6e-45   
gb|KEH23896.1|  LOB domain protein                                      164   7e-45   
ref|XP_007144924.1|  hypothetical protein PHAVU_007G195000g             164   7e-45   
ref|XP_003541340.1|  PREDICTED: LOB domain-containing protein 29-...    164   8e-45   
ref|XP_006397722.1|  hypothetical protein EUTSA_v10001778mg             162   1e-44   
ref|XP_004152037.1|  PREDICTED: LOB domain-containing protein 16-...    164   1e-44   
ref|XP_010274825.1|  PREDICTED: LOB domain-containing protein 29        164   1e-44   
gb|KGN57934.1|  hypothetical protein Csa_3G398920                       164   2e-44   
ref|XP_008787549.1|  PREDICTED: LOB domain-containing protein 14-...    164   2e-44   
emb|CDP03725.1|  unnamed protein product                                163   2e-44   
ref|XP_008391783.1|  PREDICTED: LOB domain-containing protein 20        164   2e-44   
ref|XP_008775957.1|  PREDICTED: LOB domain-containing protein 29-...    163   2e-44   
gb|KHN10727.1|  LOB domain-containing protein 29                        162   2e-44   
ref|XP_004136784.1|  PREDICTED: LOB domain-containing protein 20-...    162   2e-44   
ref|XP_010679216.1|  PREDICTED: LOB domain-containing protein 16-...    162   2e-44   
ref|XP_010262268.1|  PREDICTED: LOB domain-containing protein 29        163   3e-44   
emb|CDP18379.1|  unnamed protein product                                163   3e-44   
ref|XP_010918779.1|  PREDICTED: LOB domain-containing protein 16-...    161   3e-44   
ref|XP_007203508.1|  hypothetical protein PRUPE_ppa024802mg             164   3e-44   
ref|XP_007050346.1|  Lateral organ boundaries-domain 16                 162   3e-44   
ref|XP_008235713.1|  PREDICTED: LOB domain-containing protein 16        162   4e-44   
ref|XP_009398033.1|  PREDICTED: LOB domain-containing protein 29        162   4e-44   
emb|CAN75719.1|  hypothetical protein VITISV_037620                     162   5e-44   Vitis vinifera
gb|KEH42567.1|  lateral organ boundaries (LOB) domain protein           162   5e-44   
ref|XP_007199359.1|  hypothetical protein PRUPE_ppa025349mg             161   5e-44   
ref|XP_008244133.1|  PREDICTED: LOB domain-containing protein 20        163   5e-44   
ref|XP_004495114.1|  PREDICTED: LOB domain-containing protein 29-...    162   6e-44   
ref|XP_004289919.1|  PREDICTED: LOB domain-containing protein 16-...    161   6e-44   
gb|AGP76338.1|  ARL1                                                    158   6e-44   
ref|XP_010111894.1|  hypothetical protein L484_009778                   162   7e-44   
emb|CDY68561.1|  BnaCnng59550D                                          160   7e-44   
ref|XP_009617764.1|  PREDICTED: LOB domain-containing protein 29-...    162   8e-44   
ref|XP_010262592.1|  PREDICTED: LOB domain-containing protein 33-...    161   8e-44   
gb|KDO66074.1|  hypothetical protein CISIN_1g042813mg                   162   8e-44   
ref|XP_006443492.1|  hypothetical protein CICLE_v10021843mg             162   8e-44   
ref|XP_011080296.1|  PREDICTED: LOB domain-containing protein 29        161   8e-44   
ref|XP_009382150.1|  PREDICTED: LOB domain-containing protein 29-...    161   8e-44   
ref|XP_010935865.1|  PREDICTED: LOB domain-containing protein 29-...    162   9e-44   
ref|XP_004229819.1|  PREDICTED: LOB domain-containing protein 19        159   9e-44   
gb|KFK37334.1|  hypothetical protein AALP_AA4G243100                    161   9e-44   
ref|XP_002263533.1|  PREDICTED: LOB domain-containing protein 29        161   9e-44   Vitis vinifera
ref|NP_001106033.1|  rootless concerning crown and seminal roots1       162   9e-44   Zea mays [maize]
ref|XP_003554283.1|  PREDICTED: LOB domain-containing protein 16-...    161   9e-44   
ref|XP_002300786.2|  hypothetical protein POPTR_0002s04200g             161   1e-43   Populus trichocarpa [western balsam poplar]
ref|XP_006299263.1|  hypothetical protein CARUB_v10015417mg             162   1e-43   
gb|AGP76337.1|  ARL1                                                    157   1e-43   
gb|AGP76336.1|  ARL1                                                    157   1e-43   
ref|NP_187026.1|  LOB domain-containing protein 20                      162   1e-43   Arabidopsis thaliana [mouse-ear cress]
gb|KFK37803.1|  hypothetical protein AALP_AA3G031300                    162   1e-43   
ref|XP_011028777.1|  PREDICTED: LOB domain-containing protein 29        160   1e-43   
ref|XP_009102075.1|  PREDICTED: LOB domain-containing protein 20-...    162   1e-43   
gb|AFK37396.1|  unknown                                                 161   1e-43   
ref|XP_009771981.1|  PREDICTED: LOB domain-containing protein 14-...    161   1e-43   
ref|XP_002263559.1|  PREDICTED: LOB domain-containing protein 16        160   1e-43   Vitis vinifera
emb|CDY29956.1|  BnaC01g40520D                                          162   2e-43   
gb|AGP76326.1|  ARL1                                                    157   2e-43   
gb|EYU46475.1|  hypothetical protein MIMGU_mgv1a026613mg                161   2e-43   
gb|KDP39658.1|  hypothetical protein JCGZ_02678                         161   2e-43   
ref|XP_006351689.1|  PREDICTED: LOB domain-containing protein 29-...    161   2e-43   
ref|XP_006659712.1|  PREDICTED: LOB domain-containing protein 17-...    160   2e-43   
ref|XP_009617763.1|  PREDICTED: LOB domain-containing protein 16-...    160   2e-43   
ref|XP_002882305.1|  LOB domain protein 20                              162   2e-43   
ref|XP_002465851.1|  hypothetical protein SORBIDRAFT_01g046990          160   2e-43   Sorghum bicolor [broomcorn]
ref|XP_007030005.1|  LOB domain-containing protein 20                   160   2e-43   
ref|XP_010485728.1|  PREDICTED: LOB domain-containing protein 20        161   2e-43   
ref|XP_010513804.1|  PREDICTED: LOB domain-containing protein 20-...    162   2e-43   
emb|CDY47969.1|  BnaA04g24470D                                          160   2e-43   
ref|XP_002534416.1|  LOB domain-containing protein, putative            160   2e-43   Ricinus communis
ref|XP_004493763.1|  PREDICTED: LOB domain-containing protein 16-...    160   2e-43   
ref|XP_007199390.1|  hypothetical protein PRUPE_ppa025889mg             160   3e-43   
ref|NP_001062526.1|  Os08g0563400                                       160   3e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003536930.1|  PREDICTED: LOB domain-containing protein 16-...    159   3e-43   
ref|XP_004493764.1|  PREDICTED: LOB domain-containing protein 29-...    159   3e-43   
ref|XP_002525698.1|  LOB domain-containing protein, putative            160   3e-43   Ricinus communis
ref|XP_011070190.1|  PREDICTED: LOB domain-containing protein 20        160   3e-43   
ref|XP_008443307.1|  PREDICTED: LOB domain-containing protein 20        160   3e-43   
ref|XP_007162526.1|  hypothetical protein PHAVU_001G159400g             160   3e-43   
ref|XP_010679217.1|  PREDICTED: LOB domain-containing protein 29        160   3e-43   
ref|XP_006411500.1|  hypothetical protein EUTSA_v10017158mg             160   3e-43   
ref|XP_008461877.1|  PREDICTED: LOB domain-containing protein 16        160   3e-43   
emb|CDY14831.1|  BnaC04g48280D                                          160   3e-43   
gb|KCW49803.1|  hypothetical protein EUGRSUZ_K03284                     160   4e-43   
ref|XP_002302057.1|  LOB domain protein 16                              159   4e-43   Populus trichocarpa [western balsam poplar]
ref|XP_009616196.1|  PREDICTED: LOB domain-containing protein 20        160   4e-43   
ref|XP_010677793.1|  PREDICTED: LOB domain-containing protein 20        160   4e-43   
ref|XP_003521280.1|  PREDICTED: LOB domain-containing protein 16-...    159   5e-43   
ref|XP_010522164.1|  PREDICTED: LOB domain-containing protein 29        158   5e-43   
ref|XP_009781596.1|  PREDICTED: LOB domain-containing protein 16        159   5e-43   
ref|XP_006649406.1|  PREDICTED: LOB domain-containing protein 6-like    160   5e-43   
ref|XP_006408269.1|  hypothetical protein EUTSA_v10021301mg             161   5e-43   
ref|XP_011026012.1|  PREDICTED: LOB domain-containing protein 16        159   5e-43   
ref|XP_006435636.1|  hypothetical protein CICLE_v10033354mg             159   5e-43   
gb|KDO68482.1|  hypothetical protein CISIN_1g027399mg                   159   5e-43   
ref|XP_009133536.1|  PREDICTED: LOB domain-containing protein 16-...    160   5e-43   
gb|EYU17906.1|  hypothetical protein MIMGU_mgv1a020441mg                160   5e-43   
ref|XP_002444564.1|  hypothetical protein SORBIDRAFT_07g023810          159   5e-43   Sorghum bicolor [broomcorn]
ref|XP_002521022.1|  LOB domain-containing protein, putative            159   5e-43   Ricinus communis
ref|XP_004985692.1|  PREDICTED: LOB domain-containing protein 16-...    159   5e-43   
ref|XP_004974249.1|  PREDICTED: LOB domain-containing protein 29-...    159   5e-43   
ref|XP_007162525.1|  hypothetical protein PHAVU_001G159300g             159   5e-43   
ref|XP_002306833.1|  LOB domain protein 16                              159   5e-43   Populus trichocarpa [western balsam poplar]
ref|XP_009779769.1|  PREDICTED: LOB domain-containing protein 20        160   5e-43   
ref|XP_011028776.1|  PREDICTED: LOB domain-containing protein 16-...    159   6e-43   
ref|XP_008235796.1|  PREDICTED: LOB domain-containing protein 29-...    159   6e-43   
ref|XP_002319718.2|  hypothetical protein POPTR_0013s06070g             159   6e-43   Populus trichocarpa [western balsam poplar]
ref|XP_004492662.1|  PREDICTED: LOW QUALITY PROTEIN: LOB domain-c...    158   6e-43   
ref|XP_006443870.1|  hypothetical protein CICLE_v10023341mg             159   6e-43   
ref|XP_010517768.1|  PREDICTED: LOB domain-containing protein 16-...    159   6e-43   
gb|EEC74526.1|  hypothetical protein OsI_10033                          160   7e-43   
ref|NP_001173268.1|  Os03g0149100                                       160   7e-43   
ref|XP_010463835.1|  PREDICTED: LOB domain-containing protein 20-...    160   7e-43   
ref|XP_009367705.1|  PREDICTED: LOB domain-containing protein 16        158   7e-43   
ref|XP_009420450.1|  PREDICTED: LOB domain-containing protein 29-...    159   7e-43   
gb|ACG45473.1|  ramosa 2                                                159   7e-43   
emb|CDP03724.1|  unnamed protein product                                158   8e-43   
gb|KFK37092.1|  hypothetical protein AALP_AA4G212100                    159   8e-43   
gb|AGP76327.1|  ARL1                                                    155   8e-43   
ref|XP_002872962.1|  LOB domain protein 31                              158   9e-43   
emb|CDX74209.1|  BnaA03g28380D                                          160   9e-43   
ref|XP_004247346.1|  PREDICTED: LOB domain-containing protein 29        159   9e-43   
gb|KHN02521.1|  LOB domain-containing protein 29                        158   9e-43   
ref|XP_010523197.1|  PREDICTED: LOB domain-containing protein 31        157   1e-42   
gb|EAZ25592.1|  hypothetical protein OsJ_09419                          159   1e-42   
ref|XP_009354924.1|  PREDICTED: LOB domain-containing protein 16-...    159   1e-42   
ref|XP_010506068.1|  PREDICTED: LOB domain-containing protein 16 ...    159   1e-42   
ref|XP_002879985.1|  hypothetical protein ARALYDRAFT_903598             159   1e-42   
ref|XP_002316271.1|  LOB domain protein 33                              158   1e-42   
ref|NP_191378.1|  protein ASYMMETRIC LEAVES 2-LIKE 16                   158   1e-42   
ref|XP_008787394.1|  PREDICTED: LOB domain-containing protein 16-...    157   1e-42   
ref|XP_011083017.1|  PREDICTED: LOB domain-containing protein 16-...    157   1e-42   
ref|XP_009142837.1|  PREDICTED: LOB domain-containing protein 16        159   1e-42   
gb|KDP21329.1|  hypothetical protein JCGZ_21800                         158   1e-42   
ref|XP_009367776.1|  PREDICTED: LOB domain-containing protein 14-...    159   1e-42   
ref|XP_003573219.1|  PREDICTED: LOB domain-containing protein 29-...    157   2e-42   
gb|KHN03863.1|  LOB domain-containing protein 16                        159   2e-42   
ref|XP_006443871.1|  hypothetical protein CICLE_v10024416mg             157   2e-42   
ref|XP_011002633.1|  PREDICTED: LOB domain-containing protein 29-...    158   2e-42   
gb|KEH23888.1|  LOB domain protein                                      158   2e-42   
ref|XP_010111895.1|  hypothetical protein L484_009779                   158   2e-42   
ref|XP_006347838.1|  PREDICTED: LOB domain-containing protein 20-...    158   2e-42   
ref|XP_009591020.1|  PREDICTED: LOB domain-containing protein 16-...    157   2e-42   
gb|KDO68483.1|  hypothetical protein CISIN_1g040761mg                   157   2e-42   
ref|NP_565973.1|  LOB domain-containing protein 16                      158   2e-42   
gb|EYU30336.1|  hypothetical protein MIMGU_mgv1a012147mg                159   2e-42   
gb|KCW47777.1|  hypothetical protein EUGRSUZ_K01522                     158   2e-42   
gb|KDP26558.1|  hypothetical protein JCGZ_17716                         157   2e-42   
ref|XP_010549704.1|  PREDICTED: LOB domain-containing protein 20        159   2e-42   
ref|XP_009143138.1|  PREDICTED: LOB domain-containing protein 19-...    157   2e-42   
ref|XP_009142063.1|  PREDICTED: LOB domain-containing protein 16-...    158   2e-42   
ref|XP_004289920.1|  PREDICTED: LOB domain-containing protein 17-...    157   2e-42   
emb|CDY22562.1|  BnaC03g23720D                                          158   2e-42   
emb|CDX92049.1|  BnaC03g33510D                                          159   2e-42   
emb|CDY64515.1|  BnaC04g52730D                                          158   2e-42   
ref|XP_010036253.1|  PREDICTED: LOB domain-containing protein 20        158   2e-42   
ref|XP_006296375.1|  hypothetical protein CARUB_v10025548mg             158   3e-42   
gb|KHG26762.1|  LOB domain-containing 20 -like protein                  158   3e-42   
ref|XP_010039047.1|  PREDICTED: LOB domain-containing protein 29-...    157   3e-42   
ref|XP_007144925.1|  hypothetical protein PHAVU_007G195100g             157   3e-42   
gb|KHN44982.1|  LOB domain-containing protein 16                        157   4e-42   
ref|XP_010427729.1|  PREDICTED: LOB domain-containing protein 29        157   4e-42   
ref|XP_010935757.1|  PREDICTED: LOB domain-containing protein 16-...    156   4e-42   
ref|XP_009386252.1|  PREDICTED: LOB domain-containing protein 29-...    157   4e-42   
ref|XP_010516469.1|  PREDICTED: LOB domain-containing protein 29-...    157   4e-42   
ref|XP_006292973.1|  hypothetical protein CARUB_v10019250mg             157   4e-42   
ref|XP_010508576.1|  PREDICTED: LOB domain-containing protein 16-...    157   4e-42   
ref|XP_010504778.1|  PREDICTED: LOB domain-containing protein 29-...    157   5e-42   
ref|XP_002878193.1|  lateral organ boundaries-domain 29, lob doma...    156   6e-42   
ref|XP_003541339.1|  PREDICTED: LOB domain-containing protein 16-...    156   6e-42   
ref|XP_011080023.1|  PREDICTED: LOB domain-containing protein 16-...    155   6e-42   
ref|XP_004231253.1|  PREDICTED: LOB domain-containing protein 20        157   6e-42   
ref|XP_002277994.1|  PREDICTED: LOB domain-containing protein 33        156   7e-42   
emb|CDY70198.1|  BnaAnng32930D                                          157   7e-42   
gb|AGP76333.1|  ARL1                                                    152   8e-42   
gb|AGP76332.1|  ARL1                                                    152   8e-42   
ref|XP_008794314.1|  PREDICTED: LOB domain-containing protein 16-...    155   8e-42   
ref|XP_010067432.1|  PREDICTED: LOB domain-containing protein 29        156   8e-42   
ref|XP_010039235.1|  PREDICTED: LOB domain-containing protein 16        158   9e-42   
ref|XP_008447445.1|  PREDICTED: LOB domain-containing protein 29-...    156   9e-42   
ref|XP_009413156.1|  PREDICTED: LOB domain-containing protein 14-...    156   9e-42   
ref|XP_004152038.1|  PREDICTED: LOB domain-containing protein 29-...    156   1e-41   
ref|XP_003562079.1|  PREDICTED: LOB domain-containing protein 6-like    156   1e-41   
gb|AFP44688.1|  hypothetical protein                                    158   1e-41   
ref|XP_010911440.1|  PREDICTED: LOB domain-containing protein 20        155   1e-41   
ref|XP_008801296.1|  PREDICTED: LOB domain-containing protein 16-...    154   1e-41   
gb|KHN25184.1|  LOB domain-containing protein 20                        156   1e-41   
ref|XP_010524042.1|  PREDICTED: LOB domain-containing protein 29-...    156   1e-41   
ref|XP_004289921.1|  PREDICTED: LOB domain-containing protein 29-...    154   1e-41   
ref|XP_011034296.1|  PREDICTED: LOB domain-containing protein 20        155   2e-41   
ref|XP_003518033.2|  PREDICTED: LOB domain-containing protein 20-...    155   2e-41   
ref|XP_010933093.1|  PREDICTED: LOB domain-containing protein 16-...    154   2e-41   
gb|EPS72981.1|  hypothetical protein M569_01776                         152   2e-41   
ref|XP_010524910.1|  PREDICTED: LOB domain-containing protein 29-...    155   2e-41   
ref|XP_008777051.1|  PREDICTED: LOB domain-containing protein 20        155   3e-41   
gb|AAC19294.1|  F6N15.25 gene product                                   154   3e-41   
ref|XP_009777806.1|  PREDICTED: LOB domain-containing protein 16-...    153   3e-41   
gb|KHN05749.1|  LOB domain-containing protein 20                        154   4e-41   
dbj|BAJ99718.1|  predicted protein                                      154   4e-41   
gb|AFK41082.1|  unknown                                                 154   4e-41   
ref|XP_003553372.1|  PREDICTED: LOB domain-containing protein 20-...    155   4e-41   
ref|XP_006402799.1|  hypothetical protein EUTSA_v10006226mg             154   4e-41   
ref|XP_009354925.1|  PREDICTED: LOB domain-containing protein 29-...    154   5e-41   
ref|XP_003537147.1|  PREDICTED: LOB domain-containing protein 20-...    154   5e-41   
gb|KHN34589.1|  LOB domain-containing protein 20                        154   5e-41   
ref|XP_009394732.1|  PREDICTED: LOB domain-containing protein 29        154   5e-41   
ref|XP_008385141.1|  PREDICTED: LOB domain-containing protein 29-...    154   7e-41   
ref|XP_007200091.1|  hypothetical protein PRUPE_ppa019939mg             153   7e-41   
ref|XP_008235795.1|  PREDICTED: LOB domain-containing protein 29-...    153   7e-41   
ref|XP_006351642.1|  PREDICTED: LOB domain-containing protein 16-...    153   8e-41   
ref|XP_009138972.1|  PREDICTED: LOB domain-containing protein 29        153   8e-41   
emb|CDX71962.1|  BnaC08g29120D                                          153   8e-41   
ref|XP_004309740.1|  PREDICTED: LOB domain-containing protein 20-...    154   8e-41   
ref|XP_004163162.1|  PREDICTED: LOB domain-containing protein 29-...    152   9e-41   
ref|XP_004150342.1|  PREDICTED: LOB domain-containing protein 29-...    152   1e-40   
ref|XP_006588674.1|  PREDICTED: LOB domain-containing protein 16-...    152   1e-40   
gb|KDP44920.1|  hypothetical protein JCGZ_01420                         153   1e-40   
emb|CDY06048.1|  BnaA09g37320D                                          153   1e-40   
ref|NP_001048543.1|  Os02g0820500                                       152   1e-40   
gb|EMS57434.1|  hypothetical protein TRIUR3_01477                       152   1e-40   
ref|XP_007009269.1|  LOB domain-containing protein 29                   152   2e-40   
ref|XP_010524043.1|  PREDICTED: LOB domain-containing protein 16        152   2e-40   
emb|CDY00547.1|  BnaC04g23780D                                          152   2e-40   
ref|XP_010524923.1|  PREDICTED: LOB domain-containing protein 16-...    152   2e-40   
emb|CDX88974.1|  BnaA04g02120D                                          152   2e-40   
ref|XP_006648133.1|  PREDICTED: LOB domain-containing protein 16-...    152   2e-40   
ref|XP_010326442.1|  PREDICTED: LOB domain-containing protein 16-...    152   2e-40   
gb|EMT05213.1|  hypothetical protein F775_22967                         152   3e-40   
ref|XP_004160273.1|  PREDICTED: LOW QUALITY PROTEIN: LOB domain-c...    152   3e-40   
gb|EAZ25108.1|  hypothetical protein OsJ_08903                          151   4e-40   
ref|NP_001238198.1|  uncharacterized protein LOC100527324               151   4e-40   
ref|XP_001760316.1|  predicted protein                                  147   5e-40   
gb|EMT14513.1|  hypothetical protein F775_02052                         151   5e-40   
gb|EMS59302.1|  hypothetical protein TRIUR3_07751                       150   6e-40   
ref|XP_003572959.1|  PREDICTED: LOB domain-containing protein 16        150   6e-40   
ref|XP_002873236.1|  predicted protein                                  150   7e-40   
ref|XP_008679157.1|  PREDICTED: LOB domain-containing protein 16-...    150   7e-40   
emb|CDY14832.1|  BnaC04g48290D                                          150   8e-40   
gb|KDO85851.1|  hypothetical protein CISIN_1g041368mg                   147   8e-40   
ref|XP_006289422.1|  hypothetical protein CARUB_v10002921mg             150   8e-40   
ref|XP_006411501.1|  hypothetical protein EUTSA_v10017903mg             150   9e-40   
ref|XP_002454795.1|  hypothetical protein SORBIDRAFT_04g037550          150   9e-40   
gb|KFK25000.1|  hypothetical protein AALP_AA8G053400                    149   9e-40   
emb|CDY47970.1|  BnaA04g24480D                                          152   1e-39   
ref|NP_196226.1|  LOB domain-containing protein 33                      149   1e-39   
ref|XP_007050344.1|  Lateral organ boundaries domain family protein     151   1e-39   
ref|XP_009392817.1|  PREDICTED: LOB domain-containing protein 16-...    149   1e-39   
ref|XP_010256834.1|  PREDICTED: LOB domain-containing protein 29-...    150   2e-39   
ref|XP_009388133.1|  PREDICTED: LOB domain-containing protein 29-...    150   2e-39   
ref|XP_009142064.1|  PREDICTED: LOB domain-containing protein 17        149   2e-39   
ref|XP_010516468.1|  PREDICTED: LOB domain-containing protein 16-...    149   2e-39   
emb|CDX98901.1|  BnaC09g49340D                                          148   3e-39   
ref|XP_008447245.1|  PREDICTED: LOB domain-containing protein 29        148   3e-39   
emb|CDY35378.1|  BnaA03g19820D                                          145   3e-39   
ref|NP_001106034.1|  RTCS-like1                                         149   3e-39   
ref|XP_010504777.1|  PREDICTED: LOB domain-containing protein 16-...    149   3e-39   
ref|XP_010427728.1|  PREDICTED: LOB domain-containing protein 16-...    149   4e-39   
ref|NP_850370.4|  LOB domain-containing protein 17                      149   4e-39   
ref|XP_007151760.1|  hypothetical protein PHAVU_004G072500g             149   4e-39   
tpg|DAA43384.1|  TPA: rootless concerning crown and seminal roots1      149   4e-39   
ref|XP_006410263.1|  hypothetical protein EUTSA_v10017299mg             147   4e-39   
gb|ABO21030.1|  rootless concerning crown and seminal lateral roots     149   4e-39   
ref|XP_004954418.1|  PREDICTED: LOB domain-containing protein 16-...    149   4e-39   
ref|XP_009122213.1|  PREDICTED: LOB domain-containing protein 33        147   5e-39   
ref|XP_010506070.1|  PREDICTED: LOB domain-containing protein 17-...    149   5e-39   
ref|XP_010508574.1|  PREDICTED: LOB domain-containing protein 17-...    149   6e-39   
emb|CDY60434.1|  BnaA10g30420D                                          147   6e-39   
ref|XP_006402800.1|  hypothetical protein EUTSA_v10006423mg             147   6e-39   
ref|XP_002524207.1|  LOB domain-containing protein, putative            148   6e-39   
ref|XP_004242534.1|  PREDICTED: LOB domain-containing protein 16        147   8e-39   
ref|XP_006292407.1|  hypothetical protein CARUB_v10018619mg             148   9e-39   
ref|XP_009354970.1|  PREDICTED: LOB domain-containing protein 29-...    147   1e-38   
ref|XP_006486402.1|  PREDICTED: LOB domain-containing protein 33-...    144   1e-38   
ref|XP_008461694.1|  PREDICTED: LOB domain-containing protein 33-...    147   2e-38   
ref|XP_010543775.1|  PREDICTED: LOB domain-containing protein 33-...    147   2e-38   
ref|XP_009400671.1|  PREDICTED: LOB domain-containing protein 16-...    146   2e-38   
ref|XP_004489657.1|  PREDICTED: LOB domain-containing protein 20-...    147   2e-38   
ref|XP_010517770.1|  PREDICTED: LOB domain-containing protein 17-...    148   2e-38   
ref|XP_010491153.1|  PREDICTED: LOB domain-containing protein 33-...    145   2e-38   
ref|XP_010111893.1|  hypothetical protein L484_009777                   145   3e-38   
gb|KEH42569.1|  LOB domain protein                                      146   3e-38   
ref|XP_009398387.1|  PREDICTED: LOB domain-containing protein 17-...    146   3e-38   
ref|XP_010452521.1|  PREDICTED: LOB domain-containing protein 33-...    145   3e-38   
ref|XP_006352833.1|  PREDICTED: LOB domain-containing protein 16-...    145   3e-38   
ref|XP_010423390.1|  PREDICTED: LOB domain-containing protein 33        145   4e-38   
ref|XP_001775373.1|  predicted protein                                  142   4e-38   
emb|CDY24760.1|  BnaC04g13650D                                          145   4e-38   
gb|AAN87738.1|  Hypothetical protein                                    148   4e-38   
ref|XP_002881844.1|  hypothetical protein ARALYDRAFT_346041             147   4e-38   
ref|XP_009144227.1|  PREDICTED: LOB domain-containing protein 14        145   5e-38   
ref|XP_011076841.1|  PREDICTED: LOB domain-containing protein 25-...    146   5e-38   
ref|XP_010473920.1|  PREDICTED: LOB domain-containing protein 14        145   6e-38   
ref|XP_011017498.1|  PREDICTED: LOB domain-containing protein 19-...    142   7e-38   
ref|XP_006596617.1|  PREDICTED: LOB domain-containing protein 33-...    145   8e-38   
gb|KHN20912.1|  LOB domain-containing protein 33                        145   8e-38   
emb|CDY15375.1|  BnaC04g42480D                                          144   1e-37   
ref|XP_008382885.1|  PREDICTED: LOB domain-containing protein 29-...    144   1e-37   
ref|XP_009116510.1|  PREDICTED: LOB domain-containing protein 29-...    145   1e-37   
ref|XP_007141403.1|  hypothetical protein PHAVU_008G192500g             145   1e-37   
gb|KHN45191.1|  LOB domain-containing protein 16                        145   1e-37   
ref|NP_180689.1|  LOB domain-containing protein 14                      144   1e-37   
ref|XP_010510211.1|  PREDICTED: LOB domain-containing protein 14        144   1e-37   
ref|XP_010096608.1|  hypothetical protein L484_025355                   145   2e-37   
ref|XP_008233676.1|  PREDICTED: LOB domain-containing protein 33        144   2e-37   
ref|XP_007221130.1|  hypothetical protein PRUPE_ppa018815mg             144   2e-37   
ref|XP_009345549.1|  PREDICTED: LOB domain-containing protein 33-...    144   2e-37   
ref|XP_009141174.1|  PREDICTED: LOB domain-containing protein 14-...    143   2e-37   
gb|EYU19933.1|  hypothetical protein MIMGU_mgv1a022039mg                144   2e-37   
ref|XP_008352160.1|  PREDICTED: LOB domain-containing protein 33-...    144   3e-37   
ref|XP_002879319.1|  LOB domain protein 14                              143   3e-37   
ref|XP_006295930.1|  hypothetical protein CARUB_v10025067mg             143   3e-37   
ref|XP_004147712.1|  PREDICTED: LOB domain-containing protein 33-...    144   4e-37   
ref|XP_002973794.1|  hypothetical protein SELMODRAFT_59642              139   5e-37   
emb|CDP00128.1|  unnamed protein product                                143   5e-37   
ref|XP_003553141.1|  PREDICTED: LOB domain-containing protein 29-...    143   5e-37   
ref|XP_004161921.1|  PREDICTED: LOB domain-containing protein 33-...    143   6e-37   
emb|CDY19098.1|  BnaA04g18380D                                          144   6e-37   
ref|XP_004308845.1|  PREDICTED: LOB domain-containing protein 29-...    143   7e-37   
ref|XP_009417378.1|  PREDICTED: LOB domain-containing protein 20        143   8e-37   
gb|KEH25566.1|  LOB domain protein                                      143   8e-37   
ref|XP_004490916.1|  PREDICTED: LOB domain-containing protein 33-...    142   9e-37   
ref|XP_003616452.1|  LOB domain-containing protein                      141   1e-36   
ref|XP_010414141.1|  PREDICTED: LOB domain-containing protein 14-...    141   2e-36   
ref|XP_008372823.1|  PREDICTED: LOB domain-containing protein 33        141   3e-36   
ref|XP_009351469.1|  PREDICTED: LOB domain-containing protein 33-...    140   5e-36   
ref|XP_006576098.1|  PREDICTED: LOB domain-containing protein 33-...    140   5e-36   
gb|KHN41112.1|  LOB domain-containing protein 33                        140   6e-36   
ref|XP_010262266.1|  PREDICTED: LOB domain-containing protein 16        139   1e-35   



>ref|XP_009604912.1| PREDICTED: LOB domain-containing protein 30-like [Nicotiana tomentosiformis]
Length=266

 Score =   298 bits (762),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 174/236 (74%), Positives = 189/236 (80%), Gaps = 18/236 (8%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAV+TICY
Sbjct  44   CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTICY  103

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL+YLQAHLATLE     PP    SQ    L
Sbjct  104  EAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATLE--LPTPPPQPPSQQPQTL  161

Query  373  FVPPAVLNIADLPT-GVPMMPATYDLSSLFDPMVQPAWAIQ---PRQLDPRQLFGGGAAT  206
              P   L+IADLPT G  ++PA YDLSSLFDPMVQP+WA+Q   P  +DPRQ FGGGA  
Sbjct  162  LPPQPALSIADLPTAGTSILPAAYDLSSLFDPMVQPSWAMQQPRPPPMDPRQ-FGGGAR-  219

Query  205  RVATVDMTsssssaagsggggGDLQELARELMHRHGSPT-VPCTNAPSSALPPHSK  41
              A V+M+      + +GGG GDLQELAREL+HRHGSPT V CT   SSALPP +K
Sbjct  220  --APVEMS-----PSTTGGGSGDLQELARELLHRHGSPTVVQCTE--SSALPPQTK  266



>ref|XP_009795320.1| PREDICTED: LOB domain-containing protein 30 [Nicotiana sylvestris]
Length=273

 Score =   293 bits (749),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 170/236 (72%), Positives = 187/236 (79%), Gaps = 16/236 (7%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAV+TICY
Sbjct  49   CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTICY  108

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL+YLQAHLATLE+P  PP    Q       
Sbjct  109  EAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATLELPTPPPQPPSQQPQTLLP  168

Query  373  FVPPAVLNIADLPTGVP-MMPATYDLSSLFDPMVQPAWAIQ---PRQLDPRQLFGGGAAT  206
              P A L+I DLPT  P ++PA YDLSSLFDPMVQP+WA+Q   P  +DPR  +G GA  
Sbjct  169  PQPAAALSITDLPTAGPSILPAAYDLSSLFDPMVQPSWAMQQPRPTPMDPRH-YGSGAR-  226

Query  205  RVATVDMTsssssaagsggggGDLQELARELMHRHGSPT-VPCTNAPSSALPPHSK  41
              A V+M+      + +GGG GDLQELAREL+HRHGSPT V CT   SSALPP +K
Sbjct  227  --APVEMS-----PSTTGGGSGDLQELARELLHRHGSPTVVQCTE--SSALPPQTK  273



>emb|CDP17781.1| unnamed protein product [Coffea canephora]
Length=241

 Score =   282 bits (721),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 161/233 (69%), Positives = 171/233 (73%), Gaps = 22/233 (9%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAV+TICY
Sbjct  29   CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTICY  88

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPV+GCVAHIFALQQQVVNLQAEL+YLQ HLATLE      P       QP  
Sbjct  89   EAQARLRDPVFGCVAHIFALQQQVVNLQAELSYLQGHLATLE-----LPPPPPPSAQPQP  143

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAI-QPRQLDPRQLFGGGAATRVA  197
             + P  L IADLPTG    PATYDLSSLFDP+VQ  W + QPRQ+D  Q FG   A   A
Sbjct  144  IIAPPSLTIADLPTGSSSAPATYDLSSLFDPVVQLPWTMQQPRQMDSHQ-FGAARAPAEA  202

Query  196  TVDMTsssssaagsggggGDLQELARELMHRH-GSPTVPCTNAPSSALPPHSK  41
            +            S  G GDLQELAREL+HRH  S TVPC   P   LPPHSK
Sbjct  203  S------------SSAGTGDLQELARELLHRHRTSSTVPCNEVPP--LPPHSK  241



>gb|KHG13125.1| LOB domain-containing 18 -like protein [Gossypium arboreum]
Length=252

 Score =   278 bits (711),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 153/231 (66%), Positives = 172/231 (74%), Gaps = 23/231 (10%)
 Frame = -1

Query  730  KFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICYE  551
            KFLRRKCV GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAV+TIC+E
Sbjct  40   KFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTICFE  99

Query  550  AQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPLF  371
            AQ+RLRDPVYGCVAHIFALQQQVVNLQAEL+YLQAHL TLE     PP       Q  + 
Sbjct  100  AQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLTTLE--LPSPPPPPPPPSQTLVA  157

Query  370  VPPAVLNIADLPTGVPMMPATYDLSSLFDPMV-QPAWAIQPRQLDPRQLFGGGAATRVAT  194
             PP  L+I+DLP+    +PATYDLSSLFDPMV Q +WA+Q RQ+DPRQ  G G+A+   +
Sbjct  158  APP--LSISDLPSA-SSVPATYDLSSLFDPMVAQTSWAMQQRQIDPRQYGGTGSASSTGS  214

Query  193  VDMTsssssaagsggggGDLQELARELMHRHGSPTVPCTNAPSSALPPHSK  41
                             GDLQ LAREL+HR GSP +PCT+A  S  P  S+
Sbjct  215  -----------------GDLQALARELLHRQGSPHLPCTDASVSPAPSPSR  248



>ref|XP_006445237.1| hypothetical protein CICLE_v10021992mg [Citrus clementina]
 ref|XP_006491458.1| PREDICTED: LOB domain-containing protein 18-like [Citrus sinensis]
 gb|ESR58477.1| hypothetical protein CICLE_v10021992mg [Citrus clementina]
 gb|KDO85852.1| hypothetical protein CISIN_1g036534mg [Citrus sinensis]
Length=237

 Score =   277 bits (709),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 154/228 (68%), Positives = 169/228 (74%), Gaps = 37/228 (16%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAV+TICY
Sbjct  38   CKFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTICY  97

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL+YLQAHLATLE     P        Q  +
Sbjct  98   EAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATLE----LPSPPPPPPSQNQM  153

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPA-WAIQPRQLDPRQLFGGGAATRVA  197
              PP  L+I+ LP+    MPATYDLS+LFDPMVQPA WA+Q RQ+DPRQ FGGG      
Sbjct  154  TAPP--LSISGLPSAS-SMPATYDLSTLFDPMVQPAPWAMQQRQMDPRQ-FGGG------  203

Query  196  TVDMTsssssaagsggggGDLQELARELMHRHGSP---TVPCTNAPSS  62
                               DLQ +AREL+HR GSP   ++PCT+A SS
Sbjct  204  -------------------DLQAMARELLHRQGSPPPGSMPCTDASSS  232



>ref|XP_006339770.1| PREDICTED: LOB domain-containing protein 18-like [Solanum tuberosum]
Length=264

 Score =   277 bits (708),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 168/236 (71%), Positives = 180/236 (76%), Gaps = 23/236 (10%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAV+TICY
Sbjct  47   CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTICY  106

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL+YLQAHLATLE     P       PQ  L
Sbjct  107  EAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATLE----LPTPPPLPPPQTML  162

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAIQPRQLDPRQL-----FGGGAA  209
              PP  L IADLPT  P +PA YDLSSLFDPMVQP+W +Q  +  P        FGG   
Sbjct  163  QQPP--LTIADLPTAGPSLPAAYDLSSLFDPMVQPSWVLQQPRPPPPLPLDPRHFGGAR-  219

Query  208  TRVATVDMTsssssaagsggggGDLQELARELMHRHGSPTVPCTNAPSSALPPHSK  41
               + VDM+        +GGGGGDLQELAREL+HRHGS TVPCT   SSALPP +K
Sbjct  220  ---SQVDMS------PSTGGGGGDLQELARELLHRHGSVTVPCTE--SSALPPQTK  264



>ref|XP_002301295.2| hypothetical protein POPTR_0002s15000g [Populus trichocarpa]
 gb|EEE80568.2| hypothetical protein POPTR_0002s15000g [Populus trichocarpa]
Length=244

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 152/228 (67%), Positives = 171/228 (75%), Gaps = 27/228 (12%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIP HKR DAV+TICY
Sbjct  37   CKFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPAHKRPDAVVTICY  96

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL+YLQAHLA +EVP+ PPP           
Sbjct  97   EAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLAAMEVPSPPPPPPPALVTS---  153

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAIQPRQLDPRQLFGGGAATRVAT  194
              PP   +IADLP+   +  A YDLSSLFDPMVQP+W++QPRQLDP Q FGG + T   +
Sbjct  154  --PP--FSIADLPSASSIPGAAYDLSSLFDPMVQPSWSMQPRQLDPHQ-FGGSSGTSETS  208

Query  193  VDMTsssssaagsggggGDLQELARELMHRHGS---PTVPCTNAPSSA  59
                            GGDLQ LAREL+HR GS    +VPC++A +S+
Sbjct  209  ----------------GGDLQALARELLHRRGSLPPGSVPCSDALASS  240



>ref|XP_003521944.1| PREDICTED: LOB domain-containing protein 18-like [Glycine max]
Length=251

 Score =   272 bits (695),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 153/222 (69%), Positives = 171/222 (77%), Gaps = 19/222 (9%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQGA HFAAVHKVFGASNVSKLLL+IPV+KRLDAV+TICY
Sbjct  38   CKFLRRKCVPGCIFAPYFDSEQGATHFAAVHKVFGASNVSKLLLNIPVYKRLDAVVTICY  97

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVV+LQAEL+YLQ HLATLE+P  PPP    S PQ   
Sbjct  98   EAQARLRDPVYGCVAHIFALQQQVVSLQAELSYLQGHLATLELPQPPPPPPPPSSPQATT  157

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQ-PAWAIQPRQLDPRQLFGGGAATRVA  197
              PP V++IA+LP+ V   PATYDLSSLFDPM Q P+WA+QPR ++ RQ  G G +   A
Sbjct  158  MAPP-VISIAELPSTV---PATYDLSSLFDPMAQSPSWAVQPRPIESRQYVGSGPSGPSA  213

Query  196  TVDMTsssssaagsggggGDLQELARELMHRHGS-PTVPCTN  74
            T                GGDLQ LAREL+HRHGS P V C+N
Sbjct  214  T-------------SASGGDLQALARELLHRHGSAPVVACSN  242



>ref|XP_011017499.1| PREDICTED: LOB domain-containing protein 18-like [Populus euphratica]
Length=244

 Score =   269 bits (688),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 151/228 (66%), Positives = 169/228 (74%), Gaps = 27/228 (12%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIP HKR DAV+TICY
Sbjct  37   CKFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPAHKRPDAVVTICY  96

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL+YLQAHLA +EVP+ PPP           
Sbjct  97   EAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLAAMEVPSPPPPPPPALVTP---  153

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAIQPRQLDPRQLFGGGAATRVAT  194
                   +IADLP+    +PA YDLSSLFDPMVQP+W++QPRQLDP Q FGG +     T
Sbjct  154  ----PPFSIADLPS-TSSIPAAYDLSSLFDPMVQPSWSMQPRQLDPHQ-FGGSSTGTSET  207

Query  193  VDMTsssssaagsggggGDLQELARELMHRHGS---PTVPCTNAPSSA  59
                            GGDLQ LAREL+HR GS    +VPC++A +S+
Sbjct  208  ---------------SGGDLQALARELLHRRGSLPPGSVPCSDALASS  240



>gb|KDP28744.1| hypothetical protein JCGZ_14515 [Jatropha curcas]
Length=243

 Score =   268 bits (684),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 169/221 (76%), Gaps = 23/221 (10%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAV+TICY
Sbjct  32   CKFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTICY  91

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL YLQAHLATLEVP+ PPP         P 
Sbjct  92   EAQARLRDPVYGCVAHIFALQQQVVNLQAELTYLQAHLATLEVPSPPPPPPPPPALVTP-  150

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAIQPRQLDPRQLFGGGAATRVAT  194
                  L+I+DLP+    MPATYDLSSLFDP+ QP+W +Q RQ+DPRQ FGG + +    
Sbjct  151  ----LPLSISDLPSA-SSMPATYDLSSLFDPITQPSWTMQQRQMDPRQ-FGGSSTSSSPA  204

Query  193  VDMTsssssaagsggggGDLQELARELMHRHGSP---TVPC  80
            +              GGGDLQ LAREL+ RHGSP   ++PC
Sbjct  205  IS-------------GGGDLQSLARELLLRHGSPQRGSMPC  232



>ref|XP_003517057.1| PREDICTED: LOB domain-containing protein 18-like [Glycine max]
 gb|KHN40139.1| LOB domain-containing protein 18 [Glycine soja]
Length=247

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 148/233 (64%), Positives = 176/233 (76%), Gaps = 24/233 (10%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC+ GCIFAPYFDSE+GA HFAAVHKVFGASN+SKLLL+IPVHKRLDAV+TICY
Sbjct  30   CKFLRRKCMPGCIFAPYFDSEEGATHFAAVHKVFGASNISKLLLNIPVHKRLDAVVTICY  89

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQV++LQAEL+YLQ HLATLE+P  PPP + Q+      
Sbjct  90   EAQARLRDPVYGCVAHIFALQQQVMSLQAELSYLQGHLATLELPQPPPPSSPQATT----  145

Query  373  FVPPAVLNIAD-LPTGV---PMMPATYDLSSLFDPMVQ-PAWAIQPRQLDPRQLFGGGAA  209
              PP +++IA+ +P+       +P TYDLSSLFDPM Q P+WA+QPR ++ RQ  G G +
Sbjct  146  MAPPPLISIAEFIPSSALASSTVPPTYDLSSLFDPMAQTPSWAVQPRPIESRQYVGSGPS  205

Query  208  TRVATVDMTsssssaagsggggGDLQELARELMHRHGS-PTVPCTNAPSSALP  53
               AT+               GGDLQ LAREL+HRHGS P V C+N PSS+ P
Sbjct  206  GPSATI-------------ASGGDLQALARELLHRHGSAPVVACSN-PSSSYP  244



>ref|XP_002511730.1| LOB domain-containing protein, putative [Ricinus communis]
 gb|EEF50399.1| LOB domain-containing protein, putative [Ricinus communis]
Length=247

 Score =   264 bits (674),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 158/230 (69%), Positives = 174/230 (76%), Gaps = 24/230 (10%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAV+TICY
Sbjct  31   CKFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTICY  90

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL+YLQAHLATLE+P+ PPP   QS   P  
Sbjct  91   EAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATLELPSPPPPPPPQSLVPP--  148

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQ--PAWAIQPRQLDPRQL-FGGGAATR  203
                  L+IADLP+    +PATYDLSSLFDPM Q  P+WA+Q RQ+DPRQ   G    + 
Sbjct  149  ----PPLSIADLPSA-SSVPATYDLSSLFDPMTQPSPSWAMQQRQMDPRQFGGGSSLGSS  203

Query  202  VATVDMTsssssaagsggggGDLQELARELMHRHGSP---TVPCTNAPSS  62
             AT+              GGGDL  LAREL+HRH SP   +VPC+   SS
Sbjct  204  SATIGGC-----------GGGDLHSLARELLHRHASPPRGSVPCSGTLSS  242



>ref|XP_010692269.1| PREDICTED: LOB domain-containing protein 18 [Beta vulgaris subsp. 
vulgaris]
Length=245

 Score =   263 bits (673),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 155/225 (69%), Positives = 168/225 (75%), Gaps = 22/225 (10%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAV+TICY
Sbjct  34   CKFLRRKCVVGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTICY  93

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL YLQAHLATLEVP  PPP  Q   P P  
Sbjct  94   EAQARLRDPVYGCVAHIFALQQQVVNLQAELTYLQAHLATLEVPTPPPPPPQPLMPPPQ-  152

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAI--QPRQLDPRQLFGGGAATRV  200
                  L+IADLP+    +PATYDLSSLFDPMVQP WA+  Q +Q  P      G+  R 
Sbjct  153  ------LSIADLPSA-STVPATYDLSSLFDPMVQPLWAMHQQQQQRGPMDQRVFGSTDRG  205

Query  199  ATVDMTsssssaagsggggGDLQELARELMHRHGSPTVPCTNAPS  65
             T+              GGGDLQ +AREL+HRHGSPT+   + PS
Sbjct  206  PTIG------------SGGGDLQAVARELLHRHGSPTIGHMHDPS  238



>ref|XP_004231166.1| PREDICTED: LOB domain-containing protein 30 [Solanum lycopersicum]
Length=271

 Score =   262 bits (670),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 162/240 (68%), Positives = 176/240 (73%), Gaps = 21/240 (9%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAV+TIC+
Sbjct  44   CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVLTICF  103

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAH--LATLEvpnapppvaqqsqpqp  380
            EAQ+RLRDPVYGCVAHIFALQ QV NLQAEL+YLQAH     L  P   PP       QP
Sbjct  104  EAQARLRDPVYGCVAHIFALQHQVANLQAELSYLQAHLTTLELPTPPPLPPPPPPPPQQP  163

Query  379  PLFVPPAVLNIADLPTGVPMMPATYDLSSLFDPMV-QPAWAIQPRQLDPRQL------FG  221
               +    L IADLPT  P +PA YDLSSLFDPMV QP+WA+Q +   P  L      FG
Sbjct  164  QTMLHQPSLTIADLPTAGPSLPAAYDLSSLFDPMVIQPSWAMQQQPRPPPPLPLDPRHFG  223

Query  220  GGAATRVATVDMTsssssaagsggggGDLQELARELMHRHGSPTVPCTNAPSSALPPHSK  41
            G      A +DM+        +GGGGGDLQELAREL+HRHGS TVPCT   SSALPP +K
Sbjct  224  GAR----APMDMS------PSTGGGGGDLQELARELLHRHGSATVPCTE--SSALPPQTK  271



>ref|XP_002279521.1| PREDICTED: LOB domain-containing protein 18 [Vitis vinifera]
Length=251

 Score =   259 bits (663),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 154/233 (66%), Positives = 170/233 (73%), Gaps = 23/233 (10%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFD EQGAAHFAAVHKVFGASNVSKLL HIPVHKRLDAV+TICY
Sbjct  33   CKFLRRKCVVGCIFAPYFDPEQGAAHFAAVHKVFGASNVSKLLGHIPVHKRLDAVVTICY  92

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL+YLQAHLATLE+P+ PPP           
Sbjct  93   EAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATLELPSPPPPPPPPPPVMVTP  152

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQP-AWAIQP-RQLDPRQLFGGGAATRV  200
                  L+I+DLP+    MP TYDLSSLFDPMVQP +W +Q  RQ+DPRQ  G    T +
Sbjct  153  ----PSLSISDLPS-ASSMPPTYDLSSLFDPMVQPSSWPMQQHRQIDPRQFGGSRGPTDL  207

Query  199  ATVDMTsssssaagsggggGDLQELARELMHRHGSPT---VPCTNAPSSALPP  50
             +             G GGGDLQ LAREL+HRH S     VPCT    S++PP
Sbjct  208  PST----------AGGSGGGDLQALARELLHRHSSALGGHVPCTE---SSMPP  247



>ref|XP_004145058.1| PREDICTED: LOB domain-containing protein 18-like [Cucumis sativus]
 ref|XP_004153747.1| PREDICTED: LOB domain-containing protein 18-like [Cucumis sativus]
 ref|XP_004170755.1| PREDICTED: LOB domain-containing protein 18-like [Cucumis sativus]
 gb|KGN46236.1| hypothetical protein Csa_6G076840 [Cucumis sativus]
Length=240

 Score =   259 bits (661),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 150/222 (68%), Positives = 168/222 (76%), Gaps = 21/222 (9%)
 Frame = -1

Query  730  KFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICYE  551
            KFLRRKCV GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAV+TICYE
Sbjct  34   KFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTICYE  93

Query  550  AQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPLF  371
            AQ+RLRDPVYGCVAHIFALQQQVV+LQAEL YLQAHLATLE+P+ P P      P  P  
Sbjct  94   AQARLRDPVYGCVAHIFALQQQVVSLQAELTYLQAHLATLELPSPPNPPPPPPPPSFPAQ  153

Query  370  VPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAIQPRQLDPRQLFGGGAATRVATV  191
                 L+I+DLP+    +PATYDLSSLFDPM QPAWA+Q ++LD RQ  GGG  +  A  
Sbjct  154  ---PPLSISDLPSA-SSLPATYDLSSLFDPMAQPAWAMQQQRLDHRQFAGGGGGSSTAPG  209

Query  190  DMTsssssaagsggggGDLQELARELMHRHGSPTVPCTNAPS  65
            +               GDLQ LAREL+ RHG+P  PC++A S
Sbjct  210  E---------------GDLQALARELLLRHGAP--PCSDASS  234



>emb|CBI38861.3| unnamed protein product [Vitis vinifera]
Length=264

 Score =   259 bits (662),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 154/233 (66%), Positives = 170/233 (73%), Gaps = 23/233 (10%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFD EQGAAHFAAVHKVFGASNVSKLL HIPVHKRLDAV+TICY
Sbjct  46   CKFLRRKCVVGCIFAPYFDPEQGAAHFAAVHKVFGASNVSKLLGHIPVHKRLDAVVTICY  105

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL+YLQAHLATLE+P+ PPP           
Sbjct  106  EAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATLELPSPPPPPPPPPPVMVTP  165

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQP-AWAIQP-RQLDPRQLFGGGAATRV  200
                  L+I+DLP+    MP TYDLSSLFDPMVQP +W +Q  RQ+DPRQ  G    T +
Sbjct  166  ----PSLSISDLPS-ASSMPPTYDLSSLFDPMVQPSSWPMQQHRQIDPRQFGGSRGPTDL  220

Query  199  ATVDMTsssssaagsggggGDLQELARELMHRHGSPT---VPCTNAPSSALPP  50
             +             G GGGDLQ LAREL+HRH S     VPCT    S++PP
Sbjct  221  PST----------AGGSGGGDLQALARELLHRHSSALGGHVPCTE---SSMPP  260



>ref|XP_011093197.1| PREDICTED: LOB domain-containing protein 18-like [Sesamum indicum]
Length=245

 Score =   257 bits (657),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 150/232 (65%), Positives = 168/232 (72%), Gaps = 18/232 (8%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLH+PV KRLDAV+TICY
Sbjct  31   CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHVPVEKRLDAVVTICY  90

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL+YLQAHLATLE+P  PP       P    
Sbjct  91   EAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATLELPTPPPAPPPPLLPPALS  150

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAIQPRQ-LDPRQLFGGGAATRVA  197
                A  + A         PATYDLSSL DP++ P+W +  RQ +DPR  F    A R A
Sbjct  151  ISDSATSSSA--------FPATYDLSSLIDPILHPSWILNQRQDIDPRS-FSTTTAAR-A  200

Query  196  TVDMTsssssaagsggggGDLQELARELMHRHGSPTVPCTNAPSSALPPHSK  41
              D+       + +   GGDLQELAREL++RH  P VPC N  +S LPPHS+
Sbjct  201  PPDIP------SSAASSGGDLQELARELLNRHAPPVVPCRNQ-ASTLPPHSR  245



>ref|XP_010092844.1| hypothetical protein L484_022439 [Morus notabilis]
 gb|EXB52662.1| hypothetical protein L484_022439 [Morus notabilis]
Length=243

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 148/227 (65%), Positives = 168/227 (74%), Gaps = 25/227 (11%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAV+T+CY
Sbjct  29   CKFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTVCY  88

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVV+LQ EL+YLQAHLATLE+P+ PP          P 
Sbjct  89   EAQARLRDPVYGCVAHIFALQQQVVSLQTELSYLQAHLATLELPSPPPAPPPPPSSLNP-  147

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAIQPRQLDPRQLFGGGAATRVAT  194
                  L+IADLP+    +PATYDLSSLF+P+VQP W++Q RQLDPRQ  G   ++  + 
Sbjct  148  ----PPLSIADLPSAS-SVPATYDLSSLFEPIVQP-WSMQQRQLDPRQFGGSTGSSSTSG  201

Query  193  VDMTsssssaagsggggGDLQELARELMHRHGSP---TVPCTNAPSS  62
                              DLQ LAREL+HRHGSP    VPC++A  S
Sbjct  202  GGG---------------DLQALARELLHRHGSPPHGPVPCSDASQS  233



>gb|KHM98881.1| LOB domain-containing protein 18 [Glycine soja]
Length=237

 Score =   253 bits (647),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 162/215 (75%), Gaps = 21/215 (10%)
 Frame = -1

Query  712  CVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICYEAQSRLR  533
            CV GCIFAPYFDSEQGA HFAAVHKVFGASNVSKLLL+IPV+KRLDAV+TICYEAQ+RLR
Sbjct  33   CVPGCIFAPYFDSEQGATHFAAVHKVFGASNVSKLLLNIPVYKRLDAVVTICYEAQARLR  92

Query  532  DPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPLFVPPAVL  353
            DPVYGCVAHIFALQQQVV+LQAEL+YLQ HLATLE+P  PPP     Q      + P V+
Sbjct  93   DPVYGCVAHIFALQQQVVSLQAELSYLQGHLATLELPQPPPPPPSSPQATT---MAPPVI  149

Query  352  NIADLPTGVPMMPATYDLSSLFDPMVQ-PAWAIQPRQLDPRQLFGGGAATRVATVDMTss  176
            +IA+LP+ V   PATYDLSSLFDPM Q P+WA+QPR ++ RQ  G G +   AT      
Sbjct  150  SIAELPSTV---PATYDLSSLFDPMAQSPSWAVQPRPIESRQYVGSGPSGPSAT------  200

Query  175  sssaagsggggGDLQELARELMHRHGS-PTVPCTN  74
                      GGDLQ LAREL+HRHGS P V C+N
Sbjct  201  -------SASGGDLQALARELLHRHGSAPVVACSN  228



>ref|XP_009379266.1| PREDICTED: LOB domain-containing protein 18 [Pyrus x bretschneideri]
 ref|XP_009347043.1| PREDICTED: LOB domain-containing protein 18-like [Pyrus x bretschneideri]
Length=253

 Score =   253 bits (646),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 150/231 (65%), Positives = 163/231 (71%), Gaps = 14/231 (6%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAV+TICY
Sbjct  33   CKFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTICY  92

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL+YLQAHLAT+E     PP          L
Sbjct  93   EAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATME--LPSPPPPPPPPSAAAL  150

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAIQPRQL-DPRQLFGGGAATRVA  197
              PP   +I+DLP+ V  MPA+YDLSSLF+PMV   WA+Q R L DPR     G  +   
Sbjct  151  ITPPQ-FSISDLPSAVSSMPASYDLSSLFEPMVMQPWAMQQRALHDPRHHHQFGGGSSGP  209

Query  196  TVDMTsssssaagsggggGDLQELARELMHRHGSPTVPCTNAPSSALPPHS  44
                           GGGGDLQ LAREL+HRH S   P +   S   P HS
Sbjct  210  GSPAG----------GGGGDLQSLARELLHRHSSSPSPGSVPCSEGSPSHS  250



>ref|XP_008232676.1| PREDICTED: LOB domain-containing protein 18 [Prunus mume]
Length=256

 Score =   253 bits (646),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 158/233 (68%), Positives = 174/233 (75%), Gaps = 19/233 (8%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAV+TICY
Sbjct  35   CKFLRRKCVLGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTICY  94

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVV+LQAEL+YLQAHLATLE+P+ PPP    S   P  
Sbjct  95   EAQARLRDPVYGCVAHIFALQQQVVSLQAELSYLQAHLATLELPSPPPPPPPPSIITP--  152

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMV-QPAWAIQPRQL-DPRQLFGGGAATRV  200
                  L+I+DLP     MPATYDLSSLF+PMV Q  W +Q R L DPR         + 
Sbjct  153  ----PPLSISDLPLAASSMPATYDLSSLFEPMVIQQPWVVQHRALHDPRN-------HQF  201

Query  199  ATVDMTsssssaagsggggGDLQELARELMHRHG---SP-TVPCTNAPSSALP  53
                  S SS+  G GGGGGDLQ LAREL+HRHG   SP ++PC+ A  S  P
Sbjct  202  GGGSSGSGSSTGGGGGGGGGDLQSLARELLHRHGQSLSPGSLPCSEASPSQSP  254



>ref|XP_010056297.1| PREDICTED: LOB domain-containing protein 18-like [Eucalyptus 
grandis]
 gb|KCW72963.1| hypothetical protein EUGRSUZ_E01414 [Eucalyptus grandis]
Length=244

 Score =   253 bits (645),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 143/224 (64%), Positives = 156/224 (70%), Gaps = 22/224 (10%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVH+RLDAV+TICY
Sbjct  37   CKFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHRRLDAVVTICY  96

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL+YLQAHL TLE+P   PP        P  
Sbjct  97   EAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLTTLELPVPLPPPPPPPAMGPQ-  155

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAIQPRQLDPRQLFGGGAATRVAT  194
                  L+IADLP+    +PATYDLSSLFDPM Q AW +  RQ+D RQ  G       + 
Sbjct  156  ------LSIADLPSA-SSIPATYDLSSLFDPMAQAAWMVPQRQIDFRQFEGSCGGGGSSA  208

Query  193  VDMTsssssaagsggggGDLQELARELMHRHGSPTVPCTNAPSS  62
                              DL  LAREL+ R GSP   C +A SS
Sbjct  209  AGGG--------------DLNALARELLRRQGSPPPGCIDAMSS  238



>ref|XP_007218850.1| hypothetical protein PRUPE_ppa010383mg [Prunus persica]
 gb|EMJ20049.1| hypothetical protein PRUPE_ppa010383mg [Prunus persica]
Length=252

 Score =   253 bits (646),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 159/233 (68%), Positives = 174/233 (75%), Gaps = 19/233 (8%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAV+TICY
Sbjct  31   CKFLRRKCVLGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTICY  90

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVV+LQAEL+YLQAHLATLE+P+ PPP    S   P  
Sbjct  91   EAQARLRDPVYGCVAHIFALQQQVVSLQAELSYLQAHLATLELPSPPPPPPPPSIITP--  148

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMV-QPAWAIQPRQL-DPRQLFGGGAATRV  200
                  L+I+DLP     MPATYDLSSLF+PMV Q  W +Q R L DPR         + 
Sbjct  149  ----PPLSISDLPLAASSMPATYDLSSLFEPMVIQQPWVVQHRALHDPRH-------HQF  197

Query  199  ATVDMTsssssaagsggggGDLQELARELMHRHG---SP-TVPCTNAPSSALP  53
                  S SSS  G GGGGGDLQ LAREL+HRHG   SP ++PC+ A  S  P
Sbjct  198  GGGSSGSGSSSTGGGGGGGGDLQSLARELLHRHGQSLSPGSLPCSEASPSQSP  250



>ref|XP_011034497.1| PREDICTED: LOW QUALITY PROTEIN: LOB domain-containing protein 
18 [Populus euphratica]
Length=245

 Score =   249 bits (635),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 158/216 (73%), Gaps = 27/216 (13%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAV+TICY
Sbjct  37   CKFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTICY  96

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL+YLQAHLA LEVP+ PPP           
Sbjct  97   EAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLAALEVPSPPPPPPPTLVTP---  153

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAI--QPRQLDPRQLFGGGAATRV  200
                  L+IADLP+    +PA YDLSSLFDPM+QP+W+   Q RQ+D RQ    G ++  
Sbjct  154  ----PPLSIADLPSASS-IPAAYDLSSLFDPMMQPSWSNMQQQRQMDTRQFGDSGGSSGT  208

Query  199  ATVDMTsssssaagsggggGDLQELARELMHRHGSP  92
            +                   DLQ LAREL+HR GSP
Sbjct  209  SGG-----------------DLQALARELLHRRGSP  227



>ref|XP_002320063.1| LOB domain protein 18 [Populus trichocarpa]
 gb|EEE98378.1| LOB domain protein 18 [Populus trichocarpa]
Length=246

 Score =   248 bits (634),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 159/216 (74%), Gaps = 27/216 (13%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAV+TICY
Sbjct  38   CKFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTICY  97

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL+YLQAHLA LEVP+ PPP           
Sbjct  98   EAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLAALEVPSPPPPPPPTLVTP---  154

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWA-IQP-RQLDPRQLFGGGAATRV  200
                  L+IADLP+    +PA YDLS LFDPM+QP+W+ +QP RQ+D RQ  G G ++  
Sbjct  155  ----PPLSIADLPSASS-IPAAYDLSCLFDPMMQPSWSNMQPQRQMDIRQFGGSGGSSGT  209

Query  199  ATVDMTsssssaagsggggGDLQELARELMHRHGSP  92
                                DLQ LAREL+HR GSP
Sbjct  210  GGG-----------------DLQALARELLHRRGSP  228



>ref|XP_008343190.1| PREDICTED: LOB domain-containing protein 30 [Malus domestica]
Length=253

 Score =   248 bits (634),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 155/212 (73%), Gaps = 14/212 (7%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAV+TICY
Sbjct  33   CKFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTICY  92

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL+YLQAHLAT+E     PP          L
Sbjct  93   EAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATME--LPSPPPPPPPPSAAAL  150

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAIQPRQL-DPRQLFGGGAATRVA  197
              PP   +I+DLP+ V  MPA+YDLSSLF+PMV   W++Q R L D R     G  +   
Sbjct  151  ITPPQ-FSISDLPSAVSSMPASYDLSSLFEPMVMQPWSMQQRALHDLRHHHQFGGGSSGP  209

Query  196  TVDMTsssssaagsggggGDLQELARELMHRH  101
                           GGGGDLQ LAREL+HRH
Sbjct  210  GSPAG----------GGGGDLQSLARELLHRH  231



>ref|XP_010508173.1| PREDICTED: LOB domain-containing protein 18 [Camelina sativa]
Length=264

 Score =   248 bits (634),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 170/229 (74%), Gaps = 12/229 (5%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQG+A+FAAVHKVFGASNVSKLLLHIPVH+R DAV+TICY
Sbjct  43   CKFLRRKCVPGCIFAPYFDSEQGSAYFAAVHKVFGASNVSKLLLHIPVHRRSDAVVTICY  102

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+R+RDP+YGCVAHIFALQQQVVNLQAE++YLQAHLA+LE+P         SQ QP  
Sbjct  103  EAQARIRDPIYGCVAHIFALQQQVVNLQAEVSYLQAHLASLELPQPQTRPPSLSQQQPLY  162

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMV-QPAWAIQPRQ-LDPRQLFGGGAATRV  200
            F PP   +I D+P  V  +P+TYDL+S+FD      AWA Q R+ +DPRQ +G       
Sbjct  163  FAPPPPFSITDIPASVSPLPSTYDLASIFDQTTPSSAWATQQRRFVDPRQQYG-------  215

Query  199  ATVDMTsssssaagsggggGDLQELARELMHRHGSPTVPCT-NAPSSAL  56
              V  +SS+++  G GG   DLQ LA EL+HR GSP    T ++PS ++
Sbjct  216  --VSSSSSAAATIGLGGENSDLQALAHELLHRQGSPPPAATDDSPSRSM  262



>ref|XP_010276364.1| PREDICTED: LOB domain-containing protein 30-like [Nelumbo nucifera]
Length=254

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 163/214 (76%), Gaps = 19/214 (9%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAV+TICY
Sbjct  35   CKFLRRKCVSGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTICY  94

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQSRLRDPVYGCVAHIFALQQQVVNLQAEL+YLQAHLA LE+P+  PP    +   P  
Sbjct  95   EAQSRLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLAALELPSPSPPQPPPALLTP--  152

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPA-WAIQPRQLDPRQLFGGGAATRVA  197
                 +L+I+DLP+    +PAT+DLS+LFDP VQPA W +Q +Q+D RQ FG        
Sbjct  153  ----PLLSISDLPS-ASTVPATFDLSTLFDPGVQPAQWVLQQQQMDIRQ-FGASGRNPAE  206

Query  196  TVDMTsssssaagsggggGDLQELARELMHRHGS  95
            +   T          GGGGDLQ LAREL+ RH S
Sbjct  207  SPPST----------GGGGDLQALARELLQRHRS  230



>ref|XP_009142334.1| PREDICTED: LOB domain-containing protein 18-like [Brassica rapa]
Length=259

 Score =   246 bits (628),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 155/217 (71%), Gaps = 13/217 (6%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQG+A+FAAVHKVFGASNVSKLLLHIPVH+R DAV+TICY
Sbjct  38   CKFLRRKCVPGCIFAPYFDSEQGSAYFAAVHKVFGASNVSKLLLHIPVHRRSDAVVTICY  97

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE-vpnapppvaqqsqpqpP  377
            EAQ+R+RDP+YGCVAHIFALQQQVVNLQAE++Y+QAHLA+LE       P          
Sbjct  98   EAQARIRDPIYGCVAHIFALQQQVVNLQAEVSYVQAHLASLELPDPQTRPPPPPQSQPQS  157

Query  376  LFVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQP-AWAIQPRQ-LDPRQLFGGGAATR  203
            LF  P  L+I DL   V  +P+TYDL+S FD    P +WA Q R+ +DPR  +G   ++ 
Sbjct  158  LFFTPPPLSITDLAASVSPLPSTYDLASTFDHAASPSSWATQQRRFVDPRHQYGRSLSSS  217

Query  202  VATVDMTsssssaagsggggGDLQELARELMHRHGSP  92
             ATV +           GG  DL+ LA EL+HR GSP
Sbjct  218  SATVGL----------AGGNSDLEALAHELLHRQGSP  244



>emb|CDY57109.1| BnaC04g56960D [Brassica napus]
Length=260

 Score =   246 bits (628),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 160/217 (74%), Gaps = 13/217 (6%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQG+A+FAAVHKVFGASN+SKLLLHIPVH+R DAV+TICY
Sbjct  39   CKFLRRKCVPGCIFAPYFDSEQGSAYFAAVHKVFGASNISKLLLHIPVHRRSDAVVTICY  98

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE-vpnapppvaqqsqpqpP  377
            EAQ+R+RDP+YGCVAHIFALQQQVVNLQAE++Y+QAHLA+LE     PPP  +       
Sbjct  99   EAQARIRDPIYGCVAHIFALQQQVVNLQAEVSYVQAHLASLELPQPPPPPPPRPQSQPQL  158

Query  376  LFVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQP-AWAIQPRQ-LDPRQLFGGGAATR  203
            LF+ P  L+I DLP  V  +P+TYDL+S FD    P +WA Q R+ +DPR  +G    + 
Sbjct  159  LFLTPPPLSITDLPASVSPLPSTYDLASTFDHAASPSSWATQQRRFVDPRHQYGRSLPSS  218

Query  202  VATVDMTsssssaagsggggGDLQELARELMHRHGSP  92
             AT+ +          GGG  DL+ LA EL+HR GSP
Sbjct  219  SATLGL----------GGGNSDLEALAHELLHRQGSP  245



>ref|XP_004306912.1| PREDICTED: LOB domain-containing protein 30-like [Fragaria vesca 
subsp. vesca]
Length=244

 Score =   245 bits (625),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 165/231 (71%), Gaps = 28/231 (12%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLL HIP HKR DAV+T+C+
Sbjct  35   CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLHHIPAHKRPDAVLTVCF  94

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RL+DPVYGCVAHIFALQQQVVNLQAE++YLQAHLAT+E       +     P PPL
Sbjct  95   EAQARLKDPVYGCVAHIFALQQQVVNLQAEISYLQAHLATME-------LPSPPPPPPPL  147

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQP-AWAIQPRQLDPRQLFGGGAATRVA  197
               P  L+IADLP+    MPATYDLSSLF+PMVQP AW +Q R L   Q       +   
Sbjct  148  IAQPQ-LSIADLPSAP--MPATYDLSSLFEPMVQPTAWVMQQRALLHNQHHQFVGGSSSG  204

Query  196  TVDMTsssssaagsggggGDLQELARELMHRH-GSP--TVPCTNA-PSSAL  56
             V                GDLQ LAREL+HRH GSP  +VPC+ A PS +L
Sbjct  205  GVGGG-------------GDLQALARELLHRHTGSPSGSVPCSEASPSRSL  242



>emb|CDY68635.1| BnaAnng27870D [Brassica napus]
Length=259

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 154/217 (71%), Gaps = 13/217 (6%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQG+A+FAAVHKVFGASNVSKLLLHIPVH+R DAV+TICY
Sbjct  38   CKFLRRKCVPGCIFAPYFDSEQGSAYFAAVHKVFGASNVSKLLLHIPVHRRSDAVVTICY  97

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE-vpnapppvaqqsqpqpP  377
            EAQ+R+RDP+YGCVAHIFALQQQVVNLQAE++Y+QAHLA+LE       P          
Sbjct  98   EAQARIRDPIYGCVAHIFALQQQVVNLQAEVSYVQAHLASLELPDPQTRPPPPPQSQPQS  157

Query  376  LFVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQP-AWAIQPRQ-LDPRQLFGGGAATR  203
            LF  P  L+  DL   V  +P+TYDL+S FD    P +WA Q R+ +DPR  +G   ++ 
Sbjct  158  LFFTPPPLSTTDLAASVSPLPSTYDLASTFDHAASPSSWATQQRRFVDPRHQYGRSLSSS  217

Query  202  VATVDMTsssssaagsggggGDLQELARELMHRHGSP  92
             ATV +           GG  DL+ LA EL+HR GSP
Sbjct  218  SATVGL----------AGGNSDLEALAHELLHRQGSP  244



>ref|XP_010506484.1| PREDICTED: LOB domain-containing protein 18 [Camelina sativa]
Length=263

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 168/229 (73%), Gaps = 12/229 (5%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQG+ +FAAVHKVFGASNVSKLLLHIPVH+R DAV+TICY
Sbjct  42   CKFLRRKCVPGCIFAPYFDSEQGSGYFAAVHKVFGASNVSKLLLHIPVHRRSDAVVTICY  101

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+R+RDP+YGCVAHIFALQQQVVNLQAE++YLQAHLA+LE+P         SQ Q   
Sbjct  102  EAQARIRDPIYGCVAHIFALQQQVVNLQAEVSYLQAHLASLELPQPQTRPPPLSQQQQLF  161

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMV-QPAWAIQPRQ-LDPRQLFGGGAATRV  200
            F P    ++ DLP  V  +P+TYDL+S+FD      AWA Q R+ +DPRQ +G       
Sbjct  162  FAPAPPFSVTDLPASVSPLPSTYDLASIFDQTTPSSAWATQQRRFVDPRQQYG-------  214

Query  199  ATVDMTsssssaagsggggGDLQELARELMHRHGSPTVPCT-NAPSSAL  56
              V  +SSS++A G GG   DLQ LA EL+HR GSP    T ++PS ++
Sbjct  215  --VPSSSSSAAAIGLGGENSDLQALAHELLHRQGSPPPAATDDSPSRSM  261



>ref|XP_010906049.1| PREDICTED: LOB domain-containing protein 18-like [Elaeis guineensis]
Length=241

 Score =   243 bits (621),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 159/219 (73%), Gaps = 22/219 (10%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIP HKRLDAV+TICY
Sbjct  35   CKFLRRKCVSGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPAHKRLDAVVTICY  94

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL+YLQAHLATLE+P  PPP      P PP 
Sbjct  95   EAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATLELPTPPPPPPPPQLPSPPP  154

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAIQPRQLDP---RQLFGGGAATR  203
            F      +I+DLP+ +  +PAT DLS+LFDP VQP W++Q +Q  P   RQ  G G  + 
Sbjct  155  F------SISDLPSSL-NLPATVDLSALFDPQVQPHWSLQQQQQRPIELRQQLGPGRRSL  207

Query  202  VATVDMTsssssaagsggggGDLQELARELMHRHGSPTV  86
                  +             GDLQ LAREL+ R  + T 
Sbjct  208  SEGSGGS------------SGDLQALARELLDRQRTATT  234



>ref|XP_006397723.1| hypothetical protein EUTSA_v10001791mg [Eutrema salsugineum]
 gb|ESQ39176.1| hypothetical protein EUTSA_v10001791mg [Eutrema salsugineum]
Length=262

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 141/231 (61%), Positives = 171/231 (74%), Gaps = 15/231 (6%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQG+A+FAAVHKVFGASNVSKLLLHIPVH+R DAV+TICY
Sbjct  40   CKFLRRKCVPGCIFAPYFDSEQGSAYFAAVHKVFGASNVSKLLLHIPVHRRSDAVVTICY  99

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE--vpnapppvaqqsqpqp  380
            EAQ+R+RDP+YGCVAHIFALQQQVVNLQAE++YLQAHLA+LE   P   P    Q+Q Q 
Sbjct  100  EAQARIRDPIYGCVAHIFALQQQVVNLQAEVSYLQAHLASLELPQPQTRPAPLPQTQQQA  159

Query  379  PLFVPPAVLNIADLPTGVPMMPATYDLSSLFDPMV-QPAWAIQPRQ-LDPRQLFGGGAAT  206
              F P   L+I DLP+ V  +P+TYDL+S+FD      +WA Q R+ +DPRQ +GG +++
Sbjct  160  LFFTPTPPLSITDLPSSVSPLPSTYDLASIFDQTTSSSSWATQQRRFVDPRQQYGGSSSS  219

Query  205  RVATVDMTsssssaagsggggGDLQELARELMHRHGSPTVPCT-NAPSSAL  56
              A V +          GGG  DLQ LA EL+HR GSP    T ++PS ++
Sbjct  220  SPAAVGL----------GGGNSDLQALAHELLHRQGSPPPAATDDSPSRSM  260



>ref|XP_010917989.1| PREDICTED: LOB domain-containing protein 18-like [Elaeis guineensis]
Length=239

 Score =   241 bits (614),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 158/216 (73%), Gaps = 23/216 (11%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIP HKRLDAV+TICY
Sbjct  38   CKFLRRKCVSGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPAHKRLDAVVTICY  97

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL+YLQAHLATLE+P+ PPP    +      
Sbjct  98   EAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATLELPSPPPPPQLGAP-----  152

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAI-QPRQLDPRQLFGGGAATRVA  197
                   +I++LP+    +PAT DLS+LFDP VQP W+I Q R ++ RQ  G G+ +   
Sbjct  153  ----PPFSISNLPSS-SNLPATVDLSTLFDPQVQPQWSIQQQRPMELRQQLGPGSRSLGE  207

Query  196  TVDMTsssssaagsggggGDLQELARELMHRHGSPT  89
            +                 GDLQ LAREL+ RH + T
Sbjct  208  SSGGG------------SGDLQALARELLDRHRTTT  231



>ref|XP_004510942.1| PREDICTED: LOB domain-containing protein 18-like [Cicer arietinum]
Length=230

 Score =   240 bits (612),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 134/224 (60%), Positives = 161/224 (72%), Gaps = 27/224 (12%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC++GCIFAPYFDSEQGA+HFAAVHKVFGASNVSKLL ++PVHKRLDAVITICY
Sbjct  28   CKFLRRKCLSGCIFAPYFDSEQGASHFAAVHKVFGASNVSKLLQNVPVHKRLDAVITICY  87

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+R+RDPVYGCVAHIF LQQQVV+LQAEL+YLQ H+AT EVP  P     Q+      
Sbjct  88   EAQARMRDPVYGCVAHIFTLQQQVVSLQAELSYLQGHIATYEVPQPPKTSPPQAT-----  142

Query  373  FVPPAVLNIADLP--TGVPMMPATYDLSSLFDPMVQ-PAWAIQPRQLDPRQLFGGGAATR  203
             + P+++++A+LP  +   + PATYDLSSLFDPM Q  +WA+  R     Q FG G +T 
Sbjct  143  -IAPSMVSLANLPLASSSSINPATYDLSSLFDPMAQTSSWAMHQR--PNGQYFGSGTST-  198

Query  202  VATVDMTsssssaagsggggGDLQELARELMHRHGSPTVPCTNA  71
                           S   GGDLQ LAREL+ R+GS   P +N+
Sbjct  199  ---------------SNNSGGDLQSLARELLLRYGSSNDPSSNS  227



>ref|XP_008798540.1| PREDICTED: LOB domain-containing protein 18, partial [Phoenix 
dactylifera]
Length=243

 Score =   240 bits (613),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 139/222 (63%), Positives = 160/222 (72%), Gaps = 25/222 (11%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIP HKRLDAV+TICY
Sbjct  34   CKFLRRKCVSGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPAHKRLDAVVTICY  93

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL+YLQAHLATLE+P+ PPP        PP 
Sbjct  94   EAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATLELPSPPPPPPPLQLAAPPP  153

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAI------QPRQLDPRQLFGGGA  212
            F      +I++LP+    +PAT DLS+LFDP VQP W++        R ++PRQ  G G+
Sbjct  154  F------SISNLPSS-SNLPATVDLSTLFDPQVQPHWSLQQQQQQHQRPMEPRQQLGPGS  206

Query  211  ATRVATVDMTsssssaagsggggGDLQELARELMHRHGSPTV  86
             +   +                 GDLQ LAREL+ RH + T 
Sbjct  207  RSLGESSGGG------------SGDLQALARELLDRHRTATT  236



>ref|XP_006295913.1| hypothetical protein CARUB_v10025050mg [Capsella rubella]
 gb|EOA28811.1| hypothetical protein CARUB_v10025050mg [Capsella rubella]
Length=259

 Score =   240 bits (613),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 146/230 (63%), Positives = 173/230 (75%), Gaps = 13/230 (6%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQG+A+FAAVHKVFGASNVSKLLLHIPVH+R DAV+TICY
Sbjct  37   CKFLRRKCVPGCIFAPYFDSEQGSAYFAAVHKVFGASNVSKLLLHIPVHRRSDAVVTICY  96

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+R+RDP+YGCVAHIFALQQQVVNLQAE++YLQAHLA+LE+P         SQPQP  
Sbjct  97   EAQARIRDPIYGCVAHIFALQQQVVNLQAEVSYLQAHLASLELPQPQTRPPPLSQPQPLF  156

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMV--QPAWAIQPRQ-LDPRQLFGGGAATR  203
            F PP   +IADLP  V  +P+TYDL+S+FD       AW  Q R+ +DPRQ +G      
Sbjct  157  FTPPPPFSIADLPASVSPLPSTYDLASIFDQTTPSSAAWGTQQRRFVDPRQQYG------  210

Query  202  VATVDMTsssssaagsggggGDLQELARELMHRHGSPTVPCT-NAPSSAL  56
               V  +SSS++A G GGG  DLQ LA EL+HR GSP    T ++PS ++
Sbjct  211  ---VSSSSSSAAAIGLGGGNSDLQALAHELLHRQGSPPPAATDDSPSRSM  257



>ref|NP_850436.1| LOB domain-containing protein 18 [Arabidopsis thaliana]
 sp|O22131.2|LBD18_ARATH RecName: Full=LOB domain-containing protein 18; AltName: Full=ASYMMETRIC 
LEAVES 2-like protein 20; Short=AS2-like protein 
20 [Arabidopsis thaliana]
 gb|AAL38036.1|AF447891_1 LOB DOMAIN 18 [Arabidopsis thaliana]
 gb|AAB82622.2| expressed protein [Arabidopsis thaliana]
 gb|ABF82619.1| At2g45420 [Arabidopsis thaliana]
 dbj|BAH10564.1| ASYMMETRIC LEAVES2-like 20 protein [Arabidopsis thaliana]
 gb|AEC10551.1| LOB domain-containing protein 18 [Arabidopsis thaliana]
Length=262

 Score =   240 bits (613),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 158/216 (73%), Gaps = 11/216 (5%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQG+A+FAAVHKVFGASNVSKLLLHIPVH+R DAV+TICY
Sbjct  41   CKFLRRKCVPGCIFAPYFDSEQGSAYFAAVHKVFGASNVSKLLLHIPVHRRSDAVVTICY  100

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+R+RDP+YGCVAHIFALQQQVVNLQAE++YLQAHLA+LE+P          QPQP  
Sbjct  101  EAQARIRDPIYGCVAHIFALQQQVVNLQAEVSYLQAHLASLELPQPQTRPQPMPQPQPLF  160

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMV-QPAWAIQPRQ-LDPRQLFGGGAATRV  200
            F PP  L I DLP  V  +P+TYDL+S+FD      AWA Q R+ +DPR  +G  +++  
Sbjct  161  FTPPPPLAITDLPASVSPLPSTYDLASIFDQTTSSSAWATQQRRFIDPRHQYGVSSSSSS  220

Query  199  ATVDMTsssssaagsggggGDLQELARELMHRHGSP  92
              V +          G    DLQ LA EL+HR GSP
Sbjct  221  VAVGL---------GGENSHDLQALAHELLHRQGSP  247



>gb|KEH19039.1| LOB domain protein [Medicago truncatula]
Length=232

 Score =   238 bits (607),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 133/226 (59%), Positives = 160/226 (71%), Gaps = 27/226 (12%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC+ GCIFAPYFDSEQGA+HFAAVHKVFGASNVSKLL ++PVHKRLDAVITICY
Sbjct  27   CKFLRRKCIPGCIFAPYFDSEQGASHFAAVHKVFGASNVSKLLQNVPVHKRLDAVITICY  86

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDP++GCVAHIF LQQQV++LQAEL+YLQ HLAT EVP  P P   Q+      
Sbjct  87   EAQARLRDPIFGCVAHIFTLQQQVMSLQAELSYLQGHLATYEVPQPPTPSPPQAL-----  141

Query  373  FVPPAVLNIADLPTG-VPMMPATYDLSSLFDPMVQPAWAIQPRQLDPRQLFGGGAATRVA  197
                 ++++A+LP      MP TYDLSSL++     +W +Q R  +PRQ  G   ++   
Sbjct  142  ----PMVSLANLPLAPSSAMPDTYDLSSLYEVPQTSSWVMQQRTNEPRQYLGSDTSS---  194

Query  196  TVDMTsssssaagsggggGDLQELARELMHRHGS-PTVPCTNAPSS  62
                         +   GGDLQ LAREL+HR+GS P V C+NAPSS
Sbjct  195  -------------TSNNGGDLQALARELLHRYGSIPHVACSNAPSS  227



>ref|XP_008776002.1| PREDICTED: LOB domain-containing protein 18-like [Phoenix dactylifera]
Length=238

 Score =   235 bits (600),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 158/219 (72%), Gaps = 22/219 (10%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIP HKRLDAV+TICY
Sbjct  32   CKFLRRKCVSGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPAHKRLDAVVTICY  91

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL+YLQAHLATLE+P  PP         PP 
Sbjct  92   EAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATLELPTPPPLPPPPQLSTPPP  151

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAIQPRQLDP---RQLFGGGAATR  203
            F      +I+DLP+ +  M AT DLS+LFDP VQP W++Q +Q  P    Q  G G+ + 
Sbjct  152  F------SISDLPSSL-NMSATVDLSTLFDPQVQPHWSLQQQQQRPIALGQQLGPGSRS-  203

Query  202  VATVDMTsssssaagsggggGDLQELARELMHRHGSPTV  86
                           S GG GDLQ LAREL+ R  + T 
Sbjct  204  -----------LGESSRGGSGDLQALARELLDRQRTATT  231



>ref|XP_010228877.1| PREDICTED: LOB domain-containing protein 30-like [Brachypodium 
distachyon]
Length=260

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 143/222 (64%), Positives = 163/222 (73%), Gaps = 12/222 (5%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLL IP HKRLDAV+TICY
Sbjct  30   CKFLRRKCVSGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLQIPAHKRLDAVVTICY  89

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL YLQ HLATLE+P+ P P A    P    
Sbjct  90   EAQARLRDPVYGCVAHIFALQQQVVNLQAELTYLQTHLATLELPSPPIPAATPQMPT---  146

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQ-PAWAIQPRQLDPRQL-----FGGGA  212
              PP   +I+DLP+    +P T DLS+LFDP  Q P WA+Q +    +       +GG  
Sbjct  147  MAPPGPFSISDLPSSTLNIPTTIDLSALFDPPAQLPQWALQQQHHHHQHQLRQPPYGGAQ  206

Query  211  ATRVATVDMTsssssaagsggggGDLQELARELMHRHGSPTV  86
            A R ++       + A+G+GGGGGDLQ LAREL+ RHG   V
Sbjct  207  APRASSSMSA---AEASGAGGGGGDLQSLARELLDRHGRSGV  245



>ref|XP_002880178.1| hypothetical protein ARALYDRAFT_483677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56437.1| hypothetical protein ARALYDRAFT_483677 [Arabidopsis lyrata subsp. 
lyrata]
Length=260

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 156/216 (72%), Gaps = 13/216 (6%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQG+A+FAAVHKVFGASNVSKLLLHIPVH+R DAV+TICY
Sbjct  41   CKFLRRKCVPGCIFAPYFDSEQGSAYFAAVHKVFGASNVSKLLLHIPVHRRSDAVVTICY  100

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+R+RDP+YGCVAHIFALQQQVVNLQAE++YLQAHLA+LE+P          QP    
Sbjct  101  EAQARIRDPIYGCVAHIFALQQQVVNLQAEVSYLQAHLASLELPQPQTRPQPMPQPLFFT  160

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMV-QPAWAIQPRQ-LDPRQLFGGGAATRV  200
                  L I DLP  V  +P+TYDL+S+FD      AWA Q R+ +DPR  +G       
Sbjct  161  PP--PPLAITDLPASVSPLPSTYDLASIFDQTTSSSAWATQQRRFIDPRHQYG-------  211

Query  199  ATVDMTsssssaagsggggGDLQELARELMHRHGSP  92
              V  +SSS +A   GG   DLQ LA EL+HR GSP
Sbjct  212  --VSSSSSSVAAGLGGGNSQDLQALAHELLHRQGSP  245



>ref|XP_010277398.1| PREDICTED: LOB domain-containing protein 30-like [Nelumbo nucifera]
Length=256

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 157/214 (73%), Gaps = 21/214 (10%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAV+TICY
Sbjct  35   CKFLRRKCVIGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTICY  94

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL+YLQAHLA LE+P+ PPP           
Sbjct  95   EAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLAALELPSPPPPTLLAP------  148

Query  373  FVPPAVLNIADLPTGVPM-MPATYDLSSLFDPMVQPAWAIQPRQLDPRQLFGGGAATRVA  197
                  L+I DLP+   +   AT++LS++ DP+V P W +Q R+++ RQ FGG   +   
Sbjct  149  ----PPLSITDLPSASSIPATATFNLSTILDPVVPPHWLLQQREMELRQ-FGGSGRSPTE  203

Query  196  TVDMTsssssaagsggggGDLQELARELMHRHGS  95
                T          GGGGDLQ LAREL+ RH S
Sbjct  204  NSPPT---------AGGGGDLQALARELLQRHRS  228



>ref|XP_003534608.1| PREDICTED: LOB domain-containing protein 18-like [Glycine max]
Length=232

 Score =   233 bits (593),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 145/214 (68%), Gaps = 22/214 (10%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC+ GCIFAPYFDSEQG +HFAAVHKVFGASNVSKLLL IPVH+RLD VITICY
Sbjct  19   CKFLRRKCIPGCIFAPYFDSEQGTSHFAAVHKVFGASNVSKLLLSIPVHRRLDTVITICY  78

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQSR+RDPVYGCV+HIFALQQQVV+LQAEL+YL  HLA +E     P           +
Sbjct  79   EAQSRIRDPVYGCVSHIFALQQQVVSLQAELSYLHGHLAQME----LPQPPPPLPLPQTM  134

Query  373  FVPPAVLNIADLPT--GVPMMPATYDLSSLFDPMVQPAWAIQPRQLDPRQLFGGGAATRV  200
              PP   +IADLP+         TYDLSSLFDP+ Q +WA+Q R +DPRQ +   AA   
Sbjct  135  AAPPPGFSIADLPSATVAAAAATTYDLSSLFDPLGQTSWAMQQRAIDPRQ-YNMAAAPST  193

Query  199  ATVDMTsssssaagsggggGDLQELARELMHRHG  98
            AT                  D+Q +A ++ HRHG
Sbjct  194  ATTG---------------ADIQAVASDIPHRHG  212



>emb|CDY18932.1| BnaC04g04180D [Brassica napus]
Length=251

 Score =   232 bits (592),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 137/228 (60%), Positives = 167/228 (73%), Gaps = 18/228 (8%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQG+A+FAAVHKVFGASNVSKLLLHIPVH+R DAV+TICY
Sbjct  38   CKFLRRKCVPGCIFAPYFDSEQGSAYFAAVHKVFGASNVSKLLLHIPVHRRADAVVTICY  97

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+R+RDP+YGCVA+IFALQQQVVNLQAE++YLQAHLA+LE+P         +QPQP  
Sbjct  98   EAQARIRDPIYGCVANIFALQQQVVNLQAEVSYLQAHLASLELPQPQTRPPPLTQPQPLF  157

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAIQPRQ-LDPRQLFGGGAATRVA  197
            F PP  L+I DLP  V    + YDL+S+ DP    +WA Q R+ +DPR  +GG +++  A
Sbjct  158  FTPPPPLSITDLPASV----SPYDLASIVDPPT--SWATQQRRFVDPRNQYGGSSSSSSA  211

Query  196  TVDMTsssssaagsggggGDLQELARELMHRHGSPTVPCTN-APSSAL  56
             V +           GG  DLQ LA EL+HR GSP    T+ +PS ++
Sbjct  212  AVGLG----------GGNSDLQALAHELLHRQGSPPPAATDGSPSRSM  249



>ref|XP_007139994.1| hypothetical protein PHAVU_008G075900g [Phaseolus vulgaris]
 gb|ESW11988.1| hypothetical protein PHAVU_008G075900g [Phaseolus vulgaris]
Length=225

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 133/216 (62%), Positives = 151/216 (70%), Gaps = 31/216 (14%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC+ GCIFAPYFD+EQG  HFAAVHKVFGASNVSKLLL IPVHKRLDAVITICY
Sbjct  18   CKFLRRKCIPGCIFAPYFDAEQGTNHFAAVHKVFGASNVSKLLLSIPVHKRLDAVITICY  77

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQSRLRDPVYGCV+HIFALQQQVVNLQAEL+YLQ H A +EVP+ PPP   QS      
Sbjct  78   EAQSRLRDPVYGCVSHIFALQQQVVNLQAELSYLQGHFAQMEVPHPPPPPLTQS------  131

Query  373  FVPPAVLNIADLPT--GVPMMPATYDLSSLFDPMVQPAWAIQPRQLDPRQLFGG--GAAT  206
             V     +++DLP+        ATYDLSSLFDP  Q +WA+Q R +DPRQ  G    A+T
Sbjct  132  -VATPRFSVSDLPSTTAAAAATATYDLSSLFDPTGQVSWAMQHRAMDPRQYMGHPPSAST  190

Query  205  RVATVDMTsssssaagsggggGDLQELARELMHRHG  98
            RV                    ++Q +A +L HRHG
Sbjct  191  RV--------------------NVQAVAGDLSHRHG  206



>ref|XP_009400358.1| PREDICTED: LOB domain-containing protein 18-like [Musa acuminata 
subsp. malaccensis]
Length=241

 Score =   230 bits (587),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 134/224 (60%), Positives = 149/224 (67%), Gaps = 41/224 (18%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIP HKRLDAV+TICY
Sbjct  42   CKFLRRKCVTGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPAHKRLDAVVTICY  101

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL+YLQAHLATLE+P+ PPP    S      
Sbjct  102  EAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATLELPSPPPPPPPPSLVASMP  161

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMV---------QPAWAIQPRQLDPRQLFG  221
            F      +I+DLP+    +P+T DLS+LFDP+V         Q   +   R L     FG
Sbjct  162  F------SISDLPSAA-NLPSTVDLSALFDPLVQPLWPLQQQQLQLSTSTRNLSESSGFG  214

Query  220  GGAATRVATVDMTsssssaagsggggGDLQELARELMHRHGSPT  89
            GG                         DLQ LAREL+ R  + T
Sbjct  215  GG-------------------------DLQALARELLDRQRTAT  233



>gb|KFK37335.1| hypothetical protein AALP_AA4G243200 [Arabis alpina]
Length=262

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 142/234 (61%), Positives = 169/234 (72%), Gaps = 20/234 (9%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQG+A+FAAVHKVFGASNVSKLLLHIPVH+R DAV+TICY
Sbjct  39   CKFLRRKCVPGCIFAPYFDSEQGSAYFAAVHKVFGASNVSKLLLHIPVHRRSDAVVTICY  98

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE----vpnapppvaqqsqp  386
            EAQ+R+RDP+YGCVAHIFALQQQVVNLQ+E++YLQAHLA+LE        PP    Q QP
Sbjct  99   EAQARIRDPIYGCVAHIFALQQQVVNLQSEVSYLQAHLASLELPQPQTRPPPLPQPQPQP  158

Query  385  qpPLFVPPAVLNIADLPTGVPMMPATYDLSSLFDPMV--QPAWAIQPRQ-LDPRQLFGGG  215
            QP  F PP  L+I DLP  V  +P+TYDL+S+FD       +WA Q R+ +DPR  +G  
Sbjct  159  QPLFFTPPPPLSITDLPASVSPLPSTYDLASIFDHQTTSSSSWATQQRRFVDPRHQYG--  216

Query  214  AATRVATVDMTsssssaagsggggGDLQELARELMHRHGSPTVPCT-NAPSSAL  56
                        S+SS  G GGG  +LQ LA EL+HR GSP    T ++PS ++
Sbjct  217  ----------VPSTSSGVGLGGGNSELQALAHELLHRQGSPPPAATDDSPSRSM  260



>ref|XP_009391108.1| PREDICTED: LOB domain-containing protein 18-like [Musa acuminata 
subsp. malaccensis]
Length=242

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 133/220 (60%), Positives = 146/220 (66%), Gaps = 41/220 (19%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC+AGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIP HKRLDA +TICY
Sbjct  43   CKFLRRKCMAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPAHKRLDAAVTICY  102

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL+YLQAHLATLE        +      PPL
Sbjct  103  EAQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLATLE------LPSPPPPLPPPL  156

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAW---------AIQPRQLDPRQLFG  221
             V P    I+DLP+    +P   DLS+LF+P+VQPAW         +   R    R  FG
Sbjct  157  VVAPIPFAISDLPSAA-NLPTAVDLSTLFNPLVQPAWTLQQQQQQLSTSTRSPCERSGFG  215

Query  220  GGAATRVATVDMTsssssaagsggggGDLQELARELMHRH  101
            GG                         DLQ LAREL+ RH
Sbjct  216  GG-------------------------DLQALARELLDRH  230



>ref|XP_009143140.1| PREDICTED: LOB domain-containing protein 18 [Brassica rapa]
Length=253

 Score =   228 bits (582),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 135/227 (59%), Positives = 166/227 (73%), Gaps = 18/227 (8%)
 Frame = -1

Query  730  KFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICYE  551
            KFLRRKCV GCIFAPYFDSEQG+A+FAAVHKVFGASNVSKLLLHIPVH+R DAV+TICYE
Sbjct  41   KFLRRKCVPGCIFAPYFDSEQGSAYFAAVHKVFGASNVSKLLLHIPVHRRADAVVTICYE  100

Query  550  AQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPLF  371
            AQ+R+RDP+YGCVAHIFALQQQVVNLQAE++YLQ+HLA+LE+P         +QPQP  F
Sbjct  101  AQARIRDPIYGCVAHIFALQQQVVNLQAEVSYLQSHLASLELPQPQTRPPPITQPQPLFF  160

Query  370  VPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAIQPRQ-LDPRQLFGGGAATRVAT  194
             PP  L+I DLP  V    + YDL+++ DP    +WA Q R+ +DPR  +GG +++  A 
Sbjct  161  TPPPPLSITDLPASV----SPYDLATIVDPPT--SWATQQRRFVDPRNQYGGSSSSSSAA  214

Query  193  VDMTsssssaagsggggGDLQELARELMHRHGSPTVPCTN-APSSAL  56
            V +           GG  DLQ LA EL+HR GSP    T+ +PS ++
Sbjct  215  VGLG----------GGNSDLQALAHELLHRQGSPPPAATDGSPSRSM  251



>ref|XP_003552342.1| PREDICTED: LOB domain-containing protein 18-like [Glycine max]
Length=234

 Score =   228 bits (580),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 150/214 (70%), Gaps = 22/214 (10%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAPYFDSEQG +HFAAVHKVFGASNVSKLLL IPVH+RLD VITICY
Sbjct  21   CKFLRRKCVSGCIFAPYFDSEQGTSHFAAVHKVFGASNVSKLLLSIPVHRRLDTVITICY  80

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQSR+RDPVYGCVAHIFALQQQ+V+LQAEL+YL  HLA +E+P   PP         P 
Sbjct  81   EAQSRIRDPVYGCVAHIFALQQQLVSLQAELSYLHGHLAQMELPQPSPPPPPPQTTAAPP  140

Query  373  FVPPAVLNIADL-PTGVPMMPA-TYDLSSLFDPMVQPAWAIQPRQLDPRQLFGGGAATRV  200
                +  +IADL P  V  +PA TYDLSSLFDP+ Q +WA+Q R +D RQ     AA   
Sbjct  141  ----SGFSIADLPPATVAAVPATTYDLSSLFDPLGQTSWAMQQRAIDLRQYLAAAAAPST  196

Query  199  ATVDMTsssssaagsggggGDLQELARELMHRHG  98
             +                G D+Q +AR++ HRHG
Sbjct  197  TS----------------GADIQAVARDIPHRHG  214



>ref|XP_006288584.1| hypothetical protein CARUB_v10001875mg [Capsella rubella]
 gb|EOA21482.1| hypothetical protein CARUB_v10001875mg [Capsella rubella]
Length=231

 Score =   223 bits (568),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 154/225 (68%), Gaps = 23/225 (10%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLH+P HKR DAV++IC+
Sbjct  23   CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHVPEHKRPDAVVSICF  82

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDP+YGCV+HI +LQQQV++LQ EL+YLQAHLATLE+P   PP    S      
Sbjct  83   EAQARLRDPIYGCVSHIVSLQQQVLSLQTELSYLQAHLATLELPQPQPPAVPVSSSGS--  140

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAIQPRQLDPRQLFGGGAATRVAT  194
              P   L+I DLPT   + P+ YDLSS+F+P++   WA+Q +      LFG         
Sbjct  141  --PLQALSITDLPT---ISPSVYDLSSIFEPVMSSTWAMQQQPRPSDHLFG---------  186

Query  193  VDMTsssssaagsggggGDLQELARELMHRHGSPTVPCTNAPSSA  59
                     ++ S GGGGDLQ LARE +H    P+ P      SA
Sbjct  187  -------LPSSSSIGGGGDLQALAREFIHGGQMPSQPSPGTSGSA  224



>ref|NP_001132370.1| putative LOB domain-containing family protein [Zea mays]
 gb|ACF81185.1| unknown [Zea mays]
 gb|AFW88995.1| putative LOB domain-containing family protein [Zea mays]
 gb|AIB05953.1| LOB transcription factor, partial [Zea mays]
Length=265

 Score =   223 bits (569),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 145/247 (59%), Positives = 159/247 (64%), Gaps = 44/247 (18%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLL IP HKRLDAV+TICY
Sbjct  47   CKFLRRKCVSGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLQIPPHKRLDAVVTICY  106

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL YLQAHLATLE+P+ PP  A    P P  
Sbjct  107  EAQARLRDPVYGCVAHIFALQQQVVNLQAELTYLQAHLATLELPSPPPLPAPPQMPMPGP  166

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAIQPRQLDPRQLF----------  224
            F      +IADLP+    +P T DLS+LFDP   P WA+       +QL           
Sbjct  167  F------SIADLPSST-SVPTTVDLSTLFDP--PPQWAVHQPHHHHQQLQQHQLRQPAPY  217

Query  223  ------GGGAATRVATVDMTsssssaagsggggGDLQELARELMHRHGSPTVPCTNAPSS  62
                  GGG A   +               GG GDLQ LAREL+ RH S  V        
Sbjct  218  GAPVRPGGGMAAESSG--------------GGSGDLQSLARELLDRHRSGGVKLEPP---  260

Query  61   ALPPHSK  41
              PPHS+
Sbjct  261  --PPHSR  265



>ref|XP_006649734.1| PREDICTED: LOB domain-containing protein 18-like [Oryza brachyantha]
Length=265

 Score =   223 bits (569),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 157/216 (73%), Gaps = 9/216 (4%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLL IP HKR DAV+TICY
Sbjct  40   CKFLRRKCVSGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLQIPAHKRPDAVVTICY  99

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL YLQAHLATLE+P+ PP +    Q   P 
Sbjct  100  EAQARLRDPVYGCVAHIFALQQQVVNLQAELTYLQAHLATLELPSPPPLMPAPPQMPMP-  158

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWA---IQPRQLDPRQLFGGGAATR  203
                A  +I+DLP+    +P T DLS+LFDP  QP WA    QP+Q    Q         
Sbjct  159  ----APFSISDLPSSTS-VPTTVDLSALFDPPPQPQWAPLQHQPQQHHHHQQQHQLRQQS  213

Query  202  VATVDMTsssssaagsggggGDLQELARELMHRHGS  95
              T+   +S   A  SGGGGGDLQ LAREL+ RH S
Sbjct  214  YGTLARAASGMPAESSGGGGGDLQALARELLDRHRS  249



>ref|NP_001167808.1| uncharacterized protein LOC100381506 [Zea mays]
 gb|ACN26128.1| unknown [Zea mays]
 tpg|DAA44372.1| TPA: putative LOB domain-containing family protein [Zea mays]
Length=260

 Score =   223 bits (569),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 143/246 (58%), Positives = 157/246 (64%), Gaps = 38/246 (15%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLL IP HKRLDAV+TICY
Sbjct  38   CKFLRRKCVSGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLQIPAHKRLDAVVTICY  97

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL YLQAHLATLE+P  PP  A    P P  
Sbjct  98   EAQARLRDPVYGCVAHIFALQQQVVNLQAELTYLQAHLATLELPAPPPLPAPPQMPMPGP  157

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAIQP---------------RQLD  239
            F      +I+DLP     +P T DLS+LFDP   P WA                  RQ  
Sbjct  158  F------SISDLPLST-SVPTTVDLSALFDP-PPPQWATAQQPHHHHQQPPQHHQLRQPA  209

Query  238  PRQLFGGGAATRVATVDMTsssssaagsggggGDLQELARELMHRHGSPTVPCTNAPSSA  59
            P   +G GA+ R                  GG +LQ LAREL+ RH S  V   +     
Sbjct  210  P---YGAGASVRPGG-------GPGMAESSGGDELQSLARELLDRHRSGGVKLEHP----  255

Query  58   LPPHSK  41
             PPHS+
Sbjct  256  -PPHSR  260



>ref|XP_010053892.1| PREDICTED: LOB domain-containing protein 30-like [Eucalyptus 
grandis]
Length=248

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 132/225 (59%), Positives = 153/225 (68%), Gaps = 24/225 (11%)
 Frame = -1

Query  730  KFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICYE  551
            KFLRRKC+ GC+FAPYFDSEQGAAHFAAVH+VFGASN SKLLL+IP H+R DAV+ ICYE
Sbjct  31   KFLRRKCITGCVFAPYFDSEQGAAHFAAVHRVFGASNASKLLLNIPAHRRQDAVVAICYE  90

Query  550  AQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPLF  371
            AQ+RLRDPVYGCVAHIFALQQQVVNLQAEL+YLQAHL  LE+P  P P     Q      
Sbjct  91   AQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLGPLELPTQPLPPLLPMQLP----  146

Query  370  VPPAVLNIADL--PTGVPMMPATYDLSSLFDPMVQP-AWA---IQPRQLDPRQLFGGGAA  209
            V P  L+IADL  P+  P MPA YD+SSLFDP V P +WA   +  R +DPRQ F GG +
Sbjct  147  VAPHSLSIADLPIPSASPSMPAQYDVSSLFDPTVHPSSWAAGTLLRRTIDPRQ-FSGGCS  205

Query  208  TRVATVDMTsssssaagsggggGDLQELARELMHRHGSPTVPCTN  74
                 V+             G GDL+ L  E +     P +P T+
Sbjct  206  LPTTMVE-------------GEGDLRALTSEFLSTQCPPRMPDTS  237



>gb|ABK28616.1| unknown [Arabidopsis thaliana]
Length=229

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 124/225 (55%), Positives = 150/225 (67%), Gaps = 24/225 (11%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLL H+P HKR DAV++IC+
Sbjct  21   CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLHHVPEHKRPDAVVSICF  80

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDP+YGCV+HI +LQQQVV+LQ EL+YLQAHLATLE+P   PP    S      
Sbjct  81   EAQARLRDPIYGCVSHIVSLQQQVVSLQTELSYLQAHLATLELPQPQPPQVPVSSSGSL-  139

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAIQPRQLDPRQLFGGGAATRVAT  194
                  L+I DLPT   + P+ YDLSS+F+P++   WA+Q +      LFG  +++ +  
Sbjct  140  ----QALSITDLPT---ISPSVYDLSSIFEPVMSSTWAMQQQPRPSDHLFGVPSSSNMGG  192

Query  193  VDMTsssssaagsggggGDLQELARELMHRHGSPTVPCTNAPSSA  59
                            GG+LQ LARE +H    P  P      SA
Sbjct  193  ----------------GGELQALAREFIHGGQMPAQPSPGTSGSA  221



>ref|NP_191933.1| protein JAGGED LATERAL ORGANS [Arabidopsis thaliana]
 sp|O81323.1|LBD30_ARATH RecName: Full=LOB domain-containing protein 30; AltName: Full=ASYMMETRIC 
LEAVES 2-like protein 19; Short=AS2-like protein 
19 [Arabidopsis thaliana]
 gb|AAL27613.1|AF432232_1 LOB DOMAIN 30 [Arabidopsis thaliana]
 gb|AAC19300.1| F6N15.4 gene product [Arabidopsis thaliana]
 emb|CAB80780.1| predicted protein of unknown function [Arabidopsis thaliana]
 gb|ABE66037.1| LOB domain protein 30/lateral organ boundaries domain protein 
30 [Arabidopsis thaliana]
 gb|ABH04514.1| At4g00220 [Arabidopsis thaliana]
 dbj|BAH10563.1| ASYMMETRIC LEAVES2-like 19 protein [Arabidopsis thaliana]
 gb|AEE81839.1| LOB domain-containing protein 30 [Arabidopsis thaliana]
Length=228

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 124/225 (55%), Positives = 150/225 (67%), Gaps = 24/225 (11%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLL H+P HKR DAV++IC+
Sbjct  21   CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLHHVPEHKRPDAVVSICF  80

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDP+YGCV+HI +LQQQVV+LQ EL+YLQAHLATLE+P   PP    S      
Sbjct  81   EAQARLRDPIYGCVSHIVSLQQQVVSLQTELSYLQAHLATLELPQPQPPQVPVSSSGSL-  139

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAIQPRQLDPRQLFGGGAATRVAT  194
                  L+I DLPT   + P+ YDLSS+F+P++   WA+Q +      LFG  +++ +  
Sbjct  140  ----QALSITDLPT---ISPSVYDLSSIFEPVMSSTWAMQQQPRPSDHLFGVPSSSNMGG  192

Query  193  VDMTsssssaagsggggGDLQELARELMHRHGSPTVPCTNAPSSA  59
                            GG+LQ LARE +H    P  P      SA
Sbjct  193  ----------------GGELQALAREFIHGGQMPAQPSPGTSGSA  221



>ref|XP_004985011.1| PREDICTED: LOB domain-containing protein 18-like [Setaria italica]
Length=259

 Score =   221 bits (562),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 154/217 (71%), Gaps = 8/217 (4%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLL IP +KRLDAV+TICY
Sbjct  37   CKFLRRKCVSGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLQIPAYKRLDAVVTICY  96

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL YLQAHLATLE+P+ PP  A    P P  
Sbjct  97   EAQARLRDPVYGCVAHIFALQQQVVNLQAELTYLQAHLATLELPSPPPLPAPPQMPMPGP  156

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQ-PAWAIQPRQLDPRQLFGGGAATRVA  197
            F      +I+DLP+    +P T DLS+LFDP  Q P WA+Q +    +            
Sbjct  157  F------SISDLPSST-NVPTTVDLSALFDPPPQPPQWAVQQQHHHHQHQQQHQLRQPTP  209

Query  196  TVDMTsssssaagsggggGDLQELARELMHRHGSPTV  86
                    S  A S GGGGDLQ LAREL+ RH S  V
Sbjct  210  YAAPVRGGSGVAESSGGGGDLQALARELLDRHRSGGV  246



>ref|XP_002875043.1| LOB domain protein 30 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51302.1| LOB domain protein 30 [Arabidopsis lyrata subsp. lyrata]
Length=226

 Score =   219 bits (557),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 122/225 (54%), Positives = 149/225 (66%), Gaps = 24/225 (11%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLL H+P HKR DAV++IC+
Sbjct  19   CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLQHVPEHKRPDAVVSICF  78

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDP+YGCV+HI +LQQQVV+LQ EL+YLQAHLATLE+P   PP    S      
Sbjct  79   EAQARLRDPIYGCVSHIVSLQQQVVSLQTELSYLQAHLATLELPQPQPPQVPVSSSGSL-  137

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAIQPRQLDPRQLFGGGAATRVAT  194
                  L+I DLP+   + P+ YDLSS+F+P++   WA+Q +      LFG  +++ +  
Sbjct  138  ----QALSITDLPS---ISPSVYDLSSIFEPVMSSTWAMQQQPRPSDHLFGVPSSSNIGG  190

Query  193  VDMTsssssaagsggggGDLQELARELMHRHGSPTVPCTNAPSSA  59
                            GG+LQ LARE +H    P  P      S 
Sbjct  191  ----------------GGELQALAREFIHGGQMPAQPSPGTSGSG  219



>ref|NP_001049546.1| Os03g0246900 [Oryza sativa Japonica Group]
 gb|ABF94951.1| LOB domain protein 18, putative [Oryza sativa Japonica Group]
 dbj|BAF11460.1| Os03g0246900 [Oryza sativa Japonica Group]
 gb|EEE58693.1| hypothetical protein OsJ_10128 [Oryza sativa Japonica Group]
Length=275

 Score =   220 bits (560),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 149/245 (61%), Positives = 165/245 (67%), Gaps = 25/245 (10%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLL IP HKR DAV+TICY
Sbjct  41   CKFLRRKCVSGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLQIPAHKRPDAVVTICY  100

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL YLQAHLATLE+P+ PP +    Q   P 
Sbjct  101  EAQARLRDPVYGCVAHIFALQQQVVNLQAELTYLQAHLATLELPSPPPLMPAPPQMPMP-  159

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWA------------IQPRQLDPRQ  230
                A  +I+DLP+    +P T DLS+LFDP  QP WA                Q    Q
Sbjct  160  ----APFSISDLPSST-SVPTTVDLSALFDPPPQPQWASPLQQQQHHHHQHHHHQQQQHQ  214

Query  229  LFGGGAAT--RVATVDMTsssssaagsggggGDLQELARELMHRHGSPTVPCTNAPSSAL  56
            L     AT  R  +    ++ SS  G GGGGGDLQ LAREL+ RH S  V     P    
Sbjct  215  LRQPSYATLARAPSGMTAAAESSGGGGGGGGGDLQALARELLDRHRS-AVKLEQPP----  269

Query  55   PPHSK  41
            PPHS+
Sbjct  270  PPHSR  274



>gb|EAY89242.1| hypothetical protein OsI_10739 [Oryza sativa Indica Group]
Length=276

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 149/245 (61%), Positives = 165/245 (67%), Gaps = 25/245 (10%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLL IP HKR DAV+TICY
Sbjct  42   CKFLRRKCVSGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLQIPAHKRPDAVVTICY  101

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNLQAEL YLQAHLATLE+P+ PP +    Q   P 
Sbjct  102  EAQARLRDPVYGCVAHIFALQQQVVNLQAELTYLQAHLATLELPSPPPLMPAPPQMPMP-  160

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWA------------IQPRQLDPRQ  230
                A  +I+DLP+    +P T DLS+LFDP  QP WA                Q    Q
Sbjct  161  ----APFSISDLPSST-SVPTTVDLSALFDPPPQPQWASPLQQQQHHHHQHHHHQQQQHQ  215

Query  229  LFGGGAAT--RVATVDMTsssssaagsggggGDLQELARELMHRHGSPTVPCTNAPSSAL  56
            L     AT  R  +    ++ SS  G GGGGGDLQ LAREL+ RH S  V     P    
Sbjct  216  LRQPSYATLARAPSGMTAAAESSGGGGGGGGGDLQALARELLDRHRS-AVKLEQPP----  270

Query  55   PPHSK  41
            PPHS+
Sbjct  271  PPHSR  275



>ref|XP_007052036.1| LOB domain-containing protein 18, putative [Theobroma cacao]
 gb|EOX96193.1| LOB domain-containing protein 18, putative [Theobroma cacao]
Length=292

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 143/284 (50%), Positives = 170/284 (60%), Gaps = 81/284 (29%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAV+TICY
Sbjct  30   CKFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTICY  89

Query  553  EAQSRLRDPV----------------------------------------------YGCV  512
            EAQ+RLRDPV                                              YG  
Sbjct  90   EAQARLRDPVYGCVAHIFALQQQEAVPDIDHRKGVSKHPYPFHTSSEGLDGIRNGTYGKE  149

Query  511  AHIFA--------LQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPLFVPPAV  356
              ++         +++ VVNLQAEL+YLQAHLATLE+P+ PPP    +     L  PP  
Sbjct  150  EKMYGVHAASGAGIKEMVVNLQAELSYLQAHLATLELPSPPPPPPPSTT----LMAPPP-  204

Query  355  LNIADLPTGVPMMPATYDLSSLFDPMVQPAWAIQPRQLDPRQLFGGGAATRVATVDMTss  176
            L+I+DLP+    +PATYDLSSLFDP+VQ +W +Q RQ+DPRQ  G G+++   +      
Sbjct  205  LSISDLPSA-SSVPATYDLSSLFDPVVQHSWGMQQRQIDPRQFGGSGSSSLTGSG-----  258

Query  175  sssaagsggggGDLQELARELMHRHGSPT---VPCTNA-PSSAL  56
                        DLQ LAREL+HR GSP    +PCT+A PS +L
Sbjct  259  ------------DLQALARELLHRQGSPQHGCLPCTDASPSQSL  290



>ref|XP_010544656.1| PREDICTED: LOB domain-containing protein 18-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010544657.1| PREDICTED: LOB domain-containing protein 18-like isoform X3 [Tarenaya 
hassleriana]
Length=231

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 141/220 (64%), Gaps = 32/220 (15%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQGA +FAAVHKVFGASNVSKLLL IPVHKR DAVITI Y
Sbjct  17   CKFLRRKCVPGCIFAPYFDSEQGATYFAAVHKVFGASNVSKLLLQIPVHKRSDAVITISY  76

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EA +RLRDPVYGCVA IFALQQQVVNLQ EL++LQAHLATLE P   PP        P  
Sbjct  77   EAHARLRDPVYGCVAQIFALQQQVVNLQTELSFLQAHLATLEPPQLRPPPPPPPVVVP--  134

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMV------QPAWA-IQPRQLDPRQLFGGG  215
                  L I+DLP      P TYDLSS FDP          +WA +Q R +DPRQ +G  
Sbjct  135  ----PPLTISDLPVFSASPPTTYDLSSFFDPTALRTPSSSSSWANMQRRIVDPRQQYGAV  190

Query  214  AATRVATVDMTsssssaagsggggGDLQELARELMHRHGS  95
            +++                    G +LQ LA EL  RH S
Sbjct  191  SSS-------------------SGNELQTLAHELFQRHVS  211



>ref|XP_002465559.1| hypothetical protein SORBIDRAFT_01g041130 [Sorghum bicolor]
 gb|EER92557.1| hypothetical protein SORBIDRAFT_01g041130 [Sorghum bicolor]
Length=276

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 149/247 (60%), Positives = 162/247 (66%), Gaps = 31/247 (13%)
 Frame = -1

Query  730  KFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICYE  551
            KFLRRKCV+GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLL IP HKRLDAV+TICYE
Sbjct  44   KFLRRKCVSGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLQIPAHKRLDAVVTICYE  103

Query  550  AQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPLF  371
            AQ+RLRDPVYGCVAHIFALQQQVVNLQAEL YLQAHLATLE+P+ PP  A    P P  F
Sbjct  104  AQARLRDPVYGCVAHIFALQQQVVNLQAELTYLQAHLATLELPSPPPLPAPPQMPLPGAF  163

Query  370  VPPAVLNIADLPTGVPMMPATYDLSSLFD-PMVQPAWAIQPRQLDP--------------  236
                  +I+DLP+    +P T DLS+LFD P  QP WA+Q  Q                 
Sbjct  164  ------SISDLPSST-SVPTTVDLSALFDPPPQQPQWAVQAAQPHHHHHHHQQPQQQQHH  216

Query  235  --RQLFGGGAATRVATVDMTsssssaagsggggGDLQELARELMHRHGSPTVPCTNAPSS  62
              RQ    GA  R            A  SGGGG DLQ LAREL+ RH S  V     P  
Sbjct  217  QLRQPAPYGAPVRPGGGGPG----MAESSGGGGDDLQSLARELLDRHRSGGVKLEQPPP-  271

Query  61   ALPPHSK  41
              PPHS+
Sbjct  272  --PPHSR  276



>gb|EYU30570.1| hypothetical protein MIMGU_mgv1a013332mg [Erythranthe guttata]
Length=223

 Score =   216 bits (550),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 137/168 (82%), Gaps = 10/168 (6%)
 Frame = -1

Query  730  KFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICYE  551
            KFLRRKC AGC+F+PYF+SEQGAAHFAAVHKVFGASNVSKLLLHIPV KRLDAV+TICYE
Sbjct  22   KFLRRKCAAGCVFSPYFESEQGAAHFAAVHKVFGASNVSKLLLHIPVQKRLDAVVTICYE  81

Query  550  AQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPLF  371
            AQ+RLRDPVYGCVAHIFALQQQVVNLQAEL+YLQAHLA  E+P  PP +     P PP  
Sbjct  82   AQARLRDPVYGCVAHIFALQQQVVNLQAELSYLQAHLAAFEIPTPPPALPPPLTPPPP--  139

Query  370  VPPAVLNIADLPTGVPMMPATY--DLSSLFDPMVQPAWAI--QPRQLD  239
               A+L+I+DLPT V  +P+TY  DLSS+FD  + P W +  Q R+LD
Sbjct  140  ---ALLSISDLPT-VSAVPSTYNHDLSSIFDSTLHPTWTMNHQCRELD  183



>ref|XP_010426737.1| PREDICTED: LOB domain-containing protein 30 [Camelina sativa]
Length=225

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 132/171 (77%), Gaps = 11/171 (6%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIP HKR DAV++IC+
Sbjct  20   CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPEHKRPDAVVSICF  79

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDP+YGCV+HI +LQQQVV+LQ EL+YLQAHLATLE+P    PV+     Q   
Sbjct  80   EAQARLRDPIYGCVSHIVSLQQQVVSLQTELSYLQAHLATLELPQPMAPVSSSGSLQ---  136

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAIQPRQLDPRQLFG  221
                  L+I DLPT   + P+ YDLSS F+P++   WA+Q +      +FG
Sbjct  137  -----ALSITDLPT---ISPSLYDLSSFFEPVMSSTWAMQQQPRPSDHVFG  179



>ref|XP_009386566.1| PREDICTED: LOB domain-containing protein 30-like [Musa acuminata 
subsp. malaccensis]
Length=257

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 154/224 (69%), Gaps = 30/224 (13%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC+AGCIFAPYFD+EQGAA FAAVHKVFGASN SKLLLHIP HKR DAVITICY
Sbjct  47   CKFLRRKCMAGCIFAPYFDAEQGAARFAAVHKVFGASNASKLLLHIPAHKRHDAVITICY  106

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVV+LQAEL+YLQAHLATLE+P+ PPP    S   P  
Sbjct  107  EAQARLRDPVYGCVAHIFALQQQVVSLQAELSYLQAHLATLELPSPPPPPPPPSLLAPTP  166

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAIQ---------PRQLDPRQLFG  221
            F      + +DL T    +P+T DLS++FDP VQP W +Q         P +L P     
Sbjct  167  F------STSDL-TSASSLPSTGDLSTMFDPQVQPEWPLQQQQQQQQRPPTELRPH----  215

Query  220  GGAATRVATVDMTsssssaagsggggGDLQELARELMHRHGSPT  89
               + R   V            G GGGDLQ LAREL+ RH S T
Sbjct  216  --LSNRARNV--------LGNPGCGGGDLQALARELLDRHRSTT  249



>ref|XP_010456310.1| PREDICTED: LOB domain-containing protein 30-like [Camelina sativa]
Length=225

 Score =   212 bits (540),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 131/171 (77%), Gaps = 11/171 (6%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCVAGCIFAPYFD EQGAAHFAAVHKVFGASNVSKLLLHIP HKR DAV++IC+
Sbjct  20   CKFLRRKCVAGCIFAPYFDFEQGAAHFAAVHKVFGASNVSKLLLHIPEHKRPDAVVSICF  79

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDP+YGCV+HI +LQQQVV+LQ EL+YLQAHLATLE+P    PV+     Q   
Sbjct  80   EAQARLRDPIYGCVSHIVSLQQQVVSLQTELSYLQAHLATLELPQPMAPVSSSGSLQ---  136

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAIQPRQLDPRQLFG  221
                  L+I DLPT   + P+ YDLSS F+P++   WA+Q +      +FG
Sbjct  137  -----ALSITDLPT---ISPSLYDLSSFFEPVMSSTWAMQQQPRPSDHVFG  179



>ref|XP_010544655.1| PREDICTED: LOB domain-containing protein 18-like isoform X1 [Tarenaya 
hassleriana]
Length=234

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 141/223 (63%), Gaps = 35/223 (16%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQGA +FAAVHKVFGASNVSKLLL IPVHKR DAVITI Y
Sbjct  17   CKFLRRKCVPGCIFAPYFDSEQGATYFAAVHKVFGASNVSKLLLQIPVHKRSDAVITISY  76

Query  553  EAQSRLRDPVYGCVAHIFALQQQ---VVNLQAELAYLQAHLATLEvpnapppvaqqsqpq  383
            EA +RLRDPVYGCVA IFALQQQ   VVNLQ EL++LQAHLATLE P   PP        
Sbjct  77   EAHARLRDPVYGCVAQIFALQQQVRSVVNLQTELSFLQAHLATLEPPQLRPPPPPPPVVV  136

Query  382  pPLFVPPAVLNIADLPTGVPMMPATYDLSSLFDPMV------QPAWA-IQPRQLDPRQLF  224
            P        L I+DLP      P TYDLSS FDP          +WA +Q R +DPRQ +
Sbjct  137  P------PPLTISDLPVFSASPPTTYDLSSFFDPTALRTPSSSSSWANMQRRIVDPRQQY  190

Query  223  GGGAATRVATVDMTsssssaagsggggGDLQELARELMHRHGS  95
            G  +++                    G +LQ LA EL  RH S
Sbjct  191  GAVSSS-------------------SGNELQTLAHELFQRHVS  214



>ref|XP_009111504.1| PREDICTED: LOB domain-containing protein 30 [Brassica rapa]
 emb|CDY07236.1| BnaCnng02510D [Brassica napus]
Length=224

 Score =   211 bits (537),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 145/211 (69%), Gaps = 31/211 (15%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLL H+P HKR DAV++IC+
Sbjct  19   CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLQHVPEHKRADAVVSICF  78

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDP+YGCV+HI +LQQQVV+LQ EL+Y+QAHLATLE+P  PP     S      
Sbjct  79   EAQARLRDPIYGCVSHIVSLQQQVVSLQTELSYVQAHLATLELPQPPPAPVTSSGS----  134

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAI--QPRQLDPRQLFGGGAATRV  200
               P  L+I+DLPT   + P+ Y+LS +F+PM    W +  QPR  D   LFG  +++ +
Sbjct  135  ---PPPLSISDLPT---ITPSLYELSPIFEPMSS-TWTMQQQPRPFD--HLFGVPSSSTI  185

Query  199  ATVDMTsssssaagsggggGDLQELARELMH  107
                                +LQ LAR+ +H
Sbjct  186  GG----------------SSELQALARDFLH  200



>ref|XP_009389181.1| PREDICTED: LOB domain-containing protein 18-like [Musa acuminata 
subsp. malaccensis]
Length=236

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 144/216 (67%), Gaps = 32/216 (15%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYF+SEQGAAHFAAVHKVFGASN SKLLLHIP HKRLDAV+TICY
Sbjct  31   CKFLRRKCVTGCIFAPYFNSEQGAAHFAAVHKVFGASNASKLLLHIPAHKRLDAVVTICY  90

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNL AEL+ LQAHLATLE                 L
Sbjct  91   EAQARLRDPVYGCVAHIFALQQQVVNLHAELSCLQAHLATLE-----------------L  133

Query  373  FVPPAVLN-----IADLPTGVPMMPATYDLSSLFDPMVQPAWAIQPRQLDPRQLFGGGAA  209
              PP  L           +    +P+T DLS+LFDP + P+W +Q +Q     +     +
Sbjct  134  PTPPPSLASPIPFSMSDLSSSSTLPSTADLSTLFDPPLLPSWPLQQQQRPTLFMQQRSTS  193

Query  208  TRVATVDMTsssssaagsggggGDLQELARELMHRH  101
            TR  +            SG GGGDLQELAREL+ RH
Sbjct  194  TRSPS----------ESSGCGGGDLQELARELLGRH  219



>ref|XP_006396221.1| hypothetical protein EUTSA_v10028937mg [Eutrema salsugineum]
 gb|ESQ37674.1| hypothetical protein EUTSA_v10028937mg [Eutrema salsugineum]
Length=230

 Score =   209 bits (531),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 143/218 (66%), Gaps = 44/218 (20%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLL H+P HKR DAV++IC+
Sbjct  23   CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLHHVPEHKRPDAVVSICF  82

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDP+YGC++HI +LQQQVV+LQ EL+Y+QAHLATLE+P  PP     S      
Sbjct  83   EAQARLRDPIYGCISHIVSLQQQVVSLQTELSYVQAHLATLEMPQPPPAPVTSSGS----  138

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAI--QPRQLD-------PRQLFG  221
               P  L+I+DLPT   + P+ YDLSS+ +PM    WA+  QPR  D          + G
Sbjct  139  ---PPPLSISDLPT---ISPSVYDLSSILEPMTT-TWAMQQQPRPSDHHFDVPLSSNMGG  191

Query  220  GGAATRVATVDMTsssssaagsggggGDLQELARELMH  107
            GG                         +LQ LARE +H
Sbjct  192  GGG------------------------ELQALAREFLH  205



>ref|XP_004986691.1| PREDICTED: LOB domain-containing protein 18-like [Setaria italica]
Length=262

 Score =   209 bits (533),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 128/224 (57%), Positives = 147/224 (66%), Gaps = 27/224 (12%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLL IP HKRLDAV+T+CY
Sbjct  38   CKFLRRKCVSGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLQIPPHKRLDAVVTVCY  97

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDP+YGCV+HIFALQQQVVNLQAEL YLQ HL T+E+P  PP   Q   P P  
Sbjct  98   EAQARLRDPIYGCVSHIFALQQQVVNLQAELTYLQGHLTTMELPTPPPFAPQPQPPMPT-  156

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDP------------MVQPAWAIQPRQLDPRQ  230
                A  ++++LP     +PAT DLS+L DP              Q     Q      + 
Sbjct  157  ---NAAFSVSNLPLS-SSVPATVDLSTLLDPHNQSQQWAFQFQQQQVLQQQQQLLQQQQY  212

Query  229  LFGGGAATRVATVDMTsssssaagsggggGDLQELARELMHRHG  98
            +  G  ++RVA    T            GGDLQ LAREL+ RHG
Sbjct  213  MQMGEGSSRVAGGSST----------ADGGDLQALARELLDRHG  246



>ref|XP_004492639.1| PREDICTED: LOB domain-containing protein 18-like [Cicer arietinum]
Length=222

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 129/171 (75%), Gaps = 9/171 (5%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFD+E G  HFAAVHKVFGASNVSKLLL IP++KRLDA I++CY
Sbjct  21   CKFLRRKCVQGCIFAPYFDAEHGTTHFAAVHKVFGASNVSKLLLGIPINKRLDAAISLCY  80

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCV HIF LQQQV++LQAE+ YLQ+HL + E+         Q+   P +
Sbjct  81   EAQTRLRDPVYGCVGHIFTLQQQVMSLQAEINYLQSHLTSTELTQPLLLPPPQAATAPAV  140

Query  373  FVPPAVLNIADLPTGV-PMMPATYDLSSLFDPMVQPAWAIQPRQ--LDPRQ  230
            F      ++ADLP+     MP TYD+S+LFDP+ QP+  +Q ++  +DPRQ
Sbjct  141  F------SLADLPSATAATMPVTYDMSTLFDPLGQPSLPMQQQRPNIDPRQ  185



>ref|XP_006662199.1| PREDICTED: LOB domain-containing protein 18-like [Oryza brachyantha]
Length=240

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 128/234 (55%), Positives = 143/234 (61%), Gaps = 37/234 (16%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLL  IP H+RLDAV+TICY
Sbjct  39   CKFLRRKCVQGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLQQIPAHRRLDAVVTICY  98

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIF LQ QV  LQ EL YLQAHL+ ++                  
Sbjct  99   EAQARLRDPVYGCVAHIFHLQHQVAGLQTELNYLQAHLSAMDS-----------------  141

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFD--PMVQPAWAIQPRQLDPRQLFGGGAATRV  200
                   N +DLP+    +PAT DLS LFD  PM QP W   P     +         R+
Sbjct  142  ------FNFSDLPSSSSNVPATADLSVLFDPLPMAQPLW---PGVFQHQHHHHQHPYDRM  192

Query  199  ATVDMTsssssaagsggggGDLQELARELMHRHGSPTVPCTNAPSSAL--PPHS  44
                 +SS         GGGDLQ LAREL+ RHG       +A SS L  PPH+
Sbjct  193  GDG-SSSSRGGDDDGSDGGGDLQALARELLDRHG------RSASSSKLEPPPHT  239



>gb|EPS64174.1| hypothetical protein M569_10607, partial [Genlisea aurea]
Length=130

 Score =   201 bits (510),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKR+DAV+TICY
Sbjct  15   CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRVDAVVTICY  74

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EAQ+RLRDP+YGCV+HIF+LQQQV+NLQAE++YLQAHLA++E
Sbjct  75   EAQARLRDPIYGCVSHIFSLQQQVMNLQAEISYLQAHLASIE  116



>ref|XP_006851815.1| hypothetical protein AMTR_s00041p00044170 [Amborella trichopoda]
 gb|ERN13282.1| hypothetical protein AMTR_s00041p00044170 [Amborella trichopoda]
Length=217

 Score =   204 bits (518),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 129/228 (57%), Positives = 147/228 (64%), Gaps = 33/228 (14%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GC+FAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIP HKRLDAV+T+CY
Sbjct  19   CKFLRRKCVSGCVFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPAHKRLDAVVTVCY  78

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQV+NLQAELAY+QAHL+T+E+P  PPP    SQP    
Sbjct  79   EAQARLRDPVYGCVAHIFALQQQVMNLQAELAYMQAHLSTMELPPPPPPPPAPSQPSAAF  138

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDP----MVQPAWAIQPRQLDPRQLFGGGAAT  206
                  L IA          + +DLS+LFD     ++ PA      Q DP       A T
Sbjct  139  MSTSPDL-IASSSN------SNFDLSALFDHHSHYVIDPASRFYRSQPDP-------AVT  184

Query  205  RVATVDMTsssssaagsggggGDLQELARELMHRHGSPTVPCTNAPSS  62
                                GG+L  LAREL+ R  S   P T A S+
Sbjct  185  AGGAA---------------GGELHALARELLTRRRSSPGPSTKALSN  217



>ref|XP_009128476.1| PREDICTED: LOB domain-containing protein 30-like [Brassica rapa]
Length=224

 Score =   204 bits (518),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 130/167 (78%), Gaps = 13/167 (8%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDS+QGAAHFAAVHKVFGASNVSKLL HIP HKR DAV++IC+
Sbjct  19   CKFLRRKCVPGCIFAPYFDSDQGAAHFAAVHKVFGASNVSKLLHHIPEHKRADAVVSICF  78

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQSRLRDP+YGCV+HI +LQQQVV+LQ EL+Y+QAHLATLE+P  PP     S      
Sbjct  79   EAQSRLRDPIYGCVSHIVSLQQQVVSLQNELSYVQAHLATLELPQPPPATVTSSGS----  134

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAI--QPRQLD  239
             +PP  L+I+DLPT   + P+ YDLS +F+PM    W +  QPR  D
Sbjct  135  -LPP--LSISDLPT---ITPSMYDLSPIFEPMSS-TWPMQQQPRPSD  174



>emb|CDY54923.1| BnaAnng13580D [Brassica napus]
Length=224

 Score =   204 bits (518),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 130/167 (78%), Gaps = 13/167 (8%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDS+QGAAHFAAVHKVFGASNVSKLL HIP HKR DAV++IC+
Sbjct  19   CKFLRRKCVPGCIFAPYFDSDQGAAHFAAVHKVFGASNVSKLLHHIPEHKRADAVVSICF  78

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQSRLRDP+YGCV+HI +LQQQVV+LQ EL+Y+QAHLATLE+P  PP     S      
Sbjct  79   EAQSRLRDPIYGCVSHIVSLQQQVVSLQNELSYVQAHLATLELPQPPPATVTSSGS----  134

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAI--QPRQLD  239
             +PP  L+I+DLPT   + P+ YDLS +F+PM    W +  QPR  D
Sbjct  135  -LPP--LSISDLPT---ITPSMYDLSPIFEPMSS-TWPMQQQPRPSD  174



>gb|KFK30604.1| hypothetical protein AALP_AA6G003400 [Arabis alpina]
Length=228

 Score =   203 bits (517),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 150/228 (66%), Gaps = 31/228 (14%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAP+FDSEQGAAHF+AVHKVFGASNVSKLL  +P HKR DAV+ IC+
Sbjct  22   CKFLRRKCVSGCIFAPHFDSEQGAAHFSAVHKVFGASNVSKLLNIVPEHKRPDAVVCICF  81

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EA SRLRDPVYGCV+HI +LQQQV++LQ+EL+YLQAHLATLE+P  PP  A  S      
Sbjct  82   EAHSRLRDPVYGCVSHIVSLQQQVLSLQSELSYLQAHLATLELPQPPPAPATSSCS----  137

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAI---QPRQLDPRQLFGGGAATR  203
               P   +I+DLPT      + YDLSS+F+PM    WA+   QPR LD  Q +G  +++ 
Sbjct  138  ---PPPFSISDLPTIT--TSSVYDLSSIFEPMSS-TWAMQQQQPRPLD--QYYGVPSSSN  189

Query  202  VATVDMTsssssaagsggggGDLQELARELMHRHGSPTVPCTNAPSSA  59
            +                  GG+ Q LARE +H    PT P      SA
Sbjct  190  IGG----------------GGEFQALAREFIHGGQMPTQPPPGTSGSA  221



>ref|XP_003623721.1| LOB domain-containing protein [Medicago truncatula]
 gb|AES79939.1| LOB domain protein [Medicago truncatula]
Length=237

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 129/171 (75%), Gaps = 9/171 (5%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYFDSE G  HFAAVHKVFGASNVSKLLL IP  +RLDA +++CY
Sbjct  24   CKFLRRKCVQGCVFAPYFDSEHGTTHFAAVHKVFGASNVSKLLLGIPTGRRLDAAVSLCY  83

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQSRLRDP+YGCV HI ALQQQV++LQAEL+YLQ+H+ +  +   PP    Q+   P +
Sbjct  84   EAQSRLRDPIYGCVGHIVALQQQVMSLQAELSYLQSHINSSGLTQQPPLPPPQATAAPTV  143

Query  373  FVPPAVLNIADL-PTGVPMMPATYDLSSLFDPMVQPAWAIQPRQ--LDPRQ  230
            F      + ADL PT    MP TYD+S+LFD M QP++++Q ++  +DPRQ
Sbjct  144  F------SFADLPPTTATTMPVTYDMSTLFDSMGQPSFSMQQQRSSIDPRQ  188



>ref|XP_011094569.1| PREDICTED: LOB domain-containing protein 18 [Sesamum indicum]
Length=161

 Score =   199 bits (506),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/102 (93%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLL HIPV KRLDAV+TICY
Sbjct  40   CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLHHIPVQKRLDAVVTICY  99

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EAQSRLRDP+YGCVAHIFALQQQVVNLQ EL+YLQAHLA LE
Sbjct  100  EAQSRLRDPIYGCVAHIFALQQQVVNLQTELSYLQAHLAALE  141



>ref|XP_002467307.1| hypothetical protein SORBIDRAFT_01g024400 [Sorghum bicolor]
 gb|EER94305.1| hypothetical protein SORBIDRAFT_01g024400 [Sorghum bicolor]
Length=270

 Score =   202 bits (514),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 122/233 (52%), Positives = 149/233 (64%), Gaps = 17/233 (7%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLL IP HKRLDAV+T+CY
Sbjct  38   CKFLRRKCVTGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLQIPPHKRLDAVVTVCY  97

Query  553  EAQSRLRDPVYGCVAHIFALQQQ----------VVNLQAELAYLQAHLATLEvpnapppv  404
            EAQ+R+RDPVYGCV+H+FALQQQ          VVNLQ EL YLQ HL+T+E+P  PP  
Sbjct  98   EAQARIRDPVYGCVSHVFALQQQVCMHMQRVHVVVNLQTELTYLQGHLSTIELPTPPPFG  157

Query  403  aqqsqpqpPLFVPPAVLNIADLPTGVP-MMPATYDLSSLFDPMVQPAWAIQPRQLDPRQL  227
            AQ   P    F       +++LP+    ++P T D+S++F+P  Q +  +   Q   +  
Sbjct  158  AQNQMPMTATFC------VSNLPSASSNIIPGTVDVSTVFEPQTQESHWVSLSQQQQQVQ  211

Query  226  FGGGAATRVATVDMTsssssaagsggggGDLQELARELMHRHGSPTVPCTNAP  68
                   +   V     +  +     GGGDLQ LAREL+ RHG   V   + P
Sbjct  212  QHQFNQQQSVMVGEGPGTGMSGSGAIGGGDLQLLARELLDRHGITAVGSQSQP  264



>emb|CDY69735.1| BnaCnng65080D [Brassica napus]
Length=224

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 129/167 (77%), Gaps = 13/167 (8%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDS+QGAAHFAAVHKVFGASNVSKLL HIP HKR DAV++IC+
Sbjct  19   CKFLRRKCVPGCIFAPYFDSDQGAAHFAAVHKVFGASNVSKLLHHIPEHKRADAVVSICF  78

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQSRLRDP+YGCV+HI +LQQQVV+LQ EL+Y+QAHLATLE+P  PP     S      
Sbjct  79   EAQSRLRDPIYGCVSHIVSLQQQVVSLQNELSYVQAHLATLELPQPPPATVTSSGS----  134

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAI--QPRQLD  239
             +PP  L+I+DLPT   + P+ YDLS + +P +   W +  QPR  D
Sbjct  135  -LPP--LSISDLPT---ITPSMYDLSPILEP-ISSTWPMQQQPRPSD  174



>ref|NP_001176038.1| Os10g0162600 [Oryza sativa Japonica Group]
 gb|AAL77143.1|AC097447_9 Unknown protein [Oryza sativa Japonica Group]
 gb|AAP52248.1| LOB domain protein 31, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAD88525.1| LOB domain protein [Oryza sativa Japonica Group]
 dbj|BAH94766.1| Os10g0162600 [Oryza sativa Japonica Group]
Length=269

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 127/239 (53%), Positives = 148/239 (62%), Gaps = 14/239 (6%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSE GAAHFAAVHKVFGASNVSKLL  IP H+RLDAV+TICY
Sbjct  37   CKFLRRKCVQGCIFAPYFDSEAGAAHFAAVHKVFGASNVSKLLQQIPAHRRLDAVVTICY  96

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEv-----pnapppvaqqsq  389
            EAQ+RLRDPVYGCVAHIF LQ QV  LQ+EL YLQ HL+T+E+       A P +A    
Sbjct  97   EAQARLRDPVYGCVAHIFHLQHQVAGLQSELNYLQGHLSTMELPSPPPYVAGPTLAPPQP  156

Query  388  pqpPLFVPPAVLNIADLP-TGVPMMPATYDLSSLFDPM--VQPAWAIQPRQLDPRQLFGG  218
                     A  N +DLP +    +P T DLS+LFDP+   QP W +  +Q    Q    
Sbjct  157  QPLMPMTAAANFNFSDLPSSSAANIPVTADLSTLFDPLPAAQPQWGLYQQQQHHHQQLHH  216

Query  217  GAATRVATVDMTsssssaagsggggGDLQELARELMHRHGSPTVPCTNAPSSALPPHSK  41
                R+     +S      GS GG   LQ LAREL+ RHG  +      P    PPH++
Sbjct  217  HPYDRMGDGSSSSRGGDDDGSDGGD--LQALARELLDRHGRSSSSSKLEP----PPHTQ  269



>gb|EAY77788.1| hypothetical protein OsI_32828 [Oryza sativa Indica Group]
Length=269

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 127/239 (53%), Positives = 149/239 (62%), Gaps = 14/239 (6%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSE GAAHFAAVHKVFGASNVSKLL  IP H+RLDAV+TICY
Sbjct  37   CKFLRRKCVQGCIFAPYFDSEAGAAHFAAVHKVFGASNVSKLLQQIPAHRRLDAVVTICY  96

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEv-----pnapppvaqqsq  389
            EAQ+RLRDPVYGCVAHIF LQ QV  LQ+EL YLQ HL+T+E+       A P +A    
Sbjct  97   EAQARLRDPVYGCVAHIFHLQHQVAGLQSELNYLQGHLSTMELPSPPPYVAGPTLAPPQP  156

Query  388  pqpPLFVPPAVLNIADLP-TGVPMMPATYDLSSLFDPM--VQPAWAIQPRQLDPRQLFGG  218
                     A  N +DLP +    +P T DLS+LFDP+   QP W +  +Q   +Q    
Sbjct  157  QPLMPMTAAANFNFSDLPSSSAANIPVTADLSTLFDPLPAAQPQWGLYQQQQHHQQQLHH  216

Query  217  GAATRVATVDMTsssssaagsggggGDLQELARELMHRHGSPTVPCTNAPSSALPPHSK  41
                R+     +S      GS GG   LQ LAREL+ RHG  +      P    PPH++
Sbjct  217  HPYDRMGDGSSSSRGGDEDGSDGGD--LQALARELLDRHGRSSSSSKLEP----PPHTQ  269



>ref|XP_010523689.1| PREDICTED: LOB domain-containing protein 18-like [Tarenaya hassleriana]
Length=228

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 134/216 (62%), Gaps = 32/216 (15%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAP+FD E+GA +F+AVHKVFGASNVSKLL  IP+HKR DAV TICY
Sbjct  20   CKFLRRKCVPGCIFAPHFDHEEGATYFSAVHKVFGASNVSKLLGQIPLHKRSDAVTTICY  79

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EA +RL DPVYGC   IFALQQQVVNLQ EL++LQAHLATLE P  PP       P P L
Sbjct  80   EAHARLSDPVYGCFTQIFALQQQVVNLQTELSHLQAHLATLEPPPPPPRPPPAVVPPPLL  139

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMV----QPAWA-IQPRQLDPRQLFGGGAA  209
                    I+DLP      P  YDLSS FDP        +WA +Q R +DPRQ +G   +
Sbjct  140  --------ISDLPEN-SGSPQPYDLSSSFDPTALRTPSSSWANMQRRLVDPRQQYGAILS  190

Query  208  TRVATVDMTsssssaagsggggGDLQELARELMHRH  101
            +                      +LQ LA EL HRH
Sbjct  191  SSSGN------------------ELQTLAHELFHRH  208



>ref|XP_008659582.1| PREDICTED: LOB domain-containing protein 30-like [Zea mays]
 tpg|DAA46768.1| TPA: putative LOB domain-containing family protein [Zea mays]
 gb|AIB04527.1| LOB transcription factor, partial [Zea mays]
Length=245

 Score =   196 bits (499),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 124/165 (75%), Gaps = 7/165 (4%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYFDSEQGAAHFAAVHKVFGASNVSKLLL +P HKRLDAV+T+CY
Sbjct  38   CKFLRRKCVTGCVFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLQVPPHKRLDAVVTVCY  97

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+R+RDPVYGCV+H+FALQQQVVNLQ EL YLQ HL+T+E P  PP  AQ   P    
Sbjct  98   EAQARIRDPVYGCVSHVFALQQQVVNLQTELTYLQGHLSTMEPPTPPPLAAQNQMPMTT-  156

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLF-DPMVQPA-WAIQPRQ  245
                A   +++LP     +P T D+S+L  +P  Q + W  Q +Q
Sbjct  157  ----AAFCVSNLPWPSNDIPPTVDVSTLLEEPQTQQSNWVSQQQQ  197



>ref|XP_003571705.1| PREDICTED: LOB domain-containing protein 30-like [Brachypodium 
distachyon]
Length=255

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 147/221 (67%), Gaps = 14/221 (6%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAPYF++E GAAHFAAVHKVFGASNVSKLLL IP  KR DAV TICY
Sbjct  37   CKFLRRKCVSGCIFAPYFNTENGAAHFAAVHKVFGASNVSKLLLQIPAPKRADAVFTICY  96

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+R+RDPVYGCV+H+F LQQQV NLQAEL  LQAHLATL    APPP  QQ Q     
Sbjct  97   EAQARIRDPVYGCVSHVFNLQQQVANLQAELTCLQAHLATLGQVPAPPPFPQQPQMPMAT  156

Query  373  FVPPAVLNIADLPTGVPM-MPATYDLSSLFDP-MVQPA--WAIQPRQLDPRQLFGGGAAT  206
              P    +I+DLP  +P  +P++ DLSSLFDP M+Q +  WA Q +              
Sbjct  157  AAP---FSISDLPLTLPSNIPSSVDLSSLFDPSMMQSSSQWAFQQQPQQ-------LQQQ  206

Query  205  RVATVDMTsssssaagsggggGDLQELARELMHRHGSPTVP  83
                +    S  S  G+  G GDLQ LAREL+ R  +  +P
Sbjct  207  PFVPMMGDGSGGSGGGNLFGDGDLQALARELLERQSAGPMP  247



>gb|EMS62575.1| hypothetical protein TRIUR3_25587 [Triticum urartu]
Length=229

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 133/218 (61%), Gaps = 24/218 (11%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC   CIFAPYFDSEQG  HF AVHKVFGASNVSK+L   P HKRLDA IT+CY
Sbjct  27   CKFLRRKCADDCIFAPYFDSEQGVEHFTAVHKVFGASNVSKILNQAPPHKRLDAAITVCY  86

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EA++RLRDP+YGCV  IFALQQ+V NLQAE+A+LQAHL T +                P 
Sbjct  87   EAKARLRDPIYGCVGDIFALQQRVANLQAEVAFLQAHLTTPQ-------QPSPPPFPSPP  139

Query  373  FVPPAV-LNIADLPTGVPMMPATYDLSSLFDPMVQPAWAIQPRQLDPRQLFGGGAATRVA  197
            ++P     +I++L + +  +P T +LSSLFDP +Q  WA Q +   P    G G+  R  
Sbjct  140  YIPMTTEFSISELAS-LSNVPNTVELSSLFDPSMQ--WAFQQQHQQPYGQTGEGSGGRGN  196

Query  196  TVDMTsssssaagsggggGDLQELARELMHRHGSPTVP  83
            T                G DLQ LAREL+ R  +   P
Sbjct  197  T-------------NSNGDDLQALARELLDRRSTGLTP  221



>ref|XP_010276387.1| PREDICTED: LOB domain-containing protein 19-like [Nelumbo nucifera]
Length=208

 Score =   191 bits (484),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQGA+HFAAVHKVFGASNVSKLLL IPVHKRLDAV+TICY
Sbjct  22   CKFLRRKCVKGCIFAPYFDSEQGASHFAAVHKVFGASNVSKLLLRIPVHKRLDAVVTICY  81

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPVYGCV HIFALQQQVVNLQAELA+++A L T+E
Sbjct  82   EAFARIRDPVYGCVGHIFALQQQVVNLQAELAFIKAQLTTME  123



>ref|XP_004134346.1| PREDICTED: LOB domain-containing protein 18-like [Cucumis sativus]
 gb|KGN56593.1| hypothetical protein Csa_3G126090 [Cucumis sativus]
Length=231

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 112/154 (73%), Gaps = 3/154 (2%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC+  CIFAPYFDSEQG+ HFAAVHKVFGASNVSK+LLHIP HKRLDA ITICY
Sbjct  28   CKFLRRKCMPECIFAPYFDSEQGSTHFAAVHKVFGASNVSKMLLHIPEHKRLDAAITICY  87

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+R+R+PV GCV+HIFALQQQ   LQ E++YLQA+LAT E    P          P L
Sbjct  88   EAQARVREPVLGCVSHIFALQQQAARLQIEISYLQAYLATSE---LPRSAPHLQAQPPAL  144

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQ  272
               P + +I  LP+  P  PA  DLS L DP+ Q
Sbjct  145  VKKPTLSSIISLPSDCPSFPAESDLSLLLDPVEQ  178



>ref|XP_010277396.1| PREDICTED: LOB domain-containing protein 19-like [Nelumbo nucifera]
Length=203

 Score =   189 bits (481),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQGA+HFAAVHKVFGASNVSKLLL IPV KRLDAV+TICY
Sbjct  19   CKFLRRKCVKGCIFAPYFDSEQGASHFAAVHKVFGASNVSKLLLRIPVDKRLDAVVTICY  78

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPVYGCV HIFALQQQVVNLQAELAY+QA L  +E
Sbjct  79   EALARIRDPVYGCVGHIFALQQQVVNLQAELAYIQAQLTNME  120



>ref|XP_008438149.1| PREDICTED: LOB domain-containing protein 18 [Cucumis melo]
Length=231

 Score =   190 bits (483),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 110/154 (71%), Gaps = 3/154 (2%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC   CIFAPYFDSEQG  HFAAVHKVFGASNVSK+LLHIP HKRLDA ITICY
Sbjct  28   CKFLRRKCTPECIFAPYFDSEQGTTHFAAVHKVFGASNVSKMLLHIPEHKRLDAAITICY  87

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+R+R+PV GCVAHIFALQQQ   LQ E++YLQ +LAT E    P P        P L
Sbjct  88   EAQARVREPVLGCVAHIFALQQQAARLQIEISYLQGYLATSE---LPRPAPHLQAQPPAL  144

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQ  272
               P + +I  LP+  P  PA  DLS L DP+ Q
Sbjct  145  VKKPTLSSIVSLPSDCPSFPAESDLSLLLDPVEQ  178



>ref|XP_004155866.1| PREDICTED: LOB domain-containing protein 18-like [Cucumis sativus]
Length=312

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 112/154 (73%), Gaps = 3/154 (2%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC+  CIFAPYFDSEQG+ HFAAVHKVFGASNVSK+LLHIP HKRLDA ITICY
Sbjct  109  CKFLRRKCMPECIFAPYFDSEQGSTHFAAVHKVFGASNVSKMLLHIPEHKRLDAAITICY  168

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+R+R+PV GCV+HIFALQQQ   LQ E++YLQA+LAT E    P          P L
Sbjct  169  EAQARVREPVLGCVSHIFALQQQAARLQIEISYLQAYLATSE---LPRSAPHLQAQPPAL  225

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQ  272
               P + +I  LP+  P  PA  DLS L DP+ Q
Sbjct  226  VKKPTLSSIISLPSDCPSFPAESDLSLLLDPVEQ  259



>gb|EMT10533.1| hypothetical protein F775_04528 [Aegilops tauschii]
Length=229

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 132/217 (61%), Gaps = 22/217 (10%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC   CIFAPYF SEQG  HF AVHKVFGASNVSK+L   P HKR DA IT+CY
Sbjct  27   CKFLRRKCADDCIFAPYFGSEQGVEHFTAVHKVFGASNVSKILNQAPSHKRFDAAITVCY  86

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EA++RLRDP+YGCV  IFALQQ+V NLQAE+A LQAHL TL+ P+ PP  +    P    
Sbjct  87   EAKARLRDPIYGCVGDIFALQQRVANLQAEVASLQAHLTTLQQPSPPPFPSLSYMPMTTE  146

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAIQPRQLDPRQLFGGGAATRVAT  194
            F    + +++++P        T +LSSLFDP +Q  WA Q +   P    G G+  R   
Sbjct  147  FSISELASLSNVPN-------TVELSSLFDPSMQ--WAFQQQHQQPYGQTGEGSGRR---  194

Query  193  VDMTsssssaagsggggGDLQELARELMHRHGSPTVP  83
                        +   G DLQ LAREL+ R  +   P
Sbjct  195  ----------GNANSNGDDLQALARELLDRRSTGLAP  221



>ref|XP_003521945.2| PREDICTED: LOB domain-containing protein 19-like [Glycine max]
 gb|KHM98882.1| LOB domain-containing protein 31 [Glycine soja]
Length=212

 Score =   185 bits (469),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDS+QG AHFAAVHKVFGASN SKLL+ IP HKRLDAV+T+CY
Sbjct  22   CKFLRRKCVKGCIFAPYFDSDQGTAHFAAVHKVFGASNASKLLMRIPAHKRLDAVVTLCY  81

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA SR RDPVYGCV H+FALQQQV+NLQAEL Y+QAHLAT++
Sbjct  82   EALSRARDPVYGCVGHLFALQQQVMNLQAELTYVQAHLATMQ  123



>ref|XP_007220875.1| hypothetical protein PRUPE_ppa017589mg [Prunus persica]
 gb|EMJ22074.1| hypothetical protein PRUPE_ppa017589mg [Prunus persica]
Length=232

 Score =   185 bits (470),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC+ GCIFAPYFDSEQG AHFAAVHKVFGASN SKLLL IP HKRLDAV+T+CY
Sbjct  28   CKFLRRKCIKGCIFAPYFDSEQGTAHFAAVHKVFGASNASKLLLRIPPHKRLDAVVTLCY  87

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPVYGCV+HIF LQQQVVNLQAELAY+QA LATL+
Sbjct  88   EALARVRDPVYGCVSHIFTLQQQVVNLQAELAYVQARLATLQ  129



>ref|XP_008232675.1| PREDICTED: LOB domain-containing protein 19 [Prunus mume]
Length=228

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC+ GCIFAPYFDSEQG AHFAAVHKVFGASN SKLLL +P HKRLDAV+T+CY
Sbjct  25   CKFLRRKCIKGCIFAPYFDSEQGTAHFAAVHKVFGASNASKLLLRVPPHKRLDAVVTLCY  84

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPVYGCV+HIF LQQQVVNLQAELAY+QA LATL+
Sbjct  85   EALARVRDPVYGCVSHIFTLQQQVVNLQAELAYVQARLATLQ  126



>ref|XP_002320729.2| hypothetical protein POPTR_0014s06580g [Populus trichocarpa]
 gb|EEE99044.2| hypothetical protein POPTR_0014s06580g [Populus trichocarpa]
Length=179

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLR+KCV GCIFAPYFD +QG AHFAAVHKVFGASN SKLLL IP HKRLDAV+T+CY
Sbjct  16   CKFLRKKCVKGCIFAPYFDPDQGTAHFAAVHKVFGASNASKLLLRIPAHKRLDAVVTLCY  75

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPVYGCV HIF LQQQV+NLQAELA++QAHL+TL+
Sbjct  76   EALARVRDPVYGCVGHIFTLQQQVLNLQAELAFIQAHLSTLQ  117



>ref|XP_004306913.1| PREDICTED: LOB domain-containing protein 31-like [Fragaria vesca 
subsp. vesca]
Length=218

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC+ GCIFAPYFDS+QG AHFAAVHKVFGASN SKLLL IP HKRLDAV+T+CY
Sbjct  23   CKFLRRKCLRGCIFAPYFDSDQGTAHFAAVHKVFGASNASKLLLRIPAHKRLDAVVTLCY  82

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLAT  434
            EA +R+RDPVYGCVAHIF LQQQVVNLQAELAY+QA LAT
Sbjct  83   EALARVRDPVYGCVAHIFTLQQQVVNLQAELAYVQARLAT  122



>ref|XP_011090856.1| PREDICTED: LOB domain-containing protein 19 [Sesamum indicum]
Length=201

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDS+QG AHFAAVH+VFGASN SKLLL IP H+RLDAVIT+CY
Sbjct  13   CKFLRRKCVRGCIFAPYFDSDQGTAHFAAVHRVFGASNASKLLLRIPPHRRLDAVITLCY  72

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPVYGCVAHIF LQQQVVNLQAELAY+QA ++TL+
Sbjct  73   EALARVRDPVYGCVAHIFTLQQQVVNLQAELAYIQARISTLQ  114



>ref|XP_002273687.2| PREDICTED: LOB domain-containing protein 19 [Vitis vinifera]
 emb|CBI38860.3| unnamed protein product [Vitis vinifera]
Length=194

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYFDS+QG AHFAAVHKVFGASN SKLL  IP HKRLDAV+T+CY
Sbjct  15   CKFLRRKCVKGCVFAPYFDSDQGTAHFAAVHKVFGASNASKLLTGIPAHKRLDAVVTLCY  74

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +RLRDPVYGCVAH+F LQQQV+NLQAELA++QA L+TL+
Sbjct  75   EALARLRDPVYGCVAHVFTLQQQVMNLQAELAFIQARLSTLQ  116



>ref|XP_007052037.1| LOB domain-containing protein 31 [Theobroma cacao]
 gb|EOX96194.1| LOB domain-containing protein 31 [Theobroma cacao]
Length=203

 Score =   182 bits (462),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC+ GCIFAPYFDS+QG AHFAAVHKVFGASN SK+LL IP H+R+DAV+T+CY
Sbjct  13   CKFLRRKCIKGCIFAPYFDSDQGTAHFAAVHKVFGASNASKMLLRIPAHRRVDAVVTLCY  72

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPVYGCV HIF LQQQVVNLQAELAY+Q  L+TL+
Sbjct  73   EALARVRDPVYGCVGHIFTLQQQVVNLQAELAYIQGRLSTLQ  114



>gb|EAZ15392.1| hypothetical protein OsJ_30803 [Oryza sativa Japonica Group]
Length=229

 Score =   182 bits (463),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 140/233 (60%), Gaps = 14/233 (6%)
 Frame = -1

Query  715  KCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICYEAQSRL  536
              V GCIFAPYFDSE GAAHFAAVHKVFGASNVSKLL  IP H+RLDAV+TICYEAQ+RL
Sbjct  3    SSVVGCIFAPYFDSEAGAAHFAAVHKVFGASNVSKLLQQIPAHRRLDAVVTICYEAQARL  62

Query  535  RDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEv-----pnapppvaqqsqpqpPLF  371
            RDPVYGCVAHIF LQ QV  LQ+EL YLQ HL+T+E+       A P +A          
Sbjct  63   RDPVYGCVAHIFHLQHQVAGLQSELNYLQGHLSTMELPSPPPYVAGPTLAPPQPQPLMPM  122

Query  370  VPPAVLNIADLP-TGVPMMPATYDLSSLFDPM--VQPAWAIQPRQLDPRQLFGGGAATRV  200
               A  N +DLP +    +P T DLS+LFDP+   QP W +  +Q    Q        R+
Sbjct  123  TAAANFNFSDLPSSSAANIPVTADLSTLFDPLPAAQPQWGLYQQQQHHHQQLHHHPYDRM  182

Query  199  ATVDMTsssssaagsggggGDLQELARELMHRHGSPTVPCTNAPSSALPPHSK  41
                 +S      GS GG   LQ LAREL+ RHG  +      P    PPH++
Sbjct  183  GDGSSSSRGGDDDGSDGGD--LQALARELLDRHGRSSSSSKLEP----PPHTQ  229



>ref|XP_011034467.1| PREDICTED: LOB domain-containing protein 19 [Populus euphratica]
Length=179

 Score =   181 bits (459),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLR+KCV GCIFAPYFD +QG AHFAAVHKVFGASN SKLLL IP HKRLDAV+T+CY
Sbjct  16   CKFLRKKCVKGCIFAPYFDPDQGTAHFAAVHKVFGASNASKLLLRIPAHKRLDAVVTLCY  75

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPVYGCV HIF LQQQV+NLQAELA++QA+L+TL+
Sbjct  76   EALARVRDPVYGCVGHIFTLQQQVLNLQAELAFIQANLSTLQ  117



>gb|KHG05660.1| LOB domain-containing 19 -like protein [Gossypium arboreum]
Length=186

 Score =   181 bits (459),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDS+QG AHFAAVHKV+GASN SK+L  IPVHKRLDAV+T+CY
Sbjct  13   CKFLRRKCVKGCIFAPYFDSDQGMAHFAAVHKVYGASNASKMLQRIPVHKRLDAVVTLCY  72

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPVYGCV H+F LQQQVVNLQAELAY QA L+TL+
Sbjct  73   EALARVRDPVYGCVGHLFTLQQQVVNLQAELAYTQARLSTLQ  114



>ref|XP_009803301.1| PREDICTED: LOB domain-containing protein 19-like [Nicotiana sylvestris]
Length=227

 Score =   182 bits (463),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDS+QG AHFAAVHKVFGASN SKLLL IP HKRLDAV+T+CY
Sbjct  41   CKFLRRKCVRGCIFAPYFDSDQGTAHFAAVHKVFGASNASKLLLRIPAHKRLDAVVTLCY  100

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDP+YGCVAHIF LQQQVV+LQAELAY+QA L+TL+
Sbjct  101  EALARVRDPIYGCVAHIFTLQQQVVSLQAELAYVQARLSTLQ  142



>ref|XP_010092842.1| hypothetical protein L484_022437 [Morus notabilis]
 gb|EXB52660.1| hypothetical protein L484_022437 [Morus notabilis]
Length=240

 Score =   183 bits (464),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFD++QG AHFAAVHKVFGASN SKLLL IP HKRLDAV+++ Y
Sbjct  25   CKFLRRKCVKGCIFAPYFDADQGTAHFAAVHKVFGASNASKLLLRIPPHKRLDAVVSLSY  84

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPVYGCVAHIFALQQQVVNLQAELAY+QA L+TL+
Sbjct  85   EALARIRDPVYGCVAHIFALQQQVVNLQAELAYVQARLSTLQ  126



>ref|XP_009379264.1| PREDICTED: LOB domain-containing protein 19 [Pyrus x bretschneideri]
Length=227

 Score =   182 bits (463),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC+ GCIFAPYFD+EQG AHFAAVHKVFGASN SKLLL IP HKRLDAV+T+CY
Sbjct  22   CKFLRRKCIKGCIFAPYFDAEQGTAHFAAVHKVFGASNASKLLLRIPPHKRLDAVVTLCY  81

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPVYGC +HIF LQQQVVNLQAELAY+QA L TL+
Sbjct  82   EALARVRDPVYGCASHIFTLQQQVVNLQAELAYVQARLGTLQ  123



>ref|XP_007134896.1| hypothetical protein PHAVU_010G084900g [Phaseolus vulgaris]
 gb|ESW06890.1| hypothetical protein PHAVU_010G084900g [Phaseolus vulgaris]
Length=212

 Score =   182 bits (461),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDS+QG AHFAAVHKVFGASN SKLL+ IP HKRLDAV+T+CY
Sbjct  19   CKFLRRKCVKGCIFAPYFDSDQGTAHFAAVHKVFGASNASKLLMRIPAHKRLDAVVTLCY  78

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R RDPVYGCV H+FALQQQV+NLQAEL Y+QA LAT++
Sbjct  79   EALARARDPVYGCVGHLFALQQQVMNLQAELTYVQARLATMQ  120



>ref|XP_002302539.1| hypothetical protein POPTR_0002s14970g [Populus trichocarpa]
 gb|EEE81812.1| hypothetical protein POPTR_0002s14970g [Populus trichocarpa]
Length=211

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFD +QG AHFAAVHKVFGASN SKLLL IP HKRLDAV+T+CY
Sbjct  15   CKFLRRKCVKGCIFAPYFDPDQGTAHFAAVHKVFGASNASKLLLRIPTHKRLDAVVTLCY  74

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPV+GCV HIF LQQQV+NLQAELAY+QAHL+TL+
Sbjct  75   EALTRVRDPVHGCVGHIFTLQQQVMNLQAELAYIQAHLSTLQ  116



>ref|XP_009628901.1| PREDICTED: LOB domain-containing protein 19-like [Nicotiana tomentosiformis]
Length=213

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDS+QG AHFAAVHKVFGASN SKLLL IP HKRLDAV+T+CY
Sbjct  32   CKFLRRKCVRGCIFAPYFDSDQGTAHFAAVHKVFGASNASKLLLRIPAHKRLDAVVTLCY  91

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATL  431
            EA +R+RDP+YGCVAHIF LQQQVV LQAELAY+QA L+TL
Sbjct  92   EALARVRDPIYGCVAHIFTLQQQVVTLQAELAYVQARLSTL  132



>ref|XP_006490937.1| PREDICTED: LOB domain-containing protein 31-like [Citrus sinensis]
Length=207

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 108/152 (71%), Gaps = 7/152 (5%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYFD++QG  HFAAVHKVFGASN SKLL  IP HKRLDAV+++CY
Sbjct  15   CKFLRRKCVKGCVFAPYFDADQGTTHFAAVHKVFGASNASKLLSRIPPHKRLDAVVSLCY  74

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EA +R RDP+YGCV HI ALQQQVVNLQAELA+ QA L+ L+          QS     L
Sbjct  75   EAMARTRDPIYGCVGHIVALQQQVVNLQAELAFTQARLSILQRLPMASAAQDQSTSPCSL  134

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPM  278
            +    +++ AD+ +G       Y++S  FDP+
Sbjct  135  YSSSEMVSTADMASG-------YNISMQFDPL  159



>ref|XP_006445238.1| hypothetical protein CICLE_v10022291mg [Citrus clementina]
 gb|ESR58478.1| hypothetical protein CICLE_v10022291mg [Citrus clementina]
Length=205

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 108/152 (71%), Gaps = 7/152 (5%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYFD++QG  HFAAVHKVFGASN SKLL  IP HKRLDAV+++CY
Sbjct  13   CKFLRRKCVKGCVFAPYFDADQGTTHFAAVHKVFGASNASKLLSRIPPHKRLDAVVSLCY  72

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EA +R RDP+YGCV HI ALQQQVVNLQAELA+ QA L+ L+          QS     L
Sbjct  73   EAMARTRDPIYGCVGHIVALQQQVVNLQAELAFTQARLSILQRLPMASAAQDQSTSPCSL  132

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPM  278
            +    +++ AD+ +G       Y++S  FDP+
Sbjct  133  YSSSEMVSTADMASG-------YNISMQFDPL  157



>ref|XP_008345767.1| PREDICTED: LOB domain-containing protein 19 [Malus domestica]
Length=228

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC+ GCIFAPYFD+EQG AHFAAVHKVFGASN SKLLL IP HKRLDAV+T+ Y
Sbjct  22   CKFLRRKCIKGCIFAPYFDAEQGTAHFAAVHKVFGASNASKLLLRIPPHKRLDAVVTLSY  81

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPVYGCV+HIF LQQQVVNLQAELAY+QA L TL+
Sbjct  82   EALARVRDPVYGCVSHIFTLQQQVVNLQAELAYVQARLGTLQ  123



>ref|XP_002511729.1| LOB domain-containing protein, putative [Ricinus communis]
 gb|EEF50398.1| LOB domain-containing protein, putative [Ricinus communis]
Length=203

 Score =   179 bits (455),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC+ GCIFAPYFDS+QG AHFAAVHKVFGASN SKLLL IP HKR DAV+T+CY
Sbjct  11   CKFLRRKCLKGCIFAPYFDSDQGTAHFAAVHKVFGASNASKLLLRIPAHKRFDAVVTLCY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPVYGCV H+F LQQQVV+LQAELAY+QA L+TL+
Sbjct  71   EALARVRDPVYGCVGHLFTLQQQVVSLQAELAYIQARLSTLQ  112



>ref|XP_009347042.1| PREDICTED: LOB domain-containing protein 19-like [Pyrus x bretschneideri]
Length=227

 Score =   180 bits (456),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC+ GCIFAPYFD+EQG AHFAAVHKVFGASN SKLLL IP HKRLDAV+T+CY
Sbjct  22   CKFLRRKCIKGCIFAPYFDAEQGTAHFAAVHKVFGASNASKLLLRIPPHKRLDAVVTLCY  81

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPVYGC +HIF LQQQVVNLQAELAY+ A L TL+
Sbjct  82   EALARVRDPVYGCASHIFTLQQQVVNLQAELAYVHARLGTLQ  123



>ref|XP_011017497.1| PREDICTED: LOB domain-containing protein 19-like isoform X1 [Populus 
euphratica]
Length=212

 Score =   179 bits (455),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFD +QG AHFAAVHKVFGASN SKLLL IP HKRLDAV+T+CY
Sbjct  16   CKFLRRKCVKGCIFAPYFDPDQGTAHFAAVHKVFGASNASKLLLRIPAHKRLDAVVTLCY  75

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPV+GCV HIF LQQQV+NLQAELAY+QA+L+TL+
Sbjct  76   EALTRVRDPVHGCVGHIFTLQQQVMNLQAELAYIQAYLSTLQ  117



>ref|XP_010424034.1| PREDICTED: LOB domain-containing protein 30-like [Camelina sativa]
Length=191

 Score =   179 bits (453),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 128/225 (57%), Gaps = 60/225 (27%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIP HKR DAV++IC+
Sbjct  20   CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPEHKRPDAVVSICF  79

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDP+YGCV+HI +LQQQ                                     
Sbjct  80   EAQARLRDPIYGCVSHIVSLQQQ-------------------------------------  102

Query  373  FVPPAVLNIADLPTGVPMMPATYDLSSLFDPMVQPAWAIQPRQLDPRQLFGGGAATRVAT  194
                  L+I DLPT   + P+ YDLSS F+P++   WA+Q +      +FG         
Sbjct  103  -----ALSITDLPT---ISPSLYDLSSFFEPVMSSTWAMQQQPRPSDHVFG---------  145

Query  193  VDMTsssssaagsggggGDLQELARELMHRHGSPTVPCTNAPSSA  59
                    S++   GGGG+LQ LARE +H    P  P      SA
Sbjct  146  ------VPSSSSIIGGGGELQALAREFIHGGQMPAQPSLGTGGSA  184



>gb|KHN40140.1| LOB domain-containing protein 31 [Glycine soja]
Length=214

 Score =   179 bits (455),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDS+QG AHFAAVHKVFGASN SKLL+ IP HKRLDAV+T+CY
Sbjct  20   CKFLRRKCVKGCIFAPYFDSDQGTAHFAAVHKVFGASNASKLLMRIPAHKRLDAVVTLCY  79

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLAT  434
            EA +R RDPVYGCV H+FALQQQV+NLQAEL Y+QA LAT
Sbjct  80   EALARARDPVYGCVGHLFALQQQVMNLQAELTYVQARLAT  119



>gb|EYU32001.1| hypothetical protein MIMGU_mgv1a024257mg [Erythranthe guttata]
Length=209

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYFDSEQG AHFAAVH+VFGASN SKLLL IP H+RLDAVIT+CY
Sbjct  24   CKFLRRKCVRGCVFAPYFDSEQGTAHFAAVHRVFGASNASKLLLRIPPHRRLDAVITLCY  83

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPVYGCV HIF LQQQ+VNLQAELAY QA ++T  
Sbjct  84   EALARVRDPVYGCVGHIFTLQQQIVNLQAELAYTQARISTFR  125



>gb|ACJ85221.1| unknown [Medicago truncatula]
 gb|AFK48871.1| unknown [Medicago truncatula]
 gb|KEH19042.1| lateral organ boundaries (LOB) domain protein [Medicago truncatula]
Length=216

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDS+QG  HFAAVHKVFGASN SKLL+ IP HKRLDAV+T+CY
Sbjct  22   CKFLRRKCVKGCIFAPYFDSDQGTVHFAAVHKVFGASNASKLLMRIPAHKRLDAVVTLCY  81

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R RDPVYGCVAHIFALQQQV++LQAEL Y+QA LAT++
Sbjct  82   EALARARDPVYGCVAHIFALQQQVMSLQAELTYVQATLATMQ  123



>ref|XP_009789949.1| PREDICTED: LOB domain-containing protein 19 [Nicotiana sylvestris]
Length=161

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CK+LRRKCV GCIFAPYFD+EQG +HFAAVHKVFGASN SKLLL IP +KRL+ VIT+CY
Sbjct  9    CKYLRRKCVKGCIFAPYFDTEQGMSHFAAVHKVFGASNASKLLLSIPANKRLETVITLCY  68

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPVYGCVAHIF LQQQV+ LQAELAY+QA L+TL+
Sbjct  69   EALARVRDPVYGCVAHIFTLQQQVLTLQAELAYVQARLSTLQ  110



>ref|XP_010056298.1| PREDICTED: LOB domain-containing protein 19 [Eucalyptus grandis]
 gb|KCW72964.1| hypothetical protein EUGRSUZ_E01415 [Eucalyptus grandis]
Length=237

 Score =   177 bits (450),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYFD++QG AHFAAVH+VFGASN SKLL  +P H+RLDAV+T+CY
Sbjct  35   CKFLRRKCVRGCVFAPYFDADQGPAHFAAVHRVFGASNASKLLARVPAHRRLDAVVTLCY  94

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R RDPVYGCV HIFALQQQVVNLQAELAY+QA LA+L+
Sbjct  95   EALARARDPVYGCVGHIFALQQQVVNLQAELAYVQARLASLQ  136



>emb|CDP17780.1| unnamed protein product [Coffea canephora]
Length=201

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC+ GCIFAPYFD EQG AHFAAVHKVFGASN SK+LL +P HKRLDAV+T+CY
Sbjct  15   CKFLRRKCLKGCIFAPYFDPEQGTAHFAAVHKVFGASNASKMLLRVPAHKRLDAVVTLCY  74

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPVYGCV H+F LQQQVVNLQAELA  QA L+TL+
Sbjct  75   EALARIRDPVYGCVGHLFTLQQQVVNLQAELACAQARLSTLQ  116



>ref|XP_009398866.1| PREDICTED: LOB domain-containing protein 30-like [Musa acuminata 
subsp. malaccensis]
Length=294

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 113/159 (71%), Gaps = 23/159 (14%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CK ++RKCV GCIFAPYFD+E+GAA FAAVHK+FGASNVSKLLL IP+ KR+DA+ T+CY
Sbjct  21   CKTMKRKCVKGCIFAPYFDAERGAARFAAVHKLFGASNVSKLLLQIPIDKRVDAIATLCY  80

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RLRDPVYGCVAHIFALQQQVVNL+AEL+ LQ  L  L+                 L
Sbjct  81   EAQARLRDPVYGCVAHIFALQQQVVNLRAELSILQTQLEALQ----------------EL  124

Query  373  FVPPAVLNIADLPTGVP---MMPATYDLSSLFDPMVQPA  266
             +PP    +   P+  P   ++P T+ LS +  P+VQP+
Sbjct  125  PLPP----VPTFPSPTPFSSILPTTWGLSDVEAPLVQPS  159



>ref|XP_009604914.1| PREDICTED: LOB domain-containing protein 19-like [Nicotiana tomentosiformis]
Length=161

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CK+LRRKCV GCIFAPYFD+EQG AHFAAVHKVFGASN SKLLL IP +KRL+ VIT+CY
Sbjct  9    CKYLRRKCVKGCIFAPYFDTEQGFAHFAAVHKVFGASNASKLLLSIPANKRLETVITLCY  68

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPVYG VAHIF LQQQVV LQAELAY+QA L+TL+
Sbjct  69   EALARVRDPVYGSVAHIFTLQQQVVTLQAELAYVQARLSTLQ  110



>ref|XP_010692268.1| PREDICTED: LOB domain-containing protein 19 [Beta vulgaris subsp. 
vulgaris]
Length=245

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CK+LRRKCV GC+FAPYFDSEQG AHFAAVHKVFGASN SKLLL IP H+RLD V+T+CY
Sbjct  34   CKYLRRKCVKGCVFAPYFDSEQGTAHFAAVHKVFGASNASKLLLRIPAHRRLDTVVTLCY  93

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA SR+RDP+YGCVAHIF LQQQV+++QAELA++ A L+TL+
Sbjct  94   EALSRVRDPIYGCVAHIFTLQQQVMSMQAELAFVHARLSTLQ  135



>ref|XP_006339769.1| PREDICTED: LOB domain-containing protein 18-like [Solanum tuberosum]
Length=168

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQG AHFAAVHKVFGASN SKLLL IP +KRL+ V+T+CY
Sbjct  13   CKFLRRKCVKGCIFAPYFDSEQGMAHFAAVHKVFGASNASKLLLTIPPNKRLETVVTLCY  72

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPVYGCV HIF+LQQQ V LQAELAY+QA ++TL+
Sbjct  73   EALARVRDPVYGCVGHIFSLQQQAVTLQAELAYVQARISTLQ  114



>ref|XP_008460130.1| PREDICTED: LOB domain-containing protein 19 [Cucumis melo]
Length=228

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDS+QGAAHFAAVHKVFGASN SKLL  IP  KRLDA +T+CY
Sbjct  33   CKFLRRKCVKGCIFAPYFDSDQGAAHFAAVHKVFGASNASKLLHRIPPPKRLDACVTLCY  92

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPVYGCV+ IF+LQQQVVNLQAELAY+QA L+TL+
Sbjct  93   EALARVRDPVYGCVSQIFSLQQQVVNLQAELAYIQAKLSTLQ  134



>ref|XP_004145059.1| PREDICTED: LOB domain-containing protein 31-like [Cucumis sativus]
 ref|XP_004153748.1| PREDICTED: LOB domain-containing protein 31-like [Cucumis sativus]
 ref|XP_004160688.1| PREDICTED: LOB domain-containing protein 31-like [Cucumis sativus]
 gb|KGN46237.1| hypothetical protein Csa_6G076850 [Cucumis sativus]
Length=213

 Score =   175 bits (443),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDS+QGAAHFAAVHKVFGASN SKLL  IP  KRLDA +T+CY
Sbjct  18   CKFLRRKCVKGCIFAPYFDSDQGAAHFAAVHKVFGASNASKLLHRIPPPKRLDACVTLCY  77

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPVYGCV+ IF+LQQQVVNLQAELAY+QA L+TL+
Sbjct  78   EALARVRDPVYGCVSQIFSLQQQVVNLQAELAYIQAKLSTLQ  119



>ref|XP_004510943.1| PREDICTED: LOB domain-containing protein 31-like [Cicer arietinum]
Length=216

 Score =   175 bits (443),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDS+QG  HFAAVHKVFGASN SKLL+ IP HKRLDAV+T+CY
Sbjct  20   CKFLRRKCVKGCIFAPYFDSDQGTVHFAAVHKVFGASNASKLLMRIPSHKRLDAVVTLCY  79

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R RDP+YGCV HIFALQQQV++LQAEL Y+Q  LAT++
Sbjct  80   EALARSRDPLYGCVGHIFALQQQVMSLQAELTYVQHSLATMQ  121



>ref|XP_008467063.1| PREDICTED: LOB domain-containing protein 18-like [Cucumis melo]
Length=117

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = -1

Query  730  KFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICYE  551
            KFLRRKCV GCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAV+TICYE
Sbjct  34   KFLRRKCVPGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVVTICYE  93

Query  550  AQSRLRDPVYGCVAHIFALQQQVV  479
            AQ+RLRDPVYGCVAHIFALQQQV+
Sbjct  94   AQARLRDPVYGCVAHIFALQQQVI  117



>gb|KHN40565.1| LOB domain-containing protein 16 [Glycine soja]
Length=109

 Score =   168 bits (425),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAPYFDSEQG +HFAAVHKVFGASNVSKLLL IPVH+RLD VITICY
Sbjct  23   CKFLRRKCVSGCIFAPYFDSEQGTSHFAAVHKVFGASNVSKLLLSIPVHRRLDTVITICY  82

Query  553  EAQSRLRDPVYGCVAHIFALQQQVV  479
            EAQSR+RDPVYGCVAHIFALQQQV+
Sbjct  83   EAQSRIRDPVYGCVAHIFALQQQVI  107



>ref|NP_182065.1| LOB domain-containing protein 19 [Arabidopsis thaliana]
 sp|O22132.1|LBD19_ARATH RecName: Full=LOB domain-containing protein 19; AltName: Full=ASYMMETRIC 
LEAVES 2-like protein 23; Short=AS2-like protein 
23 [Arabidopsis thaliana]
 gb|AAB82623.1| unknown protein [Arabidopsis thaliana]
 dbj|BAH10567.1| ASYMMETRIC LEAVES2-like 23 protein [Arabidopsis thaliana]
 gb|AEC10549.1| LOB domain-containing protein 19 [Arabidopsis thaliana]
Length=191

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYFD+EQG A FAAVHKVFGASN SK+LL +P+HKRLDAV+T+CY
Sbjct  20   CKFLRRKCVKGCVFAPYFDAEQGTARFAAVHKVFGASNASKMLLRLPLHKRLDAVVTLCY  79

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPVYG V H+F+LQ QV+NLQAELA++QA L+T++
Sbjct  80   EAMARIRDPVYGSVGHLFSLQHQVMNLQAELAHVQARLSTIQ  121



>ref|XP_006296305.1| hypothetical protein CARUB_v10025477mg [Capsella rubella]
 gb|EOA29203.1| hypothetical protein CARUB_v10025477mg [Capsella rubella]
Length=193

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYFD+EQG A FAAVHKVFGASN SK+LL +P+HKR DAV+T+CY
Sbjct  21   CKFLRRKCVKGCVFAPYFDAEQGTARFAAVHKVFGASNASKMLLRLPLHKRFDAVVTLCY  80

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +RLRDPVYG V H+F+LQ QV+NLQAELA++QA L+T +
Sbjct  81   EAMARLRDPVYGSVGHLFSLQHQVMNLQAELAHVQARLSTFQ  122



>ref|XP_010506483.1| PREDICTED: LOB domain-containing protein 19 [Camelina sativa]
Length=189

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYFD+EQG A FAAVHKVFGASN SK+LL +P+HKR DAV+T+CY
Sbjct  20   CKFLRRKCVKGCVFAPYFDAEQGTARFAAVHKVFGASNASKMLLRLPLHKRFDAVVTLCY  79

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +RLRDPVYG V H+F+LQ QV+NLQAELA++QA L+T +
Sbjct  80   EAMARLRDPVYGSVGHLFSLQHQVMNLQAELAHVQARLSTFQ  121



>gb|ADE76152.1| unknown [Picea sitchensis]
Length=219

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYFDS++GA +FAAVHK+FGASNVSKLL HIP+ +R +AV+TI Y
Sbjct  11   CKFLRRKCVKGCVFAPYFDSDEGAENFAAVHKIFGASNVSKLLQHIPIPERSEAVVTISY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLAT  434
            EAQ+RLRDPVYGCVAHIFALQQQV +LQAEL ++QA LA+
Sbjct  71   EAQARLRDPVYGCVAHIFALQQQVASLQAELTFVQAQLAS  110



>gb|KDP28745.1| hypothetical protein JCGZ_14516 [Jatropha curcas]
Length=228

 Score =   170 bits (430),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 89/102 (87%), Gaps = 5/102 (5%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC+ GCIFAPYFDS+QG AHFAAVHKVFGASN SKLLL IP HKRLDAV+T+CY
Sbjct  46   CKFLRRKCLKGCIFAPYFDSDQGTAHFAAVHKVFGASNASKLLLRIPAHKRLDAVVTLCY  105

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPVYGCV H+FALQQ     QAELAY+QA L+TL+
Sbjct  106  EALARVRDPVYGCVGHLFALQQ-----QAELAYIQARLSTLQ  142



>gb|EYU32002.1| hypothetical protein MIMGU_mgv1a022726mg, partial [Erythranthe 
guttata]
Length=120

 Score =   166 bits (420),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/83 (94%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGAS+VSKLLLHIP HKRLDAV+TICY
Sbjct  38   CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASHVSKLLLHIPPHKRLDAVVTICY  97

Query  553  EAQSRLRDPVYGCVAHIFALQQQ  485
            EAQ+RLRDP+YGCVAHIFALQQQ
Sbjct  98   EAQARLRDPIYGCVAHIFALQQQ  120



>ref|XP_006289084.1| hypothetical protein CARUB_v10002489mg [Capsella rubella]
 gb|EOA21982.1| hypothetical protein CARUB_v10002489mg [Capsella rubella]
Length=220

 Score =   169 bits (428),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+ CIFAPYFDSE+G +HFAAVHKVFGASN SKLL+ IP  +RLDAV+T+ Y
Sbjct  15   CKFLRRKCVSECIFAPYFDSEEGTSHFAAVHKVFGASNASKLLMMIPASRRLDAVVTLSY  74

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +RLRDPVYGCV HIFALQ QV+NLQ ELAY+Q  L +++
Sbjct  75   EALARLRDPVYGCVGHIFALQHQVMNLQVELAYVQTQLTSIQ  116



>ref|NP_191932.4| LOB domain-containing protein 31 [Arabidopsis thaliana]
 sp|O81322.2|LBD31_ARATH RecName: Full=LOB domain-containing protein 31; AltName: Full=ASYMMETRIC 
LEAVES 2-like protein 22; Short=AS2-like protein 
22 [Arabidopsis thaliana]
 dbj|BAH10566.1| ASYMMETRIC LEAVES2-like 22 protein [Arabidopsis thaliana]
 gb|AEE81838.1| LOB domain-containing protein 31 [Arabidopsis thaliana]
Length=220

 Score =   169 bits (428),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCVA C+FAPYFDS +G +HF AVHKVFGASN SKLL+ IP  +RLDAV+T+ Y
Sbjct  15   CKFLRRKCVADCVFAPYFDSVEGTSHFTAVHKVFGASNASKLLMMIPASRRLDAVVTLTY  74

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +RLRDPVYGCV HIFALQ QV+NLQAELAY+Q  L+TL+
Sbjct  75   EALARLRDPVYGCVGHIFALQHQVMNLQAELAYVQTQLSTLQ  116



>ref|XP_010512839.1| PREDICTED: LOB domain-containing protein 19 [Camelina sativa]
Length=190

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYFD+EQG A FAAVHKVFGASN SK+L  +P+HKR DAV+T+CY
Sbjct  21   CKFLRRKCVKGCVFAPYFDAEQGTARFAAVHKVFGASNASKMLQRLPLHKRFDAVVTLCY  80

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +RLRDPVYG V H+F+LQ QV+NLQAELA++QA L+T +
Sbjct  81   EAMARLRDPVYGSVGHLFSLQHQVMNLQAELAHVQARLSTFQ  122



>ref|XP_001779579.1| predicted protein [Physcomitrella patens]
 gb|EDQ55573.1| predicted protein [Physcomitrella patens]
Length=118

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYF +EQGAA FAAVHKVFGASNV+KLLLHIP  +R DAV+TI Y
Sbjct  20   CKFLRRKCVRGCIFAPYFGAEQGAAKFAAVHKVFGASNVAKLLLHIPTPRRCDAVLTISY  79

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL DPVYGCVA IF+LQQQV +LQAELA +QA LA
Sbjct  80   EAQARLSDPVYGCVATIFSLQQQVASLQAELAMVQAQLA  118



>gb|KFK30603.1| hypothetical protein AALP_AA6G003300 [Arabis alpina]
Length=211

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCVA CIFAPYFDSE+GAAHF AVHKVFGASN +KLL  +P  +RLDAV+T+ Y
Sbjct  11   CKFLRRKCVAECIFAPYFDSEEGAAHFTAVHKVFGASNAAKLLSTVPASQRLDAVVTLSY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +RL DPVYGCV HIFALQ QV+NLQAELAY Q HL+ L+
Sbjct  71   EAFARLSDPVYGCVGHIFALQHQVMNLQAELAYFQTHLSALQ  112



>ref|XP_006396220.1| hypothetical protein EUTSA_v10028924mg [Eutrema salsugineum]
 gb|ESQ37673.1| hypothetical protein EUTSA_v10028924mg [Eutrema salsugineum]
Length=237

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCVA CIFAPYFDSE+G AHFAAVHKVFGASN SKLL  IP  +RLDAV+T+ Y
Sbjct  28   CKFLRRKCVAECIFAPYFDSEEGTAHFAAVHKVFGASNASKLLFMIPASRRLDAVVTLSY  87

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +RL DPVYGCV HIFALQ QV+NL+AELA +Q  L+TL+
Sbjct  88   EALARLSDPVYGCVGHIFALQHQVMNLEAELAMVQTQLSTLQ  129



>ref|XP_010918824.1| PREDICTED: LOB domain-containing protein 14-like [Elaeis guineensis]
Length=236

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYF  EQGA HFAA+HKVFGASNVSKLL+H+PV+ R +A ITI Y
Sbjct  11   CKFLRRKCVRGCIFAPYFCHEQGATHFAAIHKVFGASNVSKLLMHLPVNDRSEAAITISY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAH  443
            EAQ+RL+DP+YGCVAHIFALQQQVVNLQA+LA LQA 
Sbjct  71   EAQARLQDPIYGCVAHIFALQQQVVNLQAQLASLQAQ  107



>ref|XP_001763572.1| predicted protein [Physcomitrella patens]
 gb|EDQ71761.1| predicted protein [Physcomitrella patens]
Length=117

 Score =   164 bits (415),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYF +EQGAA FAAVHK+FGASNV+KLLLHIPV +R DAV+TI Y
Sbjct  5    CKFLRRKCVRGCIFAPYFGAEQGAARFAAVHKIFGASNVAKLLLHIPVSRRCDAVLTISY  64

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EAQ+RL DPVYGCVA IFALQQQV +LQAELA +QA L   +
Sbjct  65   EAQARLSDPVYGCVATIFALQQQVASLQAELAMVQAQLVNRQ  106



>ref|XP_002882012.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58271.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=192

 Score =   167 bits (422),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYFD++QG A FAAVHKVFGASN SK+LL +P+HKRLDAV+T+C+
Sbjct  21   CKFLRRKCVKGCVFAPYFDADQGTARFAAVHKVFGASNASKMLLRLPLHKRLDAVVTLCH  80

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +RLRDPVYG V H+F+LQ QV+NLQAELA++QA L+T +
Sbjct  81   EAMARLRDPVYGSVGHLFSLQHQVMNLQAELAHVQALLSTFQ  122



>ref|XP_010904567.1| PREDICTED: LOB domain-containing protein 29-like [Elaeis guineensis]
Length=238

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQGAAHFAA+HKVFGASNVSKLL+H+PV+ R +A ITI Y
Sbjct  11   CKFLRRKCVRGCVFAPYFCHEQGAAHFAAIHKVFGASNVSKLLMHLPVNDRSEAAITISY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL+DP+YGCVAHIFALQQQVVNLQA+LA L+A  A
Sbjct  71   EAQARLQDPIYGCVAHIFALQQQVVNLQAQLASLKAQAA  109



>ref|XP_001772946.1| predicted protein [Physcomitrella patens]
 gb|EDQ62171.1| predicted protein [Physcomitrella patens]
Length=105

 Score =   162 bits (411),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYF +EQGAA FAAVHKVFGASNV+KLLLHIP  +R DAV+TI Y
Sbjct  7    CKFLRRKCVRGCIFAPYFSAEQGAAKFAAVHKVFGASNVAKLLLHIPAPRRGDAVLTISY  66

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL DPVYGCVA IFALQQQV +LQAELA +Q  LA
Sbjct  67   EAQARLSDPVYGCVATIFALQQQVASLQAELAMVQTQLA  105



>ref|XP_008794315.1| PREDICTED: LOB domain-containing protein 29-like [Phoenix dactylifera]
Length=236

 Score =   167 bits (422),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQGAAHFAA+HKVFGASNVSKLL+H+PV+ R +A ITI Y
Sbjct  11   CKFLRRKCVRGCVFAPYFCHEQGAAHFAAIHKVFGASNVSKLLMHLPVNDRSEAAITISY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL+DP+YGCVAHIFALQQQVVNLQA+LA L+A  A
Sbjct  71   EAQARLQDPIYGCVAHIFALQQQVVNLQAQLASLKAQAA  109



>ref|XP_010426727.1| PREDICTED: LOB domain-containing protein 31-like [Camelina sativa]
Length=214

 Score =   166 bits (420),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC++ C+FAPYFDSE+G +HFAAVHKVFGASN SKLL+ IP  +RLDAV+T+ Y
Sbjct  15   CKFLRRKCLSECVFAPYFDSEEGTSHFAAVHKVFGASNASKLLMMIPESRRLDAVVTLSY  74

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +RLRDPVYGCV HIFALQ QV+NLQAELA +Q  L++L+
Sbjct  75   EALARLRDPVYGCVGHIFALQHQVMNLQAELADVQTQLSSLQ  116



>ref|XP_010419557.1| PREDICTED: LOB domain-containing protein 31-like [Camelina sativa]
Length=216

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC++ C+FAPYFDSE+G +HFAAVHKVFGASN SKLL+ IP  +RLDAV+T+ Y
Sbjct  15   CKFLRRKCLSECVFAPYFDSEEGTSHFAAVHKVFGASNASKLLMMIPESRRLDAVVTLSY  74

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +RLRDPVYGCV HIFALQ QV+NLQAELA +Q  L++L+
Sbjct  75   EALARLRDPVYGCVGHIFALQHQVMNLQAELADVQTQLSSLQ  116



>ref|XP_009142333.1| PREDICTED: LOB domain-containing protein 19-like [Brassica rapa]
Length=168

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GC+FAPYFD+EQG A FAA+HKVFGASN SK+LL +P+HKRLDAV T+ Y
Sbjct  22   CKFLRRKCVSGCVFAPYFDAEQGTASFAAIHKVFGASNTSKMLLRLPLHKRLDAVATLGY  81

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPVYGCV H+F+LQ QV+NLQAE+A++QA L+  +
Sbjct  82   EALARVRDPVYGCVGHLFSLQHQVMNLQAEIAHVQARLSMFQ  123



>ref|XP_002271115.1| PREDICTED: LOB domain-containing protein 20 [Vitis vinifera]
Length=238

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAP+F S+QGAA FAAVHKVFGASNVSKLLLHIPV++R DAV+TI Y
Sbjct  46   CKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLLHIPVNRRHDAVVTISY  105

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHL  440
            EAQ+RL DPVYGCV+ I ALQQQV +LQAELA +QA L
Sbjct  106  EAQARLSDPVYGCVSTILALQQQVASLQAELAMVQAQL  143



>ref|XP_010413062.1| PREDICTED: LOB domain-containing protein 18-like [Camelina sativa]
Length=190

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 138/197 (70%), Gaps = 13/197 (7%)
 Frame = -1

Query  637  VFGASNVSKLLLHIPVHKRLDAVITICYEAQSRLRDPVYGCVAHIFALQQQVVNLQAELA  458
            VFGASNVSKLLLHIPVH+R DAV+TICYEAQ+R+RDP+YGCVAHIFALQQQVVNLQAE++
Sbjct  2    VFGASNVSKLLLHIPVHRRSDAVVTICYEAQARIRDPIYGCVAHIFALQQQVVNLQAEVS  61

Query  457  YLQAHLATLEvpnapppvaqqsqpqpPLFVPPAVLNIADLPTGVPMMPATYDLSSLFDPM  278
            YLQAHLA+LE+P         SQ QP  F PP   ++ + P  V  +P+TYDL+S+FD  
Sbjct  62   YLQAHLASLELPQPQTRPQPLSQQQPLFFAPPPPFSVTE-PASVSPLPSTYDLASIFDQN  120

Query  277  V-QPAWAIQPRQ-LDPRQLFGGGAATRVATVDMTsssssaagsggggGDLQELARELMHR  104
                AWA Q R+ +DPRQ +G         V  +SSS++A G GG   DL  LA EL+HR
Sbjct  121  TPSSAWATQQRRFVDPRQQYG---------VPSSSSSAAAIGLGGENSDLHALAHELLHR  171

Query  103  HGSPTVPCT-NAPSSAL  56
             GSP    T ++PS ++
Sbjct  172  QGSPPPAATDDSPSRSM  188



>ref|XP_010266765.1| PREDICTED: LOB domain-containing protein 20 [Nelumbo nucifera]
Length=236

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 111/173 (64%), Gaps = 11/173 (6%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC++GCIFAPYF ++QGAA FAAVHKVFGASNVSKLLLH+P ++R D V+TI Y
Sbjct  44   CKFLRRKCISGCIFAPYFGTDQGAARFAAVHKVFGASNVSKLLLHVPTNRRHDTVVTISY  103

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EAQ+RL DPVYGCV+ I ALQQQV  LQAEL+ +Q  L    +  A     Q S  Q   
Sbjct  104  EAQARLSDPVYGCVSTILALQQQVAALQAELSVVQEQLINNRLAVANALQLQMSTQQHLS  163

Query  373  FVPPAVLNIADLPTGVPMM---PATYDLSSLFDPMVQPAWAIQPRQLDPRQLF  224
             + PA  N +     +  M   P+++DL+    P         PR  +P QLF
Sbjct  164  VLQPAFSNNSTASNNLVTMSGLPSSFDLAIEMGP--------SPRSFEPLQLF  208



>ref|XP_010524360.1| PREDICTED: LOB domain-containing protein 19 [Tarenaya hassleriana]
Length=204

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 113/189 (60%), Gaps = 17/189 (9%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFD E+G + FAAVHKVFGASN SK+L+ +P +KRLDA +T+CY
Sbjct  16   CKFLRRKCVGGCIFAPYFDGEEGTSRFAAVHKVFGASNASKMLMKLPSNKRLDASVTLCY  75

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPL  374
            EA SRLRDPVYG V+ +F+LQ QVV LQAELAY+QA L+T +             P    
Sbjct  76   EALSRLRDPVYGPVSLLFSLQHQVVKLQAELAYIQARLSTFQRFPPQQLHPSLQIPPSLR  135

Query  373  FVPPAVLNIADLPTGV------PMMPATYDLSSLFDPMVQPAWAIQPRQLDPRQLFGGGA  212
            +  P+ +    LP  V      P  P+ +DL           W   P  +D R L     
Sbjct  136  WSSPSDMTQPSLPQVVVPNSHSPTDPSDFDL-----------WEEDPLAIDDRALLQQQV  184

Query  211  ATRVATVDM  185
            AT++  ++ 
Sbjct  185  ATQLTAMNF  193



>ref|XP_010496906.1| PREDICTED: LOB domain-containing protein 30-like, partial [Camelina 
sativa]
Length=186

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 110/148 (74%), Gaps = 8/148 (5%)
 Frame = -1

Query  664  AAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICYEAQSRLRDPVYGCVAHIFALQQQ  485
            AAHFAAVHKVFGASNVSKLLLHIP HKR DAV++IC+EAQ+RLRDP+YGCVAHI +LQQQ
Sbjct  1    AAHFAAVHKVFGASNVSKLLLHIPEHKRPDAVVSICFEAQARLRDPIYGCVAHIVSLQQQ  60

Query  484  VVNLQAELAYLQAHLATLEvpnapppvaqqsqpqpPLFVPPAVLNIADLPTGVPMMPATY  305
            VV+LQ EL+YLQAHLATLE+P   PP+A  S            L+I DLPT   + P+ Y
Sbjct  61   VVSLQTELSYLQAHLATLELPQPQPPMAPVSSSGSL-----QALSITDLPT---ISPSLY  112

Query  304  DLSSLFDPMVQPAWAIQPRQLDPRQLFG  221
            DLSS F+P++   WA+Q +      +FG
Sbjct  113  DLSSFFEPVMSSTWAMQQQTRPSDHVFG  140



>emb|CDY07237.1| BnaCnng02520D [Brassica napus]
Length=193

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCVA CIFAPYFD+E+G AHFAAVHKVFGASN SKLLL IP ++R +AV T+ Y
Sbjct  15   CKFLRRKCVAECIFAPYFDAEEGTAHFAAVHKVFGASNTSKLLLMIPANRRPEAVATLSY  74

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +RLRDPVYGCV HIFALQ QV++LQ ELA ++ HL TLE
Sbjct  75   EALARLRDPVYGCVGHIFALQHQVMSLQEELAVVKTHLTTLE  116



>emb|CDY57108.1| BnaC04g56950D [Brassica napus]
Length=178

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYFD+EQG A FAA+HKVFGASN SK+LL +P+HKRLDAV T+ Y
Sbjct  32   CKFLRRKCVRGCVFAPYFDAEQGTASFAAIHKVFGASNTSKMLLRLPLHKRLDAVATLGY  91

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPVYGCV H+F+LQ QV+NLQAE+A++QA L+  +
Sbjct  92   EALARVRDPVYGCVGHLFSLQHQVMNLQAEIAHVQARLSMFQ  133



>emb|CDY37038.1| BnaA04g26160D [Brassica napus]
Length=178

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYFD+EQG A FAA+HKVFGASN SK+LL +P+HKRLDAV T+ Y
Sbjct  32   CKFLRRKCVRGCVFAPYFDAEQGTASFAAIHKVFGASNTSKMLLRLPLHKRLDAVATLGY  91

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPVYGCV H+F+LQ QV+NLQAE+A++QA L+  +
Sbjct  92   EALARVRDPVYGCVGHLFSLQHQVMNLQAEIAHVQARLSMFQ  133



>ref|XP_003536931.1| PREDICTED: LOB domain-containing protein 29-like [Glycine max]
 gb|KHN03864.1| LOB domain-containing protein 29 [Glycine soja]
Length=239

 Score =   165 bits (418),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQGA HFAA+HKVFGASNVSKLL H+PV  R +A +TI Y
Sbjct  11   CKFLRRKCVRGCVFAPYFCQEQGATHFAAIHKVFGASNVSKLLAHLPVSDRCEAAVTISY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL+DP+YGCV+HIFALQQQVVNLQA+LAYL+   A
Sbjct  71   EAQARLQDPIYGCVSHIFALQQQVVNLQAQLAYLKEQAA  109



>ref|XP_009366531.1| PREDICTED: LOB domain-containing protein 20-like [Pyrus x bretschneideri]
Length=232

 Score =   165 bits (417),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC++GCIFAP F S+QGAA FAAVHKVFGASNVSKLLLHIP+++R DAV+TI Y
Sbjct  59   CKFLRRKCISGCIFAPLFSSDQGAARFAAVHKVFGASNVSKLLLHIPLNRRHDAVVTISY  118

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHL  440
            EAQ+RL DPVYGCV+ I ALQQQV +LQAELA +Q  L
Sbjct  119  EAQARLSDPVYGCVSTILALQQQVASLQAELAMVQTQL  156



>ref|XP_009111506.1| PREDICTED: LOB domain-containing protein 31 [Brassica rapa]
 emb|CDY67746.1| BnaUnng02520D [Brassica napus]
Length=222

 Score =   164 bits (416),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCVA CIFAPYFD+E+G AHFAAVHKVFGASN SKLLL IP ++R +AV T+ Y
Sbjct  15   CKFLRRKCVAECIFAPYFDAEEGTAHFAAVHKVFGASNTSKLLLMIPANRRPEAVATLSY  74

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +RLRDPVYGCV HIFALQ QV++LQ ELA ++ HL TLE
Sbjct  75   EALARLRDPVYGCVGHIFALQHQVMSLQEELAVVKTHLTTLE  116



>emb|CBI31238.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   165 bits (418),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAP+F S+QGAA FAAVHKVFGASNVSKLLLHIPV++R DAV+TI Y
Sbjct  38   CKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLLHIPVNRRHDAVVTISY  97

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHL  440
            EAQ+RL DPVYGCV+ I ALQQQV +LQAELA +QA L
Sbjct  98   EAQARLSDPVYGCVSTILALQQQVASLQAELAMVQAQL  135



>ref|XP_009353184.1| PREDICTED: LOB domain-containing protein 20-like [Pyrus x bretschneideri]
Length=246

 Score =   165 bits (417),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC++GCIFAP+F S+QGAA FAAVHKVFGASNVSKLLLHIP+++R DAV+TI Y
Sbjct  57   CKFLRRKCISGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLLHIPLNRRHDAVVTITY  116

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHL  440
            EAQ+RL DPVYGCV+ + ALQQQV +LQAELA +Q  L
Sbjct  117  EAQARLSDPVYGCVSTVLALQQQVASLQAELATVQTQL  154



>ref|XP_001759142.1| predicted protein [Physcomitrella patens]
 gb|EDQ76211.1| predicted protein [Physcomitrella patens]
Length=152

 Score =   162 bits (409),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYF +EQGAA FAAVHKVFGASNV+KLLLHIP  +R DAV+TI Y
Sbjct  8    CKFLRRKCVRGCIFAPYFSAEQGAAKFAAVHKVFGASNVAKLLLHIPAPRRNDAVLTISY  67

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHL  440
            EAQ+RL DPVYGCVA IFALQQQV +LQAEL  +Q  L
Sbjct  68   EAQARLSDPVYGCVATIFALQQQVASLQAELTMMQTQL  105



>ref|XP_003623743.1| LOB domain-containing protein [Medicago truncatula]
 gb|AES79961.1| LOB domain protein [Medicago truncatula]
Length=197

 Score =   163 bits (413),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 90/104 (87%), Gaps = 2/104 (2%)
 Frame = -1

Query  733  CKFLRRKCVAGC-IFAPYFDSE-QGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITI  560
            CKFLRRKCV GC IFAPYF+S  QG+AHFAAVHKVFGASN +KLL  IPVHKRLDAV+T+
Sbjct  16   CKFLRRKCVKGCCIFAPYFESSGQGSAHFAAVHKVFGASNAAKLLTRIPVHKRLDAVVTL  75

Query  559  CYEAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            CYEA +R  DPVYGCVAH+FALQQQVV LQAELAY+QA L+ L 
Sbjct  76   CYEALARATDPVYGCVAHLFALQQQVVELQAELAYVQARLSILN  119



>gb|KEH23896.1| LOB domain protein [Medicago truncatula]
Length=224

 Score =   164 bits (415),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYF  EQGA HFAA+HKVFGASNVSKLL H+PV  R +A +TI Y
Sbjct  12   CKFLRRKCVRGCIFAPYFCHEQGATHFAAIHKVFGASNVSKLLAHLPVTDRCEAAVTISY  71

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL+DP+YGCVAHIFALQQQVVNLQA+LA+L+   A
Sbjct  72   EAQARLQDPIYGCVAHIFALQQQVVNLQAQLAFLREQAA  110



>ref|XP_007144924.1| hypothetical protein PHAVU_007G195000g [Phaseolus vulgaris]
 gb|ESW16918.1| hypothetical protein PHAVU_007G195000g [Phaseolus vulgaris]
Length=238

 Score =   164 bits (416),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQGA HFAA+HKVFGASNVSKLL H+PV  R +A +TI Y
Sbjct  11   CKFLRRKCVRGCVFAPYFCHEQGATHFAAIHKVFGASNVSKLLAHLPVSDRCEAAVTISY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL+DP+YGCV+HIFALQQQVVNLQA+LAYL+   A
Sbjct  71   EAQARLQDPIYGCVSHIFALQQQVVNLQAQLAYLKEQAA  109



>ref|XP_003541340.1| PREDICTED: LOB domain-containing protein 29-like [Glycine max]
 gb|KHN44981.1| LOB domain-containing protein 29 [Glycine soja]
Length=237

 Score =   164 bits (416),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQGA HFAA+HKVFGASNVSKLL H+PV  R +A +TI Y
Sbjct  11   CKFLRRKCVRGCVFAPYFCHEQGATHFAAIHKVFGASNVSKLLAHLPVSDRCEAAVTISY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL+DP+YGCV+HIFALQQQVVNLQA+LAYL+   A
Sbjct  71   EAQARLQDPIYGCVSHIFALQQQVVNLQAQLAYLKEQAA  109



>ref|XP_006397722.1| hypothetical protein EUTSA_v10001778mg [Eutrema salsugineum]
 gb|ESQ39175.1| hypothetical protein EUTSA_v10001778mg [Eutrema salsugineum]
Length=193

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLR+KCV GC+FAPYFD+EQG + FAAVHKVFGASN SK+L  +P++KRLDAV+T+CY
Sbjct  20   CKFLRKKCVRGCVFAPYFDAEQGTSRFAAVHKVFGASNASKMLQRLPLNKRLDAVVTLCY  79

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +RLRDPVYG V H+F LQ QV+NLQAELA++QA L+T +
Sbjct  80   EALARLRDPVYGSVGHLFYLQHQVMNLQAELAHVQARLSTFQ  121



>ref|XP_004152037.1| PREDICTED: LOB domain-containing protein 16-like [Cucumis sativus]
 ref|XP_004165236.1| PREDICTED: LOB domain-containing protein 16-like [Cucumis sativus]
Length=229

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCVA CIFAPYF SEQGAA FAA+HKVFGASNVSKLLLH+PVH R +AV+TI Y
Sbjct  21   CKFLRRKCVADCIFAPYFCSEQGAARFAAIHKVFGASNVSKLLLHVPVHDRCEAVVTIAY  80

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+R+ DPVYGCVAHIFALQQQV  LQ +L + +A LA
Sbjct  81   EAQARIHDPVYGCVAHIFALQQQVAYLQTQLMHAKAQLA  119



>ref|XP_010274825.1| PREDICTED: LOB domain-containing protein 29 [Nelumbo nucifera]
Length=240

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQGA HFAA+HKVFGASNVSKLL H+PV  R +A +TI Y
Sbjct  11   CKFLRRKCVKGCVFAPYFCHEQGATHFAAIHKVFGASNVSKLLAHLPVTDRCEAAVTISY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL+DP+YGCV+HIFALQQQVVNLQA+LA L+A  A
Sbjct  71   EAQARLQDPIYGCVSHIFALQQQVVNLQAQLASLKAQAA  109



>gb|KGN57934.1| hypothetical protein Csa_3G398920 [Cucumis sativus]
Length=241

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCVA CIFAPYF SEQGAA FAA+HKVFGASNVSKLLLH+PVH R +AV+TI Y
Sbjct  33   CKFLRRKCVADCIFAPYFCSEQGAARFAAIHKVFGASNVSKLLLHVPVHDRCEAVVTIAY  92

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+R+ DPVYGCVAHIFALQQQV  LQ +L + +A LA
Sbjct  93   EAQARIHDPVYGCVAHIFALQQQVAYLQTQLMHAKAQLA  131



>ref|XP_008787549.1| PREDICTED: LOB domain-containing protein 14-like [Phoenix dactylifera]
Length=242

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYF  EQGAAHFAA+HKVFGASNVSKLL+H+PV  R +A +TI Y
Sbjct  11   CKFLRRKCVRGCIFAPYFCHEQGAAHFAAIHKVFGASNVSKLLMHLPVADRCEAAVTISY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL+DP+YGCVAHIF LQQQVVNLQA+LA L+A  A
Sbjct  71   EAQARLQDPIYGCVAHIFTLQQQVVNLQAQLASLKAQAA  109



>emb|CDP03725.1| unnamed protein product [Coffea canephora]
Length=234

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQGAAHFAA+HKVFGASNVSKLL H+PV  R +A +TI Y
Sbjct  11   CKFLRRKCVRGCVFAPYFCHEQGAAHFAAIHKVFGASNVSKLLAHLPVSDRCEAAVTISY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL+DP+YGCV+HIFALQQQVVNLQA+LA+L+   A
Sbjct  71   EAQARLQDPIYGCVSHIFALQQQVVNLQAQLAFLREQAA  109



>ref|XP_008391783.1| PREDICTED: LOB domain-containing protein 20 [Malus domestica]
Length=254

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC++GCIFAP+F S+QGAA FAAVHKVFGASNVSKLLLHIP+++R DAV+TI Y
Sbjct  57   CKFLRRKCISGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLLHIPLNRRHDAVVTITY  116

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHL  440
            EAQ+RL DPVYGCV+ I ALQQQV +LQ ELA +Q  L
Sbjct  117  EAQARLSDPVYGCVSTILALQQQVASLQGELAMVQTQL  154



>ref|XP_008775957.1| PREDICTED: LOB domain-containing protein 29-like [Phoenix dactylifera]
Length=234

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQGAAHFAA+HKVFGASNVSKLL H+PV+ R +A I++ Y
Sbjct  11   CKFLRRKCVRGCVFAPYFCHEQGAAHFAAIHKVFGASNVSKLLTHLPVNDRSEAAISMSY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL+DP+YGCVAHIFALQQQVVNLQA+LA L+A  A
Sbjct  71   EAQARLQDPIYGCVAHIFALQQQVVNLQAQLASLKAQAA  109



>gb|KHN10727.1| LOB domain-containing protein 29 [Glycine soja]
Length=212

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQG  HFAA+HKVFGASNVSKLL H+PV  R +A +TI Y
Sbjct  11   CKFLRRKCVRGCVFAPYFCHEQGVTHFAAIHKVFGASNVSKLLAHLPVSDRCEATVTISY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQ  449
            EAQ+RL+DP+YGCVAHIFALQ+QVVNLQA+LAYL+
Sbjct  71   EAQARLQDPIYGCVAHIFALQEQVVNLQAQLAYLR  105



>ref|XP_004136784.1| PREDICTED: LOB domain-containing protein 20-like [Cucumis sativus]
 ref|XP_004159662.1| PREDICTED: LOB domain-containing protein 20-like [Cucumis sativus]
 gb|KGN59488.1| hypothetical protein Csa_3G822390 [Cucumis sativus]
Length=222

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAP+F S+QGAA FAAVHK+FGASNVSKLLLHIPV +R DAV+TI Y
Sbjct  34   CKFLRRKCVNGCIFAPHFASDQGAARFAAVHKIFGASNVSKLLLHIPVSRRNDAVVTISY  93

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHL  440
            EAQ+RL DPVYGCV+ + ALQQQV +LQAELA +QA L
Sbjct  94   EAQARLSDPVYGCVSTVLALQQQVASLQAELAAVQAQL  131



>ref|XP_010679216.1| PREDICTED: LOB domain-containing protein 16-like [Beta vulgaris 
subsp. vulgaris]
Length=224

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC + CIFAPYF SEQG A FAA+HKVFGASNVSKLLLH+PVH+R +AV+TI Y
Sbjct  12   CKFLRRKCASDCIFAPYFCSEQGPARFAAIHKVFGASNVSKLLLHLPVHERCEAVVTIAY  71

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLAT  434
            EAQ+R+RDPVYGCVAHIFALQQQV  LQA+L  ++  LA 
Sbjct  72   EAQARIRDPVYGCVAHIFALQQQVAYLQAQLMQVKGQLAN  111



>ref|XP_010262268.1| PREDICTED: LOB domain-containing protein 29 [Nelumbo nucifera]
Length=232

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQGA HFAA+HKVFGASNVSKLL H+PV  R +A +TI Y
Sbjct  11   CKFLRRKCVRGCVFAPYFCHEQGATHFAAIHKVFGASNVSKLLAHLPVTDRCEAAVTISY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL+DP+YGCV+HIFALQQQVVNLQA+LA L+A  A
Sbjct  71   EAQARLQDPIYGCVSHIFALQQQVVNLQAQLATLKAQAA  109



>emb|CDP18379.1| unnamed protein product [Coffea canephora]
Length=249

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC++GCIFAP+F S+QGAA FAAVHKVFGASNVSKLLLHIP ++R DAV+TI Y
Sbjct  52   CKFLRRKCISGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLLHIPENRRNDAVVTISY  111

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHL  440
            EAQ+RL DPVYGCV+ I ALQQQV +LQAELA +Q  L
Sbjct  112  EAQARLSDPVYGCVSTILALQQQVASLQAELAVVQTQL  149



>ref|XP_010918779.1| PREDICTED: LOB domain-containing protein 16-like [Elaeis guineensis]
Length=189

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC A CIFAPYF SEQGAA FAA+HKVFGASNVSKLLLH+P+H R +AV++I Y
Sbjct  8    CKFLRRKCTADCIFAPYFGSEQGAARFAAIHKVFGASNVSKLLLHVPLHDRCEAVVSIAY  67

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL+DPVYGCV HIFALQQQV +LQ +L   +A LA
Sbjct  68   EAQARLKDPVYGCVGHIFALQQQVASLQLQLMQAKAQLA  106



>ref|XP_007203508.1| hypothetical protein PRUPE_ppa024802mg [Prunus persica]
 gb|EMJ04707.1| hypothetical protein PRUPE_ppa024802mg [Prunus persica]
Length=263

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC++GCIFAP+F S+QGAA FAAVHKVFGASNVSKLLLHIP+++R DAV+TI Y
Sbjct  57   CKFLRRKCISGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLLHIPLNRRQDAVVTISY  116

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHL  440
            EAQ+RL DPVYGCV+ I ALQQQV +LQAELA +Q  L
Sbjct  117  EAQARLADPVYGCVSTILALQQQVASLQAELAMVQTQL  154



>ref|XP_007050346.1| Lateral organ boundaries-domain 16 [Theobroma cacao]
 gb|EOX94503.1| Lateral organ boundaries-domain 16 [Theobroma cacao]
Length=204

 Score =   162 bits (409),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC + CIFAPYF SEQG A FAA+HKVFGASNVSKLLLHIP H R +AV+TI Y
Sbjct  17   CKFLRRKCASDCIFAPYFCSEQGPARFAAIHKVFGASNVSKLLLHIPAHDRCEAVVTIAY  76

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+R+RDPVYGCVAHIFALQQQV  LQA+L  ++A LA
Sbjct  77   EAQARIRDPVYGCVAHIFALQQQVACLQAQLMQVKAQLA  115



>ref|XP_008235713.1| PREDICTED: LOB domain-containing protein 16 [Prunus mume]
Length=210

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC + CIFAPYF SEQG A FAA+HKVFGASNVSKLLLH+PVH R +AV+TI Y
Sbjct  19   CKFLRRKCASDCIFAPYFCSEQGPARFAAIHKVFGASNVSKLLLHVPVHDRCEAVVTIAY  78

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+R+RDPVYGCVAHIFALQQQV  LQA+L  ++A LA
Sbjct  79   EAQARIRDPVYGCVAHIFALQQQVACLQAQLMQVKAQLA  117



>ref|XP_009398033.1| PREDICTED: LOB domain-containing protein 29 [Musa acuminata subsp. 
malaccensis]
Length=214

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQGAAHFAA+HKVFGASN SK+L+H+PV  R +A IT+ Y
Sbjct  11   CKFLRRKCVRGCVFAPYFCHEQGAAHFAAIHKVFGASNFSKILMHLPVADRSEAAITVSY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL+DPVYGCVAHIFALQQQVVNLQA+L+ L+A  A
Sbjct  71   EAQARLQDPVYGCVAHIFALQQQVVNLQAQLSSLRAQAA  109



>emb|CAN75719.1| hypothetical protein VITISV_037620 [Vitis vinifera]
Length=232

 Score =   162 bits (410),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQGAAHFAA+HKVFGASNVSKLL H+PV  R +A +TI Y
Sbjct  11   CKFLRRKCVRGCVFAPYFCHEQGAAHFAAIHKVFGASNVSKLLGHLPVSDRCEAAVTIAY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL+DP+YGCV+HIFALQQQVVNLQA+LA L+   A
Sbjct  71   EAQARLQDPIYGCVSHIFALQQQVVNLQAQLASLKEQAA  109



>gb|KEH42567.1| lateral organ boundaries (LOB) domain protein [Medicago truncatula]
Length=234

 Score =   162 bits (410),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC+ GC+FAPYF  EQGA HF+A+HKVFGASNVSKLL H+PV  R +A +TI Y
Sbjct  16   CKFLRRKCIRGCVFAPYFSHEQGATHFSAIHKVFGASNVSKLLAHLPVSDRCEAAVTISY  75

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL+DP+YGCV+HIFALQQQVV+LQ +LAYL+   A
Sbjct  76   EAQARLQDPIYGCVSHIFALQQQVVSLQTQLAYLKEQAA  114



>ref|XP_007199359.1| hypothetical protein PRUPE_ppa025349mg [Prunus persica]
 gb|EMJ00558.1| hypothetical protein PRUPE_ppa025349mg [Prunus persica]
Length=210

 Score =   161 bits (408),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC + CIFAPYF SEQG A FAA+HKVFGASNVSKLLLH+PVH R +AV+TI Y
Sbjct  19   CKFLRRKCASDCIFAPYFCSEQGPARFAAIHKVFGASNVSKLLLHVPVHDRCEAVVTIAY  78

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+R+RDPVYGCVAHIFALQQQV  LQA+L  ++A LA
Sbjct  79   EAQARIRDPVYGCVAHIFALQQQVACLQAQLMQVRAQLA  117



>ref|XP_008244133.1| PREDICTED: LOB domain-containing protein 20 [Prunus mume]
Length=259

 Score =   163 bits (412),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC++GCIFAP+F S+QGAA FAAVHKVFGASNVSKLLLHIP+++R DAV+TI Y
Sbjct  57   CKFLRRKCISGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLLHIPLNRRQDAVVTISY  116

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHL  440
            EAQ+RL DPVYGCV+ I ALQQQV +LQAELA +Q  L
Sbjct  117  EAQARLADPVYGCVSTILALQQQVASLQAELAMVQTQL  154



>ref|XP_004495114.1| PREDICTED: LOB domain-containing protein 29-like [Cicer arietinum]
Length=229

 Score =   162 bits (409),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC+ GC+FAPYF  EQGA HFAA+HKVFGASNVSKLL H+P+  R +A +TI Y
Sbjct  13   CKFLRRKCIRGCVFAPYFCHEQGATHFAAIHKVFGASNVSKLLAHLPLTDRCEAAVTISY  72

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQ  449
            EAQ+RL+DP+YGCV+HIFALQQQVVNLQ +LAYL+
Sbjct  73   EAQARLQDPIYGCVSHIFALQQQVVNLQTQLAYLK  107



>ref|XP_004289919.1| PREDICTED: LOB domain-containing protein 16-like [Fragaria vesca 
subsp. vesca]
Length=215

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC + CIFAPYF SEQG A FAA+HKVFGASNVSKLLLH+PVH R +AV+TI Y
Sbjct  22   CKFLRRKCASDCIFAPYFCSEQGPARFAAIHKVFGASNVSKLLLHVPVHDRCEAVVTIAY  81

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+R+RDPVYGCVAHIFALQQQV  LQA+L  ++A +A
Sbjct  82   EAQARIRDPVYGCVAHIFALQQQVACLQAQLMQVKAQVA  120



>gb|AGP76338.1| ARL1, partial [Oryza granulata]
Length=118

 Score =   158 bits (400),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQGAAHFAA+HKVFGASNVSKLL H+P+  R +A +TI Y
Sbjct  11   CKFLRRKCVRGCVFAPYFCHEQGAAHFAAIHKVFGASNVSKLLAHLPLADRPEAAVTISY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RLRDP+YGCVAHIFALQQQV+ LQA+LA L+A  A
Sbjct  71   EAQARLRDPIYGCVAHIFALQQQVMTLQAQLASLKAQAA  109



>ref|XP_010111894.1| hypothetical protein L484_009778 [Morus notabilis]
 gb|EXC31928.1| hypothetical protein L484_009778 [Morus notabilis]
Length=227

 Score =   162 bits (409),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAPYF  EQGA HFAA+HKVFGASNVSKLL H+PV  R +A +TI Y
Sbjct  11   CKFLRRKCVSGCIFAPYFCHEQGATHFAAIHKVFGASNVSKLLSHLPVTDRCEAAVTISY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQ  449
            EAQ+RL+DP+YGCV+HIFALQQQVVNLQA+LA L+
Sbjct  71   EAQARLQDPIYGCVSHIFALQQQVVNLQAQLASLK  105



>emb|CDY68561.1| BnaCnng59550D [Brassica napus]
Length=188

 Score =   160 bits (405),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GC+FAPYFD+EQG A FAAVHKVFGASN SK+LL +P++KR DAV T+CY
Sbjct  19   CKFLRRKCVSGCVFAPYFDAEQGTATFAAVHKVFGASNASKMLLRLPLNKRHDAVSTLCY  78

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +RL DPVYG V H+F+LQ QV+NLQAE+A++QA L+T +
Sbjct  79   EALARLSDPVYGSVGHLFSLQHQVMNLQAEIAHVQARLSTFQ  120



>ref|XP_009617764.1| PREDICTED: LOB domain-containing protein 29-like [Nicotiana tomentosiformis]
Length=233

 Score =   162 bits (409),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQGA HF+A+HKVFGASNVSKLL HIPV  R +A +TI Y
Sbjct  12   CKFLRRKCVKGCVFAPYFCYEQGATHFSAIHKVFGASNVSKLLAHIPVSDRGEAAVTIAY  71

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL+DP+YGCV+HIFALQQQVVNLQA+LA L+   A
Sbjct  72   EAQARLQDPIYGCVSHIFALQQQVVNLQAQLASLKEQAA  110



>ref|XP_010262592.1| PREDICTED: LOB domain-containing protein 33-like [Nelumbo nucifera]
Length=223

 Score =   161 bits (408),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC  GC+FAPYF  EQGA HFAA+HKVFGASNVSKLL H+PVH R +A ITI Y
Sbjct  11   CKFLRRKCSNGCVFAPYFCYEQGANHFAAIHKVFGASNVSKLLSHLPVHNRSEAAITISY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATL  431
            EA +R+RDP+YGCVAHI ALQQQVVNLQ E+ +L+  +A L
Sbjct  71   EALARMRDPIYGCVAHILALQQQVVNLQEEIEFLENQVANL  111



>gb|KDO66074.1| hypothetical protein CISIN_1g042813mg [Citrus sinensis]
Length=250

 Score =   162 bits (410),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAP+F S+QGAA FAAVHKVFGASNVSKLLLHIPV++R DAV+TI Y
Sbjct  44   CKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLLHIPVNRRQDAVVTISY  103

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHL  440
            EAQ+RL DPVYGCV+ I ALQQQV +LQAEL  +Q  L
Sbjct  104  EAQARLSDPVYGCVSTILALQQQVASLQAELTMVQNQL  141



>ref|XP_006443492.1| hypothetical protein CICLE_v10021843mg [Citrus clementina]
 ref|XP_006479165.1| PREDICTED: LOB domain-containing protein 20-like [Citrus sinensis]
 gb|ESR56732.1| hypothetical protein CICLE_v10021843mg [Citrus clementina]
Length=250

 Score =   162 bits (410),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAP+F S+QGAA FAAVHKVFGASNVSKLLLHIPV++R DAV+TI Y
Sbjct  44   CKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLLHIPVNRRQDAVVTISY  103

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHL  440
            EAQ+RL DPVYGCV+ I ALQQQV +LQAEL  +Q  L
Sbjct  104  EAQARLSDPVYGCVSTILALQQQVASLQAELTMVQNQL  141



>ref|XP_011080296.1| PREDICTED: LOB domain-containing protein 29 [Sesamum indicum]
Length=232

 Score =   161 bits (408),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQGA HFAA+HKVFGASNVSKLL H+PV  R +A +TI Y
Sbjct  11   CKFLRRKCVRGCVFAPYFCHEQGATHFAAIHKVFGASNVSKLLAHLPVSDRCEAAVTISY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL+DP+YGCV+HIFALQQQVVNLQA+LA L+   A
Sbjct  71   EAQARLQDPIYGCVSHIFALQQQVVNLQAQLASLKEQAA  109



>ref|XP_009382150.1| PREDICTED: LOB domain-containing protein 29-like [Musa acuminata 
subsp. malaccensis]
Length=211

 Score =   161 bits (407),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GC+FAP+F  EQGAAHFAA+HKVFGASNV+KLL+H+P+  R +A ITI Y
Sbjct  11   CKFLRRKCVSGCVFAPFFHHEQGAAHFAAIHKVFGASNVAKLLMHLPMADRSEAAITISY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL++P+YGCVAHIFALQQQVVNLQA++A L+A  A
Sbjct  71   EAQARLQNPIYGCVAHIFALQQQVVNLQAQVASLEAQAA  109



>ref|XP_010935865.1| PREDICTED: LOB domain-containing protein 29-like [Elaeis guineensis]
Length=236

 Score =   162 bits (409),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYF  EQGAAHFAA+HKVFGASNVSKLL+H+PV  R +A +TI Y
Sbjct  11   CKFLRRKCVRGCIFAPYFCHEQGAAHFAAIHKVFGASNVSKLLMHLPVTDRCEAAVTISY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQ  449
            EAQ+RL+DP+YGCVAHIF LQQQVVNLQA+LA L+
Sbjct  71   EAQARLQDPIYGCVAHIFTLQQQVVNLQAQLASLK  105



>ref|XP_004229819.1| PREDICTED: LOB domain-containing protein 19 [Solanum lycopersicum]
Length=167

 Score =   159 bits (403),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYFDSEQG AHFA VHKVFGASN SKLLL IP +KR + V+T+ +
Sbjct  11   CKFLRRKCVKGCIFAPYFDSEQGMAHFAVVHKVFGASNTSKLLLTIPPNKRFETVVTLYF  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EA +R+RDPVYGCV HI +LQQQ V LQAELAY+QA ++
Sbjct  71   EALARVRDPVYGCVGHIISLQQQAVTLQAELAYVQARIS  109



>gb|KFK37334.1| hypothetical protein AALP_AA4G243100 [Arabis alpina]
Length=213

 Score =   161 bits (407),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYFD++QG   FAAVHKVFGASN SK+LL +P+HKRLDAV+T+ Y
Sbjct  21   CKFLRRKCVKGCVFAPYFDADQGTTRFAAVHKVFGASNASKMLLRLPLHKRLDAVVTLSY  80

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLATLE  428
            EA +R+RDPVYG V H+F+LQ QV+NLQAELA++QA L+T +
Sbjct  81   EALARVRDPVYGSVGHLFSLQHQVMNLQAELAHVQACLSTFQ  122



>ref|XP_002263533.1| PREDICTED: LOB domain-containing protein 29 [Vitis vinifera]
 emb|CBI37087.3| unnamed protein product [Vitis vinifera]
Length=232

 Score =   161 bits (408),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQGAAHFAA+HKVFGASNVSKLL H+PV  R +A +TI Y
Sbjct  11   CKFLRRKCVRGCVFAPYFCHEQGAAHFAAIHKVFGASNVSKLLGHLPVSDRCEAAVTIAY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQ  449
            EAQ+RL+DP+YGCV+HIFALQQQVVNLQA+LA L+
Sbjct  71   EAQARLQDPIYGCVSHIFALQQQVVNLQAQLASLK  105



>ref|NP_001106033.1| rootless concerning crown and seminal roots1 [Zea mays]
 gb|ABO21027.1| rootless concerning crown and seminal lateral roots [Zea mays]
 tpg|DAA43385.1| TPA: rootless concerning crown and seminal roots1 [Zea mays]
 gb|AIB04717.1| LOB transcription factor, partial [Zea mays]
Length=244

 Score =   162 bits (409),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQGAAHFAA+HKVFGASNVSKLL H+P+  R +A +TI Y
Sbjct  11   CKFLRRKCVRGCVFAPYFCHEQGAAHFAAIHKVFGASNVSKLLAHLPLADRAEAAVTISY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RLRDP+YGCVAHIFALQQQV+ LQA+LA L+A  A
Sbjct  71   EAQARLRDPIYGCVAHIFALQQQVMTLQAQLASLKAQAA  109



>ref|XP_003554283.1| PREDICTED: LOB domain-containing protein 16-like [Glycine max]
 gb|KHN02522.1| LOB domain-containing protein 16 [Glycine soja]
Length=213

 Score =   161 bits (407),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC A CIFAPYF SEQG A FAA+HKVFGASNVSKLLLHIP H R +AV+TI Y
Sbjct  20   CKFLRRKCAADCIFAPYFCSEQGPARFAAIHKVFGASNVSKLLLHIPAHDRCEAVVTIAY  79

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+R+RDPVYGCV+HIFALQQQV  LQA+L  ++A LA
Sbjct  80   EAQARIRDPVYGCVSHIFALQQQVACLQAQLMQVKAQLA  118



>ref|XP_002300786.2| hypothetical protein POPTR_0002s04200g [Populus trichocarpa]
 gb|EEE80059.2| hypothetical protein POPTR_0002s04200g [Populus trichocarpa]
Length=223

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQGA HFAA+HKVFGASNVSKLL H+PV  R +A +TI Y
Sbjct  11   CKFLRRKCVRGCVFAPYFCHEQGAQHFAAIHKVFGASNVSKLLAHLPVSDRSEAAVTISY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL+DP+YGCV+HIFALQQQVVNLQA+LA L+   A
Sbjct  71   EAQARLQDPIYGCVSHIFALQQQVVNLQAQLASLKEQAA  109



>ref|XP_006299263.1| hypothetical protein CARUB_v10015417mg [Capsella rubella]
 gb|EOA32161.1| hypothetical protein CARUB_v10015417mg [Capsella rubella]
Length=278

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAP+F S+QGAA FAAVHKVFGASNVSKLL HIPV++R DAV+TI Y
Sbjct  58   CKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLHHIPVNRRHDAVVTISY  117

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHL  440
            EAQ+RL DPVYGCV+ I ALQQQV +LQAEL+ +Q+ L
Sbjct  118  EAQARLSDPVYGCVSTILALQQQVASLQAELSVVQSQL  155



>gb|AGP76337.1| ARL1, partial [Oryza australiensis]
Length=117

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQGAAHFAA+HKVFGASNVSKLL H+P+  R +A +TI Y
Sbjct  9    CKFLRRKCVRGCVFAPYFCHEQGAAHFAAIHKVFGASNVSKLLAHLPLADRPEAAVTISY  68

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQA  446
            EAQ+RLRDP+YGCVAHIFALQQQV+ LQA+LA L+A
Sbjct  69   EAQARLRDPIYGCVAHIFALQQQVMTLQAQLASLKA  104



>gb|AGP76336.1| ARL1, partial [Oryza officinalis]
Length=119

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQGAAHFAA+HKVFGASNVSKLL H+P+  R +A +TI Y
Sbjct  11   CKFLRRKCVRGCVFAPYFCHEQGAAHFAAIHKVFGASNVSKLLAHLPLADRPEAAVTISY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQA  446
            EAQ+RLRDP+YGCVAHIFALQQQV+ LQA+LA L+A
Sbjct  71   EAQARLRDPIYGCVAHIFALQQQVMTLQAQLASLKA  106



>ref|NP_187026.1| LOB domain-containing protein 20 [Arabidopsis thaliana]
 sp|Q9SRV3.1|LBD20_ARATH RecName: Full=LOB domain-containing protein 20; AltName: Full=ASYMMETRIC 
LEAVES 2-like protein 21; Short=AS2-like protein 
21 [Arabidopsis thaliana]
 gb|AAF00641.1|AC009540_18 unknown protein [Arabidopsis thaliana]
 dbj|BAC42909.1| unknown protein [Arabidopsis thaliana]
 gb|AAP40416.1| unknown protein [Arabidopsis thaliana]
 dbj|BAH10565.1| ASYMMETRIC LEAVES2-like 21 protein [Arabidopsis thaliana]
 gb|AEE73983.1| LOB domain-containing protein 20 [Arabidopsis thaliana]
Length=273

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAP+F S+QGAA FAAVHKVFGASNVSKLL HIPV++R DAV+TI Y
Sbjct  55   CKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLHHIPVNRRHDAVVTISY  114

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHL  440
            EAQ+RL DPVYGCV+ I ALQQQV +LQAEL+ +Q+ L
Sbjct  115  EAQARLSDPVYGCVSTILALQQQVASLQAELSVVQSQL  152



>gb|KFK37803.1| hypothetical protein AALP_AA3G031300 [Arabis alpina]
Length=279

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAP+F S+QGAA FAAVHKVFGASNVSKLL HIPV++R DAV+TI Y
Sbjct  60   CKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLHHIPVNRRHDAVVTISY  119

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHL  440
            EAQ+RL DPVYGCV+ I ALQQQV +LQAEL+ +Q+ L
Sbjct  120  EAQARLSDPVYGCVSTILALQQQVASLQAELSLVQSQL  157



>ref|XP_011028777.1| PREDICTED: LOB domain-containing protein 29 [Populus euphratica]
Length=223

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQGA HFAA+HKVFGASNVSKLL H+PV  R +A +TI Y
Sbjct  11   CKFLRRKCVRGCVFAPYFCHEQGAQHFAAIHKVFGASNVSKLLAHLPVSDRSEAAVTISY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL+DP+YGCV+HIFALQQQVVNLQA+LA L+   A
Sbjct  71   EAQARLQDPIYGCVSHIFALQQQVVNLQAQLASLKEQAA  109



>ref|XP_009102075.1| PREDICTED: LOB domain-containing protein 20-like [Brassica rapa]
Length=275

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAP+F S+QGAA FAAVHKVFGASNVSKLL HIPV++R DAV+TI Y
Sbjct  57   CKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLHHIPVNRRHDAVVTISY  116

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHL  440
            EAQ+RL DPVYGCV+ I ALQQQV +LQAEL+ +Q+ L
Sbjct  117  EAQARLSDPVYGCVSTILALQQQVASLQAELSLVQSQL  154



>gb|AFK37396.1| unknown [Lotus japonicus]
Length=236

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQGA HFAA+HKVFGASNVSKLL ++PV  R +A +TI Y
Sbjct  17   CKFLRRKCVRGCVFAPYFCHEQGATHFAAIHKVFGASNVSKLLSYLPVSDRCEAAVTISY  76

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL+DP+YGCV+HIF+LQQQV NLQA+LAYL+   A
Sbjct  77   EAQARLQDPIYGCVSHIFSLQQQVANLQAQLAYLKEQAA  115



>ref|XP_009771981.1| PREDICTED: LOB domain-containing protein 14-like [Nicotiana sylvestris]
Length=233

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQGA HF+A+HKVFGASNVSKLL HIP+  R +A +TI Y
Sbjct  12   CKFLRRKCVKGCVFAPYFCYEQGATHFSAIHKVFGASNVSKLLAHIPMTDRGEAAVTIAY  71

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL+DP+YGCV+HIFALQQQVVNLQA+LA L+   A
Sbjct  72   EAQARLQDPIYGCVSHIFALQQQVVNLQAQLASLKEQAA  110



>ref|XP_002263559.1| PREDICTED: LOB domain-containing protein 16 [Vitis vinifera]
 emb|CBI37088.3| unnamed protein product [Vitis vinifera]
Length=195

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC A C+FAPYF SEQG A FAA+HKVFGASNVSKLLLH+PV  R +AV+TI Y
Sbjct  12   CKFLRRKCAADCVFAPYFCSEQGPARFAAIHKVFGASNVSKLLLHVPVADRCEAVVTIAY  71

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLAT  434
            EAQ+R+RDPVYGCVAHIFALQQQV  LQA+L  L+A LA 
Sbjct  72   EAQARIRDPVYGCVAHIFALQQQVACLQAQLMQLKAQLAN  111



>emb|CDY29956.1| BnaC01g40520D [Brassica napus]
Length=275

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAP+F S+QGAA FAAVHKVFGASNVSKLL HIPV++R DAV+TI Y
Sbjct  57   CKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLHHIPVNRRHDAVVTISY  116

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHL  440
            EAQ+RL DPVYGCV+ I ALQQQV +LQAEL+ +Q+ L
Sbjct  117  EAQARLSDPVYGCVSTILALQQQVASLQAELSLVQSQL  154



>gb|AGP76326.1| ARL1, partial [Oryza nivara]
 gb|AGP76328.1| ARL1, partial [Oryza glumipatula]
 gb|AGP76329.1| ARL1, partial [Oryza longistaminata]
 gb|AGP76330.1| ARL1, partial [Oryza barthii]
 gb|AGP76331.1| ARL1, partial [Oryza meridionalis]
 gb|AGP76334.1| ARL1, partial [Oryza sativa Japonica Group]
 gb|AGP76335.1| ARL1, partial [Oryza punctata]
Length=119

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQGAAHFAA+HKVFGASNVSKLL H+P+  R +A +TI Y
Sbjct  11   CKFLRRKCVRGCVFAPYFCHEQGAAHFAAIHKVFGASNVSKLLAHLPLADRPEAAVTISY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQA  446
            EAQ+RLRDP+YGCVAHIFALQQQV+ LQA+LA L+A
Sbjct  71   EAQARLRDPIYGCVAHIFALQQQVMTLQAQLASLKA  106



>gb|EYU46475.1| hypothetical protein MIMGU_mgv1a026613mg [Erythranthe guttata]
Length=249

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQGA HFAA+HKVFGASNVSKLL H+PV  R +A +TI Y
Sbjct  11   CKFLRRKCVRGCVFAPYFCHEQGATHFAAIHKVFGASNVSKLLAHLPVTDRCEAAVTISY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL+DP+YGCV+HIFALQQQVVNLQA+LA L+   A
Sbjct  71   EAQARLQDPIYGCVSHIFALQQQVVNLQAQLASLKEQAA  109



>gb|KDP39658.1| hypothetical protein JCGZ_02678 [Jatropha curcas]
Length=259

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC++GCIFAP+F S+QGAA FAAVHKVFGASNVSKLLLHIPV++R +AV+TI Y
Sbjct  51   CKFLRRKCISGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLLHIPVNRRHEAVVTISY  110

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHL  440
            EAQ+RL DPVYGCV+ I ALQQQV +LQAELA +Q  L
Sbjct  111  EAQARLSDPVYGCVSTILALQQQVASLQAELAMVQTQL  148



>ref|XP_006351689.1| PREDICTED: LOB domain-containing protein 29-like [Solanum tuberosum]
Length=245

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC+ GC+FAPYF  EQGA HF+A+HKVFGASNVSKLL HIPV  R +A +TI Y
Sbjct  11   CKFLRRKCIKGCVFAPYFCYEQGATHFSAIHKVFGASNVSKLLAHIPVSDRGEAAVTIAY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL+DP+YGCV+HIFALQQQVVNLQA+LA L+   A
Sbjct  71   EAQARLQDPIYGCVSHIFALQQQVVNLQAQLASLKEQAA  109



>ref|XP_006659712.1| PREDICTED: LOB domain-containing protein 17-like [Oryza brachyantha]
Length=215

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQGAAHFAA+HKVFGASN SKLL+H+PV  R +A +T+ Y
Sbjct  11   CKFLRRKCVKGCVFAPYFCHEQGAAHFAAIHKVFGASNASKLLMHLPVSDRCEAAVTMSY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAH  443
            EAQ+RLRDP+YGCV+HIF+LQQQVV+LQA+L  L+A 
Sbjct  71   EAQARLRDPIYGCVSHIFSLQQQVVSLQAQLESLKAQ  107



>ref|XP_009617763.1| PREDICTED: LOB domain-containing protein 16-like [Nicotiana tomentosiformis]
Length=218

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC A CIFAPYF SEQG A FAA+HKVFGASNVSKLLLH+PV  R +AV+TI Y
Sbjct  12   CKFLRRKCAADCIFAPYFCSEQGPARFAAIHKVFGASNVSKLLLHVPVADRCEAVVTIAY  71

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+R++DPVYGCVAHIFALQQQV  LQA+L  ++A +A
Sbjct  72   EAQARIKDPVYGCVAHIFALQQQVAYLQAQLMQMKAQMA  110



>ref|XP_002882305.1| LOB domain protein 20 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58564.1| LOB domain protein 20 [Arabidopsis lyrata subsp. lyrata]
Length=281

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAP+F S+QGAA FAAVHKVFGASNVSKLL HIPV++R DAV+TI Y
Sbjct  55   CKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLHHIPVNRRHDAVVTISY  114

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHL  440
            EAQ+RL DPVYGCV+ I ALQQQV +LQAEL+ +Q+ L
Sbjct  115  EAQARLSDPVYGCVSTILALQQQVASLQAELSVVQSQL  152



>ref|XP_002465851.1| hypothetical protein SORBIDRAFT_01g046990 [Sorghum bicolor]
 gb|EER92849.1| hypothetical protein SORBIDRAFT_01g046990 [Sorghum bicolor]
Length=245

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQGAAHFAA+HKVFGASNVSKLL H+P+  R +A +TI Y
Sbjct  11   CKFLRRKCVRGCVFAPYFCHEQGAAHFAAIHKVFGASNVSKLLAHLPLADRPEAAVTISY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RLRDP+YGCVAHIFALQQQV+ LQA+LA L+A  A
Sbjct  71   EAQARLRDPIYGCVAHIFALQQQVMTLQAQLASLKAQAA  109



>ref|XP_007030005.1| LOB domain-containing protein 20 [Theobroma cacao]
 gb|EOY10507.1| LOB domain-containing protein 20 [Theobroma cacao]
Length=236

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC++GCIFAP+F S+QGAA FAAVHKVFGASNVSKLLLHIPV++R DAV+TI Y
Sbjct  46   CKFLRRKCISGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLLHIPVNRRHDAVVTISY  105

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHL  440
            EAQ+RL DPVYGCV+ I +LQQQV +LQAELA +Q  L
Sbjct  106  EAQARLSDPVYGCVSTILSLQQQVASLQAELAMVQNQL  143



>ref|XP_010485728.1| PREDICTED: LOB domain-containing protein 20 [Camelina sativa]
Length=273

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAP+F S+QGAA FAAVHKVFGASNVSKLL HIPV++R DAV+TI Y
Sbjct  57   CKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLHHIPVNRRHDAVVTISY  116

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHL  440
            EAQ+RL DPVYGCV+ I ALQQQV +LQAEL+ +Q+ L
Sbjct  117  EAQARLSDPVYGCVSTILALQQQVASLQAELSVVQSQL  154



>ref|XP_010513804.1| PREDICTED: LOB domain-containing protein 20-like [Camelina sativa]
Length=277

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAP+F S+QGAA FAAVHKVFGASNVSKLL HIPV++R DAV+TI Y
Sbjct  58   CKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLHHIPVNRRHDAVVTISY  117

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHL  440
            EAQ+RL DPVYGCV+ I ALQQQV +LQAEL+ +Q+ L
Sbjct  118  EAQARLSDPVYGCVSTILALQQQVASLQAELSVVQSQL  155



>emb|CDY47969.1| BnaA04g24470D [Brassica napus]
Length=246

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC + CIFAPYF SEQGAA FAA+HKVFGASNVSKLLL++P+H R +AV+TI Y
Sbjct  19   CKFLRRKCASDCIFAPYFSSEQGAARFAAIHKVFGASNVSKLLLNVPIHDRCEAVVTIAY  78

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL DPVYGCV+HIFALQQQV  LQA++  ++A +A
Sbjct  79   EAQARLHDPVYGCVSHIFALQQQVAYLQAQVMQMKAQIA  117



>ref|XP_002534416.1| LOB domain-containing protein, putative [Ricinus communis]
 gb|EEF27968.1| LOB domain-containing protein, putative [Ricinus communis]
Length=225

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQGA HFAA+HKVFGASNVSKLL H+PV  R +A +TI Y
Sbjct  11   CKFLRRKCVRGCVFAPYFCHEQGATHFAAIHKVFGASNVSKLLAHLPVSDRCEAAVTISY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL+DP+YGCV+HIFALQQQV+NLQA+LA L+   A
Sbjct  71   EAQARLQDPIYGCVSHIFALQQQVMNLQAQLASLKEQAA  109



>ref|XP_004493763.1| PREDICTED: LOB domain-containing protein 16-like [Cicer arietinum]
Length=219

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC + CIFAPYF SEQG A FAA+HKVFGASNVSKLLLHIP H+R +AV+TI Y
Sbjct  15   CKFLRRKCASDCIFAPYFCSEQGPARFAAIHKVFGASNVSKLLLHIPAHERCEAVVTIAY  74

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+R+RDPVYGCV+HIFALQQQV  LQA+L  +++ L+
Sbjct  75   EAQARIRDPVYGCVSHIFALQQQVACLQAQLMQVKSQLS  113



>ref|XP_007199390.1| hypothetical protein PRUPE_ppa025889mg [Prunus persica]
 gb|EMJ00589.1| hypothetical protein PRUPE_ppa025889mg [Prunus persica]
Length=239

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GCIFAPYF  EQGA HF+A+HKVFGASNVSKLL H+P+  R +A +TI Y
Sbjct  11   CKFLRRKCVRGCIFAPYFCHEQGATHFSAIHKVFGASNVSKLLAHLPLSDRCEAAVTISY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL+DP+YGCV+HIFALQQQVVNLQA+LA L+   A
Sbjct  71   EAQARLQDPIYGCVSHIFALQQQVVNLQAQLASLKDQAA  109



>ref|NP_001062526.1| Os08g0563400 [Oryza sativa Japonica Group]
 dbj|BAD09627.1| putative LOB domain protein 17 [Oryza sativa Japonica Group]
 dbj|BAF24440.1| Os08g0563400 [Oryza sativa Japonica Group]
 gb|EAZ08032.1| hypothetical protein OsI_30297 [Oryza sativa Indica Group]
 gb|EAZ43677.1| hypothetical protein OsJ_28302 [Oryza sativa Japonica Group]
Length=215

 Score =   160 bits (404),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  EQGAAHFAA+HKVFGASN SK+L+H+PV  R +A +T+ Y
Sbjct  11   CKFLRRKCVKGCVFAPYFCHEQGAAHFAAIHKVFGASNASKILMHLPVSDRCEAAVTMSY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQA  446
            EAQ+RLRDP+YGCVAHIF+LQQQVV+LQA+L  L+A
Sbjct  71   EAQARLRDPIYGCVAHIFSLQQQVVSLQAQLESLKA  106



>ref|XP_003536930.1| PREDICTED: LOB domain-containing protein 16-like isoform X1 [Glycine 
max]
Length=213

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV  CIFAPYF SEQGAA FAA+HKVFGASNVSKLLL IP H R +A++TI Y
Sbjct  20   CKFLRRKCVTDCIFAPYFCSEQGAAKFAAIHKVFGASNVSKLLLRIPAHGRFEAILTIAY  79

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHL  440
            EAQ+RLRDPVYGCV+HIFALQQQV  LQA++  ++A L
Sbjct  80   EAQARLRDPVYGCVSHIFALQQQVACLQAQVMQMKAQL  117



>ref|XP_004493764.1| PREDICTED: LOB domain-containing protein 29-like [Cicer arietinum]
Length=214

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV GC+FAPYF  E+GA HFAA+HKVFGASNVSKLL H+P+  R +A +TI Y
Sbjct  11   CKFLRRKCVRGCVFAPYFCHEEGATHFAAIHKVFGASNVSKLLAHLPLTDRFEAALTISY  70

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHLA  437
            EAQ+RL+DP+YGCVAHIF+LQQQVV+LQA+LAYL+   A
Sbjct  71   EAQARLQDPIYGCVAHIFSLQQQVVSLQAQLAYLREQAA  109



>ref|XP_002525698.1| LOB domain-containing protein, putative [Ricinus communis]
 gb|EEF36681.1| LOB domain-containing protein, putative [Ricinus communis]
Length=240

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC+ GCIFAP+F S+QGAA FAAVHKVFGASNVSKLLLHIPV++R +AV+TI Y
Sbjct  46   CKFLRRKCINGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLLHIPVNRRHEAVVTISY  105

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHL  440
            EAQ+RL DPVYGCV+ I ALQQQV +LQAEL  +Q  L
Sbjct  106  EAQARLSDPVYGCVSTILALQQQVASLQAELTMVQTQL  143



>ref|XP_011070190.1| PREDICTED: LOB domain-containing protein 20 [Sesamum indicum]
Length=244

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKCV+GCIFAP+F S+QGAA FAAVHKVFGASNVSKLL+HIP ++R DAV+TI Y
Sbjct  42   CKFLRRKCVSGCIFAPHFGSDQGAARFAAVHKVFGASNVSKLLMHIPANRRHDAVVTISY  101

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHL  440
            EAQ+RL DPVYGCV+ I ALQQQV +LQAEL+ +Q  L
Sbjct  102  EAQARLSDPVYGCVSTIIALQQQVASLQAELSVVQTQL  139



>ref|XP_008443307.1| PREDICTED: LOB domain-containing protein 20 [Cucumis melo]
Length=224

 Score =   160 bits (404),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -1

Query  733  CKFLRRKCVAGCIFAPYFDSEQGAAHFAAVHKVFGASNVSKLLLHIPVHKRLDAVITICY  554
            CKFLRRKC+ GCIFAP+F S+QGAA FAAVHKVFGASNVSKLLLHIPV +R DAV+TI Y
Sbjct  34   CKFLRRKCINGCIFAPHFASDQGAARFAAVHKVFGASNVSKLLLHIPVSRRNDAVVTISY  93

Query  553  EAQSRLRDPVYGCVAHIFALQQQVVNLQAELAYLQAHL  440
            EAQ+RL DPVYGCV+ + ALQQQV +LQAELA +QA +
Sbjct  94   EAQARLSDPVYGCVSTVLALQQQVASLQAELAAVQAQV  131



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2290717995426