BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18946_g1_i3 len=1432 path=[1:0-417 419:418-1082 1281:1083-1431]

Length=1432
                                                                      Score     E

ref|XP_009624680.1|  PREDICTED: uncharacterized protein LOC104115706    399   1e-132   
ref|XP_006366111.1|  PREDICTED: uncharacterized protein LOC102579521    399   1e-132   
gb|ABO93007.1|  putative CAAX aminoterminal protease                    396   1e-131   Solanum tuberosum [potatoes]
ref|XP_009794989.1|  PREDICTED: uncharacterized protein LOC104241...    395   5e-131   
gb|ABO92979.1|  putative CAAX amino terminal protease                   393   3e-130   Solanum tuberosum [potatoes]
gb|AAU90306.2|  CAAX amino terminal protease family protein, puta...    390   3e-129   Solanum tuberosum [potatoes]
ref|XP_004238797.1|  PREDICTED: uncharacterized protein LOC101265823    385   5e-127   
ref|XP_011075500.1|  PREDICTED: uncharacterized protein LOC105159963    384   7e-127   
ref|XP_010683196.1|  PREDICTED: uncharacterized protein LOC104897927    369   1e-120   
ref|XP_006438679.1|  hypothetical protein CICLE_v10032082mg             366   8e-120   
ref|XP_006483160.1|  PREDICTED: uncharacterized protein LOC102618349    365   4e-119   
emb|CDP00329.1|  unnamed protein product                                364   1e-118   
ref|XP_010044739.1|  PREDICTED: uncharacterized protein LOC104433...    359   7e-117   
ref|XP_002522426.1|  prenyl-dependent CAAX protease, putative           357   4e-116   Ricinus communis
ref|XP_008446340.1|  PREDICTED: uncharacterized protein LOC103489...    357   6e-116   
ref|XP_004135178.1|  PREDICTED: uncharacterized protein LOC101219539    356   1e-115   
ref|XP_002311592.1|  CAAX amino terminal protease family protein        353   1e-114   Populus trichocarpa [western balsam poplar]
ref|XP_011025753.1|  PREDICTED: uncharacterized protein LOC105126551    352   3e-114   
ref|XP_006586026.1|  PREDICTED: uncharacterized protein LOC100808...    347   2e-112   
gb|KHN17369.1|  hypothetical protein glysoja_034780                     347   2e-112   
ref|XP_002270372.1|  PREDICTED: uncharacterized protein LOC100251779    347   2e-112   Vitis vinifera
ref|XP_009794997.1|  PREDICTED: uncharacterized protein LOC104241...    345   4e-112   
ref|XP_008389475.1|  PREDICTED: uncharacterized protein LOC103451824    347   7e-112   
ref|XP_006602296.1|  PREDICTED: uncharacterized protein LOC100816434    346   9e-112   
ref|XP_009360341.1|  PREDICTED: uncharacterized protein LOC103950826    345   4e-111   
ref|XP_007224691.1|  hypothetical protein PRUPE_ppa025479mg             342   3e-110   
ref|XP_008339907.1|  PREDICTED: uncharacterized protein LOC103402902    342   5e-110   
ref|XP_004516087.1|  PREDICTED: uncharacterized protein LOC101490706    341   5e-110   
gb|KHN06857.1|  hypothetical protein glysoja_033098                     341   8e-110   
gb|KDP41192.1|  hypothetical protein JCGZ_15599                         341   9e-110   
ref|XP_007133453.1|  hypothetical protein PHAVU_011G179800g             339   3e-109   
ref|XP_006417032.1|  hypothetical protein EUTSA_v10008130mg             338   1e-108   
ref|XP_007158659.1|  hypothetical protein PHAVU_002G171700g             337   2e-108   
ref|XP_006827217.1|  hypothetical protein AMTR_s00010p00259870          338   2e-108   
ref|XP_008221625.1|  PREDICTED: uncharacterized protein LOC103321584    337   4e-108   
ref|XP_010523459.1|  PREDICTED: uncharacterized protein LOC104801...    336   5e-108   
ref|XP_007046110.1|  CAAX amino terminal protease family protein ...    335   8e-108   
ref|XP_010523458.1|  PREDICTED: uncharacterized protein LOC104801...    335   1e-107   
ref|XP_007046109.1|  CAAX amino terminal protease family protein ...    335   2e-107   
ref|XP_010937144.1|  PREDICTED: uncharacterized protein LOC105056...    334   3e-107   
ref|XP_010257309.1|  PREDICTED: uncharacterized protein LOC104597460    334   5e-107   
gb|EPS61964.1|  hypothetical protein M569_12828                         329   2e-106   
gb|KEH19737.1|  CAAX amino terminal protease family protein             331   4e-106   
ref|XP_008784102.1|  PREDICTED: uncharacterized protein LOC103703133    330   1e-105   
gb|EYU28746.1|  hypothetical protein MIMGU_mgv1a008810mg                330   1e-105   
ref|XP_006586025.1|  PREDICTED: uncharacterized protein LOC100808...    330   2e-105   
emb|CDX96862.1|  BnaA08g24050D                                          328   4e-105   
ref|XP_010458918.1|  PREDICTED: uncharacterized protein LOC104740...    325   1e-103   
ref|XP_010476474.1|  PREDICTED: uncharacterized protein LOC104755721    325   1e-103   
gb|EEE69696.1|  hypothetical protein OsJ_29346                          325   2e-103   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002892797.1|  hypothetical protein ARALYDRAFT_471595             323   5e-103   
gb|EEC84569.1|  hypothetical protein OsI_31352                          323   6e-103   Oryza sativa Indica Group [Indian rice]
ref|XP_010495880.1|  PREDICTED: uncharacterized protein LOC104773...    323   7e-103   
ref|XP_006306018.1|  hypothetical protein CARUB_v10011314mg             323   8e-103   
ref|NP_563943.2|  CAAX amino terminal protease family protein           323   8e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009110552.1|  PREDICTED: uncharacterized protein LOC103836...    322   1e-102   
gb|AAM65055.1|  unknown                                                 322   2e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009110551.1|  PREDICTED: uncharacterized protein LOC103836...    322   2e-102   
emb|CDX84039.1|  BnaC08g16060D                                          320   1e-101   
ref|XP_010096551.1|  hypothetical protein L484_001018                   318   2e-101   
ref|XP_006660621.1|  PREDICTED: uncharacterized protein LOC102712385    319   4e-101   
emb|CDY49101.1|  BnaA06g09050D                                          317   8e-101   
ref|XP_009148709.1|  PREDICTED: uncharacterized protein LOC103872...    317   1e-100   
ref|XP_004956804.1|  PREDICTED: uncharacterized protein LOC101774...    312   1e-98    
ref|XP_010044740.1|  PREDICTED: uncharacterized protein LOC104433...    306   7e-98    
ref|XP_009407354.1|  PREDICTED: uncharacterized protein LOC103990050    309   3e-97    
ref|XP_008446341.1|  PREDICTED: uncharacterized protein LOC103489...    306   1e-96    
ref|XP_003578112.1|  PREDICTED: uncharacterized protein LOC100835467    303   5e-95    
emb|CDY39329.1|  BnaC05g10500D                                          301   1e-94    
gb|AAF43926.1|AC012188_3  Contains similarity to a hypothetical p...    302   2e-94    Arabidopsis thaliana [mouse-ear cress]
tpg|DAA61422.1|  TPA: CAAX amino terminal protease family protein       301   2e-94    
dbj|BAJ85717.1|  predicted protein                                      301   2e-94    
ref|NP_001141914.1|  uncharacterized protein LOC100274063               301   2e-94    Zea mays [maize]
gb|ACG31838.1|  CAAX amino terminal protease family protein             299   2e-93    Zea mays [maize]
ref|XP_006660160.1|  PREDICTED: uncharacterized protein LOC102705837    296   2e-92    
ref|XP_008668484.1|  PREDICTED: hypothetical protein isoform X1         296   4e-92    
ref|XP_004973526.1|  PREDICTED: uncharacterized protein LOC101774...    290   4e-90    
ref|XP_010235172.1|  PREDICTED: uncharacterized protein LOC100838017    283   5e-87    
ref|NP_973823.1|  CAAX amino terminal protease family protein           276   4e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010523460.1|  PREDICTED: uncharacterized protein LOC104801...    275   7e-86    
gb|EYU28749.1|  hypothetical protein MIMGU_mgv1a024984mg                278   5e-85    
ref|XP_007224612.1|  hypothetical protein PRUPE_ppa026907mg             273   7e-85    
gb|ACF86904.1|  unknown                                                 273   7e-85    Zea mays [maize]
gb|KCW86842.1|  hypothetical protein EUGRSUZ_B03438                     275   1e-84    
ref|XP_010937145.1|  PREDICTED: uncharacterized protein LOC105056...    274   2e-84    
ref|XP_009110553.1|  PREDICTED: uncharacterized protein LOC103836...    266   2e-82    
gb|ABI34291.1|  CAAX amino terminal protease family protein, puta...    270   2e-82    Solanum demissum
ref|XP_010458920.1|  PREDICTED: uncharacterized protein LOC104740...    266   3e-82    
ref|XP_010495885.1|  PREDICTED: uncharacterized protein LOC104773...    265   8e-82    
ref|NP_001077532.1|  CAAX amino terminal protease family protein        263   4e-81    Arabidopsis thaliana [mouse-ear cress]
gb|AAT38755.2|  CAAX amino terminal protease family protein, puta...    263   2e-80    Solanum demissum
ref|XP_009148710.1|  PREDICTED: uncharacterized protein LOC103872...    259   1e-79    
ref|XP_010937146.1|  PREDICTED: uncharacterized protein LOC105056...    251   2e-76    
ref|XP_004956805.1|  PREDICTED: uncharacterized protein LOC101774...    253   4e-76    
gb|EYU28747.1|  hypothetical protein MIMGU_mgv1a008800mg                251   5e-75    
tpg|DAA48961.1|  TPA: hypothetical protein ZEAMMB73_611537              249   2e-74    
ref|XP_002444401.1|  hypothetical protein SORBIDRAFT_07g021390          248   6e-74    Sorghum bicolor [broomcorn]
gb|KEH19739.1|  CAAX amino terminal protease family protein             246   9e-74    
gb|EMS56159.1|  Putative membrane peptidase ydiL                        241   5e-72    
gb|EEE68756.1|  hypothetical protein OsJ_27450                          234   5e-69    Oryza sativa Japonica Group [Japonica rice]
dbj|BAD10144.1|  CAAX amino terminal protease family-like protein       228   2e-66    Oryza sativa Japonica Group [Japonica rice]
gb|EMT33317.1|  hypothetical protein F775_52251                         229   5e-66    
ref|XP_006438678.1|  hypothetical protein CICLE_v10032082mg             223   2e-65    
ref|XP_002460206.1|  hypothetical protein SORBIDRAFT_02g024590          221   4e-64    Sorghum bicolor [broomcorn]
dbj|BAJ85779.1|  predicted protein                                      212   3e-62    
tpg|DAA48960.1|  TPA: hypothetical protein ZEAMMB73_611537              208   1e-60    
ref|XP_001785505.1|  predicted protein                                  199   3e-56    
gb|ACF78295.1|  unknown                                                 194   3e-56    Zea mays [maize]
gb|AAT38683.2|  CAAX amino terminal protease family protein, puta...    196   1e-54    Solanum demissum
ref|NP_001142170.1|  hypothetical protein                               188   9e-54    Zea mays [maize]
gb|KDO37736.1|  hypothetical protein CISIN_1g045219mg                   191   1e-53    
gb|EMS54663.1|  hypothetical protein TRIUR3_30489                       196   5e-52    
tpg|DAA61425.1|  TPA: hypothetical protein ZEAMMB73_931097              181   6e-51    
ref|NP_001063162.1|  Os09g0413200                                       181   7e-51    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002980171.1|  hypothetical protein SELMODRAFT_58140              179   5e-49    
ref|XP_010276954.1|  PREDICTED: uncharacterized protein LOC104611...    180   1e-48    
ref|XP_010931435.1|  PREDICTED: uncharacterized protein LOC105052...    180   2e-48    
ref|XP_010276952.1|  PREDICTED: uncharacterized protein LOC104611...    181   2e-48    
ref|XP_008788011.1|  PREDICTED: uncharacterized protein LOC103705...    179   5e-48    
gb|KHG15038.1|  D-alanine--D-alanine ligase                             171   3e-46    
ref|XP_010931434.1|  PREDICTED: uncharacterized protein LOC105052...    171   4e-45    
ref|XP_008788008.1|  PREDICTED: uncharacterized protein LOC103705...    169   2e-44    
gb|KDO37340.1|  hypothetical protein CISIN_1g034665mg                   160   5e-44    
gb|ACJ84920.1|  unknown                                                 151   6e-39    Medicago truncatula
ref|XP_008788017.1|  PREDICTED: uncharacterized protein LOC103705...    150   2e-38    
ref|XP_003078834.1|  putative CAAX amino terminal protease family...    151   8e-38    
emb|CEF97615.1|  CAAX amino terminal protease                           150   2e-37    
ref|XP_010931436.1|  PREDICTED: uncharacterized protein LOC105052...    149   3e-37    
gb|AFK39440.1|  unknown                                                 145   5e-37    
ref|XP_005651934.1|  Abi-domain-containing protein                      127   4e-30    
gb|EEC83628.1|  hypothetical protein OsI_29356                          120   4e-28    Oryza sativa Indica Group [Indian rice]
ref|XP_010276955.1|  PREDICTED: uncharacterized protein LOC104611...    121   1e-27    
ref|XP_006836172.1|  hypothetical protein AMTR_s00101p00054740          113   6e-27    
ref|XP_001417530.1|  predicted protein                                  117   1e-26    Ostreococcus lucimarinus CCE9901
ref|XP_001691345.1|  predicted protein                                  110   4e-25    Chlamydomonas reinhardtii
ref|XP_007512704.1|  predicted protein                                  115   1e-24    
ref|XP_005847247.1|  hypothetical protein CHLNCDRAFT_134232             110   3e-24    
ref|XP_002946992.1|  hypothetical protein VOLCADRAFT_120396             107   3e-22    
ref|XP_010258367.1|  PREDICTED: uncharacterized protein LOC104598...  97.4    5e-20    
ref|XP_010258366.1|  PREDICTED: uncharacterized protein LOC104598...  97.4    5e-20    
ref|NP_001061888.2|  Os08g0436600                                     85.9    4e-17    Oryza sativa Japonica Group [Japonica rice]
gb|AIE72603.1|  Abortive infection protein                            90.5    5e-16    
ref|WP_018399233.1|  hypothetical protein                             90.1    7e-16    
ref|WP_010873047.1|  hypothetical protein                             89.7    1e-15    
ref|XP_009357838.1|  PREDICTED: uncharacterized protein LOC103948...  87.0    1e-15    
ref|WP_026072788.1|  metal-dependent membrane protease                88.2    3e-15    
gb|AFK40816.1|  unknown                                               80.9    5e-15    
ref|WP_026135053.1|  abortive phage infection protein                 87.0    6e-15    
gb|KEI69029.1|  hypothetical protein A19Y_4361                        87.0    7e-15    
ref|XP_008337467.1|  PREDICTED: uncharacterized protein LOC103400...  84.7    9e-15    
ref|WP_006530204.1|  putative metal-dependent membrane protease       86.7    9e-15    
ref|WP_026793425.1|  MULTISPECIES: abortive phage infection protein   86.7    1e-14    
ref|WP_026787505.1|  MULTISPECIES: abortive phage infection protein   86.3    1e-14    
ref|WP_008188312.1|  CAAX amino terminal protease family              82.8    1e-14    
ref|WP_026798410.1|  MULTISPECIES: abortive phage infection protein   86.3    1e-14    
tpg|DAA48962.1|  TPA: hypothetical protein ZEAMMB73_611537            82.4    1e-14    
ref|WP_011243347.1|  hypothetical protein                             85.9    1e-14    
ref|WP_011377596.1|  hypothetical protein                             85.9    2e-14    
ref|WP_017661438.1|  hypothetical protein                             85.9    2e-14    
ref|XP_008245665.1|  PREDICTED: uncharacterized protein LOC103343807  83.6    2e-14    
ref|XP_008245252.1|  PREDICTED: uncharacterized protein LOC103343...  83.6    2e-14    
ref|XP_007198946.1|  hypothetical protein PRUPE_ppa016497mg           82.4    2e-14    
ref|WP_038081935.1|  abortive phage infection protein                 85.5    2e-14    
ref|WP_017316111.1|  abortive phage infection protein                 85.1    3e-14    
ref|WP_039780122.1|  peptidase                                        85.1    3e-14    
ref|WP_010473563.1|  peptidase                                        85.1    3e-14    
ref|WP_015230125.1|  metal-dependent membrane protease                85.1    3e-14    
ref|XP_007132668.1|  hypothetical protein PHAVU_011G1146001g          79.3    4e-14    
ref|WP_023071621.1|  abortive infection protein                       84.3    4e-14    
ref|WP_029681615.1|  CAAX protease                                    84.3    5e-14    
ref|WP_014274552.1|  hypothetical protein                             84.0    6e-14    
gb|KDP24144.1|  hypothetical protein JCGZ_25801                       82.0    6e-14    
ref|WP_030006069.1|  CAAX protease                                    84.0    6e-14    
emb|CDN11786.1|  hypothetical protein RintRC_6086                     84.0    7e-14    
gb|KDO42457.1|  hypothetical protein CISIN_1g026106mg                 80.1    7e-14    
ref|WP_012305909.1|  CAAX amino protease                              84.0    7e-14    
ref|WP_035986145.1|  metal-dependent membrane protease                84.0    7e-14    
ref|WP_037218212.1|  abortive phage infection protein                 83.6    8e-14    
ref|XP_007198805.1|  hypothetical protein PRUPE_ppa025767mg           79.3    8e-14    
ref|WP_009631880.1|  putative metal-dependent membrane protease       83.6    8e-14    
ref|WP_015133566.1|  abortive infection protein                       83.6    9e-14    
ref|XP_008461909.1|  PREDICTED: uncharacterized protein LOC103500...  80.9    1e-13    
ref|XP_010106589.1|  Putative membrane peptidase ydiL                 82.4    1e-13    
gb|ACL54593.1|  unknown                                               79.7    1e-13    Zea mays [maize]
ref|XP_008239007.1|  PREDICTED: uncharacterized protein LOC103337...  81.6    1e-13    
ref|WP_019502188.1|  hypothetical protein                             82.8    1e-13    
ref|WP_007356391.1|  MULTISPECIES: abortive phage infection protein   82.8    1e-13    
ref|WP_027843144.1|  abortive phage infection protein                 82.8    2e-13    
ref|XP_007209320.1|  hypothetical protein PRUPE_ppa007988mg           81.6    2e-13    
ref|XP_008239006.1|  PREDICTED: uncharacterized protein LOC103337...  81.3    2e-13    
gb|KDO42455.1|  hypothetical protein CISIN_1g026106mg                 79.7    2e-13    
ref|XP_006491646.1|  PREDICTED: uncharacterized protein LOC102619...  79.7    2e-13    
gb|KDO42456.1|  hypothetical protein CISIN_1g026106mg                 79.3    2e-13    
ref|WP_016860061.1|  abortive phage infection protein                 82.0    2e-13    
ref|XP_004161901.1|  PREDICTED: uncharacterized protein LOC101228787  80.1    2e-13    
ref|WP_015199187.1|  abortive infection protein                       82.0    2e-13    
ref|WP_019490774.1|  hypothetical protein                             82.0    3e-13    
ref|WP_015191891.1|  Abortive infection protein                       82.0    3e-13    
ref|WP_035154569.1|  abortive phage infection protein                 82.0    3e-13    
ref|XP_004139689.1|  PREDICTED: uncharacterized protein LOC101217192  79.7    3e-13    
ref|WP_006098562.1|  abortive phage infection protein                 82.0    3e-13    
ref|XP_008461908.1|  PREDICTED: uncharacterized protein LOC103500...  80.1    3e-13    
ref|XP_006491645.1|  PREDICTED: uncharacterized protein LOC102619...  79.7    4e-13    
ref|WP_015187177.1|  Abortive infection protein                       81.6    4e-13    
ref|XP_006388524.1|  hypothetical protein POPTR_0163s00230g           75.9    4e-13    
ref|WP_006516835.1|  putative metal-dependent membrane protease       81.3    5e-13    
ref|WP_019508695.1|  hypothetical protein                             81.3    5e-13    
ref|WP_026719661.1|  abortive phage infection protein                 81.3    5e-13    
ref|WP_036479682.1|  abortive phage infection protein                 80.9    6e-13    
ref|WP_023064005.1|  CAAX protease self-immunity family protein       80.9    6e-13    
emb|CEF99712.1|  CAAX amino terminal protease                         80.5    6e-13    
ref|WP_009784581.1|  abortive phage infection protein                 80.9    6e-13    
ref|XP_003082097.1|  unnamed protein product                          79.3    7e-13    
gb|EPS73198.1|  hypothetical protein M569_01553                       78.2    7e-13    
ref|WP_017715794.1|  hypothetical protein                             80.9    7e-13    
ref|WP_017304316.1|  hypothetical protein                             80.5    7e-13    
ref|WP_016878155.1|  abortive phage infection protein                 80.5    8e-13    
ref|WP_026099232.1|  hypothetical protein                             80.5    8e-13    
ref|WP_006510963.1|  putative metal-dependent membrane protease       80.5    9e-13    
ref|WP_017309079.1|  abortive phage infection protein                 80.1    1e-12    
ref|WP_015172784.1|  abortive infection protein                       80.1    1e-12    
gb|KHG14846.1|  Putative membrane peptidase ydiL                      79.0    1e-12    
ref|WP_009344607.1|  abortive phage infection protein                 80.1    1e-12    
ref|WP_017320949.1|  abortive phage infection protein                 80.1    1e-12    
ref|XP_010533617.1|  PREDICTED: uncharacterized protein LOC104809356  79.0    1e-12    
ref|WP_015174715.1|  Abortive infection protein                       79.7    1e-12    
ref|XP_009334489.1|  PREDICTED: uncharacterized protein LOC103927305  78.6    2e-12    
ref|WP_012407312.1|  abortive phage infection protein                 79.3    2e-12    
ref|WP_008307815.1|  putative metal-dependent membrane protease       79.3    2e-12    
ref|XP_004298847.1|  PREDICTED: uncharacterized protein LOC101297145  78.2    2e-12    
ref|WP_006633320.1|  abortive phage infection protein                 79.3    2e-12    
ref|WP_015221989.1|  abortive infection protein                       79.3    2e-12    
ref|XP_011080891.1|  PREDICTED: uncharacterized protein LOC105164040  78.6    2e-12    
ref|XP_007043568.1|  Prenyl-dependent CAAX protease, putative iso...  77.4    2e-12    
ref|XP_007043571.1|  Prenyl-dependent CAAX protease, putative iso...  77.4    2e-12    
ref|WP_011431455.1|  CAAX amino terminal protease                     79.0    2e-12    
gb|KHN16775.1|  hypothetical protein glysoja_002872                   77.8    2e-12    
ref|XP_004514447.1|  PREDICTED: uncharacterized protein LOC101505516  77.4    2e-12    
gb|EAZ01098.1|  hypothetical protein OsI_23126                        78.2    3e-12    Oryza sativa Indica Group [Indian rice]
ref|XP_006656998.1|  PREDICTED: uncharacterized protein LOC102717626  77.8    3e-12    
ref|WP_009458258.1|  MULTISPECIES: abortive phage infection protein   79.0    3e-12    
ref|NP_001057716.1|  Os06g0505400                                     78.2    3e-12    Oryza sativa Japonica Group [Japonica rice]
ref|WP_026732987.1|  abortive phage infection protein                 79.0    3e-12    
ref|WP_006619217.1|  MULTISPECIES: abortive phage infection protein   79.0    3e-12    
ref|WP_015227581.1|  abortive infection protein                       79.0    3e-12    
gb|KDR58696.1|  abortive phage infection protein                      78.6    3e-12    
ref|WP_016868025.1|  abortive phage infection protein                 79.0    3e-12    
ref|WP_008050985.1|  abortive phage infection protein                 78.6    3e-12    
ref|XP_006371570.1|  CAAX amino terminal protease family protein      75.9    3e-12    
gb|KDP25361.1|  hypothetical protein JCGZ_20517                       77.8    3e-12    
ref|WP_039714507.1|  abortive phage infection protein                 78.6    3e-12    
ref|WP_006275617.1|  abortive phage infection protein                 78.6    3e-12    
ref|WP_029637233.1|  abortive phage infection protein [               78.6    3e-12    
ref|XP_006476474.1|  PREDICTED: uncharacterized protein LOC102608...  77.4    3e-12    
ref|NP_001239773.1|  uncharacterized protein LOC100775964             77.4    3e-12    
gb|KHG09262.1|  Putative membrane peptidase ydiL                      77.4    4e-12    
ref|WP_012595794.1|  MULTISPECIES: abortive phage infection protein   78.2    4e-12    
ref|XP_006439445.1|  hypothetical protein CICLE_v10020944mg           77.0    4e-12    
ref|XP_011039734.1|  PREDICTED: uncharacterized protein LOC105136195  76.3    5e-12    
ref|XP_003592164.1|  hypothetical protein MTR_1g099420                77.0    5e-12    
ref|WP_009555084.1|  putative metal-dependent membrane protease       78.2    5e-12    
ref|WP_015211243.1|  putative metal-dependent membrane protease       78.2    5e-12    
ref|WP_012626968.1|  abortive infection protein                       78.2    5e-12    
ref|XP_004303139.1|  PREDICTED: uncharacterized protein LOC101291066  76.3    5e-12    
ref|WP_015157261.1|  abortive infection protein                       78.2    5e-12    
ref|WP_015130455.1|  abortive infection protein                       77.8    5e-12    
ref|WP_039744126.1|  abortive phage infection protein                 77.8    5e-12    
emb|CAJ72603.1|  hypothetical protein kustd1858                       75.5    5e-12    Candidatus Kuenenia stuttgartiensis
ref|XP_010060044.1|  PREDICTED: uncharacterized protein LOC104447982  77.0    5e-12    
ref|WP_039725813.1|  hypothetical protein                             77.8    6e-12    
gb|KFF41437.1|  putative metal-dependent membrane protease            77.8    6e-12    
ref|WP_026100828.1|  hypothetical protein                             77.8    7e-12    
ref|XP_007160122.1|  hypothetical protein PHAVU_002G294300g           76.3    7e-12    
ref|XP_010099572.1|  Clathrin light chain 1                           77.0    8e-12    
gb|KFK27600.1|  hypothetical protein AALP_AA8G404700                  76.3    8e-12    
ref|WP_015122741.1|  metal-dependent membrane protease                77.4    8e-12    
gb|EYU23404.1|  hypothetical protein MIMGU_mgv1a008473mg              76.6    9e-12    
ref|XP_010261427.1|  PREDICTED: uncharacterized protein LOC104600265  75.9    1e-11    
ref|XP_001779782.1|  predicted protein                                74.3    1e-11    
ref|XP_008806546.1|  PREDICTED: uncharacterized protein LOC103719198  75.1    1e-11    
ref|XP_004173484.1|  PREDICTED: uncharacterized LOC101217840          74.3    1e-11    
ref|WP_006456997.1|  CAAX amino terminal protease family              76.6    1e-11    
ref|WP_011433748.1|  CAAX amino terminal protease                     76.6    1e-11    
ref|XP_010053192.1|  PREDICTED: uncharacterized protein LOC104441...  75.5    1e-11    
ref|WP_010997926.1|  abortive phage infection protein                 76.6    1e-11    
ref|XP_011026961.1|  PREDICTED: uncharacterized protein LOC105127389  75.5    2e-11    
ref|XP_010272481.1|  PREDICTED: uncharacterized protein LOC104608243  75.5    2e-11    
gb|KGN49906.1|  hypothetical protein Csa_5G139840                     75.5    2e-11    
ref|XP_004145910.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  75.5    2e-11    
ref|WP_017288393.1|  hypothetical protein                             76.3    2e-11    
ref|XP_007040382.1|  CAAX amino terminal protease family protein ...  75.1    2e-11    
ref|WP_011318362.1|  abortive phage infection protein                 76.3    2e-11    
ref|XP_006580547.1|  PREDICTED: uncharacterized protein LOC100779061  75.1    2e-11    
ref|XP_008437553.1|  PREDICTED: uncharacterized protein LOC103482932  75.1    2e-11    
ref|WP_022604308.1|  putative metal-dependent membrane protease       76.3    2e-11    
gb|ADN33781.1|  CAAX amino terminal protease family                   75.1    2e-11    
gb|EYU26171.1|  hypothetical protein MIMGU_mgv1a011125mg              74.3    2e-11    
ref|XP_001420366.1|  predicted protein                                75.1    2e-11    
dbj|BAP17592.1|  abortive infection protein                           75.9    3e-11    
ref|WP_002796784.1|  abortive phage infection protein                 75.9    3e-11    
ref|XP_001765302.1|  predicted protein                                73.6    3e-11    
emb|CDP05121.1|  unnamed protein product                              73.6    3e-11    
ref|XP_006476476.1|  PREDICTED: uncharacterized protein LOC102608...  74.3    3e-11    
ref|WP_016951194.1|  abortive phage infection protein                 75.5    3e-11    
ref|XP_011073439.1|  PREDICTED: uncharacterized protein LOC105158386  74.7    3e-11    
ref|XP_004503658.1|  PREDICTED: uncharacterized protein LOC101509853  74.7    3e-11    
ref|XP_006476475.1|  PREDICTED: uncharacterized protein LOC102608...  74.3    3e-11    
ref|XP_010241956.1|  PREDICTED: uncharacterized protein LOC104586...  73.2    3e-11    
ref|WP_008229995.1|  Abortive infection protein                       71.6    3e-11    
ref|XP_011085964.1|  PREDICTED: uncharacterized protein LOC105167...  73.6    4e-11    
ref|XP_002948930.1|  hypothetical protein VOLCADRAFT_80447            74.3    4e-11    
ref|XP_007040384.1|  CAAX amino terminal protease family protein ...  73.6    4e-11    
gb|ACU18810.1|  unknown                                               72.4    4e-11    
ref|WP_026101894.1|  abortive phage infection protein                 75.1    4e-11    
ref|WP_028083018.1|  abortive phage infection protein                 75.1    4e-11    
ref|WP_032522502.1|  peptidase                                        74.7    4e-11    
ref|XP_010656965.1|  PREDICTED: uncharacterized protein LOC100265...  72.8    4e-11    
ref|XP_002276929.1|  PREDICTED: uncharacterized protein LOC100250094  73.9    4e-11    
ref|XP_002864700.1|  CAAX amino terminal protease family protein      73.9    5e-11    
gb|EMT18677.1|  Elongation factor Ts                                  75.5    5e-11    
ref|XP_010676389.1|  PREDICTED: uncharacterized protein LOC104892223  73.9    5e-11    
gb|AHJ26426.1|  hypothetical protein NSP_690                          74.7    5e-11    
ref|WP_006194387.1|  abortive phage infection protein                 74.7    6e-11    
ref|WP_012265482.1|  abortive phage infection protein                 74.7    6e-11    
ref|XP_010443878.1|  PREDICTED: uncharacterized protein LOC104726664  73.6    6e-11    
ref|XP_006280734.1|  hypothetical protein CARUB_v10026703mg           73.6    6e-11    
ref|WP_015139741.1|  metal-dependent membrane protease                74.7    6e-11    
ref|XP_010929565.1|  PREDICTED: uncharacterized protein LOC105051...  73.6    6e-11    
ref|WP_028090624.1|  abortive phage infection protein                 74.3    7e-11    
emb|CDP12096.1|  unnamed protein product                              73.9    7e-11    
ref|WP_015160360.1|  putative metal-dependent membrane protease       74.3    7e-11    
ref|XP_003527432.1|  PREDICTED: uncharacterized protein LOC100806...  72.8    8e-11    
ref|NP_568928.1|  endopeptidase SCO4                                  73.2    8e-11    
ref|XP_010456718.1|  PREDICTED: uncharacterized protein LOC104738203  73.6    8e-11    
dbj|BAB09848.1|  unnamed protein product                              72.8    8e-11    
ref|XP_010483728.1|  PREDICTED: uncharacterized protein LOC104762182  73.2    8e-11    
emb|CDY09186.1|  BnaA02g06120D                                        73.2    8e-11    
ref|XP_010929564.1|  PREDICTED: uncharacterized protein LOC105051...  73.6    8e-11    
ref|XP_007512818.1|  predicted protein                                73.9    8e-11    
emb|CDX73865.1|  BnaA03g31820D                                        73.2    8e-11    
ref|XP_009126584.1|  PREDICTED: uncharacterized protein LOC103851485  73.2    9e-11    
dbj|GAL94240.1|  hypothetical protein N44_02820                       73.9    1e-10    
ref|WP_015219444.1|  abortive infection protein                       73.9    1e-10    
gb|EKD06554.1|  abortive infection protein                            68.9    1e-10    
ref|WP_012163967.1|  peptidase                                        73.9    1e-10    
ref|XP_010241955.1|  PREDICTED: uncharacterized protein LOC104586...  72.4    1e-10    
ref|XP_009796702.1|  PREDICTED: uncharacterized protein LOC104243239  73.2    1e-10    
ref|WP_024969764.1|  abortive phage infection protein                 73.9    1e-10    
ref|XP_002517936.1|  prenyl-dependent CAAX protease, putative         72.0    1e-10    
ref|XP_006400816.1|  hypothetical protein EUTSA_v10013994mg           72.8    1e-10    
ref|WP_002795086.1|  abortive phage infection protein                 73.9    1e-10    
ref|WP_002778370.1|  abortive phage infection protein                 73.9    1e-10    
ref|WP_002747965.1|  CAAX amino terminal protease family protein      73.9    1e-10    
ref|WP_002738495.1|  CAAX amino terminal protease family protein      73.9    1e-10    
ref|WP_016515540.1|  CAAX amino terminal protease self- immunity      73.9    1e-10    
ref|WP_002801231.1|  abortive phage infection protein                 73.6    1e-10    
ref|WP_008202035.1|  abortive phage infection protein                 73.6    1e-10    
ref|WP_002768655.1|  abortive phage infection protein                 73.6    1e-10    
ref|WP_002758417.1|  abortive phage infection protein                 73.6    1e-10    
ref|WP_002756130.1|  abortive phage infection protein                 73.6    1e-10    
ref|XP_009775664.1|  PREDICTED: uncharacterized protein LOC104225...  71.2    1e-10    
gb|KEH21164.1|  CAAX amino terminal protease family protein           72.8    1e-10    
ref|WP_008234090.1|  Abortive infection protein                       73.6    1e-10    
ref|WP_015185319.1|  metal-dependent membrane protease                73.6    1e-10    
ref|WP_002783197.1|  Abortive infection protein                       73.6    1e-10    
ref|XP_003061561.1|  predicted protein                                73.6    1e-10    
ref|WP_009628867.1|  Abortive infection protein                       73.6    1e-10    
ref|WP_002789067.1|  abortive phage infection protein                 73.6    1e-10    
ref|XP_009630290.1|  PREDICTED: uncharacterized protein LOC104120259  72.8    1e-10    
ref|XP_006343913.1|  PREDICTED: uncharacterized protein LOC102605715  72.8    1e-10    
ref|XP_004496505.1|  PREDICTED: uncharacterized protein LOC101505330  72.4    1e-10    
ref|XP_004245558.1|  PREDICTED: uncharacterized protein LOC101244021  72.8    1e-10    
ref|WP_015115811.1|  abortive infection protein                       73.6    1e-10    
ref|XP_002273804.1|  PREDICTED: uncharacterized protein LOC100265...  71.6    2e-10    
ref|WP_017655174.1|  abortive phage infection protein                 73.2    2e-10    
ref|XP_008788014.1|  PREDICTED: uncharacterized protein LOC103705...  71.2    2e-10    
ref|XP_010918483.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  71.6    2e-10    
gb|AFK38413.1|  unknown                                               70.9    2e-10    
ref|XP_002298001.2|  hypothetical protein POPTR_0001s10060g           72.4    2e-10    
ref|XP_008776534.1|  PREDICTED: uncharacterized protein LOC103696628  72.4    2e-10    
ref|XP_003563167.1|  PREDICTED: uncharacterized protein LOC100841...  72.0    2e-10    
ref|XP_011022594.1|  PREDICTED: uncharacterized protein LOC105124...  72.0    2e-10    
ref|XP_007143506.1|  hypothetical protein PHAVU_007G077200g           72.0    2e-10    
ref|WP_015212375.1|  Abortive infection protein                       72.8    2e-10    
ref|XP_009591219.1|  PREDICTED: uncharacterized protein LOC104088...  70.5    2e-10    
ref|XP_009775663.1|  PREDICTED: uncharacterized protein LOC104225...  71.2    2e-10    
ref|WP_015163386.1|  abortive infection protein                       72.8    2e-10    
gb|ACU19176.1|  unknown                                               71.2    2e-10    
ref|XP_002304526.1|  hypothetical protein POPTR_0003s13360g           71.6    2e-10    
emb|CBI21837.3|  unnamed protein product                              72.0    3e-10    
ref|WP_012953634.1|  abortive phage infection protein                 72.4    3e-10    
ref|XP_010238776.1|  PREDICTED: uncharacterized protein LOC100841...  71.2    3e-10    
gb|AFK34486.1|  unknown                                               69.3    3e-10    
ref|XP_005646969.1|  metal-dependent CAAX amino terminal protease...  69.7    3e-10    
ref|WP_007221100.1|  hypothetical protein                             70.1    3e-10    
ref|XP_009408532.1|  PREDICTED: uncharacterized protein LOC103990947  71.6    3e-10    
ref|WP_036003622.1|  abortive phage infection protein                 72.0    4e-10    
ref|XP_002509884.1|  prenyl-dependent CAAX protease, putative         71.2    4e-10    
ref|WP_012007339.1|  peptidase                                        71.6    4e-10    
ref|XP_010489000.1|  PREDICTED: uncharacterized protein LOC104766754  70.5    4e-10    
ref|XP_010468788.1|  PREDICTED: uncharacterized protein LOC104748907  69.7    4e-10    
ref|XP_010323734.1|  PREDICTED: uncharacterized protein LOC101267135  70.1    5e-10    
ref|XP_009591203.1|  PREDICTED: uncharacterized protein LOC104088...  70.1    5e-10    
ref|XP_009591211.1|  PREDICTED: uncharacterized protein LOC104088...  69.3    5e-10    
ref|XP_003064160.1|  predicted protein                                68.9    6e-10    
ref|WP_015124194.1|  metal-dependent membrane protease                71.2    6e-10    
ref|XP_003556135.1|  PREDICTED: uncharacterized protein LOC100808...  70.5    6e-10    
ref|XP_006298194.1|  hypothetical protein CARUB_v10014241mg           70.1    6e-10    
ref|WP_013190948.1|  abortive phage infection protein                 71.2    6e-10    
ref|XP_002509194.1|  predicted protein                                72.0    7e-10    
ref|XP_006357490.1|  PREDICTED: uncharacterized protein LOC102597987  68.9    7e-10    
gb|KGF93286.1|  putative membrane associated protease                 70.9    7e-10    
ref|XP_001700469.1|  metal-dependent CAAX amino terminal protease...  68.9    7e-10    
ref|XP_003556136.1|  PREDICTED: uncharacterized protein LOC100808...  70.5    8e-10    
ref|XP_003556137.1|  PREDICTED: uncharacterized protein LOC100808...  70.5    8e-10    
ref|WP_032513910.1|  peptidase                                        70.9    8e-10    
ref|WP_011143167.1|  hypothetical protein                             70.9    9e-10    
ref|XP_005848457.1|  hypothetical protein CHLNCDRAFT_144842           70.1    1e-09    
ref|XP_003592165.1|  hypothetical protein MTR_1g099420                70.5    1e-09    
ref|WP_002805273.1|  peptidase                                        70.5    1e-09    
ref|WP_025929943.1|  peptidase                                        70.5    1e-09    
ref|WP_032526819.1|  peptidase                                        70.5    1e-09    
ref|WP_025926155.1|  peptidase                                        70.1    1e-09    
ref|WP_039597171.1|  membrane protein                                 68.6    2e-09    
ref|WP_006483779.1|  membrane protein                                 68.2    2e-09    
ref|WP_006494713.1|  membrane protein                                 68.2    2e-09    
ref|XP_010689299.1|  PREDICTED: uncharacterized protein LOC104903...  68.6    2e-09    
ref|XP_010689298.1|  PREDICTED: uncharacterized protein LOC104903...  68.6    2e-09    
ref|XP_001421859.1|  predicted protein                                67.8    2e-09    
ref|WP_034720932.1|  CAAX protease                                    68.2    2e-09    
ref|XP_009101997.1|  PREDICTED: uncharacterized protein LOC103828...  67.4    2e-09    
emb|CBI22601.3|  unnamed protein product                              70.1    2e-09    
ref|WP_025914334.1|  peptidase                                        69.3    2e-09    
ref|WP_011611783.1|  abortive phage infection protein                 69.3    3e-09    
ref|WP_011862535.1|  peptidase                                        69.3    3e-09    
ref|XP_005709210.1|  CAAX amino terminal protease family protein      69.3    3e-09    
ref|WP_036984526.1|  hypothetical protein                             65.1    3e-09    
ref|XP_010662643.1|  PREDICTED: uncharacterized protein LOC100254...  68.6    3e-09    
ref|WP_025913506.1|  peptidase                                        69.3    3e-09    
ref|XP_010662642.1|  PREDICTED: uncharacterized protein LOC100254...  68.6    3e-09    
emb|CAN67252.1|  hypothetical protein VITISV_023148                   67.0    3e-09    
ref|NP_565483.1|  CAAX amino terminal protease family protein         67.8    3e-09    
ref|XP_010662641.1|  PREDICTED: uncharacterized protein LOC100254...  68.2    3e-09    
ref|XP_004956135.1|  PREDICTED: uncharacterized protein LOC101765331  67.8    4e-09    
ref|WP_015144430.1|  metal-dependent membrane protease                68.9    4e-09    
ref|XP_002275682.2|  PREDICTED: uncharacterized protein LOC100254...  68.6    4e-09    
ref|WP_032132524.1|  hypothetical protein                             65.9    4e-09    
ref|XP_010662640.1|  PREDICTED: uncharacterized protein LOC100254...  68.2    4e-09    
ref|WP_009544848.1|  MULTISPECIES: abortive phage infection protein   68.9    4e-09    
emb|CDY05787.1|  BnaC07g00160D                                        67.8    4e-09    
ref|XP_009101996.1|  PREDICTED: uncharacterized protein LOC103828...  67.0    5e-09    
ref|WP_036897514.1|  peptidase                                        68.6    5e-09    
ref|WP_019474046.1|  hypothetical protein                             68.6    5e-09    
ref|WP_025957615.1|  peptidase                                        67.4    6e-09    
ref|XP_005819270.1|  hypothetical protein GUITHDRAFT_121552           68.2    6e-09    
ref|WP_017775221.1|  hypothetical protein                             66.6    6e-09    
gb|KFK40447.1|  hypothetical protein AALP_AA3G374300                  66.6    7e-09    
ref|WP_022063909.1|  putative uncharacterized protein                 67.4    7e-09    
ref|WP_011376075.1|  peptidase                                        67.8    7e-09    
ref|WP_025975749.1|  peptidase                                        67.8    7e-09    
ref|WP_025945771.1|  peptidase                                        67.8    7e-09    
ref|XP_002508579.1|  hypothetical protein MICPUN_85896                66.2    8e-09    
ref|WP_025944521.1|  hypothetical protein                             65.1    8e-09    
ref|WP_034204718.1|  membrane protein                                 66.2    8e-09    
ref|WP_013598677.1|  hypothetical protein                             66.2    9e-09    
ref|WP_025965439.1|  peptidase                                        67.4    1e-08    
ref|XP_002886301.1|  CAAX amino terminal protease family protein      66.2    1e-08    
ref|WP_025929235.1|  peptidase                                        67.0    1e-08    
ref|WP_025924271.1|  peptidase                                        67.4    1e-08    
ref|WP_025894165.1|  MULTISPECIES: peptidase                          67.4    1e-08    
ref|WP_032517783.1|  peptidase                                        67.4    1e-08    
ref|WP_025955355.1|  peptidase                                        67.4    1e-08    
ref|WP_025953554.1|  peptidase                                        67.4    1e-08    
ref|WP_025973200.1|  peptidase                                        67.4    1e-08    
ref|WP_025943687.1|  peptidase                                        67.4    1e-08    
ref|WP_025969092.1|  peptidase                                        67.4    1e-08    
ref|WP_025934917.1|  peptidase                                        67.4    1e-08    
ref|WP_011818024.1|  peptidase                                        67.4    1e-08    
ref|WP_025967929.1|  peptidase                                        67.4    1e-08    
ref|WP_025931530.1|  MULTISPECIES: peptidase                          67.4    1e-08    
ref|WP_008277033.1|  abortive phage infection protein                 67.4    1e-08    
ref|WP_025971854.1|  peptidase                                        67.0    1e-08    
ref|WP_035474339.1|  hypothetical protein                             65.5    2e-08    
ref|WP_025956543.1|  hypothetical protein                             64.3    2e-08    
gb|AIQ94584.1|  putative membrane associated protease                 66.6    2e-08    
ref|WP_034180224.1|  membrane protein                                 65.5    2e-08    
ref|WP_015955015.1|  abortive phage infection protein                 67.0    2e-08    
ref|XP_002459805.1|  hypothetical protein SORBIDRAFT_02g011005        65.9    2e-08    
gb|KFM28767.1|  Serine palmitoyltransferase 2                         67.0    2e-08    
emb|CDY31942.1|  BnaA07g00530D                                        65.5    2e-08    
ref|WP_036906931.1|  protease                                         66.6    2e-08    
ref|WP_025947226.1|  peptidase                                        66.2    2e-08    
ref|WP_025964664.1|  peptidase                                        66.6    2e-08    
ref|WP_025972884.1|  peptidase                                        66.2    2e-08    
gb|EHJ12771.1|  Abortive infection protein                            65.1    2e-08    
ref|WP_025939799.1|  peptidase                                        66.2    2e-08    
ref|WP_025941435.1|  peptidase                                        66.2    2e-08    
ref|WP_025890520.1|  peptidase                                        66.2    2e-08    
ref|WP_025978818.1|  peptidase                                        66.2    2e-08    
ref|WP_025925098.1|  MULTISPECIES: peptidase                          66.2    2e-08    



>ref|XP_009624680.1| PREDICTED: uncharacterized protein LOC104115706 [Nicotiana tomentosiformis]
Length=335

 Score =   399 bits (1025),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 247/332 (74%), Positives = 273/332 (82%), Gaps = 10/332 (3%)
 Frame = -3

Query  1352  VSLARPSAPIASLSPKLFPYKPLTQKLQLLSF----RRTDQA---LRPRFSTTVCSYSSG  1194
             ++L + S PI    PKL+  K L QK   +S     +  D A      R  TT+C  S  
Sbjct  7     ITLTQSSCPIL---PKLYSSKSLLQKSHRISLAPFLKFQDSAPSQSSTRGFTTICFSSPR  63

Query  1193  NRPDPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELS  1014
             N PD KGSGP+ PI RRW VPWNWQT+SL+SLACG SFVLTGLIETA+IPY G+ V+ELS
Sbjct  64    NGPDYKGSGPDWPILRRWDVPWNWQTVSLSSLACGLSFVLTGLIETASIPYVGLDVDELS  123

Query  1013  LDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaigl  834
             LDEKAEILF DQAITTA+VL VLYTLTKSS+PLP+DIY YD +EPFNLQRGWLLWA IGL
Sbjct  124   LDEKAEILFADQAITTAVVLIVLYTLTKSSQPLPDDIYRYDLKEPFNLQRGWLLWAGIGL  183

Query  833   agalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEET  654
              GA+ AIALTG AMS+ N E P RETDAL RLLPLIGSSSIST+SLLGITGVLAP+LEET
Sbjct  184   VGAIGAIALTGAAMSTFNGETPPRETDALARLLPLIGSSSISTVSLLGITGVLAPILEET  243

Query  653   VFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTP  474
             VFRGF MVSLTKWLP+PLA LIS AVF+ AHLTPG+FPQLFVLGTALGFSYAQTRNLLTP
Sbjct  244   VFRGFFMVSLTKWLPTPLAALISGAVFALAHLTPGQFPQLFVLGTALGFSYAQTRNLLTP  303

Query  473   ITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             ITIHAFWNSGVILLLTFLQLQGYDIKE+IQA+
Sbjct  304   ITIHAFWNSGVILLLTFLQLQGYDIKEIIQAT  335



>ref|XP_006366111.1| PREDICTED: uncharacterized protein LOC102579521 [Solanum tuberosum]
Length=337

 Score =   399 bits (1025),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 243/322 (75%), Positives = 267/322 (83%), Gaps = 10/322 (3%)
 Frame = -3

Query  1313  SPKLFPYKPLTQKLQLLS-------FRRTDQALRP---RFSTTVCSYSSGNRPDPKGSGP  1164
             SPKL+  KPL QK   +S        +  D A      R  TT+C  S  N PD KG GP
Sbjct  16    SPKLYSSKPLLQKSHRISIAPLTPFLKFQDSAASQASTRGFTTICFSSPRNGPDYKGGGP  75

Query  1163  NCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFL  984
             + PI RRW VPWNWQT+SL+SLACG SFVLTGLIETA+IPY G+ VE LSLDEKAEILF 
Sbjct  76    DWPILRRWDVPWNWQTVSLSSLACGLSFVLTGLIETASIPYVGLDVEALSLDEKAEILFA  135

Query  983   DQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLT  804
             DQAITTA+VL VLYTLTKSS+PLP+DIY YD +EPFNLQRGWLLWA IGLAGA+ AIALT
Sbjct  136   DQAITTAVVLIVLYTLTKSSQPLPDDIYRYDLKEPFNLQRGWLLWAGIGLAGAIGAIALT  195

Query  803   GVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSL  624
             GVAMS+ N EPP RETDAL RLLPLIGSSSIST SLLGITGVLAP+LEETVFRGF MVSL
Sbjct  196   GVAMSAFNGEPPQRETDALARLLPLIGSSSISTASLLGITGVLAPILEETVFRGFFMVSL  255

Query  623   TKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSG  444
             TKW+P+PLAV+IS AVF+ AHLTPG+FPQLFVLGTALGFSYAQTRNLLTPITIHA WNSG
Sbjct  256   TKWVPTPLAVVISGAVFALAHLTPGQFPQLFVLGTALGFSYAQTRNLLTPITIHALWNSG  315

Query  443   VILLLTFLQLQGYDIKELIQAS  378
             VILLLTFLQLQGYDI+E+IQ +
Sbjct  316   VILLLTFLQLQGYDIREIIQGT  337



>gb|ABO93007.1| putative CAAX aminoterminal protease [Solanum tuberosum]
Length=337

 Score =   396 bits (1018),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 242/323 (75%), Positives = 266/323 (82%), Gaps = 10/323 (3%)
 Frame = -3

Query  1316  LSPKLFPYKPLTQKLQLLS-------FRRTDQA---LRPRFSTTVCSYSSGNRPDPKGSG  1167
              SPKL+  KPL QK   +S        +  D A      R  TT+C  S  N PD KG G
Sbjct  15    FSPKLYSSKPLLQKSHRISIAPLTAFLKFQDSASSQASTRGFTTICFSSPRNGPDYKGDG  74

Query  1166  PNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILF  987
             P+ PI RRW VPWNWQT+SL+SLACG SFVLTGLIETA+IPY G+ VE LSLDEKAEILF
Sbjct  75    PDWPISRRWDVPWNWQTVSLSSLACGLSFVLTGLIETASIPYVGLDVEALSLDEKAEILF  134

Query  986   LDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaL  807
              DQAITTA+VL VLYTLTKSS+PLP+DIY YD +EPFNLQRGWLLWA IGLAGA+ AIAL
Sbjct  135   ADQAITTAVVLIVLYTLTKSSQPLPDDIYRYDLKEPFNLQRGWLLWAGIGLAGAIGAIAL  194

Query  806   TGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVS  627
             TGVAMS+ N EPP RETDAL RLLPLIGSSSIST SLLGITGVLAP+LEETVFRGF MVS
Sbjct  195   TGVAMSAFNGEPPQRETDALARLLPLIGSSSISTASLLGITGVLAPILEETVFRGFFMVS  254

Query  626   LTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNS  447
             LTKW+P+PLA +IS AVF+ AHLTPG+FPQLFVLGTALGFSYAQTRNLLTPITIHA WNS
Sbjct  255   LTKWVPTPLAAVISGAVFALAHLTPGQFPQLFVLGTALGFSYAQTRNLLTPITIHALWNS  314

Query  446   GVILLLTFLQLQGYDIKELIQAS  378
             GVILLLTFLQLQGYDI+E+IQ +
Sbjct  315   GVILLLTFLQLQGYDIREIIQGT  337



>ref|XP_009794989.1| PREDICTED: uncharacterized protein LOC104241753 isoform X1 [Nicotiana 
sylvestris]
Length=335

 Score =   395 bits (1014),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 241/318 (76%), Positives = 267/318 (84%), Gaps = 7/318 (2%)
 Frame = -3

Query  1310  PKLFPYKPLTQKLQLLSF----RRTDQA---LRPRFSTTVCSYSSGNRPDPKGSGPNCPI  1152
             PKL+  K + QK   +S     +  D A      R  TT+C     N PD KGSGP+ PI
Sbjct  18    PKLYSSKSILQKSNRISLTPFLKFQDSAPTQSSTRGFTTICFSRPRNGPDYKGSGPDWPI  77

Query  1151  FRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAI  972
              RRW+VPWNWQT+SL+SLACG SFVLTGLIETA+IPY G+ V+ELSLDEKAEILF DQAI
Sbjct  78    LRRWNVPWNWQTVSLSSLACGLSFVLTGLIETASIPYVGLDVDELSLDEKAEILFADQAI  137

Query  971   TTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAM  792
             TTA+VL VLYTLTKSS+PLP+DIY YD +EPFNLQRGWLLWA IGL GA+ AIALTGVAM
Sbjct  138   TTAVVLIVLYTLTKSSQPLPDDIYRYDLKEPFNLQRGWLLWAGIGLVGAIGAIALTGVAM  197

Query  791   SSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWL  612
             S+ N E P RETDAL RLLPLIGSSSIST+SLLGITGVLAP+LEETVFRGF MVSLTKWL
Sbjct  198   STFNGETPPRETDALARLLPLIGSSSISTVSLLGITGVLAPILEETVFRGFFMVSLTKWL  257

Query  611   PSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILL  432
             P+PLA +IS AVF+ AHLTPG+FPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILL
Sbjct  258   PTPLAAVISGAVFALAHLTPGQFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILL  317

Query  431   LTFLQLQGYDIKELIQAS  378
             LTFLQLQGYDIKE+IQA+
Sbjct  318   LTFLQLQGYDIKEIIQAT  335



>gb|ABO92979.1| putative CAAX amino terminal protease [Solanum tuberosum]
Length=337

 Score =   393 bits (1009),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 240/323 (74%), Positives = 264/323 (82%), Gaps = 10/323 (3%)
 Frame = -3

Query  1316  LSPKLFPYKPLTQKLQLLS-------FRRTDQALRP---RFSTTVCSYSSGNRPDPKGSG  1167
              SPKL+  KPL QK   +S        +  D A      R  TT+C  S  N PD KG G
Sbjct  15    FSPKLYSSKPLLQKSHRISIAPLTPFLKFQDSAASQASTRGFTTICFSSPRNGPDYKGGG  74

Query  1166  PNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILF  987
             P+ PI RRW VPWNWQT+SL+SLACG SFVLTGLIETA+I Y G+ VE LSLDEKAEILF
Sbjct  75    PDWPILRRWDVPWNWQTVSLSSLACGLSFVLTGLIETASITYVGLDVEALSLDEKAEILF  134

Query  986   LDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaL  807
              DQAITTA+VL VLYTLTKSS+PLP+DIY YD +EPFNLQRGWLLWA IGLAGA+ AIAL
Sbjct  135   ADQAITTAVVLIVLYTLTKSSQPLPDDIYRYDLKEPFNLQRGWLLWAGIGLAGAIGAIAL  194

Query  806   TGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVS  627
             TGVAMS+ N EPP RETDAL RLLPLIGSSSIST SLLGITGVLAP+LEETVFRGF MVS
Sbjct  195   TGVAMSAFNGEPPQRETDALARLLPLIGSSSISTASLLGITGVLAPILEETVFRGFFMVS  254

Query  626   LTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNS  447
             LTKW+P+PLA +IS AVF+ AHLTPG+FPQLFVLGTALGFSYAQTRNLLTPITIHA WNS
Sbjct  255   LTKWVPTPLAAVISGAVFALAHLTPGQFPQLFVLGTALGFSYAQTRNLLTPITIHALWNS  314

Query  446   GVILLLTFLQLQGYDIKELIQAS  378
             GVI LLTFLQLQGYDI+E+IQ +
Sbjct  315   GVIFLLTFLQLQGYDIREIIQGT  337



>gb|AAU90306.2| CAAX amino terminal protease family protein, putative [Solanum 
tuberosum]
Length=335

 Score =   390 bits (1002),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 238/321 (74%), Positives = 264/321 (82%), Gaps = 8/321 (2%)
 Frame = -3

Query  1316  LSPKLFPYKPLTQKLQ-------LLSFRRTDQA-LRPRFSTTVCSYSSGNRPDPKGSGPN  1161
              SPKL+  KPL +K          L F+ +  +    R  TT+C  S  N  D KG GP+
Sbjct  15    FSPKLYSSKPLLEKSHRIAPLTPFLKFQDSAHSQCSTRGFTTICFSSPRNGSDYKGGGPD  74

Query  1160  CPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLD  981
              PI RRW VPWNWQT+SL+SLACG SFVLTGLIETA+IPY G+ VE LSLDEKAEILF D
Sbjct  75    WPILRRWDVPWNWQTVSLSSLACGLSFVLTGLIETASIPYVGLDVEALSLDEKAEILFAD  134

Query  980   QAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTG  801
             Q ITTA+VL VLYTLTKSS+PLP+DIY YD +EPFNLQRGWLLWA IGLAGA+ AIALTG
Sbjct  135   QFITTAVVLIVLYTLTKSSQPLPDDIYRYDLKEPFNLQRGWLLWAGIGLAGAIGAIALTG  194

Query  800   VAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLT  621
             VAMS+ N EPP RETDAL RLLPLIGSSSIST SLLGITGVLAP+LEETVFRGF MVSLT
Sbjct  195   VAMSAFNGEPPQRETDALARLLPLIGSSSISTASLLGITGVLAPILEETVFRGFFMVSLT  254

Query  620   KWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGV  441
             KW+P+PLA +IS AVF+ AHLTPG+FPQLFVLGTALGFSYAQTRNLLTPITIHA WNSGV
Sbjct  255   KWVPTPLAAVISGAVFALAHLTPGQFPQLFVLGTALGFSYAQTRNLLTPITIHALWNSGV  314

Query  440   ILLLTFLQLQGYDIKELIQAS  378
             ILLLTFLQLQGYDI+E+IQ +
Sbjct  315   ILLLTFLQLQGYDIREIIQGT  335



>ref|XP_004238797.1| PREDICTED: uncharacterized protein LOC101265823 [Solanum lycopersicum]
Length=335

 Score =   385 bits (988),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 238/321 (74%), Positives = 262/321 (82%), Gaps = 8/321 (2%)
 Frame = -3

Query  1316  LSPKLF-PYKPLTQKLQLLS----FRRTDQA---LRPRFSTTVCSYSSGNRPDPKGSGPN  1161
              SPKL+   KPL QK   +S     +  D A      R  TT+C  S  N P  KG GP+
Sbjct  15    FSPKLYYSSKPLLQKSHRISIAPFLKFQDSAPSQGSTRGFTTICFSSPRNGPGYKGGGPD  74

Query  1160  CPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLD  981
              PI RRW VPWNWQT+SL+SLACG SFVLTGLIE A+IPY G+ VE LSLDEKAEILF D
Sbjct  75    WPILRRWDVPWNWQTVSLSSLACGLSFVLTGLIEAASIPYVGLDVEALSLDEKAEILFAD  134

Query  980   QAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTG  801
             QAITTA+VL VLY LTKSS+PLP+DIY YD +EPFNLQRGWLLWA IGL GA+ AIALTG
Sbjct  135   QAITTAVVLIVLYALTKSSQPLPDDIYRYDLKEPFNLQRGWLLWAGIGLGGAIGAIALTG  194

Query  800   VAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLT  621
             VAMS+ N EPP RETDAL RLLPLIGSSSIST SLLGITGVLAP+LEETVFRGF MVSLT
Sbjct  195   VAMSAFNGEPPQRETDALARLLPLIGSSSISTASLLGITGVLAPILEETVFRGFFMVSLT  254

Query  620   KWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGV  441
             KW+P+PLA +IS AVF+ AHLTPG+FPQLFVLGTALGFSYAQTRNLLTPITIHA WNSGV
Sbjct  255   KWVPTPLAAVISGAVFALAHLTPGQFPQLFVLGTALGFSYAQTRNLLTPITIHALWNSGV  314

Query  440   ILLLTFLQLQGYDIKELIQAS  378
             ILLLTFLQLQGYDI+E+IQ +
Sbjct  315   ILLLTFLQLQGYDIREIIQGT  335



>ref|XP_011075500.1| PREDICTED: uncharacterized protein LOC105159963 [Sesamum indicum]
Length=339

 Score =   384 bits (987),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 240/339 (71%), Positives = 265/339 (78%), Gaps = 12/339 (4%)
 Frame = -3

Query  1367  AALFYVSLARPSAPIASLSPKLFPYKPLTQKLQL---LSFRRTDQALRPRFSTT-----V  1212
             A   Y S  R S     LSPKL  Y P+    QL   L F     AL+ R ++T     V
Sbjct  2     AVTLYTSFTRSSISTVRLSPKL--YSPVRTHFQLSPGLRFSPLTHALKLRITSTRGFCTV  59

Query  1211  CSYSSG--NRPDPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYT  1038
             C Y +        K SG N  I +RW VPWNWQTISLTSLACG SFVLTGLIE  A+ Y+
Sbjct  60    CCYKNNTPQESSKKDSGLNWRILKRWDVPWNWQTISLTSLACGLSFVLTGLIEAVALQYS  119

Query  1037  GIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgw  858
             G+ +EELSLD+KAEIL  DQ I T +VL VLY+LTKS  PLP+DIY YDWREPFNL++GW
Sbjct  120   GLNIEELSLDQKAEILLADQGIATIVVLAVLYSLTKSFSPLPDDIYRYDWREPFNLEKGW  179

Query  857   llwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGV  678
             LLWA IGL GALAAIA+TGVAMS LN EPP RETDALVRLLPLIGSSSIST SLLGITG+
Sbjct  180   LLWAGIGLGGALAAIAVTGVAMSFLNGEPPQRETDALVRLLPLIGSSSISTASLLGITGI  239

Query  677   LAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYA  498
             LAP+LEETVFRGF MVSLTKWLP+PL+VL+SAAVF+AAHLTPGEFPQLFVLGTALGFSYA
Sbjct  240   LAPILEETVFRGFFMVSLTKWLPTPLSVLVSAAVFAAAHLTPGEFPQLFVLGTALGFSYA  299

Query  497   QTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQA  381
             QTRNLLTPI IHA WNSGVI+LLTFLQLQGYDIKEL+QA
Sbjct  300   QTRNLLTPIMIHASWNSGVIVLLTFLQLQGYDIKELLQA  338



>ref|XP_010683196.1| PREDICTED: uncharacterized protein LOC104897927 [Beta vulgaris 
subsp. vulgaris]
Length=361

 Score =   369 bits (947),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 220/293 (75%), Positives = 248/293 (85%), Gaps = 1/293 (0%)
 Frame = -3

Query  1253  RTDQALRPRFSTTVCSYS-SGNRPDPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFV  1077
             R+      R  +  CSY+ S N P PKG GP+ PI +RW VPW WQTISLTSLACG SFV
Sbjct  68    RSKLGSSTRLLSVACSYNKSSNNPQPKGGGPDWPILKRWDVPWPWQTISLTSLACGISFV  127

Query  1076  LTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYC  897
             LTGLI T A+PY G    +L+LDEKAEILFLDQ+ITTA+VLGVL++LTKS +PLP+D Y 
Sbjct  128   LTGLIVTQALPYLGFNFGDLTLDEKAEILFLDQSITTAVVLGVLFSLTKSFEPLPDDFYR  187

Query  896   YDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligss  717
             YD REPFNLQ+GWLLWA IGLAGAL AIALTGVA+S  + E P RETDALVRLLPLIGSS
Sbjct  188   YDLREPFNLQKGWLLWAGIGLAGALGAIALTGVALSFFSGENPQRETDALVRLLPLIGSS  247

Query  716   sistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQ  537
              IST+SLL +TGVLAP+LEETVFRGF MVS+TKW+P+P+AV ISAAVF+ AHLTPG+FPQ
Sbjct  248   DISTISLLAVTGVLAPILEETVFRGFFMVSMTKWVPTPVAVAISAAVFALAHLTPGQFPQ  307

Query  536   LFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             LFVLGTALGFSYAQTRNL+T ITIHAFWNSGVIL LTFLQLQGYDIKEL+QAS
Sbjct  308   LFVLGTALGFSYAQTRNLMTSITIHAFWNSGVILFLTFLQLQGYDIKELLQAS  360



>ref|XP_006438679.1| hypothetical protein CICLE_v10032082mg [Citrus clementina]
 gb|ESR51919.1| hypothetical protein CICLE_v10032082mg [Citrus clementina]
Length=330

 Score =   366 bits (939),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 223/325 (69%), Positives = 261/325 (80%), Gaps = 10/325 (3%)
 Frame = -3

Query  1325  IASLSPKLFPYKPLTQKLQLL---SFRRTDQALRPRFSTTVCSYSSGNRPD-----PKGS  1170
             IA+L+   F     +QKL  L   S  R  +    RFS+ +C Y++G   +      K +
Sbjct  6     IAALAQPCFYSFSTSQKLSKLKPNSNTRVTKTCYRRFSS-ICFYNAGKDSESGSTEDKET  64

Query  1169  GPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEIL  990
               + P+ +RW VPW WQT SLTSLACGFSFVLTGL+E AA+PY G+++EELSLDEKAEIL
Sbjct  65    KLDWPVLKRWDVPWGWQTASLTSLACGFSFVLTGLVEAAALPYLGLKIEELSLDEKAEIL  124

Query  989   FLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaia  810
             FLDQ ITTA++LGVLY ++ + KPLP D++CYD REPFNL++GWLLWA IGL GAL A+A
Sbjct  125   FLDQGITTAVILGVLYGISSTFKPLPEDLFCYDLREPFNLKKGWLLWAGIGLGGALLAVA  184

Query  809   LTGVAMSSLNSE-PPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLM  633
              TG A+S  N E PP RETDALVRLLPLIGSSSIST  L+GITGVLAP+LEE VFRGF M
Sbjct  185   ATGAALSLFNGENPPERETDALVRLLPLIGSSSISTACLVGITGVLAPLLEENVFRGFFM  244

Query  632   VSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFW  453
             VSLTKW+P+P+AV+ISAAVF+ AHLTPGEFPQLFVLG ALGFSYAQTRNLLTPITIHAFW
Sbjct  245   VSLTKWVPTPIAVIISAAVFALAHLTPGEFPQLFVLGIALGFSYAQTRNLLTPITIHAFW  304

Query  452   NSGVILLLTFLQLQGYDIKELIQAS  378
             NSGVILLLTFLQLQGYD+KEL+QAS
Sbjct  305   NSGVILLLTFLQLQGYDLKELLQAS  329



>ref|XP_006483160.1| PREDICTED: uncharacterized protein LOC102618349 [Citrus sinensis]
Length=364

 Score =   365 bits (938),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 223/325 (69%), Positives = 261/325 (80%), Gaps = 10/325 (3%)
 Frame = -3

Query  1325  IASLSPKLFPYKPLTQKLQLL---SFRRTDQALRPRFSTTVCSYSSGNRPD-----PKGS  1170
             IA+L+   F     +QKL  L   S  R  +    RFS+ +C Y++G   +      K +
Sbjct  40    IAALAQPCFYSFSTSQKLSKLKPNSNTRVTKTCYRRFSS-ICFYNAGKDSESGSTEDKET  98

Query  1169  GPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEIL  990
               + P+ +RW VPW WQT SLTSLACGFSFVLTGL+E AA+PY G+++EELSLDEKAEIL
Sbjct  99    KLDWPVLKRWDVPWGWQTASLTSLACGFSFVLTGLVEAAALPYLGLKIEELSLDEKAEIL  158

Query  989   FLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaia  810
             FLDQ ITTA++LGVLY ++ + KPLP D++CYD REPFNL++GWLLWA IGL GAL A+A
Sbjct  159   FLDQGITTAVILGVLYGISSTFKPLPEDLFCYDLREPFNLKKGWLLWAGIGLGGALLAVA  218

Query  809   LTGVAMSSLNSE-PPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLM  633
              TG A+S  N E PP RETDALVRLLPLIGSSSIST  L+GITGVLAP+LEE VFRGF M
Sbjct  219   ATGAALSLFNGENPPERETDALVRLLPLIGSSSISTACLVGITGVLAPLLEENVFRGFFM  278

Query  632   VSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFW  453
             VSLTKW+P+P+AV+ISAAVF+ AHLTPGEFPQLFVLG ALGFSYAQTRNLLTPITIHAFW
Sbjct  279   VSLTKWVPTPIAVIISAAVFALAHLTPGEFPQLFVLGIALGFSYAQTRNLLTPITIHAFW  338

Query  452   NSGVILLLTFLQLQGYDIKELIQAS  378
             NSGVILLLTFLQLQGYD+KEL+QAS
Sbjct  339   NSGVILLLTFLQLQGYDLKELLQAS  363



>emb|CDP00329.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   364 bits (934),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 221/310 (71%), Positives = 251/310 (81%), Gaps = 3/310 (1%)
 Frame = -3

Query  1301  FPYKPLTQKLQLLSFR--RTDQALRPRFSTTVCSYSSGNRPDPKGSGPNCPIFRRWSVPW  1128
             +  + L Q    LSFR   T   +       +C YS G   + KG G + PI RRW VPW
Sbjct  45    YTLRQLNQLPSSLSFRAPSTSSPVHRSRRRCICFYS-GKESEQKGDGLDWPILRRWDVPW  103

Query  1127  NWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGV  948
              WQT+SLTSLACG SFVLTGLIETAAIPY G+Q+ ELSLDEKAEILFLDQAITTA VL V
Sbjct  104   KWQTVSLTSLACGLSFVLTGLIETAAIPYLGVQIRELSLDEKAEILFLDQAITTAAVLAV  163

Query  947   LYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPP  768
             LY +T S  PLP D++ YD REPFNLQ+GW++WA IGLAGAL AIALTGVA+S  + E P
Sbjct  164   LYGITSSFGPLPEDVFRYDIREPFNLQKGWIVWAGIGLAGALVAIALTGVAVSFFSGETP  223

Query  767   TRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLI  588
              RETDALVRLLPLIGSSSIST  L+GITG+LAP+LEETVFRGF MV+LTKWLP+PL++++
Sbjct  224   QRETDALVRLLPLIGSSSISTACLVGITGILAPLLEETVFRGFFMVALTKWLPTPLSIVV  283

Query  587   SAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQG  408
             SAAVF+ AHLTPGEFPQLFVLG ALG SYAQTRNLLTPITIHA WNSGVILLLTFL+LQG
Sbjct  284   SAAVFAIAHLTPGEFPQLFVLGIALGLSYAQTRNLLTPITIHALWNSGVILLLTFLELQG  343

Query  407   YDIKELIQAS  378
             YDI+E+IQAS
Sbjct  344   YDIREMIQAS  353



>ref|XP_010044739.1| PREDICTED: uncharacterized protein LOC104433628 isoform X1 [Eucalyptus 
grandis]
 gb|KCW86841.1| hypothetical protein EUGRSUZ_B03438 [Eucalyptus grandis]
Length=341

 Score =   359 bits (921),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 225/343 (66%), Positives = 267/343 (78%), Gaps = 15/343 (4%)
 Frame = -3

Query  1370  AAALFYVSLARPSAPIASLSPKLFPYKPLTQKLQLLSF---------RRTDQALRPRFST  1218
             A+ +   SLA+    + S SP+L    PL++   LL+          RR+  + R R S 
Sbjct  2     ASMVILSSLAQSPLRLFSTSPEL---PPLSRARSLLAGSRLFVSPRRRRSGPSDRWRLSP  58

Query  1217  TVCSYSS---GNRPDPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAI  1047
                  +    G     +GSGP+ PI +RW VPW WQT+SLTSLACG SFVLTGL+ETAAI
Sbjct  59    VRAQDARDEPGGSFREEGSGPDWPILKRWDVPWQWQTVSLTSLACGVSFVLTGLVETAAI  118

Query  1046  PYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQ  867
             PY G+++EELSLDEKAEILF+DQ+ITTA VLGVLY +T++ +P+P D++ YD +EPFNLQ
Sbjct  119   PYLGLRLEELSLDEKAEILFVDQSITTAAVLGVLYGITRTFQPVPEDLFRYDLKEPFNLQ  178

Query  866   RgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgi  687
             RGWLLWA IGL GAL A+A+TG AMS  + E P RETDALVRLLPLIGSS +ST  LLGI
Sbjct  179   RGWLLWAGIGLIGALLAVAVTGYAMSLFSGETPQRETDALVRLLPLIGSSGVSTACLLGI  238

Query  686   tGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGF  507
             TG+LAP LEET+FRGF MVSLTKW+P+P+AVLISAAVF+ AHLTPGEFPQLFVLGTALG 
Sbjct  239   TGILAPFLEETIFRGFFMVSLTKWVPTPVAVLISAAVFALAHLTPGEFPQLFVLGTALGL  298

Query  506   SYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             SYAQTRNL+TPITIH+ WNSGVILLLTFLQLQGYDIKEL+QAS
Sbjct  299   SYAQTRNLITPITIHSLWNSGVILLLTFLQLQGYDIKELLQAS  341



>ref|XP_002522426.1| prenyl-dependent CAAX protease, putative [Ricinus communis]
 gb|EEF39918.1| prenyl-dependent CAAX protease, putative [Ricinus communis]
Length=341

 Score =   357 bits (916),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 212/290 (73%), Positives = 246/290 (85%), Gaps = 7/290 (2%)
 Frame = -3

Query  1229  RFSTTVCSYSSGNRPDPKGS------GPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTG  1068
             RFS+ VC ++SG +    G+      G + PI +RW VPW WQT SLTSLACG SFVLTG
Sbjct  53    RFSS-VCFFNSGEKNKNNGNFDGEEGGLDWPILKRWDVPWQWQTASLTSLACGLSFVLTG  111

Query  1067  LIETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDW  888
             L ETAAIP  GI++EELSLDEKAE+L LDQ+ITTA++LGV+Y++  + +PLP D++ YD 
Sbjct  112   LAETAAIPLLGIKIEELSLDEKAELLLLDQSITTAVILGVIYSIANTFQPLPEDMFRYDL  171

Query  887   REPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssis  708
             +EPF+LQ+GWLLWA IGL  AL AIALTGVAMS+ N EPP RETDALVRLLPLIGSSSIS
Sbjct  172   KEPFDLQKGWLLWAVIGLVAALLAIALTGVAMSTFNGEPPQRETDALVRLLPLIGSSSIS  231

Query  707   tlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFV  528
             T  L+ ITGVLAP+LEETVFRGF MVSLTKW+P+P+AVLISAAVF+ AHLTPGEFPQLFV
Sbjct  232   TACLVVITGVLAPILEETVFRGFFMVSLTKWVPTPIAVLISAAVFAIAHLTPGEFPQLFV  291

Query  527   LGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             LGTALGFSYAQTRNLLT ITIHA WNSGVIL+LTFLQLQGYDIKE++QA+
Sbjct  292   LGTALGFSYAQTRNLLTSITIHACWNSGVILILTFLQLQGYDIKEILQAT  341



>ref|XP_008446340.1| PREDICTED: uncharacterized protein LOC103489109 isoform X1 [Cucumis 
melo]
Length=350

 Score =   357 bits (915),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 221/324 (68%), Positives = 257/324 (79%), Gaps = 12/324 (4%)
 Frame = -3

Query  1328  PIASLSPK--LFPYKPLTQKLQ-LLSFRRTDQALRPRFSTTVCSYS----SGNRPDPKGS  1170
             PI   +PK  LF Y+ L+ +L  L S   +    RP     +C ++    SG     K +
Sbjct  32    PIGKRTPKILLFGYRNLSLRLSPLRSNSLSQSGFRP-----LCFFNAKDESGGDFQQKEN  86

Query  1169  GPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEIL  990
             G   PI RRW VPW WQT+SLTSLACG SF++TGL+E+AAIPY GI++EELSLDEKAEIL
Sbjct  87    GAGWPILRRWDVPWGWQTVSLTSLACGLSFIVTGLVESAAIPYLGIRIEELSLDEKAEIL  146

Query  989   FLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaia  810
             FLDQ ITT  VLG+LY++  + +PLP+ +Y YD R+P NLQRGWLLWA +GLAGALA+IA
Sbjct  147   FLDQGITTVTVLGILYSIANTFQPLPDGLYRYDIRDPLNLQRGWLLWAGVGLAGALASIA  206

Query  809   LTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMV  630
             +TG  +SS N     RETDALVRLLPLIGSSSIST  L+GITGVLAPVLEETVFRGFLMV
Sbjct  207   VTGAVLSSFNGGSTERETDALVRLLPLIGSSSISTACLVGITGVLAPVLEETVFRGFLMV  266

Query  629   SLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWN  450
             SLTKW+P+P+AVLI+AAVF+ AHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHA WN
Sbjct  267   SLTKWIPTPVAVLITAAVFALAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHALWN  326

Query  449   SGVILLLTFLQLQGYDIKELIQAS  378
             SGVILLLTFL LQGYDIKEL+Q +
Sbjct  327   SGVILLLTFLSLQGYDIKELLQTT  350



>ref|XP_004135178.1| PREDICTED: uncharacterized protein LOC101219539 [Cucumis sativus]
 ref|XP_004155311.1| PREDICTED: uncharacterized protein LOC101229734 [Cucumis sativus]
 gb|KGN51910.1| hypothetical protein Csa_5G605040 [Cucumis sativus]
Length=350

 Score =   356 bits (913),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 222/324 (69%), Positives = 256/324 (79%), Gaps = 12/324 (4%)
 Frame = -3

Query  1328  PIASLSPK--LFPYKPLTQKLQ-LLSFRRTDQALRPRFSTTVCSYS----SGNRPDPKGS  1170
             PI   +PK  LF Y+ L+ +L  L S   +    RP     +C ++    SG     K +
Sbjct  32    PIGKRTPKILLFGYRNLSLRLSPLRSNSLSQSGFRP-----LCFFNAKDESGGDFQQKEN  86

Query  1169  GPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEIL  990
             G   PI RRW VPW W T+SLTSLACG SF++TGL+E+AAIPY GI++EELSLDEKAEIL
Sbjct  87    GAGWPILRRWDVPWEWPTVSLTSLACGLSFIVTGLVESAAIPYLGIRIEELSLDEKAEIL  146

Query  989   FLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaia  810
             FLDQ ITT  VLG+LY++  + +PLP+D+Y YD R+P NLQRGWLLWAA+GL GALA+IA
Sbjct  147   FLDQGITTVTVLGILYSIANTFQPLPDDLYRYDIRDPLNLQRGWLLWAAVGLVGALASIA  206

Query  809   LTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMV  630
             +TG  +SS N     RETDALVRLLPLIGSSSIST  L+GITGVLAPVLEETVFRGFLMV
Sbjct  207   VTGAVLSSFNGGSTQRETDALVRLLPLIGSSSISTACLVGITGVLAPVLEETVFRGFLMV  266

Query  629   SLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWN  450
             SLTKW P+P+AVLISAAVF+ AHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHA WN
Sbjct  267   SLTKWTPTPVAVLISAAVFALAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHALWN  326

Query  449   SGVILLLTFLQLQGYDIKELIQAS  378
             SGVILLLTFL LQGYDIKEL+Q +
Sbjct  327   SGVILLLTFLSLQGYDIKELLQTT  350



>ref|XP_002311592.1| CAAX amino terminal protease family protein [Populus trichocarpa]
 gb|EEE88959.1| CAAX amino terminal protease family protein [Populus trichocarpa]
Length=339

 Score =   353 bits (905),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 213/301 (71%), Positives = 245/301 (81%), Gaps = 4/301 (1%)
 Frame = -3

Query  1268  LLSFRRTDQALRPRFSTTVCSYSSGNRPDPK----GSGPNCPIFRRWSVPWNWQTISLTS  1101
             LLS R+    LRP+      S  +G     K      G   PI +RW VPW WQTISLTS
Sbjct  39    LLSCRQKVVLLRPKRRQLASSIYAGKESKAKVEEQDKGLEWPIIKRWDVPWPWQTISLTS  98

Query  1100  LACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSK  921
             LACG SF+LTGL+E  AIPY GI++EELSLDEKAEIL LDQ+I TA+VLGVLY +  + +
Sbjct  99    LACGISFILTGLVEATAIPYLGIKIEELSLDEKAEILLLDQSIATAVVLGVLYGILNTFQ  158

Query  920   PLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVR  741
             PLP D++ YD +EPFNL++GWLLWA IGLA AL A+ALTGVA+S+ + E P RETDALVR
Sbjct  159   PLPEDVFRYDLKEPFNLEKGWLLWAGIGLASALLAVALTGVAVSTFSGETPQRETDALVR  218

Query  740   llpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAH  561
             LLPLIGSSSIST  L+GITGVLAPVLEE VFRGF MVSLTKW+P+P++VLISAAVF+ AH
Sbjct  219   LLPLIGSSSISTACLIGITGVLAPVLEENVFRGFFMVSLTKWVPTPVSVLISAAVFALAH  278

Query  560   LTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQA  381
             LTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGV+L+LT LQLQGYDIKEL+QA
Sbjct  279   LTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVVLILTLLQLQGYDIKELLQA  338

Query  380   S  378
             +
Sbjct  339   T  339



>ref|XP_011025753.1| PREDICTED: uncharacterized protein LOC105126551 [Populus euphratica]
 ref|XP_011025762.1| PREDICTED: uncharacterized protein LOC105126551 [Populus euphratica]
 ref|XP_011025769.1| PREDICTED: uncharacterized protein LOC105126551 [Populus euphratica]
Length=339

 Score =   352 bits (903),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 213/301 (71%), Positives = 245/301 (81%), Gaps = 4/301 (1%)
 Frame = -3

Query  1268  LLSFRRTDQALRPRFSTTVCSYSSGNRPDPK----GSGPNCPIFRRWSVPWNWQTISLTS  1101
             LLS R+    LRP+      S  +G     K      G   PI +RW VPW WQTISLTS
Sbjct  39    LLSCRQKVVLLRPKRRQLASSIYAGKESKAKVEAHDKGLEWPIIKRWDVPWPWQTISLTS  98

Query  1100  LACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSK  921
             LACG SF+LTGL+E  AIPY GI++EELSLDEKAEIL LDQ+I TA+VLGVLY +  + +
Sbjct  99    LACGISFILTGLVEATAIPYLGIKIEELSLDEKAEILLLDQSIATAVVLGVLYGILNTFQ  158

Query  920   PLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVR  741
             PLP D++ YD +EPFNL++GWLLWA IGLA AL A+ALTGVA+S+ + E P RETDALVR
Sbjct  159   PLPEDVFRYDLKEPFNLEKGWLLWAGIGLASALLAVALTGVAVSTFSGETPPRETDALVR  218

Query  740   llpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAH  561
             LLPLIGSSSIST  L+GITGVLAPVLEE VFRGF MVSLTKW+P+P++VLISAAVF+ AH
Sbjct  219   LLPLIGSSSISTACLIGITGVLAPVLEENVFRGFFMVSLTKWVPTPVSVLISAAVFALAH  278

Query  560   LTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQA  381
             LTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGV+L+LT LQLQGYDIKEL+QA
Sbjct  279   LTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVVLILTLLQLQGYDIKELLQA  338

Query  380   S  378
             +
Sbjct  339   T  339



>ref|XP_006586026.1| PREDICTED: uncharacterized protein LOC100808678 isoform X2 [Glycine 
max]
Length=337

 Score =   347 bits (891),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 202/280 (72%), Positives = 239/280 (85%), Gaps = 2/280 (1%)
 Frame = -3

Query  1217  TVCSYSSGNRPDPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYT  1038
             +VC +++G++ D K SG   PI RRW VPW WQT+SLTSLACG  FVLTGL E  A+PY 
Sbjct  60    SVCFFNTGDKSDSKESG--WPILRRWEVPWQWQTVSLTSLACGLGFVLTGLTEAIALPYL  117

Query  1037  GIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgw  858
             GI+ + LSLD+KAEIL  DQ+ITTA+VLG++Y++  + +PLP D + YD REPFNLQ+GW
Sbjct  118   GIKPDVLSLDDKAEILLFDQSITTAVVLGIIYSVANTFQPLPEDFFKYDLREPFNLQKGW  177

Query  857   llwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGV  678
             LLWA IGLAGA+ AI+LTGVA+S  N E P RETDALVRLLPLIGSS++ST  L+GITGV
Sbjct  178   LLWAGIGLAGAILAISLTGVAVSFFNGETPQRETDALVRLLPLIGSSNLSTACLVGITGV  237

Query  677   LAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYA  498
             LAP+LEETVFRGF M SLTKW+P+P+AV+ISAAVF+ AHLTPGEFPQLFVLGTALGFSYA
Sbjct  238   LAPLLEETVFRGFFMTSLTKWVPTPVAVVISAAVFALAHLTPGEFPQLFVLGTALGFSYA  297

Query  497   QTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             QT NLLTPITIH+FWNSGVIL LTFLQLQGYDI+EL+QA+
Sbjct  298   QTHNLLTPITIHSFWNSGVILFLTFLQLQGYDIRELLQAT  337



>gb|KHN17369.1| hypothetical protein glysoja_034780 [Glycine soja]
Length=339

 Score =   347 bits (891),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 206/295 (70%), Positives = 245/295 (83%), Gaps = 2/295 (1%)
 Frame = -3

Query  1262  SFRRTDQALRPRFSTTVCSYSSGNRPDPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFS  1083
             S +R       R   +VC +++ ++ D K SG   PI RRW VPW WQT+SLTSLACGF 
Sbjct  47    SLQRHLSLGSKRVLPSVCFFNTEDKSDSKESG--WPILRRWEVPWEWQTVSLTSLACGFG  104

Query  1082  FVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDI  903
             FVLTGL E  A+PY GI+ + LSLD+KAEIL LDQ+ITTA+VLG++Y++  + +PLP D 
Sbjct  105   FVLTGLTEAIALPYLGIKPDVLSLDDKAEILLLDQSITTAVVLGIIYSVANTFQPLPEDF  164

Query  902   YCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllplig  723
             + YD REPFNLQ+GWLLWA IGLAGA+ AI+LTGVA+S  N E P RETDALVRLLPLIG
Sbjct  165   FKYDLREPFNLQKGWLLWAGIGLAGAILAISLTGVAVSFFNGETPQRETDALVRLLPLIG  224

Query  722   sssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEF  543
             SS++ST  L+GITGVLAP+LEETVFRGF M SLTKW+P+P+AV+ISAA+F+ AHLTPGEF
Sbjct  225   SSNLSTACLVGITGVLAPLLEETVFRGFFMTSLTKWVPTPVAVVISAALFALAHLTPGEF  284

Query  542   PQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             PQLFVLGTALGFSYAQT NLLTPITIH+FWNSGVILLLTFLQLQGYDI+EL+QA+
Sbjct  285   PQLFVLGTALGFSYAQTHNLLTPITIHSFWNSGVILLLTFLQLQGYDIRELLQAT  339



>ref|XP_002270372.1| PREDICTED: uncharacterized protein LOC100251779 [Vitis vinifera]
 emb|CBI31964.3| unnamed protein product [Vitis vinifera]
Length=330

 Score =   347 bits (890),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 209/284 (74%), Positives = 239/284 (84%), Gaps = 2/284 (1%)
 Frame = -3

Query  1229  RFSTTVCSYSSGNRPDPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAA  1050
             R  +++C  SS  + D   + P   + RRW VPW WQT+SLTS ACG SFVLTGL+E AA
Sbjct  48    RRHSSICFDSS--KEDSGANFPGKEVLRRWDVPWEWQTVSLTSFACGLSFVLTGLVEAAA  105

Query  1049  IPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNL  870
             +PY G+Q+ ELSLDEKAEILF+DQ ITTA+VLGV+Y +T + +PLP+D   YD REPF+L
Sbjct  106   VPYLGLQIGELSLDEKAEILFVDQGITTAVVLGVIYGITNTFQPLPDDFLRYDLREPFSL  165

Query  869   QRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllg  690
             Q+GWLLWA IGL GA+ AIALTG AMS  + E P RETDALVRLLPLIGSSSIST  L+G
Sbjct  166   QKGWLLWAGIGLFGAIIAIALTGAAMSLFSGETPERETDALVRLLPLIGSSSISTACLVG  225

Query  689   itGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALG  510
             ITGVLAP+LEETVFRGF MVSLTKW+P+P++VLISAAVF+ AHLTP EFPQLFVLGTALG
Sbjct  226   ITGVLAPLLEETVFRGFFMVSLTKWVPTPVSVLISAAVFALAHLTPSEFPQLFVLGTALG  285

Query  509   FSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             FSYAQTRNLLTPITIHA WNSGVILLLTFLQLQGYDIKEL+QAS
Sbjct  286   FSYAQTRNLLTPITIHATWNSGVILLLTFLQLQGYDIKELLQAS  329



>ref|XP_009794997.1| PREDICTED: uncharacterized protein LOC104241753 isoform X2 [Nicotiana 
sylvestris]
Length=304

 Score =   345 bits (886),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 205/318 (64%), Positives = 232/318 (73%), Gaps = 38/318 (12%)
 Frame = -3

Query  1310  PKLFPYKPLTQKLQLLSF----RRTDQA---LRPRFSTTVCSYSSGNRPDPKGSGPNCPI  1152
             PKL+  K + QK   +S     +  D A      R  TT+C     N PD KGSGP+ PI
Sbjct  18    PKLYSSKSILQKSNRISLTPFLKFQDSAPTQSSTRGFTTICFSRPRNGPDYKGSGPDWPI  77

Query  1151  FRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAI  972
              RRW+VPWNWQT+SL+SLACG SFVLTGLIETA+IPY G+ V+ELSLDEKAEILF DQAI
Sbjct  78    LRRWNVPWNWQTVSLSSLACGLSFVLTGLIETASIPYVGLDVDELSLDEKAEILFADQAI  137

Query  971   TTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAM  792
             TTA+VL VLYTLTKSS+PLP+DIY YD +EPFNLQRGWLLWA IGL GA+ AIALTGVAM
Sbjct  138   TTAVVLIVLYTLTKSSQPLPDDIYRYDLKEPFNLQRGWLLWAGIGLVGAIGAIALTGVAM  197

Query  791   SSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWL  612
             S+ N E P RETDAL R                     L P++  +  R          L
Sbjct  198   STFNGETPPRETDALAR---------------------LLPLIGSSSIR----------L  226

Query  611   PSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILL  432
             P+PLA +IS AVF+ AHLTPG+FPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILL
Sbjct  227   PTPLAAVISGAVFALAHLTPGQFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILL  286

Query  431   LTFLQLQGYDIKELIQAS  378
             LTFLQLQGYDIKE+IQA+
Sbjct  287   LTFLQLQGYDIKEIIQAT  304



>ref|XP_008389475.1| PREDICTED: uncharacterized protein LOC103451824 [Malus domestica]
Length=359

 Score =   347 bits (889),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 221/353 (63%), Positives = 255/353 (72%), Gaps = 16/353 (5%)
 Frame = -3

Query  1388  TILQMAAAALFYVSLARPSAPIASLSPKLFPYKPLTQKLQLLSFRRTDQALRPRFSTT--  1215
             TI + A     + S+A+ S    S SPK    K     L L   R       PR ST   
Sbjct  7     TISKPAMVCTLFTSVAQSSFSCFSDSPKPTSSKTQIPSLFLDGRRSFTAGFSPRRSTQLS  66

Query  1214  ----------VCSYSSGNRP----DPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFV  1077
                       +C +S G +P      K +     I +RW VPW WQT SLTSLACG SFV
Sbjct  67    RLRNVRNPPYICFFSGGGKPKGDFQEKENESQWLILKRWDVPWEWQTASLTSLACGLSFV  126

Query  1076  LTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYC  897
             LTGL+E AAIPY GI++++LSLDEKAEILFLDQ ITTA VL VLYT+  + +PLP D+Y 
Sbjct  127   LTGLVEAAAIPYLGIRIQDLSLDEKAEILFLDQGITTAAVLAVLYTVANTYQPLPEDVYR  186

Query  896   YDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligss  717
             YD +EPFNLQ+GWLLWA IG  GA+AAIA+TG A+S L  E P RE DALV LLPLIGSS
Sbjct  187   YDLKEPFNLQKGWLLWAGIGFVGAIAAIAVTGAALSMLRGESPEREKDALVSLLPLIGSS  246

Query  716   sistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQ  537
              IST  LLGITGVLAP+LEETVFRGF MVS+TKW+P+P+A++ISAAVF+ AHLTPGEFPQ
Sbjct  247   GISTACLLGITGVLAPILEETVFRGFFMVSMTKWVPTPVAIVISAAVFALAHLTPGEFPQ  306

Query  536   LFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             LFVLGTALG SYAQTRNL+TPITIHA WNSGVILLLTFLQLQGYDIKEL+Q +
Sbjct  307   LFVLGTALGLSYAQTRNLVTPITIHALWNSGVILLLTFLQLQGYDIKELLQTT  359



>ref|XP_006602296.1| PREDICTED: uncharacterized protein LOC100816434 [Glycine max]
Length=339

 Score =   346 bits (887),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 204/295 (69%), Positives = 244/295 (83%), Gaps = 2/295 (1%)
 Frame = -3

Query  1262  SFRRTDQALRPRFSTTVCSYSSGNRPDPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFS  1083
             S +R       R   +VC +++ ++ D K SG   PI RRW VPW WQT+SLTSLACGF 
Sbjct  47    SLQRHLSLGSKRVLPSVCFFNTEDKSDSKESG--WPILRRWEVPWEWQTVSLTSLACGFG  104

Query  1082  FVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDI  903
             FVL GL E  A+PY GI+ + LSLD+KAEIL LDQ+ITTA+VLG++Y++  + +PLP D 
Sbjct  105   FVLAGLTEAIALPYLGIKPDVLSLDDKAEILLLDQSITTAVVLGIIYSVANTFQPLPEDF  164

Query  902   YCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllplig  723
             + YD REPFNLQ+GWLLWA +GLAGA+ AI+LTGVA+S  N E P RETDALVRLLPLIG
Sbjct  165   FKYDLREPFNLQKGWLLWAGVGLAGAILAISLTGVAVSFFNGETPQRETDALVRLLPLIG  224

Query  722   sssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEF  543
             SS++ST  L+GITGVLAP+LEETVFRGF M SLTKW+P+P+AV+ISAA+F+ AHLTPGEF
Sbjct  225   SSNLSTACLVGITGVLAPLLEETVFRGFFMTSLTKWVPTPVAVVISAALFALAHLTPGEF  284

Query  542   PQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             PQLFVLGTALGFSYAQT NLLTPITIH+FWNSGVILLLTFLQLQGYDI+EL+QA+
Sbjct  285   PQLFVLGTALGFSYAQTHNLLTPITIHSFWNSGVILLLTFLQLQGYDIRELLQAT  339



>ref|XP_009360341.1| PREDICTED: uncharacterized protein LOC103950826 [Pyrus x bretschneideri]
Length=359

 Score =   345 bits (884),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 209/300 (70%), Positives = 239/300 (80%), Gaps = 7/300 (2%)
 Frame = -3

Query  1256  RRTDQALRPRFSTT---VCSYSSGNRP----DPKGSGPNCPIFRRWSVPWNWQTISLTSL  1098
             RR+ Q  R R       +C +S G RP      K +     I +RW VPW WQT SLTSL
Sbjct  60    RRSTQLSRLRNVRNPPYICFFSGGGRPKGDFQEKENESQWRILKRWDVPWEWQTASLTSL  119

Query  1097  ACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKP  918
             ACG SFVLTGL+E AAIPY GI++++LSLDEKAEILFLDQ ITTA VL VLYT+  + +P
Sbjct  120   ACGLSFVLTGLVEAAAIPYLGIRIQDLSLDEKAEILFLDQGITTAAVLAVLYTVANTYQP  179

Query  917   LPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRl  738
             LP D+Y YD +EPFNLQ+GWLLWA IG  GA+AAIA+TG A+S L  E P RE DALV L
Sbjct  180   LPEDVYRYDLKEPFNLQKGWLLWAGIGFVGAIAAIAVTGAALSLLRGESPEREKDALVSL  239

Query  737   lpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHL  558
             LPLIGSS IST  LLGITGVLAP+LEETVFRGF MVS+TKW+P+P+A++ISAAVF+ AHL
Sbjct  240   LPLIGSSGISTACLLGITGVLAPILEETVFRGFFMVSMTKWVPTPVAIVISAAVFALAHL  299

Query  557   TPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             TPGEFPQLFVLGTALG SYAQTRNL+TPITIHA WNSGVILLLTFLQLQGYDIKEL+Q +
Sbjct  300   TPGEFPQLFVLGTALGLSYAQTRNLVTPITIHALWNSGVILLLTFLQLQGYDIKELLQTT  359



>ref|XP_007224691.1| hypothetical protein PRUPE_ppa025479mg [Prunus persica]
 gb|EMJ25890.1| hypothetical protein PRUPE_ppa025479mg [Prunus persica]
Length=347

 Score =   342 bits (877),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 214/343 (62%), Positives = 255/343 (74%), Gaps = 16/343 (5%)
 Frame = -3

Query  1358  FYVSLARPSAPIASLSPKLFPYKPLTQKLQLLSFRRTDQALRPRFSTT------------  1215
              + SLA+ S    S SPKL   K  +  L L + +  +    PR ST             
Sbjct  5     LFTSLAQSSFSSFSDSPKLSSSKYQSHGLFLNAHKSFNAKFSPRQSTQLTRLRNVRRSPY  64

Query  1214  VCSYSSGNRP----DPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAI  1047
             +C ++ G +P      K +G    I +RW VPW WQT+SLTS ACG SFVLTGL+ETAAI
Sbjct  65    ICFFNGGGKPKGDLQEKETGEQWQILKRWEVPWEWQTVSLTSFACGLSFVLTGLVETAAI  124

Query  1046  PYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQ  867
             PY G+ +++LS+DEKAEILFLDQ+ITTA VL VLYT+  + +PLP D+Y YD ++PF+LQ
Sbjct  125   PYLGLNIQDLSIDEKAEILFLDQSITTAAVLAVLYTVASTFQPLPQDVYRYDLKDPFSLQ  184

Query  866   RgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgi  687
             +GWLLWA IGLAGA+ AIA+TG   S    E P RE DALV LLPLIGSSS+ST  LLGI
Sbjct  185   KGWLLWAGIGLAGAIVAIAVTGAVASLFRGESPEREKDALVSLLPLIGSSSVSTACLLGI  244

Query  686   tGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGF  507
             TGVLAP+LEETVFRGF MVS+TKW+P+P+A+ ISAAVF+ AHLTPGEFPQLFVLG+ALG 
Sbjct  245   TGVLAPILEETVFRGFFMVSMTKWVPTPVAIGISAAVFALAHLTPGEFPQLFVLGSALGL  304

Query  506   SYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             SYAQTRNLLTPITIHA WNSGVILLLTFLQLQGYDIKEL+Q +
Sbjct  305   SYAQTRNLLTPITIHALWNSGVILLLTFLQLQGYDIKELLQTT  347



>ref|XP_008339907.1| PREDICTED: uncharacterized protein LOC103402902 [Malus domestica]
Length=347

 Score =   342 bits (876),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 215/343 (63%), Positives = 249/343 (73%), Gaps = 16/343 (5%)
 Frame = -3

Query  1358  FYVSLARPSAPIASLSPKLFPYKPLTQKLQLLSFRRTDQALRPRFST------------T  1215
              + S+A+ S    S SPKL   +     L L   R       PR  T             
Sbjct  5     LFTSVAQSSFSNFSDSPKLTSSRTQIPSLLLDGGRSFTAGFSPRRPTQLSRLKNVRNTPC  64

Query  1214  VCSYSSGNRP----DPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAI  1047
             +C +S G +P      K +     I +RW VPW WQT SLTSLACG SFVLTGL+E AAI
Sbjct  65    ICFFSGGGKPKGDFQEKENESEWRILKRWDVPWEWQTASLTSLACGLSFVLTGLVEAAAI  124

Query  1046  PYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQ  867
             PY GI++ ELSLDEKAEILFLDQ ITTA VL VLY +  + +PLP D+Y YD +EPF+LQ
Sbjct  125   PYLGIRIPELSLDEKAEILFLDQGITTAAVLAVLYAVASTYQPLPEDVYRYDLKEPFBLQ  184

Query  866   RgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgi  687
             +GWLLWA IG+ GA+AAI +TG A+S L  E P RE DALV LLPLIGSS IST  LLGI
Sbjct  185   KGWLLWAGIGIVGAIAAITVTGAALSLLRGESPEREKDALVSLLPLIGSSGISTACLLGI  244

Query  686   tGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGF  507
             TGVLAP+LEETVFRGF MVS+TKW+P+P+A++ISAAVF+ AHLTPGEFPQLFVLGTALG 
Sbjct  245   TGVLAPILEETVFRGFFMVSMTKWVPTPVAIVISAAVFALAHLTPGEFPQLFVLGTALGL  304

Query  506   SYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             SYAQTRNL+TPITIHA WNSGVILLLTFLQLQGYDIKEL+Q +
Sbjct  305   SYAQTRNLVTPITIHALWNSGVILLLTFLQLQGYDIKELLQTT  347



>ref|XP_004516087.1| PREDICTED: uncharacterized protein LOC101490706 [Cicer arietinum]
Length=335

 Score =   341 bits (874),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 203/301 (67%), Positives = 240/301 (80%), Gaps = 10/301 (3%)
 Frame = -3

Query  1286  LTQKLQLLSFRRTDQALRPRFSTTVCSYSSGNRPDPKGSGPNCPIFRRWSVPWNWQTISL  1107
             L+Q  + LS +R          ++VC +++G++   K SG   PI RRW VPW WQT+SL
Sbjct  43    LSQHYRFLSSKRG--------LSSVCFFNAGDKS--KDSGLEWPILRRWEVPWEWQTVSL  92

Query  1106  TSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKS  927
             T  ACG  FVLTGL+E  ++PY GIQ + LSLDEKAE+LFLDQ ITTA VLG++Y +  +
Sbjct  93    TFFACGLGFVLTGLVEATSLPYLGIQPDALSLDEKAELLFLDQGITTAAVLGIIYGVVNT  152

Query  926   SKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDAL  747
              +PLP D + YD REPFNLQ+GWLLWA IGL GA+ AI LTGV +S  N E P RETDAL
Sbjct  153   FQPLPEDFFKYDLREPFNLQKGWLLWAGIGLVGAIVAIGLTGVVVSFFNEETPQRETDAL  212

Query  746   VRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSA  567
             VRLLPLIGSS++ST  L+GITGVLAP+LEETVFRGF M SLTKW+P+P+A++ISAAVF+ 
Sbjct  213   VRLLPLIGSSNVSTACLVGITGVLAPLLEETVFRGFFMTSLTKWVPTPVAIIISAAVFAL  272

Query  566   AHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELI  387
             AHLTPGEFPQLFVLG+ALG SYAQT NLLTPITIHAFWNSGVILLLTFLQLQGYDIKEL+
Sbjct  273   AHLTPGEFPQLFVLGSALGISYAQTHNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELL  332

Query  386   Q  384
             Q
Sbjct  333   Q  333



>gb|KHN06857.1| hypothetical protein glysoja_033098 [Glycine soja]
Length=347

 Score =   341 bits (874),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 202/288 (70%), Positives = 239/288 (83%), Gaps = 8/288 (3%)
 Frame = -3

Query  1217  TVCSYSSGNRPDPKG-SGP-------NCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLI  1062
             +VC +++G++ D K  S P         PI RRW VPW WQT+SLTSLACG  FVLTGL 
Sbjct  60    SVCFFNTGDKSDSKAISQPFLYYLESGWPILRRWEVPWQWQTVSLTSLACGLGFVLTGLT  119

Query  1061  ETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWRE  882
             E  A+PY GI+ + LSLD+KAEIL  DQ+ITTA+VLG++Y++  + +PLP D + YD RE
Sbjct  120   EAIALPYLGIKPDVLSLDDKAEILLFDQSITTAVVLGIIYSVANTFQPLPEDFFKYDLRE  179

Query  881   PFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistl  702
             PFNLQ+GWLLWA IGLAGA+ AI+LTGVA+S  N E P RETDALVRLLPLIGSS++ST 
Sbjct  180   PFNLQKGWLLWAGIGLAGAILAISLTGVAVSFFNGETPQRETDALVRLLPLIGSSNLSTA  239

Query  701   sllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLG  522
              L+GITGVLAP+LEETVFRGF M SLTKW+P+P+AV+ISAAVF+ AHLTPGEFPQLFVLG
Sbjct  240   CLVGITGVLAPLLEETVFRGFFMTSLTKWVPTPVAVVISAAVFALAHLTPGEFPQLFVLG  299

Query  521   TALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             TALGFSYAQT NLLTPITIH+FWNSGVIL LTFLQLQGYDI+EL+QA+
Sbjct  300   TALGFSYAQTHNLLTPITIHSFWNSGVILFLTFLQLQGYDIRELLQAT  347



>gb|KDP41192.1| hypothetical protein JCGZ_15599 [Jatropha curcas]
Length=344

 Score =   341 bits (874),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 222/340 (65%), Positives = 267/340 (79%), Gaps = 11/340 (3%)
 Frame = -3

Query  1376  MAAAALFYVSLARPSAPIASLSPKLFPYKPLTQKLQLLS---FRRTDQALRPRFSTTVCS  1206
             +A ++L+ VS    SA ++SL   +   +PL  +  L S   F R+   +  R   +VC 
Sbjct  9     LAQSSLYCVS---DSAKLSSLGLFVKQNRPLLNRPNLSSNFGFSRS-FPVHYRELRSVCF  64

Query  1205  YSSGNRP----DPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYT  1038
             +S+  +     D + +G + PI +RW VPW WQT SLTSLACG SFVLTGL ETAAIP  
Sbjct  65    FSAKEKSNGNFDGQENGLDWPILKRWDVPWQWQTASLTSLACGLSFVLTGLAETAAIPLL  124

Query  1037  GIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgw  858
             GI++EELSLDEKAE+L LDQ+ITTA+VLGVLY +T + +PLP D++ YD REPF+LQRGW
Sbjct  125   GIKIEELSLDEKAELLLLDQSITTAVVLGVLYGITNTFQPLPEDMFRYDLREPFDLQRGW  184

Query  857   llwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGV  678
              LWA IGL GAL A+ALTGVAMS+ N EPP RETDALVRLLPLIGSSS ST  L+ ITGV
Sbjct  185   FLWAVIGLVGALLAVALTGVAMSAFNGEPPQRETDALVRLLPLIGSSSTSTACLVVITGV  244

Query  677   LAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYA  498
             LAP+LEET+FRGF MVS+TKW+P+P+A+LISAAVF+ AHLTPGEFPQLFVLG ALGFSYA
Sbjct  245   LAPILEETLFRGFFMVSITKWVPTPIAILISAAVFAIAHLTPGEFPQLFVLGVALGFSYA  304

Query  497   QTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             QTRNLLT ITIHAFWNSGVIL+LT LQLQGYDIKE++QA+
Sbjct  305   QTRNLLTSITIHAFWNSGVILILTLLQLQGYDIKEILQAT  344



>ref|XP_007133453.1| hypothetical protein PHAVU_011G179800g [Phaseolus vulgaris]
 gb|ESW05447.1| hypothetical protein PHAVU_011G179800g [Phaseolus vulgaris]
Length=337

 Score =   339 bits (869),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 199/284 (70%), Positives = 236/284 (83%), Gaps = 4/284 (1%)
 Frame = -3

Query  1229  RFSTTVCSYSSGNRPDPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAA  1050
             R  ++VC +++G+    K SG   PI RRW VPW WQT+SLTSLACG  FVLTGL E  A
Sbjct  58    RALSSVCFFNAGD----KDSGLEWPILRRWEVPWEWQTVSLTSLACGLGFVLTGLTEAIA  113

Query  1049  IPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNL  870
             +PY GI+ + LSLD+KAEIL LDQ +TTA+VLG+++++  + +PLP D + YD REPFNL
Sbjct  114   LPYLGIKPDVLSLDDKAEILLLDQGVTTAVVLGIIFSVANTFQPLPEDFFKYDLREPFNL  173

Query  869   QRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllg  690
             Q+GWLLWA +GL GA+ AIALTGVA+S  + E P RETDALVRLLPLIGSS++ST  L+G
Sbjct  174   QKGWLLWAGVGLVGAIIAIALTGVAVSFFSGETPQRETDALVRLLPLIGSSNLSTACLVG  233

Query  689   itGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALG  510
             ITGVLAP+LEETVFRGF M SLTKW+P+P+AV+ISA VFS AHLTPGEFPQLFVLG ALG
Sbjct  234   ITGVLAPLLEETVFRGFFMTSLTKWVPTPVAVIISATVFSLAHLTPGEFPQLFVLGAALG  293

Query  509   FSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             FSYAQT NLLTPITIHAFWNSGVIL LTFLQLQGYDI+EL+QA+
Sbjct  294   FSYAQTHNLLTPITIHAFWNSGVILFLTFLQLQGYDIRELLQAT  337



>ref|XP_006417032.1| hypothetical protein EUTSA_v10008130mg [Eutrema salsugineum]
 gb|ESQ35385.1| hypothetical protein EUTSA_v10008130mg [Eutrema salsugineum]
Length=338

 Score =   338 bits (866),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 201/313 (64%), Positives = 248/313 (79%), Gaps = 3/313 (1%)
 Frame = -3

Query  1310  PKLFPYKPLTQKLQLLSFRRTDQALRPRFSTTVCSYSSGNRP--DPKGSGPNCPIFRRWS  1137
             PK +    L+Q     + RR     R ++ +  C ++SG  P  D KG      I +RW 
Sbjct  27    PKTYNRFGLSQFSPGFASRRLSNVNRRKWRSA-CIFNSGKEPGGDEKGGSSEWAILQRWE  85

Query  1136  VPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIV  957
             VPW WQT+SLTSLACG SFVLTGL E  AIP+ GI VE+LSLDEKAEILFLDQ ITTA+V
Sbjct  86    VPWEWQTVSLTSLACGLSFVLTGLTEMLAIPFLGIDVEKLSLDEKAEILFLDQGITTAVV  145

Query  956   LGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNS  777
             L V++T+ K+ +PLP DI  YD ++PFNLQ+GWL+W  IGLAGA+ AIALTGVA+S   +
Sbjct  146   LAVIFTVAKTFEPLPEDILRYDLKQPFNLQKGWLVWGGIGLAGAVGAIALTGVALSLFKT  205

Query  776   EPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLA  597
             E P RE D+L++LLPLIGSS+IST+SL+GITG+LAP+LEETVFRGF MVSLTKW+P+P+A
Sbjct  206   ETPQREVDSLMKLLPLIGSSNISTISLVGITGILAPLLEETVFRGFFMVSLTKWVPTPIA  265

Query  596   VLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQ  417
             ++IS+A F+ AHLTPGEFPQLF+LG+ LG SYAQTRNL+TP+ IH FWNSGVILLLTFLQ
Sbjct  266   IIISSAAFALAHLTPGEFPQLFILGSVLGLSYAQTRNLITPMVIHGFWNSGVILLLTFLQ  325

Query  416   LQGYDIKELIQAS  378
             +QGYDIKEL+QA+
Sbjct  326   IQGYDIKELLQAN  338



>ref|XP_007158659.1| hypothetical protein PHAVU_002G171700g [Phaseolus vulgaris]
 gb|ESW30653.1| hypothetical protein PHAVU_002G171700g [Phaseolus vulgaris]
Length=336

 Score =   337 bits (865),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 199/284 (70%), Positives = 237/284 (83%), Gaps = 4/284 (1%)
 Frame = -3

Query  1229  RFSTTVCSYSSGNRPDPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAA  1050
             R  ++VC +++G+    K S    PI RRW VPW WQT+SLTSLACG  FVLTGL E  A
Sbjct  57    RALSSVCFFNAGD----KESELEWPILRRWEVPWEWQTVSLTSLACGLGFVLTGLTEAIA  112

Query  1049  IPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNL  870
             +PY GI+ + LSLD+KAEIL LDQ +TTA+VLG++Y++  + +PLP D + YD REPFNL
Sbjct  113   LPYLGIKPDVLSLDDKAEILLLDQGMTTAVVLGIIYSVANTFQPLPEDFFKYDTREPFNL  172

Query  869   QRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllg  690
             Q+GWLLWA +GL GA+ AIALTGVA+S  + E P RETDALVRLLPLIGSS++ST  L+G
Sbjct  173   QKGWLLWAGVGLVGAIIAIALTGVAVSFFSGETPQRETDALVRLLPLIGSSNLSTACLVG  232

Query  689   itGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALG  510
             ITGVLAP+LEETVFRGF M SLTKW+P+P+AV+ISA+VF+ AHLTPGEFPQLFVLGTALG
Sbjct  233   ITGVLAPLLEETVFRGFFMTSLTKWVPTPVAVVISASVFALAHLTPGEFPQLFVLGTALG  292

Query  509   FSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             FSYAQT NLLTPITIHAFWNSGVIL LTFLQLQGYDI+EL+QA+
Sbjct  293   FSYAQTHNLLTPITIHAFWNSGVILFLTFLQLQGYDIRELLQAT  336



>ref|XP_006827217.1| hypothetical protein AMTR_s00010p00259870 [Amborella trichopoda]
 gb|ERM94454.1| hypothetical protein AMTR_s00010p00259870 [Amborella trichopoda]
Length=358

 Score =   338 bits (866),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 200/280 (71%), Positives = 229/280 (82%), Gaps = 4/280 (1%)
 Frame = -3

Query  1205  YSSGNRP---DP-KGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYT  1038
             YSS   P   DP K SG   PI RRW VPW WQT+ LT  AC  SFVLTGL+ETA +PY 
Sbjct  79    YSSKGSPGMNDPEKDSGVGWPILRRWDVPWKWQTVFLTMFACAISFVLTGLVETAVVPYL  138

Query  1037  GIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgw  858
             G ++E+LSLD+KAE+LF+DQ I TA++LGV+Y  T   KPLP+DI+CY  ++PFNLQ GW
Sbjct  139   GFKLEDLSLDDKAELLFVDQFIVTAVILGVVYGFTGIFKPLPDDIFCYKLKDPFNLQNGW  198

Query  857   llwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGV  678
             LLWA +GL GA  AI LTG   + LN E P RETDALVRLLPLIGSSSIST  L+GITGV
Sbjct  199   LLWAGVGLVGATLAITLTGAIQALLNGENPQRETDALVRLLPLIGSSSISTACLVGITGV  258

Query  677   LAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYA  498
             LAPVLEETVFRGFLMVSLTKW+P+P+AVL+SAAVF+ AHLTPGEFPQLF+LG ALG +YA
Sbjct  259   LAPVLEETVFRGFLMVSLTKWVPTPVAVLLSAAVFAIAHLTPGEFPQLFILGAALGLAYA  318

Query  497   QTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             QT NLLTPITIHAFWNSGVI+LLTFLQ+QGYDI+ELIQ S
Sbjct  319   QTHNLLTPITIHAFWNSGVIVLLTFLQVQGYDIRELIQGS  358



>ref|XP_008221625.1| PREDICTED: uncharacterized protein LOC103321584 [Prunus mume]
Length=347

 Score =   337 bits (863),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 219/343 (64%), Positives = 258/343 (75%), Gaps = 16/343 (5%)
 Frame = -3

Query  1358  FYVSLARPSAPIASLSPKLFPYKPLTQKLQLLSFRRTDQALRPRFSTT------------  1215
              + SLA+ S    S SPKL   K  +  L + + +  D    PR ST             
Sbjct  5     LFTSLAQSSFSSFSDSPKLSSSKYQSHGLFVNAHKSFDAKFSPRQSTQLTRLRNVRRSPY  64

Query  1214  VCSYSSGNRP----DPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAI  1047
             +C ++ G +P      K  G    I +RW VPW WQT+SLTSLACG SFVLTGLIETAAI
Sbjct  65    ICFFNGGGKPKGDLQEKEIGEQWQILKRWEVPWEWQTVSLTSLACGLSFVLTGLIETAAI  124

Query  1046  PYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQ  867
             PY G++V++LS+DEKAEILFLDQ ITTA VL VLYT+ ++ +PLP D+Y YD ++PF+LQ
Sbjct  125   PYLGLRVQDLSIDEKAEILFLDQIITTAAVLAVLYTVARTFQPLPQDVYRYDLKDPFSLQ  184

Query  866   RgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgi  687
             +GWLLWA IGLAGA+AAIA+TG A S    E P RE DALV LLPLIGSSS+ST  LLGI
Sbjct  185   KGWLLWAGIGLAGAIAAIAVTGAAASLFRGESPEREKDALVSLLPLIGSSSVSTACLLGI  244

Query  686   tGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGF  507
             TGVLAP+LEETVFRGF MVS+TKW+P+P+A+ ISAAVF+ AHLTPGEFPQLFVLG+ALG 
Sbjct  245   TGVLAPILEETVFRGFFMVSMTKWVPTPVAIGISAAVFALAHLTPGEFPQLFVLGSALGL  304

Query  506   SYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             SYAQTRNLLTPITIHA WNSGVILLLTFLQLQGYDIKEL+Q +
Sbjct  305   SYAQTRNLLTPITIHALWNSGVILLLTFLQLQGYDIKELLQTT  347



>ref|XP_010523459.1| PREDICTED: uncharacterized protein LOC104801795 isoform X2 [Tarenaya 
hassleriana]
Length=337

 Score =   336 bits (861),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 198/282 (70%), Positives = 232/282 (82%), Gaps = 3/282 (1%)
 Frame = -3

Query  1217  TVCSYSSGNRPDPKG---SGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAI  1047
             +VC +++G     +G   S    PI +RW VPW WQT+SLTSLACG SFVLTG+ E A +
Sbjct  55    SVCFFNAGKESGGEGKEASSSEWPILQRWEVPWEWQTVSLTSLACGLSFVLTGVTEMAVL  114

Query  1046  PYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQ  867
             PY GI++EELSLDEKAEILFLDQ ITTA VLGV++T+ K+  PLP DI+ YD R+PF+LQ
Sbjct  115   PYLGIKIEELSLDEKAEILFLDQGITTAAVLGVIFTVAKTFDPLPEDIFRYDLRQPFDLQ  174

Query  866   RgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgi  687
             +GWLLW  IGL GA+ +IAL G  +S    E P RE D+LV+LLPLIGSS+ISTLSL+GI
Sbjct  175   KGWLLWGGIGLVGAVGSIALVGTVLSLFRGEMPEREVDSLVKLLPLIGSSNISTLSLVGI  234

Query  686   tGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGF  507
             TG+LAPVLEETVFRGF MVSLTKW+P+P+AV ISAA F+ AHLTPG+FPQLFVLGT LGF
Sbjct  235   TGILAPVLEETVFRGFFMVSLTKWVPTPIAVTISAAAFALAHLTPGQFPQLFVLGTVLGF  294

Query  506   SYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQA  381
             SYAQTRNL+TPI IH FWNSGVILLLTFLQLQGYDIKEL+QA
Sbjct  295   SYAQTRNLVTPIMIHGFWNSGVILLLTFLQLQGYDIKELLQA  336



>ref|XP_007046110.1| CAAX amino terminal protease family protein isoform 2 [Theobroma 
cacao]
 gb|EOY01942.1| CAAX amino terminal protease family protein isoform 2 [Theobroma 
cacao]
Length=340

 Score =   335 bits (860),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 206/283 (73%), Positives = 240/283 (85%), Gaps = 5/283 (2%)
 Frame = -3

Query  1211  CSYSSGNRPDP-----KGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAI  1047
             C +++G  PD      + +    PI +RW VPW WQT+SLTSLACG SF+LTGLIETAAI
Sbjct  57    CFFNAGEDPDSNFQEREETNLEWPILKRWEVPWEWQTVSLTSLACGLSFILTGLIETAAI  116

Query  1046  PYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQ  867
             PY G+++EELSLDEKAEILF+DQ+ITT +VLGVLY +  + +PLP D++ YD +EPFNLQ
Sbjct  117   PYLGLKIEELSLDEKAEILFVDQSITTLVVLGVLYGVANTFQPLPEDLFRYDLKEPFNLQ  176

Query  866   RgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgi  687
             +GW+LWA IGL GA+ AIALTG AMS    E P RETDALVRLLPLIGSSSIST  L+GI
Sbjct  177   KGWVLWAVIGLVGAIIAIALTGAAMSLFRGEDPQRETDALVRLLPLIGSSSISTACLVGI  236

Query  686   tGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGF  507
             TGVLAP+LEETVFRGF M SLTKW+P+P++V+ISAAVF+ AHLTPGEFPQLFVLGTALGF
Sbjct  237   TGVLAPILEETVFRGFFMTSLTKWVPTPVSVIISAAVFALAHLTPGEFPQLFVLGTALGF  296

Query  506   SYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             SYAQTRNL+TPITIHAFWNSGVILLLT LQLQGYDIKEL+QA+
Sbjct  297   SYAQTRNLVTPITIHAFWNSGVILLLTLLQLQGYDIKELLQAT  339



>ref|XP_010523458.1| PREDICTED: uncharacterized protein LOC104801795 isoform X1 [Tarenaya 
hassleriana]
Length=339

 Score =   335 bits (859),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 198/284 (70%), Positives = 232/284 (82%), Gaps = 5/284 (2%)
 Frame = -3

Query  1217  TVCSYSSGNRPDPKG-----SGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETA  1053
             +VC +++G     +G     S    PI +RW VPW WQT+SLTSLACG SFVLTG+ E A
Sbjct  55    SVCFFNAGKESGGEGKLQEASSSEWPILQRWEVPWEWQTVSLTSLACGLSFVLTGVTEMA  114

Query  1052  AIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFN  873
              +PY GI++EELSLDEKAEILFLDQ ITTA VLGV++T+ K+  PLP DI+ YD R+PF+
Sbjct  115   VLPYLGIKIEELSLDEKAEILFLDQGITTAAVLGVIFTVAKTFDPLPEDIFRYDLRQPFD  174

Query  872   LQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsll  693
             LQ+GWLLW  IGL GA+ +IAL G  +S    E P RE D+LV+LLPLIGSS+ISTLSL+
Sbjct  175   LQKGWLLWGGIGLVGAVGSIALVGTVLSLFRGEMPEREVDSLVKLLPLIGSSNISTLSLV  234

Query  692   gitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTAL  513
             GITG+LAPVLEETVFRGF MVSLTKW+P+P+AV ISAA F+ AHLTPG+FPQLFVLGT L
Sbjct  235   GITGILAPVLEETVFRGFFMVSLTKWVPTPIAVTISAAAFALAHLTPGQFPQLFVLGTVL  294

Query  512   GFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQA  381
             GFSYAQTRNL+TPI IH FWNSGVILLLTFLQLQGYDIKEL+QA
Sbjct  295   GFSYAQTRNLVTPIMIHGFWNSGVILLLTFLQLQGYDIKELLQA  338



>ref|XP_007046109.1| CAAX amino terminal protease family protein isoform 1 [Theobroma 
cacao]
 gb|EOY01941.1| CAAX amino terminal protease family protein isoform 1 [Theobroma 
cacao]
Length=342

 Score =   335 bits (859),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 206/285 (72%), Positives = 240/285 (84%), Gaps = 7/285 (2%)
 Frame = -3

Query  1211  CSYSSGNRPDP-------KGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETA  1053
             C +++G  PD        + +    PI +RW VPW WQT+SLTSLACG SF+LTGLIETA
Sbjct  57    CFFNAGEDPDSNFQERSQEETNLEWPILKRWEVPWEWQTVSLTSLACGLSFILTGLIETA  116

Query  1052  AIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFN  873
             AIPY G+++EELSLDEKAEILF+DQ+ITT +VLGVLY +  + +PLP D++ YD +EPFN
Sbjct  117   AIPYLGLKIEELSLDEKAEILFVDQSITTLVVLGVLYGVANTFQPLPEDLFRYDLKEPFN  176

Query  872   LQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsll  693
             LQ+GW+LWA IGL GA+ AIALTG AMS    E P RETDALVRLLPLIGSSSIST  L+
Sbjct  177   LQKGWVLWAVIGLVGAIIAIALTGAAMSLFRGEDPQRETDALVRLLPLIGSSSISTACLV  236

Query  692   gitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTAL  513
             GITGVLAP+LEETVFRGF M SLTKW+P+P++V+ISAAVF+ AHLTPGEFPQLFVLGTAL
Sbjct  237   GITGVLAPILEETVFRGFFMTSLTKWVPTPVSVIISAAVFALAHLTPGEFPQLFVLGTAL  296

Query  512   GFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             GFSYAQTRNL+TPITIHAFWNSGVILLLT LQLQGYDIKEL+QA+
Sbjct  297   GFSYAQTRNLVTPITIHAFWNSGVILLLTLLQLQGYDIKELLQAT  341



>ref|XP_010937144.1| PREDICTED: uncharacterized protein LOC105056591 isoform X1 [Elaeis 
guineensis]
Length=345

 Score =   334 bits (857),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 196/282 (70%), Positives = 235/282 (83%), Gaps = 4/282 (1%)
 Frame = -3

Query  1211  CSYSSGNRPDP----KGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIP  1044
             C Y++ ++ +P    K      PI +RW VPW WQT +LT +ACG SFVLTGL+E + +P
Sbjct  64    CFYNAKDKLEPTSREKALKVEWPILQRWDVPWGWQTATLTMIACGVSFVLTGLVEASVLP  123

Query  1043  YTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQR  864
             Y G Q  E+SL+EKAEILF  Q   TA+VLGV+Y +T S +PLP+DI+CYDW++PF+LQ 
Sbjct  124   YLGFQGGEVSLEEKAEILFAGQFAVTAVVLGVIYGITNSFRPLPDDIFCYDWKDPFSLQN  183

Query  863   gwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgit  684
             GWLLWA IGL GAL AIAL GVA+++ + E P RETDAL+RLLPLIGSSSIST  L+G+T
Sbjct  184   GWLLWAGIGLVGALIAIALAGVALTTFSGENPQRETDALIRLLPLIGSSSISTACLVGVT  243

Query  683   GVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFS  504
             GVLAP+LEETVFRGFLMVSLTKW+P+P++VLISAAVF+ AHLTPGEFPQLF+LG ALGFS
Sbjct  244   GVLAPILEETVFRGFLMVSLTKWVPTPVSVLISAAVFAIAHLTPGEFPQLFLLGAALGFS  303

Query  503   YAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             YAQTRNLLTPITIH+ WNSGVILLLTFLQLQGYDI+EL+QAS
Sbjct  304   YAQTRNLLTPITIHSIWNSGVILLLTFLQLQGYDIRELLQAS  345



>ref|XP_010257309.1| PREDICTED: uncharacterized protein LOC104597460 [Nelumbo nucifera]
Length=359

 Score =   334 bits (857),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 194/288 (67%), Positives = 237/288 (82%), Gaps = 4/288 (1%)
 Frame = -3

Query  1229  RFSTTVCSYSSGNRPDPK----GSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLI  1062
             R   ++C Y++    + K     +G +  I +RW VPW WQT+ LT  ACG SF+LTGL+
Sbjct  72    RGHHSICFYNAKEESEGKFQGKETGLDWRILKRWDVPWKWQTVILTMTACGLSFILTGLV  131

Query  1061  ETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWRE  882
             E A  PY G ++ E++LDEKAE+LF+DQA+ TA+VLGV+Y LT + +PLP+D++ Y+ +E
Sbjct  132   EAALTPYLGFRIGEMNLDEKAEVLFVDQAVATAVVLGVVYGLTNTFQPLPDDLFRYESKE  191

Query  881   PFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistl  702
             PFNLQ+GWLLWA +GL GA  A+ALTG AM+  + E P RETDALVRLLPLIGSS+IST 
Sbjct  192   PFNLQKGWLLWAGVGLVGAFTAVALTGAAMALFSGENPQRETDALVRLLPLIGSSNISTA  251

Query  701   sllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLG  522
              L+GITGVLAP+LEETVFRGFLM SLTKW P+P+++LISAAVF+ AHLTPGEFPQLFVLG
Sbjct  252   CLVGITGVLAPLLEETVFRGFLMASLTKWFPTPVSILISAAVFALAHLTPGEFPQLFVLG  311

Query  521   TALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             TALGFSYAQTRNLLTPITIHAFWNSGVIL+LTFLQLQGYDI+EL+QAS
Sbjct  312   TALGFSYAQTRNLLTPITIHAFWNSGVILVLTFLQLQGYDIRELLQAS  359



>gb|EPS61964.1| hypothetical protein M569_12828, partial [Genlisea aurea]
Length=259

 Score =   329 bits (843),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 195/259 (75%), Positives = 217/259 (84%), Gaps = 0/259 (0%)
 Frame = -3

Query  1154  IFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQA  975
             + +RW+VPWNWQTISLTS+ACG SFVLTGLIE  A+ Y+G+ VE LSLDEKA ILFLDQ 
Sbjct  1     VLKRWAVPWNWQTISLTSIACGLSFVLTGLIEAGALEYSGLNVETLSLDEKAGILFLDQL  60

Query  974   ITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVA  795
             I T  VL VL++LTKS  PLP DIY YDWR P +L+RGWLLWAAIGL G LA++ALT   
Sbjct  61    IATTAVLAVLFSLTKSLSPLPYDIYRYDWRGPLDLKRGWLLWAAIGLGGGLASVALTATV  120

Query  794   MSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTKW  615
              S L  EPP RE DALVRLLPLIGSS IST  L+GI GVLAP+LEETVFRGFLMVSLTKW
Sbjct  121   TSLLQGEPPHREVDALVRLLPLIGSSKISTACLVGIAGVLAPLLEETVFRGFLMVSLTKW  180

Query  614   LPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVIL  435
              P+P++V+ISAA+FSAAHLTP EFPQLF LG ALGFSYAQTRNLLTPI IHA WNSGVIL
Sbjct  181   FPTPVSVVISAAIFSAAHLTPSEFPQLFALGAALGFSYAQTRNLLTPIAIHAVWNSGVIL  240

Query  434   LLTFLQLQGYDIKELIQAS  378
             LL FLQLQGYDI+E+IQ S
Sbjct  241   LLAFLQLQGYDIREVIQGS  259



>gb|KEH19737.1| CAAX amino terminal protease family protein [Medicago truncatula]
 gb|KEH19738.1| CAAX amino terminal protease family protein [Medicago truncatula]
Length=338

 Score =   331 bits (849),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 200/287 (70%), Positives = 232/287 (81%), Gaps = 5/287 (2%)
 Frame = -3

Query  1229  RFSTTVCSYSS-GNRPDPK----GSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGL  1065
             R   +VC ++S  N+ D K     S    PI RRW VPW WQT+SLTSLACG  FVLTGL
Sbjct  51    RILPSVCFFNSRDNKSDTKLQDQDSRSEWPILRRWEVPWEWQTVSLTSLACGLGFVLTGL  110

Query  1064  IETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWR  885
              E  A+PY GI+ + LSLDEKAE+LF+DQ ITTA VLG++Y++  + +PLP   + YD R
Sbjct  111   AEATALPYLGIRPDMLSLDEKAELLFIDQGITTAAVLGIIYSVFNTYQPLPEGFFKYDLR  170

Query  884   EPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssist  705
             EPFNLQ+GWLLWA +GL GAL +I LTGVA+S  N E P RETDALVRLLPLIGSSSIST
Sbjct  171   EPFNLQKGWLLWAGVGLVGALVSIGLTGVAVSFFNGETPERETDALVRLLPLIGSSSIST  230

Query  704   lsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVL  525
               L+GITGV AP+LEETVFRGF M SLTKW+P+P+A+++SAAVF+ AHLTPGEFPQLFVL
Sbjct  231   ACLVGITGVFAPLLEETVFRGFFMTSLTKWVPTPVAIILSAAVFALAHLTPGEFPQLFVL  290

Query  524   GTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQ  384
             G+ALG SYAQTRNLLTPITIHAFWNSGVILLLT LQLQGYDIKEL+Q
Sbjct  291   GSALGISYAQTRNLLTPITIHAFWNSGVILLLTVLQLQGYDIKELLQ  337



>ref|XP_008784102.1| PREDICTED: uncharacterized protein LOC103703133 [Phoenix dactylifera]
Length=345

 Score =   330 bits (847),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 196/282 (70%), Positives = 234/282 (83%), Gaps = 4/282 (1%)
 Frame = -3

Query  1211  CSYSSGNRPDP----KGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIP  1044
             C Y++  + +P    K    + PI +RW VPW WQT +LT +ACG SFVLTGL+E + +P
Sbjct  64    CFYNAKEKLEPTSPEKALKVDWPILQRWDVPWGWQTATLTMIACGVSFVLTGLVEASVLP  123

Query  1043  YTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQR  864
             Y G Q  E+SL+EKAEILF  Q   TA+VLGV+Y +T S +PLP+DI+CYDW+ PF+LQ 
Sbjct  124   YLGFQGGEVSLEEKAEILFAGQFAVTAVVLGVIYGITNSFRPLPDDIFCYDWKNPFSLQN  183

Query  863   gwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgit  684
             GWLLWA IGLA AL AIAL GVA+++ + E P RETDAL+RLLPLIGSSSIST  L+G+T
Sbjct  184   GWLLWAGIGLASALIAIALAGVALTTFSGENPQRETDALIRLLPLIGSSSISTACLVGVT  243

Query  683   GVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFS  504
             GVLAP+LEETVFRGFLMVSLTKW+P+P++VLISAAVF+ AHLTPGEFPQLF+LG ALGFS
Sbjct  244   GVLAPILEETVFRGFLMVSLTKWVPTPVSVLISAAVFAIAHLTPGEFPQLFLLGAALGFS  303

Query  503   YAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             YAQTRNLLTPITIH+ WNSGVILLLTFLQLQGYDI+EL+QAS
Sbjct  304   YAQTRNLLTPITIHSIWNSGVILLLTFLQLQGYDIRELLQAS  345



>gb|EYU28746.1| hypothetical protein MIMGU_mgv1a008810mg [Erythranthe guttata]
Length=361

 Score =   330 bits (847),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 208/307 (68%), Positives = 242/307 (79%), Gaps = 10/307 (3%)
 Frame = -3

Query  1298  PYKPLTQKLQLLSFRRTDQALRPRFSTTVCSYSSGNRPD-PKGSGPNCPIFRRWSVPWNW  1122
             P  P   K+++ S RR         ST  C  +S       K  G +  + +RW VPWNW
Sbjct  63    PLIPANSKIRVASTRRP--------STIYCFKNSAPEESLQKDKGFSLQVLKRWDVPWNW  114

Query  1121  QTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLY  942
             QTISLTSLACGFSFVLTGLIE AAI Y+GI ++ELSLD  AEILFL Q I TA+VL VL 
Sbjct  115   QTISLTSLACGFSFVLTGLIEAAAIQYSGINIQELSLDGTAEILFLTQGIATAVVLTVLL  174

Query  941   TLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTR  762
             +LTKS  PLP+DIY YDWREPF+L++GWLLWA IGL GALAA+A+TG AMS   S  P R
Sbjct  175   SLTKSFSPLPDDIYQYDWREPFDLKKGWLLWAGIGLGGALAAVAVTGAAMSFF-SFNPER  233

Query  761   ETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISA  582
             +TD+L+ LLPLIGSS+IST  L+G+TGVLAPVLEETVFRGF MVSLTKWLP+PL+VL+SA
Sbjct  234   KTDSLMMLLPLIGSSTISTACLVGVTGVLAPVLEETVFRGFFMVSLTKWLPTPLSVLLSA  293

Query  581   AVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYD  402
             AVF+ AHLTPG FPQLFVLG  LGFSY+QTRNLLTPITIHAFWN+GVI+LLTFLQL GYD
Sbjct  294   AVFALAHLTPGGFPQLFVLGIVLGFSYSQTRNLLTPITIHAFWNTGVIILLTFLQLNGYD  353

Query  401   IKELIQA  381
             IKE++Q+
Sbjct  354   IKEMLQS  360



>ref|XP_006586025.1| PREDICTED: uncharacterized protein LOC100808678 isoform X1 [Glycine 
max]
Length=350

 Score =   330 bits (845),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 199/293 (68%), Positives = 236/293 (81%), Gaps = 15/293 (5%)
 Frame = -3

Query  1217  TVCSYSSGNRPDPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTG----------  1068
             +VC +++G++ D K SG   PI RRW VPW WQT+SLTSLACG   VL            
Sbjct  60    SVCFFNTGDKSDSKESG--WPILRRWEVPWQWQTVSLTSLACGLGCVLNSCYDFISNLKY  117

Query  1067  ---LIETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYC  897
                L E  A+PY GI+ + LSLD+KAEIL  DQ+ITTA+VLG++Y++  + +PLP D + 
Sbjct  118   CKCLTEAIALPYLGIKPDVLSLDDKAEILLFDQSITTAVVLGIIYSVANTFQPLPEDFFK  177

Query  896   YDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligss  717
             YD REPFNLQ+GWLLWA IGLAGA+ AI+LTGVA+S  N E P RETDALVRLLPLIGSS
Sbjct  178   YDLREPFNLQKGWLLWAGIGLAGAILAISLTGVAVSFFNGETPQRETDALVRLLPLIGSS  237

Query  716   sistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQ  537
             ++ST  L+GITGVLAP+LEETVFRGF M SLTKW+P+P+AV+ISAAVF+ AHLTPGEFPQ
Sbjct  238   NLSTACLVGITGVLAPLLEETVFRGFFMTSLTKWVPTPVAVVISAAVFALAHLTPGEFPQ  297

Query  536   LFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             LFVLGTALGFSYAQT NLLTPITIH+FWNSGVIL LTFLQLQGYDI+EL+QA+
Sbjct  298   LFVLGTALGFSYAQTHNLLTPITIHSFWNSGVILFLTFLQLQGYDIRELLQAT  350



>emb|CDX96862.1| BnaA08g24050D [Brassica napus]
Length=340

 Score =   328 bits (842),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 194/317 (61%), Positives = 246/317 (78%), Gaps = 5/317 (2%)
 Frame = -3

Query  1316  LSPKLFPYKPLTQKLQLLSFRRTDQALRPRFSTTVCSYSSGNRPDP----KGSGPNCPIF  1149
             + PK +    L +    L+ +R    +R ++ +    ++SG  P      +GS    PI 
Sbjct  25    IQPKTYNRGGLNRFSPGLATQRLSTVIRKKWRSASI-FNSGKEPGGEGKLQGSSSEWPIL  83

Query  1148  RRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAIT  969
              RW VPW WQT+SLTSLAC  SFVLTGL E AA+PY G+ VE+LSLD+KAEILFLDQ IT
Sbjct  84    ERWEVPWEWQTVSLTSLACVLSFVLTGLAEIAALPYLGVDVEKLSLDQKAEILFLDQGIT  143

Query  968   TAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMS  789
             TA++L V++T+ K+ +PLP DI  YD ++PFNLQ+GWL+W  IGL  A+  IALTGVA+S
Sbjct  144   TAVILAVIFTVAKTFEPLPEDILRYDLKQPFNLQKGWLVWGGIGLVAAVGGIALTGVALS  203

Query  788   SLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLP  609
               ++E P RE D+L++LLPLIGSS+ISTLSL+GITGVLAP+LEETVFRGF MVSLTKW+P
Sbjct  204   LFSTETPEREVDSLMQLLPLIGSSNISTLSLVGITGVLAPLLEETVFRGFFMVSLTKWVP  263

Query  608   SPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLL  429
             +P+A++IS+A F+ AHLTPGEFPQLF+LG+ LG +YAQTRNL+TP+ IH FWNSGVILLL
Sbjct  264   TPVAIIISSAAFALAHLTPGEFPQLFILGSVLGLTYAQTRNLITPMVIHGFWNSGVILLL  323

Query  428   TFLQLQGYDIKELIQAS  378
             TFLQ+QGYDIKEL+Q S
Sbjct  324   TFLQVQGYDIKELLQGS  340



>ref|XP_010458918.1| PREDICTED: uncharacterized protein LOC104740091 isoform X1 [Camelina 
sativa]
 ref|XP_010458919.1| PREDICTED: uncharacterized protein LOC104740091 isoform X2 [Camelina 
sativa]
Length=341

 Score =   325 bits (833),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 197/315 (63%), Positives = 245/315 (78%), Gaps = 5/315 (2%)
 Frame = -3

Query  1310  PKLFPYKPLTQKLQLLSFRRTDQALRPRFSTTVCSYSSGNRP--DPK--GSGPNCPIFRR  1143
             PK +    L++  +  + RR     R ++ +  C ++SG  P  D K  G     PI +R
Sbjct  28    PKTYNGGCLSRFSRGFANRRLFTVNRRKWRSA-CIFNSGKEPGGDGKLQGGSSEWPILQR  86

Query  1142  WSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAITTA  963
             W VPW WQT+SLTS AC  SFVLTGL E A IP+ GI  E+LSLD+KAEILFLDQ +TTA
Sbjct  87    WEVPWEWQTVSLTSFACALSFVLTGLTEMAVIPFLGIDAEKLSLDDKAEILFLDQGLTTA  146

Query  962   IVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSL  783
             +VL V++T+ K+ +PLP DI  YD R+PFNLQ+GWL+W  IGL GA+ AIALTGVA+S  
Sbjct  147   VVLAVIFTVAKTFEPLPEDILRYDLRQPFNLQKGWLVWGGIGLVGAVGAIALTGVALSLF  206

Query  782   NSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSP  603
              +E P RE D+L++LLPLIGSSSISTLSL+GITG+LAP+LEETVFRGF MVSLTKW+P+P
Sbjct  207   RTEAPEREVDSLMKLLPLIGSSSISTLSLVGITGILAPLLEETVFRGFFMVSLTKWVPTP  266

Query  602   LAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTF  423
             +A++IS+A F+ AHLTPGEFPQLF+LG+ LG SYAQTRNL+TP+ IH  WNSGVILLLTF
Sbjct  267   IAIIISSAAFALAHLTPGEFPQLFILGSVLGLSYAQTRNLITPMVIHGIWNSGVILLLTF  326

Query  422   LQLQGYDIKELIQAS  378
             LQ+QGYDIKEL+QA+
Sbjct  327   LQIQGYDIKELLQAN  341



>ref|XP_010476474.1| PREDICTED: uncharacterized protein LOC104755721 [Camelina sativa]
Length=341

 Score =   325 bits (832),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 191/284 (67%), Positives = 232/284 (82%), Gaps = 4/284 (1%)
 Frame = -3

Query  1217  TVCSYSSGNRP--DPK--GSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAA  1050
             + C ++SG  P  D K  G     PI +RW VPW WQT+SLTS AC  SFVLTGL E A 
Sbjct  58    SACIFNSGKEPGGDGKLQGGSSEWPILQRWEVPWEWQTVSLTSFACALSFVLTGLTEMAV  117

Query  1049  IPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNL  870
             IP+ GI  E+LSLD+KAEILFLDQ +TTA+VL V++T+ K+ +PLP DI  YD R+PFNL
Sbjct  118   IPFLGIDAEKLSLDDKAEILFLDQGLTTAVVLAVIFTVAKTFEPLPEDILRYDLRQPFNL  177

Query  869   QRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllg  690
             Q+GWL+W  IGL GA+ AIALTGVA+S   +E P RE D+L++LLPLIGSSSISTLSL+G
Sbjct  178   QKGWLVWGGIGLVGAVGAIALTGVALSLFRTEAPEREVDSLMKLLPLIGSSSISTLSLVG  237

Query  689   itGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALG  510
             ITG+LAP+LEETVFRGF MVSLTKW+P+P+A++IS+A F+ AHLTPGEFPQLF+LG+ LG
Sbjct  238   ITGILAPLLEETVFRGFFMVSLTKWVPTPIAIIISSAAFALAHLTPGEFPQLFILGSVLG  297

Query  509   FSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
              SYAQTRNL+TP+ IH  WNSGVILLLTFLQ+QGYDIKEL+QA+
Sbjct  298   LSYAQTRNLITPMVIHGIWNSGVILLLTFLQIQGYDIKELLQAN  341



>gb|EEE69696.1| hypothetical protein OsJ_29346 [Oryza sativa Japonica Group]
Length=353

 Score =   325 bits (832),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 193/288 (67%), Positives = 229/288 (80%), Gaps = 2/288 (1%)
 Frame = -3

Query  1235  RPRFSTTVCSYSSGNRPDPKGS--GPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLI  1062
             R R      S++SGN+P P  S      PI RRW VPW WQT+ LT + CG SFVLTGL+
Sbjct  66    RRRGGYACLSFNSGNKPPPPSSENSDEWPILRRWDVPWEWQTVVLTMVGCGVSFVLTGLV  125

Query  1061  ETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWRE  882
             E + + Y G +  E ++D+KAEILFL Q   TA+VLGV+Y +T + +PLP+DI+ YD +E
Sbjct  126   EQSVLTYVGFRAVEATVDQKAEILFLGQLSVTAVVLGVVYGITNTFRPLPDDIFRYDIKE  185

Query  881   PFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistl  702
             PF LQ GWLLWA +GL GA+ +IAL GVAM+ LN EPP RETD+LV LLPLIGSSS ST 
Sbjct  186   PFKLQNGWLLWAGVGLFGAIISIALVGVAMTYLNGEPPERETDSLVLLLPLIGSSSASTA  245

Query  701   sllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLG  522
              L+GITGVLAP+LEETVFRGFLMVSLTKW P+P+ +L+SAA+F+ AHLTPG+FPQLF+LG
Sbjct  246   FLVGITGVLAPILEETVFRGFLMVSLTKWFPTPVCILVSAALFAFAHLTPGQFPQLFILG  305

Query  521   TALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
              ALGFSYAQT NLLTPITIHAFWNSGVILLLTFLQLQGYDIKEL+ AS
Sbjct  306   VALGFSYAQTHNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELLGAS  353



>ref|XP_002892797.1| hypothetical protein ARALYDRAFT_471595 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69056.1| hypothetical protein ARALYDRAFT_471595 [Arabidopsis lyrata subsp. 
lyrata]
Length=338

 Score =   323 bits (828),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 187/284 (66%), Positives = 230/284 (81%), Gaps = 4/284 (1%)
 Frame = -3

Query  1217  TVCSYSSGNRPDP----KGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAA  1050
             + C ++SG  P      +G     PI +RW VPW WQ +SLTS AC  SFVLTGL E A 
Sbjct  55    SACIFNSGKEPGGEGKLQGGSSEWPILQRWEVPWGWQIVSLTSFACALSFVLTGLTEMAV  114

Query  1049  IPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNL  870
             IP+ GI VE+L+LD+KAEILFLDQ +TTA+VL V++T+ K+  PLP DI  YD R+PFNL
Sbjct  115   IPFLGIDVEKLTLDDKAEILFLDQGLTTAVVLAVIFTVAKTFDPLPEDILRYDLRQPFNL  174

Query  869   QRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllg  690
             Q+GWL+W  IGL GA+ AIALTGV +S   +E P RE D+L++LLPLIGSS+ISTLSL+G
Sbjct  175   QKGWLVWGGIGLVGAVGAIALTGVVLSVFRTEAPEREVDSLMKLLPLIGSSNISTLSLVG  234

Query  689   itGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALG  510
             ITG+LAP+LEETVFRGF MVSLTKW+P+P+A++IS+A F+ AHLTPGEFPQLF+LG+ LG
Sbjct  235   ITGILAPLLEETVFRGFFMVSLTKWVPTPIAIIISSAAFALAHLTPGEFPQLFILGSVLG  294

Query  509   FSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
              SYAQTRNL+TP+ IH FWNSGVILLLTFLQ+QGYDIKEL+QA+
Sbjct  295   LSYAQTRNLITPMVIHGFWNSGVILLLTFLQIQGYDIKELLQAN  338



>gb|EEC84569.1| hypothetical protein OsI_31352 [Oryza sativa Indica Group]
Length=353

 Score =   323 bits (829),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 193/288 (67%), Positives = 228/288 (79%), Gaps = 2/288 (1%)
 Frame = -3

Query  1235  RPRFSTTVCSYSSGNRPDPKGS--GPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLI  1062
             R R      S++SGN+P P  S      PI RRW VPW WQT+ LT   CG SFVLTGL+
Sbjct  66    RRRGGYACLSFNSGNKPPPPSSENSDEWPILRRWDVPWEWQTVVLTMAGCGVSFVLTGLV  125

Query  1061  ETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWRE  882
             E + + Y G +  E ++D+KAEILFL Q   TA+VLGV+Y +T + +PLP+DI+ YD +E
Sbjct  126   EQSVLTYVGFRAVEATVDQKAEILFLGQLSMTAVVLGVVYGITNTFRPLPDDIFRYDIKE  185

Query  881   PFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistl  702
             PF LQ GWLLWA +GL GA+ +IAL GVAM+ LN EPP RETD+LV LLPLIGSSS ST 
Sbjct  186   PFKLQNGWLLWAGVGLFGAIISIALVGVAMTYLNGEPPERETDSLVLLLPLIGSSSASTA  245

Query  701   sllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLG  522
              L+GITGVLAP+LEETVFRGFLMVSLTKW P+P+ +L+SAA+F+ AHLTPG+FPQLF+LG
Sbjct  246   FLVGITGVLAPILEETVFRGFLMVSLTKWFPTPVCILVSAALFAFAHLTPGQFPQLFILG  305

Query  521   TALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
              ALGFSYAQT NLLTPITIHAFWNSGVILLLTFLQLQGYDIKEL+ AS
Sbjct  306   VALGFSYAQTHNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELLGAS  353



>ref|XP_010495880.1| PREDICTED: uncharacterized protein LOC104773030 isoform X1 [Camelina 
sativa]
Length=340

 Score =   323 bits (827),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 191/282 (68%), Positives = 230/282 (82%), Gaps = 4/282 (1%)
 Frame = -3

Query  1211  CSYSSGNRP--DPK--GSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIP  1044
             C ++SG  P  D K  G     PI +RW VPW WQT+SLTS AC  SFVLTGL E A IP
Sbjct  59    CIFNSGKEPGGDGKLQGGSSEWPILQRWEVPWEWQTVSLTSFACALSFVLTGLTEMAVIP  118

Query  1043  YTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQR  864
               GI  E+LSLD+KAEILFLDQ +TTA+VL V++T+ K+ +PLP DI  YD R+PFNLQ+
Sbjct  119   LLGIDAEKLSLDDKAEILFLDQGLTTAVVLAVIFTVAKTFEPLPEDILRYDLRQPFNLQK  178

Query  863   gwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgit  684
             GWL+W  IGL GA+ AIALTGVA+S   +E P RE D+L++LLPLIGSSSISTLSL+GIT
Sbjct  179   GWLVWGGIGLVGAVGAIALTGVALSLFRTEAPEREVDSLMKLLPLIGSSSISTLSLVGIT  238

Query  683   GVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFS  504
             G+LAP+LEETVFRGF MVSLTKW+P+P+A++IS+A F+ AHLTPGEFPQLF+LG+ LG S
Sbjct  239   GILAPLLEETVFRGFFMVSLTKWVPTPIAIIISSAAFALAHLTPGEFPQLFILGSVLGLS  298

Query  503   YAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             YAQTRNL+TP+ IH  WNSGVILLLTFLQ+QGYDIKEL+QA+
Sbjct  299   YAQTRNLITPMVIHGIWNSGVILLLTFLQIQGYDIKELLQAN  340



>ref|XP_006306018.1| hypothetical protein CARUB_v10011314mg, partial [Capsella rubella]
 gb|EOA38916.1| hypothetical protein CARUB_v10011314mg, partial [Capsella rubella]
Length=344

 Score =   323 bits (827),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 190/284 (67%), Positives = 233/284 (82%), Gaps = 4/284 (1%)
 Frame = -3

Query  1217  TVCSYSSGNRP--DPK--GSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAA  1050
             + C ++SG  P  D K  G     PI +RW VPW WQT+SLTS AC  SFVLTGL E AA
Sbjct  61    SACIFNSGKEPGGDGKLQGGSSEWPILQRWEVPWGWQTVSLTSFACALSFVLTGLTEMAA  120

Query  1049  IPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNL  870
             IP+ GI  E+LSLD+KAEILFLDQ +TTA+VL V++T+ K+ +PLP DI  YD R+PFNL
Sbjct  121   IPFLGIDPEKLSLDDKAEILFLDQGLTTAVVLAVIFTVAKTFEPLPEDILRYDLRQPFNL  180

Query  869   QRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllg  690
             Q+GWL+W  IG+AGA+ AIALTGVA+S   +E P RE D+L+++LPLIGSSSISTLSL+G
Sbjct  181   QKGWLVWGGIGIAGAVGAIALTGVALSLFRTEAPEREVDSLMKILPLIGSSSISTLSLVG  240

Query  689   itGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALG  510
             ITG+ AP+LEETVFRGF MVSLTKW+P+P+A++IS+A F+ AHLTPGEFPQLF+LG+ LG
Sbjct  241   ITGIFAPLLEETVFRGFFMVSLTKWVPTPIAIIISSAAFALAHLTPGEFPQLFILGSVLG  300

Query  509   FSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
              SYAQTRNL+TP+ IH  WNSGVILLLTFLQ+QGYDIKEL+QA+
Sbjct  301   LSYAQTRNLITPMVIHGIWNSGVILLLTFLQIQGYDIKELLQAN  344



>ref|NP_563943.2| CAAX amino terminal protease family protein [Arabidopsis thaliana]
 gb|AEE29134.1| CAAX amino terminal protease family protein [Arabidopsis thaliana]
Length=353

 Score =   323 bits (828),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 193/315 (61%), Positives = 241/315 (77%), Gaps = 5/315 (2%)
 Frame = -3

Query  1310  PKLFPYKPLTQKLQLLSFRRTDQALRPRFSTTVCSYSSGNRPDP----KGSGPNCPIFRR  1143
             PK   Y  L++     + RR     R ++ +  C ++SG  P      +G     PI +R
Sbjct  40    PKTCTYGGLSRFSPGFASRRLFTVNRKKWRSA-CIFNSGKEPGGEGKLQGGSSEWPILQR  98

Query  1142  WSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAITTA  963
             W VPW WQT+SLTS AC  SFVLTGL E A IP+ GI VE+L+LD+KAEILFLDQ +TTA
Sbjct  99    WEVPWGWQTVSLTSFACALSFVLTGLTEMAVIPFLGIDVEKLTLDDKAEILFLDQGLTTA  158

Query  962   IVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSL  783
             +VL V++T+ K+  PLP DI  YD R+P NLQ+GWL+W  IGL GA+ AIALTGV +S  
Sbjct  159   VVLAVIFTVAKTFDPLPEDILRYDLRQPVNLQKGWLVWGGIGLVGAVGAIALTGVVLSVF  218

Query  782   NSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSP  603
              +E P RE D+L++LLPLIGSS+ISTLSL+GITG+LAP+LEETVFRGF MVSLTKW+P+P
Sbjct  219   RTEAPEREVDSLMKLLPLIGSSNISTLSLVGITGILAPLLEETVFRGFFMVSLTKWVPTP  278

Query  602   LAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTF  423
             +A++IS+A F+ AH TPGEFPQLF+LG+ LG SYAQTRNL+TP+ IH FWNSGVILLLTF
Sbjct  279   IAIIISSAAFALAHFTPGEFPQLFILGSVLGLSYAQTRNLITPMVIHGFWNSGVILLLTF  338

Query  422   LQLQGYDIKELIQAS  378
             LQ+QGYDIKEL+QA+
Sbjct  339   LQIQGYDIKELLQAN  353



>ref|XP_009110552.1| PREDICTED: uncharacterized protein LOC103836079 isoform X2 [Brassica 
rapa]
Length=338

 Score =   322 bits (826),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 191/315 (61%), Positives = 242/315 (77%), Gaps = 3/315 (1%)
 Frame = -3

Query  1316  LSPKLFPYKPLTQKLQLLSFRRTDQALRPRFSTTVCSYSSGNRPDPKG--SGPNCPIFRR  1143
             + PK +    L +    L+ +R    +R ++ +    ++SG  P  +G     +  I  R
Sbjct  25    IQPKTYNRGGLNRFSPGLATQRLSTVIRKKWRSASI-FNSGKEPGGEGKEGSSDWAILER  83

Query  1142  WSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAITTA  963
             W VPW WQT SLTSLAC  SFVLTGL E AA+PY G+ VE+LSLD+KAEILFLDQ ITTA
Sbjct  84    WEVPWEWQTASLTSLACVLSFVLTGLAEMAALPYLGVDVEKLSLDQKAEILFLDQGITTA  143

Query  962   IVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSL  783
             ++L V++T+ K+  PLP DI  YD ++PFNLQ+GWL+W  IGL  A+  IALTGVA+S  
Sbjct  144   VILAVIFTVAKTFDPLPEDILRYDLKQPFNLQKGWLVWGGIGLVAAVGGIALTGVALSLF  203

Query  782   NSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSP  603
             ++E P RE D+L++LLPLIGSS+ISTLSL+GITGVLAP+LEETVFRGF MVSLTKW+P+P
Sbjct  204   STETPEREVDSLMQLLPLIGSSNISTLSLVGITGVLAPLLEETVFRGFFMVSLTKWVPTP  263

Query  602   LAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTF  423
             +A++IS+A F+ AHLTPGEFPQLF+LG+ LG +YAQTRNL+TP+ IH  WNSGVILLLTF
Sbjct  264   IAIIISSAAFALAHLTPGEFPQLFILGSVLGLTYAQTRNLITPMVIHGLWNSGVILLLTF  323

Query  422   LQLQGYDIKELIQAS  378
             LQ+QGYDIKEL+Q S
Sbjct  324   LQVQGYDIKELLQGS  338



>gb|AAM65055.1| unknown [Arabidopsis thaliana]
Length=340

 Score =   322 bits (825),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 189/297 (64%), Positives = 234/297 (79%), Gaps = 5/297 (2%)
 Frame = -3

Query  1256  RRTDQALRPRFSTTVCSYSSGNRPDP----KGSGPNCPIFRRWSVPWNWQTISLTSLACG  1089
             RR     R ++ +  C ++SG  P      +G     PI +RW VPW WQT+SLTS AC 
Sbjct  45    RRLFTVNRKKWRSA-CIFNSGKEPGGEGKLQGGSSEWPILQRWEVPWGWQTVSLTSFACA  103

Query  1088  FSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPN  909
              SFVLTGL E A IP+ GI VE+L+LD+KAEILFLDQ +TTA+VL V++T+ K+  PLP 
Sbjct  104   LSFVLTGLTEMAVIPFLGIDVEKLTLDDKAEILFLDQGLTTAVVLAVIFTVAKTFDPLPE  163

Query  908   DIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpl  729
             DI  YD R+P NLQ+GWL+W  IGL GA+ AIALTGV +S   +E P RE D+L++LLPL
Sbjct  164   DILRYDLRQPVNLQKGWLVWGGIGLVGAVGAIALTGVVLSVFRTEAPEREVDSLMKLLPL  223

Query  728   igsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPG  549
             IGSS+ISTLSL+GITG+LAP+LEETVFRGF MVSLTKW+P+P+A++IS+A F+ AH TPG
Sbjct  224   IGSSNISTLSLVGITGILAPLLEETVFRGFFMVSLTKWVPTPIAIIISSAAFALAHFTPG  283

Query  548   EFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             EFPQLF+LG+ LG SYAQTRNL+TP+ IH FWNSGVILLLTFLQ+QGYDIKEL+QA+
Sbjct  284   EFPQLFILGSVLGLSYAQTRNLITPMVIHGFWNSGVILLLTFLQIQGYDIKELLQAN  340



>ref|XP_009110551.1| PREDICTED: uncharacterized protein LOC103836079 isoform X1 [Brassica 
rapa]
Length=340

 Score =   322 bits (824),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 191/317 (60%), Positives = 242/317 (76%), Gaps = 5/317 (2%)
 Frame = -3

Query  1316  LSPKLFPYKPLTQKLQLLSFRRTDQALRPRFSTTVCSYSSGNRPDPKG----SGPNCPIF  1149
             + PK +    L +    L+ +R    +R ++ +    ++SG  P  +G       +  I 
Sbjct  25    IQPKTYNRGGLNRFSPGLATQRLSTVIRKKWRSASI-FNSGKEPGGEGKLQEGSSDWAIL  83

Query  1148  RRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAIT  969
              RW VPW WQT SLTSLAC  SFVLTGL E AA+PY G+ VE+LSLD+KAEILFLDQ IT
Sbjct  84    ERWEVPWEWQTASLTSLACVLSFVLTGLAEMAALPYLGVDVEKLSLDQKAEILFLDQGIT  143

Query  968   TAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMS  789
             TA++L V++T+ K+  PLP DI  YD ++PFNLQ+GWL+W  IGL  A+  IALTGVA+S
Sbjct  144   TAVILAVIFTVAKTFDPLPEDILRYDLKQPFNLQKGWLVWGGIGLVAAVGGIALTGVALS  203

Query  788   SLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLP  609
               ++E P RE D+L++LLPLIGSS+ISTLSL+GITGVLAP+LEETVFRGF MVSLTKW+P
Sbjct  204   LFSTETPEREVDSLMQLLPLIGSSNISTLSLVGITGVLAPLLEETVFRGFFMVSLTKWVP  263

Query  608   SPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLL  429
             +P+A++IS+A F+ AHLTPGEFPQLF+LG+ LG +YAQTRNL+TP+ IH  WNSGVILLL
Sbjct  264   TPIAIIISSAAFALAHLTPGEFPQLFILGSVLGLTYAQTRNLITPMVIHGLWNSGVILLL  323

Query  428   TFLQLQGYDIKELIQAS  378
             TFLQ+QGYDIKEL+Q S
Sbjct  324   TFLQVQGYDIKELLQGS  340



>emb|CDX84039.1| BnaC08g16060D [Brassica napus]
Length=340

 Score =   320 bits (819),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 184/274 (67%), Positives = 226/274 (82%), Gaps = 0/274 (0%)
 Frame = -3

Query  1199  SGNRPDPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEE  1020
             SG     +G      I  RW VPW WQT SLTSLAC  SFVLTGL E AA+PY G+ VE+
Sbjct  67    SGGEGKLQGGSSEWAILERWEVPWEWQTASLTSLACVLSFVLTGLAEMAALPYLGVDVEK  126

Query  1019  LSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaai  840
             LSLD+KAEILFLDQ ITTA++L V++T+ K+ +PLP+DI  YD ++PFNLQ+GWL+W  I
Sbjct  127   LSLDQKAEILFLDQGITTAVILAVIFTVAKTFEPLPDDILRYDLKQPFNLQKGWLVWGGI  186

Query  839   glagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLE  660
             GL GA+  IALTGVA+S  ++E P RE D+L++LLPLIG+S+ISTLSL+GITG+LAP+LE
Sbjct  187   GLVGAVGGIALTGVALSLFSTETPEREVDSLMQLLPLIGTSNISTLSLVGITGILAPLLE  246

Query  659   ETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLL  480
             ETVFRGF MVSLTKW+P+PLA++IS+A F+ AHLTPGEFPQLF+LG+ LG +YAQTRNL+
Sbjct  247   ETVFRGFFMVSLTKWVPTPLAIIISSAAFALAHLTPGEFPQLFILGSVLGLTYAQTRNLI  306

Query  479   TPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             TP+ IH  WNSGVILLLTFLQ+QGYDIKEL+Q S
Sbjct  307   TPMVIHGLWNSGVILLLTFLQVQGYDIKELLQGS  340



>ref|XP_010096551.1| hypothetical protein L484_001018 [Morus notabilis]
 gb|EXB64798.1| hypothetical protein L484_001018 [Morus notabilis]
Length=319

 Score =   318 bits (816),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 183/295 (62%), Positives = 220/295 (75%), Gaps = 35/295 (12%)
 Frame = -3

Query  1250  TDQALRPRFSTTVCSYSSGN--RPDPKG--SGPNCPIFRRWSVPWNWQTISLTSLACGFS  1083
             +  +L+ R    +C +++G+  + D +G  SG   PI +RW VPW WQT+SLTSLACG S
Sbjct  56    SHASLKRRRLRPICFFNAGDNSKDDFQGKESGSEWPILKRWEVPWQWQTVSLTSLACGLS  115

Query  1082  FVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDI  903
             FVLTGL+E AAIPY GI +E+LSLDEKAEILFLDQ ITTA+VLG+LY++T S +PLP DI
Sbjct  116   FVLTGLVEAAAIPYLGISIEKLSLDEKAEILFLDQGITTAVVLGILYSVTNSFQPLPEDI  175

Query  902   YCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllplig  723
             Y YD REPF+L++GWLLWA IGL GA+ AI+LTG AMS  +SE P RETDALVR      
Sbjct  176   YRYDLREPFSLRKGWLLWAGIGLVGAIGAISLTGAAMSLFSSESPQRETDALVR------  229

Query  722   sssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEF  543
                            L P++  +  R          +P+P+AVL+SAAVF+ AHLTPGEF
Sbjct  230   ---------------LLPLIGSSSIR----------VPTPVAVLVSAAVFALAHLTPGEF  264

Query  542   PQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             PQLFVLGTA+GFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKEL+QA+
Sbjct  265   PQLFVLGTAMGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELLQAT  319



>ref|XP_006660621.1| PREDICTED: uncharacterized protein LOC102712385 [Oryza brachyantha]
Length=351

 Score =   319 bits (817),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 191/279 (68%), Positives = 225/279 (81%), Gaps = 2/279 (1%)
 Frame = -3

Query  1208  SYSSGNRPDPKGS--GPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTG  1035
             S +SGN P P  +      PI RRW VPW WQT+ LT + CG SFVLTGL+E + + Y G
Sbjct  73    SSNSGNNPPPPSTKNSDEWPILRRWDVPWEWQTVVLTMVGCGVSFVLTGLVEQSVLTYVG  132

Query  1034  IQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwl  855
              +  E ++D+KAEILFL Q   TA+VLGV++ +T + +PLP+DI+ YD +EPF LQ GWL
Sbjct  133   FKAVEATVDQKAEILFLGQLSVTAVVLGVVFGITNTFRPLPDDIFRYDIKEPFKLQNGWL  192

Query  854   lwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVL  675
             LWAA GL GA+ +IAL GVAM+ LN EPP RETD+LV LLPLIGSSS ST  L+GITGVL
Sbjct  193   LWAAAGLFGAIISIALVGVAMNYLNGEPPERETDSLVLLLPLIGSSSASTAFLVGITGVL  252

Query  674   APVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQ  495
             AP+LEETVFRGFLMVSLTKW P+P+ +L+SAA+F+ AHLTPG+FPQLFVLG ALGFSYAQ
Sbjct  253   APILEETVFRGFLMVSLTKWFPTPVCILVSAALFALAHLTPGQFPQLFVLGLALGFSYAQ  312

Query  494   TRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             T NLLTPITIHAFWNSGVILLLTFLQLQGYDIKEL+ AS
Sbjct  313   THNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELLGAS  351



>emb|CDY49101.1| BnaA06g09050D [Brassica napus]
Length=338

 Score =   317 bits (813),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 196/329 (60%), Positives = 248/329 (75%), Gaps = 7/329 (2%)
 Frame = -3

Query  1370  AAALFYVSLARPSAPIASLSPKLFPYKPLTQKLQLLSFRRTDQALRPRFSTTVCSYSSGN  1191
             +++LF +S +R   P     PK +    L +     + RR     R ++ +  C  +SG 
Sbjct  12    SSSLFCISGSRSLIP-----PKTYNRGGLCRFSPGFASRRLSTVNRRKWRSA-CISNSGK  65

Query  1190  RPDPKGS-GPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELS  1014
               + +G       I  RW VPW WQT+SLTSLACG SFVLTGL E  A+PY GI V++LS
Sbjct  66    ETEGEGKLQGEWRILERWEVPWEWQTVSLTSLACGLSFVLTGLTEMVALPYLGIDVQKLS  125

Query  1013  LDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaigl  834
             LD+KAEILFLDQ +TT  VL V++T+ K+ +PLP DI  YD ++PFNLQ+GWL+W+ IGL
Sbjct  126   LDDKAEILFLDQGLTTLAVLAVIFTVAKTFEPLPEDILRYDLKQPFNLQKGWLVWSGIGL  185

Query  833   agalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEET  654
              GA+ AIALTGVA+S   +E P RE D+L++ LPLIGSS+ISTLSL+GITGVLAP+LEET
Sbjct  186   VGAVGAIALTGVALSLFRTETPEREVDSLMKFLPLIGSSNISTLSLVGITGVLAPLLEET  245

Query  653   VFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTP  474
             VFRGF MVSLTKW+P+P+A++IS+A F+ AHLTPGEFPQLF+LG+ LG SYAQTRNL+TP
Sbjct  246   VFRGFFMVSLTKWVPTPIAIIISSAAFALAHLTPGEFPQLFILGSVLGLSYAQTRNLITP  305

Query  473   ITIHAFWNSGVILLLTFLQLQGYDIKELI  387
             + IH FWNSGVILLLTFLQ+QGYDIKEL+
Sbjct  306   MVIHGFWNSGVILLLTFLQVQGYDIKELL  334



>ref|XP_009148709.1| PREDICTED: uncharacterized protein LOC103872119 isoform X1 [Brassica 
rapa]
Length=338

 Score =   317 bits (812),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 197/329 (60%), Positives = 248/329 (75%), Gaps = 7/329 (2%)
 Frame = -3

Query  1370  AAALFYVSLARPSAPIASLSPKLFPYKPLTQKLQLLSFRRTDQALRPRFSTTVCSYSSGN  1191
             +++LF +S +R   P     PK +    L +     + RR     R ++ +  C  +SG 
Sbjct  12    SSSLFCISGSRSLIP-----PKTYNRGGLCRFPPGFASRRLSTVYRRKWRSA-CISNSGK  65

Query  1190  RPDPKGS-GPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELS  1014
                 +G       I  RW VPW WQT+SLTSLACG SFVLTGL E  A+PY GI V++LS
Sbjct  66    ETGGEGKLQGEWRILERWEVPWEWQTVSLTSLACGLSFVLTGLTEMVALPYLGIDVQKLS  125

Query  1013  LDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaigl  834
             LD+KAEILFLDQ +TT  VL V++T+ K+ +PLP DI  YD ++PFNLQ+GWL+W+ IGL
Sbjct  126   LDDKAEILFLDQGLTTLAVLAVIFTVAKTFEPLPEDILRYDLKQPFNLQKGWLVWSGIGL  185

Query  833   agalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEET  654
              GA+ AIALTGVA+S   +E P RE D+L++LLPLIGSS+ISTLSL+GITGVLAP+LEET
Sbjct  186   VGAVGAIALTGVALSLFRTETPEREVDSLMKLLPLIGSSNISTLSLVGITGVLAPLLEET  245

Query  653   VFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTP  474
             VFRGF MVSLTKW+P+P+A++IS+A F+ AHLTPGEFPQLF+LG+ LG SYAQTRNL+TP
Sbjct  246   VFRGFFMVSLTKWVPTPIAIIISSAAFALAHLTPGEFPQLFILGSVLGLSYAQTRNLITP  305

Query  473   ITIHAFWNSGVILLLTFLQLQGYDIKELI  387
             + IH FWNSGVILLLTFLQ+QGYDIKEL+
Sbjct  306   MVIHGFWNSGVILLLTFLQVQGYDIKELL  334



>ref|XP_004956804.1| PREDICTED: uncharacterized protein LOC101774793 isoform X1 [Setaria 
italica]
Length=354

 Score =   312 bits (800),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 197/334 (59%), Positives = 242/334 (72%), Gaps = 12/334 (4%)
 Frame = -3

Query  1343  ARPSAPIA-SLSPKLFPY---------KPLTQKLQLLSFRRTDQALRPRFSTTVCSYSSG  1194
             A PS P+  S   K FPY         +   + L+L    R  ++ R        SY++ 
Sbjct  21    ALPSKPLLLSRHRKPFPYPKSGRIAVARAQQRLLRLPETGRWGRSWRRGGGFPCFSYNAN  80

Query  1193  NRPDP--KGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEE  1020
             N   P    S  N  I +RW VPW WQT+ L+ + CG SFVLTGL+E +A+ Y G +  E
Sbjct  81    NESPPPSDKSSDNWRILQRWDVPWEWQTVVLSMVGCGVSFVLTGLVEQSALQYVGFKALE  140

Query  1019  LSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaai  840
              ++DEKAEILFL Q   T +VLGV++ +T + +P P+D++ YD +EPF L+ GWLLWA +
Sbjct  141   ATIDEKAEILFLGQLSVTVVVLGVIFGITNTFRPFPDDVFRYDIKEPFKLKNGWLLWAGV  200

Query  839   glagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLE  660
             GL GA+ +I LTG AM+ LN EPP RETD+LV LLPLIGSS+ ST  L+GITGVLAP+LE
Sbjct  201   GLFGAIISIGLTGAAMTYLNGEPPERETDSLVLLLPLIGSSTTSTAFLVGITGVLAPLLE  260

Query  659   ETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLL  480
             ET+FRGFLMVSLTKW P+P+ VL+SAAVF+ AHLTPG+FPQLF+LG ALGFSYAQTRNLL
Sbjct  261   ETLFRGFLMVSLTKWFPTPVCVLVSAAVFALAHLTPGQFPQLFILGVALGFSYAQTRNLL  320

Query  479   TPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             TPITIHAFWNSGVILLLTFLQLQGYDIKEL+ AS
Sbjct  321   TPITIHAFWNSGVILLLTFLQLQGYDIKELLGAS  354



>ref|XP_010044740.1| PREDICTED: uncharacterized protein LOC104433628 isoform X2 [Eucalyptus 
grandis]
Length=249

 Score =   306 bits (785),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 185/236 (78%), Positives = 212/236 (90%), Gaps = 0/236 (0%)
 Frame = -3

Query  1085  SFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPND  906
             SFVLTGL+ETAAIPY G+++EELSLDEKAEILF+DQ+ITTA VLGVLY +T++ +P+P D
Sbjct  14    SFVLTGLVETAAIPYLGLRLEELSLDEKAEILFVDQSITTAAVLGVLYGITRTFQPVPED  73

Query  905   IYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpli  726
             ++ YD +EPFNLQRGWLLWA IGL GAL A+A+TG AMS  + E P RETDALVRLLPLI
Sbjct  74    LFRYDLKEPFNLQRGWLLWAGIGLIGALLAVAVTGYAMSLFSGETPQRETDALVRLLPLI  133

Query  725   gsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGE  546
             GSS +ST  LLGITG+LAP LEET+FRGF MVSLTKW+P+P+AVLISAAVF+ AHLTPGE
Sbjct  134   GSSGVSTACLLGITGILAPFLEETIFRGFFMVSLTKWVPTPVAVLISAAVFALAHLTPGE  193

Query  545   FPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             FPQLFVLGTALG SYAQTRNL+TPITIH+ WNSGVILLLTFLQLQGYDIKEL+QAS
Sbjct  194   FPQLFVLGTALGLSYAQTRNLITPITIHSLWNSGVILLLTFLQLQGYDIKELLQAS  249



>ref|XP_009407354.1| PREDICTED: uncharacterized protein LOC103990050 [Musa acuminata 
subsp. malaccensis]
Length=354

 Score =   309 bits (791),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 195/288 (68%), Positives = 235/288 (82%), Gaps = 6/288 (2%)
 Frame = -3

Query  1223  STTVCSYSSGNRPDPKGSGPN------CPIFRRWSVPWNWQTISLTSLACGFSFVLTGLI  1062
             S T C Y++ ++  P  SG +        + RRW VPW+WQT+SLT +ACG SFVLTGL+
Sbjct  67    SVTACFYNANDKLKPASSGDDEDSEVEWSVLRRWDVPWSWQTVSLTMMACGVSFVLTGLV  126

Query  1061  ETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWRE  882
             E++ +PY G Q  ELSLDEKAEILF  Q   TA+VLGV+Y +T + +PLP+D++ YD +E
Sbjct  127   ESSLLPYLGFQDRELSLDEKAEILFAGQFSVTAVVLGVIYGITNTFQPLPDDVFRYDLKE  186

Query  881   PFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistl  702
             PF+L+ GWLLWA +GL GAL AIALTG A++  + E P RETDAL+RLLPLIGSS IST 
Sbjct  187   PFDLRDGWLLWAGVGLLGALIAIALTGFALNIFSGENPQRETDALIRLLPLIGSSGISTA  246

Query  701   sllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLG  522
              LLGITGVLAPVLEET+FRGFLMVSLTK+L +P++V+ISAA+F+ AHLTPGEFPQLFVLG
Sbjct  247   CLLGITGVLAPVLEETIFRGFLMVSLTKYLSTPISVIISAAIFAIAHLTPGEFPQLFVLG  306

Query  521   TALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             TALGFSYAQT NLLTPITIHA WNSGVILLLTFLQ+QGYDI+EL+QAS
Sbjct  307   TALGFSYAQTHNLLTPITIHALWNSGVILLLTFLQVQGYDIRELLQAS  354



>ref|XP_008446341.1| PREDICTED: uncharacterized protein LOC103489109 isoform X2 [Cucumis 
melo]
Length=319

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 185/324 (57%), Positives = 223/324 (69%), Gaps = 43/324 (13%)
 Frame = -3

Query  1328  PIASLSPK--LFPYKPLTQKLQ-LLSFRRTDQALRPRFSTTVCSYS----SGNRPDPKGS  1170
             PI   +PK  LF Y+ L+ +L  L S   +    RP     +C ++    SG     K +
Sbjct  32    PIGKRTPKILLFGYRNLSLRLSPLRSNSLSQSGFRP-----LCFFNAKDESGGDFQQKEN  86

Query  1169  GPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEIL  990
             G   PI RRW VPW WQT+SLTSLACG SF++TGL+E+AAIPY GI++EELSLDEKAEIL
Sbjct  87    GAGWPILRRWDVPWGWQTVSLTSLACGLSFIVTGLVESAAIPYLGIRIEELSLDEKAEIL  146

Query  989   FLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaia  810
             FLDQ ITT  VLG+LY++  + +PLP+ +Y YD R+P NLQRGWLLWA +GLAGALA+IA
Sbjct  147   FLDQGITTVTVLGILYSIANTFQPLPDGLYRYDIRDPLNLQRGWLLWAGVGLAGALASIA  206

Query  809   LTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMV  630
             +TG  +SS N     RETDALVR                     L P++  +  R     
Sbjct  207   VTGAVLSSFNGGSTERETDALVR---------------------LLPLIGSSSIR-----  240

Query  629   SLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWN  450
                  +P+P+AVLI+AAVF+ AHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHA WN
Sbjct  241   -----IPTPVAVLITAAVFALAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHALWN  295

Query  449   SGVILLLTFLQLQGYDIKELIQAS  378
             SGVILLLTFL LQGYDIKEL+Q +
Sbjct  296   SGVILLLTFLSLQGYDIKELLQTT  319



>ref|XP_003578112.1| PREDICTED: uncharacterized protein LOC100835467 [Brachypodium 
distachyon]
Length=350

 Score =   303 bits (776),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 185/292 (63%), Positives = 224/292 (77%), Gaps = 1/292 (0%)
 Frame = -3

Query  1253  RTDQALRPRFSTTVCSYSSGNRPDPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVL  1074
             R  ++LR        SYS+   P  K S    P+ RRW VPW WQT+ LT + CG SF L
Sbjct  60    RWRRSLRSGGGFVCLSYSNPPPPSNKDSD-EWPVLRRWDVPWEWQTVVLTMVGCGVSFAL  118

Query  1073  TGLIETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCY  894
             TGL+E + + Y G +    ++DEKAEILFL Q   TA++LGV++++T + +P P+DI+ Y
Sbjct  119   TGLVEQSVLQYAGYKAAGATIDEKAEILFLGQLSVTAVLLGVIFSITNTFRPFPDDIFRY  178

Query  893   DWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsss  714
             D +EPF L+ GWLLWA IGL GA+ +IAL G AM+ LN EPP RE D+LV LLPLIGSS+
Sbjct  179   DIKEPFKLRNGWLLWAGIGLFGAVISIALVGAAMTYLNGEPPEREKDSLVLLLPLIGSST  238

Query  713   istlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQL  534
             +ST  L+GITGVLAP+LEETVFRGFLMVSLTKW P+P+ V+ SAAVF+ AHLTP +FPQL
Sbjct  239   LSTAYLVGITGVLAPILEETVFRGFLMVSLTKWFPTPVCVVFSAAVFAFAHLTPDQFPQL  298

Query  533   FVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             FVLG ALGF+YAQTRNLL PITIHAFWNSGVILLLTFLQLQGYDIKEL+ AS
Sbjct  299   FVLGVALGFTYAQTRNLLAPITIHAFWNSGVILLLTFLQLQGYDIKELLGAS  350



>emb|CDY39329.1| BnaC05g10500D [Brassica napus]
Length=341

 Score =   301 bits (772),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 194/294 (66%), Positives = 234/294 (80%), Gaps = 5/294 (2%)
 Frame = -3

Query  1256  RRTDQALRPRFSTTVCSYSSGN--RPDPK--GSGPNCPIFRRWSVPWNWQTISLTSLACG  1089
             RR     R R   + C  +SG   R + K  G G    I  RW VPW WQT+SLTSLACG
Sbjct  45    RRLSTVYR-RKQRSACISNSGKETRGEGKLQGGGSEWRILERWEVPWEWQTVSLTSLACG  103

Query  1088  FSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPN  909
              SFVLTGL E  A+PY GI V++LSLD+KAEILFLDQ +TT  VL V++T+ K+ +PLP 
Sbjct  104   LSFVLTGLTEMVALPYLGIDVQKLSLDDKAEILFLDQGLTTLAVLAVIFTVAKTFEPLPE  163

Query  908   DIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpl  729
             DI  YD ++PFNLQ+GWL+W+ IGL GA+ AIALTGVA+S   +E P RE D+L++LLPL
Sbjct  164   DILRYDLKQPFNLQKGWLVWSGIGLVGAVGAIALTGVALSLFRTETPEREVDSLMKLLPL  223

Query  728   igsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPG  549
             IGSS+ISTLSL+GITGVLAP+LEETVFRGF MVSLTKW+P+P+A++ISAA F+ AHLTPG
Sbjct  224   IGSSNISTLSLVGITGVLAPLLEETVFRGFFMVSLTKWVPTPIAIIISAAAFALAHLTPG  283

Query  548   EFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELI  387
             EFPQLF+LG+ LG SYAQTRNL+TP+ IH FWNSGVILLLTFLQ+QGYDIKEL+
Sbjct  284   EFPQLFILGSVLGLSYAQTRNLITPMVIHGFWNSGVILLLTFLQVQGYDIKELL  337



>gb|AAF43926.1|AC012188_3 Contains similarity to a hypothetical protein from Synechocystis 
sp. gb|D90914.1 [Arabidopsis thaliana]
Length=354

 Score =   302 bits (773),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 189/329 (57%), Positives = 239/329 (73%), Gaps = 19/329 (6%)
 Frame = -3

Query  1310  PKLFPYKPLTQKLQLLSFRRTDQALRPRFSTTVCSYSSGNRPDP----KGSGPNCPIFRR  1143
             PK   Y  L++     + RR     R ++ +  C ++SG  P      +G     PI +R
Sbjct  27    PKTCTYGGLSRFSPGFASRRLFTVNRKKWRSA-CIFNSGKEPGGEGKLQGGSSEWPILQR  85

Query  1142  WSVPWNWQTISLTSLACGF-------SFVLT-------GLIETAAIPYTGIQVEELSLDE  1005
             W VPW WQT+SLTS AC         S ++T        L E A IP+ GI VE+L+LD+
Sbjct  86    WEVPWGWQTVSLTSFACALRYSHQKLSLLMTLGLEFDERLTEMAVIPFLGIDVEKLTLDD  145

Query  1004  KAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglaga  825
             KAEILFLDQ +TTA+VL V++T+ K+  PLP DI  YD R+P NLQ+GWL+W  IGL GA
Sbjct  146   KAEILFLDQGLTTAVVLAVIFTVAKTFDPLPEDILRYDLRQPVNLQKGWLVWGGIGLVGA  205

Query  824   laaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFR  645
             + AIALTGV +S   +E P RE D+L++LLPLIGSS+ISTLSL+GITG+LAP+LEETVFR
Sbjct  206   VGAIALTGVVLSVFRTEAPEREVDSLMKLLPLIGSSNISTLSLVGITGILAPLLEETVFR  265

Query  644   GFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITI  465
             GF MVSLTKW+P+P+A++IS+A F+ AH TPGEFPQLF+LG+ LG SYAQTRNL+TP+ I
Sbjct  266   GFFMVSLTKWVPTPIAIIISSAAFALAHFTPGEFPQLFILGSVLGLSYAQTRNLITPMVI  325

Query  464   HAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             H FWNSGVILLLTFLQ+QGYDIKEL+QA+
Sbjct  326   HGFWNSGVILLLTFLQIQGYDIKELLQAN  354



>tpg|DAA61422.1| TPA: CAAX amino terminal protease family protein [Zea mays]
Length=350

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 182/279 (65%), Positives = 218/279 (78%), Gaps = 2/279 (1%)
 Frame = -3

Query  1208  SYSSGNR--PDPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTG  1035
             SY++ N+  P    S     I RRW VPW WQT+ L+ + CG SFVLTGL+E  A+   G
Sbjct  72    SYNAKNKTPPPSDKSSDEWAIVRRWDVPWEWQTVVLSMVGCGVSFVLTGLVEQLALQELG  131

Query  1034  IQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwl  855
              +  E ++DEKAEILF  Q   T +VLGV++ +T + +P P+D++ YD +EPF LQ GWL
Sbjct  132   FKAVEATIDEKAEILFFGQLSVTVVVLGVIFGITNTFRPFPDDVFRYDIKEPFKLQNGWL  191

Query  854   lwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVL  675
             LWA IGL GA+ +IAL G AM+ LN E P RETD+LV LLPLIGSS+ ST  L+GITGVL
Sbjct  192   LWAGIGLFGAVISIALAGAAMTYLNGETPARETDSLVLLLPLIGSSTTSTAFLVGITGVL  251

Query  674   APVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQ  495
             AP+LEET+FRGFLMVSLTKW P+P  VL+SAAVF+ AHLTPG+FPQLF+LG ALGFSYAQ
Sbjct  252   APLLEETLFRGFLMVSLTKWFPTPACVLVSAAVFALAHLTPGQFPQLFILGVALGFSYAQ  311

Query  494   TRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             TRNLLTPITIHAFWNSGVILLLTFLQLQGYD+KEL+ AS
Sbjct  312   TRNLLTPITIHAFWNSGVILLLTFLQLQGYDLKELLGAS  350



>dbj|BAJ85717.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=350

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 181/276 (66%), Positives = 215/276 (78%), Gaps = 1/276 (0%)
 Frame = -3

Query  1202  SSGNRPDPKGSGPN-CPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQV  1026
             S  N P P     N  PI RRW VPW WQT+ L+ + CG SF LTGL+E + + Y G   
Sbjct  75    SYNNPPPPSSKDSNEWPILRRWDVPWEWQTVVLSMVGCGVSFALTGLVEQSILQYVGYSA  134

Query  1025  EELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwa  846
                ++DEKAEILFL Q   TA+VLGV++++T + +P P+D++ YD +EPF LQ GWLLWA
Sbjct  135   AGATIDEKAEILFLGQLSVTAVVLGVIFSITNTFRPFPDDVFRYDVKEPFKLQNGWLLWA  194

Query  845   aiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPV  666
              IGL GA+ +IAL G AMS LN  PP RE D+LV LLPLIGSS++ST  L+GIT VLAP+
Sbjct  195   GIGLFGAVISIALVGAAMSYLNGAPPEREKDSLVLLLPLIGSSTLSTAYLVGITRVLAPI  254

Query  665   LEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRN  486
             LEETVFRGFLMVSLTKW P+P+ V++SAAVF+ AHLTP +FPQLFVLG ALGF+YAQTRN
Sbjct  255   LEETVFRGFLMVSLTKWFPTPVCVILSAAVFAFAHLTPDQFPQLFVLGVALGFTYAQTRN  314

Query  485   LLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             LL PITIHAFWNSGVILLLTFLQLQGYDIKEL+ AS
Sbjct  315   LLAPITIHAFWNSGVILLLTFLQLQGYDIKELLGAS  350



>ref|NP_001141914.1| uncharacterized protein LOC100274063 [Zea mays]
 gb|ACF87301.1| unknown [Zea mays]
Length=350

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 182/279 (65%), Positives = 218/279 (78%), Gaps = 2/279 (1%)
 Frame = -3

Query  1208  SYSSGNR--PDPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTG  1035
             SY++ N+  P    S     I RRW VPW WQT+ L+ + CG SFVLTGL+E  A+   G
Sbjct  72    SYNAKNKTPPPSDKSSDEWAIVRRWDVPWEWQTVVLSMVGCGVSFVLTGLVEQLALQELG  131

Query  1034  IQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwl  855
              +  E ++DEKAEILF  Q   T +VLGV++ +T + +P P+D++ YD +EPF LQ GWL
Sbjct  132   FKAVEATIDEKAEILFFGQLSVTVVVLGVIFGITNTFRPFPDDVFRYDIKEPFKLQNGWL  191

Query  854   lwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVL  675
             LWA IGL GA+ +IAL G AM+ LN E P RETD+LV LLPLIGSS+ ST  L+GITGVL
Sbjct  192   LWAGIGLFGAVISIALAGAAMTYLNGETPARETDSLVLLLPLIGSSTTSTAFLVGITGVL  251

Query  674   APVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQ  495
             AP+LEET+FRGFLMVSLTKW P+P  VL+SAAVF+ AHLTPG+FPQLF+LG ALGFSYAQ
Sbjct  252   APLLEETLFRGFLMVSLTKWFPTPACVLVSAAVFALAHLTPGQFPQLFILGVALGFSYAQ  311

Query  494   TRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             TRNLLTPITIHAFWNSGVILLLTFLQLQGYD+KEL+ AS
Sbjct  312   TRNLLTPITIHAFWNSGVILLLTFLQLQGYDLKELLGAS  350



>gb|ACG31838.1| CAAX amino terminal protease family protein [Zea mays]
Length=350

 Score =   299 bits (765),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 189/323 (59%), Positives = 235/323 (73%), Gaps = 12/323 (4%)
 Frame = -3

Query  1337  PSAPIASLSPKLFPYKPLTQKLQLLSFRRTDQALRPRFSTTVC-SYSSGNR--PDPKGSG  1167
             P+  + + S +    +P+T +     +RR+ +    R     C SY++ N+  P    S 
Sbjct  37    PAVRVEARSQQRLQRRPVTGQ-----WRRSCR----RGGGYACFSYNAKNKTPPPSDKSS  87

Query  1166  PNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILF  987
                 I RRW VPW WQT+ L+ + CG SFVLTGL+E  A+   G +  E ++DEKAEILF
Sbjct  88    DEWAIVRRWDVPWEWQTVVLSMVGCGVSFVLTGLVEQLALQELGFKAVEATIDEKAEILF  147

Query  986   LDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaL  807
               Q   T +VLGV++ +T + +P P+D++ Y  +EPF LQ GWLLWA IGL GA+ +IAL
Sbjct  148   FGQLSVTVVVLGVIFGITNTFRPFPDDVFRYHIKEPFKLQNGWLLWAGIGLFGAVISIAL  207

Query  806   TGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVS  627
              G AM+ LN E P RETD+LV LLPLIGSS+ ST  L+GITGVLAP+LEET+FRGFLMVS
Sbjct  208   AGAAMTYLNGETPARETDSLVLLLPLIGSSTTSTAFLVGITGVLAPLLEETLFRGFLMVS  267

Query  626   LTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNS  447
             LTKW P+P  VL+SAAVF+ AHLTPG+FPQLF+LG ALGFSYAQTRNLLTPITIHAFWNS
Sbjct  268   LTKWFPTPACVLVSAAVFALAHLTPGQFPQLFILGVALGFSYAQTRNLLTPITIHAFWNS  327

Query  446   GVILLLTFLQLQGYDIKELIQAS  378
             GVILLLTFLQLQGYD+KEL+ AS
Sbjct  328   GVILLLTFLQLQGYDLKELLGAS  350



>ref|XP_006660160.1| PREDICTED: uncharacterized protein LOC102705837 [Oryza brachyantha]
Length=352

 Score =   296 bits (759),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 195/356 (55%), Positives = 241/356 (68%), Gaps = 37/356 (10%)
 Frame = -3

Query  1346  LARPSAPIASLSPKLFPYKPL----TQKLQLLSFRRTDQALRPRFSTT------------  1215
             +A PSAP +     LF  +P+       L++LS RR  Q L PR                
Sbjct  1     MASPSAPPS----LLFRLRPMPCGGGGSLRVLSKRRLRQFLSPRTGRRRVVEELLMRLPE  56

Query  1214  ----------VCSYSSGNRPDPKGSGPNC-------PIFRRWSVPWNWQTISLTSLACGF  1086
                        C  S  +R DP    P+        P+ RRW VPW W TISLT +AC  
Sbjct  57    AGRRRGCGGFACFCSLDDRNDPPALPPDNKKILDEWPVLRRWDVPWEWPTISLTMVACAV  116

Query  1085  SFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPND  906
             SF+LTG++E A + YTG Q  + ++DEKAE+LF  Q I TA+VLGV++ +T + +P  +D
Sbjct  117   SFLLTGMVEQAVLEYTGFQAGDATIDEKAEVLFFGQFIVTAVVLGVIFGITNTFRPFSDD  176

Query  905   IYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpli  726
             ++ YD +EPF L+ GWLLWA +GL GA+ +I+L G AMS L  E P R TD+LV LLPLI
Sbjct  177   VFRYDLKEPFKLENGWLLWAGVGLFGAIISISLAGAAMSFLGGETPERGTDSLVLLLPLI  236

Query  725   gsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGE  546
             GSS++ST  LLGITGVLAP+LEETVFRGFLMVSLT W  +P++VLI+A+VF+ AHLTPGE
Sbjct  237   GSSNMSTACLLGITGVLAPILEETVFRGFLMVSLTMWFSTPISVLITASVFAFAHLTPGE  296

Query  545   FPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             FPQLFVLG  LGFSYAQ+RNLLTPI IHA WNSGVILLLTFLQLQGY+IKEL+ AS
Sbjct  297   FPQLFVLGVVLGFSYAQSRNLLTPIVIHAMWNSGVILLLTFLQLQGYNIKELLSAS  352



>ref|XP_008668484.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA48964.1| TPA: hypothetical protein ZEAMMB73_611537 [Zea mays]
Length=356

 Score =   296 bits (757),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 183/283 (65%), Positives = 216/283 (76%), Gaps = 5/283 (2%)
 Frame = -3

Query  1211  CSYSSGN-----RPDPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAI  1047
             CSY + N      PD   S    PI RRW VPW W TISLT +AC  SF+LTG+ E + +
Sbjct  74    CSYDTENGLPTPSPDKGKSSDEWPILRRWDVPWEWPTISLTMVACAVSFLLTGIAEQSIL  133

Query  1046  PYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQ  867
                G +  E +LDEKAEILFL Q  TT +VLGV++ +T + +P  +DI+ Y++ EP  LQ
Sbjct  134   EQLGFRAGETTLDEKAEILFLGQLSTTVVVLGVIFGMTNTFRPFSDDIFRYEFNEPLKLQ  193

Query  866   RgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgi  687
              GWLLW+AIGL  A+ AIAL G AM+ LN E P RETD+LV LLPLIGSS+IST  LLGI
Sbjct  194   NGWLLWSAIGLFVAIVAIALAGAAMTFLNGETPQRETDSLVLLLPLIGSSNISTACLLGI  253

Query  686   tGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGF  507
             TG+LAP+LEETVFRGFLMVSLT W P+P AVL++AAVF+ AH TPGEFPQLFVLG  LGF
Sbjct  254   TGILAPILEETVFRGFLMVSLTMWFPTPYAVLMTAAVFAFAHFTPGEFPQLFVLGVVLGF  313

Query  506   SYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             SYAQTRNLLTPI IHA WNSGVILLLTFLQ+QGYDI+E++QAS
Sbjct  314   SYAQTRNLLTPIAIHAVWNSGVILLLTFLQMQGYDIREILQAS  356



>ref|XP_004973526.1| PREDICTED: uncharacterized protein LOC101774236 isoform X1 [Setaria 
italica]
 ref|XP_004973527.1| PREDICTED: uncharacterized protein LOC101774236 isoform X2 [Setaria 
italica]
 ref|XP_004973528.1| PREDICTED: uncharacterized protein LOC101774236 isoform X3 [Setaria 
italica]
Length=355

 Score =   290 bits (743),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 187/283 (66%), Positives = 216/283 (76%), Gaps = 5/283 (2%)
 Frame = -3

Query  1211  CSYSSGNRP-----DPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAI  1047
             CSY + N P     D + S    P+ RRW VPW W TISLT +AC  SF+LTG++E + +
Sbjct  73    CSYDAENGPPTPPPDREESSDEWPVLRRWDVPWEWPTISLTMVACAVSFLLTGMVEQSIL  132

Query  1046  PYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQ  867
                G QV E +LDEKAE+LFL Q  TT +VLG ++ +T + +P  +DI+ Y + EP  LQ
Sbjct  133   EQFGFQVGEATLDEKAEVLFLGQFSTTVVVLGSIFGITNTFRPFSDDIFRYKFEEPLKLQ  192

Query  866   RgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgi  687
              GWLLWA IGL  A+ AIAL G AM+ LN E P RETD+LV LLPLIGSS IST  LLGI
Sbjct  193   NGWLLWAGIGLLVAIIAIALAGAAMTFLNGETPQRETDSLVILLPLIGSSGISTACLLGI  252

Query  686   tGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGF  507
             TG+LAP+LEETVFRGFLMVSLT W  +P AVLI+AAVF+ AHLTPGEFPQLFVLG  LGF
Sbjct  253   TGILAPILEETVFRGFLMVSLTMWFSTPYAVLITAAVFAFAHLTPGEFPQLFVLGVVLGF  312

Query  506   SYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             SYAQTRNLLTPITIHA WNSGVILLLTFLQLQGYDIKEL+QAS
Sbjct  313   SYAQTRNLLTPITIHAVWNSGVILLLTFLQLQGYDIKELLQAS  355



>ref|XP_010235172.1| PREDICTED: uncharacterized protein LOC100838017 [Brachypodium 
distachyon]
 ref|XP_010235173.1| PREDICTED: uncharacterized protein LOC100838017 [Brachypodium 
distachyon]
 ref|XP_010235174.1| PREDICTED: uncharacterized protein LOC100838017 [Brachypodium 
distachyon]
Length=359

 Score =   283 bits (723),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 172/260 (66%), Positives = 207/260 (80%), Gaps = 0/260 (0%)
 Frame = -3

Query  1157  PIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQ  978
             P+ RRW VPW W TISLT +AC  S +LTG++E + + Y G Q  E ++DEKA +LFL Q
Sbjct  100   PVLRRWDVPWEWPTISLTMVACAVSSLLTGMVEKSGLEYLGYQAGEATIDEKAGVLFLGQ  159

Query  977   AITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGV  798
                TA+VLGV++ +T + +P  +DI+ YD++EPF L  GWLLWA IGL  A+  IALTG 
Sbjct  160   FSVTAVVLGVIFGITNTFRPFSDDIFRYDFKEPFKLPNGWLLWAGIGLFFAVIFIALTGA  219

Query  797   AMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTK  618
             AM+ LN E   RETD+LV LLPLIGSS+IST  LLGITGVLAP+LEETVFRGFLMVSL  
Sbjct  220   AMTFLNGEAAQRETDSLVLLLPLIGSSNISTAYLLGITGVLAPILEETVFRGFLMVSLNM  279

Query  617   WLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVI  438
             W  +P++VLI+AAVF+ AHLTPGEF QLFVLG ALGFSYAQ+RNLLTPI +HA WNSGVI
Sbjct  280   WFSTPVSVLITAAVFAFAHLTPGEFSQLFVLGVALGFSYAQSRNLLTPIMMHAIWNSGVI  339

Query  437   LLLTFLQLQGYDIKELIQAS  378
             +LLTFLQLQGY+IKEL+QAS
Sbjct  340   VLLTFLQLQGYNIKELLQAS  359



>ref|NP_973823.1| CAAX amino terminal protease family protein [Arabidopsis thaliana]
 gb|AEE29135.1| CAAX amino terminal protease family protein [Arabidopsis thaliana]
Length=247

 Score =   276 bits (706),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 165/236 (70%), Positives = 202/236 (86%), Gaps = 0/236 (0%)
 Frame = -3

Query  1085  SFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPND  906
             SFVLTGL E A IP+ GI VE+L+LD+KAEILFLDQ +TTA+VL V++T+ K+  PLP D
Sbjct  12    SFVLTGLTEMAVIPFLGIDVEKLTLDDKAEILFLDQGLTTAVVLAVIFTVAKTFDPLPED  71

Query  905   IYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpli  726
             I  YD R+P NLQ+GWL+W  IGL GA+ AIALTGV +S   +E P RE D+L++LLPLI
Sbjct  72    ILRYDLRQPVNLQKGWLVWGGIGLVGAVGAIALTGVVLSVFRTEAPEREVDSLMKLLPLI  131

Query  725   gsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGE  546
             GSS+ISTLSL+GITG+LAP+LEETVFRGF MVSLTKW+P+P+A++IS+A F+ AH TPGE
Sbjct  132   GSSNISTLSLVGITGILAPLLEETVFRGFFMVSLTKWVPTPIAIIISSAAFALAHFTPGE  191

Query  545   FPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             FPQLF+LG+ LG SYAQTRNL+TP+ IH FWNSGVILLLTFLQ+QGYDIKEL+QA+
Sbjct  192   FPQLFILGSVLGLSYAQTRNLITPMVIHGFWNSGVILLLTFLQIQGYDIKELLQAN  247



>ref|XP_010523460.1| PREDICTED: uncharacterized protein LOC104801795 isoform X3 [Tarenaya 
hassleriana]
Length=227

 Score =   275 bits (703),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 168/226 (74%), Positives = 194/226 (86%), Gaps = 0/226 (0%)
 Frame = -3

Query  1055  AAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPF  876
             A +PY GI++EELSLDEKAEILFLDQ ITTA VLGV++T+ K+  PLP DI+ YD R+PF
Sbjct  2     AVLPYLGIKIEELSLDEKAEILFLDQGITTAAVLGVIFTVAKTFDPLPEDIFRYDLRQPF  61

Query  875   NLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsl  696
             +LQ+GWLLW  IGL GA+ +IAL G  +S    E P RE D+LV+LLPLIGSS+ISTLSL
Sbjct  62    DLQKGWLLWGGIGLVGAVGSIALVGTVLSLFRGEMPEREVDSLVKLLPLIGSSNISTLSL  121

Query  695   lgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTA  516
             +GITG+LAPVLEETVFRGF MVSLTKW+P+P+AV ISAA F+ AHLTPG+FPQLFVLGT 
Sbjct  122   VGITGILAPVLEETVFRGFFMVSLTKWVPTPIAVTISAAAFALAHLTPGQFPQLFVLGTV  181

Query  515   LGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             LGFSYAQTRNL+TPI IH FWNSGVILLLTFLQLQGYDIKEL+QA 
Sbjct  182   LGFSYAQTRNLVTPIMIHGFWNSGVILLLTFLQLQGYDIKELLQAK  227



>gb|EYU28749.1| hypothetical protein MIMGU_mgv1a024984mg [Erythranthe guttata]
Length=361

 Score =   278 bits (710),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 178/311 (57%), Positives = 224/311 (72%), Gaps = 10/311 (3%)
 Frame = -3

Query  1307  KLFPYKPLTQKLQL-LSFRRTDQALRPRFSTTVC-SYSSGNRPDPKGSGPNCPIFRRWSV  1134
             +L  + PL   L+L ++  RT+       STT C + S+ +    K    N  + +RW+V
Sbjct  58    QLRHFSPLIPALKLPVTITRTN-------STTFCFTNSTPDESVEKDDELNWQVLKRWNV  110

Query  1133  PWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVL  954
             PWNWQ +SLTSLAC  S   T LI   A+ Y+GI + ELS D  A I F+   I TA+VL
Sbjct  111   PWNWQRVSLTSLACVLSLHSTVLIGVVAVAYSGINIHELSPDGMAGIGFVGYGIVTAVVL  170

Query  953   GVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSE  774
              VL++LTKS  P+  DIY YD REPF++++GWLLWA IG  GA+AA+ LT  AMS  N  
Sbjct  171   AVLFSLTKSFSPITEDIYQYDLREPFDIKKGWLLWAGIGYVGAVAALVLTVAAMSFFNFN  230

Query  773   PPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAV  594
             P  R +D+L+ LLP+IGSS+ ST  ++G+ GVL PVLEETVFRGFLMVSLTKWLP+PL+V
Sbjct  231   P-RRGSDSLMILLPMIGSSTFSTACVVGMIGVLTPVLEETVFRGFLMVSLTKWLPTPLSV  289

Query  593   LISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQL  414
             L+SAAVF+ AH TPG FPQLFV G   GFSYAQTRNLLTPITIHAFWN+G++LLLTFLQL
Sbjct  290   LLSAAVFALAHFTPGRFPQLFVGGIVFGFSYAQTRNLLTPITIHAFWNTGIVLLLTFLQL  349

Query  413   QGYDIKELIQA  381
             +GYDIK+++Q 
Sbjct  350   KGYDIKKMLQG  360



>ref|XP_007224612.1| hypothetical protein PRUPE_ppa026907mg, partial [Prunus persica]
 gb|EMJ25811.1| hypothetical protein PRUPE_ppa026907mg, partial [Prunus persica]
Length=254

 Score =   273 bits (699),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 178/254 (70%), Positives = 210/254 (83%), Gaps = 3/254 (1%)
 Frame = -3

Query  1172  SGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEI  993
             +G    I +RW VPW WQT+SLTSLACG SF+LTGL+ETAA+PY G++V++LS+DEKAEI
Sbjct  2     TGVQWQILKRWEVPWEWQTVSLTSLACGLSFILTGLVETAAVPYLGLRVQDLSIDEKAEI  61

Query  992   LFLDQAITTAIVLGVLYTLTKSSKPLPNDIY-CYDWREPFNLQRgwllwaaiglagalaa  816
             LFLDQ ITTA +L VLYT+  + +PLP D+Y CY  ++PF+LQ+GWLLWA IGLAGA+AA
Sbjct  62    LFLDQGITTAAILAVLYTVASTFQPLPQDVYRCYL-KDPFSLQKGWLLWAGIGLAGAIAA  120

Query  815   iaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRG-F  639
             IA+T  A S    E P  E DALV LLPLIGSSS+ST  LLGITGVLAP+LEETVFRG F
Sbjct  121   IAVTEAAASLFRGESPENEFDALVSLLPLIGSSSVSTACLLGITGVLAPILEETVFRGFF  180

Query  638   LMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHA  459
              MVS+T+W+P+P+A+ I AAVF+ AHLTPGEFPQLFVLG+AL  SYA T NLLTPITIHA
Sbjct  181   FMVSMTEWVPTPVAIGIGAAVFALAHLTPGEFPQLFVLGSALELSYAHTCNLLTPITIHA  240

Query  458   FWNSGVILLLTFLQ  417
              WNSGVILLLTFLQ
Sbjct  241   LWNSGVILLLTFLQ  254



>gb|ACF86904.1| unknown [Zea mays]
Length=242

 Score =   273 bits (698),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 166/241 (69%), Positives = 197/241 (82%), Gaps = 0/241 (0%)
 Frame = -3

Query  1100  LACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSK  921
             + CG SFVLTGL+E  A+   G +  E ++DEKAEILF  Q   T +VLGV++ +T + +
Sbjct  2     VGCGVSFVLTGLVEQLALQELGFKAVEATIDEKAEILFFGQLSVTVVVLGVIFGITNTFR  61

Query  920   PLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVR  741
             P P+D++ YD +EPF LQ GWLLWA IGL GA+ +IAL G AM+ LN E P RETD+LV 
Sbjct  62    PFPDDVFRYDIKEPFKLQNGWLLWAGIGLFGAVISIALAGAAMTYLNGETPARETDSLVL  121

Query  740   llpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAH  561
             LLPLIGSS+ ST  L+GITGVLAP+LEET+FRGFLMVSLTKW P+P  VL+SAAVF+ AH
Sbjct  122   LLPLIGSSTTSTAFLVGITGVLAPLLEETLFRGFLMVSLTKWFPTPACVLVSAAVFALAH  181

Query  560   LTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQA  381
             LTPG+FPQLF+LG ALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYD+KEL+ A
Sbjct  182   LTPGQFPQLFILGVALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDLKELLGA  241

Query  380   S  378
             S
Sbjct  242   S  242



>gb|KCW86842.1| hypothetical protein EUGRSUZ_B03438 [Eucalyptus grandis]
Length=312

 Score =   275 bits (703),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 168/231 (73%), Positives = 197/231 (85%), Gaps = 0/231 (0%)
 Frame = -3

Query  1178  KGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKA  999
             +GSGP+ PI +RW VPW WQT+SLTSLACG SFVLTGL+ETAAIPY G+++EELSLDEKA
Sbjct  75    EGSGPDWPILKRWDVPWQWQTVSLTSLACGVSFVLTGLVETAAIPYLGLRLEELSLDEKA  134

Query  998   EILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagala  819
             EILF+DQ+ITTA VLGVLY +T++ +P+P D++ YD +EPFNLQRGWLLWA IGL GAL 
Sbjct  135   EILFVDQSITTAAVLGVLYGITRTFQPVPEDLFRYDLKEPFNLQRGWLLWAGIGLIGALL  194

Query  818   aiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGF  639
             A+A+TG AMS  + E P RETDALVRLLPLIGSS +ST  LLGITG+LAP LEET+FRGF
Sbjct  195   AVAVTGYAMSLFSGETPQRETDALVRLLPLIGSSGVSTACLLGITGILAPFLEETIFRGF  254

Query  638   LMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRN  486
              MVSLTKW+P+P+AVLISAAVF+ AHLTPGEFPQLFVLG+ L F     RN
Sbjct  255   FMVSLTKWVPTPVAVLISAAVFALAHLTPGEFPQLFVLGSDLIFYDMVKRN  305



>ref|XP_010937145.1| PREDICTED: uncharacterized protein LOC105056591 isoform X2 [Elaeis 
guineensis]
Length=309

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 175/282 (62%), Positives = 209/282 (74%), Gaps = 40/282 (14%)
 Frame = -3

Query  1211  CSYSSGNRPDP----KGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIP  1044
             C Y++ ++ +P    K      PI +RW VPW WQT +LT +ACG S V           
Sbjct  64    CFYNAKDKLEPTSREKALKVEWPILQRWDVPWGWQTATLTMIACGVSAV-----------  112

Query  1043  YTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQR  864
                                      TA+VLGV+Y +T S +PLP+DI+CYDW++PF+LQ 
Sbjct  113   -------------------------TAVVLGVIYGITNSFRPLPDDIFCYDWKDPFSLQN  147

Query  863   gwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgit  684
             GWLLWA IGL GAL AIAL GVA+++ + E P RETDAL+RLLPLIGSSSIST  L+G+T
Sbjct  148   GWLLWAGIGLVGALIAIALAGVALTTFSGENPQRETDALIRLLPLIGSSSISTACLVGVT  207

Query  683   GVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFS  504
             GVLAP+LEETVFRGFLMVSLTKW+P+P++VLISAAVF+ AHLTPGEFPQLF+LG ALGFS
Sbjct  208   GVLAPILEETVFRGFLMVSLTKWVPTPVSVLISAAVFAIAHLTPGEFPQLFLLGAALGFS  267

Query  503   YAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             YAQTRNLLTPITIH+ WNSGVILLLTFLQLQGYDI+EL+QAS
Sbjct  268   YAQTRNLLTPITIHSIWNSGVILLLTFLQLQGYDIRELLQAS  309



>ref|XP_009110553.1| PREDICTED: uncharacterized protein LOC103836079 isoform X3 [Brassica 
rapa]
 ref|XP_009110554.1| PREDICTED: uncharacterized protein LOC103836079 isoform X3 [Brassica 
rapa]
 ref|XP_009110555.1| PREDICTED: uncharacterized protein LOC103836079 isoform X3 [Brassica 
rapa]
Length=227

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 157/226 (69%), Positives = 195/226 (86%), Gaps = 0/226 (0%)
 Frame = -3

Query  1055  AAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPF  876
             AA+PY G+ VE+LSLD+KAEILFLDQ ITTA++L V++T+ K+  PLP DI  YD ++PF
Sbjct  2     AALPYLGVDVEKLSLDQKAEILFLDQGITTAVILAVIFTVAKTFDPLPEDILRYDLKQPF  61

Query  875   NLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsl  696
             NLQ+GWL+W  IGL  A+  IALTGVA+S  ++E P RE D+L++LLPLIGSS+ISTLSL
Sbjct  62    NLQKGWLVWGGIGLVAAVGGIALTGVALSLFSTETPEREVDSLMQLLPLIGSSNISTLSL  121

Query  695   lgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTA  516
             +GITGVLAP+LEETVFRGF MVSLTKW+P+P+A++IS+A F+ AHLTPGEFPQLF+LG+ 
Sbjct  122   VGITGVLAPLLEETVFRGFFMVSLTKWVPTPIAIIISSAAFALAHLTPGEFPQLFILGSV  181

Query  515   LGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             LG +YAQTRNL+TP+ IH  WNSGVILLLTFLQ+QGYDIKEL+Q S
Sbjct  182   LGLTYAQTRNLITPMVIHGLWNSGVILLLTFLQVQGYDIKELLQGS  227



>gb|ABI34291.1| CAAX amino terminal protease family protein, putative [Solanum 
demissum]
Length=339

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 195/321 (61%), Positives = 216/321 (67%), Gaps = 56/321 (17%)
 Frame = -3

Query  1316  LSPKLFPYKPLTQKLQLLS-------FRRTDQALRP---RFSTTVCSYSSGNRPDPKGSG  1167
              SPKL+  KPL QK   +S        +  D A      R  TT+C  S  N PD KG G
Sbjct  15    FSPKLYSSKPLLQKSHRISIAPLTPFLKFQDSAASQASTRGFTTICFSSPRNGPDYKGGG  74

Query  1166  PNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILF  987
             P+ PI RRW VPWNWQT+SL+SLACG S                                
Sbjct  75    PDWPILRRWDVPWNWQTVSLSSLACGLS--------------------------------  102

Query  986   LDQAITTAIVLGVLYTLTKSSKPLPNDIYCYD-W---------REPFNLQRgwllwaaig  837
                 ITTA+VL VLYTLTKSS+PLP+DIY Y+ W             +   GWLLWA IG
Sbjct  103   ----ITTAVVLIVLYTLTKSSQPLPDDIYRYENWIAVSSTLKDYSVVDYDLGWLLWAGIG  158

Query  836   lagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEE  657
             LAGA+ AIALTGVAMS+ N EPP RETDAL RLLPLIGSSSIST SLLGITGVLAP+LEE
Sbjct  159   LAGAIGAIALTGVAMSAFNGEPPQRETDALARLLPLIGSSSISTASLLGITGVLAPILEE  218

Query  656   TVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLT  477
             TVFRGF MVSLTKW+P+PLA +IS AVF+ AHLTPG+FPQLFVLGTALGFSYAQTRNLLT
Sbjct  219   TVFRGFFMVSLTKWVPTPLAAVISGAVFALAHLTPGQFPQLFVLGTALGFSYAQTRNLLT  278

Query  476   PITIHAFWNSGVILLLTFLQL  414
             PITIHA WNSGVI LLTFLQ+
Sbjct  279   PITIHALWNSGVIFLLTFLQV  299



>ref|XP_010458920.1| PREDICTED: uncharacterized protein LOC104740091 isoform X3 [Camelina 
sativa]
 ref|XP_010458921.1| PREDICTED: uncharacterized protein LOC104740091 isoform X3 [Camelina 
sativa]
Length=227

 Score =   266 bits (679),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 160/226 (71%), Positives = 196/226 (87%), Gaps = 0/226 (0%)
 Frame = -3

Query  1055  AAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPF  876
             A IP+ GI  E+LSLD+KAEILFLDQ +TTA+VL V++T+ K+ +PLP DI  YD R+PF
Sbjct  2     AVIPFLGIDAEKLSLDDKAEILFLDQGLTTAVVLAVIFTVAKTFEPLPEDILRYDLRQPF  61

Query  875   NLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsl  696
             NLQ+GWL+W  IGL GA+ AIALTGVA+S   +E P RE D+L++LLPLIGSSSISTLSL
Sbjct  62    NLQKGWLVWGGIGLVGAVGAIALTGVALSLFRTEAPEREVDSLMKLLPLIGSSSISTLSL  121

Query  695   lgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTA  516
             +GITG+LAP+LEETVFRGF MVSLTKW+P+P+A++IS+A F+ AHLTPGEFPQLF+LG+ 
Sbjct  122   VGITGILAPLLEETVFRGFFMVSLTKWVPTPIAIIISSAAFALAHLTPGEFPQLFILGSV  181

Query  515   LGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             LG SYAQTRNL+TP+ IH  WNSGVILLLTFLQ+QGYDIKEL+QA+
Sbjct  182   LGLSYAQTRNLITPMVIHGIWNSGVILLLTFLQIQGYDIKELLQAN  227



>ref|XP_010495885.1| PREDICTED: uncharacterized protein LOC104773030 isoform X2 [Camelina 
sativa]
Length=227

 Score =   265 bits (676),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 160/226 (71%), Positives = 195/226 (86%), Gaps = 0/226 (0%)
 Frame = -3

Query  1055  AAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPF  876
             A IP  GI  E+LSLD+KAEILFLDQ +TTA+VL V++T+ K+ +PLP DI  YD R+PF
Sbjct  2     AVIPLLGIDAEKLSLDDKAEILFLDQGLTTAVVLAVIFTVAKTFEPLPEDILRYDLRQPF  61

Query  875   NLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsl  696
             NLQ+GWL+W  IGL GA+ AIALTGVA+S   +E P RE D+L++LLPLIGSSSISTLSL
Sbjct  62    NLQKGWLVWGGIGLVGAVGAIALTGVALSLFRTEAPEREVDSLMKLLPLIGSSSISTLSL  121

Query  695   lgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTA  516
             +GITG+LAP+LEETVFRGF MVSLTKW+P+P+A++IS+A F+ AHLTPGEFPQLF+LG+ 
Sbjct  122   VGITGILAPLLEETVFRGFFMVSLTKWVPTPIAIIISSAAFALAHLTPGEFPQLFILGSV  181

Query  515   LGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             LG SYAQTRNL+TP+ IH  WNSGVILLLTFLQ+QGYDIKEL+QA+
Sbjct  182   LGLSYAQTRNLITPMVIHGIWNSGVILLLTFLQIQGYDIKELLQAN  227



>ref|NP_001077532.1| CAAX amino terminal protease family protein [Arabidopsis thaliana]
 ref|NP_001117285.1| CAAX amino terminal protease family protein [Arabidopsis thaliana]
 gb|AAM14026.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29136.1| CAAX amino terminal protease family protein [Arabidopsis thaliana]
 gb|AEE29137.1| CAAX amino terminal protease family protein [Arabidopsis thaliana]
Length=227

 Score =   263 bits (671),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 157/226 (69%), Positives = 194/226 (86%), Gaps = 0/226 (0%)
 Frame = -3

Query  1055  AAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPF  876
             A IP+ GI VE+L+LD+KAEILFLDQ +TTA+VL V++T+ K+  PLP DI  YD R+P 
Sbjct  2     AVIPFLGIDVEKLTLDDKAEILFLDQGLTTAVVLAVIFTVAKTFDPLPEDILRYDLRQPV  61

Query  875   NLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsl  696
             NLQ+GWL+W  IGL GA+ AIALTGV +S   +E P RE D+L++LLPLIGSS+ISTLSL
Sbjct  62    NLQKGWLVWGGIGLVGAVGAIALTGVVLSVFRTEAPEREVDSLMKLLPLIGSSNISTLSL  121

Query  695   lgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTA  516
             +GITG+LAP+LEETVFRGF MVSLTKW+P+P+A++IS+A F+ AH TPGEFPQLF+LG+ 
Sbjct  122   VGITGILAPLLEETVFRGFFMVSLTKWVPTPIAIIISSAAFALAHFTPGEFPQLFILGSV  181

Query  515   LGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             LG SYAQTRNL+TP+ IH FWNSGVILLLTFLQ+QGYDIKEL+QA+
Sbjct  182   LGLSYAQTRNLITPMVIHGFWNSGVILLLTFLQIQGYDIKELLQAN  227



>gb|AAT38755.2| CAAX amino terminal protease family protein, putative [Solanum 
demissum]
Length=283

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 176/240 (73%), Positives = 195/240 (81%), Gaps = 15/240 (6%)
 Frame = -3

Query  1088  FSFVLT-----GLIETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSS  924
             F FVL      GLIETA+IPY G+ VE LSLDEKAEILF DQ ITTA+VL VLYTLTKSS
Sbjct  4     FCFVLELGRILGLIETASIPYVGLDVEALSLDEKAEILFADQFITTAVVLIVLYTLTKSS  63

Query  923   KPLPNDIYCYD-WREPFNLQRgwllw---------aaiglagalaaiaLTGVAMSSLNSE  774
             +PLP+DIY Y+ W    +  + + +          A IGLAGA+ AIALTGVAMS+ N E
Sbjct  64    QPLPDDIYRYENWIAVSSTLKDYSVVDYDLGWLLWAGIGLAGAVGAIALTGVAMSAFNGE  123

Query  773   PPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAV  594
             PP RETDAL RLLPLIGSSSIST SLLGITGVLAP+LEETVFRGF MVSLTKW+P+PLA 
Sbjct  124   PPQRETDALARLLPLIGSSSISTASLLGITGVLAPILEETVFRGFFMVSLTKWVPTPLAA  183

Query  593   LISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQL  414
             +IS AVF+ AHLTPG+FPQLFVLGTALGFSYAQTRNLLTPITIHA WNSGVILLLTFLQ+
Sbjct  184   VISGAVFALAHLTPGQFPQLFVLGTALGFSYAQTRNLLTPITIHALWNSGVILLLTFLQV  243



>ref|XP_009148710.1| PREDICTED: uncharacterized protein LOC103872119 isoform X2 [Brassica 
rapa]
Length=228

 Score =   259 bits (662),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 157/223 (70%), Positives = 194/223 (87%), Gaps = 0/223 (0%)
 Frame = -3

Query  1055  AAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPF  876
              A+PY GI V++LSLD+KAEILFLDQ +TT  VL V++T+ K+ +PLP DI  YD ++PF
Sbjct  2     VALPYLGIDVQKLSLDDKAEILFLDQGLTTLAVLAVIFTVAKTFEPLPEDILRYDLKQPF  61

Query  875   NLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsl  696
             NLQ+GWL+W+ IGL GA+ AIALTGVA+S   +E P RE D+L++LLPLIGSS+ISTLSL
Sbjct  62    NLQKGWLVWSGIGLVGAVGAIALTGVALSLFRTETPEREVDSLMKLLPLIGSSNISTLSL  121

Query  695   lgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTA  516
             +GITGVLAP+LEETVFRGF MVSLTKW+P+P+A++IS+A F+ AHLTPGEFPQLF+LG+ 
Sbjct  122   VGITGVLAPLLEETVFRGFFMVSLTKWVPTPIAIIISSAAFALAHLTPGEFPQLFILGSV  181

Query  515   LGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELI  387
             LG SYAQTRNL+TP+ IH FWNSGVILLLTFLQ+QGYDIKEL+
Sbjct  182   LGLSYAQTRNLITPMVIHGFWNSGVILLLTFLQVQGYDIKELL  224



>ref|XP_010937146.1| PREDICTED: uncharacterized protein LOC105056591 isoform X3 [Elaeis 
guineensis]
Length=236

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = -3

Query  995  ILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaa  816
            ++F  +   TA+VLGV+Y +T S +PLP+DI+CYDW++PF+LQ GWLLWA IGL GAL A
Sbjct  31   LVFRVENAVTAVVLGVIYGITNSFRPLPDDIFCYDWKDPFSLQNGWLLWAGIGLVGALIA  90

Query  815  iaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFL  636
            IAL GVA+++ + E P RETDAL+RLLPLIGSSSIST  L+G+TGVLAP+LEETVFRGFL
Sbjct  91   IALAGVALTTFSGENPQRETDALIRLLPLIGSSSISTACLVGVTGVLAPILEETVFRGFL  150

Query  635  MVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAF  456
            MVSLTKW+P+P++VLISAAVF+ AHLTPGEFPQLF+LG ALGFSYAQTRNLLTPITIH+ 
Sbjct  151  MVSLTKWVPTPVSVLISAAVFAIAHLTPGEFPQLFLLGAALGFSYAQTRNLLTPITIHSI  210

Query  455  WNSGVILLLTFLQLQGYDIKELIQAS  378
            WNSGVILLLTFLQLQGYDI+EL+QAS
Sbjct  211  WNSGVILLLTFLQLQGYDIRELLQAS  236



>ref|XP_004956805.1| PREDICTED: uncharacterized protein LOC101774793 isoform X2 [Setaria 
italica]
Length=318

 Score =   253 bits (646),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 177/334 (53%), Positives = 216/334 (65%), Gaps = 48/334 (14%)
 Frame = -3

Query  1343  ARPSAPIA-SLSPKLFPY---------KPLTQKLQLLSFRRTDQALRPRFSTTVCSYSSG  1194
             A PS P+  S   K FPY         +   + L+L    R  ++ R        SY++ 
Sbjct  21    ALPSKPLLLSRHRKPFPYPKSGRIAVARAQQRLLRLPETGRWGRSWRRGGGFPCFSYNAN  80

Query  1193  NRPDP--KGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEE  1020
             N   P    S  N  I +RW VPW WQT+ L+ + CG S V                   
Sbjct  81    NESPPPSDKSSDNWRILQRWDVPWEWQTVVLSMVGCGVSSV-------------------  121

Query  1019  LSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaai  840
                              T +VLGV++ +T + +P P+D++ YD +EPF L+ GWLLWA +
Sbjct  122   -----------------TVVVLGVIFGITNTFRPFPDDVFRYDIKEPFKLKNGWLLWAGV  164

Query  839   glagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLE  660
             GL GA+ +I LTG AM+ LN EPP RETD+LV LLPLIGSS+ ST  L+GITGVLAP+LE
Sbjct  165   GLFGAIISIGLTGAAMTYLNGEPPERETDSLVLLLPLIGSSTTSTAFLVGITGVLAPLLE  224

Query  659   ETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLL  480
             ET+FRGFLMVSLTKW P+P+ VL+SAAVF+ AHLTPG+FPQLF+LG ALGFSYAQTRNLL
Sbjct  225   ETLFRGFLMVSLTKWFPTPVCVLVSAAVFALAHLTPGQFPQLFILGVALGFSYAQTRNLL  284

Query  479   TPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             TPITIHAFWNSGVILLLTFLQLQGYDIKEL+ AS
Sbjct  285   TPITIHAFWNSGVILLLTFLQLQGYDIKELLGAS  318



>gb|EYU28747.1| hypothetical protein MIMGU_mgv1a008800mg [Erythranthe guttata]
Length=362

 Score =   251 bits (642),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 163/285 (57%), Positives = 202/285 (71%), Gaps = 3/285 (1%)
 Frame = -3

Query  1229  RFSTTVC--SYSSGNRPDPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIET  1056
             R STT C  + SS + P  K +G    + +RW VPWN QTISLTSLAC  S  LT LIE 
Sbjct  79    RNSTTFCFTNNSSPDEPVEKDNGSTWQVLKRWDVPWNGQTISLTSLACVVSCALTVLIEA  138

Query  1055  AAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPF  876
             AA+ Y+GI  ++LSLD+ A   FL Q I T ++L V  +LTKS  P+P DIY YD REPF
Sbjct  139   AAVIYSGITTDKLSLDQLAGFCFLSQGIPTVVILAVQLSLTKSLSPIPEDIYKYDLREPF  198

Query  875   NLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsl  696
             +L++GWLLWA IG  GA AAI LT   MS +N  P  RE D ++ LLP+IG S+ ST  L
Sbjct  199   DLKKGWLLWAGIGYVGARAAIYLTNSVMSFINYRP-KREIDYIMILLPMIGHSTFSTACL  257

Query  695   lgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTA  516
             LG+ GVLAP+LEETVFRGFLMVSLTKW P P++VL+SAAVF+ AH   G  PQLF  G  
Sbjct  258   LGMVGVLAPILEETVFRGFLMVSLTKWFPIPVSVLLSAAVFALAHFDVGGLPQLFAHGIV  317

Query  515   LGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQA  381
             LGF YAQTRNL+TPITI A WN+ + LLL++L  +GYD++ ++Q+
Sbjct  318   LGFCYAQTRNLVTPITIQALWNTRICLLLSYLLHKGYDVRGMLQS  362



>tpg|DAA48961.1| TPA: hypothetical protein ZEAMMB73_611537 [Zea mays]
Length=333

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 166/283 (59%), Positives = 195/283 (69%), Gaps = 28/283 (10%)
 Frame = -3

Query  1211  CSYSSGN-----RPDPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAI  1047
             CSY + N      PD   S    PI RRW VPW W TISLT +AC     L  +      
Sbjct  74    CSYDTENGLPTPSPDKGKSSDEWPILRRWDVPWEWPTISLTMVACAVRVTLLAIF-----  128

Query  1046  PYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQ  867
                                F   + TT +VLGV++ +T + +P  +DI+ Y++ EP  LQ
Sbjct  129   ------------------CFCKCSSTTVVVLGVIFGMTNTFRPFSDDIFRYEFNEPLKLQ  170

Query  866   RgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgi  687
              GWLLW+AIGL  A+ AIAL G AM+ LN E P RETD+LV LLPLIGSS+IST  LLGI
Sbjct  171   NGWLLWSAIGLFVAIVAIALAGAAMTFLNGETPQRETDSLVLLLPLIGSSNISTACLLGI  230

Query  686   tGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGF  507
             TG+LAP+LEETVFRGFLMVSLT W P+P AVL++AAVF+ AH TPGEFPQLFVLG  LGF
Sbjct  231   TGILAPILEETVFRGFLMVSLTMWFPTPYAVLMTAAVFAFAHFTPGEFPQLFVLGVVLGF  290

Query  506   SYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             SYAQTRNLLTPI IHA WNSGVILLLTFLQ+QGYDI+E++QAS
Sbjct  291   SYAQTRNLLTPIAIHAVWNSGVILLLTFLQMQGYDIREILQAS  333



>ref|XP_002444401.1| hypothetical protein SORBIDRAFT_07g021390 [Sorghum bicolor]
 gb|EES13896.1| hypothetical protein SORBIDRAFT_07g021390 [Sorghum bicolor]
Length=335

 Score =   248 bits (632),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 164/283 (58%), Positives = 200/283 (71%), Gaps = 28/283 (10%)
 Frame = -3

Query  1211  CSYSSGNR-----PDPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAI  1047
             CSY + N      PD   S    P+ RRW VPW W TISLT +AC               
Sbjct  76    CSYDTKNGLPTPPPDKGKSSDEWPVLRRWDVPWEWPTISLTMVACA--------------  121

Query  1046  PYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQ  867
                 ++V  L++       F   + TT +VLGV++ +T + +P  +DI+ Y+++EPF LQ
Sbjct  122   ----VRVTLLAI-----FYFCKCSSTTVVVLGVIFGITGTFRPFSDDIFRYEFKEPFKLQ  172

Query  866   RgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgi  687
              GWLLW+ IGL  A+ AIAL G AM+ +N E P RETD+LV LLPLIGSS++ST  LLGI
Sbjct  173   NGWLLWSGIGLFVAVVAIALAGAAMTFVNGETPQRETDSLVLLLPLIGSSNVSTACLLGI  232

Query  686   tGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGF  507
             TG+LAP+LEETVFRGFLMVSLT W  +P AVLI+AA+F+ AHLTPGEFPQLFVLG  LGF
Sbjct  233   TGILAPILEETVFRGFLMVSLTMWFSTPYAVLITAAMFAFAHLTPGEFPQLFVLGVVLGF  292

Query  506   SYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             SYAQTRNLLTPI IHA WNSGVILLLTFLQ+QGYDI+E++QAS
Sbjct  293   SYAQTRNLLTPIAIHAVWNSGVILLLTFLQMQGYDIREILQAS  335



>gb|KEH19739.1| CAAX amino terminal protease family protein [Medicago truncatula]
Length=293

 Score =   246 bits (627),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 158/241 (66%), Positives = 188/241 (78%), Gaps = 5/241 (2%)
 Frame = -3

Query  1229  RFSTTVCSYSS-GNRPDPK----GSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGL  1065
             R   +VC ++S  N+ D K     S    PI RRW VPW WQT+SLTSLACG  FVLTGL
Sbjct  51    RILPSVCFFNSRDNKSDTKLQDQDSRSEWPILRRWEVPWEWQTVSLTSLACGLGFVLTGL  110

Query  1064  IETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWR  885
              E  A+PY GI+ + LSLDEKAE+LF+DQ ITTA VLG++Y++  + +PLP   + YD R
Sbjct  111   AEATALPYLGIRPDMLSLDEKAELLFIDQGITTAAVLGIIYSVFNTYQPLPEGFFKYDLR  170

Query  884   EPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssist  705
             EPFNLQ+GWLLWA +GL GAL +I LTGVA+S  N E P RETDALVRLLPLIGSSSIST
Sbjct  171   EPFNLQKGWLLWAGVGLVGALVSIGLTGVAVSFFNGETPERETDALVRLLPLIGSSSIST  230

Query  704   lsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVL  525
               L+GITGV AP+LEETVFRGF M SLTKW+P+P+A+++SAAVF+ AHLTPGEFPQLFVL
Sbjct  231   ACLVGITGVFAPLLEETVFRGFFMTSLTKWVPTPVAIILSAAVFALAHLTPGEFPQLFVL  290

Query  524   G  522
             G
Sbjct  291   G  291



>gb|EMS56159.1| Putative membrane peptidase ydiL [Triticum urartu]
Length=288

 Score =   241 bits (615),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 151/223 (68%), Positives = 182/223 (82%), Gaps = 0/223 (0%)
 Frame = -3

Query  1085  SFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPND  906
             SF LTGL+E + + Y G      ++DEKAEILFL Q   TA+VLGV++++T + +P P+D
Sbjct  17    SFALTGLVEQSILQYVGFSAAGATIDEKAEILFLGQLSVTAVVLGVIFSITNTFRPFPDD  76

Query  905   IYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpli  726
             ++ YD +EPF LQ GWLLWA IGL GA+ +IAL G AM+ LN  PP RE D+LV LLPLI
Sbjct  77    VFRYDVKEPFKLQNGWLLWAGIGLFGAVISIALVGAAMTYLNGAPPEREKDSLVLLLPLI  136

Query  725   gsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGE  546
             GSS++ST  L+GITGVLAP+LEETVFRGFLMVSLTKW P+P+ V++SAAVF+ AHLTP +
Sbjct  137   GSSTLSTAYLVGITGVLAPILEETVFRGFLMVSLTKWFPTPVCVILSAAVFAFAHLTPDQ  196

Query  545   FPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQ  417
             FPQLFVLG ALGF+YAQTRNLL PITIHAFWNSGVILLLTFLQ
Sbjct  197   FPQLFVLGVALGFTYAQTRNLLAPITIHAFWNSGVILLLTFLQ  239



>gb|EEE68756.1| hypothetical protein OsJ_27450 [Oryza sativa Japonica Group]
Length=323

 Score =   234 bits (598),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 163/283 (58%), Positives = 188/283 (66%), Gaps = 41/283 (14%)
 Frame = -3

Query  1211  CSYSSGNR-----PDPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAI  1047
             CS+   N      PD K    +  + RRW VPW W TISLT +AC  S V          
Sbjct  77    CSFDDSNESPQLPPDNKEILDDWSVLRRWDVPWEWPTISLTMVACAVSSV----------  126

Query  1046  PYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQ  867
                                       TA VLGV++ +T + +P  NDI+ YD +EPF L+
Sbjct  127   --------------------------TAAVLGVIFGITNTYRPFSNDIFRYDLKEPFKLE  160

Query  866   RgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgi  687
              GWLLWA IG   A+ +IAL G AMS L  E P RETD+LV LLPLIGSS+IST  LLGI
Sbjct  161   NGWLLWAGIGFFAAIISIALAGAAMSFLGGETPERETDSLVLLLPLIGSSNISTACLLGI  220

Query  686   tGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGF  507
             TGVLAP+LEETVFRGFLMVSLT W  +P++VLI+A+VF+ AHLTPGEFPQLFVLG  LGF
Sbjct  221   TGVLAPILEETVFRGFLMVSLTMWFSTPISVLITASVFAFAHLTPGEFPQLFVLGIVLGF  280

Query  506   SYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             SYAQTRNLLTPI IHA WNSGVILLLT LQLQGY+IKEL+ AS
Sbjct  281   SYAQTRNLLTPIIIHAMWNSGVILLLTVLQLQGYNIKELLLAS  323



>dbj|BAD10144.1| CAAX amino terminal protease family-like protein [Oryza sativa 
Japonica Group]
Length=321

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 161/283 (57%), Positives = 187/283 (66%), Gaps = 43/283 (15%)
 Frame = -3

Query  1211  CSYSSGNR-----PDPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAI  1047
             CS+   N      PD K    +  + RRW VPW W TISLT +AC +S V          
Sbjct  77    CSFDDSNESPQLPPDNKEILDDWSVLRRWDVPWEWPTISLTMVACAYSSV----------  126

Query  1046  PYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQ  867
                                       TA VLGV++ +T + +P  NDI+ YD +EPF L+
Sbjct  127   --------------------------TAAVLGVIFGITNTYRPFSNDIFRYDLKEPFKLE  160

Query  866   RgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgi  687
              GWLLWA IG   A+ +IAL G AMS L  E P RETD+LV LLPLIGSS+IST  LLGI
Sbjct  161   NGWLLWAGIGFFAAIISIALAGAAMSFLGGETPERETDSLVLLLPLIGSSNISTACLLGI  220

Query  686   tGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGF  507
             TGVLAP+LEETVFRGFLMVSLT W  +P++VLI+A+VF+ AHLTPGEFPQLFVLG  LGF
Sbjct  221   TGVLAPILEETVFRGFLMVSLTMWFSTPISVLITASVFAFAHLTPGEFPQLFVLGIVLGF  280

Query  506   SYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             SYAQTRNLLTPI IHA WNSGVILLLT   LQGY+IKEL+ AS
Sbjct  281   SYAQTRNLLTPIIIHAMWNSGVILLLTV--LQGYNIKELLLAS  321



>gb|EMT33317.1| hypothetical protein F775_52251 [Aegilops tauschii]
Length=388

 Score =   229 bits (583),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 156/260 (60%), Positives = 182/260 (70%), Gaps = 36/260 (14%)
 Frame = -3

Query  1157  PIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQ  978
             P   RW VPW W T+SLT +AC  S V                                 
Sbjct  165   PALSRWDVPWQWPTVSLTMVACALSSV---------------------------------  191

Query  977   AITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGV  798
                TA+ +GV++ +T + +P  +DI+ YD++EPF LQ GWLLWA IGL  AL +I+LTG 
Sbjct  192   ---TAVAIGVIFGITNTFRPFSDDIFRYDFKEPFKLQNGWLLWAGIGLFFALVSISLTGA  248

Query  797   AMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTK  618
              M+ LN E   RETD+L  LLPLIGSS+IST  LLGITGVLAP+LEETVFRGFLMVSLT 
Sbjct  249   VMTFLNGETTQRETDSLGLLLPLIGSSNISTACLLGITGVLAPILEETVFRGFLMVSLTM  308

Query  617   WLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVI  438
             W  +P++VLI+A VF+ AHLTPGE PQLFVLG ALGFSY+QTRNLLTPITIHA WNSGVI
Sbjct  309   WFSTPVSVLITAVVFAFAHLTPGEIPQLFVLGVALGFSYSQTRNLLTPITIHAAWNSGVI  368

Query  437   LLLTFLQLQGYDIKELIQAS  378
             LLLTFLQLQGYDIKEL+QAS
Sbjct  369   LLLTFLQLQGYDIKELLQAS  388



>ref|XP_006438678.1| hypothetical protein CICLE_v10032082mg [Citrus clementina]
 gb|ESR51918.1| hypothetical protein CICLE_v10032082mg [Citrus clementina]
Length=250

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 153/246 (62%), Positives = 184/246 (75%), Gaps = 10/246 (4%)
 Frame = -3

Query  1325  IASLSPKLFPYKPLTQKLQLL---SFRRTDQALRPRFSTTVCSYSSGNRPD-----PKGS  1170
             IA+L+   F     +QKL  L   S  R  +    RFS+ +C Y++G   +      K +
Sbjct  6     IAALAQPCFYSFSTSQKLSKLKPNSNTRVTKTCYRRFSS-ICFYNAGKDSESGSTEDKET  64

Query  1169  GPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEIL  990
               + P+ +RW VPW WQT SLTSLACGFSFVLTGL+E AA+PY G+++EELSLDEKAEIL
Sbjct  65    KLDWPVLKRWDVPWGWQTASLTSLACGFSFVLTGLVEAAALPYLGLKIEELSLDEKAEIL  124

Query  989   FLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaia  810
             FLDQ ITTA++LGVLY ++ + KPLP D++CYD REPFNL++GWLLWA IGL GAL A+A
Sbjct  125   FLDQGITTAVILGVLYGISSTFKPLPEDLFCYDLREPFNLKKGWLLWAGIGLGGALLAVA  184

Query  809   LTGVAMSSLNSE-PPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLM  633
              TG A+S  N E PP RETDALVRLLPLIGSSSIST  L+GITGVLAP+LEE VFRGF M
Sbjct  185   ATGAALSLFNGENPPERETDALVRLLPLIGSSSISTACLVGITGVLAPLLEENVFRGFFM  244

Query  632   VSLTKW  615
             VSLTKW
Sbjct  245   VSLTKW  250



>ref|XP_002460206.1| hypothetical protein SORBIDRAFT_02g024590 [Sorghum bicolor]
 gb|EER96727.1| hypothetical protein SORBIDRAFT_02g024590 [Sorghum bicolor]
Length=306

 Score =   221 bits (564),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 177/234 (76%), Gaps = 2/234 (1%)
 Frame = -3

Query  1208  SYSSGNR--PDPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTG  1035
             SY++ N+  P    S     I RRW VPW WQT+ L+ + CG SFVLTGL+E +A+ Y G
Sbjct  68    SYNANNKTPPPSDKSSDKWAILRRWDVPWEWQTVVLSMVGCGVSFVLTGLVEQSALQYLG  127

Query  1034  IQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwl  855
              +  E ++DEKAEILF  Q   T +VLGV++++T + +P P+D++ YD +EPF LQ GWL
Sbjct  128   FKAVEATIDEKAEILFFGQLSVTVVVLGVIFSITNTFRPFPDDMFRYDIKEPFKLQNGWL  187

Query  854   lwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVL  675
             LWA +GL GA+ +IAL G AM+ LN E P RETD+LV LLPLIGSS+ ST  L+GITGVL
Sbjct  188   LWAGVGLFGAIISIALAGAAMTYLNGETPERETDSLVLLLPLIGSSTTSTAFLVGITGVL  247

Query  674   APVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTAL  513
             AP+LEET+FRGFLMVSLTKW P+P  VL+SAAVF+ AHLTPG+FPQLF+LG +L
Sbjct  248   APLLEETLFRGFLMVSLTKWFPTPFCVLVSAAVFALAHLTPGQFPQLFILGNSL  301



>dbj|BAJ85779.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=190

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = -3

Query  947  LYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPP  768
            ++ +T + +P  +DI+ YD +EPF LQ GWLLWA IGL  AL +I LTG AMS LN E  
Sbjct  1    MFGITNTFRPFSDDIFRYDLKEPFKLQNGWLLWAGIGLFFALVSIVLTGAAMSFLNGETT  60

Query  767  TRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLI  588
             RETD+LV LLPLIGSS+IST  LLGITGVLAP+LEETVFRGFLMVSLT W  +P++VLI
Sbjct  61   QRETDSLVLLLPLIGSSNISTACLLGITGVLAPILEETVFRGFLMVSLTMWFSTPVSVLI  120

Query  587  SAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQG  408
            +A VF+ AHLTPGEFPQLFVLG ALGFSY+QTRNL+TPITIHA WNSGVILLLT LQLQG
Sbjct  121  TAVVFAFAHLTPGEFPQLFVLGLALGFSYSQTRNLITPITIHAVWNSGVILLLTVLQLQG  180

Query  407  YDIKELIQAS  378
            YDIKEL+QAS
Sbjct  181  YDIKELLQAS  190



>tpg|DAA48960.1| TPA: hypothetical protein ZEAMMB73_611537 [Zea mays]
Length=187

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = -3

Query  938  LTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRE  759
            +T + +P  +DI+ Y++ EP  LQ GWLLW+AIGL  A+ AIAL G AM+ LN E P RE
Sbjct  1    MTNTFRPFSDDIFRYEFNEPLKLQNGWLLWSAIGLFVAIVAIALAGAAMTFLNGETPQRE  60

Query  758  TDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAA  579
            TD+LV LLPLIGSS+IST  LLGITG+LAP+LEETVFRGFLMVSLT W P+P AVL++AA
Sbjct  61   TDSLVLLLPLIGSSNISTACLLGITGILAPILEETVFRGFLMVSLTMWFPTPYAVLMTAA  120

Query  578  VFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDI  399
            VF+ AH TPGEFPQLFVLG  LGFSYAQTRNLLTPI IHA WNSGVILLLTFLQ+QGYDI
Sbjct  121  VFAFAHFTPGEFPQLFVLGVVLGFSYAQTRNLLTPIAIHAVWNSGVILLLTFLQMQGYDI  180

Query  398  KELIQAS  378
            +E++QAS
Sbjct  181  REILQAS  187



>ref|XP_001785505.1| predicted protein [Physcomitrella patens]
 gb|EDQ49680.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 131/261 (50%), Positives = 177/261 (68%), Gaps = 4/261 (2%)
 Frame = -3

Query  1157  PIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEE-LSLDEKAEILFLD  981
             PI  +W+VPW+  T  +  L+  FSF+LTGL  +      GI   E L LDE+A  + + 
Sbjct  3     PILEQWNVPWDGTTTLVGMLSWLFSFLLTGLAVSVGAAQLGIGRREVLDLDEQATFILIH  62

Query  980   QAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTG  801
             Q   T   LG +  + +  KPLP   + Y +  PF+L+RGW+L+  +G+  A A++    
Sbjct  63    QLAETIAGLGAISLVLRRYKPLPPQFFSYGFSNPFDLRRGWVLYGGLGIVAATASVVAAS  122

Query  800   VAMSSLNSEPPTRE-TDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSL  624
               + +L  +PP RE  DAL++LLP+IG+S  ST SL+ +TGVLAP+LEETVFRGFLM SL
Sbjct  123   TLVVNLTGQPPPREEADALLQLLPIIGASPTSTASLIIVTGVLAPLLEETVFRGFLMTSL  182

Query  623   TKW--LPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWN  450
             TKW  + +P+A+ +SA  F+ AHLTPGEFPQL  LG  LG +YAQTR L+TP+ IH+ WN
Sbjct  183   TKWYEVSTPVAIAVSACAFAGAHLTPGEFPQLVALGIVLGLAYAQTRTLITPMLIHSLWN  242

Query  449   SGVILLLTFLQLQGYDIKELI  387
             SGVI+LLT L+LQGYDIKEL+
Sbjct  243   SGVIILLTILRLQGYDIKELL  263



>gb|ACF78295.1| unknown [Zea mays]
 tpg|DAA61424.1| TPA: hypothetical protein ZEAMMB73_931097 [Zea mays]
Length=139

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -3

Query  794  MSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTKW  615
            M+ LN E P RETD+LV LLPLIGSS+ ST  L+GITGVLAP+LEET+FRGFLMVSLTKW
Sbjct  1    MTYLNGETPARETDSLVLLLPLIGSSTTSTAFLVGITGVLAPLLEETLFRGFLMVSLTKW  60

Query  614  LPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVIL  435
             P+P  VL+SAAVF+ AHLTPG+FPQLF+LG ALGFSYAQTRNLLTPITIHAFWNSGVIL
Sbjct  61   FPTPACVLVSAAVFALAHLTPGQFPQLFILGVALGFSYAQTRNLLTPITIHAFWNSGVIL  120

Query  434  LLTFLQLQGYDIKELIQAS  378
            LLTFLQLQGYD+KEL+ AS
Sbjct  121  LLTFLQLQGYDLKELLGAS  139



>gb|AAT38683.2| CAAX amino terminal protease family protein, putative [Solanum 
demissum]
Length=304

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -3

Query  893  DWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsss  714
            D +EPFNLQRGWLLWA IGL GA+ AIALTGVAMS+ N EP  RETDAL RLLPLIGSSS
Sbjct  105  DLKEPFNLQRGWLLWAGIGLTGAIGAIALTGVAMSAFNGEPAQRETDALARLLPLIGSSS  164

Query  713  istlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQL  534
            IST SLLGITGVLAP+LEETVFRGF MVSLTKW+P+PLAV+IS AVF+ AHLTPG+FPQL
Sbjct  165  ISTASLLGITGVLAPILEETVFRGFFMVSLTKWVPTPLAVVISGAVFALAHLTPGQFPQL  224

Query  533  FVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQL  414
            FVLGTALGFSYAQTRNLLTPITIHA WNSGVILLLTFLQ+
Sbjct  225  FVLGTALGFSYAQTRNLLTPITIHALWNSGVILLLTFLQV  264


 Score = 80.9 bits (198),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 51/88 (58%), Gaps = 10/88 (11%)
 Frame = -3

Query  1316  LSPKLFPYKPLTQKLQ---------LLSFRRTDQA-LRPRFSTTVCSYSSGNRPDPKGSG  1167
              SPKL+  KPL QK            L F+ +  +    R  TT+C  S  N PD KG G
Sbjct  15    FSPKLYSSKPLLQKSHRICIAPLTPFLKFQDSAASQASTRGFTTICFSSPRNGPDYKGGG  74

Query  1166  PNCPIFRRWSVPWNWQTISLTSLACGFS  1083
             P+ PI RRW VPWNWQT+SL+SLACG S
Sbjct  75    PDWPILRRWDVPWNWQTVSLSSLACGLS  102



>ref|NP_001142170.1| hypothetical protein [Zea mays]
 gb|ACF87811.1| unknown [Zea mays]
 tpg|DAA48957.1| TPA: hypothetical protein ZEAMMB73_611537 [Zea mays]
 tpg|DAA48958.1| TPA: hypothetical protein ZEAMMB73_611537 [Zea mays]
 tpg|DAA48959.1| TPA: hypothetical protein ZEAMMB73_611537 [Zea mays]
Length=139

 Score =   188 bits (478),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -3

Query  794  MSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTKW  615
            M+ LN E P RETD+LV LLPLIGSS+IST  LLGITG+LAP+LEETVFRGFLMVSLT W
Sbjct  1    MTFLNGETPQRETDSLVLLLPLIGSSNISTACLLGITGILAPILEETVFRGFLMVSLTMW  60

Query  614  LPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVIL  435
             P+P AVL++AAVF+ AH TPGEFPQLFVLG  LGFSYAQTRNLLTPI IHA WNSGVIL
Sbjct  61   FPTPYAVLMTAAVFAFAHFTPGEFPQLFVLGVVLGFSYAQTRNLLTPIAIHAVWNSGVIL  120

Query  434  LLTFLQLQGYDIKELIQAS  378
            LLTFLQ+QGYDI+E++QAS
Sbjct  121  LLTFLQMQGYDIREILQAS  139



>gb|KDO37736.1| hypothetical protein CISIN_1g045219mg, partial [Citrus sinensis]
Length=218

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 146/204 (72%), Gaps = 10/204 (5%)
 Frame = -3

Query  1325  IASLSPKLFPYKPLTQKLQLL---SFRRTDQALRPRFSTTVCSYSSGNRPD-----PKGS  1170
             IA+L+   F     +QKL  L   S  R  +    RFS+ +C Y++G   +      K +
Sbjct  6     IAALAQPCFYSFSTSQKLSKLKPNSNTRLTKTCYRRFSS-ICFYNAGKDSESGSTEDKET  64

Query  1169  GPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEIL  990
               + P+ +RW VPW WQT SLTSLACGFSFVLTGL+E AA+PY G+++EELSLDEKAEIL
Sbjct  65    KLDWPVLKRWDVPWGWQTASLTSLACGFSFVLTGLVEAAALPYLGLKIEELSLDEKAEIL  124

Query  989   FLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaia  810
             FLDQ ITTA++LGVLY ++ + KPLP D++CYD REPFNL++GWLLWA IGL GAL A+A
Sbjct  125   FLDQGITTAVILGVLYGISSTFKPLPEDLFCYDLREPFNLKKGWLLWAGIGLGGALLAVA  184

Query  809   LTGVAMSSLNSE-PPTRETDALVR  741
              TG A+S  N E PP RETDALVR
Sbjct  185   ATGAALSLFNGENPPERETDALVR  208



>gb|EMS54663.1| hypothetical protein TRIUR3_30489 [Triticum urartu]
Length=579

 Score =   196 bits (497),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 159/194 (82%), Gaps = 0/194 (0%)
 Frame = -3

Query  992  LFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaai  813
            LF  ++  TA+ +GV++ +T + +P  +DI+ YD++EPF LQ GWLLWA IGL  AL +I
Sbjct  127  LFWQESSVTAVAIGVIFGITNTFRPFSDDIFRYDFKEPFKLQNGWLLWAGIGLFFALVSI  186

Query  812  aLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLM  633
            +LTG  M+ LN E   RETD+L+ LLPLIGSS+IST  LLGITGVLAP+LEETVFRGFLM
Sbjct  187  SLTGAVMTFLNGETTQRETDSLLLLLPLIGSSNISTACLLGITGVLAPILEETVFRGFLM  246

Query  632  VSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFW  453
            VSLT W  +P++VLI+A VF+ AHLTPGEFPQLFVLG ALGFSY+QTRNLLTPITIHA W
Sbjct  247  VSLTMWFSTPVSVLITAVVFAFAHLTPGEFPQLFVLGVALGFSYSQTRNLLTPITIHAAW  306

Query  452  NSGVILLLTFLQLQ  411
            NSGVILLLTFLQ Q
Sbjct  307  NSGVILLLTFLQQQ  320



>tpg|DAA61425.1| TPA: hypothetical protein ZEAMMB73_931097 [Zea mays]
Length=136

 Score =   181 bits (458),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -3

Query  761  ETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISA  582
            +TD+LV LLPLIGSS+ ST  L+GITGVLAP+LEET+FRGFLMVSLTKW P+P  VL+SA
Sbjct  9    QTDSLVLLLPLIGSSTTSTAFLVGITGVLAPLLEETLFRGFLMVSLTKWFPTPACVLVSA  68

Query  581  AVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYD  402
            AVF+ AHLTPG+FPQLF+LG ALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYD
Sbjct  69   AVFALAHLTPGQFPQLFILGVALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYD  128

Query  401  IKELIQAS  378
            +KEL+ AS
Sbjct  129  LKELLGAS  136



>ref|NP_001063162.1| Os09g0413200 [Oryza sativa Japonica Group]
 dbj|BAF25076.1| Os09g0413200, partial [Oryza sativa Japonica Group]
Length=136

 Score =   181 bits (458),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -3

Query  761  ETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISA  582
            +TD+LV LLPLIGSSS ST  L+GITGVLAP+LEETVFRGFLMVSLTKW P+P+ +L+SA
Sbjct  9    QTDSLVLLLPLIGSSSASTAFLVGITGVLAPILEETVFRGFLMVSLTKWFPTPVCILVSA  68

Query  581  AVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYD  402
            A+F+ AHLTPG+FPQLF+LG ALGFSYAQT NLLTPITIHAFWNSGVILLLTFLQLQGYD
Sbjct  69   ALFAFAHLTPGQFPQLFILGVALGFSYAQTHNLLTPITIHAFWNSGVILLLTFLQLQGYD  128

Query  401  IKELIQAS  378
            IKEL+ AS
Sbjct  129  IKELLGAS  136



>ref|XP_002980171.1| hypothetical protein SELMODRAFT_58140, partial [Selaginella moellendorffii]
 ref|XP_002993815.1| hypothetical protein SELMODRAFT_48059, partial [Selaginella moellendorffii]
 ref|XP_002994633.1| hypothetical protein SELMODRAFT_49325, partial [Selaginella moellendorffii]
 gb|EFJ04302.1| hypothetical protein SELMODRAFT_49325, partial [Selaginella moellendorffii]
 gb|EFJ05107.1| hypothetical protein SELMODRAFT_48059, partial [Selaginella moellendorffii]
 gb|EFJ19041.1| hypothetical protein SELMODRAFT_58140, partial [Selaginella moellendorffii]
Length=226

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 122/226 (54%), Positives = 161/226 (71%), Gaps = 2/226 (1%)
 Frame = -3

Query  1085  SFVLTGLIETAAIPYTGIQVEE-LSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPN  909
             SF +TGL         GI   E L +DE+A  +   Q + T   LG +  +T   +PLP+
Sbjct  1     SFFVTGLATAVLGHNLGIDRREILDMDEQAAFILFSQVLQTITGLGTINLVTTKYQPLPS  60

Query  908   DIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSE-PPTRETDALVRllp  732
             D++ YD+R+PF+LQRGWLLW+ IG+  A  A+ LT + +SS+N E PP  + DAL +LLP
Sbjct  61    DMFVYDFRKPFDLQRGWLLWSGIGILCAGGAVVLTSIIVSSVNGELPPREDNDALSQLLP  120

Query  731   ligsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTP  552
             LIG S +ST SL+ +TG LAP+LEETVFRGFL+ SLTK LP P+AV++SAA F+ AHLTP
Sbjct  121   LIGVSPLSTASLIVVTGALAPLLEETVFRGFLLTSLTKRLPVPVAVVLSAAAFALAHLTP  180

Query  551   GEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQL  414
             GEFPQLF LG  +GF+Y++T N+LTPI IHA WNSGV++ LT L +
Sbjct  181   GEFPQLFALGIVIGFAYSKTHNMLTPILIHATWNSGVVVALTALSV  226



>ref|XP_010276954.1| PREDICTED: uncharacterized protein LOC104611555 isoform X2 [Nelumbo 
nucifera]
Length=299

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 116/261 (44%), Positives = 166/261 (64%), Gaps = 5/261 (2%)
 Frame = -3

Query  1154  IFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELS-----LDEKAEIL  990
             + + W VPW+W+ I    +    S +LTG++E+A +       E ++      DE+A  L
Sbjct  38    LLQAWDVPWDWKIILYVMMPYLMSILLTGIVESAGLGVMQPHAENVTPHLHGTDEEAIRL  97

Query  989   FLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaia  810
             FLD+ + TA+ L VLY      +P P++++ Y W +PFN+Q GWLLW   GL  A + + 
Sbjct  98    FLDELLKTAVKLSVLYVFVSPYQPFPDNVFSYRWHQPFNIQNGWLLWGIGGLVAASSVVF  157

Query  809   LTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMV  630
             L    +S  ++     E ++LVRLLP IG SSIS  SLLGI G+LAP+ EET++RGFLM 
Sbjct  158   LIKSFISGPDANQIQNEAESLVRLLPFIGVSSISNASLLGILGILAPLCEETIYRGFLMT  217

Query  629   SLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWN  450
             SLTKWLP PL++++S+ VF+ AH +PG+  ++ + G  LG  YAQTRNLL PI +HA WN
Sbjct  218   SLTKWLPVPLSIIVSSIVFTLAHQSPGKSTEILIFGVVLGLVYAQTRNLLAPIIMHACWN  277

Query  449   SGVILLLTFLQLQGYDIKELI  387
              GVI  L + Q QG DI++ +
Sbjct  278   LGVIFTLIYFQSQGQDIQKYV  298



>ref|XP_010931435.1| PREDICTED: uncharacterized protein LOC105052354 isoform X2 [Elaeis 
guineensis]
Length=331

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 117/268 (44%), Positives = 168/268 (63%), Gaps = 6/268 (2%)
 Frame = -3

Query  1172  SGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAA-----IPYTGIQVEEL-SL  1011
              G  C IFR W VPW+W+  +   +    S + TG  ++        PY+   + ++ S 
Sbjct  63    GGKECEIFRPWDVPWDWKVTACVMMPYLMSAIFTGFTQSGGPDGLLKPYSETMLSQIHST  122

Query  1010  DEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaigla  831
             DE A  LF+DQ + +A  L VLY      +P P+DI+ + W  PFNLQ GW+LWA+ GL 
Sbjct  123   DEIAMQLFMDQLLKSAAKLSVLYMFVMPHQPFPDDIFSFRWGRPFNLQNGWILWASGGLI  182

Query  830   galaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETV  651
              A  A+ L    +S  ++     + + L +LLP I SS +ST  LLG  G+LAPV EETV
Sbjct  183   IACFAVFLVKALISGSSAGQTPNQAEFLGQLLPFIDSSDLSTCCLLGTLGILAPVCEETV  242

Query  650   FRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPI  471
             +RGFLM SLTKW P P++V +S+A+F+ AH +PG+  ++F+ G  LG  YA TRNLL PI
Sbjct  243   YRGFLMTSLTKWFPLPVSVALSSALFTIAHHSPGKSIEIFIFGLLLGLVYAHTRNLLAPI  302

Query  470   TIHAFWNSGVILLLTFLQLQGYDIKELI  387
             T+HA WN+GVI++LT+L  QG++I++ +
Sbjct  303   TMHACWNAGVIIILTYLHSQGHEIQKYV  330



>ref|XP_010276952.1| PREDICTED: uncharacterized protein LOC104611555 isoform X1 [Nelumbo 
nucifera]
Length=342

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 116/261 (44%), Positives = 166/261 (64%), Gaps = 5/261 (2%)
 Frame = -3

Query  1154  IFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELS-----LDEKAEIL  990
             + + W VPW+W+ I    +    S +LTG++E+A +       E ++      DE+A  L
Sbjct  81    LLQAWDVPWDWKIILYVMMPYLMSILLTGIVESAGLGVMQPHAENVTPHLHGTDEEAIRL  140

Query  989   FLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaia  810
             FLD+ + TA+ L VLY      +P P++++ Y W +PFN+Q GWLLW   GL  A + + 
Sbjct  141   FLDELLKTAVKLSVLYVFVSPYQPFPDNVFSYRWHQPFNIQNGWLLWGIGGLVAASSVVF  200

Query  809   LTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMV  630
             L    +S  ++     E ++LVRLLP IG SSIS  SLLGI G+LAP+ EET++RGFLM 
Sbjct  201   LIKSFISGPDANQIQNEAESLVRLLPFIGVSSISNASLLGILGILAPLCEETIYRGFLMT  260

Query  629   SLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWN  450
             SLTKWLP PL++++S+ VF+ AH +PG+  ++ + G  LG  YAQTRNLL PI +HA WN
Sbjct  261   SLTKWLPVPLSIIVSSIVFTLAHQSPGKSTEILIFGVVLGLVYAQTRNLLAPIIMHACWN  320

Query  449   SGVILLLTFLQLQGYDIKELI  387
              GVI  L + Q QG DI++ +
Sbjct  321   LGVIFTLIYFQSQGQDIQKYV  341



>ref|XP_008788011.1| PREDICTED: uncharacterized protein LOC103705897 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008788013.1| PREDICTED: uncharacterized protein LOC103705897 isoform X2 [Phoenix 
dactylifera]
Length=331

 Score =   179 bits (454),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 127/326 (39%), Positives = 191/326 (59%), Gaps = 20/326 (6%)
 Frame = -3

Query  1343  ARPSAPIASLSPKLFPYKPLTQKLQLLSFRRTDQALRPRFSTTVCSYSSGNRPDPKG-SG  1167
             + P+  ++SL  K F            ++R   +A  P+F  +      G     +   G
Sbjct  18    SHPTTKLSSLGSKKFT-----------TYRSMREA--PKFWCSSSREGPGEFCSKENLEG  64

Query  1166  PNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAA-----IPYTGIQVEEL-SLDE  1005
                 I R W VPW+W+  +   +    S + TG +E+        PY+   + ++ S DE
Sbjct  65    KEFKICRPWHVPWDWKVTACVMMPYLISTIFTGFMESGGSGGLLKPYSETMLSQMHSTDE  124

Query  1004  KAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglaga  825
              A  LF+DQ + +   L VLY   +  +P P+DI+ + W  PFNLQ GW+LWA+ GL  A
Sbjct  125   IAMQLFMDQLLKSVAKLSVLYMFVRPHQPFPDDIFSFRWGRPFNLQNGWILWASGGLVIA  184

Query  824   laaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFR  645
               A+ L    +S+ ++     + + LV+LLP I SS++ST  LLG  G+LAPV EETV+R
Sbjct  185   SFAVFLVKALISASSAGQTPNQAEFLVQLLPFIDSSNLSTFWLLGTLGILAPVCEETVYR  244

Query  644   GFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITI  465
             GFLM SLTKW P P++V +S+A+F+ AH +PG+  ++F+ G  LG  YAQTRNLL PIT+
Sbjct  245   GFLMTSLTKWFPLPVSVALSSALFTIAHHSPGKSIEIFIFGLLLGLVYAQTRNLLAPITM  304

Query  464   HAFWNSGVILLLTFLQLQGYDIKELI  387
             HA WN+GVI++LT+L  QG++I++ +
Sbjct  305   HACWNAGVIIILTYLHSQGHEIQKYV  330



>gb|KHG15038.1| D-alanine--D-alanine ligase [Gossypium arboreum]
Length=293

 Score =   171 bits (433),  Expect(3) = 3e-46, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 126/161 (78%), Gaps = 4/161 (2%)
 Frame = -3

Query  1211  CSYSSG-NRPD---PKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIP  1044
             C +++G + PD    + +    PI +RW VPW WQT+SLTSLACG SF+LTGLIETAAIP
Sbjct  67    CFFNAGKDNPDFQQKEETELGWPILKRWEVPWEWQTVSLTSLACGLSFILTGLIETAAIP  126

Query  1043  YTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQR  864
             Y G+ +EELSLD+KAEILF+DQ+ITT +VLGVLY +  + +PLP D++ YD++EPFNL++
Sbjct  127   YLGLNIEELSLDQKAEILFVDQSITTIVVLGVLYGVANTFQPLPEDLFRYDFKEPFNLKK  186

Query  863   gwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVR  741
             GWLLWAAIGL GAL AIALTG AMS    E   RETDALVR
Sbjct  187   GWLLWAAIGLVGALIAIALTGAAMSLFRGEDSQRETDALVR  227


 Score = 39.7 bits (91),  Expect(3) = 3e-46, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = -2

Query  525  RYCIRIFICSNPKSTYTNYYSCFLELRSYFASDLPSAPRI  406
            R C  +FICSN +S  + + +CFLEL S FAS L S  R+
Sbjct  254  RDCFGVFICSNSQSGDSYHNTCFLELGSDFASYLSSVARV  293


 Score = 24.6 bits (52),  Expect(3) = 3e-46, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 16/29 (55%), Gaps = 1/29 (3%)
 Frame = -1

Query  721  LQASAL*VYWVSLASLHQFLRRR-CLEAF  638
            + +S L  +W S    HQFLRRR C   F
Sbjct  232  IGSSTLLAWWASQVFWHQFLRRRDCFGVF  260



>ref|XP_010931434.1| PREDICTED: uncharacterized protein LOC105052354 isoform X1 [Elaeis 
guineensis]
Length=332

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 116/269 (43%), Positives = 167/269 (62%), Gaps = 7/269 (3%)
 Frame = -3

Query  1172  SGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAA-----IPYTGIQVEEL-SL  1011
              G  C IFR W VPW+W+  +   +    S + TG  ++        PY+   + ++ S 
Sbjct  63    GGKECEIFRPWDVPWDWKVTACVMMPYLMSAIFTGFTQSGGPDGLLKPYSETMLSQIHST  122

Query  1010  DEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaigla  831
             DE A  LF+DQ + +A  L VLY      +P P+DI+ + W  PFNLQ GW+LWA+ GL 
Sbjct  123   DEIAMQLFMDQLLKSAAKLSVLYMFVMPHQPFPDDIFSFRWGRPFNLQNGWILWASGGLI  182

Query  830   galaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETV  651
              A  A+ L    +S  ++     + + L +LLP I SS +ST  LLG  G+LAPV EETV
Sbjct  183   IACFAVFLVKALISGSSAGQTPNQAEFLGQLLPFIDSSDLSTCCLLGTLGILAPVCEETV  242

Query  650   FRGFLMVSLTKW-LPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTP  474
             +RGFLM SLTK   P P++V +S+A+F+ AH +PG+  ++F+ G  LG  YA TRNLL P
Sbjct  243   YRGFLMTSLTKCRFPLPVSVALSSALFTIAHHSPGKSIEIFIFGLLLGLVYAHTRNLLAP  302

Query  473   ITIHAFWNSGVILLLTFLQLQGYDIKELI  387
             IT+HA WN+GVI++LT+L  QG++I++ +
Sbjct  303   ITMHACWNAGVIIILTYLHSQGHEIQKYV  331



>ref|XP_008788008.1| PREDICTED: uncharacterized protein LOC103705897 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008788009.1| PREDICTED: uncharacterized protein LOC103705897 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008788010.1| PREDICTED: uncharacterized protein LOC103705897 isoform X1 [Phoenix 
dactylifera]
Length=332

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 126/327 (39%), Positives = 190/327 (58%), Gaps = 21/327 (6%)
 Frame = -3

Query  1343  ARPSAPIASLSPKLFPYKPLTQKLQLLSFRRTDQALRPRFSTTVCSYSSGNRPDPKG-SG  1167
             + P+  ++SL  K F            ++R   +A  P+F  +      G     +   G
Sbjct  18    SHPTTKLSSLGSKKFT-----------TYRSMREA--PKFWCSSSREGPGEFCSKENLEG  64

Query  1166  PNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAA-----IPYTGIQVEEL-SLDE  1005
                 I R W VPW+W+  +   +    S + TG +E+        PY+   + ++ S DE
Sbjct  65    KEFKICRPWHVPWDWKVTACVMMPYLISTIFTGFMESGGSGGLLKPYSETMLSQMHSTDE  124

Query  1004  KAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglaga  825
              A  LF+DQ + +   L VLY   +  +P P+DI+ + W  PFNLQ GW+LWA+ GL  A
Sbjct  125   IAMQLFMDQLLKSVAKLSVLYMFVRPHQPFPDDIFSFRWGRPFNLQNGWILWASGGLVIA  184

Query  824   laaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFR  645
               A+ L    +S+ ++     + + LV+LLP I SS++ST  LLG  G+LAPV EETV+R
Sbjct  185   SFAVFLVKALISASSAGQTPNQAEFLVQLLPFIDSSNLSTFWLLGTLGILAPVCEETVYR  244

Query  644   GFLMVSLTKW-LPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPIT  468
             GFLM SLTK   P P++V +S+A+F+ AH +PG+  ++F+ G  LG  YAQTRNLL PIT
Sbjct  245   GFLMTSLTKCRFPLPVSVALSSALFTIAHHSPGKSIEIFIFGLLLGLVYAQTRNLLAPIT  304

Query  467   IHAFWNSGVILLLTFLQLQGYDIKELI  387
             +HA WN+GVI++LT+L  QG++I++ +
Sbjct  305   MHACWNAGVIIILTYLHSQGHEIQKYV  331



>gb|KDO37340.1| hypothetical protein CISIN_1g034665mg [Citrus sinensis]
Length=87

 Score =   160 bits (405),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = -3

Query  635  MVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAF  456
            MVSLTKW+P+P+AV+ISAAVF+ AHLTPGEFPQLFVLG ALGFSYAQTRNLLTPITIHAF
Sbjct  1    MVSLTKWVPTPIAVIISAAVFALAHLTPGEFPQLFVLGIALGFSYAQTRNLLTPITIHAF  60

Query  455  WNSGVILLLTFLQLQGYDIKELIQAS  378
            WNSGVILLLTFLQLQGYD+KEL+QAS
Sbjct  61   WNSGVILLLTFLQLQGYDLKELLQAS  86



>gb|ACJ84920.1| unknown [Medicago truncatula]
Length=209

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 111/155 (72%), Gaps = 5/155 (3%)
 Frame = -3

Query  1217  TVCSYSS-GNRPDPK----GSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETA  1053
             +VC ++S  N+ D K     S    PI RRW VPW WQT+SLTSLACG  FVLTGL E  
Sbjct  55    SVCFFNSRDNKSDTKLQDQDSRSEWPILRRWEVPWEWQTVSLTSLACGLGFVLTGLAEAT  114

Query  1052  AIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFN  873
             A+PY GI+ + LSLDEKAE+LF+DQ ITTA VLG++Y++  + +PLP   + YD REPFN
Sbjct  115   ALPYLGIRPDMLSLDEKAELLFIDQGITTAAVLGIIYSVFNTYQPLPEGFFKYDLREPFN  174

Query  872   LQRgwllwaaiglagalaaiaLTGVAMSSLNSEPP  768
             LQ+GWLLWA +GL GAL +  LTGVA+S  N E P
Sbjct  175   LQKGWLLWAGVGLVGALVSTGLTGVAVSFFNGETP  209



>ref|XP_008788017.1| PREDICTED: uncharacterized protein LOC103705897 isoform X4 [Phoenix 
dactylifera]
Length=234

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 104/222 (47%), Positives = 151/222 (68%), Gaps = 2/222 (1%)
 Frame = -3

Query  1046  PYTGIQVEEL-SLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNL  870
             PY+   + ++ S DE A  LF+DQ + +   L VLY   +  +P P+DI+ + W  PFNL
Sbjct  12    PYSETMLSQMHSTDEIAMQLFMDQLLKSVAKLSVLYMFVRPHQPFPDDIFSFRWGRPFNL  71

Query  869   QRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllg  690
             Q GW+LWA+ GL  A  A+ L    +S+ ++     + + LV+LLP I SS++ST  LLG
Sbjct  72    QNGWILWASGGLVIASFAVFLVKALISASSAGQTPNQAEFLVQLLPFIDSSNLSTFWLLG  131

Query  689   itGVLAPVLEETVFRGFLMVSLTKW-LPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTAL  513
               G+LAPV EETV+RGFLM SLTK   P P++V +S+A+F+ AH +PG+  ++F+ G  L
Sbjct  132   TLGILAPVCEETVYRGFLMTSLTKCRFPLPVSVALSSALFTIAHHSPGKSIEIFIFGLLL  191

Query  512   GFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELI  387
             G  YAQTRNLL PIT+HA WN+GVI++LT+L  QG++I++ +
Sbjct  192   GLVYAQTRNLLAPITMHACWNAGVIIILTYLHSQGHEIQKYV  233



>ref|XP_003078834.1| putative CAAX amino terminal protease family protein (ISS) [Ostreococcus 
tauri]
Length=322

 Score =   151 bits (381),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 108/264 (41%), Positives = 154/264 (58%), Gaps = 14/264 (5%)
 Frame = -3

Query  1178  KGSGPNCPIFR-RWSVPWNWQTISLTSLACGFSFV-LTGLIETAAIPYTGIQVEELSLDE  1005
              G G     +R RW VPW+  T+++  L    +FV +  L    A+   G+    +S+ E
Sbjct  16    DGRGAALDDYRARWDVPWDGGTVTVGILGWSVAFVGVAALAGPVALSVLGVDPASMSVTE  75

Query  1004  KAEILFLDQAITTAIVLGVLYTL----TKSSKPLPNDIYCYDWREPFNLQRgwllwaaig  837
             +AE L   Q   TA  LG++Y L     ++ +   ND +  D+ EPF  +RGW  +  IG
Sbjct  76    RAEYLLGVQVAETATSLGLVYALLSPYAETIQEEGNDWFKIDFSEPFERERGWAKYGLIG  135

Query  836   lagalaaiaLTGVAMSSLNS--------EPPTRETDALVRllpligsssistlsllgitG  681
              A    A+A TG A+             E   ++   +  +LPLI   S + +++L +T 
Sbjct  136   YATTFLALAATGFALDFFERASGGQQAVEAAAKQAGTIDGVLPLIQGDSGTMIAVLTVTS  195

Query  680   VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
             VLAP+LEE VFRGFL+ SLTKWLP+P AVL S+ +F+ AHL P +F +L VLG  LGFSY
Sbjct  196   VLAPLLEEVVFRGFLLASLTKWLPTPGAVLFSSVLFACAHLAPRDFVELTVLGMVLGFSY  255

Query  500   AQTRNLLTPITIHAFWNSGVILLL  429
             A+TRNLLTP+ IH+ WNSGV+++L
Sbjct  256   ARTRNLLTPMLIHSLWNSGVLVVL  279



>emb|CEF97615.1| CAAX amino terminal protease [Ostreococcus tauri]
Length=364

 Score =   150 bits (380),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 108/264 (41%), Positives = 154/264 (58%), Gaps = 14/264 (5%)
 Frame = -3

Query  1178  KGSGPNCPIFR-RWSVPWNWQTISLTSLACGFSFV-LTGLIETAAIPYTGIQVEELSLDE  1005
              G G     +R RW VPW+  T+++  L    +FV +  L    A+   G+    +S+ E
Sbjct  84    DGRGAALDDYRARWDVPWDGGTVTVGILGWSVAFVGVAALAGPVALSVLGVDPASMSVTE  143

Query  1004  KAEILFLDQAITTAIVLGVLYTL----TKSSKPLPNDIYCYDWREPFNLQRgwllwaaig  837
             +AE L   Q   TA  LG++Y L     ++ +   ND +  D+ EPF  +RGW  +  IG
Sbjct  144   RAEYLLGVQVAETATSLGLVYALLSPYAETIQEEGNDWFKIDFSEPFERERGWAKYGLIG  203

Query  836   lagalaaiaLTGVAMSSLNS--------EPPTRETDALVRllpligsssistlsllgitG  681
              A    A+A TG A+             E   ++   +  +LPLI   S + +++L +T 
Sbjct  204   YATTFLALAATGFALDFFERASGGQQAVEAAAKQAGTIDGVLPLIQGDSGTMIAVLTVTS  263

Query  680   VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
             VLAP+LEE VFRGFL+ SLTKWLP+P AVL S+ +F+ AHL P +F +L VLG  LGFSY
Sbjct  264   VLAPLLEEVVFRGFLLASLTKWLPTPGAVLFSSVLFACAHLAPRDFVELTVLGMVLGFSY  323

Query  500   AQTRNLLTPITIHAFWNSGVILLL  429
             A+TRNLLTP+ IH+ WNSGV+++L
Sbjct  324   ARTRNLLTPMLIHSLWNSGVLVVL  347



>ref|XP_010931436.1| PREDICTED: uncharacterized protein LOC105052354 isoform X3 [Elaeis 
guineensis]
Length=315

 Score =   149 bits (377),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 107/249 (43%), Positives = 150/249 (60%), Gaps = 7/249 (3%)
 Frame = -3

Query  1172  SGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAA-----IPYTGIQVEEL-SL  1011
              G  C IFR W VPW+W+  +   +    S + TG  ++        PY+   + ++ S 
Sbjct  63    GGKECEIFRPWDVPWDWKVTACVMMPYLMSAIFTGFTQSGGPDGLLKPYSETMLSQIHST  122

Query  1010  DEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaigla  831
             DE A  LF+DQ + +A  L VLY      +P P+DI+ + W  PFNLQ GW+LWA+ GL 
Sbjct  123   DEIAMQLFMDQLLKSAAKLSVLYMFVMPHQPFPDDIFSFRWGRPFNLQNGWILWASGGLI  182

Query  830   galaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETV  651
              A  A+ L    +S  ++     + + L +LLP I SS +ST  LLG  G+LAPV EETV
Sbjct  183   IACFAVFLVKALISGSSAGQTPNQAEFLGQLLPFIDSSDLSTCCLLGTLGILAPVCEETV  242

Query  650   FRGFLMVSLTKW-LPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTP  474
             +RGFLM SLTK   P P++V +S+A+F+ AH +PG+  ++F+ G  LG  YA TRNLL P
Sbjct  243   YRGFLMTSLTKCRFPLPVSVALSSALFTIAHHSPGKSIEIFIFGLLLGLVYAHTRNLLAP  302

Query  473   ITIHAFWNS  447
             IT+HA WN+
Sbjct  303   ITMHACWNA  311



>gb|AFK39440.1| unknown [Medicago truncatula]
Length=204

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 109/148 (74%), Gaps = 5/148 (3%)
 Frame = -3

Query  1217  TVCSYSS-GNRPDPK----GSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETA  1053
             +VC ++S  N+ D K     S    PI RRW VPW WQT+SLTSLACG  FVLTGL E  
Sbjct  55    SVCFFNSRDNKSDTKLQDQDSRSEWPILRRWEVPWEWQTVSLTSLACGLGFVLTGLAEAT  114

Query  1052  AIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFN  873
             A+PY GI+ + LSLDEKAE+LF+DQ ITTA VLG++Y++  + +PLP   + YD REPFN
Sbjct  115   ALPYLGIRPDMLSLDEKAELLFIDQGITTAAVLGIIYSVFNTYQPLPEGFFKYDLREPFN  174

Query  872   LQRgwllwaaiglagalaaiaLTGVAMS  789
             LQ+GWLLWA +GL GAL +I LTGVA+S
Sbjct  175   LQKGWLLWAGVGLVGALVSIGLTGVAVS  202



>ref|XP_005651934.1| Abi-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE27390.1| Abi-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=246

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 94/246 (38%), Positives = 141/246 (57%), Gaps = 9/246 (4%)
 Frame = -3

Query  1097  ACGFSFVLTGLI-ETAAIPYTGI-QVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSS  924
             A   SF+L GL+     +   G+     L+  +K+ ++  +Q   T + + V+       
Sbjct  3     AWALSFLLVGLVLAPLVVKAAGVTNYSRLTATDKSFLVLANQVAETVVGIAVIKRTIGGF  62

Query  923   KPLPN--DIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRE--T  756
              PLP   D++   WREPF+  RGWL WA +G+  + A I +T   +S    E    +   
Sbjct  63    DPLPEEADLFKTSWREPFSKPRGWLTWALLGMVLSPAVIGITVTIVSYAGYEAVGGQGTA  122

Query  755   DALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAV  576
             D + R++ L   +  S L++ G   +LAP LEETVFRGFL+ +LTKW+P+P AV++SA  
Sbjct  123   DGVARIISLDLPTYASLLAVTG---ILAPFLEETVFRGFLLTTLTKWMPTPAAVVLSATA  179

Query  575   FSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIK  396
             F  AHL+P + PQL  LGT LGFSY ++RNLLTP+ IH  WNS V+ +L  L   G ++ 
Sbjct  180   FGLAHLSPRDLPQLIALGTLLGFSYVRSRNLLTPMIIHGAWNSVVLTVLFALTASGVNVS  239

Query  395   ELIQAS  378
             E++ + 
Sbjct  240   EMLSSG  245



>gb|EEC83628.1| hypothetical protein OsI_29356 [Oryza sativa Indica Group]
Length=201

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 71/86 (83%), Gaps = 2/86 (2%)
 Frame = -3

Query  635  MVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAF  456
            MV+      +P++VLI+A+VF+ AHLTPGEFPQLFVLG  LGFSYAQTRNLLTPI IHA 
Sbjct  118  MVACAVRFSTPISVLITASVFAFAHLTPGEFPQLFVLGIVLGFSYAQTRNLLTPIIIHAM  177

Query  455  WNSGVILLLTFLQLQGYDIKELIQAS  378
            WNSGVILLLT   LQGY+IKEL+ AS
Sbjct  178  WNSGVILLLTV--LQGYNIKELLLAS  201



>ref|XP_010276955.1| PREDICTED: uncharacterized protein LOC104611555 isoform X3 [Nelumbo 
nucifera]
Length=282

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            +LAP+ EET++RGFLM SLTKWLP PL++++S+ VF+ AH +PG+  ++ + G  LG  Y
Sbjct  184  ILAPLCEETIYRGFLMTSLTKWLPVPLSIIVSSIVFTLAHQSPGKSTEILIFGVVLGLVY  243

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELI  387
            AQTRNLL PI +HA WN GVI  L + Q QG DI++ +
Sbjct  244  AQTRNLLAPIIMHACWNLGVIFTLIYFQSQGQDIQKYV  281


 Score = 60.5 bits (145),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 50/92 (54%), Gaps = 5/92 (5%)
 Frame = -3

Query  1154  IFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELS-----LDEKAEIL  990
             + + W VPW+W+ I    +    S +LTG++E+A +       E ++      DE+A  L
Sbjct  81    LLQAWDVPWDWKIILYVMMPYLMSILLTGIVESAGLGVMQPHAENVTPHLHGTDEEAIRL  140

Query  989   FLDQAITTAIVLGVLYTLTKSSKPLPNDIYCY  894
             FLD+ + TA+ L VLY      +P P++++ Y
Sbjct  141   FLDELLKTAVKLSVLYVFVSPYQPFPDNVFSY  172



>ref|XP_006836172.1| hypothetical protein AMTR_s00101p00054740 [Amborella trichopoda]
 gb|ERM99025.1| hypothetical protein AMTR_s00101p00054740 [Amborella trichopoda]
Length=84

 Score =   113 bits (283),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = -3

Query  635  MVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAF  456
            M SLTKWLP P++V +SA +F+  HL+PG+F ++F+ G  LG  YAQTRNLL PIT+HA 
Sbjct  1    MTSLTKWLPVPVSVGVSAFIFALCHLSPGKFVEIFIFGIVLGLVYAQTRNLLAPITMHAC  60

Query  455  WNSGVILLLTFLQLQGYDIKELI  387
            WN GVILLLTFL++QGYDI+  +
Sbjct  61   WNLGVILLLTFLKMQGYDIQSYV  83



>ref|XP_001417530.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95823.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=237

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 82/217 (38%), Positives = 123/217 (57%), Gaps = 13/217 (6%)
 Frame = -3

Query  1037  GIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSS----KPLPNDIYCYDWREPFNL  870
             G+   ++  + +AE L   Q   T + L ++Y L        K    D + +D+ +PF  
Sbjct  5     GVDPAKMDANAQAEYLLAVQCAETVVSLSLVYALVSPHMDVVKDESKDWFKFDFSDPFER  64

Query  869   QRgwllwaaiglagalaaiaLTG----VAMSSLNSEPPTRETDALVRll-----pligss  717
             +RGW  +  IG      A+A TG    VA  +   +    +    V  +      +   +
Sbjct  65    ERGWAKYGLIGYGTTFLALAATGFVLDVAEKAQGGQQAIEKASEQVGTIDGVLPLISSDN  124

Query  716   sistlsllgitGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQ  537
             + + L++L +T VLAP+LEE VFRGF++ SLTKWLP+P AVL S+ +F  AH  P +F +
Sbjct  125   NGTLLAVLTVTSVLAPLLEEVVFRGFILASLTKWLPTPGAVLFSSVLFGLAHFAPRDFVE  184

Query  536   LFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLT  426
             L VLG  LGFSYA+TRNLLTP+ IH+ WNSGV++++ 
Sbjct  185   LVVLGMVLGFSYARTRNLLTPMLIHSMWNSGVLVVVA  221



>ref|XP_001691345.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP05078.1| predicted protein [Chlamydomonas reinhardtii]
Length=151

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            VLAP+LEETVFRGFL+ SLT+++P+  AV+ S+  F  AHL+P + P L  LG  LG+SY
Sbjct  43   VLAPILEETVFRGFLLTSLTRFMPTWAAVVASSGFFGLAHLSPRDLPVLSALGLLLGWSY  102

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQ  384
             ++RNLLTPI IH  WNSGV+ +L +L  +G D+++LI 
Sbjct  103  VRSRNLLTPILIHGAWNSGVLTVLFWLASEGVDVQQLIS  141



>ref|XP_007512704.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17304.1| predicted protein [Bathycoccus prasinos]
Length=446

 Score =   115 bits (287),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            V AP+LEETVFRGFL+ SLTKWLP+P AV+ S+ +F  AHL P +FP+L  LG  LGFSY
Sbjct  346  VFAPLLEETVFRGFLLASLTKWLPAPGAVVFSSFIFGFAHLAPRDFPELVALGCVLGFSY  405

Query  500  AQTRNLLTPITIHAFWNSGVILLL  429
             +TRNLL P+ IH+ WNSGV++L+
Sbjct  406  VRTRNLLVPMFIHSCWNSGVLVLV  429



>ref|XP_005847247.1| hypothetical protein CHLNCDRAFT_134232 [Chlorella variabilis]
 gb|EFN55145.1| hypothetical protein CHLNCDRAFT_134232 [Chlorella variabilis]
Length=250

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 95/260 (37%), Positives = 132/260 (51%), Gaps = 23/260 (9%)
 Frame = -3

Query  1139  SVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQV-----EELSLDEKAEILFLDQA  975
             SVPW  + + L   A   +FV  GL   A IP             LS  +K+     +Q 
Sbjct  5     SVPWGGKEVVLGMAAWCAAFVGVGL---AFIPVVRAMAGADGFSGLSATDKSVFALANQV  61

Query  974   ITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVA  795
               TA+ + ++       +PLP D++ YD   PF   RGWL+W  +G+  +   +  +   
Sbjct  62    AETAVSIAIIRLGVARFEPLPPDLFKYDLSAPFKKPRGWLMWGLLGVLLSPLVVYASATL  121

Query  794   MSSLN-SEPPTRET-DALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLT  621
                L  S+   R T DA+     +I  +  +  SL+  T +LAP+LEETVFRGFL+ SLT
Sbjct  122   SDGLGVSDTAGRGTVDAV---SSIITINFSTYASLMATTSILAPLLEETVFRGFLLTSLT  178

Query  620   KWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGV  441
             KW+P P AV +S+  F            L  LG  LGF+Y ++RNLLTPI IH  WN  V
Sbjct  179   KWMPVPAAVAVSSLAFG----------MLTALGFLLGFTYVRSRNLLTPILIHGAWNGSV  228

Query  440   ILLLTFLQLQGYDIKELIQA  381
             + +L FL  QG  I EL+ A
Sbjct  229   LTILFFLASQGISIDELLHA  248



>ref|XP_002946992.1| hypothetical protein VOLCADRAFT_120396 [Volvox carteri f. nagariensis]
 gb|EFJ52218.1| hypothetical protein VOLCADRAFT_120396 [Volvox carteri f. nagariensis]
Length=407

 Score =   107 bits (268),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 95/282 (34%), Positives = 144/282 (51%), Gaps = 32/282 (11%)
 Frame = -3

Query  1142  WSVPWNWQTISLTSLACGF-SFVLTGLIETAAI-PYTGIQVEELSLDEKAEILFLDQAIT  969
             W VPW    ++   LA  F SF+  G +    +    G+ + +LS ++KA    + QA+ 
Sbjct  122   WQVPWGPGRVA-GGLALWFGSFIGVGFVLVPQLYRMAGVSLYDLSPEDKATFTLVCQAVE  180

Query  968   TAIVLGVLYTLTKSSKPLPN---------------------------DIYCYDWREPFNL  870
             T + L ++  +T    P+                             D + YD R PF+ 
Sbjct  181   TVVSLALVRLITVG--PITEAAASSSSSSLSPSSSSRPPPLSPANGLDFFVYDPRRPFSR  238

Query  869   QRgwllwaaiglagalaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllg  690
              RGW  WA +G+  + A +      +S +  E        +  +  +I     + LSLL 
Sbjct  239   PRGWGFWALLGVVASPAVVGSVAALLSVVGYEQAVGGQGTVDGVAGMIDLDLPTYLSLLA  298

Query  689   itGVLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALG  510
             +TGV+AP+LEETVFRGFL+ SLT+++P+  AV  S+  F  AHL+  + P L  LG  LG
Sbjct  299   VTGVMAPLLEETVFRGFLLTSLTRFMPTWAAVAASSVSFGLAHLSARDLPVLCALGLLLG  358

Query  509   FSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQ  384
             +SY ++RNLLTPI IH  WNS V+ LL +L  +G D+++LI 
Sbjct  359   WSYVRSRNLLTPIVIHGAWNSAVLTLLFWLAAEGVDVQQLIS  400



>ref|XP_010258367.1| PREDICTED: uncharacterized protein LOC104598140 isoform X2 [Nelumbo 
nucifera]
Length=177

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = -3

Query  1085  SFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPND  906
             SFVLTGL+E A  PY G Q+ ELSLDEKAE+LF+DQAITTA+VLGV+Y LT + +PLP++
Sbjct  35    SFVLTGLVEVALTPYLGFQIGELSLDEKAEVLFVDQAITTALVLGVVYGLTNTFQPLPDN  94

Query  905   IYCYDWREPFNL  870
             ++CY    P +L
Sbjct  95    LFCYMVDAPVSL  106



>ref|XP_010258366.1| PREDICTED: uncharacterized protein LOC104598140 isoform X1 [Nelumbo 
nucifera]
Length=186

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = -3

Query  1085  SFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAITTAIVLGVLYTLTKSSKPLPND  906
             SFVLTGL+E A  PY G Q+ ELSLDEKAE+LF+DQAITTA+VLGV+Y LT + +PLP++
Sbjct  35    SFVLTGLVEVALTPYLGFQIGELSLDEKAEVLFVDQAITTALVLGVVYGLTNTFQPLPDN  94

Query  905   IYCYDWREPFNL  870
             ++CY    P +L
Sbjct  95    LFCYMVDAPVSL  106


 Score = 43.9 bits (102),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKW  615
            VLAP+LEETVFRGF M SLTKW
Sbjct  126  VLAPLLEETVFRGFFMASLTKW  147


 Score = 34.7 bits (78),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 23/38 (61%), Gaps = 0/38 (0%)
 Frame = -2

Query  519  CIRIFICSNPKSTYTNYYSCFLELRSYFASDLPSAPRI  406
            C   F+CSN +S+  + Y+C LE R   +S   SAPRI
Sbjct  149  CTGTFLCSNSQSSNPHQYTCSLEFRGDPSSHFSSAPRI  186



>ref|NP_001061888.2| Os08g0436600 [Oryza sativa Japonica Group]
 dbj|BAF23802.2| Os08g0436600 [Oryza sativa Japonica Group]
Length=52

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -3

Query  533  FVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLLTFLQLQGYDIKELIQAS  378
             + G  LGFSYAQTRNLLTPI IHA WNSGVILLLT LQLQGY+IKEL+ AS
Sbjct  1    MITGIVLGFSYAQTRNLLTPIIIHAMWNSGVILLLTVLQLQGYNIKELLLAS  52



>gb|AIE72603.1| Abortive infection protein [Synechocystis sp. PCC 6714]
Length=509

 Score = 90.5 bits (223),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 62/87 (71%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            VLAPV EE +FRGFL+ +LT++ P  +A+++S+ +F+ AHL   E   LFVLG+ LG  Y
Sbjct  420  VLAPVFEEIIFRGFLLPALTRYFPVSVAIILSSLLFAIAHLNVSEILPLFVLGSVLGLVY  479

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL+ I +H+ WNSG +L L  L
Sbjct  480  TRSRNLLSSIILHSLWNSGTLLSLFIL  506



>ref|WP_018399233.1| hypothetical protein [filamentous cyanobacterium ESFC-1]
Length=518

 Score = 90.1 bits (222),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + APV EE +FRGFL+ SLT++LP   A+L+S+ +F+ AHL+P E   L +LG  LG +Y
Sbjct  430  IAAPVFEEIIFRGFLLPSLTRYLPVWGAILLSSLIFAIAHLSPSEILPLTILGIVLGTTY  489

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL+ + +H+FWNSG +L L  L
Sbjct  490  TRSRNLLSSMMLHSFWNSGTLLSLFIL  516



>ref|WP_010873047.1| hypothetical protein [Synechocystis sp. PCC 6803]
 ref|NP_441746.1| hypothetical protein slr0959 [Synechocystis sp. PCC 6803]
 ref|YP_005383614.1| hypothetical protein SYNGTI_1852 [Synechocystis sp. PCC 6803 
substr. GT-I]
 ref|YP_005386783.1| hypothetical protein SYNPCCP_1851 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 ref|YP_005409490.1| hypothetical protein SYNPCCN_1851 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 ref|YP_005651805.1| hypothetical protein SYNGTS_1852 [Synechocystis sp. PCC 6803]
 ref|YP_007451628.1| hypothetical protein MYO_118690 [Synechocystis sp. PCC 6803]
 dbj|BAA18426.1| slr0959 [Synechocystis sp. PCC 6803]
 dbj|BAK50600.1| hypothetical protein SYNGTS_1852 [Synechocystis sp. PCC 6803]
 dbj|BAL29599.1| hypothetical protein SYNGTI_1852 [Synechocystis sp. PCC 6803 
substr. GT-I]
 dbj|BAL32768.1| hypothetical protein SYNPCCN_1851 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 dbj|BAL35937.1| hypothetical protein SYNPCCP_1851 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 dbj|BAM54855.1| hypothetical protein BEST7613_5924 [Bacillus subtilis BEST7613]
 gb|AGF52114.1| hypothetical protein MYO_118690 [Synechocystis sp. PCC 6803]
Length=529

 Score = 89.7 bits (221),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            VLAPV EE +FRGFL+ +LT++ P  +A+++S+ +F+ AHL   E   LFVLG+ LG  Y
Sbjct  440  VLAPVFEEIIFRGFLLPALTRYFPVSVAIILSSLLFAIAHLNVSEILPLFVLGSILGLVY  499

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
            +++RNLL+ + +H+ WNSG +L L  L
Sbjct  500  SRSRNLLSSMILHSLWNSGTLLSLFIL  526



>ref|XP_009357838.1| PREDICTED: uncharacterized protein LOC103948522 isoform X2 [Pyrus 
x bretschneideri]
Length=316

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 65/90 (72%), Gaps = 7/90 (8%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSL---TKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALG  510
            ++ PVLEETV+RGFL+ S+   TKW     AVLIS+A+FSAAHL+   F QLF++G  LG
Sbjct  230  IITPVLEETVYRGFLLASILSTTKWQS---AVLISSAIFSAAHLSGENFLQLFIIGCVLG  286

Query  509  FSYAQTRNLLTPITIHAFWNSGVILLLTFL  420
             SY  T NL +PI IH+ +N+ + L++TFL
Sbjct  287  CSYCWTGNLSSPILIHSLYNA-MTLMITFL  315



>ref|WP_026072788.1| metal-dependent membrane protease [Nodosilinea nodulosa]
Length=512

 Score = 88.2 bits (217),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 76/243 (31%), Positives = 117/243 (48%), Gaps = 11/243 (5%)
 Frame = -3

Query  1148  RRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAIT  969
             R W VPW  QTI    L  GF FV   L+    +   GI    LS   +A    +   + 
Sbjct  279   RGWEVPWTAQTI-WQVLIAGFFFVGQILLPLV-LGNLGINGAALSSRGRAVFSLVYYLLM  336

Query  968   TAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMS  789
              A  LGVL+   +  +P+P D+        F ++              +A   + GVA+ 
Sbjct  337   AAGSLGVLWWSIRPYRPVPKDM--------FRIKPSGAGLLWGLGGYFVAVPLMFGVALL  388

Query  788   SLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTKWLP  609
             +         ++ L++ +          +  +    V AP+ EE +FRGFL+ SLT++L 
Sbjct  389   NQKIWQGQGGSNPLLQTVLEEQDGVALLVFFVTAA-VAAPLFEEFLFRGFLLPSLTRYLS  447

Query  608   SPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVILLL  429
             +  A+ +SA +F+AAHL+  E   L VLG  LGF Y ++RNLL+P+ +H+ WNS  +L L
Sbjct  448   TGWAIALSAFIFAAAHLSLSEILPLTVLGAVLGFVYQRSRNLLSPMVLHSAWNSATMLGL  507

Query  428   TFL  420
               L
Sbjct  508   FIL  510



>gb|AFK40816.1| unknown [Lotus japonicus]
Length=102

 Score = 80.9 bits (198),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +1

Query  619  FVRDTIKKPLNTVSSRTGARTPVIPNRLRVLMLEEPINGSKRTRASVSLVGGSLFKEDMA  798
            F + + KKP NTVSSR+GARTP +P +  VL  ++PINGSKRTRASVS  G S  K+D A
Sbjct  20   FSQGSHKKPRNTVSSRSGARTPTMPTKQAVLRFDDPINGSKRTRASVSPSGVSPLKKDTA  79

Query  799  TPVsaiaasaparpiaaHNSQPL  867
            TPV+A+AA AP  P  AH SQP 
Sbjct  80   TPVNAMAARAPISPTPAHKSQPF  102


 Score = 28.9 bits (63),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (56%), Gaps = 0/27 (0%)
 Frame = +3

Query  561  MCSRKYSSADKDSKWARQPLRQGYHQK  641
            M   K+S  + DS W R P  QG H+K
Sbjct  1    MSKGKHSRTNDDSNWCRNPFSQGSHKK  27



>ref|WP_026135053.1| abortive phage infection protein [Scytonema hofmanni]
Length=528

 Score = 87.0 bits (214),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 61/87 (70%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EE +FRGFL+ SLT++LP   ++LIS+ +F+AAHL+  E   LF LG  LG  Y
Sbjct  437  IAAPIFEEILFRGFLLPSLTRYLPVWGSILISSFLFAAAHLSLAEIFPLFSLGIVLGVVY  496

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL P+ +H+ WNSG +L L  L
Sbjct  497  TRSRNLLAPMLLHSLWNSGTLLSLFIL  523



>gb|KEI69029.1| hypothetical protein A19Y_4361 [Planktothrix agardhii NIVA-CYA 
126/8]
Length=526

 Score = 87.0 bits (214),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EET+FRGFL+ SLT++LP   A+L+S  +F+ AH    E   L  LG  LGF Y
Sbjct  435  IAAPIFEETMFRGFLLPSLTRYLPLGSAILLSGFLFAVAHFNVSEILPLMTLGIVLGFVY  494

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL P+ +H  WNSG +L L  L
Sbjct  495  TRSRNLLAPMFMHGLWNSGTLLSLYVL  521



>ref|XP_008337467.1| PREDICTED: uncharacterized protein LOC103400595 isoform X1 [Malus 
domestica]
Length=316

 Score = 84.7 bits (208),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 63/89 (71%), Gaps = 7/89 (8%)
 Frame = -3

Query  677  LAPVLEETVFRGFL---MVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGF  507
            + PVLEETV+RGFL   M+S TKW     AVLIS+A+FSAAHL+   F QLF +G  LG 
Sbjct  231  ITPVLEETVYRGFLLASMLSTTKWQS---AVLISSAIFSAAHLSGENFLQLFXIGCVLGC  287

Query  506  SYAQTRNLLTPITIHAFWNSGVILLLTFL  420
            SY  T NL +PI IH+ +N+ + L++TFL
Sbjct  288  SYCWTGNLSSPILIHSLYNA-MTLMITFL  315



>ref|WP_006530204.1| putative metal-dependent membrane protease [Gloeocapsa sp. PCC 
73106]
 gb|ELR96955.1| putative metal-dependent membrane protease [Gloeocapsa sp. PCC 
73106]
Length=484

 Score = 86.7 bits (213),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 61/87 (70%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EE +FRGFL+ SLT++  +  A+++S+ VFS AHL+  E   L VLG  LGF Y
Sbjct  396  IAAPLFEEIIFRGFLLASLTRYFSTWGAIVLSSLVFSIAHLSLSEVLPLTVLGMILGFVY  455

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
            +++RNLL PI +H+ WNSG ++ L  L
Sbjct  456  SRSRNLLAPILLHSLWNSGTLMSLFVL  482



>ref|WP_026793425.1| MULTISPECIES: abortive phage infection protein [Planktothrix]
Length=509

 Score = 86.7 bits (213),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EET+FRGFL+ SLT++LP   A+++S  +F+ AH    E   L  LG  LGF Y
Sbjct  418  IAAPIFEETMFRGFLLPSLTRYLPLGSAIILSGFLFAVAHFNVSEILPLMTLGIVLGFVY  477

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL P+ +H  WNSG +L L  L
Sbjct  478  TRSRNLLAPMFMHGLWNSGTLLSLYIL  504



>ref|WP_026787505.1| MULTISPECIES: abortive phage infection protein [Planktothrix]
Length=509

 Score = 86.3 bits (212),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EET+FRGFL+ SLT++LP   A+++S  +F+ AH    E   L  LG  LGF Y
Sbjct  418  IAAPIFEETMFRGFLLPSLTRYLPLGSAIILSGFLFAVAHFNVSEILPLMTLGIVLGFVY  477

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL P+ +H  WNSG +L L  L
Sbjct  478  TRSRNLLAPMFMHGLWNSGTLLSLYIL  504



>ref|WP_008188312.1| CAAX amino terminal protease family [Moorea producens]
 gb|EGJ30098.1| CAAX amino terminal protease family [Moorea producens 3L]
Length=190

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            V APV EE +FRGFL+ SLT++LP   A+ +S+ +F+ AHL+  E   L  LG  LGF Y
Sbjct  101  VAAPVFEEIIFRGFLLPSLTRYLPVWGAIALSSLIFAIAHLSLSEVLPLATLGIVLGFVY  160

Query  500  AQTRNLLTPITIHAFWNSGVIL  435
             ++RNLL P+ +H+ WNSG +L
Sbjct  161  TRSRNLLAPMLLHSLWNSGTLL  182



>ref|WP_026798410.1| MULTISPECIES: abortive phage infection protein [Planktothrix]
Length=509

 Score = 86.3 bits (212),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EET+FRGFL+ SLT++LP   A+++S  +F+ AH    E   L  LG  LGF Y
Sbjct  418  IAAPIFEETMFRGFLLPSLTRYLPLGSAIILSGFLFAVAHFNVSEILPLMTLGIVLGFVY  477

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL P+ +H  WNSG +L L  L
Sbjct  478  TRSRNLLAPMFMHGLWNSGTLLSLYVL  504



>tpg|DAA48962.1| TPA: hypothetical protein ZEAMMB73_611537 [Zea mays]
 tpg|DAA48963.1| TPA: hypothetical protein ZEAMMB73_611537 [Zea mays]
Length=191

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 50/83 (60%), Gaps = 5/83 (6%)
 Frame = -3

Query  1211  CSYSSGN-----RPDPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAI  1047
             CSY + N      PD   S    PI RRW VPW W TISLT +AC  SF+LTG+ E + +
Sbjct  74    CSYDTENGLPTPSPDKGKSSDEWPILRRWDVPWEWPTISLTMVACAVSFLLTGIAEQSIL  133

Query  1046  PYTGIQVEELSLDEKAEILFLDQ  978
                G +  E +LDEKAEILFL Q
Sbjct  134   EQLGFRAGETTLDEKAEILFLGQ  156



>ref|WP_011243347.1| hypothetical protein [Synechococcus elongatus]
 ref|YP_171745.1| hypothetical protein syc1035_d [Synechococcus elongatus PCC 6301]
 dbj|BAD79225.1| hypothetical protein [Synechococcus elongatus PCC 6301]
Length=480

 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EE +FRGFL+ SLT+WLP   A+ +S  +F+ AHL+  E   LF LG  LG  Y
Sbjct  391  IAAPLFEEVLFRGFLLASLTRWLPVRGAIALSGLLFALAHLSLSEVLPLFALGCLLGEVY  450

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL P+ +H  WNSG ++ L  L
Sbjct  451  TRSRNLLAPMLLHGLWNSGTLISLLLL  477



>ref|WP_011377596.1| hypothetical protein [Synechococcus elongatus]
 ref|YP_399503.1| hypothetical protein Synpcc7942_0484 [Synechococcus elongatus 
PCC 7942]
 gb|ABB56516.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
 gb|AJD56441.1| hypothetical protein M744_00540 [Synechococcus sp. UTEX 2973]
Length=480

 Score = 85.9 bits (211),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EE +FRGFL+ SLT+WLP   A+ +S  +F+ AHL+  E   LF LG  LG  Y
Sbjct  391  IAAPLFEEVLFRGFLLASLTRWLPVRGAIALSGLLFALAHLSLSEVLPLFALGCLLGEVY  450

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL P+ +H  WNSG ++ L  L
Sbjct  451  TRSRNLLAPMLLHGLWNSGTLISLLLL  477



>ref|WP_017661438.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=523

 Score = 85.9 bits (211),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            +LAPV EE +FRGFL+ SLTK++P   A++IS+ VF+ AHL+  E   L  LG  LG  Y
Sbjct  433  ILAPVFEEFIFRGFLLPSLTKYVPVWGAIVISSLVFALAHLSVSEVLPLATLGIVLGVIY  492

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
            A++RNLL  + +H  WNSG +L L  L
Sbjct  493  ARSRNLLAAMLMHGLWNSGTLLSLVIL  519



>ref|XP_008245665.1| PREDICTED: uncharacterized protein LOC103343807 [Prunus mume]
Length=307

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            ++ PVLEETV+RGFL+ S++  +    AVLIS+A+FSAAHL+     QLF++G  LG SY
Sbjct  221  IVTPVLEETVYRGFLLASISSTMKWQSAVLISSAIFSAAHLSGENSLQLFIIGCVLGCSY  280

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
              T NL +PI IH+ +N+ + L++TFL
Sbjct  281  CWTGNLRSPILIHSLYNA-MTLMITFL  306



>ref|XP_008245252.1| PREDICTED: uncharacterized protein LOC103343368 isoform X1 [Prunus 
mume]
Length=307

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            ++ PVLEETV+RGFL+ S++  +    AVLIS+A+FSAAHL+     QLF++G  LG SY
Sbjct  221  IVTPVLEETVYRGFLLASISSAMKWQSAVLISSAIFSAAHLSGENSLQLFIIGCVLGCSY  280

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
              T NL +PI IH+ +N+ + L++TFL
Sbjct  281  CWTGNLRSPILIHSLYNA-MTLMITFL  306



>ref|XP_007198946.1| hypothetical protein PRUPE_ppa016497mg [Prunus persica]
 gb|EMJ00145.1| hypothetical protein PRUPE_ppa016497mg [Prunus persica]
Length=220

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            ++ PVLEETV+RGFL+ S+   +    AVLIS+A+FSAAHL+     QLF++G  LG SY
Sbjct  134  IVTPVLEETVYRGFLLASILSTMKWQSAVLISSAIFSAAHLSGENSLQLFIIGCVLGCSY  193

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
              T NL +PI IH+ +N+ + L++TFL
Sbjct  194  CWTGNLRSPILIHSLYNA-MTLMITFL  219



>ref|WP_038081935.1| abortive phage infection protein [Tolypothrix bouteillei]
 gb|KIE08186.1| abortive phage infection protein [Tolypothrix bouteillei VB521301]
Length=527

 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP  EE +FRGFL+ SLT++LP   ++LIS+ +F+AAHL+  E   LF LG  LG  Y
Sbjct  436  IAAPFFEEILFRGFLLPSLTRYLPVWGSILISSFLFAAAHLSLAEVLPLFSLGIVLGVVY  495

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL P+ +H+ WNSG +L L  L
Sbjct  496  TRSRNLLAPMLLHSLWNSGTLLSLFIL  522



>ref|WP_017316111.1| abortive phage infection protein [Mastigocladopsis repens]
Length=526

 Score = 85.1 bits (209),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EE +FRGFL+ SLT++LP   ++L S+ +F+AAHL+  E   LF LG  LG  Y
Sbjct  435  IAAPIFEEILFRGFLLPSLTRYLPVWGSILASSFLFAAAHLSLSEIIPLFTLGIVLGIVY  494

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL P+ +H+ WNSG +L L  L
Sbjct  495  TRSRNLLAPMLLHSLWNSGTLLSLFVL  521



>ref|WP_039780122.1| peptidase [Acaryochloris sp. CCMEE 5410]
Length=537

 Score = 85.1 bits (209),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            VLAPV EE +FRGF + SLT++LP   A+ IS  VF+ AHL   +   L VLG  LGF Y
Sbjct  446  VLAPVFEEILFRGFFLTSLTRYLPMWGAIGISGIVFAVAHLNLADILPLSVLGCVLGFVY  505

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
            +++RNLL  + +H+ WNSG  L L  L
Sbjct  506  SRSRNLLASMLLHSLWNSGSFLSLLIL  532



>ref|WP_010473563.1| peptidase [Acaryochloris sp. CCMEE 5410]
Length=543

 Score = 85.1 bits (209),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            VLAPV EE +FRGF + SLT++LP   A+ IS  VF+ AHL   +   L VLG  LGF Y
Sbjct  452  VLAPVFEEILFRGFFLTSLTRYLPMWGAIGISGIVFAVAHLNLADILPLSVLGCVLGFVY  511

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
            +++RNLL  + +H+ WNSG  L L  L
Sbjct  512  SRSRNLLASMLLHSLWNSGSFLSLLIL  538



>ref|WP_015230125.1| metal-dependent membrane protease [Dactylococcopsis salina]
 ref|YP_007172492.1| metal-dependent membrane protease [Dactylococcopsis salina PCC 
8305]
 gb|AFZ51135.1| putative metal-dependent membrane protease [Dactylococcopsis 
salina PCC 8305]
Length=520

 Score = 85.1 bits (209),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 73/248 (29%), Positives = 112/248 (45%), Gaps = 24/248 (10%)
 Frame = -3

Query  1145  RWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAITT  966
             +W  PWNW+ I+   L  GF F+   L+    I  +GI      +  KA  +     + T
Sbjct  286   KWETPWNWE-ITWQVLVVGFFFIGQFLLPLV-IGISGINPTGWGIQGKALYVLATYVLMT  343

Query  965   AIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAMSS  786
                L VLY   ++  PLP     ++W+    L  G   +        + +I    +    
Sbjct  344   TGGLTVLYFSIRTYFPLPEG--WFNWKGNNWLLWGIGGYLVAIPLVVIVSIINQEIWQGQ  401

Query  785   LNSEP------PTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSL  624
               S P        ++T AL+                     + AP+ EE +FRGFL+ SL
Sbjct  402   GGSNPLLFLAVQAQDTIALL--------------IFFTTAAIAAPIFEEIIFRGFLLPSL  447

Query  623   TKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSG  444
             TK+ P  +++ +S+ +FS AHL+  E   L VLG  LG  Y ++RN+L  I +H+ WNSG
Sbjct  448   TKYFPVWVSIALSSLLFSVAHLSLSEVLPLTVLGLVLGVVYTRSRNILASIVVHSLWNSG  507

Query  443   VILLLTFL  420
              +L L  L
Sbjct  508   TLLSLYIL  515



>ref|XP_007132668.1| hypothetical protein PHAVU_011G1146001g, partial [Phaseolus vulgaris]
 gb|ESW04662.1| hypothetical protein PHAVU_011G1146001g, partial [Phaseolus vulgaris]
Length=113

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            ++ P+LEE V+RGFL+ SL+  +    AV IS+A+FSA HL+   F QLFV+G  LG SY
Sbjct  27   IVIPLLEEVVYRGFLLTSLSSTMEGQQAVAISSAIFSAIHLSAQNFLQLFVIGCILGCSY  86

Query  500  AQTRNLLTPITIHAFWNS  447
            + T NL + I IH+ +N+
Sbjct  87   SWTGNLSSSIVIHSLYNA  104



>ref|WP_023071621.1| abortive infection protein [Leptolyngbya sp. Heron Island J]
 gb|ESA37592.1| abortive infection protein [Leptolyngbya sp. Heron Island J]
Length=496

 Score = 84.3 bits (207),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            V AP+ EE +FRGFL+ SLT+++P   A+L+S+ +F+AAHL+  E   L +LGT L + Y
Sbjct  408  VAAPLFEEVLFRGFLLPSLTRYMPVWSAILLSSLIFAAAHLSLSEVLPLTLLGTILAWVY  467

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
            A++RNLL+P+ IH+ WNS  ++ L  L
Sbjct  468  ARSRNLLSPMLIHSLWNSATLVGLFLL  494



>ref|WP_029681615.1| CAAX protease [Synechococcus sp. NKBG15041c]
Length=501

 Score = 84.3 bits (207),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 61/87 (70%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            V+AP+ EE +FRGFL+ SLT+++P   ++++SA +F+ AH++  E   L  LG  LGF Y
Sbjct  413  VMAPLFEEIMFRGFLLPSLTRYMPVWGSIILSAFLFAIAHMSLSEVLPLMTLGIILGFVY  472

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL P+ +H+ WNSG +L L  L
Sbjct  473  VKSRNLLAPMLLHSLWNSGTLLSLFIL  499



>ref|WP_014274552.1| hypothetical protein [Arthrospira platensis]
 ref|YP_005067475.1| hypothetical protein [Arthrospira platensis NIES-39]
 dbj|BAI88937.1| hypothetical protein [Arthrospira platensis NIES-39]
Length=491

 Score = 84.0 bits (206),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP  EE +FRGFL+ SLT++ P   A++ S  +F+ AHL   E   LFVLG  LGF Y
Sbjct  400  IAAPWFEEVLFRGFLLPSLTRYFPLWGAIIASGLLFAVAHLNVSEILPLFVLGIVLGFVY  459

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL P+ +H+ WNSG ++ L  L
Sbjct  460  TRSRNLLAPMLLHSLWNSGTLISLYIL  486



>gb|KDP24144.1| hypothetical protein JCGZ_25801 [Jatropha curcas]
Length=296

 Score = 82.0 bits (201),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            ++ P++EE ++RGFL+ SL   +    AV IS+AVFSAAH +   F QLF++G  LGF Y
Sbjct  210  LVTPLMEEIIYRGFLLTSLASTMNWQKAVFISSAVFSAAHFSGENFLQLFIIGCVLGFCY  269

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFLQ  417
            + T NL +PI IH+ +N+ V L++TF+ 
Sbjct  270  SWTGNLSSPIAIHSLYNA-VTLIITFVS  296



>ref|WP_030006069.1| CAAX protease [Synechococcus sp. NKBG042902]
Length=502

 Score = 84.0 bits (206),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 61/87 (70%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            V+AP+ EE +FRGFL+ SLT+++P   ++++SA +F+ AH++  E   L  LG  LGF Y
Sbjct  414  VMAPLFEEIMFRGFLLPSLTRYVPVWGSIILSAFLFAIAHMSLSEVLPLMTLGIILGFVY  473

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL P+ +H+ WNSG +L L  L
Sbjct  474  VKSRNLLAPMLLHSLWNSGTLLSLFIL  500



>emb|CDN11786.1| hypothetical protein RintRC_6086 [Richelia intracellularis]
Length=487

 Score = 84.0 bits (206),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            V AP+ EE +FRGFL+ SLT++LP   A+++S+ +F+ AHL+  E   L  LG  LGF Y
Sbjct  396  VAAPLFEECLFRGFLLPSLTRYLPMWGAIVVSSFLFAIAHLSLSEIIPLTALGMVLGFVY  455

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFLQLQG  408
             ++RNLL P+ +H+ WNSG ++ L  L   G
Sbjct  456  VRSRNLLAPMLLHSLWNSGTLISLFILGSNG  486



>gb|KDO42457.1| hypothetical protein CISIN_1g026106mg [Citrus sinensis]
Length=188

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 60/88 (68%), Gaps = 1/88 (1%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            ++AP+LEE V+RGFL+ SL   +    AV+IS+A+FS AH +   F QLF++G  LG SY
Sbjct  102  IIAPLLEEAVYRGFLLTSLASTMSWRNAVVISSAIFSVAHFSIDNFLQLFIIGCVLGSSY  161

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFLQ  417
              + NL++ I IH+ +N+  IL++ FL 
Sbjct  162  CWSGNLISSIAIHSLYNAS-ILMIIFLS  188



>ref|WP_012305909.1| CAAX amino protease [Synechococcus sp. PCC 7002]
 ref|YP_001733541.1| CAAX amino protease [Synechococcus sp. PCC 7002]
 gb|ACA98285.1| CAAX amino terminal protease family; membrane protein [Synechococcus 
sp. PCC 7002]
Length=502

 Score = 84.0 bits (206),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 61/87 (70%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            V+AP+ EE +FRGFL+ SLT+++P   ++++SA +F+ AH++  E   L  LG  LGF Y
Sbjct  414  VMAPLFEEIMFRGFLLPSLTRYVPVWGSIILSAFLFAIAHMSLSEVLPLMTLGIILGFVY  473

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL P+ +H+ WNSG +L L  L
Sbjct  474  VKSRNLLAPMLLHSLWNSGTLLSLFIL  500



>ref|WP_035986145.1| metal-dependent membrane protease [Leptolyngbya sp. KIOST-1]
Length=529

 Score = 84.0 bits (206),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 61/87 (70%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EE +FRGFL+ SLT++L +  A+ +SA +F+AAHL+  E   L +LG  LGF Y
Sbjct  441  IAAPLFEEVLFRGFLLPSLTRYLSAGWAIALSAFIFAAAHLSLSEVLPLTLLGAVLGFVY  500

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL+P+ +H+ WNS  +L L  L
Sbjct  501  TRSRNLLSPMVLHSAWNSATMLGLFIL  527



>ref|WP_037218212.1| abortive phage infection protein [Richelia intracellularis]
Length=522

 Score = 83.6 bits (205),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            V AP+ EE +FRGFL+ SLT++LP   A+++S+ +F+ AHL+  E   L  LG  LGF Y
Sbjct  431  VAAPLFEECLFRGFLLPSLTRYLPMWGAIVVSSFLFAIAHLSLSEIIPLTALGMVLGFVY  490

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFLQLQG  408
             ++RNLL P+ +H+ WNSG ++ L  L   G
Sbjct  491  VRSRNLLAPMLLHSLWNSGTLISLFILGSNG  521



>ref|XP_007198805.1| hypothetical protein PRUPE_ppa025767mg, partial [Prunus persica]
 gb|EMJ00004.1| hypothetical protein PRUPE_ppa025767mg, partial [Prunus persica]
Length=148

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            ++ PVLEET++RGFL+ S++  +    AVLIS+A+FSAAHL+     QLF++G  LG SY
Sbjct  62   IVTPVLEETIYRGFLLASISFTMKWQSAVLISSAIFSAAHLSGENSLQLFIIGCVLGCSY  121

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFLQ  417
              T N  +P+ IH+ +N+ + L++TFL 
Sbjct  122  CSTGNSRSPMLIHSLYNA-MTLMITFLS  148



>ref|WP_009631880.1| putative metal-dependent membrane protease [Synechocystis sp. 
PCC 7509]
Length=521

 Score = 83.6 bits (205),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            V AP+ EE +FRGFL+ SLT++     A+LISA +F+ AHL+  E   L VLG  LGF Y
Sbjct  430  VAAPLFEEFLFRGFLLPSLTRYFSVWQAILISAFLFAIAHLSLSEVLPLMVLGVVLGFVY  489

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL P+ +H+ WNSG ++ L  L
Sbjct  490  TRSRNLLAPMLLHSLWNSGTLVSLFIL  516



>ref|WP_015133566.1| abortive infection protein [Leptolyngbya sp. PCC 7376]
 ref|YP_007070628.1| abortive infection protein [Leptolyngbya sp. PCC 7376]
 gb|AFY37794.1| Abortive infection protein [Leptolyngbya sp. PCC 7376]
Length=497

 Score = 83.6 bits (205),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 61/87 (70%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            VLAP+ EE +FRGFL+ SLT++LP   ++++SA +F+ AHL+  E   L  LG  LGF Y
Sbjct  409  VLAPLYEEIMFRGFLLPSLTRYLPVWGSIVLSAFLFAIAHLSLSEVLPLMTLGIILGFVY  468

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             +++N+L P+ +H+ WNSG +L L  L
Sbjct  469  TKSKNILAPMLLHSLWNSGTLLSLFIL  495



>ref|XP_008461909.1| PREDICTED: uncharacterized protein LOC103500400 isoform X2 [Cucumis 
melo]
Length=258

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            V+ P LEETV+RGFL+ S++  +    AV+IS+AVFSAAHL+     QLF++G  LG SY
Sbjct  172  VVTPFLEETVYRGFLLASISSEMQWQQAVVISSAVFSAAHLSVENSLQLFIIGCVLGCSY  231

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
              T NL + I IH+ +N  + LLLT+L
Sbjct  232  CWTGNLRSSILIHSLYN-AMTLLLTYL  257



>ref|XP_010106589.1| Putative membrane peptidase ydiL [Morus notabilis]
 gb|EXC10843.1| Putative membrane peptidase ydiL [Morus notabilis]
Length=368

 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 69/241 (29%), Positives = 113/241 (47%), Gaps = 14/241 (6%)
 Frame = -3

Query  1145  RWSVPWNWQTISLTSL--ACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAI  972
             RW+VPW  +TI    L     F F+ + ++  AA   TG+  E L+L  +A    L    
Sbjct  134   RWTVPWTLETILQVMLLWVAAFCFIGSSMVPFAA-HLTGLSRESLTLRGQALFSLLTDIT  192

Query  971   TTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGVAM  792
                  + +L       +PLP D + + ++  + +           + G L    + G++ 
Sbjct  193   EGLAGIMILLRCLSRFRPLPPDWFRFSFKGNWYID---------VVLGCLMFPLVNGLSH  243

Query  791   SSLNSEP--PTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTK  618
              +L   P  P+           ++    ++    + +  V APV EE VFRGFL+ SLTK
Sbjct  244   FNLKLLPILPSTPVTLSSVEQSVLACDRVAMALYVIVVSVCAPVWEEIVFRGFLLPSLTK  303

Query  617   WLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVI  438
             ++P   A+L+S+ VF+ AH        L  LG  +G  +A++RNLL  + +H+ WNS V 
Sbjct  304   YMPVWCAILVSSVVFALAHFNIQRMLPLIFLGVVMGAVFARSRNLLPSMLLHSLWNSFVF  363

Query  437   L  435
             L
Sbjct  364   L  364



>gb|ACL54593.1| unknown [Zea mays]
Length=191

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -3

Query  1187  PDPKGSGPNCPIFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYTGIQVEELSLD  1008
             PD   S    PI RRW VPW W TISLT +AC  SF+LTG+ E + +   G +  E +LD
Sbjct  87    PDKGKSSDEWPILRRWDVPWEWPTISLTMVACAVSFLLTGIAEQSILEQLGFRAGETTLD  146

Query  1007  EKAEILFLDQ  978
             EKAEILFL Q
Sbjct  147   EKAEILFLGQ  156



>ref|XP_008239007.1| PREDICTED: uncharacterized protein LOC103337617 isoform X2 [Prunus 
mume]
Length=337

 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 70/253 (28%), Positives = 105/253 (42%), Gaps = 34/253 (13%)
 Frame = -3

Query  1145  RWSVPWNWQTISLTSL--ACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAI  972
             RWSVPW  +TI    L     F F+ + ++  AA    G   E L+   +A    +    
Sbjct  103   RWSVPWTAETIMQVMLLWVVAFWFIGSWMVPFAA-HLAGFSRESLTFRGQALFSLVTDVT  161

Query  971   TTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNL------------QRgwllwaaiglag  828
                  + +LY      +PLP D + +  +  + L             R       +    
Sbjct  162   EGLAGIVILYRCLSRFRPLPPDWFKFSLKGSWQLDVALGCLMFPLVNRLSQFNLNLLPLL  221

Query  827   alaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVF  648
                 + ++ V  S L  +P      A+V                     V APV EE VF
Sbjct  222   PSTPVTISSVEQSILARDPVAMALYAVV-------------------VSVCAPVWEEIVF  262

Query  647   RGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPIT  468
             RGFL+ SLTK++P   A+L+S+ VF+ AH        L  LG  +G  +A++RNLL  + 
Sbjct  263   RGFLLPSLTKYMPVWSAILVSSVVFALAHFNVQRMLPLIFLGVVMGVIFARSRNLLPSML  322

Query  467   IHAFWNSGVILLL  429
             +H+ WN  V L L
Sbjct  323   LHSLWNGFVFLDL  335



>ref|WP_019502188.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=513

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 56/87 (64%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP  EE +FRGFLM SLTK +P   A+ IS  +F+ AHL   +   L VLGT LGF Y
Sbjct  424  IAAPFFEEILFRGFLMPSLTKIVPFWSAIAISGFLFAVAHLNLADLMPLTVLGTILGFVY  483

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
            A++ NLL P+ +HA WNSG  L L  L
Sbjct  484  ARSGNLLAPMFLHALWNSGSFLALVAL  510



>ref|WP_007356391.1| MULTISPECIES: abortive phage infection protein [Kamptonema]
 emb|CBN57189.1| abortive infection protein [ [[Oscillatoria] sp. PCC 6506]
Length=528

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EE +FRGFL+ SLT++LP   A+ +S  VF+ AHL   E   L  LG  LGF Y
Sbjct  437  IAAPLFEEIIFRGFLLPSLTRYLPIWGAIALSGFVFAIAHLNASEVLPLATLGMILGFVY  496

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL P+ +H+ WNSG +L L  L
Sbjct  497  TRSRNLLAPMLLHSLWNSGTLLSLFIL  523



>ref|WP_027843144.1| abortive phage infection protein [Mastigocoleus testarum]
Length=513

 Score = 82.8 bits (203),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EE +FRGFL+ SLTK+LP   +++IS+ +F+AAH +  E   L  LG  LG  Y
Sbjct  422  IAAPLFEEILFRGFLLPSLTKYLPVWGSIIISSVLFAAAHFSLSELIPLTSLGIILGIVY  481

Query  500  AQTRNLLTPITIHAFWNSGVILLL  429
             ++RNLL P+ +H+ WNSG +L L
Sbjct  482  TRSRNLLAPMLLHSLWNSGTLLSL  505



>ref|XP_007209320.1| hypothetical protein PRUPE_ppa007988mg [Prunus persica]
 gb|EMJ10519.1| hypothetical protein PRUPE_ppa007988mg [Prunus persica]
Length=349

 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 70/253 (28%), Positives = 105/253 (42%), Gaps = 34/253 (13%)
 Frame = -3

Query  1145  RWSVPWNWQTISLTSL--ACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAI  972
             RWSVPW  +TI    L     F F+ + ++  AA    G   E L+   +A    +    
Sbjct  115   RWSVPWTAETIMQVMLLWVVAFWFIGSWMVPFAA-HLAGFSRESLTFRGQALFSLVTDVT  173

Query  971   TTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNL------------QRgwllwaaiglag  828
                  + +LY      +PLP D + +  +  + L             R       +    
Sbjct  174   EGLAGIVILYRCLSRFRPLPPDWFKFSLKGSWQLDVALGCLMFPLVNRLSQFNLNLLPLL  233

Query  827   alaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVF  648
                 + ++ V  S L  +P      A+V                     V APV EE VF
Sbjct  234   PSTPVTISSVEQSILARDPVAMALYAVV-------------------VSVCAPVWEEIVF  274

Query  647   RGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPIT  468
             RGFL+ SLTK++P   A+L+S+ VF+ AH        L  LG  +G  +A++RNLL  + 
Sbjct  275   RGFLLPSLTKYMPVWSAILVSSVVFALAHFNVQRMLPLIFLGVVMGVIFARSRNLLPSML  334

Query  467   IHAFWNSGVILLL  429
             +H+ WN  V L L
Sbjct  335   LHSLWNGFVFLDL  347



>ref|XP_008239006.1| PREDICTED: uncharacterized protein LOC103337617 isoform X1 [Prunus 
mume]
Length=349

 Score = 81.3 bits (199),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 70/253 (28%), Positives = 105/253 (42%), Gaps = 34/253 (13%)
 Frame = -3

Query  1145  RWSVPWNWQTISLTSL--ACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAI  972
             RWSVPW  +TI    L     F F+ + ++  AA    G   E L+   +A    +    
Sbjct  115   RWSVPWTAETIMQVMLLWVVAFWFIGSWMVPFAA-HLAGFSRESLTFRGQALFSLVTDVT  173

Query  971   TTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNL------------QRgwllwaaiglag  828
                  + +LY      +PLP D + +  +  + L             R       +    
Sbjct  174   EGLAGIVILYRCLSRFRPLPPDWFKFSLKGSWQLDVALGCLMFPLVNRLSQFNLNLLPLL  233

Query  827   alaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVF  648
                 + ++ V  S L  +P      A+V                     V APV EE VF
Sbjct  234   PSTPVTISSVEQSILARDPVAMALYAVV-------------------VSVCAPVWEEIVF  274

Query  647   RGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPIT  468
             RGFL+ SLTK++P   A+L+S+ VF+ AH        L  LG  +G  +A++RNLL  + 
Sbjct  275   RGFLLPSLTKYMPVWSAILVSSVVFALAHFNVQRMLPLIFLGVVMGVIFARSRNLLPSML  334

Query  467   IHAFWNSGVILLL  429
             +H+ WN  V L L
Sbjct  335   LHSLWNGFVFLDL  347



>gb|KDO42455.1| hypothetical protein CISIN_1g026106mg [Citrus sinensis]
Length=243

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 60/88 (68%), Gaps = 1/88 (1%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            ++AP+LEE V+RGFL+ SL   +    AV+IS+A+FS AH +   F QLF++G  LG SY
Sbjct  157  IIAPLLEEAVYRGFLLTSLASTMSWRNAVVISSAIFSVAHFSIDNFLQLFIIGCVLGSSY  216

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFLQ  417
              + NL++ I IH+ +N+  IL++ FL 
Sbjct  217  CWSGNLISSIAIHSLYNAS-ILMIIFLS  243



>ref|XP_006491646.1| PREDICTED: uncharacterized protein LOC102619273 isoform X2 [Citrus 
sinensis]
Length=254

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            ++AP+LEE V+RGFL+ SL   +    AV+IS+A+FS AH +   F QLF++G  LG SY
Sbjct  168  IIAPLLEEAVYRGFLLTSLASTMSWRNAVVISSAIFSVAHFSIDNFLQLFIIGCVLGSSY  227

Query  500  AQTRNLLTPITIHAFWNSGVILLL  429
              + NL++ I IH+ +N+ +++++
Sbjct  228  CWSGNLISSIAIHSLYNASILMII  251



>gb|KDO42456.1| hypothetical protein CISIN_1g026106mg [Citrus sinensis]
Length=220

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            ++AP+LEE V+RGFL+ SL   +    AV+IS+A+FS AH +   F QLF++G  LG SY
Sbjct  134  IIAPLLEEAVYRGFLLTSLASTMSWRNAVVISSAIFSVAHFSIDNFLQLFIIGCVLGSSY  193

Query  500  AQTRNLLTPITIHAFWNSGVILLL  429
              + NL++ I IH+ +N+ +++++
Sbjct  194  CWSGNLISSIAIHSLYNASILMII  217



>ref|WP_016860061.1| abortive phage infection protein [Fischerella muscicola]
Length=525

 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EE +FRGFL+ SLT+++    A++ISA +F+ AHL+  E   LF LG  LG  Y
Sbjct  435  IAAPLFEEFLFRGFLLPSLTRYVSVWWAIIISALLFAIAHLSLSEVLPLFALGVVLGVVY  494

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL P+ +H+ WNSG +L L  L
Sbjct  495  TRSRNLLAPMLLHSLWNSGTLLSLFIL  521



>ref|XP_004161901.1| PREDICTED: uncharacterized protein LOC101228787 [Cucumis sativus]
Length=279

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            V+ P+LEETV+RGFL+ S++  +    AV+IS+AVFSAAHL+     QLF++G  LG SY
Sbjct  193  VVTPLLEETVYRGFLLASISSEMQWQQAVVISSAVFSAAHLSVENSLQLFIIGCVLGCSY  252

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
              T NL + I IH+ +N  + LLLT+L
Sbjct  253  CWTGNLRSSILIHSLYN-AMSLLLTYL  278



>ref|WP_015199187.1| abortive infection protein [Calothrix parietina]
 ref|YP_007138532.1| abortive infection protein [Calothrix sp. PCC 6303]
 gb|AFZ02560.1| Abortive infection protein [Calothrix sp. PCC 6303]
Length=507

 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EE +FRGFL+ SLT++LP   A+++S+ +F+AAHL+  E   LF LG  LG  Y
Sbjct  416  IAAPLFEEFLFRGFLLPSLTRYLPVWGAIVLSSLLFAAAHLSLSEIIPLFFLGCILGVVY  475

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL  + +H+ WNSG +L L  L
Sbjct  476  TRSRNLLASMLLHSLWNSGTLLALFVL  502



>ref|WP_019490774.1| hypothetical protein [Calothrix sp. PCC 7103]
Length=519

 Score = 82.0 bits (201),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EE +FRGFL+ SLT+++P   ++++S+ +F+AAHL+  E   L  LG  LG  Y
Sbjct  428  IAAPLFEEFLFRGFLLPSLTRYMPVWASIIVSSFIFAAAHLSLSEILPLTSLGIILGIVY  487

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL P+ +H+ WNSG +L L  L
Sbjct  488  TRSRNLLAPMMLHSLWNSGTLLTLFVL  514



>ref|WP_015191891.1| Abortive infection protein [Stanieria cyanosphaera]
 ref|YP_007131184.1| Abortive infection protein [Stanieria cyanosphaera PCC 7437]
 gb|AFZ34218.1| Abortive infection protein [Stanieria cyanosphaera PCC 7437]
Length=530

 Score = 82.0 bits (201),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EE +FRGFL+ SLT+++P   A++IS  +F+ AHL+  E   L  LG  LG  Y
Sbjct  440  IAAPLFEEVMFRGFLLPSLTRYVPVWGAIIISGFIFAVAHLSLSEVLPLATLGIILGIVY  499

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL PI +H+ WNSG +L L  L
Sbjct  500  TRSRNLLAPIFLHSLWNSGTLLSLFVL  526



>ref|WP_035154569.1| abortive phage infection protein [Calothrix sp. 336/3]
 gb|KFB84374.1| abortive phage infection protein [Calothrix sp. 336/3]
Length=509

 Score = 82.0 bits (201),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + APV EE +FRGFL+ SLT+++    A+LIS+ VF+ AHL+  E   LF LG  LG  Y
Sbjct  418  IAAPVFEEFLFRGFLLPSLTRYMSVWGAILISSLVFAVAHLSLSEILPLFALGVVLGVVY  477

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL  + +H+ WNSG +L L  L
Sbjct  478  TRSRNLLASMLLHSLWNSGTLLSLFVL  504



>ref|XP_004139689.1| PREDICTED: uncharacterized protein LOC101217192 [Cucumis sativus]
 gb|KGN44453.1| hypothetical protein Csa_7G291730 [Cucumis sativus]
Length=300

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            V+ P+LEETV+RGFL+ S++  +    AV+IS+AVFSAAHL+     QLF++G  LG SY
Sbjct  214  VVTPLLEETVYRGFLLASISSEMQWQQAVVISSAVFSAAHLSVENSLQLFIIGCVLGCSY  273

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
              T NL + I IH+ +N  + LLLT+L
Sbjct  274  CWTGNLRSSILIHSLYN-AMSLLLTYL  299



>ref|WP_006098562.1| abortive phage infection protein [Coleofasciculus chthonoplastes]
 gb|EDX78126.1| CAAX amino terminal protease family [Coleofasciculus chthonoplastes 
PCC 7420]
Length=547

 Score = 82.0 bits (201),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EE +FRGFL+ SLT+++P   A++ S+ VF+ AHL+  E   L  LG  LG  Y
Sbjct  456  IAAPLFEEFMFRGFLLPSLTRYMPVWGAIVTSSLVFAIAHLSLSEVLPLATLGIVLGIVY  515

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL P+ +H+ WNSG +L L  L
Sbjct  516  TRSRNLLAPMIVHSLWNSGTLLSLVIL  542



>ref|XP_008461908.1| PREDICTED: uncharacterized protein LOC103500400 isoform X1 [Cucumis 
melo]
Length=311

 Score = 80.1 bits (196),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            V+ P LEETV+RGFL+ S++  +    AV+IS+AVFSAAHL+     QLF++G  LG SY
Sbjct  225  VVTPFLEETVYRGFLLASISSEMQWQQAVVISSAVFSAAHLSVENSLQLFIIGCVLGCSY  284

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
              T NL + I IH+ +N  + LLLT+L
Sbjct  285  CWTGNLRSSILIHSLYN-AMTLLLTYL  310



>ref|XP_006491645.1| PREDICTED: uncharacterized protein LOC102619273 isoform X1 [Citrus 
sinensis]
Length=317

 Score = 79.7 bits (195),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            ++AP+LEE V+RGFL+ SL   +    AV+IS+A+FS AH +   F QLF++G  LG SY
Sbjct  231  IIAPLLEEAVYRGFLLTSLASTMSWRNAVVISSAIFSVAHFSIDNFLQLFIIGCVLGSSY  290

Query  500  AQTRNLLTPITIHAFWNSGVILLL  429
              + NL++ I IH+ +N+ +++++
Sbjct  291  CWSGNLISSIAIHSLYNASILMII  314



>ref|WP_015187177.1| Abortive infection protein [Gloeocapsa sp. PCC 7428]
 ref|YP_007126460.1| Abortive infection protein [Gloeocapsa sp. PCC 7428]
 gb|AFZ29300.1| Abortive infection protein [Gloeocapsa sp. PCC 7428]
Length=529

 Score = 81.6 bits (200),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EE +FRGFL+ SLT+++    A+L+S+ +F+ AHL+  E   L VLG  LG  Y
Sbjct  438  IAAPIFEELLFRGFLLPSLTRYVSVSGAILLSSLLFAVAHLSVAEILPLTVLGIVLGVVY  497

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL P+ +H+ WNSG +L L  L
Sbjct  498  TRSRNLLAPMLLHSLWNSGTLLSLFIL  524



>ref|XP_006388524.1| hypothetical protein POPTR_0163s00230g, partial [Populus trichocarpa]
 gb|ERP47438.1| hypothetical protein POPTR_0163s00230g, partial [Populus trichocarpa]
Length=94

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            ++ P+LEE V+RGFL+ SL   +    AVL+S+AVFSAAH +   F QLF++G  LG SY
Sbjct  8    LVTPLLEEIVYRGFLLKSLASTMNWQQAVLLSSAVFSAAHFSVENFIQLFIIGCVLGCSY  67

Query  500  AQTRNLLTPITIHAFWNSGVILLLTF  423
            + + NL +PI  H+  N+ + L++TF
Sbjct  68   SWSGNLCSPILTHSLCNA-LTLIITF  92



>ref|WP_006516835.1| putative metal-dependent membrane protease [Leptolyngbya sp. 
PCC 7375]
 gb|EKV02452.1| putative metal-dependent membrane protease [Leptolyngbya sp. 
PCC 7375]
Length=497

 Score = 81.3 bits (199),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 62/87 (71%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            V AP+ EE +FRGFL+ SLT+++P   A+L+S+ +F++AHL+  E   L +LGT L + Y
Sbjct  408  VAAPLFEEVLFRGFLLPSLTRYMPVWGAILLSSFIFASAHLSLSEVLPLTMLGTILAWVY  467

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
            +++RNLL P+ IH+ WNS  ++ L  L
Sbjct  468  SRSRNLLAPMLIHSLWNSATLIGLFLL  494



>ref|WP_019508695.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=522

 Score = 81.3 bits (199),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EE +FRGFL+ SLT+++    A++ISA +F+ AHL+  E   L  LG  LG  Y
Sbjct  432  IAAPLFEEIMFRGFLLPSLTRYVSVSGAIMISAIIFAVAHLSLSEVLPLTTLGIVLGVVY  491

Query  500  AQTRNLLTPITIHAFWNSGVILLL  429
             ++RNLL P+ +H+ WNSG ++ L
Sbjct  492  TRSRNLLAPMLLHSLWNSGTLISL  515



>ref|WP_026719661.1| abortive phage infection protein [Fischerella sp. PCC 9431]
Length=525

 Score = 81.3 bits (199),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EE +FRGFL+ SLT+++    A++ SA +F+ AHL+  E   LF LG  LG  Y
Sbjct  435  IAAPLFEEFLFRGFLLSSLTRYMSVWWAIITSAFLFAIAHLSLSEVLPLFALGVVLGVVY  494

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL P+ +H+ WNSG +L L  L
Sbjct  495  TRSRNLLAPMLLHSLWNSGTLLSLFVL  521



>ref|WP_036479682.1| abortive phage infection protein [Myxosarcina sp. GI1]
Length=524

 Score = 80.9 bits (198),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EE +FRGFL+ SLT+++    A++ISA +F+ AHL+  E   L  LG  LG  Y
Sbjct  434  IAAPIFEEIMFRGFLLPSLTRYVSVWGAIIISALIFAVAHLSLSEVLPLATLGIVLGVVY  493

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL P+ +H+ WNSG ++ L  L
Sbjct  494  TRSRNLLAPMLLHSLWNSGTLISLFIL  520



>ref|WP_023064005.1| CAAX protease self-immunity family protein [Lyngbya aestuarii]
 gb|ERT09943.1| CAAX protease self-immunity family protein [Lyngbya aestuarii 
BL J]
Length=499

 Score = 80.9 bits (198),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 56/87 (64%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + APV EE +FRGFL+ SLT+++    A+L+S+  F+ AH+   E   L  LG  LGF Y
Sbjct  408  IAAPVFEEIMFRGFLLPSLTRYMSMGSAILLSSLFFAVAHMNISEIIPLMTLGIVLGFVY  467

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL+ + +H  WNSG +L L  L
Sbjct  468  TRSRNLLSSMLLHCLWNSGTLLSLYIL  494



>emb|CEF99712.1| CAAX amino terminal protease [Ostreococcus tauri]
Length=402

 Score = 80.5 bits (197),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTP-GEFPQLFVLGTALGFS  504
            VLAP+ EE  FRG+LM SLTK++ +P+AV  SA +F+  H    G+  QL V+G A G  
Sbjct  313  VLAPIFEEICFRGYLMPSLTKYVSTPVAVGASAVIFALVHQHGVGDTAQLLVVGLATGLV  372

Query  503  YAQTRNLLTPITIHAFWNSGVILLLTF  423
            YA+TRNL   + +HA +N+ VI L   
Sbjct  373  YARTRNLAASMAVHAAFNATVIALFAL  399



>ref|WP_009784581.1| abortive phage infection protein [Lyngbya sp. PCC 8106]
 gb|EAW36845.1| hypothetical protein L8106_26827 [Lyngbya sp. PCC 8106]
Length=499

 Score = 80.9 bits (198),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 56/87 (64%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + APV EE +FRGFL+ SLT+++    A+L+S+  F+ AH+   E   L  LG  LGF Y
Sbjct  408  IAAPVFEEIMFRGFLLPSLTRYMSMGSAILLSSLFFAVAHMNISEIIPLMTLGIVLGFVY  467

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL+ + +H  WNSG +L L  L
Sbjct  468  TRSRNLLSSMLLHCLWNSGTLLSLYIL  494



>ref|XP_003082097.1| unnamed protein product [Ostreococcus tauri]
Length=329

 Score = 79.3 bits (194),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTP-GEFPQLFVLGTALGFS  504
            VLAP+ EE  FRG+LM SLTK++ +P+AV  SA +F+  H    G+  QL V+G A G  
Sbjct  240  VLAPIFEEICFRGYLMPSLTKYVSTPVAVGASAVIFALVHQHGVGDTAQLLVVGLATGLV  299

Query  503  YAQTRNLLTPITIHAFWNSGVILLLTF  423
            YA+TRNL   + +HA +N+ VI L   
Sbjct  300  YARTRNLAASMAVHAAFNATVIALFAL  326



>gb|EPS73198.1| hypothetical protein M569_01553, partial [Genlisea aurea]
Length=243

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 71/248 (29%), Positives = 109/248 (44%), Gaps = 26/248 (10%)
 Frame = -3

Query  1148  RRWSVPWNWQTISLTSL--ACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEI-LFLDQ  978
             + W+VPW+ QTI+   +     F FV + +I   A    G   E LS   +A   L  D 
Sbjct  8     KPWTVPWSAQTIAQVVILWIASFWFVGSWMIPIGA-HMVGFSKESLSFRGQALFSLLTDV  66

Query  977   AITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaia----  810
             A   A +L +L+      +PLP D +    R  + +           +            
Sbjct  67    AEGIAGIL-ILHRCLSRFRPLPPDWFKLTLRGKWAIDVFVGCSMFPLVNRLSQFNMDLLP  125

Query  809   ---LTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGF  639
                 T V +SS+      R+  A+                   +  V APV EE VFRGF
Sbjct  126   ILPSTPVTLSSVEHSIMARDPVAM--------------GLYALVLVVCAPVWEEVVFRGF  171

Query  638   LMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHA  459
             L+ SLTK++P  L++++S+  F+ AHL       L  LG  +G +YA++RNL+  + +H+
Sbjct  172   LLPSLTKYMPVGLSIVVSSVAFALAHLNVQRMLPLIFLGMVMGVTYARSRNLVPCMLLHS  231

Query  458   FWNSGVIL  435
              WN  V L
Sbjct  232   LWNGFVFL  239



>ref|WP_017715794.1| hypothetical protein [Oscillatoria sp. PCC 10802]
Length=530

 Score = 80.9 bits (198),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 56/87 (64%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            V APV EE +FRGFL+ SLT++LP   A+  S+ +F+ AHL   E   L  LG  LGF Y
Sbjct  439  VAAPVFEEIMFRGFLLPSLTRYLPVWGAIAASSLLFAVAHLNLSEVLPLATLGAVLGFVY  498

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             +TRNL   + +H+ WN+G +L L FL
Sbjct  499  TRTRNLFASMLLHSLWNTGTLLSLFFL  525



>ref|WP_017304316.1| hypothetical protein [Spirulina subsalsa]
Length=518

 Score = 80.5 bits (197),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = -3

Query  674  APVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQ  495
            AP+ EE +FRGF + SLT+++P   A+ +S+ VF+ AHL   E   L VLG  LGF Y +
Sbjct  431  APLFEEIIFRGFFLPSLTRYIPVWGAITLSSLVFAIAHLNISEVLPLTVLGMVLGFVYVR  490

Query  494  TRNLLTPITIHAFWNSGVILLLTFL  420
            +RNLL  I +H+ WNSG +L L  L
Sbjct  491  SRNLLASICLHSLWNSGTLLSLFLL  515



>ref|WP_016878155.1| abortive phage infection protein [Chlorogloeopsis fritschii]
Length=526

 Score = 80.5 bits (197),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EE +FRGFL+ SLT++L    A+++S+ +F+ AHL+  E   LF LG  LG  Y
Sbjct  435  IAAPIFEEFLFRGFLLPSLTRYLSVWGAIIVSSLLFAVAHLSLSEVLPLFSLGVVLGVVY  494

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL P+ +H+ WNSG ++ L  L
Sbjct  495  TRSRNLLAPMLLHSLWNSGTLISLFIL  521



>ref|WP_026099232.1| hypothetical protein [Prochlorothrix hollandica]
Length=540

 Score = 80.5 bits (197),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EE +FRGFL+ SLT++  S  A+ +SA +FS AHL+  E   LFVLG  LG+ Y
Sbjct  450  IAAPLFEEFLFRGFLLASLTRYFSSWGAIALSALIFSIAHLSLSEVLPLFVLGAVLGYVY  509

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             +++NLL P+ +H+ WNS  +  L  L
Sbjct  510  RRSQNLLAPMLLHSLWNSATLAGLVIL  536



>ref|WP_006510963.1| putative metal-dependent membrane protease [Xenococcus sp. PCC 
7305]
 gb|ELS01931.1| putative metal-dependent membrane protease [Xenococcus sp. PCC 
7305]
Length=524

 Score = 80.5 bits (197),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + APV EE +FRGFL+ SLT++L    A++IS  +F+ AHL+  E   L  LG  LG  Y
Sbjct  434  IAAPVFEEIMFRGFLLPSLTRYLSVSTAIVISGFIFAIAHLSLSEVLPLTTLGIILGAVY  493

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RN+L P+ +H+ WNSG +L L  L
Sbjct  494  TRSRNILAPMLLHSLWNSGTLLSLFIL  520



>ref|WP_017309079.1| abortive phage infection protein [Fischerella sp. PCC 9339]
Length=525

 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EE +FRGFL+ SLT+++    A++ SA +F+ AHL+  E   LF LG  LG  Y
Sbjct  435  IAAPLFEEFLFRGFLLPSLTRYVSVWWAIITSAFLFAIAHLSLSEVLPLFALGVVLGIVY  494

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL P+ +H+ WNSG +L L  L
Sbjct  495  TRSRNLLAPMLLHSLWNSGTLLSLFIL  521



>ref|WP_015172784.1| abortive infection protein [Geitlerinema sp. PCC 7407]
 ref|YP_007110272.1| abortive infection protein [Geitlerinema sp. PCC 7407]
 gb|AFY67220.1| Abortive infection protein [Geitlerinema sp. PCC 7407]
Length=507

 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EE +FRGFL+ SLT+++P   A+ +S+ +F+ AHL+  E   L  LG  LGF Y
Sbjct  416  IAAPLFEEILFRGFLLPSLTRYVPVWGAIALSSLIFALAHLSLSEVLPLATLGCVLGFVY  475

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL P+ +H  WNSG ++ L  L
Sbjct  476  TRSRNLLAPMLLHGLWNSGTLVSLVVL  502



>gb|KHG14846.1| Putative membrane peptidase ydiL [Gossypium arboreum]
Length=346

 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 106/246 (43%), Gaps = 24/246 (10%)
 Frame = -3

Query  1145  RWSVPWNWQTISLTSL--ACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAI  972
             RW+VPW  +TI    L     F F+ + +I  AA   +G   E L+   +A    +    
Sbjct  112   RWTVPWTAKTILQVMLLWVAAFWFIGSWMIPFAA-HMSGFSKESLTFRGQALFSLVTDVT  170

Query  971   TTAIVLGVLYTLTKSSKPLPNDIYCYDWREPF-------NLQRgwllwaaiglagalaai  813
                  + +L+       PLP+D + +  R  +        L    +   +      L  +
Sbjct  171   EGLAGIAILHRCLSQFYPLPSDWFKFSLRGKWLFDVMLGCLMFPAINRLSQFSLNLLPLM  230

Query  812   aLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLM  633
               T V +SS+      R+  A+                   +  + APV EE VFRGFL+
Sbjct  231   PSTPVTLSSVEQSIYARDPVAMA--------------LYAIVVSICAPVWEEIVFRGFLL  276

Query  632   VSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFW  453
              SLTK++P   A+L+S+  F+ AH        L  LG  +G  +A++RNLL  + +H+ W
Sbjct  277   PSLTKYMPVWCAILVSSVAFALAHFNVRRMLPLIFLGMVMGVVFARSRNLLPSMLLHSLW  336

Query  452   NSGVIL  435
             N  V L
Sbjct  337   NGFVFL  342



>ref|WP_009344607.1| abortive phage infection protein [Raphidiopsis brookii]
 gb|EFA71530.1| Abortive infection protein [Raphidiopsis brookii D9]
Length=493

 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EE +FRGFL+ SLT  LP   A+++S+ +F+ AHL+  E   L VLG  LG  Y
Sbjct  402  IAAPLFEEFLFRGFLLPSLTPHLPVSWAIVVSSFIFAIAHLSLSEMLPLTVLGMVLGVVY  461

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL+P+ +H  WNSG ++ L  L
Sbjct  462  TRSRNLLSPMLLHGLWNSGTLVSLFIL  488



>ref|WP_017320949.1| abortive phage infection protein [cyanobacterium PCC 7702]
Length=521

 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EE +FRGFL+ SLT+++    A+  S+ +F+ AHL+  E   LF LG  LG  Y
Sbjct  430  IAAPLFEEFLFRGFLLPSLTRYMSVWQAIFASSLLFAVAHLSLSEVLPLFALGVVLGVVY  489

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL P+ IH+ WNSG +L L  L
Sbjct  490  TRSRNLLAPMLIHSLWNSGTLLSLFIL  516



>ref|XP_010533617.1| PREDICTED: uncharacterized protein LOC104809356 [Tarenaya hassleriana]
Length=350

 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 66/249 (27%), Positives = 106/249 (43%), Gaps = 25/249 (10%)
 Frame = -3

Query  1145  RWSVPWNWQTISLTSL--ACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAI  972
             RW+VPW  +TI+   L     F F+ + +I  AA   +G   + L+   +A    +    
Sbjct  115   RWTVPWTAETIAQVMLLWVAAFWFIGSWMIPFAA-HVSGFHKDSLTFRGQALFSLITDVT  173

Query  971   TTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaia------  810
                  + +L+      +PLP D + +  +  + L      +    +              
Sbjct  174   EGLAGIAILHRCLSPFRPLPQDWFRFTLKGNWQLDIILGCFMFPLVNRISQFNLNLLPLP  233

Query  809   --LTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFL  636
                + V +SS+      R+  A+                   +  V APV EE VFRGFL
Sbjct  234   APSSPVTLSSVEQSIMARDPVAMA--------------LYAVVVSVCAPVWEEIVFRGFL  279

Query  635   MVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAF  456
             + SLTK++P   A+L+SA  F+ AH        L  LG  +G  +A++RNLL  + +H+ 
Sbjct  280   LPSLTKYMPVWCAILVSAFAFALAHFNVQRLLPLVFLGVVMGLIFARSRNLLPSMLLHSL  339

Query  455   WNSGVILLL  429
             WN  V L L
Sbjct  340   WNGFVFLEL  348



>ref|WP_015174715.1| Abortive infection protein [Oscillatoria nigro-viridis]
 ref|YP_007113802.1| Abortive infection protein [Oscillatoria nigro-viridis PCC 7112]
 gb|AFZ05386.1| Abortive infection protein [Oscillatoria nigro-viridis PCC 7112]
Length=530

 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + APV EE VFRGFL+ SLT++LP   A+  SA +F+ AHL+  E   L  LG  LGF Y
Sbjct  439  IAAPVFEEIVFRGFLLPSLTRYLPVWGAIAASALLFAVAHLSVSEILPLATLGAVLGFVY  498

Query  500  AQTRNLLTPITIHAFWN  450
             ++RNLL P+ +H+ WN
Sbjct  499  TRSRNLLAPMLLHSLWN  515



>ref|XP_009334489.1| PREDICTED: uncharacterized protein LOC103927305 [Pyrus x bretschneideri]
Length=349

 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 73/250 (29%), Positives = 113/250 (45%), Gaps = 28/250 (11%)
 Frame = -3

Query  1145  RWSVPWNWQTISLTSL--ACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAI  972
             RWSVPW+ +TI    L     F F+ + ++  AA    G   E  SL  + + LF     
Sbjct  115   RWSVPWSAETILQVMLLWVAAFCFIGSWMVPFAA-HMAGFSRE--SLTNRGQALFSLVTD  171

Query  971   TTAIVLGVLYTLTKSSK--PLPNDIYCYDWREPFNLQRgw-------llwaaiglagala  819
              T  ++G++      S+  PLP D + +  +  + L           +   +      L 
Sbjct  172   VTEGLVGIMIICRCLSRFRPLPPDWFKFSLKGTWQLDVALGCLMFPLVNQLSQFNLSLLP  231

Query  818   aiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGF  639
              +  T VA+SS+      R+  A+                   +  V AP+ EE +FRGF
Sbjct  232   LLPSTPVAVSSVEQSIMARDPVAMA--------------MYAVVVSVCAPMWEEILFRGF  277

Query  638   LMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHA  459
             L+ SLTK++P   AVL+S+ VF+ AH        L  LG  +G  +A++RNLL  + +H+
Sbjct  278   LLPSLTKYMPVWSAVLVSSVVFALAHWNVQRILPLIFLGVVMGVVFARSRNLLPSMLLHS  337

Query  458   FWNSGVILLL  429
              WN  V L L
Sbjct  338   LWNGFVFLDL  347



>ref|WP_012407312.1| abortive phage infection protein [Nostoc punctiforme]
 ref|YP_001864230.1| hypothetical protein Npun_R0514 [Nostoc punctiforme PCC 73102]
 gb|ACC79287.1| Abortive infection protein [Nostoc punctiforme PCC 73102]
Length=524

 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP  EE +FRGFL+ SLT++LP   +++IS+ +F+ AHL+  E   L  LG  LG  Y
Sbjct  435  IAAPFFEEILFRGFLLPSLTRYLPVWGSIIISSLLFAIAHLSLSEILPLTALGIVLGVVY  494

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL P+ +H+ WNSG +L L  L
Sbjct  495  TRSRNLLAPMLLHSLWNSGTLLSLFVL  521



>ref|WP_008307815.1| putative metal-dependent membrane protease [Leptolyngbya sp. 
PCC 6406]
Length=508

 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EE +FRGFL+ SLT+++P   A+ +S+ +F+AAHL+  E   L VLG  LG  Y
Sbjct  418  IAAPLFEEFLFRGFLLPSLTRYMPVGGAIWLSSFIFAAAHLSLSEILPLMVLGMVLGLVY  477

Query  500  AQTRNLLTPITIHAFWNS  447
             ++RNLL P+ +H+ WNS
Sbjct  478  TRSRNLLAPMVLHSAWNS  495



>ref|XP_004298847.1| PREDICTED: uncharacterized protein LOC101297145 [Fragaria vesca 
subsp. vesca]
Length=349

 Score = 78.2 bits (191),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 68/251 (27%), Positives = 105/251 (42%), Gaps = 34/251 (14%)
 Frame = -3

Query  1145  RWSVPWNWQTISLTSL--ACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAI  972
             RW+VPW  +TI    L     F F+ + ++  AA    G   E L+   +A    +    
Sbjct  115   RWTVPWTAETILQVMLLWVVAFWFIGSWMVPFAA-HLAGFNRESLTFRGQALFSLVTDVT  173

Query  971   TTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNL------------QRgwllwaaiglag  828
                  + +L+      +PLP D + +  +  + +             R  L    +    
Sbjct  174   EGLAGIMILHRCLSRFRPLPPDWFKFSLKGTWQIDVVLGCLMFPLVNRLSLFNLNLLPLL  233

Query  827   alaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVF  648
                 + ++ V  S L  +P      A+V                     V APV EE VF
Sbjct  234   PSTPVTISSVEQSILARDPVAMALYAIV-------------------VSVCAPVWEEIVF  274

Query  647   RGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPIT  468
             RGFL+ SLTK++P   A+L+SA VF+ AH        L  LG  +G  +A++RNLL  + 
Sbjct  275   RGFLLPSLTKYMPVWSAILVSAVVFALAHFNVQRMLPLVFLGVVMGVIFARSRNLLPSML  334

Query  467   IHAFWNSGVIL  435
             +H+ WN  V L
Sbjct  335   LHSLWNGFVFL  345



>ref|WP_006633320.1| abortive phage infection protein [Microcoleus vaginatus]
 gb|EGK87764.1| Abortive infection protein [Microcoleus vaginatus FGP-2]
Length=530

 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + APV EE VFRGFL+ SLT++LP   A+  SA +F+ AHL+  E   L  LG  LGF Y
Sbjct  439  IAAPVFEEIVFRGFLLPSLTRYLPVWGAIAASAFLFAVAHLSVSEILPLATLGAVLGFVY  498

Query  500  AQTRNLLTPITIHAFWN  450
             ++RNLL P+ +H+ WN
Sbjct  499  TRSRNLLAPMLLHSLWN  515



>ref|WP_015221989.1| abortive infection protein [Cyanobacterium stanieri]
 ref|YP_007164320.1| abortive infection protein [Cyanobacterium stanieri PCC 7202]
 gb|AFZ46671.1| Abortive infection protein [Cyanobacterium stanieri PCC 7202]
Length=491

 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            V AP+ EE +FRGFL+ SLT+++P   A+++S  VF+ AHL+  E   L  LG  LG  Y
Sbjct  400  VAAPIFEEIIFRGFLLPSLTRYMPVWGAIVLSGGVFAIAHLSLSEILPLATLGILLGIIY  459

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++R+LL+ I +H+ WNSG +  L  L
Sbjct  460  TRSRSLLSSIMVHSLWNSGTLFSLFLL  486



>ref|XP_011080891.1| PREDICTED: uncharacterized protein LOC105164040 [Sesamum indicum]
Length=370

 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 69/251 (27%), Positives = 109/251 (43%), Gaps = 28/251 (11%)
 Frame = -3

Query  1154  IFRRWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPY----TGIQVEELSLDEKAEILF  987
             I R W+VPW  +TI   +L    SF   G   +  IP+     G   E L+   +A    
Sbjct  133   IGRPWTVPWTAETILQVTLLWIVSFWFVG---SWMIPFGAHVVGFSRESLTFRGQAFFSL  189

Query  986   LDQAITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPF-------NLQRgwllwaaiglag  828
             L         + +L+      +PLP+D + +  +  +        L    +   +     
Sbjct  190   LTDVTEGLAGILILHRCLSRFRPLPSDWFKFSLKGNWLVDVLLGCLMFPLVNCLSQFNLD  249

Query  827   alaaiaLTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVF  648
              L  +  T VA+SS+      R+  A+                   +  V AP+ EE VF
Sbjct  250   LLPVLPSTPVALSSVEQSILARDPIAMA--------------LYALVLVVCAPLWEEIVF  295

Query  647   RGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPIT  468
             RGFL+ SLTK++P   ++L+S+  F+ AH        L  LG  +G +YA++RNLL  + 
Sbjct  296   RGFLLPSLTKYMPVWCSILVSSVAFALAHFNVQRMLPLIFLGVVMGVTYARSRNLLPSML  355

Query  467   IHAFWNSGVIL  435
             +H+ WN  V L
Sbjct  356   LHSLWNGFVFL  366



>ref|XP_007043568.1| Prenyl-dependent CAAX protease, putative isoform 1 [Theobroma 
cacao]
 gb|EOX99399.1| Prenyl-dependent CAAX protease, putative isoform 1 [Theobroma 
cacao]
Length=299

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            ++ P LEE V+RGFL+ SL   +    AV++SAA+FSAAH +   F QLFV+G  LG SY
Sbjct  213  IITPPLEEMVYRGFLLASLVSTMSWQQAVVLSAAIFSAAHFSGENFLQLFVVGCILGCSY  272

Query  500  AQTRNLLTPITIHAFWNSGVILLLTF  423
              T NL + I IH+ +N+ + L++TF
Sbjct  273  CGTGNLRSSIVIHSLYNA-LTLIITF  297



>ref|XP_007043571.1| Prenyl-dependent CAAX protease, putative isoform 4 [Theobroma 
cacao]
 gb|EOX99402.1| Prenyl-dependent CAAX protease, putative isoform 4 [Theobroma 
cacao]
Length=297

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            ++ P LEE V+RGFL+ SL   +    AV++SAA+FSAAH +   F QLFV+G  LG SY
Sbjct  211  IITPPLEEMVYRGFLLASLVSTMSWQQAVVLSAAIFSAAHFSGENFLQLFVVGCILGCSY  270

Query  500  AQTRNLLTPITIHAFWNSGVILLLTF  423
              T NL + I IH+ +N+ + L++TF
Sbjct  271  CGTGNLRSSIVIHSLYNA-LTLIITF  295



>ref|WP_011431455.1| CAAX amino terminal protease [Synechococcus sp. JA-3-3Ab]
 ref|YP_476047.1| CAAX amino terminal protease family protein [Synechococcus sp. 
JA-3-3Ab]
 gb|ABD00784.1| CAAX amino terminal protease family protein [Synechococcus sp. 
JA-3-3Ab]
Length=537

 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            V APV EE +FRGF + +L+++LP   A+L+SA  F+ AHL   +   L +LG  LG  Y
Sbjct  447  VCAPVFEEVLFRGFWLPTLSRYLPMGAAILLSAFTFALAHLNLSDLLPLTMLGVVLGVVY  506

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
            + +RNLL PI +H+ WN+G ++ L  L
Sbjct  507  SHSRNLLAPILLHSLWNTGSLVTLLVL  533



>gb|KHN16775.1| hypothetical protein glysoja_002872 [Glycine soja]
Length=341

 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 68/246 (28%), Positives = 101/246 (41%), Gaps = 24/246 (10%)
 Frame = -3

Query  1145  RWSVPWNWQTISLTSL--ACGFSFVLTGLIETAAIPYTGIQVEELSLDEKAEILFLDQAI  972
             RW VPWN  TI    L     F F+ + +I  AA   TG   E L+   +A    +    
Sbjct  107   RWVVPWNAMTILQVMLLWTTAFWFIGSWMIPFAA-HITGFSKESLTFRGQALFSLVTDVT  165

Query  971   TTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaia------  810
                  + +L       +PLP D + +  +  + L           +              
Sbjct  166   EGLAGVAILLRCLSRFRPLPPDWFEFSLKGNWQLDVIMGCLMFPLVNRLSQFNLDLLPLL  225

Query  809   -LTGVAMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLM  633
               T V +SS+      R+  A++                  +  V APV EE VFRGFL+
Sbjct  226   PSTPVTLSSVEQSIRARDPVAML--------------LYATVVSVCAPVWEEIVFRGFLL  271

Query  632   VSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFW  453
              SLTK++P   A+L+S+  F+ AH        L  LG  +G  Y ++RNLL  + +H+ W
Sbjct  272   PSLTKYMPVWCAILVSSIAFALAHFNIQRMLPLIFLGMVMGVIYTRSRNLLPSMLLHSLW  331

Query  452   NSGVIL  435
             N  V L
Sbjct  332   NGFVFL  337



>ref|XP_004514447.1| PREDICTED: uncharacterized protein LOC101505516 [Cicer arietinum]
Length=311

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            ++ P+LEE V+RGFL+ SL+  +    A+ IS+ +FSA H + G F QLF++G  LG SY
Sbjct  225  IVTPLLEEVVYRGFLLTSLSSTMKWQKAIAISSVIFSAIHFSGGNFVQLFIIGCVLGCSY  284

Query  500  AQTRNLLTPITIHAFWNSGVILLLTF  423
              T NL + I IH+ +N+  +++  F
Sbjct  285  CWTGNLKSSIVIHSLYNALTLIITYF  310



>gb|EAZ01098.1| hypothetical protein OsI_23126 [Oryza sativa Indica Group]
Length=366

 Score = 78.2 bits (191),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            V AP+ EE VFRGFL+ SLT+++P P ++L+SAA F+ AH        L  LG  +G  +
Sbjct  281  VCAPIWEEIVFRGFLLPSLTRYMPLPWSILVSAAAFALAHFNAQRVMPLVFLGVVMGGVF  340

Query  500  AQTRNLLTPITIHAFWNSGVILLL  429
            A++RNLL  + +H+ WN  V L L
Sbjct  341  ARSRNLLASMVLHSLWNGFVFLDL  364



>ref|XP_006656998.1| PREDICTED: uncharacterized protein LOC102717626 [Oryza brachyantha]
Length=335

 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            V AP+ EE VFRGFL+ SLT+++P P ++L+SAA F+ AH        L  LG  +G  +
Sbjct  250  VCAPIWEEIVFRGFLLPSLTRYMPLPWSILVSAAAFALAHFNAQRVMPLVFLGVVMGGVF  309

Query  500  AQTRNLLTPITIHAFWNSGVILLL  429
            A++RNLL  + +H+ WN  V L L
Sbjct  310  ARSRNLLASMVLHSLWNGFVFLDL  333



>ref|WP_009458258.1| MULTISPECIES: abortive phage infection protein [Fischerella]
 gb|EHC11041.1| Abortive infection protein [Fischerella sp. JSC-11]
Length=526

 Score = 79.0 bits (193),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EE +FRGFL+ SLT+++    A++ S+ +F+ AHL+  E   LF LG  LG  Y
Sbjct  435  IAAPLFEEFLFRGFLLPSLTRYMSVWWAIIASSFLFAIAHLSLSEVLPLFALGIVLGVVY  494

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL P+ +H+ WNSG +L L  L
Sbjct  495  TRSRNLLAPMLLHSLWNSGTLLSLFIL  521



>ref|NP_001057716.1| Os06g0505400 [Oryza sativa Japonica Group]
 dbj|BAD45834.1| metal-dependent membrane protease-like [Oryza sativa Japonica 
Group]
 dbj|BAF19630.1| Os06g0505400 [Oryza sativa Japonica Group]
 gb|EAZ37142.1| hypothetical protein OsJ_21482 [Oryza sativa Japonica Group]
Length=366

 Score = 78.2 bits (191),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            V AP+ EE VFRGFL+ SLT+++P P ++L+SAA F+ AH        L  LG  +G  +
Sbjct  281  VCAPIWEEIVFRGFLLPSLTRYMPLPWSILVSAAAFALAHFNAQRVMPLVFLGVVMGGVF  340

Query  500  AQTRNLLTPITIHAFWNSGVILLL  429
            A++RNLL  + +H+ WN  V L L
Sbjct  341  ARSRNLLASMVLHSLWNGFVFLDL  364



>ref|WP_026732987.1| abortive phage infection protein [Fischerella sp. PCC 9605]
Length=527

 Score = 79.0 bits (193),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EE +FRGFL+ SLT+++    A++ S+ +F+ AHL+  E   LF LG  LG  Y
Sbjct  436  IAAPLFEEFLFRGFLLPSLTRYMSVWWAIIASSLLFAIAHLSLSEVLPLFALGVVLGVVY  495

Query  500  AQTRNLLTPITIHAFWNSGVILLL  429
             ++RNLL P+ +H+ WNSG +L L
Sbjct  496  TRSRNLLAPMLLHSLWNSGTLLSL  519



>ref|WP_006619217.1| MULTISPECIES: abortive phage infection protein [Arthrospira]
 gb|EDZ94156.1| Abortive infection protein [Arthrospira maxima CS-328]
Length=500

 Score = 79.0 bits (193),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 55/87 (63%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP  EE +FRGFL+ SLT++     A++ S  +F+ AHL   E   LFVLG  LGF Y
Sbjct  409  IAAPWFEEVLFRGFLLPSLTRYFSLWGAIIASGLLFAVAHLNVSEILPLFVLGIVLGFVY  468

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNL  P+ +H+ WNSG ++ L  L
Sbjct  469  TRSRNLWAPMLLHSLWNSGTLISLYIL  495



>ref|WP_015227581.1| abortive infection protein [Halothece sp. PCC 7418]
 ref|YP_007169923.1| abortive infection protein [Halothece sp. PCC 7418]
 gb|AFZ45709.1| Abortive infection protein [Halothece sp. PCC 7418]
Length=520

 Score = 79.0 bits (193),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EE +FRGFL+ SLT+++P   A+++S+ +FS AHL+  E   L  LG  LG  Y
Sbjct  429  IAAPIFEEIIFRGFLLPSLTRYIPVWSAIVLSSLLFSIAHLSLSEVLPLTALGLVLGVVY  488

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RN+L  + +H+ WNSG +L L  L
Sbjct  489  TRSRNILASMVVHSLWNSGTLLSLFVL  515



>gb|KDR58696.1| abortive phage infection protein [Arthrospira platensis str. 
Paraca]
Length=492

 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 55/87 (63%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP  EE +FRGFL+ SLT++     A++ S  +F+ AHL   E   LFVLG  LGF Y
Sbjct  401  IAAPWFEEVLFRGFLLPSLTRYFSLWGAIIASGLLFAVAHLNVSEILPLFVLGIVLGFVY  460

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNL  P+ +H+ WNSG ++ L  L
Sbjct  461  TRSRNLWAPMLLHSLWNSGTLISLYIL  487



>ref|WP_016868025.1| abortive phage infection protein [Fischerella muscicola]
Length=526

 Score = 79.0 bits (193),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP+ EE +FRGFL+ SLT+++    A++ S+ +F+ AHL+  E   LF LG  LG  Y
Sbjct  435  IAAPLFEEFLFRGFLLPSLTRYMSVWWAIIASSFLFAIAHLSLSEVLPLFALGIVLGVVY  494

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNLL P+ +H+ WNSG +L L  L
Sbjct  495  TRSRNLLAPMLLHSLWNSGTLLSLFIL  521



>ref|WP_008050985.1| abortive phage infection protein [Arthrospira sp. PCC 8005]
 emb|CCE16715.1| conserved hypothetical protein (membrane) [Arthrospira sp. PCC 
8005]
 emb|CDM95393.1| conserved hypothetical protein (membrane) [Arthrospira sp. PCC 
8005]
Length=492

 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 55/87 (63%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            + AP  EE +FRGFL+ SLT++     A++ S  +F+ AHL   E   LFVLG  LGF Y
Sbjct  401  IAAPWFEEVLFRGFLLPSLTRYFSLWGAIIASGLLFAVAHLNVSEILPLFVLGIVLGFVY  460

Query  500  AQTRNLLTPITIHAFWNSGVILLLTFL  420
             ++RNL  P+ +H+ WNSG ++ L  L
Sbjct  461  TRSRNLWAPMLLHSLWNSGTLISLYIL  487



>ref|XP_006371570.1| CAAX amino terminal protease family protein [Populus trichocarpa]
 gb|ERP49367.1| CAAX amino terminal protease family protein [Populus trichocarpa]
Length=220

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = -3

Query  680  VLAPVLEETVFRGFLMVSLTKWLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSY  501
            ++ P+LEE V+RGFL+ SL   +    AVL+S+AVFSAAH +   F QLF++G  LG SY
Sbjct  134  LVTPLLEEIVYRGFLLKSLASTMNWQQAVLLSSAVFSAAHFSGENFIQLFIIGCVLGCSY  193

Query  500  AQTRNLLTPITIHAFWNSGVILLLTF  423
            + + NL +PI  H+ +N+  +++  F
Sbjct  194  SWSGNLCSPILTHSLYNALTLIITYF  219



>gb|KDP25361.1| hypothetical protein JCGZ_20517 [Jatropha curcas]
Length=352

 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 110/243 (45%), Gaps = 14/243 (6%)
 Frame = -3

Query  1145  RWSVPWNWQTISLTSLACGFSFVLTGLIETAAIPYT----GIQVEELSLDEKAEILFLDQ  978
             RW+VPW  +TI    L    SF   G   +  IP+     G   E L+   +A    +  
Sbjct  118   RWTVPWTAETIMQVMLLWVVSFWFIG---SWVIPFAAHMAGFNKESLTFRGQALFSLVTD  174

Query  977   AITTAIVLGVLYTLTKSSKPLPNDIYCYDWREPFNLQRgwllwaaiglagalaaiaLTGV  798
                    + +L+      +PLP+D +       F+L+  W+   A+G         L+  
Sbjct  175   VTEGLAGIAILHRCLSRFRPLPSDWF------RFSLKGNWMFDVALGCFMFPLVNRLSQF  228

Query  797   AMSSLNSEPPTRETDALVRllpligsssistlsllgitGVLAPVLEETVFRGFLMVSLTK  618
              +S L   P T  T + V             L  + ++ V APV EE VFRGFL+ SLT+
Sbjct  229   NLSLLPILPSTPVTLSSVEQSIAARDPVAMALYAIVVS-VCAPVWEEIVFRGFLLPSLTR  287

Query  617   WLPSPLAVLISAAVFSAAHLTPGEFPQLFVLGTALGFSYAQTRNLLTPITIHAFWNSGVI  438
             ++P   A+L+S+  F+ AH        L  LG  +G  +A++RNL+  + +H+ WN  V 
Sbjct  288   YMPVWCAILVSSVAFALAHFNVQRMLPLIFLGVVMGVIFARSRNLMPSMLLHSLWNGFVF  347

Query  437   LLL  429
             L L
Sbjct  348   LDL  350



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3851970174216