BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18927_g1_i1 len=393 path=[1682:0-228 554:229-302 628:303-316
1972:317-392]

Length=393
                                                                      Score     E

ref|XP_009791964.1|  PREDICTED: glutamate receptor 3.6-like             134   1e-36   
ref|XP_010094542.1|  Glutamate receptor 3.3                             142   2e-36   
ref|XP_010029575.1|  PREDICTED: glutamate receptor 3.6                  142   4e-36   
gb|KCW56490.1|  hypothetical protein EUGRSUZ_I02216                     142   4e-36   
ref|XP_009796243.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    139   4e-36   
ref|XP_009605827.1|  PREDICTED: glutamate receptor 3.6-like             141   6e-36   
ref|XP_006340926.1|  PREDICTED: glutamate receptor 3.6-like             140   1e-35   
ref|XP_008786666.1|  PREDICTED: glutamate receptor 3.1                  140   2e-35   
gb|KDP43782.1|  hypothetical protein JCGZ_22409                         140   2e-35   
ref|XP_004287716.1|  PREDICTED: glutamate receptor 3.3-like             140   2e-35   
gb|KHG10460.1|  Glutamate receptor 3.6 -like protein                    139   3e-35   
ref|XP_010680623.1|  PREDICTED: glutamate receptor 3.6-like             139   3e-35   
ref|XP_006306244.1|  hypothetical protein CARUB_v10012075mg             139   5e-35   
ref|XP_006467098.1|  PREDICTED: glutamate receptor 3.6-like isofo...    138   6e-35   
gb|KDO71514.1|  hypothetical protein CISIN_1g002505mg                   138   8e-35   
ref|XP_006467097.1|  PREDICTED: glutamate receptor 3.6-like isofo...    138   8e-35   
ref|XP_007046473.1|  Glutamate receptor 3.6                             138   9e-35   
ref|XP_009618635.1|  PREDICTED: glutamate receptor 3.3-like             138   1e-34   
ref|XP_010266233.1|  PREDICTED: glutamate receptor 3.3-like isofo...    138   1e-34   
ref|XP_010316485.1|  PREDICTED: glutamate receptor 3.6 isoform X3       138   1e-34   
emb|CDX80728.1|  BnaC08g05620D                                          131   1e-34   
ref|XP_010316484.1|  PREDICTED: glutamate receptor 3.6 isoform X2       138   1e-34   
ref|XP_004232576.1|  PREDICTED: glutamate receptor 3.6 isoform X1       138   1e-34   
ref|XP_010266235.1|  PREDICTED: glutamate receptor 3.3-like isofo...    137   1e-34   
ref|XP_010463180.1|  PREDICTED: glutamate receptor 3.3-like             137   1e-34   
ref|XP_010266230.1|  PREDICTED: glutamate receptor 3.3-like isofo...    137   1e-34   
ref|XP_010478979.1|  PREDICTED: glutamate receptor 3.3-like             137   1e-34   
ref|XP_010500221.1|  PREDICTED: glutamate receptor 3.3                  137   1e-34   
ref|XP_009786331.1|  PREDICTED: glutamate receptor 3.3 isoform X1       137   1e-34   
ref|XP_011022205.1|  PREDICTED: glutamate receptor 3.6-like isofo...    137   2e-34   
ref|XP_002891241.1|  predicted protein                                  137   2e-34   
ref|XP_010266234.1|  PREDICTED: glutamate receptor 3.3-like isofo...    137   2e-34   
ref|XP_004238633.2|  PREDICTED: glutamate receptor 3.3                  137   2e-34   
ref|XP_011022202.1|  PREDICTED: glutamate receptor 3.6-like isofo...    137   2e-34   
ref|XP_011022201.1|  PREDICTED: glutamate receptor 3.6-like isofo...    137   2e-34   
ref|XP_011022199.1|  PREDICTED: glutamate receptor 3.6-like isofo...    137   2e-34   
ref|XP_006342151.1|  PREDICTED: glutamate receptor 3.3-like isofo...    137   3e-34   
ref|XP_006425261.1|  hypothetical protein CICLE_v10024825mg             136   3e-34   
ref|XP_010530328.1|  PREDICTED: glutamate receptor 3.3                  136   4e-34   
ref|XP_008241921.1|  PREDICTED: glutamate receptor 3.6-like isofo...    136   4e-34   
ref|XP_008241916.1|  PREDICTED: glutamate receptor 3.6-like isofo...    136   4e-34   
ref|XP_007203996.1|  hypothetical protein PRUPE_ppa000995mg             136   4e-34   
ref|XP_007203104.1|  hypothetical protein PRUPE_ppa023817mg             136   5e-34   
ref|XP_002306436.1|  glutamate receptor family protein                  135   6e-34   Populus trichocarpa [western balsam poplar]
ref|XP_007203235.1|  hypothetical protein PRUPE_ppa001033mg             135   7e-34   
ref|NP_174978.1|  glutamate receptor 3.3                                135   8e-34   Arabidopsis thaliana [mouse-ear cress]
gb|AAR27949.1|  GLR3.3                                                  135   8e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008245275.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    134   9e-34   
emb|CAN72607.1|  hypothetical protein VITISV_021339                     135   9e-34   Vitis vinifera
emb|CDY35797.1|  BnaA08g04580D                                          135   9e-34   
ref|XP_010550509.1|  PREDICTED: glutamate receptor 3.6 isoform X2       135   1e-33   
ref|XP_010550505.1|  PREDICTED: glutamate receptor 3.6 isoform X1       135   1e-33   
ref|XP_006396004.1|  hypothetical protein EUTSA_v10003614mg             135   1e-33   
emb|CBI40741.3|  unnamed protein product                                135   1e-33   
ref|XP_003608144.1|  Glutamate receptor 3.3                             132   1e-33   
ref|XP_008242064.1|  PREDICTED: glutamate receptor 3.6-like             130   2e-33   
ref|XP_009107640.1|  PREDICTED: glutamate receptor 3.3 isoform X1       134   2e-33   
ref|XP_002272859.2|  PREDICTED: glutamate receptor 3.3                  134   2e-33   Vitis vinifera
ref|XP_003629105.1|  Glutamate receptor 3.6                             133   2e-33   
ref|XP_006587552.1|  PREDICTED: glutamate receptor 3.6-like isofo...    134   2e-33   
ref|XP_006577929.1|  PREDICTED: glutamate receptor 3.3-like             134   2e-33   
gb|KHG21169.1|  Glutamate receptor 3.2 -like protein                    134   3e-33   
gb|KHN12498.1|  Glutamate receptor 3.6                                  134   3e-33   
gb|KHN38860.1|  Glutamate receptor 3.6                                  134   3e-33   
ref|XP_009418664.1|  PREDICTED: glutamate receptor 3.3-like             134   3e-33   
ref|XP_003533407.2|  PREDICTED: glutamate receptor 3.6-like isofo...    134   3e-33   
ref|XP_010266236.1|  PREDICTED: glutamate receptor 3.2-like             134   3e-33   
ref|XP_007156253.1|  hypothetical protein PHAVU_003G270900g             134   3e-33   
ref|XP_011100274.1|  PREDICTED: glutamate receptor 3.3                  134   3e-33   
ref|XP_010270512.1|  PREDICTED: glutamate receptor 3.2-like isofo...    133   4e-33   
gb|AET03581.2|  glutamate receptor 3.2                                  133   4e-33   
gb|KHN33784.1|  Glutamate receptor 3.3                                  133   5e-33   
ref|XP_003527293.1|  PREDICTED: glutamate receptor 3.3-like isofo...    133   6e-33   
ref|XP_011041194.1|  PREDICTED: glutamate receptor 3.3-like             132   7e-33   
ref|XP_008337897.1|  PREDICTED: glutamate receptor 3.6-like             132   8e-33   
ref|XP_002313575.2|  Glutamate receptor 3.1 precursor family protein    132   9e-33   Populus trichocarpa [western balsam poplar]
ref|XP_010680624.1|  PREDICTED: glutamate receptor 3.6-like             132   9e-33   
ref|XP_002510703.1|  glutamate receptor 3 plant, putative               132   9e-33   Ricinus communis
ref|XP_002306988.2|  Glutamate receptor 3.3 precursor family protein    132   1e-32   Populus trichocarpa [western balsam poplar]
ref|XP_007135963.1|  hypothetical protein PHAVU_009G006500g             132   1e-32   
ref|XP_009359614.1|  PREDICTED: glutamate receptor 3.6-like isofo...    132   1e-32   
ref|XP_009359613.1|  PREDICTED: glutamate receptor 3.6-like isofo...    132   1e-32   
ref|XP_009359612.1|  PREDICTED: glutamate receptor 3.6-like isofo...    132   1e-32   
emb|CDP07274.1|  unnamed protein product                                132   1e-32   
gb|KCW70331.1|  hypothetical protein EUGRSUZ_F03574                     131   2e-32   
gb|KHG26328.1|  Glutamate receptor 3.3 -like protein                    131   2e-32   
ref|XP_010063139.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    131   2e-32   
ref|XP_008440927.1|  PREDICTED: glutamate receptor 3.6 isoform X2       131   2e-32   
gb|ABO28526.1|  glutamate receptor                                      131   2e-32   Malus hupehensis
ref|XP_008440920.1|  PREDICTED: glutamate receptor 3.6 isoform X1       131   3e-32   
ref|XP_003547880.2|  PREDICTED: glutamate receptor 3.6-like             130   3e-32   
gb|KDO85161.1|  hypothetical protein CISIN_1g002309mg                   130   4e-32   
ref|XP_006473826.1|  PREDICTED: glutamate receptor 3.3-like isofo...    130   4e-32   
gb|KDP36767.1|  hypothetical protein JCGZ_08058                         130   4e-32   
gb|KDO85160.1|  hypothetical protein CISIN_1g002309mg                   130   5e-32   
ref|XP_011000874.1|  PREDICTED: glutamate receptor 3.2                  130   5e-32   
ref|XP_010103244.1|  Glutamate receptor 3.6                             130   5e-32   
ref|XP_006435401.1|  hypothetical protein CICLE_v10000195mg             130   6e-32   
gb|EYU41186.1|  hypothetical protein MIMGU_mgv1a000937mg                130   6e-32   
emb|CBI21566.3|  unnamed protein product                                130   7e-32   
ref|XP_002276999.1|  PREDICTED: glutamate receptor 3.6                  130   7e-32   Vitis vinifera
ref|XP_007210370.1|  hypothetical protein PRUPE_ppa001283mg             129   7e-32   
ref|XP_010266354.1|  PREDICTED: glutamate receptor 3.3-like             129   7e-32   
ref|XP_007046476.1|  Glutamate receptor 3.4, putative isoform 3         129   8e-32   
ref|XP_010923968.1|  PREDICTED: glutamate receptor 3.4-like             129   8e-32   
ref|XP_007018099.1|  Glutamate receptor 3.3 isoform 6                   129   9e-32   
ref|XP_007046474.1|  Glutamate receptor isoform 1                       129   9e-32   
ref|XP_004500849.1|  PREDICTED: glutamate receptor 3.3-like isofo...    129   1e-31   
ref|XP_009417233.1|  PREDICTED: glutamate receptor 3.4-like             129   1e-31   
ref|XP_007018094.1|  Glutamate receptor 3.3 isoform 1                   129   1e-31   
ref|XP_009392853.1|  PREDICTED: glutamate receptor 3.1-like isofo...    129   1e-31   
ref|XP_008373417.1|  PREDICTED: glutamate receptor 3.3                  129   1e-31   
ref|XP_003603849.1|  Glutamate-gated kainate-type ion channel rec...    129   1e-31   
ref|XP_009392852.1|  PREDICTED: glutamate receptor 3.1-like isofo...    129   1e-31   
ref|XP_008237957.1|  PREDICTED: glutamate receptor 3.3                  129   2e-31   
ref|XP_007018096.1|  Glutamate receptor 3.3 isoform 3                   129   2e-31   
gb|KEH36346.1|  glutamate receptor 3.2                                  129   2e-31   
emb|CDX73718.1|  BnaC08g22850D                                          129   2e-31   
gb|EEE66428.1|  hypothetical protein OsJ_22782                          122   2e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009369789.1|  PREDICTED: glutamate receptor 3.6-like             129   2e-31   
ref|XP_008804484.1|  PREDICTED: glutamate receptor 3.1-like isofo...    128   2e-31   
ref|XP_008337223.1|  PREDICTED: glutamate receptor 3.3-like             127   2e-31   
ref|XP_004500848.1|  PREDICTED: glutamate receptor 3.3-like isofo...    128   2e-31   
ref|XP_002306435.2|  hypothetical protein POPTR_0005s10560g             128   2e-31   Populus trichocarpa [western balsam poplar]
ref|XP_009115836.1|  PREDICTED: glutamate receptor 3.6 isoform X2       128   2e-31   
ref|XP_008804475.1|  PREDICTED: glutamate receptor 3.1-like isofo...    128   2e-31   
ref|XP_006403911.1|  hypothetical protein EUTSA_v10010111mg             128   2e-31   
ref|XP_007158022.1|  hypothetical protein PHAVU_002G117500g             128   2e-31   
ref|XP_004512282.1|  PREDICTED: glutamate receptor 3.6-like isofo...    128   3e-31   
ref|XP_009115834.1|  PREDICTED: glutamate receptor 3.6 isoform X1       128   3e-31   
ref|XP_004512281.1|  PREDICTED: glutamate receptor 3.6-like isofo...    128   3e-31   
gb|KGN48998.1|  hypothetical protein Csa_6G509670                       128   3e-31   
ref|XP_004134824.1|  PREDICTED: glutamate receptor 3.6-like             128   3e-31   
ref|XP_004158839.1|  PREDICTED: glutamate receptor 3.6-like             128   3e-31   
ref|XP_007158020.1|  hypothetical protein PHAVU_002G117500g             128   3e-31   
ref|XP_007158021.1|  hypothetical protein PHAVU_002G117500g             128   3e-31   
ref|XP_010686867.1|  PREDICTED: glutamate receptor 3.3                  127   4e-31   
ref|XP_009372603.1|  PREDICTED: glutamate receptor 3.3-like             127   4e-31   
ref|XP_010270511.1|  PREDICTED: glutamate receptor 3.3-like isofo...    126   7e-31   
ref|XP_011034843.1|  PREDICTED: glutamate receptor 3.3-like isofo...    127   9e-31   
ref|XP_010270510.1|  PREDICTED: glutamate receptor 3.3-like isofo...    126   9e-31   
ref|XP_011034844.1|  PREDICTED: glutamate receptor 3.3-like isofo...    127   9e-31   
gb|KEH27628.1|  glutamate receptor 3.2                                  127   9e-31   
ref|XP_003612376.1|  Glutamate receptor 3.6                             127   1e-30   
ref|XP_010270508.1|  PREDICTED: glutamate receptor 3.3-like isofo...    126   1e-30   
gb|EAZ02474.1|  hypothetical protein OsI_24580                          126   1e-30   Oryza sativa Indica Group [Indian rice]
dbj|BAC10393.1|  glutamate receptor, ionotropic kainate 5 precurs...    126   1e-30   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058687.1|  Os07g0103100                                       126   1e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010270507.1|  PREDICTED: glutamate receptor 3.3-like isofo...    126   1e-30   
ref|XP_011034842.1|  PREDICTED: glutamate receptor 3.3-like isofo...    126   1e-30   
gb|AFK41266.1|  unknown                                                 120   1e-30   
ref|XP_008453000.1|  PREDICTED: glutamate receptor 3.3 isoform X2       125   2e-30   
ref|XP_006646788.1|  PREDICTED: glutamate receptor 3.1-like             125   2e-30   
ref|XP_010918356.1|  PREDICTED: glutamate receptor 3.1                  125   2e-30   
ref|XP_006292183.1|  hypothetical protein CARUB_v10018389mg             125   3e-30   
ref|XP_008452999.1|  PREDICTED: glutamate receptor 3.3 isoform X1       125   3e-30   
ref|XP_010503841.1|  PREDICTED: glutamate receptor 3.6-like isofo...    125   3e-30   
ref|XP_002301908.2|  Glutamate receptor 3.3 precursor family protein    125   3e-30   Populus trichocarpa [western balsam poplar]
ref|XP_008392995.1|  PREDICTED: glutamate receptor 3.6-like             125   3e-30   
ref|XP_010426704.1|  PREDICTED: glutamate receptor 3.6 isoform X1       125   3e-30   
ref|NP_190716.3|  glutamate receptor 3.6                                125   3e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876089.1|  ATGLR3.6                                           125   3e-30   
ref|XP_010515556.1|  PREDICTED: glutamate receptor 3.6-like isofo...    125   3e-30   
emb|CAB63012.1|  putative glutamate receptor                            125   4e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007043075.1|  Glutamate receptor 2 isoform 1                     124   5e-30   
gb|KHG05232.1|  Glutamate receptor 3.2 -like protein                    124   5e-30   
ref|XP_007043076.1|  Glutamate receptor 2 isoform 2                     124   6e-30   
gb|KHN35947.1|  Glutamate receptor 3.6                                  124   6e-30   
ref|XP_003517130.1|  PREDICTED: glutamate receptor 3.6-like isofo...    124   6e-30   
ref|XP_009608800.1|  PREDICTED: glutamate receptor 3.2-like             124   8e-30   
ref|XP_008344238.1|  PREDICTED: glutamate receptor 3.6-like             121   8e-30   
gb|KDP43779.1|  hypothetical protein JCGZ_22406                         124   9e-30   
ref|XP_004145549.1|  PREDICTED: glutamate receptor 3.3-like             123   1e-29   
ref|XP_008337216.1|  PREDICTED: glutamate receptor 3.3-like             120   1e-29   
ref|XP_002459199.1|  hypothetical protein SORBIDRAFT_02g000430          123   1e-29   Sorghum bicolor [broomcorn]
ref|XP_008354606.1|  PREDICTED: glutamate receptor 3.6-like             120   1e-29   
gb|KHN46864.1|  Glutamate receptor 3.2                                  123   1e-29   
ref|XP_007203997.1|  hypothetical protein PRUPE_ppa001054mg             123   2e-29   
ref|XP_010110512.1|  Glutamate receptor 3.6                             123   2e-29   
ref|XP_009401867.1|  PREDICTED: glutamate receptor 3.1-like             123   2e-29   
ref|XP_008651910.1|  PREDICTED: glutamate receptor 3.4-like             123   2e-29   
ref|XP_006595634.1|  PREDICTED: glutamate receptor 3.2-like isofo...    123   2e-29   
ref|XP_011022198.1|  PREDICTED: glutamate receptor 3.6-like             123   2e-29   
ref|XP_003545055.1|  PREDICTED: glutamate receptor 3.2-like isofo...    123   2e-29   
ref|XP_003533408.1|  PREDICTED: glutamate receptor 3.3-like             123   2e-29   
ref|XP_003533409.1|  PREDICTED: glutamate receptor 3.3-like isofo...    122   2e-29   
ref|XP_009403107.1|  PREDICTED: glutamate receptor 3.5-like             122   3e-29   
ref|XP_007200076.1|  hypothetical protein PRUPE_ppa021130mg             122   3e-29   
ref|XP_004952127.1|  PREDICTED: glutamate receptor 3.1-like isofo...    122   3e-29   
ref|XP_004987272.1|  PREDICTED: glutamate receptor 3.4-like             122   3e-29   
ref|XP_008235912.1|  PREDICTED: glutamate receptor 3.2-like             122   4e-29   
emb|CAN64711.1|  hypothetical protein VITISV_043726                     122   4e-29   Vitis vinifera
ref|XP_006422389.1|  hypothetical protein CICLE_v10027770mg             122   4e-29   
ref|XP_004952125.1|  PREDICTED: glutamate receptor 3.1-like isofo...    122   5e-29   
ref|XP_004290072.1|  PREDICTED: glutamate receptor 3.2-like             122   5e-29   
ref|XP_002279899.1|  PREDICTED: glutamate receptor 3.2                  122   5e-29   Vitis vinifera
ref|XP_006486565.1|  PREDICTED: glutamate receptor 3.2-like isofo...    122   5e-29   
ref|XP_006422390.1|  hypothetical protein CICLE_v10027770mg             122   5e-29   
gb|KDO68407.1|  hypothetical protein CISIN_1g002211mg                   121   6e-29   
ref|XP_008645171.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    121   6e-29   
gb|AFW69814.1|  hypothetical protein ZEAMMB73_405216                    121   6e-29   
ref|XP_007149970.1|  hypothetical protein PHAVU_005G114800g             121   7e-29   
ref|XP_004509457.1|  PREDICTED: glutamate receptor 3.6-like isofo...    121   7e-29   
gb|ACN36836.1|  unknown                                                 118   7e-29   Zea mays [maize]
ref|XP_011079012.1|  PREDICTED: glutamate receptor 3.4                  121   7e-29   
emb|CBI37733.3|  unnamed protein product                                121   7e-29   
ref|XP_004509455.1|  PREDICTED: glutamate receptor 3.6-like isofo...    121   8e-29   
ref|XP_002451392.1|  hypothetical protein SORBIDRAFT_04g001300          120   9e-29   Sorghum bicolor [broomcorn]
gb|EMS57750.1|  Glutamate receptor 3.3                                  121   9e-29   
ref|XP_004289031.1|  PREDICTED: glutamate receptor 3.3-like             119   1e-28   
ref|XP_002520606.1|  glutamate receptor 3 plant, putative               120   1e-28   Ricinus communis
ref|XP_008812266.1|  PREDICTED: glutamate receptor 3.4 isoform X2       120   1e-28   
gb|EMT02755.1|  Glutamate receptor 3.3                                  120   1e-28   
ref|XP_008242065.1|  PREDICTED: glutamate receptor 3.6-like             120   1e-28   
ref|XP_009399220.1|  PREDICTED: glutamate receptor 3.5-like             120   1e-28   
ref|XP_010907850.1|  PREDICTED: glutamate receptor 3.4-like             120   1e-28   
ref|XP_008812265.1|  PREDICTED: glutamate receptor 3.4 isoform X1       120   2e-28   
gb|EEE56178.1|  hypothetical protein OsJ_05129                          120   2e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009763348.1|  PREDICTED: glutamate receptor 3.2-like             120   2e-28   
ref|XP_010028854.1|  PREDICTED: glutamate receptor 3.2-like isofo...    120   2e-28   
gb|KCW55682.1|  hypothetical protein EUGRSUZ_I01532                     120   2e-28   
gb|EEC72350.1|  hypothetical protein OsI_05591                          120   2e-28   Oryza sativa Indica Group [Indian rice]
ref|NP_001045687.1|  Os02g0117500                                       120   2e-28   Oryza sativa Japonica Group [Japonica rice]
gb|AFW66756.1|  hypothetical protein ZEAMMB73_452909                    120   2e-28   
gb|EMT17124.1|  Glutamate receptor 3.1                                  120   2e-28   
ref|XP_004289032.1|  PREDICTED: glutamate receptor 3.6-like             119   2e-28   
ref|XP_010515566.1|  PREDICTED: glutamate receptor 3.6-like isofo...    119   2e-28   
ref|XP_010935350.1|  PREDICTED: glutamate receptor 3.1                  120   2e-28   
ref|XP_006855692.1|  hypothetical protein AMTR_s00044p00137040          120   3e-28   
tpg|DAA59325.1|  TPA: hypothetical protein ZEAMMB73_375779              119   3e-28   
ref|XP_006858062.1|  hypothetical protein AMTR_s00062p00050250          119   3e-28   
ref|XP_010426721.1|  PREDICTED: glutamate receptor 3.6-like isofo...    119   3e-28   
ref|XP_008241922.1|  PREDICTED: glutamate receptor 3.6-like             119   3e-28   
ref|XP_010515561.1|  PREDICTED: glutamate receptor 3.6-like isofo...    119   3e-28   
ref|XP_010515560.1|  PREDICTED: glutamate receptor 3.6-like isofo...    119   3e-28   
ref|XP_010426717.1|  PREDICTED: glutamate receptor 3.6-like isofo...    119   4e-28   
ref|XP_010426707.1|  PREDICTED: glutamate receptor 3.6-like isofo...    119   4e-28   
ref|XP_010515565.1|  PREDICTED: glutamate receptor 3.6-like isofo...    119   4e-28   
ref|XP_004966219.1|  PREDICTED: glutamate receptor 3.4-like             119   6e-28   
dbj|BAK06938.1|  predicted protein                                      118   7e-28   
ref|XP_008241924.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    118   7e-28   
ref|XP_009416682.1|  PREDICTED: glutamate receptor 3.4-like             118   8e-28   
ref|XP_010276016.1|  PREDICTED: glutamate receptor 3.4-like             118   9e-28   
gb|EMT00479.1|  Glutamate receptor 3.1                                  118   9e-28   
gb|EYU33298.1|  hypothetical protein MIMGU_mgv1a001051mg                118   1e-27   
ref|XP_007203444.1|  hypothetical protein PRUPE_ppa022019mg             117   1e-27   
ref|XP_004487406.1|  PREDICTED: glutamate receptor 3.4-like isofo...    117   1e-27   
gb|AGN92471.1|  glutamate receptor 1                                    117   1e-27   
ref|XP_004487403.1|  PREDICTED: glutamate receptor 3.4-like isofo...    117   1e-27   
ref|XP_008358485.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    116   1e-27   
ref|XP_006364369.1|  PREDICTED: glutamate receptor 3.2-like             117   1e-27   
ref|XP_011087613.1|  PREDICTED: glutamate receptor 3.2-like isofo...    117   2e-27   
ref|XP_006467103.1|  PREDICTED: glutamate receptor 3.6-like isofo...    117   2e-27   
ref|XP_006425257.1|  hypothetical protein CICLE_v10024813mg             117   2e-27   
ref|XP_010090700.1|  Glutamate receptor 3.2                             117   2e-27   
ref|XP_007202847.1|  hypothetical protein PRUPE_ppa014700mg             117   2e-27   
dbj|BAJ99508.1|  predicted protein                                      117   2e-27   
gb|EMT06356.1|  Glutamate receptor 3.1                                  117   3e-27   
ref|XP_010530965.1|  PREDICTED: glutamate receptor 3.2-like             117   3e-27   
emb|CDP16877.1|  unnamed protein product                                117   3e-27   
ref|XP_008379924.1|  PREDICTED: glutamate receptor 3.4-like             116   3e-27   
ref|XP_009359749.1|  PREDICTED: glutamate receptor 3.6-like             116   3e-27   
emb|CDP11785.1|  unnamed protein product                                116   3e-27   
ref|XP_008803655.1|  PREDICTED: glutamate receptor 3.5-like             116   3e-27   
ref|XP_008348134.1|  PREDICTED: glutamate receptor 3.4-like             116   3e-27   
ref|XP_008382743.1|  PREDICTED: glutamate receptor 3.2-like             116   4e-27   
ref|XP_003573352.1|  PREDICTED: glutamate receptor 3.1 isoform X1       116   4e-27   
gb|KHN44877.1|  Glutamate receptor 3.4                                  116   4e-27   
ref|XP_003539503.1|  PREDICTED: glutamate receptor 3.4-like isofo...    116   4e-27   
ref|XP_009419590.1|  PREDICTED: glutamate receptor 3.5-like             116   4e-27   
dbj|BAK04480.1|  predicted protein                                      116   4e-27   
ref|XP_004171803.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    116   4e-27   
ref|XP_004151932.1|  PREDICTED: glutamate receptor 3.4-like             116   4e-27   
ref|XP_010233709.1|  PREDICTED: glutamate receptor 3.1 isoform X2       116   4e-27   
emb|CDP01776.1|  unnamed protein product                                116   5e-27   
ref|XP_009589005.1|  PREDICTED: glutamate receptor 3.4 isoform X2       116   5e-27   
ref|XP_002301627.1|  Glutamate receptor 3.5 precursor family protein    116   5e-27   Populus trichocarpa [western balsam poplar]
ref|XP_009589003.1|  PREDICTED: glutamate receptor 3.4 isoform X1       116   6e-27   
gb|EMS53869.1|  Glutamate receptor 3.3                                  115   6e-27   
ref|XP_008455862.1|  PREDICTED: glutamate receptor 3.4-like             115   6e-27   
ref|NP_001053676.1|  Os04g0585200                                       112   7e-27   
ref|XP_008337899.1|  PREDICTED: glutamate receptor 3.6-like             115   7e-27   
ref|XP_009353269.1|  PREDICTED: glutamate receptor 3.4-like             115   8e-27   
ref|XP_011008405.1|  PREDICTED: glutamate receptor 3.4 isoform X1       115   9e-27   
ref|XP_010689636.1|  PREDICTED: glutamate receptor 3.4-like             115   9e-27   
ref|XP_009794415.1|  PREDICTED: glutamate receptor 3.4-like isofo...    115   9e-27   
ref|XP_009625697.1|  PREDICTED: glutamate receptor 3.4-like isofo...    115   9e-27   
ref|XP_009359750.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    112   1e-26   
gb|KHG01323.1|  Glutamate receptor 3.4 -like protein                    115   1e-26   
ref|XP_009794414.1|  PREDICTED: glutamate receptor 3.4-like isofo...    115   1e-26   
ref|XP_009625694.1|  PREDICTED: glutamate receptor 3.4-like isofo...    115   1e-26   
ref|XP_006652703.1|  PREDICTED: glutamate receptor 3.1-like isofo...    112   1e-26   
ref|XP_006590755.1|  PREDICTED: glutamate receptor 3.6-like isofo...    114   2e-26   
ref|XP_008455860.1|  PREDICTED: glutamate receptor 3.4-like isofo...    114   2e-26   
dbj|BAL15055.1|  glutamate receptor 3.2                                 114   2e-26   
ref|XP_004243468.1|  PREDICTED: glutamate receptor 3.4 isoform X1       114   2e-26   
ref|XP_008455858.1|  PREDICTED: glutamate receptor 3.4-like isofo...    114   2e-26   
gb|KDO71524.1|  hypothetical protein CISIN_1g002301mg                   114   2e-26   
ref|XP_010323822.1|  PREDICTED: glutamate receptor 3.4 isoform X2       114   2e-26   
gb|KDO71522.1|  hypothetical protein CISIN_1g002301mg                   114   2e-26   
gb|KDO71521.1|  hypothetical protein CISIN_1g002301mg                   114   2e-26   
gb|EYU35042.1|  hypothetical protein MIMGU_mgv1a001148mg                114   2e-26   
ref|XP_006367285.1|  PREDICTED: glutamate receptor 3.4-like isofo...    114   3e-26   
ref|XP_009765170.1|  PREDICTED: glutamate receptor 3.4                  114   3e-26   
ref|XP_003541945.1|  PREDICTED: glutamate receptor 3.4-like isofo...    114   3e-26   
gb|KDP47011.1|  hypothetical protein JCGZ_10738                         114   3e-26   
ref|XP_010507397.1|  PREDICTED: glutamate receptor 3.6-like             113   3e-26   
gb|KDP25838.1|  hypothetical protein JCGZ_22868                         114   4e-26   
ref|XP_009359611.1|  PREDICTED: glutamate receptor 3.6-like             114   4e-26   
gb|KEH39013.1|  glutamate receptor 3.2                                  113   4e-26   
gb|EMS57327.1|  Glutamate receptor 3.4                                  113   4e-26   
gb|KDP43780.1|  hypothetical protein JCGZ_22407                         113   4e-26   
ref|XP_011092253.1|  PREDICTED: glutamate receptor 3.2-like             113   4e-26   
dbj|BAK02402.1|  predicted protein                                      113   4e-26   
ref|XP_008337900.1|  PREDICTED: glutamate receptor 3.6-like             113   4e-26   
gb|EMT10329.1|  Glutamate receptor 3.4                                  113   4e-26   
ref|XP_003596996.1|  Glutamate receptor 3.4                             113   4e-26   
gb|KEH39011.1|  glutamate receptor 3.2                                  113   5e-26   
gb|EEE67292.1|  hypothetical protein OsJ_24491                          113   6e-26   
emb|CDY52597.1|  BnaCnng22760D                                          113   6e-26   
ref|XP_010446945.1|  PREDICTED: glutamate receptor 3.2-like             112   7e-26   
gb|EYU43117.1|  hypothetical protein MIMGU_mgv1a000935mg                112   7e-26   
ref|XP_006412122.1|  hypothetical protein EUTSA_v10024351mg             112   8e-26   
emb|CAH66856.1|  H0307D04.1                                             112   9e-26   
sp|Q7XP59.1|GLR31_ORYSJ  RecName: Full=Glutamate receptor 3.1; Al...    112   9e-26   
ref|XP_006283116.1|  hypothetical protein CARUB_v10004138mg             112   1e-25   
gb|KHN41809.1|  Glutamate receptor 3.6                                  112   1e-25   
ref|XP_002869097.1|  hypothetical protein ARALYDRAFT_491120             112   1e-25   
ref|XP_007203978.1|  hypothetical protein PRUPE_ppa025247mg             112   1e-25   
ref|XP_006652702.1|  PREDICTED: glutamate receptor 3.1-like isofo...    112   1e-25   
ref|XP_002273744.3|  PREDICTED: glutamate receptor 3.4 isoform X1       112   1e-25   
ref|XP_002524179.1|  glutamate receptor 3 plant, putative               112   1e-25   
ref|XP_010432300.1|  PREDICTED: glutamate receptor 3.2                  112   1e-25   
ref|XP_010437494.1|  PREDICTED: glutamate receptor 3.2-like             112   1e-25   
gb|AET03597.2|  glutamate receptor 3.2                                  112   2e-25   
emb|CDX75491.1|  BnaA01g02110D                                          106   2e-25   
emb|CDX69127.1|  BnaC01g03260D                                          112   2e-25   
ref|XP_009121143.1|  PREDICTED: glutamate receptor 3.1 isoform X2       111   2e-25   
dbj|BAJ91183.1|  predicted protein                                      112   2e-25   
emb|CBI28943.3|  unnamed protein product                                112   2e-25   
gb|EEC82165.1|  hypothetical protein OsI_26240                          111   2e-25   
ref|XP_009121142.1|  PREDICTED: glutamate receptor 3.1 isoform X1       111   2e-25   
ref|XP_004158559.1|  PREDICTED: glutamate receptor 3.4-like             111   2e-25   
ref|XP_004151885.1|  PREDICTED: glutamate receptor 3.4-like             111   2e-25   
gb|AAF21901.1|AF109392_1  ligand gated channel-like protein             111   2e-25   
emb|CDY24327.1|  BnaA07g02520D                                          111   2e-25   
emb|CAN66741.1|  hypothetical protein VITISV_021644                     111   2e-25   
ref|XP_010267711.1|  PREDICTED: glutamate receptor 3.5-like isofo...    111   2e-25   
ref|XP_010267710.1|  PREDICTED: glutamate receptor 3.5-like isofo...    111   2e-25   
ref|XP_010240316.1|  PREDICTED: glutamate receptor 3.1-like             111   2e-25   
ref|XP_010267709.1|  PREDICTED: glutamate receptor 3.5-like isofo...    111   2e-25   
gb|AAK13248.1|AF159498_1  putative glutamate receptor like-protein      111   3e-25   
gb|AAL24126.1|  unknown protein                                         111   3e-25   
ref|NP_567981.1|  glutamate receptor 3.2                                111   3e-25   
emb|CAA18740.1|  putative protein                                       111   3e-25   
ref|XP_009103268.1|  PREDICTED: glutamate receptor 3.2                  111   3e-25   
ref|XP_003629121.1|  Glutamate receptor                                 110   3e-25   
ref|XP_002437454.1|  hypothetical protein SORBIDRAFT_10g027370          111   3e-25   
ref|XP_003561526.1|  PREDICTED: glutamate receptor 3.4-like             111   3e-25   
ref|XP_011005110.1|  PREDICTED: glutamate receptor 3.4 isoform X2       110   4e-25   
ref|XP_003608176.1|  Glutamate receptor 3.3                             110   4e-25   
ref|XP_011005108.1|  PREDICTED: glutamate receptor 3.4 isoform X1       110   4e-25   
dbj|BAD45488.1|  putative ionotropic glutamate receptor ortholog ...    110   5e-25   
ref|NP_001058372.1|  Os06g0680500                                       110   6e-25   
gb|EAZ38031.1|  hypothetical protein OsJ_22375                          110   6e-25   
ref|XP_010321555.1|  PREDICTED: glutamate receptor 3.4-like isofo...    110   7e-25   
ref|XP_004240147.1|  PREDICTED: glutamate receptor 3.4-like isofo...    110   7e-25   
ref|XP_009341487.1|  PREDICTED: glutamate receptor 3.2-like             110   7e-25   
ref|XP_009333813.1|  PREDICTED: glutamate receptor 3.2-like             110   7e-25   
ref|XP_006657772.1|  PREDICTED: glutamate receptor 3.4-like             110   7e-25   
ref|XP_002321123.2|  hypothetical protein POPTR_0014s15030g             110   7e-25   
ref|XP_003563418.1|  PREDICTED: glutamate receptor 3.4                  110   7e-25   
ref|XP_006356918.1|  PREDICTED: glutamate receptor 3.4-like isofo...    110   8e-25   
ref|XP_006858063.1|  hypothetical protein AMTR_s00062p00055860          106   8e-25   
ref|XP_010557012.1|  PREDICTED: glutamate receptor 3.4-like isofo...    109   9e-25   
ref|XP_004966221.1|  PREDICTED: glutamate receptor 3.5-like             109   9e-25   
ref|XP_010548171.1|  PREDICTED: glutamate receptor 3.1-like isofo...    109   1e-24   
emb|CDY65624.1|  BnaCnng48020D                                          109   1e-24   
ref|XP_010557011.1|  PREDICTED: glutamate receptor 3.4-like isofo...    109   1e-24   
ref|XP_010548165.1|  PREDICTED: glutamate receptor 3.1-like isofo...    109   1e-24   
ref|XP_007217063.1|  hypothetical protein PRUPE_ppa001079mg             109   1e-24   
ref|XP_008230073.1|  PREDICTED: glutamate receptor 3.4-like             109   1e-24   
gb|EYU24786.1|  hypothetical protein MIMGU_mgv1a000911mg                109   1e-24   
ref|XP_002884045.1|  predicted protein                                  108   2e-24   
ref|XP_004289164.1|  PREDICTED: glutamate receptor 3.4-like             108   2e-24   
ref|XP_002459200.1|  hypothetical protein SORBIDRAFT_02g000440          108   2e-24   
gb|EMS61084.1|  Glutamate receptor 3.4                                  108   2e-24   
gb|EAZ02098.1|  hypothetical protein OsI_24185                          108   2e-24   
ref|XP_006582348.1|  PREDICTED: glutamate receptor 3.4-like isofo...    108   2e-24   
gb|AAQ02674.1|  glutamate receptor                                      108   2e-24   
ref|XP_003527492.1|  PREDICTED: glutamate receptor 3.4-like isofo...    108   2e-24   
ref|XP_007132553.1|  hypothetical protein PHAVU_011G104300g             108   3e-24   
gb|KHN41219.1|  Glutamate receptor 3.4                                  108   3e-24   
gb|EPS72720.1|  glutamate receptor                                      107   4e-24   
ref|XP_006592379.1|  PREDICTED: glutamate receptor 3.4-like isofo...    107   4e-24   
ref|XP_006592378.1|  PREDICTED: glutamate receptor 3.4-like isofo...    107   4e-24   
ref|XP_010035564.1|  PREDICTED: glutamate receptor 3.4                  107   4e-24   
ref|XP_003540841.1|  PREDICTED: glutamate receptor 3.4-like isofo...    107   4e-24   
gb|KHN21237.1|  Glutamate receptor 3.4                                  107   4e-24   
gb|AAB92421.1|  ligand gated channel-like protein                       107   5e-24   
ref|XP_008379630.1|  PREDICTED: glutamate receptor 3.4                  107   5e-24   
ref|XP_008353536.1|  PREDICTED: glutamate receptor 3.4-like             107   5e-24   
ref|XP_008347560.1|  PREDICTED: glutamate receptor 3.2-like             104   5e-24   
sp|Q7XJL2.2|GLR31_ARATH  RecName: Full=Glutamate receptor 3.1; Sh...    107   5e-24   
ref|XP_006296930.1|  hypothetical protein CARUB_v10012924mg             107   5e-24   
gb|AAR88099.1|  putative glutamate receptor ion channel                 107   5e-24   
ref|NP_028351.2|  glutamate receptor                                    107   5e-24   
ref|XP_009353274.1|  PREDICTED: glutamate receptor 3.4-like isofo...    107   6e-24   
ref|XP_009353273.1|  PREDICTED: glutamate receptor 3.4-like isofo...    107   6e-24   
gb|EMT06987.1|  Glutamate receptor 3.3                                  107   6e-24   
ref|XP_006657254.1|  PREDICTED: glutamate receptor 3.5-like             107   7e-24   
ref|XP_010690549.1|  PREDICTED: glutamate receptor 3.2-like             107   7e-24   
ref|XP_007045624.1|  Glutamate receptor isoform 5                       107   8e-24   
ref|XP_007045620.1|  Glutamate receptor isoform 1                       107   8e-24   
ref|XP_006409331.1|  hypothetical protein EUTSA_v10022533mg             107   9e-24   
ref|XP_008377883.1|  PREDICTED: glutamate receptor 3.2-like             107   9e-24   
gb|KHG17978.1|  Glutamate receptor 3.4 -like protein                    106   1e-23   
ref|XP_004287941.1|  PREDICTED: glutamate receptor 3.7-like             106   1e-23   
gb|KHN20098.1|  Glutamate receptor 3.3                                  106   1e-23   
ref|XP_010237634.1|  PREDICTED: glutamate receptor 3.4-like isofo...    106   1e-23   
ref|XP_004966220.1|  PREDICTED: glutamate receptor 3.5-like             106   2e-23   
ref|XP_003563011.1|  PREDICTED: glutamate receptor 3.4-like isofo...    106   2e-23   
ref|XP_010515365.1|  PREDICTED: glutamate receptor 3.1                  105   2e-23   
ref|XP_010467485.1|  PREDICTED: glutamate receptor 3.1-like isofo...    105   2e-23   
ref|XP_010467484.1|  PREDICTED: glutamate receptor 3.1-like isofo...    105   2e-23   
ref|XP_004976611.1|  PREDICTED: glutamate receptor 3.1-like             105   2e-23   
ref|XP_007046477.1|  Glutamate receptor isoform 4                       105   3e-23   
ref|XP_009108617.1|  PREDICTED: glutamate receptor 3.2-like isofo...    105   4e-23   
ref|XP_009108616.1|  PREDICTED: glutamate receptor 3.2-like isofo...    105   4e-23   
emb|CDX76331.1|  BnaA08g10690D                                          105   4e-23   
ref|XP_002437456.1|  hypothetical protein SORBIDRAFT_10g027420          104   4e-23   
ref|XP_009108612.1|  PREDICTED: glutamate receptor 3.2-like isofo...    105   4e-23   
ref|XP_010266353.1|  PREDICTED: glutamate receptor 3.6-like             104   5e-23   
ref|XP_002963727.1|  hypothetical protein SELMODRAFT_166047             104   5e-23   
ref|XP_002974811.1|  hypothetical protein SELMODRAFT_102172             104   5e-23   
ref|XP_008670454.1|  PREDICTED: glutamate receptor 3.4-like             104   5e-23   
ref|XP_006418053.1|  hypothetical protein EUTSA_v10006709mg             104   6e-23   
ref|XP_008644926.1|  PREDICTED: glutamate receptor 3.5-like isofo...    104   7e-23   
gb|AFW69068.1|  hypothetical protein ZEAMMB73_591659                    104   7e-23   
ref|XP_008644925.1|  PREDICTED: glutamate receptor 3.5-like isofo...    104   7e-23   
ref|XP_010035563.1|  PREDICTED: glutamate receptor 3.7                  103   8e-23   
ref|XP_010522331.1|  PREDICTED: glutamate receptor 3.4                  103   9e-23   
ref|XP_008341999.1|  PREDICTED: glutamate receptor 3.7-like             103   1e-22   
ref|XP_007217061.1|  hypothetical protein PRUPE_ppa001093mg             103   1e-22   
gb|KDO41668.1|  hypothetical protein CISIN_1g002267mg                   103   1e-22   
ref|XP_010276025.1|  PREDICTED: glutamate receptor 3.7-like isofo...    103   1e-22   
ref|XP_010276019.1|  PREDICTED: glutamate receptor 3.7-like isofo...    103   1e-22   
ref|XP_010276026.1|  PREDICTED: glutamate receptor 3.7-like isofo...    103   1e-22   
ref|XP_011100303.1|  PREDICTED: glutamate receptor 3.5-like             103   1e-22   
ref|XP_006447543.1|  hypothetical protein CICLE_v10014175mg             103   1e-22   
ref|XP_008812269.1|  PREDICTED: glutamate receptor 3.7 isoform X2       103   1e-22   
ref|XP_008812267.1|  PREDICTED: glutamate receptor 3.7 isoform X1       103   1e-22   
emb|CDY71348.1|  BnaAnng37040D                                        99.8    2e-22   
ref|XP_009108610.1|  PREDICTED: glutamate receptor 3.2-like isofo...  99.8    2e-22   
ref|XP_002889538.1|  ATGLR3.4                                           103   2e-22   
emb|CDY46839.1|  BnaA10g03230D                                          103   2e-22   
ref|XP_009119183.1|  PREDICTED: glutamate receptor 3.4                  103   2e-22   
ref|XP_009108609.1|  PREDICTED: glutamate receptor 3.2-like isofo...  99.8    2e-22   
ref|XP_009108608.1|  PREDICTED: glutamate receptor 3.2-like isofo...  99.8    2e-22   
ref|XP_008379927.1|  PREDICTED: glutamate receptor 3.4-like             102   2e-22   
ref|XP_010484800.1|  PREDICTED: glutamate receptor 3.4 isoform X2       102   2e-22   
ref|XP_010475202.1|  PREDICTED: glutamate receptor 3.4-like isofo...    102   2e-22   
gb|AAD47833.1|AF167355_1  ligand-gated channel-like protein precu...    102   3e-22   
ref|XP_006303896.1|  hypothetical protein CARUB_v10008205mg             102   3e-22   
ref|NP_172012.2|  glutamate receptor 3.4                                102   3e-22   
ref|XP_010475194.1|  PREDICTED: glutamate receptor 3.4-like isofo...    102   3e-22   
ref|XP_010457602.1|  PREDICTED: glutamate receptor 3.4-like             102   3e-22   
ref|XP_010484773.1|  PREDICTED: glutamate receptor 3.4 isoform X1       102   3e-22   
pir||T51137  ionotropic glutamate receptor homolog GLR4 [imported...    102   3e-22
gb|EMT02012.1|  Glutamate receptor 3.4                                  102   3e-22   
ref|XP_007156252.1|  hypothetical protein PHAVU_003G270800g             102   3e-22   
gb|EMS63860.1|  Glutamate receptor 3.4                                  102   4e-22   
ref|XP_001762626.1|  predicted protein                                  102   4e-22   
emb|CDY49512.1|  BnaC05g03240D                                          101   6e-22   
ref|XP_002460792.1|  hypothetical protein SORBIDRAFT_02g034960          101   7e-22   
ref|XP_008230072.1|  PREDICTED: glutamate receptor 3.7                  101   8e-22   
ref|NP_001146373.1|  hypothetical protein                             98.6    1e-21   
emb|CDP11784.1|  unnamed protein product                                100   1e-21   
ref|XP_001779207.1|  predicted protein                                  100   2e-21   
ref|XP_010267706.1|  PREDICTED: glutamate receptor 3.7-like isofo...    100   2e-21   
ref|XP_010267707.1|  PREDICTED: glutamate receptor 3.7-like isofo...    100   2e-21   
dbj|BAL15057.1|  glutamate receptor 3.4                                 100   2e-21   
ref|XP_010909025.1|  PREDICTED: glutamate receptor 3.7                99.8    2e-21   
ref|XP_010109511.1|  Glutamate receptor 3.4                           99.8    3e-21   
ref|XP_009399221.1|  PREDICTED: glutamate receptor 3.7-like           99.4    3e-21   
ref|XP_009353277.1|  PREDICTED: glutamate receptor 3.7 isoform X2     99.4    4e-21   
ref|XP_008667840.1|  PREDICTED: hypothetical protein isoform X3       99.4    4e-21   
ref|XP_009353276.1|  PREDICTED: glutamate receptor 3.7 isoform X1     99.4    4e-21   
ref|XP_008667839.1|  PREDICTED: hypothetical protein isoform X2       99.4    4e-21   
ref|XP_008667836.1|  PREDICTED: hypothetical protein isoform X1       99.4    4e-21   
ref|XP_004957886.1|  PREDICTED: glutamate receptor 3.4-like           99.0    5e-21   
gb|KDP25837.1|  hypothetical protein JCGZ_22867                       99.0    5e-21   
ref|XP_008447826.1|  PREDICTED: glutamate receptor 3.2                98.6    6e-21   
ref|XP_008455863.1|  PREDICTED: glutamate receptor 3.7-like           98.6    7e-21   
ref|XP_007045627.1|  Glutamate receptor isoform 1                     98.6    8e-21   
ref|NP_001142769.1|  hypothetical protein precursor                   93.6    1e-20   
gb|KHG04010.1|  Glutamate receptor 3.7 -like protein                  97.8    1e-20   
gb|AFW69063.1|  hypothetical protein ZEAMMB73_044126                  97.4    2e-20   
ref|XP_008644923.1|  PREDICTED: glutamate receptor 3.4-like isofo...  97.4    2e-20   
ref|XP_008644922.1|  PREDICTED: glutamate receptor 3.4-like isofo...  97.4    2e-20   



>ref|XP_009791964.1| PREDICTED: glutamate receptor 3.6-like [Nicotiana sylvestris]
Length=184

 Score =   134 bits (338),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST C+F I+G EF ++G GFAF + SPL+VDMSTAI +LS+NGELQRIHDKWL   AC
Sbjct  4    FLSTRCQFSILGQEFTKNGWGFAFPRDSPLAVDMSTAILKLSENGELQRIHDKWLSGIAC  63

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             SQNT+L+V++L LKSFS LF +CG AC  ALL++F++
Sbjct  64   TSQNTKLEVDRLQLKSFSGLFFICGLACFLALLIYFVM  101



>ref|XP_010094542.1| Glutamate receptor 3.3 [Morus notabilis]
 gb|EXB56296.1| Glutamate receptor 3.3 [Morus notabilis]
Length=932

 Score =   142 bits (359),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 61/97 (63%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST C+F +VG EF +SG GFAF + SPL+VDMSTAI ++S+NG+LQRIHDKWL+R AC
Sbjct  754  FLSTQCKFRVVGQEFTKSGWGFAFPRDSPLAVDMSTAILQMSENGDLQRIHDKWLMRSAC  813

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              +  EL+ +QLHLKSF+ LFLMCG AC  A+L++F+
Sbjct  814  SMEGAELESDQLHLKSFAGLFLMCGVACFVAILIYFL  850



>ref|XP_010029575.1| PREDICTED: glutamate receptor 3.6 [Eucalyptus grandis]
 gb|KCW56489.1| hypothetical protein EUGRSUZ_I02216 [Eucalyptus grandis]
Length=942

 Score =   142 bits (358),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 62/97 (64%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST CEF IVG EF ++G GFAF + SPL+VDMSTAI +LS+NG+LQRIHDKWL+R AC
Sbjct  762  FLSTRCEFSIVGQEFTKNGWGFAFPRDSPLAVDMSTAILKLSENGDLQRIHDKWLMRSAC  821

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ T+L +++LHLKSF  LF++CG AC  AL+++F+
Sbjct  822  TSQGTKLALDRLHLKSFWGLFVLCGSACFLALIIYFL  858



>gb|KCW56490.1| hypothetical protein EUGRSUZ_I02216 [Eucalyptus grandis]
Length=944

 Score =   142 bits (358),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 62/97 (64%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST CEF IVG EF ++G GFAF + SPL+VDMSTAI +LS+NG+LQRIHDKWL+R AC
Sbjct  764  FLSTRCEFSIVGQEFTKNGWGFAFPRDSPLAVDMSTAILKLSENGDLQRIHDKWLMRSAC  823

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ T+L +++LHLKSF  LF++CG AC  AL+++F+
Sbjct  824  TSQGTKLALDRLHLKSFWGLFVLCGSACFLALIIYFL  860



>ref|XP_009796243.1| PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 3.3-like, 
partial [Nicotiana sylvestris]
Length=527

 Score =   139 bits (350),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 62/98 (63%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST C+F I+G EF ++G GFAF + SPL++DMSTAI +LS+NGELQRIHDKWL   AC
Sbjct  347  FLSTRCQFSILGQEFTKNGWGFAFPRDSPLAIDMSTAILKLSENGELQRIHDKWLSGIAC  406

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             SQNT+L+V++L LKSFS LF +CG AC  ALL++F++
Sbjct  407  TSQNTKLEVDRLQLKSFSGLFFLCGLACFLALLIYFVM  444



>ref|XP_009605827.1| PREDICTED: glutamate receptor 3.6-like [Nicotiana tomentosiformis]
 ref|XP_009605828.1| PREDICTED: glutamate receptor 3.6-like [Nicotiana tomentosiformis]
 ref|XP_009605829.1| PREDICTED: glutamate receptor 3.6-like [Nicotiana tomentosiformis]
Length=936

 Score =   141 bits (356),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 63/98 (64%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST C+F I+G EF ++G GFAF + SPL+VDMSTAI +LS+NGELQRIHDKWL   AC
Sbjct  756  FLSTRCQFSILGQEFTKNGWGFAFPRDSPLAVDMSTAILKLSENGELQRIHDKWLSGIAC  815

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             SQNT+L+V++L LKSFS LF +CG AC  ALL++F++
Sbjct  816  TSQNTKLEVDRLQLKSFSGLFFLCGLACFLALLIYFVM  853



>ref|XP_006340926.1| PREDICTED: glutamate receptor 3.6-like [Solanum tuberosum]
Length=976

 Score =   140 bits (354),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 63/98 (64%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLSTHC F I G EF ++G GFAF + SPL+VDMSTAI +LS+NGELQRIHDKWL   AC
Sbjct  796  FLSTHCHFSIRGQEFTKNGWGFAFPRDSPLAVDMSTAILKLSENGELQRIHDKWLSGIAC  855

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             SQNT+L+V++L LKSFS LF +CG AC  A+L++F++
Sbjct  856  TSQNTKLEVDRLKLKSFSGLFFLCGLACFLAVLIYFVM  893



>ref|XP_008786666.1| PREDICTED: glutamate receptor 3.1 [Phoenix dactylifera]
Length=921

 Score =   140 bits (353),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 64/98 (65%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST C F IVGSEF RSG GFAF + SPL+VD+STAI  LS+NG+LQRIHDKWL R AC
Sbjct  755  FLSTQCRFAIVGSEFTRSGWGFAFPRDSPLAVDLSTAIVALSENGDLQRIHDKWLTRSAC  814

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             SQN++L+ +QL L SF  LFL+CG AC  AL+++F+L
Sbjct  815  ISQNSDLESDQLDLGSFWGLFLICGMACTVALIIYFLL  852



>gb|KDP43782.1| hypothetical protein JCGZ_22409 [Jatropha curcas]
Length=941

 Score =   140 bits (353),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 60/97 (62%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST CEF IVG EF ++G GFAF++ SPL+VDMSTAI +LS+NG+LQR+HDKWL+R AC
Sbjct  757  FLSTRCEFSIVGQEFTKNGWGFAFARDSPLAVDMSTAILKLSENGDLQRLHDKWLMRSAC  816

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             S  T+L++++L L+SF  LF++CG ACL AL L+F+
Sbjct  817  SSTATKLEIDRLQLRSFWGLFMICGLACLLALFLYFL  853



>ref|XP_004287716.1| PREDICTED: glutamate receptor 3.3-like [Fragaria vesca subsp. 
vesca]
Length=940

 Score =   140 bits (352),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 61/102 (60%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F IVG EF R+G GFAF++ SPLSVDMSTA+ +LSDNG+LQRIHDKWLL+  C
Sbjct  760  FLSSRCDFSIVGQEFTRTGWGFAFARDSPLSVDMSTALLKLSDNGDLQRIHDKWLLKSPC  819

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
             S+   L+V++L LKSFS LF +CG AC+ AL+++F +  Y+
Sbjct  820  TSKGANLEVDKLELKSFSALFALCGAACVIALIIYFSMMCYQ  861



>gb|KHG10460.1| Glutamate receptor 3.6 -like protein [Gossypium arboreum]
Length=947

 Score =   139 bits (350),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 62/97 (64%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST CEF IVG EF ++G GFAF + SPL+VDMSTAI +LS+NG+LQRIHDKWLLR AC
Sbjct  758  FLSTRCEFSIVGQEFTKNGWGFAFPRDSPLAVDMSTAILKLSENGDLQRIHDKWLLRRAC  817

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              Q  +++V++L L+SF  LFL+CG ACL AL L+F+
Sbjct  818  SYQGAKMEVDRLQLRSFWGLFLICGLACLIALFLYFL  854



>ref|XP_010680623.1| PREDICTED: glutamate receptor 3.6-like [Beta vulgaris subsp. 
vulgaris]
Length=960

 Score =   139 bits (351),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 61/100 (61%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ CE+ IVG EF ++G GFAF + SPL+VDMSTA+ ++++NG+LQRIHDKWL+R AC
Sbjct  763  FLSSRCEYTIVGQEFTKNGWGFAFPRDSPLAVDMSTALLQIAENGDLQRIHDKWLMRKAC  822

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGI  94
             SQ+T+L VN+L LKSF  LFL+CG AC  AL+L+F L +
Sbjct  823  SSQDTKLDVNRLELKSFWGLFLVCGIACFVALILYFGLTV  862



>ref|XP_006306244.1| hypothetical protein CARUB_v10012075mg [Capsella rubella]
 gb|EOA39142.1| hypothetical protein CARUB_v10012075mg [Capsella rubella]
Length=941

 Score =   139 bits (349),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 60/97 (62%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS++C + IVG EF +SG GFAF + SPL++D+STAI EL++NG+LQRIHDKWL++ AC
Sbjct  760  FLSSNCAYRIVGQEFTKSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNAC  819

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              +N EL+ ++LHLKSF  LFL+CG AC+FALLL+F+
Sbjct  820  TLENAELESDRLHLKSFWGLFLICGVACIFALLLYFI  856



>ref|XP_006467098.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Citrus sinensis]
Length=909

 Score =   138 bits (348),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 62/97 (64%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST CEF I+G EF R G GFAF + SPL+VDMS AI ELS+NG+LQRIHDKWL R AC
Sbjct  719  FLSTRCEFSIIGQEFTRIGWGFAFPRDSPLAVDMSIAILELSENGDLQRIHDKWLTRSAC  778

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ  + + +QLHLKSF  LF++CG ACL ALL++ +
Sbjct  779  SSQGAKQEADQLHLKSFWGLFVLCGVACLLALLIYLI  815



>gb|KDO71514.1| hypothetical protein CISIN_1g002505mg [Citrus sinensis]
Length=914

 Score =   138 bits (348),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 62/97 (64%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST CEF I+G EF R G GFAF + SPL+VDMS AI ELS+NG+LQRIHDKWL R AC
Sbjct  758  FLSTRCEFSIIGQEFTRIGWGFAFPRDSPLAVDMSIAILELSENGDLQRIHDKWLTRSAC  817

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ  + + +QLHLKSF  LF++CG ACL ALL++ +
Sbjct  818  SSQGAKQEADQLHLKSFWGLFVLCGVACLLALLIYLI  854



>ref|XP_006467097.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Citrus sinensis]
Length=948

 Score =   138 bits (348),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 62/97 (64%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST CEF I+G EF R G GFAF + SPL+VDMS AI ELS+NG+LQRIHDKWL R AC
Sbjct  758  FLSTRCEFSIIGQEFTRIGWGFAFPRDSPLAVDMSIAILELSENGDLQRIHDKWLTRSAC  817

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ  + + +QLHLKSF  LF++CG ACL ALL++ +
Sbjct  818  SSQGAKQEADQLHLKSFWGLFVLCGVACLLALLIYLI  854



>ref|XP_007046473.1| Glutamate receptor 3.6 [Theobroma cacao]
 gb|EOX90630.1| Glutamate receptor 3.6 [Theobroma cacao]
Length=939

 Score =   138 bits (347),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 61/97 (63%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST CEF IVG EF ++G GFAF + SPL++DMSTAI  LS+NG+LQRIHDKWLLR AC
Sbjct  758  FLSTRCEFSIVGQEFTKNGWGFAFPRDSPLAMDMSTAILRLSENGDLQRIHDKWLLRRAC  817

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              Q  +++V++L LKSF  LFL+CG AC  ALL++F+
Sbjct  818  SYQGAKMEVDELQLKSFWGLFLICGLACFIALLIYFL  854



>ref|XP_009618635.1| PREDICTED: glutamate receptor 3.3-like [Nicotiana tomentosiformis]
 ref|XP_009618636.1| PREDICTED: glutamate receptor 3.3-like [Nicotiana tomentosiformis]
Length=930

 Score =   138 bits (347),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 61/97 (63%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  C+F IVG EF +SG GFAF + SPL+VD+STAI  LS+NG+LQRIHDKWL R AC
Sbjct  753  FLSNQCKFRIVGQEFTKSGWGFAFPRDSPLAVDLSTAILTLSENGDLQRIHDKWLSRSAC  812

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              +N EL+ ++LHL+SFS LFL+CG AC  ALL++F+
Sbjct  813  SLENAELESDRLHLRSFSGLFLICGIACFIALLIYFL  849



>ref|XP_010266233.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Nelumbo nucifera]
Length=944

 Score =   138 bits (347),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 63/102 (62%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST C F +VG EF +SG GFAF + SP++VDMSTAI  LS+NG+LQRIHDKWL R AC
Sbjct  775  FLSTQCNFRVVGQEFTKSGWGFAFPRDSPIAVDMSTAILALSENGDLQRIHDKWLKRSAC  834

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
               + EL+ NQLHLKSF  LFL+CG AC  AL ++F L I +
Sbjct  835  SLDDNELESNQLHLKSFWGLFLICGLACFVALFIYFFLMIRK  876



>ref|XP_010316485.1| PREDICTED: glutamate receptor 3.6 isoform X3 [Solanum lycopersicum]
Length=937

 Score =   138 bits (347),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 61/98 (62%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F I+G EF ++G GFAF + SPL+VDMSTAI +LS+NGELQRIHDKWL   AC
Sbjct  757  FLSSRCQFSILGQEFTKNGWGFAFPRDSPLAVDMSTAILKLSENGELQRIHDKWLSGIAC  816

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             SQ+T+L+V++L LKSFS LF +CG AC  ALL++F++
Sbjct  817  TSQSTKLEVDRLQLKSFSGLFFLCGLACFLALLIYFVM  854



>emb|CDX80728.1| BnaC08g05620D [Brassica napus]
Length=242

 Score =   131 bits (329),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS++C + IVG EF +SG GFAF + SPL++D+STAI EL++NG+LQRIHDKWL++ AC
Sbjct  63   FLSSNCAYRIVGQEFTKSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNAC  122

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              +N EL+ ++LHLKSF  LFL+CG AC+ AL L+F+
Sbjct  123  TLENAELESDRLHLKSFWGLFLICGVACVLALFLYFV  159



>ref|XP_010316484.1| PREDICTED: glutamate receptor 3.6 isoform X2 [Solanum lycopersicum]
Length=951

 Score =   138 bits (347),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 61/98 (62%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F I+G EF ++G GFAF + SPL+VDMSTAI +LS+NGELQRIHDKWL   AC
Sbjct  771  FLSSRCQFSILGQEFTKNGWGFAFPRDSPLAVDMSTAILKLSENGELQRIHDKWLSGIAC  830

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             SQ+T+L+V++L LKSFS LF +CG AC  ALL++F++
Sbjct  831  TSQSTKLEVDRLQLKSFSGLFFLCGLACFLALLIYFVM  868



>ref|XP_004232576.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Solanum lycopersicum]
 dbj|BAL15058.1| glutamate receptor 3.5 [Solanum lycopersicum]
Length=958

 Score =   138 bits (347),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 61/98 (62%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F I+G EF ++G GFAF + SPL+VDMSTAI +LS+NGELQRIHDKWL   AC
Sbjct  778  FLSSRCQFSILGQEFTKNGWGFAFPRDSPLAVDMSTAILKLSENGELQRIHDKWLSGIAC  837

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             SQ+T+L+V++L LKSFS LF +CG AC  ALL++F++
Sbjct  838  TSQSTKLEVDRLQLKSFSGLFFLCGLACFLALLIYFVM  875



>ref|XP_010266235.1| PREDICTED: glutamate receptor 3.3-like isoform X4 [Nelumbo nucifera]
Length=916

 Score =   137 bits (346),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 63/102 (62%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST C F +VG EF +SG GFAF + SP++VDMSTAI  LS+NG+LQRIHDKWL R AC
Sbjct  747  FLSTQCNFRVVGQEFTKSGWGFAFPRDSPIAVDMSTAILALSENGDLQRIHDKWLKRSAC  806

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
               + EL+ NQLHLKSF  LFL+CG AC  AL ++F L I +
Sbjct  807  SLDDNELESNQLHLKSFWGLFLICGLACFVALFIYFFLMIRK  848



>ref|XP_010463180.1| PREDICTED: glutamate receptor 3.3-like [Camelina sativa]
Length=892

 Score =   137 bits (346),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 60/97 (62%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS++C + IVG EF +SG GFAF + SPL++D+STAI EL++NG+LQRIHDKWL++ AC
Sbjct  711  FLSSNCAYRIVGQEFTKSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNAC  770

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              +N EL+ ++LHLKSF  LFL+CG ACL ALLL+F+
Sbjct  771  TLENAELESDRLHLKSFWGLFLICGVACLLALLLYFV  807



>ref|XP_010266230.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Nelumbo nucifera]
 ref|XP_010266231.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Nelumbo nucifera]
Length=947

 Score =   137 bits (346),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 63/102 (62%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST C F +VG EF +SG GFAF + SP++VDMSTAI  LS+NG+LQRIHDKWL R AC
Sbjct  778  FLSTQCNFRVVGQEFTKSGWGFAFPRDSPIAVDMSTAILALSENGDLQRIHDKWLKRSAC  837

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
               + EL+ NQLHLKSF  LFL+CG AC  AL ++F L I +
Sbjct  838  SLDDNELESNQLHLKSFWGLFLICGLACFVALFIYFFLMIRK  879



>ref|XP_010478979.1| PREDICTED: glutamate receptor 3.3-like [Camelina sativa]
 ref|XP_010478980.1| PREDICTED: glutamate receptor 3.3-like [Camelina sativa]
Length=936

 Score =   137 bits (346),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 60/97 (62%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS++C + IVG EF +SG GFAF + SPL++D+STAI EL++NG+LQRIHDKWL++ AC
Sbjct  755  FLSSNCAYRIVGQEFTKSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNAC  814

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              +N EL+ ++LHLKSF  LFL+CG ACL ALLL+F+
Sbjct  815  TLENAELESDRLHLKSFWGLFLICGVACLLALLLYFV  851



>ref|XP_010500221.1| PREDICTED: glutamate receptor 3.3 [Camelina sativa]
 ref|XP_010500222.1| PREDICTED: glutamate receptor 3.3 [Camelina sativa]
Length=936

 Score =   137 bits (346),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 60/97 (62%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS++C + IVG EF +SG GFAF + SPL++D+STAI EL++NG+LQRIHDKWL++ AC
Sbjct  755  FLSSNCAYRIVGQEFTKSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNAC  814

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              +N EL+ ++LHLKSF  LFL+CG ACL ALLL+F+
Sbjct  815  TLENAELESDRLHLKSFWGLFLICGVACLLALLLYFV  851



>ref|XP_009786331.1| PREDICTED: glutamate receptor 3.3 isoform X1 [Nicotiana sylvestris]
Length=930

 Score =   137 bits (346),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 61/97 (63%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  C+F IVG EF +SG GFAF + SPL+VD+STAI  LS+NG+LQRIHDKWL R AC
Sbjct  753  FLSNQCKFRIVGQEFTKSGWGFAFPRDSPLAVDLSTAILTLSENGDLQRIHDKWLSRSAC  812

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              +N EL+ ++LHL+SFS LFL+CG AC  ALL++F+
Sbjct  813  SLENAELESDRLHLRSFSGLFLICGIACFIALLIYFL  849



>ref|XP_011022205.1| PREDICTED: glutamate receptor 3.6-like isoform X4 [Populus euphratica]
Length=845

 Score =   137 bits (344),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 59/97 (61%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  CEF IVG EF ++G GFAF + SPL+VD+STAI +LS+NG+LQRIHDKWL+R AC
Sbjct  666  FLSNQCEFSIVGQEFTKNGWGFAFPRDSPLAVDLSTAILKLSENGDLQRIHDKWLMRSAC  725

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ T+ +V++L L+SF  L+L+CG ACL AL ++F+
Sbjct  726  SSQGTKFEVDRLDLRSFWGLYLICGIACLLALFIYFL  762



>ref|XP_002891241.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67500.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=937

 Score =   137 bits (345),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 60/97 (62%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C + IVG EF +SG GFAF + SPL++D+STAI EL++NG+LQRIHDKWL++ AC
Sbjct  756  FLSTNCAYRIVGQEFTKSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNAC  815

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              +N EL+ ++LHLKSF  LFL+CG ACL AL L+F+
Sbjct  816  TLENAELESDRLHLKSFWGLFLICGVACLLALFLYFV  852



>ref|XP_010266234.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Nelumbo nucifera]
Length=928

 Score =   137 bits (345),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 63/102 (62%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST C F +VG EF +SG GFAF + SP++VDMSTAI  LS+NG+LQRIHDKWL R AC
Sbjct  759  FLSTQCNFRVVGQEFTKSGWGFAFPRDSPIAVDMSTAILALSENGDLQRIHDKWLKRSAC  818

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
               + EL+ NQLHLKSF  LFL+CG AC  AL ++F L I +
Sbjct  819  SLDDNELESNQLHLKSFWGLFLICGLACFVALFIYFFLMIRK  860



>ref|XP_004238633.2| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum]
 ref|XP_010320472.1| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum]
 ref|XP_010320473.1| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum]
 ref|XP_010320474.1| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum]
 ref|XP_010320475.1| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum]
Length=945

 Score =   137 bits (345),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 61/97 (63%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  C+F IVG EF +SG GFAF + SPL+VD+STAI  LS+NG+LQRIHDKWL R AC
Sbjct  770  FLSNQCKFRIVGQEFTKSGWGFAFPRDSPLAVDLSTAILTLSENGDLQRIHDKWLARSAC  829

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
               N EL+ ++LHL+SFS LFL+CG AC  ALL++F+
Sbjct  830  SLDNAELESDRLHLRSFSGLFLICGIACFIALLIYFI  866



>ref|XP_011022202.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Populus euphratica]
 ref|XP_011022203.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Populus euphratica]
 ref|XP_011022204.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Populus euphratica]
Length=937

 Score =   137 bits (344),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 59/97 (61%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  CEF IVG EF ++G GFAF + SPL+VD+STAI +LS+NG+LQRIHDKWL+R AC
Sbjct  758  FLSNQCEFSIVGQEFTKNGWGFAFPRDSPLAVDLSTAILKLSENGDLQRIHDKWLMRSAC  817

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ T+ +V++L L+SF  L+L+CG ACL AL ++F+
Sbjct  818  SSQGTKFEVDRLDLRSFWGLYLICGIACLLALFIYFL  854



>ref|XP_011022201.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Populus euphratica]
Length=965

 Score =   137 bits (344),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 59/97 (61%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  CEF IVG EF ++G GFAF + SPL+VD+STAI +LS+NG+LQRIHDKWL+R AC
Sbjct  786  FLSNQCEFSIVGQEFTKNGWGFAFPRDSPLAVDLSTAILKLSENGDLQRIHDKWLMRSAC  845

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ T+ +V++L L+SF  L+L+CG ACL AL ++F+
Sbjct  846  SSQGTKFEVDRLDLRSFWGLYLICGIACLLALFIYFL  882



>ref|XP_011022199.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Populus euphratica]
Length=967

 Score =   137 bits (344),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 59/97 (61%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  CEF IVG EF ++G GFAF + SPL+VD+STAI +LS+NG+LQRIHDKWL+R AC
Sbjct  788  FLSNQCEFSIVGQEFTKNGWGFAFPRDSPLAVDLSTAILKLSENGDLQRIHDKWLMRSAC  847

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ T+ +V++L L+SF  L+L+CG ACL AL ++F+
Sbjct  848  SSQGTKFEVDRLDLRSFWGLYLICGIACLLALFIYFL  884



>ref|XP_006342151.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Solanum tuberosum]
 ref|XP_006342152.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Solanum tuberosum]
 ref|XP_006342153.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Solanum tuberosum]
Length=946

 Score =   137 bits (344),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 61/97 (63%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  C+F IVG EF +SG GFAF + SPL+VD+STAI  LS+NG+LQRIHDKWL R AC
Sbjct  768  FLSNQCKFRIVGQEFTKSGWGFAFPRDSPLAVDLSTAILTLSENGDLQRIHDKWLARSAC  827

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
               N EL+ ++LHL+SFS LFL+CG AC  ALL++F+
Sbjct  828  SLDNAELESDRLHLRSFSGLFLICGIACFIALLIYFI  864



>ref|XP_006425261.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
 gb|ESR38501.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
Length=926

 Score =   136 bits (343),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 61/97 (63%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST CEF I+G EF R G GFAF + SPL+VDMS AI ELS+NG+LQRIHDKWL R AC
Sbjct  736  FLSTRCEFSIIGQEFTRIGWGFAFPRDSPLAVDMSIAILELSENGDLQRIHDKWLTRSAC  795

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ  + + ++LHLKSF  LF++CG ACL ALL++ +
Sbjct  796  SSQGAKQEADRLHLKSFWGLFVLCGVACLLALLIYLI  832



>ref|XP_010530328.1| PREDICTED: glutamate receptor 3.3 [Tarenaya hassleriana]
Length=962

 Score =   136 bits (342),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 60/96 (63%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS++C + IVG EF +SG GFAF + SPL+VD+STAI EL++NG+LQRIHDKWL++ AC
Sbjct  758  FLSSNCAYRIVGQEFTKSGWGFAFPRDSPLAVDLSTAILELAENGDLQRIHDKWLMKNAC  817

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
               N EL+ ++LHLKSF  LFL+CG ACL ALL++F
Sbjct  818  TLDNAELESDRLHLKSFWGLFLICGIACLLALLIYF  853



>ref|XP_008241921.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Prunus mume]
Length=937

 Score =   136 bits (342),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 59/97 (61%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F IVG EF ++G GFAF++ SPLSVDMSTAI +LS+NG+LQRIHDKWL+  +C
Sbjct  756  FLSSRCDFSIVGQEFTKTGWGFAFARDSPLSVDMSTAILKLSENGDLQRIHDKWLISSSC  815

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ  +LQV++L LKSF  LF++CG AC  AL+++F+
Sbjct  816  ASQGAKLQVDRLQLKSFWGLFVLCGSACFLALIIYFI  852



>ref|XP_008241916.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Prunus mume]
 ref|XP_008241917.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Prunus mume]
 ref|XP_008241918.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Prunus mume]
Length=937

 Score =   136 bits (342),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 59/97 (61%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F IVG EF ++G GFAF++ SPLSVDMSTAI +LS+NG+LQRIHDKWL+  +C
Sbjct  756  FLSSRCDFSIVGQEFTKTGWGFAFARDSPLSVDMSTAILKLSENGDLQRIHDKWLISSSC  815

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ  +LQV++L LKSF  LF++CG AC  AL+++F+
Sbjct  816  ASQGAKLQVDRLQLKSFWGLFVLCGSACFLALIIYFI  852



>ref|XP_007203996.1| hypothetical protein PRUPE_ppa000995mg [Prunus persica]
 gb|EMJ05195.1| hypothetical protein PRUPE_ppa000995mg [Prunus persica]
Length=937

 Score =   136 bits (342),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 59/97 (61%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F IVG EF ++G GFAF++ SPLSVDMSTAI +LS+NG+LQRIHDKWL+  +C
Sbjct  756  FLSSRCDFSIVGQEFTKTGWGFAFARDSPLSVDMSTAILKLSENGDLQRIHDKWLISSSC  815

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ  +LQV++L LKSF  LF++CG AC  AL+++F+
Sbjct  816  ASQGAKLQVDRLQLKSFWGLFVLCGSACFLALIIYFI  852



>ref|XP_007203104.1| hypothetical protein PRUPE_ppa023817mg [Prunus persica]
 gb|EMJ04303.1| hypothetical protein PRUPE_ppa023817mg [Prunus persica]
Length=937

 Score =   136 bits (342),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 59/97 (61%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F IVG EF ++G GFAF++ SPLSVDMSTAI +LSDNG+L+RIHDKWL+  +C
Sbjct  756  FLSSRCDFSIVGQEFTKTGWGFAFARDSPLSVDMSTAILKLSDNGDLRRIHDKWLISSSC  815

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ  +LQV++L LKSF  LF++CG AC  AL+++F+
Sbjct  816  ASQGAKLQVDRLQLKSFWGLFVLCGSACFLALIIYFI  852



>ref|XP_002306436.1| glutamate receptor family protein [Populus trichocarpa]
 gb|EEE93432.1| glutamate receptor family protein [Populus trichocarpa]
Length=937

 Score =   135 bits (341),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 59/97 (61%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  CEF IVG EF ++G GFAF + SPL+VD+STAI +LS+NG+LQRIHDKWL+R AC
Sbjct  758  FLSNQCEFSIVGREFTKNGWGFAFPRDSPLAVDLSTAILKLSENGDLQRIHDKWLMRSAC  817

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ  + +V++L L+SF  L+L+CG ACL AL L+F+
Sbjct  818  SSQGAKFEVDRLDLRSFWGLYLICGIACLLALFLYFL  854



>ref|XP_007203235.1| hypothetical protein PRUPE_ppa001033mg [Prunus persica]
 gb|EMJ04434.1| hypothetical protein PRUPE_ppa001033mg [Prunus persica]
Length=927

 Score =   135 bits (341),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 60/97 (62%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F IVG EF +SG GFAF++ SPLSVDMSTAI +LS+NG+LQRIHDKWL+   C
Sbjct  757  FLSSRCDFSIVGQEFTKSGWGFAFARDSPLSVDMSTAILKLSENGDLQRIHDKWLISSGC  816

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ  +LQV++L LKSF  LF++CG AC  AL++ F+
Sbjct  817  ASQGAKLQVDRLQLKSFWGLFVLCGSACFLALIIFFI  853



>ref|NP_174978.1| glutamate receptor 3.3 [Arabidopsis thaliana]
 sp|Q9C8E7.1|GLR33_ARATH RecName: Full=Glutamate receptor 3.3; AltName: Full=Ligand-gated 
ion channel 3.3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51316.1|AC025815_3 ligand-gated ion channel, putative [Arabidopsis thaliana]
 gb|AEE31925.1| glutamate receptor 3.3 [Arabidopsis thaliana]
Length=933

 Score =   135 bits (340),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 59/97 (61%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS++C + IVG EF +SG GFAF + SPL++D+STAI EL++NG+LQRIHDKWL++ AC
Sbjct  753  FLSSNCAYRIVGQEFTKSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNAC  812

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              +N EL+ ++LHLKSF  LFL+CG ACL AL L+F+
Sbjct  813  TLENAELESDRLHLKSFWGLFLICGVACLLALFLYFV  849



>gb|AAR27949.1| GLR3.3 [Arabidopsis thaliana]
Length=933

 Score =   135 bits (340),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 59/97 (61%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS++C + IVG EF +SG GFAF + SPL++D+STAI EL++NG+LQRIHDKWL++ AC
Sbjct  753  FLSSNCAYRIVGQEFTKSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNAC  812

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              +N EL+ ++LHLKSF  LFL+CG ACL AL L+F+
Sbjct  813  TLENAELESDRLHLKSFWGLFLICGVACLLALFLYFV  849



>ref|XP_008245275.1| PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 3.6-like [Prunus 
mume]
Length=761

 Score =   134 bits (338),  Expect = 9e-34, Method: Composition-based stats.
 Identities = 58/97 (60%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F IVG EF ++G GFAF++ SPLSVDMSTAI +LS+NG+LQRIHDKWL+  +C
Sbjct  591  FLSSRCDFSIVGQEFTKTGWGFAFARDSPLSVDMSTAILKLSENGDLQRIHDKWLISSSC  650

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ  +L+V++L LKSF  LF++CG AC  AL+++F+
Sbjct  651  ASQGAKLEVDRLQLKSFWGLFVLCGSACFLALIIYFI  687



>emb|CAN72607.1| hypothetical protein VITISV_021339 [Vitis vinifera]
Length=916

 Score =   135 bits (340),  Expect = 9e-34, Method: Composition-based stats.
 Identities = 61/96 (64%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST C+F IVG EF +SG GF F + SPL+VDMSTAI  LS+NG+LQRIHDKWL   AC
Sbjct  736  FLSTQCKFRIVGQEFTKSGWGFVFPRDSPLAVDMSTAILALSENGDLQRIHDKWLATSAC  795

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
             S++TEL+ ++LHLKSF  LFL+CG AC  AL+++F
Sbjct  796  SSESTELESDRLHLKSFWGLFLICGLACFVALVIYF  831



>emb|CDY35797.1| BnaA08g04580D [Brassica napus]
Length=822

 Score =   135 bits (339),  Expect = 9e-34, Method: Composition-based stats.
 Identities = 58/97 (60%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS++C + IVG EF +SG GFAF + SPL++D+STAI EL++NG+LQRIHDKWL++ AC
Sbjct  643  FLSSNCAYRIVGQEFTKSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNAC  702

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              +N EL+ ++LHLKSF  LFL+CG AC+ AL L+F+
Sbjct  703  TLENAELESDRLHLKSFWGLFLICGVACVLALFLYFV  739



>ref|XP_010550509.1| PREDICTED: glutamate receptor 3.6 isoform X2 [Tarenaya hassleriana]
Length=889

 Score =   135 bits (339),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 62/100 (62%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  CEF IVG EF ++G GFAF ++SPL+VD STAI +LS+NG+LQRIHDKWLLR AC
Sbjct  732  FLSNRCEFGIVGHEFTKNGWGFAFPRNSPLAVDFSTAILQLSENGDLQRIHDKWLLRKAC  791

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGI  94
              Q  E++V++L LKSF  LF++CG ACLF LL++ +L I
Sbjct  792  SLQGAEIEVDRLELKSFWGLFVVCGMACLFTLLIYSVLVI  831



>ref|XP_010550505.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Tarenaya hassleriana]
 ref|XP_010550506.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Tarenaya hassleriana]
 ref|XP_010550507.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Tarenaya hassleriana]
 ref|XP_010550508.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Tarenaya hassleriana]
Length=896

 Score =   135 bits (339),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 62/100 (62%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  CEF IVG EF ++G GFAF ++SPL+VD STAI +LS+NG+LQRIHDKWLLR AC
Sbjct  739  FLSNRCEFGIVGHEFTKNGWGFAFPRNSPLAVDFSTAILQLSENGDLQRIHDKWLLRKAC  798

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGI  94
              Q  E++V++L LKSF  LF++CG ACLF LL++ +L I
Sbjct  799  SLQGAEIEVDRLELKSFWGLFVVCGMACLFTLLIYSVLVI  838



>ref|XP_006396004.1| hypothetical protein EUTSA_v10003614mg [Eutrema salsugineum]
 gb|ESQ33290.1| hypothetical protein EUTSA_v10003614mg [Eutrema salsugineum]
Length=937

 Score =   135 bits (339),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 58/97 (60%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS++C + IVG EF +SG GFAF + SPL++D+STAI EL++NG+LQRIHDKWL++ AC
Sbjct  756  FLSSNCAYRIVGQEFTKSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNAC  815

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              +N EL+ ++LHLKSF  LFL+CG AC+ AL L+F+
Sbjct  816  TLENAELESDRLHLKSFWGLFLICGVACVLALFLYFV  852



>emb|CBI40741.3| unnamed protein product [Vitis vinifera]
Length=934

 Score =   135 bits (339),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 61/96 (64%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST C+F IVG EF +SG GF F + SPL+VDMSTAI  LS+NG+LQRIHDKWL   AC
Sbjct  754  FLSTQCKFRIVGQEFTKSGWGFVFPRDSPLAVDMSTAILALSENGDLQRIHDKWLATSAC  813

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
             S++TEL+ ++LHLKSF  LFL+CG AC  AL+++F
Sbjct  814  SSESTELESDRLHLKSFWGLFLICGLACFVALVIYF  849



>ref|XP_003608144.1| Glutamate receptor 3.3 [Medicago truncatula]
Length=473

 Score =   132 bits (331),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 58/97 (60%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F IVG EF R+G GFAF   SPL+VD+STAI EL+++G+LQRIHDKWLL  AC
Sbjct  291  FLSSRCDFSIVGQEFTRNGWGFAFPPDSPLAVDLSTAILELAESGDLQRIHDKWLLSSAC  350

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
            +SQ  +L+V++L+L+SF  L+L+CG AC  ALL++F+
Sbjct  351  RSQGAKLEVDRLNLRSFWGLYLVCGLACFLALLIYFI  387



>ref|XP_008242064.1| PREDICTED: glutamate receptor 3.6-like [Prunus mume]
Length=347

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F IVG EF ++G GFAF++ SPLSVDMSTAI +LS+NG+LQRIHDKWL+  +C
Sbjct  166  FLSSRCDFSIVGQEFTKTGWGFAFARDSPLSVDMSTAILKLSENGDLQRIHDKWLISSSC  225

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ  +L+V++L LKSF  LF++CG AC  AL+++F+
Sbjct  226  ASQGAKLEVDRLQLKSFWGLFVLCGSACFLALIIYFI  262



>ref|XP_009107640.1| PREDICTED: glutamate receptor 3.3 isoform X1 [Brassica rapa]
Length=929

 Score =   134 bits (338),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 58/97 (60%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS++C + IVG EF +SG GFAF + SPL++D+STAI EL++NG+LQRIHDKWL++ AC
Sbjct  750  FLSSNCAYRIVGQEFTKSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNAC  809

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              +N EL+ ++LHLKSF  LFL+CG AC+ AL L+F+
Sbjct  810  TLENAELESDRLHLKSFWGLFLICGVACVLALFLYFV  846



>ref|XP_002272859.2| PREDICTED: glutamate receptor 3.3 [Vitis vinifera]
Length=964

 Score =   134 bits (338),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 61/96 (64%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST C+F IVG EF +SG GF F + SPL+VDMSTAI  LS+NG+LQRIHDKWL   AC
Sbjct  784  FLSTQCKFRIVGQEFTKSGWGFVFPRDSPLAVDMSTAILALSENGDLQRIHDKWLATSAC  843

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
             S++TEL+ ++LHLKSF  LFL+CG AC  AL+++F
Sbjct  844  SSESTELESDRLHLKSFWGLFLICGLACFVALVIYF  879



>ref|XP_003629105.1| Glutamate receptor 3.6 [Medicago truncatula]
Length=739

 Score =   133 bits (335),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 58/97 (60%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F IVG EF R+G GFAF   SPL+VD+STAI EL+++G+LQRIHDKWLL  AC
Sbjct  557  FLSSRCDFSIVGQEFTRNGWGFAFPPDSPLAVDLSTAILELAESGDLQRIHDKWLLSSAC  616

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
            +SQ  +L+V++L+L+SF  L+L+CG AC  ALL++F+
Sbjct  617  RSQGAKLEVDRLNLRSFWGLYLVCGLACFLALLIYFI  653



>ref|XP_006587552.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Glycine max]
Length=845

 Score =   134 bits (336),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 58/97 (60%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C++ IVG EF R+G GFAF + SPL+VD+STAI EL++NG+LQRIHDKWLL  AC
Sbjct  665  FLSSRCDYSIVGQEFTRNGWGFAFPRDSPLAVDLSTAILELAENGDLQRIHDKWLLSSAC  724

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ  +L+V++L+L+SF  L+L+CG AC+ ALL++F+
Sbjct  725  LSQGAKLEVDRLNLRSFWGLYLVCGLACVLALLIYFI  761



>ref|XP_006577929.1| PREDICTED: glutamate receptor 3.3-like [Glycine max]
Length=925

 Score =   134 bits (337),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 60/97 (62%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C F IVG EF RSG GFAF + SPL+VDMSTAI +LS+ G+LQRIHDKW+ R +C
Sbjct  757  FLSSQCTFRIVGQEFTRSGWGFAFPRDSPLAVDMSTAILQLSETGDLQRIHDKWMTRSSC  816

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              +N E+  ++L LKSF  LFL+CG AC  AL+LHFM
Sbjct  817  SLENAEIDSDRLQLKSFWGLFLICGIACFIALVLHFM  853



>gb|KHG21169.1| Glutamate receptor 3.2 -like protein [Gossypium arboreum]
Length=925

 Score =   134 bits (337),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS HCEF + G EF +SG GFAF + SPL++DMSTAI  LS+NGELQ+IHD+WL + AC
Sbjct  745  FLSEHCEFSVRGQEFTKSGWGFAFPRDSPLAIDMSTAILSLSENGELQKIHDRWLSKSAC  804

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             S+N+E  + QL LKSF  LF++CG AC+ ALL++F L
Sbjct  805  SSENSEDDIEQLDLKSFWGLFVICGIACMLALLVYFWL  842



>gb|KHN12498.1| Glutamate receptor 3.6 [Glycine soja]
Length=916

 Score =   134 bits (336),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 58/97 (60%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C++ IVG EF R+G GFAF + SPL+VD+STAI EL++NG+LQRIHDKWLL  AC
Sbjct  767  FLSSRCDYSIVGQEFTRNGWGFAFPRDSPLAVDLSTAILELAENGDLQRIHDKWLLSSAC  826

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ  +L+V++L+L+SF  L+L+CG AC+ ALL++F+
Sbjct  827  LSQGAKLEVDRLNLRSFWGLYLVCGLACVLALLIYFI  863



>gb|KHN38860.1| Glutamate receptor 3.6 [Glycine soja]
Length=938

 Score =   134 bits (336),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 58/97 (60%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C++ IVG EF R+G GFAF + SPL+VD+STAI EL++NG+LQRIHDKWLL  AC
Sbjct  758  FLSSRCDYSIVGQEFTRNGWGFAFPRDSPLAVDLSTAILELAENGDLQRIHDKWLLSSAC  817

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ  +L+V++L+L+SF  L+L+CG AC+ ALL++F+
Sbjct  818  LSQGAKLEVDRLNLRSFWGLYLVCGLACVLALLIYFI  854



>ref|XP_009418664.1| PREDICTED: glutamate receptor 3.3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418665.1| PREDICTED: glutamate receptor 3.3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418666.1| PREDICTED: glutamate receptor 3.3-like [Musa acuminata subsp. 
malaccensis]
Length=918

 Score =   134 bits (336),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 59/100 (59%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C+F I+GSEF +SG GF F + SPL+VDMSTAI  LS+NG+LQRIHDKW  R AC
Sbjct  754  FLSTNCKFAIIGSEFTKSGWGFVFPRDSPLAVDMSTAILTLSENGDLQRIHDKWFTRAAC  813

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGI  94
             S+  E+   +LHL SF  LFL+CG +C  ALL++F++ I
Sbjct  814  ISETDEIDSERLHLSSFWGLFLICGMSCFLALLIYFIIMI  853



>ref|XP_003533407.2| PREDICTED: glutamate receptor 3.6-like isoform X1 [Glycine max]
Length=947

 Score =   134 bits (336),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 58/97 (60%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C++ IVG EF R+G GFAF + SPL+VD+STAI EL++NG+LQRIHDKWLL  AC
Sbjct  767  FLSSRCDYSIVGQEFTRNGWGFAFPRDSPLAVDLSTAILELAENGDLQRIHDKWLLSSAC  826

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ  +L+V++L+L+SF  L+L+CG AC+ ALL++F+
Sbjct  827  LSQGAKLEVDRLNLRSFWGLYLVCGLACVLALLIYFI  863



>ref|XP_010266236.1| PREDICTED: glutamate receptor 3.2-like [Nelumbo nucifera]
 ref|XP_010266237.1| PREDICTED: glutamate receptor 3.2-like [Nelumbo nucifera]
 ref|XP_010266238.1| PREDICTED: glutamate receptor 3.2-like [Nelumbo nucifera]
Length=928

 Score =   134 bits (336),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 60/98 (61%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  C+F IVG EF +SG GFAF + SPL+VDMSTAI  LS+NG+LQRIHDKWL    C
Sbjct  745  FLSKQCKFSIVGREFTKSGWGFAFPRDSPLAVDMSTAILTLSENGDLQRIHDKWLTSKTC  804

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             S+ TE + ++LHL+SF  LFL+CG AC  AL L+F+L
Sbjct  805  SSRGTEFESDRLHLRSFWGLFLICGIACFIALFLYFIL  842



>ref|XP_007156253.1| hypothetical protein PHAVU_003G270900g [Phaseolus vulgaris]
 ref|XP_007156254.1| hypothetical protein PHAVU_003G270900g [Phaseolus vulgaris]
 gb|ESW28247.1| hypothetical protein PHAVU_003G270900g [Phaseolus vulgaris]
 gb|ESW28248.1| hypothetical protein PHAVU_003G270900g [Phaseolus vulgaris]
Length=939

 Score =   134 bits (336),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 59/97 (61%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ CEF IVG EF R+G GFAF + SPL+VD+STAI EL++NG+LQRIHDKWLL  AC
Sbjct  759  FLSSRCEFSIVGQEFTRNGWGFAFPRDSPLAVDLSTAILELAENGDLQRIHDKWLLSSAC  818

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ  +L+V++L L+SF  L+L+CG AC+ ALL++ +
Sbjct  819  LSQGAKLEVDRLKLRSFWGLYLVCGLACILALLIYLV  855



>ref|XP_011100274.1| PREDICTED: glutamate receptor 3.3 [Sesamum indicum]
 ref|XP_011100281.1| PREDICTED: glutamate receptor 3.3 [Sesamum indicum]
 ref|XP_011100289.1| PREDICTED: glutamate receptor 3.3 [Sesamum indicum]
 ref|XP_011100297.1| PREDICTED: glutamate receptor 3.3 [Sesamum indicum]
Length=935

 Score =   134 bits (336),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 57/102 (56%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FL++ C F I+G EF +SG GFAF + SPL++D+STAI  LS+NG+LQRIHDKWL   +C
Sbjct  755  FLASQCRFRIIGQEFTKSGWGFAFPRDSPLAIDLSTAILTLSENGDLQRIHDKWLTTSSC  814

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
             S NTEL+ ++LHLKSF  L+L+CG AC  ALL++F+  +++
Sbjct  815  SSDNTELESDRLHLKSFWGLYLLCGIACFIALLIYFLQIVHK  856



>ref|XP_010270512.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Nelumbo nucifera]
 ref|XP_010270513.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Nelumbo nucifera]
Length=924

 Score =   133 bits (335),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 61/97 (63%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  C+F IVG EF +SG GFAF + SPL +DMSTAI  LS+NG+LQRIHDKWL R  C
Sbjct  745  FLSNQCKFSIVGEEFTKSGWGFAFPRDSPLPIDMSTAILTLSENGDLQRIHDKWLSRKTC  804

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ+TEL+ N+LHL+SF  LFL+CG AC  AL ++F+
Sbjct  805  -SQSTELEPNRLHLRSFWGLFLICGIACFLALFIYFI  840



>gb|AET03581.2| glutamate receptor 3.2 [Medicago truncatula]
Length=941

 Score =   133 bits (335),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 58/97 (60%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F IVG EF R+G GFAF   SPL+VD+STAI EL+++G+LQRIHDKWLL  AC
Sbjct  759  FLSSRCDFSIVGQEFTRNGWGFAFPPDSPLAVDLSTAILELAESGDLQRIHDKWLLSSAC  818

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
            +SQ  +L+V++L+L+SF  L+L+CG AC  ALL++F+
Sbjct  819  RSQGAKLEVDRLNLRSFWGLYLVCGLACFLALLIYFI  855



>gb|KHN33784.1| Glutamate receptor 3.3 [Glycine soja]
Length=882

 Score =   133 bits (334),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 59/97 (61%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C F IVG EF RSG GFAF + SPL+VD+STAI +LS+ G+LQRIHDKW+ R +C
Sbjct  714  FLSSQCTFRIVGQEFTRSGWGFAFPRDSPLAVDISTAILQLSETGDLQRIHDKWMTRSSC  773

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              +N E+  ++L LKSF  LFL+CG AC  AL+LHFM
Sbjct  774  SLENAEIDSDRLQLKSFWGLFLICGIACFIALVLHFM  810



>ref|XP_003527293.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Glycine max]
 ref|XP_006581132.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Glycine max]
 ref|XP_006581133.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Glycine max]
Length=929

 Score =   133 bits (334),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 59/97 (61%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C F IVG EF RSG GFAF + SPL+VDMSTAI +LS+ G+LQRIHDKW+ R +C
Sbjct  757  FLSSQCTFRIVGQEFTRSGWGFAFPRDSPLAVDMSTAILQLSETGDLQRIHDKWMTRSSC  816

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              +N E+  ++L LKSF  LFL+CG AC  AL+LHF+
Sbjct  817  SLENAEIDSDRLQLKSFWGLFLICGIACFIALVLHFL  853



>ref|XP_011041194.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041195.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041196.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041197.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041198.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041199.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041200.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
Length=933

 Score =   132 bits (333),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 59/96 (61%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  C F IVG EF +SG GFAF + SPL++DMSTAI  LS+NG+LQRIHDKWL + +C
Sbjct  755  FLSRQCTFRIVGQEFTKSGWGFAFPRDSPLALDMSTAILALSENGDLQRIHDKWLTQSSC  814

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
             S+ +EL+ ++LHLKSF  LFL+CG AC  +LL+HF
Sbjct  815  SSETSELESDRLHLKSFWGLFLICGLACFISLLIHF  850



>ref|XP_008337897.1| PREDICTED: glutamate receptor 3.6-like [Malus domestica]
 ref|XP_008337898.1| PREDICTED: glutamate receptor 3.6-like [Malus domestica]
Length=946

 Score =   132 bits (333),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 56/102 (55%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F +VG EF ++G GFAF++ SPL+VD+STA+ +LS+NG+LQRIHDKWL+R  C
Sbjct  765  FLSSRCDFSVVGQEFTKTGWGFAFARDSPLAVDLSTALLKLSENGDLQRIHDKWLMRTPC  824

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
             SQ  +LQV++L LKSF  LF++CG AC  AL ++F + +++
Sbjct  825  ASQGAKLQVDRLQLKSFWGLFVICGXACFLALAIYFCMMLHQ  866



>ref|XP_002313575.2| Glutamate receptor 3.1 precursor family protein [Populus trichocarpa]
 gb|EEE87530.2| Glutamate receptor 3.1 precursor family protein [Populus trichocarpa]
Length=900

 Score =   132 bits (332),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 60/96 (63%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS HCEF I+G EF RSG GFAF + SPL++DMSTAI +LS+NGELQ IH+KWL R  C
Sbjct  745  FLSEHCEFSIIGQEFTRSGWGFAFPRDSPLAIDMSTAILQLSENGELQNIHNKWLQRKLC  804

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
             SQ+     +QL L+SF  LFL+CG ACL ALL++F
Sbjct  805  SSQDIGSSADQLQLQSFWGLFLICGIACLLALLIYF  840



>ref|XP_010680624.1| PREDICTED: glutamate receptor 3.6-like [Beta vulgaris subsp. 
vulgaris]
Length=907

 Score =   132 bits (332),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 59/96 (61%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  CEF I G  F ++G GFAFS+ SPL+VDMSTAI ++S+NG+LQRIHDKWL + AC
Sbjct  763  FLSRRCEFIIRGQRFTKNGRGFAFSRGSPLAVDMSTAILKMSENGDLQRIHDKWLRKSAC  822

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
            +SQ+T+L V++L LKSF  LFL+ G AC FAL+++F
Sbjct  823  RSQDTKLTVDRLELKSFWGLFLLSGLACFFALIVYF  858



>ref|XP_002510703.1| glutamate receptor 3 plant, putative [Ricinus communis]
 gb|EEF52890.1| glutamate receptor 3 plant, putative [Ricinus communis]
Length=927

 Score =   132 bits (332),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 59/97 (61%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C F IVG EF +SG GFAF + SPL+VDMSTAI ELS+NG+LQRIHDKWL+   C
Sbjct  755  FLSSQCSFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILELSENGDLQRIHDKWLMHSGC  814

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             S  TE++ ++L LKSF  LFL+CG AC  AL ++F+
Sbjct  815  SSDTTEIESDRLELKSFWGLFLICGIACFIALFIYFL  851



>ref|XP_002306988.2| Glutamate receptor 3.3 precursor family protein [Populus trichocarpa]
 gb|EEE93984.2| Glutamate receptor 3.3 precursor family protein [Populus trichocarpa]
Length=932

 Score =   132 bits (332),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 59/96 (61%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  C F IVG EF +SG GFAF + SPL++DMSTAI  LS+NG+LQRIHDKWL +  C
Sbjct  755  FLSRQCTFRIVGQEFTKSGWGFAFPRDSPLALDMSTAILALSENGDLQRIHDKWLTQSTC  814

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
             S+ +EL+ ++LHLKSF  LFL+CG AC  +LL+HF
Sbjct  815  SSETSELESDRLHLKSFWGLFLICGLACFISLLIHF  850



>ref|XP_007135963.1| hypothetical protein PHAVU_009G006500g [Phaseolus vulgaris]
 ref|XP_007135964.1| hypothetical protein PHAVU_009G006500g [Phaseolus vulgaris]
 gb|ESW07957.1| hypothetical protein PHAVU_009G006500g [Phaseolus vulgaris]
 gb|ESW07958.1| hypothetical protein PHAVU_009G006500g [Phaseolus vulgaris]
Length=918

 Score =   132 bits (332),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 60/102 (59%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C F IVG EF RSG GFAF + SPL+VDMSTAI +LS+ G+LQRIHDKW+ R +C
Sbjct  752  FLSSQCTFRIVGQEFTRSGWGFAFPRDSPLAVDMSTAILQLSETGDLQRIHDKWMTRSSC  811

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
               N E+  ++L LKSF  LF++CG AC  ALLLHF+  I++
Sbjct  812  SLDNAEIDSDRLQLKSFWGLFIICGIACFVALLLHFLQIIFQ  853



>ref|XP_009359614.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Pyrus x bretschneideri]
 ref|XP_009359616.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Pyrus x bretschneideri]
 ref|XP_009359617.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Pyrus x bretschneideri]
 ref|XP_009359618.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Pyrus x bretschneideri]
Length=937

 Score =   132 bits (332),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 56/102 (55%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F +VG EF ++G GFAF++ SPL+VD+STA+ +LS+NG+LQRIHDKWL+R  C
Sbjct  765  FLSSRCDFSVVGQEFTKTGWGFAFARDSPLAVDLSTALLKLSENGDLQRIHDKWLMRTPC  824

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
             SQ  +LQV++L LKSF  LF++CG AC  AL ++F + +++
Sbjct  825  ASQGAKLQVDRLQLKSFWGLFVICGAACFLALAIYFCMMLHQ  866



>ref|XP_009359613.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Pyrus x bretschneideri]
Length=942

 Score =   132 bits (332),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 56/102 (55%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F +VG EF ++G GFAF++ SPL+VD+STA+ +LS+NG+LQRIHDKWL+R  C
Sbjct  770  FLSSRCDFSVVGQEFTKTGWGFAFARDSPLAVDLSTALLKLSENGDLQRIHDKWLMRTPC  829

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
             SQ  +LQV++L LKSF  LF++CG AC  AL ++F + +++
Sbjct  830  ASQGAKLQVDRLQLKSFWGLFVICGAACFLALAIYFCMMLHQ  871



>ref|XP_009359612.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Pyrus x bretschneideri]
Length=946

 Score =   132 bits (332),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 56/102 (55%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F +VG EF ++G GFAF++ SPL+VD+STA+ +LS+NG+LQRIHDKWL+R  C
Sbjct  774  FLSSRCDFSVVGQEFTKTGWGFAFARDSPLAVDLSTALLKLSENGDLQRIHDKWLMRTPC  833

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
             SQ  +LQV++L LKSF  LF++CG AC  AL ++F + +++
Sbjct  834  ASQGAKLQVDRLQLKSFWGLFVICGAACFLALAIYFCMMLHQ  875



>emb|CDP07274.1| unnamed protein product [Coffea canephora]
Length=923

 Score =   132 bits (332),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 58/97 (60%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F IVG EF +SG GFAF + S L+VD+STAI  LS+NG+LQRIHDKWL +  C
Sbjct  758  FLSSQCKFRIVGQEFTKSGWGFAFPRDSALAVDLSTAILALSENGDLQRIHDKWLTKSTC  817

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             S N E+  ++LHLKSFS LFL+CG  C  ALL++F+
Sbjct  818  SSDNAEIDSDRLHLKSFSGLFLLCGITCFIALLIYFL  854



>gb|KCW70331.1| hypothetical protein EUGRSUZ_F03574 [Eucalyptus grandis]
Length=808

 Score =   131 bits (330),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 58/97 (60%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST C F IVG EF +SG GFAF + SPL+VD+STAI  LS+NG+LQRIHDKWL++ +C
Sbjct  630  FLSTQCSFRIVGPEFTKSGWGFAFPRDSPLAVDLSTAILALSENGDLQRIHDKWLMQTSC  689

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             S + E++ ++LHLKSF  LFL+CG AC  AL ++F+
Sbjct  690  LSDSAEIESDRLHLKSFWGLFLICGIACFVALFIYFL  726



>gb|KHG26328.1| Glutamate receptor 3.3 -like protein [Gossypium arboreum]
Length=909

 Score =   131 bits (330),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 56/97 (58%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C F IVG EF +SG GFAF + SPL++DMSTAI  L++NG+LQRIHDKWL++  C
Sbjct  754  FLSSQCSFKIVGQEFTKSGWGFAFPRDSPLAIDMSTAILALAENGDLQRIHDKWLMQSTC  813

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              ++TE++ NQL+L SF  LFL+CG AC+ AL ++F+
Sbjct  814  SLESTEIETNQLNLSSFWGLFLICGVACIIALFIYFL  850



>ref|XP_010063139.1| PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 3.3 [Eucalyptus 
grandis]
Length=940

 Score =   131 bits (330),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 58/97 (60%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST C F IVG EF +SG GFAF + SPL+VD+STAI  LS+NG+LQRIHDKWL++ +C
Sbjct  762  FLSTQCSFRIVGPEFTKSGWGFAFPRDSPLAVDLSTAILALSENGDLQRIHDKWLMQTSC  821

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             S + E++ ++LHLKSF  LFL+CG AC  AL ++F+
Sbjct  822  LSDSAEIESDRLHLKSFWGLFLICGIACFVALFIYFL  858



>ref|XP_008440927.1| PREDICTED: glutamate receptor 3.6 isoform X2 [Cucumis melo]
Length=900

 Score =   131 bits (329),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 58/96 (60%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST CE+ IVG EF ++G GFAF + SPL+VDMSTAI  LS+NG+LQRIHDKWL++ AC
Sbjct  723  FLSTRCEYSIVGQEFTKNGWGFAFPRDSPLAVDMSTAILRLSENGDLQRIHDKWLMKSAC  782

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
             SQ ++++V++L L SF  LFL+CG ACL AL ++ 
Sbjct  783  TSQASKIEVDRLQLNSFWGLFLICGCACLLALSIYL  818



>gb|ABO28526.1| glutamate receptor [Malus hupehensis]
Length=946

 Score =   131 bits (329),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 55/102 (54%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F +VG EF ++G GFAF++ SPL+VD+STA+ +LS+NG+LQRIHDKWL+R  C
Sbjct  765  FLSSRCDFSVVGQEFTKTGWGFAFARDSPLAVDLSTALLKLSENGDLQRIHDKWLMRTPC  824

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
             SQ  +LQV++L L+SF  LF++CG AC  AL ++F + +++
Sbjct  825  ASQGAKLQVDRLQLRSFWGLFVICGAACFLALAIYFCMMLHQ  866



>ref|XP_008440920.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Cucumis melo]
 ref|XP_008440921.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Cucumis melo]
 ref|XP_008440922.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Cucumis melo]
 ref|XP_008440924.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Cucumis melo]
 ref|XP_008440925.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Cucumis melo]
 ref|XP_008440926.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Cucumis melo]
Length=938

 Score =   131 bits (329),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 58/96 (60%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST CE+ IVG EF ++G GFAF + SPL+VDMSTAI  LS+NG+LQRIHDKWL++ AC
Sbjct  761  FLSTRCEYSIVGQEFTKNGWGFAFPRDSPLAVDMSTAILRLSENGDLQRIHDKWLMKSAC  820

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
             SQ ++++V++L L SF  LFL+CG ACL AL ++ 
Sbjct  821  TSQASKIEVDRLQLNSFWGLFLICGCACLLALSIYL  856



>ref|XP_003547880.2| PREDICTED: glutamate receptor 3.6-like [Glycine max]
Length=916

 Score =   130 bits (328),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 57/95 (60%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C++ IVG EF R+G GFAF + SPL+VD+STAI EL++NG+LQRIHDKWLL  AC
Sbjct  767  FLSSRCDYSIVGQEFTRNGWGFAFPRDSPLAVDLSTAILELAENGDLQRIHDKWLLSSAC  826

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLH  109
             SQ  +L+V++L+L+SF  L+L+CG AC+ ALL++
Sbjct  827  LSQGAKLEVDRLNLRSFWGLYLVCGLACVLALLIY  861



>gb|KDO85161.1| hypothetical protein CISIN_1g002309mg [Citrus sinensis]
 gb|KDO85162.1| hypothetical protein CISIN_1g002309mg [Citrus sinensis]
Length=930

 Score =   130 bits (327),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 56/97 (58%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C F IVG EF +SG GFAF + SPL+VD+S+AI EL++NG+LQRIHDKWL++ +C
Sbjct  753  FLSSQCSFRIVGQEFTKSGWGFAFPRDSPLAVDLSSAILELAENGDLQRIHDKWLMKSSC  812

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              +N EL+ ++LHL SF  LFL+CG AC  AL+++F+
Sbjct  813  SLENAELESDRLHLSSFWGLFLICGVACFIALVIYFL  849



>ref|XP_006473826.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Citrus sinensis]
 ref|XP_006473827.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Citrus sinensis]
Length=930

 Score =   130 bits (327),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 56/97 (58%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C F IVG EF +SG GFAF + SPL+VD+S+AI EL++NG+LQRIHDKWL++ +C
Sbjct  753  FLSSQCSFRIVGQEFTKSGWGFAFPRDSPLAVDLSSAILELAENGDLQRIHDKWLMKSSC  812

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              +N EL+ ++LHL SF  LFL+CG AC  AL+++F+
Sbjct  813  SLENAELESDRLHLSSFWGLFLICGVACFIALVIYFL  849



>gb|KDP36767.1| hypothetical protein JCGZ_08058 [Jatropha curcas]
Length=926

 Score =   130 bits (327),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 58/96 (60%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST C F IVG EF +SG GFAF + SPL+VDMSTAI EL++NG+LQRIHDKWL+   C
Sbjct  755  FLSTQCTFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILELTENGDLQRIHDKWLMHSGC  814

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
             S  +EL+ ++L LKSF  LFL+CG AC  +L ++F
Sbjct  815  SSDASELESDRLELKSFWGLFLICGIACFLSLFVYF  850



>gb|KDO85160.1| hypothetical protein CISIN_1g002309mg [Citrus sinensis]
Length=938

 Score =   130 bits (327),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 56/97 (58%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C F IVG EF +SG GFAF + SPL+VD+S+AI EL++NG+LQRIHDKWL++ +C
Sbjct  761  FLSSQCSFRIVGQEFTKSGWGFAFPRDSPLAVDLSSAILELAENGDLQRIHDKWLMKSSC  820

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              +N EL+ ++LHL SF  LFL+CG AC  AL+++F+
Sbjct  821  SLENAELESDRLHLSSFWGLFLICGVACFIALVIYFL  857



>ref|XP_011000874.1| PREDICTED: glutamate receptor 3.2 [Populus euphratica]
 ref|XP_011000875.1| PREDICTED: glutamate receptor 3.2 [Populus euphratica]
Length=928

 Score =   130 bits (327),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 58/96 (60%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS HCEF I+G EF RSG GFAF + SPL++DMS AI +LS+NGELQ+IH+KWL R  C
Sbjct  745  FLSEHCEFSIIGQEFTRSGWGFAFPRDSPLAIDMSNAILQLSENGELQKIHNKWLQRKLC  804

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
             SQ+     +QL L+SF  LFL+CG AC+ ALL++F
Sbjct  805  SSQDIGSSADQLQLQSFWGLFLICGIACILALLIYF  840



>ref|XP_010103244.1| Glutamate receptor 3.6 [Morus notabilis]
 gb|EXB95115.1| Glutamate receptor 3.6 [Morus notabilis]
Length=1034

 Score =   130 bits (327),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 59/97 (61%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST CEF IVG EF + G GFAF + SPL++DMSTAI +LS+NG LQRIHDKWL+RGAC
Sbjct  858  FLSTRCEFSIVGQEFTKMGWGFAFPRDSPLAIDMSTAILKLSENGILQRIHDKWLMRGAC  917

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             S+  +  V++L +KSF  LFL+ G AC  ALLL+ +
Sbjct  918  SSEGAKQDVDRLQIKSFWGLFLLSGLACFIALLLYLI  954



>ref|XP_006435401.1| hypothetical protein CICLE_v10000195mg [Citrus clementina]
 gb|ESR48641.1| hypothetical protein CICLE_v10000195mg [Citrus clementina]
Length=930

 Score =   130 bits (327),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 56/97 (58%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C F IVG EF +SG GFAF + SPL+VD+S+AI EL++NG+LQRIHDKWL++ +C
Sbjct  753  FLSSQCSFRIVGQEFTKSGWGFAFPRDSPLAVDLSSAILELAENGDLQRIHDKWLMKSSC  812

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              +N EL+ ++LHL SF  LFL+CG AC  AL+++F+
Sbjct  813  SLENAELESDRLHLSSFWGLFLICGVACFIALVVYFL  849



>gb|EYU41186.1| hypothetical protein MIMGU_mgv1a000937mg [Erythranthe guttata]
Length=938

 Score =   130 bits (326),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 57/102 (56%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FL++ C+F I+G EF +SG GFAF + SPL++D+STAI  LS+NG+LQRIHDKWL    C
Sbjct  760  FLASQCKFRIIGQEFTKSGWGFAFPRDSPLAIDLSTAILTLSENGDLQRIHDKWLTMSTC  819

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
             S NTEL+ ++LHLKSF  L+L+CG AC  ALL++     +R
Sbjct  820  SSDNTELESDRLHLKSFWGLYLLCGIACFIALLIYVFQIFHR  861



>emb|CBI21566.3| unnamed protein product [Vitis vinifera]
Length=936

 Score =   130 bits (326),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST CEF IVG EF +SG GFAF + SPL+VDMSTAI +LS+ G+LQRIHDKWL   AC
Sbjct  755  FLSTRCEFTIVGQEFTKSGWGFAFPRDSPLAVDMSTAILKLSETGDLQRIHDKWLKGSAC  814

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
            +SQ+ +L V++L L+SF  L+ +CG ACL AL ++ +L
Sbjct  815  RSQDAKLAVDRLQLRSFWGLYAICGLACLVALFIYAIL  852



>ref|XP_002276999.1| PREDICTED: glutamate receptor 3.6 [Vitis vinifera]
 ref|XP_010652906.1| PREDICTED: glutamate receptor 3.6 [Vitis vinifera]
Length=938

 Score =   130 bits (326),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST CEF IVG EF +SG GFAF + SPL+VDMSTAI +LS+ G+LQRIHDKWL   AC
Sbjct  757  FLSTRCEFTIVGQEFTKSGWGFAFPRDSPLAVDMSTAILKLSETGDLQRIHDKWLKGSAC  816

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
            +SQ+ +L V++L L+SF  L+ +CG ACL AL ++ +L
Sbjct  817  RSQDAKLAVDRLQLRSFWGLYAICGLACLVALFIYAIL  854



>ref|XP_007210370.1| hypothetical protein PRUPE_ppa001283mg [Prunus persica]
 gb|EMJ11569.1| hypothetical protein PRUPE_ppa001283mg [Prunus persica]
Length=863

 Score =   129 bits (325),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 55/97 (57%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F ++G EF +SG GFAF + SPL+VDMSTA+ +LS+NG+LQRI+DKWL + +C
Sbjct  683  FLSSQCKFRVIGQEFTKSGWGFAFPRDSPLAVDMSTALLQLSENGDLQRIYDKWLRQSSC  742

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              ++TEL+ ++LHLKSF  LFL+CG AC  AL ++F+
Sbjct  743  TLESTELESDRLHLKSFWGLFLICGIACFIALFIYFL  779



>ref|XP_010266354.1| PREDICTED: glutamate receptor 3.3-like [Nelumbo nucifera]
Length=758

 Score =   129 bits (324),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 58/97 (60%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F IVG EF R+G GFAF + SPL+VDMSTAI  LS+NGEL+RI +KWL R AC
Sbjct  580  FLSSRCKFTIVGQEFTRNGWGFAFQRDSPLAVDMSTAILALSENGELRRIREKWLRRSAC  639

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ   +  +QLHL+SF  LFL+CG AC+ +LL++F+
Sbjct  640  NSQGDGIGSDQLHLESFRGLFLICGLACIVSLLVYFI  676



>ref|XP_007046476.1| Glutamate receptor 3.4, putative isoform 3, partial [Theobroma 
cacao]
 gb|EOX90633.1| Glutamate receptor 3.4, putative isoform 3, partial [Theobroma 
cacao]
Length=762

 Score =   129 bits (324),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 60/96 (63%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST CEF IVGSEF + G GFAF + S L+VDMSTAI +LS+NG+LQRIH+KWL   AC
Sbjct  667  FLSTQCEFSIVGSEFSKMGWGFAFPRDSQLAVDMSTAILKLSENGDLQRIHNKWLKGIAC  726

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
            +SQ T+ +V++L L SF  LF++CGFACL ALL++ 
Sbjct  727  RSQGTKEEVDRLQLNSFWGLFVLCGFACLLALLVYL  762



>ref|XP_010923968.1| PREDICTED: glutamate receptor 3.4-like [Elaeis guineensis]
 ref|XP_010923969.1| PREDICTED: glutamate receptor 3.4-like [Elaeis guineensis]
Length=930

 Score =   129 bits (325),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 59/97 (61%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS HC+F  VG EF ++G GFAF + SPL+VD+STAI +LS+NG+LQRIHDKWL R  C
Sbjct  758  FLSNHCKFKTVGQEFTKNGWGFAFPRDSPLAVDLSTAILQLSENGDLQRIHDKWLTRNGC  817

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ+T +  N+L LKSF  LFL+ G ACL AL++ FM
Sbjct  818  TSQDTGVDSNRLSLKSFWGLFLISGIACLIALMVFFM  854



>ref|XP_007018099.1| Glutamate receptor 3.3 isoform 6 [Theobroma cacao]
 gb|EOY15324.1| Glutamate receptor 3.3 isoform 6 [Theobroma cacao]
Length=870

 Score =   129 bits (325),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 57/97 (59%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C F IVG EF +SG GFAF + SPL+VDMSTAI  L++NG+LQRI DKWLL+  C
Sbjct  691  FLSSQCTFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILALAENGDLQRIRDKWLLQSTC  750

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              ++TE++ N+LHL SF  LFL+CG AC  AL ++F+
Sbjct  751  SLESTEIESNRLHLSSFWGLFLICGIACFIALFIYFL  787



>ref|XP_007046474.1| Glutamate receptor isoform 1 [Theobroma cacao]
 gb|EOX90631.1| Glutamate receptor isoform 1 [Theobroma cacao]
Length=932

 Score =   129 bits (325),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 60/97 (62%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST CEF IVGSEF + G GFAF + S L+VDMSTAI +LS+NG+LQRIH+KWL   AC
Sbjct  759  FLSTQCEFSIVGSEFSKMGWGFAFPRDSQLAVDMSTAILKLSENGDLQRIHNKWLKGIAC  818

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
            +SQ T+ +V++L L SF  LF++CGFACL ALL++ +
Sbjct  819  RSQGTKEEVDRLQLNSFWGLFVLCGFACLLALLVYLV  855



>ref|XP_004500849.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Cicer arietinum]
Length=871

 Score =   129 bits (324),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 57/97 (59%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  C F IVG EF RSG GFAF + SPL+VD+STAI +LS+ G+LQRIHDKW+ R  C
Sbjct  703  FLSAQCTFRIVGQEFTRSGWGFAFPRDSPLAVDLSTAILQLSETGDLQRIHDKWMTRSTC  762

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
               NTE+  ++L LKSF  LF++CG AC  ALL++F+
Sbjct  763  SLDNTEIDSDRLQLKSFWGLFIICGLACFIALLIYFL  799



>ref|XP_009417233.1| PREDICTED: glutamate receptor 3.4-like [Musa acuminata subsp. 
malaccensis]
Length=931

 Score =   129 bits (324),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 58/97 (60%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS +C++  VG EF +SG GFAF + SPL+VD+STAI  LS+NG+LQRIHDKWL R  C
Sbjct  761  FLSNNCKYTTVGQEFTKSGWGFAFPRDSPLAVDLSTAILTLSENGDLQRIHDKWLARTGC  820

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ+ E+  N+L L SF  LFL+CG ACL AL++ FM
Sbjct  821  SSQDNEIDSNRLSLGSFWGLFLICGLACLLALIVFFM  857



>ref|XP_007018094.1| Glutamate receptor 3.3 isoform 1 [Theobroma cacao]
 ref|XP_007018095.1| Glutamate receptor 3.3 isoform 1 [Theobroma cacao]
 gb|EOY15319.1| Glutamate receptor 3.3 isoform 1 [Theobroma cacao]
 gb|EOY15320.1| Glutamate receptor 3.3 isoform 1 [Theobroma cacao]
Length=933

 Score =   129 bits (324),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 57/97 (59%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C F IVG EF +SG GFAF + SPL+VDMSTAI  L++NG+LQRI DKWLL+  C
Sbjct  754  FLSSQCTFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILALAENGDLQRIRDKWLLQSTC  813

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              ++TE++ N+LHL SF  LFL+CG AC  AL ++F+
Sbjct  814  SLESTEIESNRLHLSSFWGLFLICGIACFIALFIYFL  850



>ref|XP_009392853.1| PREDICTED: glutamate receptor 3.1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=915

 Score =   129 bits (324),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 59/98 (60%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C F IVGSEF +SG GF F + SPL+VDMSTAI  LS+NG+LQRIHDKWL R AC
Sbjct  754  FLSTNCNFAIVGSEFTKSGWGFVFPRDSPLAVDMSTAILTLSENGDLQRIHDKWLTRAAC  813

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             S+  E+   +L L SF  LFL+CG +C  ALL++ +L
Sbjct  814  ISETDEIDSQRLQLSSFWGLFLICGTSCFLALLIYLIL  851



>ref|XP_008373417.1| PREDICTED: glutamate receptor 3.3 [Malus domestica]
Length=959

 Score =   129 bits (324),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 57/97 (59%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F +VG EF +SG GFAF + SPL+VDMSTAI +LS+NG+LQRIHDKWL++ +C
Sbjct  783  FLSSQCKFRVVGPEFTKSGWGFAFPRDSPLAVDMSTAILQLSENGDLQRIHDKWLMQSSC  842

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
                TEL+ ++LHLKSF  LFL+CG AC  AL ++ +
Sbjct  843  SLDTTELESDRLHLKSFWGLFLICGIACSVALFIYLL  879



>ref|XP_003603849.1| Glutamate-gated kainate-type ion channel receptor subunit GluR5 
[Medicago truncatula]
 gb|AES74100.1| glutamate receptor 3.2 [Medicago truncatula]
Length=914

 Score =   129 bits (324),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 57/97 (59%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST C F IVG EF RSG GFAF + SPL+VD+STAI +LS+ G+LQRIHDKW+ R  C
Sbjct  752  FLSTQCTFRIVGQEFTRSGWGFAFPRDSPLAVDLSTAILQLSETGDLQRIHDKWMTRSTC  811

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
               NTE++ ++L LKSF  LF++CG AC  AL+++F+
Sbjct  812  SLDNTEIESDRLQLKSFWGLFIICGAACFIALVIYFL  848



>ref|XP_009392852.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009392854.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=941

 Score =   129 bits (324),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 59/98 (60%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C F IVGSEF +SG GF F + SPL+VDMSTAI  LS+NG+LQRIHDKWL R AC
Sbjct  780  FLSTNCNFAIVGSEFTKSGWGFVFPRDSPLAVDMSTAILTLSENGDLQRIHDKWLTRAAC  839

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             S+  E+   +L L SF  LFL+CG +C  ALL++ +L
Sbjct  840  ISETDEIDSQRLQLSSFWGLFLICGTSCFLALLIYLIL  877



>ref|XP_008237957.1| PREDICTED: glutamate receptor 3.3 [Prunus mume]
Length=945

 Score =   129 bits (323),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 55/97 (57%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F ++G EF +SG GFAF + SPL+VDMSTA+ +LS+NG+LQRI+DKWL + +C
Sbjct  765  FLSSQCKFRVIGQEFTKSGWGFAFPRDSPLAVDMSTALLQLSENGDLQRIYDKWLRQSSC  824

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              ++TEL+ ++LHLKSF  LFL+CG AC  AL ++F+
Sbjct  825  TLESTELESDRLHLKSFWGLFLICGIACFVALFIYFL  861



>ref|XP_007018096.1| Glutamate receptor 3.3 isoform 3 [Theobroma cacao]
 gb|EOY15321.1| Glutamate receptor 3.3 isoform 3 [Theobroma cacao]
Length=941

 Score =   129 bits (323),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 57/97 (59%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C F IVG EF +SG GFAF + SPL+VDMSTAI  L++NG+LQRI DKWLL+  C
Sbjct  762  FLSSQCTFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILALAENGDLQRIRDKWLLQSTC  821

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
              ++TE++ N+LHL SF  LFL+CG AC  AL ++F+
Sbjct  822  SLESTEIESNRLHLSSFWGLFLICGIACFIALFIYFL  858



>gb|KEH36346.1| glutamate receptor 3.2 [Medicago truncatula]
Length=959

 Score =   129 bits (323),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 57/97 (59%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST C F IVG EF RSG GFAF + SPL+VD+STAI +LS+ G+LQRIHDKW+ R  C
Sbjct  797  FLSTQCTFRIVGQEFTRSGWGFAFPRDSPLAVDLSTAILQLSETGDLQRIHDKWMTRSTC  856

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
               NTE++ ++L LKSF  LF++CG AC  AL+++F+
Sbjct  857  SLDNTEIESDRLQLKSFWGLFIICGAACFIALVIYFL  893



>emb|CDX73718.1| BnaC08g22850D [Brassica napus]
Length=891

 Score =   129 bits (323),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 59/102 (58%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  CEF IVG EF ++G GFAF ++SPL+VD+STAI +LS+NG+LQRI DKWLLR AC
Sbjct  740  FLSNRCEFGIVGQEFTKNGWGFAFPRNSPLAVDVSTAILQLSENGDLQRIRDKWLLRKAC  799

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
              Q  E++V++L LKSF  LF++CG AC+ AL ++ +L I +
Sbjct  800  SLQGAEIEVDRLELKSFWGLFVVCGLACVVALAVYIVLMIRK  841



>gb|EEE66428.1| hypothetical protein OsJ_22782 [Oryza sativa Japonica Group]
Length=205

 Score =   122 bits (305),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C+F  VG EF +SG GFAF + SPL+VD+STAI  LS+NG+LQRIHDKWL  G C
Sbjct  37   FLSTNCQFRTVGQEFTKSGWGFAFQRDSPLAVDLSTAILTLSENGDLQRIHDKWLSPGQC  96

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
             SQ T++  ++L+L SF  LFL+CG AC  ALL+ F
Sbjct  97   ASQGTDVGADRLNLSSFWGLFLICGVACFIALLIFF  132



>ref|XP_009369789.1| PREDICTED: glutamate receptor 3.6-like [Pyrus x bretschneideri]
 ref|XP_009369790.1| PREDICTED: glutamate receptor 3.6-like [Pyrus x bretschneideri]
 ref|XP_009369791.1| PREDICTED: glutamate receptor 3.6-like [Pyrus x bretschneideri]
 ref|XP_009369792.1| PREDICTED: glutamate receptor 3.6-like [Pyrus x bretschneideri]
Length=943

 Score =   129 bits (323),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 55/98 (56%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ CEF +VG EF ++G GFAF + SPL+VD+STA+ +LS+NG+LQRI+DKWL+R  C
Sbjct  763  FLSSRCEFSVVGQEFTKTGWGFAFPRDSPLAVDLSTALLKLSENGDLQRIYDKWLMRTPC  822

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             S   +LQV++L LKSF  LF++CG AC  AL ++F +
Sbjct  823  ASNGGKLQVDRLQLKSFGGLFIICGVACFLALAIYFCI  860



>ref|XP_008804484.1| PREDICTED: glutamate receptor 3.1-like isoform X2 [Phoenix dactylifera]
Length=916

 Score =   128 bits (322),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 57/98 (58%), Positives = 71/98 (72%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FL  +C+F I+GSEF +SG GF F + SPL+VD+STAI  LS+NG+LQRIHDKWL  G C
Sbjct  755  FLEANCKFSIIGSEFTKSGWGFIFPRDSPLAVDLSTAILSLSENGDLQRIHDKWLTTGTC  814

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             +   EL  ++LHL SF  LFL+CG AC  AL + FML
Sbjct  815  STATDELDSDRLHLNSFWGLFLICGVACFLALFIFFML  852



>ref|XP_008337223.1| PREDICTED: glutamate receptor 3.3-like [Malus domestica]
Length=634

 Score =   127 bits (319),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 54/98 (55%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FL++ CEF +VG EF ++G GFAF++ SPL+VD+STA  +LS+NG+LQRI+DKWL+R  C
Sbjct  454  FLASRCEFSVVGQEFTKTGWGFAFARDSPLAVDLSTAJLKLSENGDLQRIYDKWLMRTPC  513

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             S   +LQV++L LKSF  LF++CG AC  AL ++F +
Sbjct  514  ASNGGKLQVDRLQLKSFXGLFIICGAACXLALAIYFCI  551



>ref|XP_004500848.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Cicer arietinum]
Length=935

 Score =   128 bits (322),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 57/97 (59%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  C F IVG EF RSG GFAF + SPL+VD+STAI +LS+ G+LQRIHDKW+ R  C
Sbjct  767  FLSAQCTFRIVGQEFTRSGWGFAFPRDSPLAVDLSTAILQLSETGDLQRIHDKWMTRSTC  826

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
               NTE+  ++L LKSF  LF++CG AC  ALL++F+
Sbjct  827  SLDNTEIDSDRLQLKSFWGLFIICGLACFIALLIYFL  863



>ref|XP_002306435.2| hypothetical protein POPTR_0005s10560g [Populus trichocarpa]
 gb|EEE93431.2| hypothetical protein POPTR_0005s10560g [Populus trichocarpa]
Length=913

 Score =   128 bits (322),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 58/88 (66%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST C+F IVG EF +SG GFAF + SPL+VDMS AI +LS+ GELQRIHDKWL R AC
Sbjct  745  FLSTRCDFSIVGQEFSKSGWGFAFPRDSPLAVDMSAAILKLSEGGELQRIHDKWLQRSAC  804

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFAC  130
             S+  +  +N+LHLKSF  LFLMCG AC
Sbjct  805  SSEGAKESINRLHLKSFWGLFLMCGVAC  832



>ref|XP_009115836.1| PREDICTED: glutamate receptor 3.6 isoform X2 [Brassica rapa]
 emb|CDX78008.1| BnaA09g32030D [Brassica napus]
Length=891

 Score =   128 bits (322),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 58/102 (57%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  CEF IVG EF ++G GFAF ++SPL+VD+STAI +LS+NG+LQRI DKWLLR AC
Sbjct  740  FLSNRCEFGIVGQEFTKTGWGFAFPRNSPLAVDVSTAILQLSENGDLQRIRDKWLLRKAC  799

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
              Q  E++V++L LKSF  LF++CG AC+ AL ++ ++ I +
Sbjct  800  SLQGAEIEVDRLELKSFWGLFVVCGLACVVALAVYIVMMIRK  841



>ref|XP_008804475.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Phoenix dactylifera]
Length=932

 Score =   128 bits (322),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 57/98 (58%), Positives = 71/98 (72%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FL  +C+F I+GSEF +SG GF F + SPL+VD+STAI  LS+NG+LQRIHDKWL  G C
Sbjct  771  FLEANCKFSIIGSEFTKSGWGFIFPRDSPLAVDLSTAILSLSENGDLQRIHDKWLTTGTC  830

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             +   EL  ++LHL SF  LFL+CG AC  AL + FML
Sbjct  831  STATDELDSDRLHLNSFWGLFLICGVACFLALFIFFML  868



>ref|XP_006403911.1| hypothetical protein EUTSA_v10010111mg [Eutrema salsugineum]
 gb|ESQ45364.1| hypothetical protein EUTSA_v10010111mg [Eutrema salsugineum]
Length=896

 Score =   128 bits (322),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 59/100 (59%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  CEF IVG EF ++G GFAF ++SPL+VD+STAI +LS+NG+LQRI DKWLLR AC
Sbjct  743  FLSNRCEFGIVGQEFTKNGWGFAFPRNSPLAVDVSTAILQLSENGDLQRIRDKWLLRKAC  802

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGI  94
              Q  E++V++L LKSF  LF++CG AC+ AL ++ +L I
Sbjct  803  SLQGAEIEVDRLELKSFWGLFVVCGLACVLALAVYTVLMI  842



>ref|XP_007158022.1| hypothetical protein PHAVU_002G117500g [Phaseolus vulgaris]
 gb|ESW30016.1| hypothetical protein PHAVU_002G117500g [Phaseolus vulgaris]
Length=846

 Score =   128 bits (321),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 56/97 (58%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F +VG EF R+G GFAF + SPL+VDMSTAI ++ D+G+LQRIHDKWLL  AC
Sbjct  665  FLSSRCDFTVVGQEFTRNGWGFAFPRDSPLAVDMSTAILQMIDSGDLQRIHDKWLLSSAC  724

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ  +L+V +L LKSF  L+ +CG ACL AL ++ +
Sbjct  725  LSQGAKLEVERLQLKSFWGLYAICGLACLLALFMYLI  761



>ref|XP_004512282.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Cicer arietinum]
Length=915

 Score =   128 bits (322),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 61/106 (58%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ CEF +VG  F R+G GFAF + SPL+VD+STAI ++ DNG+LQRIHDKWLL  AC
Sbjct  724  FLSSRCEFTVVGQAFTRNGWGFAFPRDSPLAVDLSTAILQMVDNGDLQRIHDKWLLSRAC  783

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR*INK  76
             SQ  +L+V +L LKSF  L+ +CG ACL AL + F++ I R  NK
Sbjct  784  LSQGAKLEVEKLKLKSFWGLYAICGSACLLALFI-FLIQIIRQYNK  828



>ref|XP_009115834.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Brassica rapa]
 ref|XP_009115835.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Brassica rapa]
Length=940

 Score =   128 bits (322),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 58/102 (57%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  CEF IVG EF ++G GFAF ++SPL+VD+STAI +LS+NG+LQRI DKWLLR AC
Sbjct  789  FLSNRCEFGIVGQEFTKTGWGFAFPRNSPLAVDVSTAILQLSENGDLQRIRDKWLLRKAC  848

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
              Q  E++V++L LKSF  LF++CG AC+ AL ++ ++ I +
Sbjct  849  SLQGAEIEVDRLELKSFWGLFVVCGLACVVALAVYIVMMIRK  890



>ref|XP_004512281.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Cicer arietinum]
Length=943

 Score =   128 bits (322),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 61/106 (58%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ CEF +VG  F R+G GFAF + SPL+VD+STAI ++ DNG+LQRIHDKWLL  AC
Sbjct  752  FLSSRCEFTVVGQAFTRNGWGFAFPRDSPLAVDLSTAILQMVDNGDLQRIHDKWLLSRAC  811

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR*INK  76
             SQ  +L+V +L LKSF  L+ +CG ACL AL + F++ I R  NK
Sbjct  812  LSQGAKLEVEKLKLKSFWGLYAICGSACLLALFI-FLIQIIRQYNK  856



>gb|KGN48998.1| hypothetical protein Csa_6G509670 [Cucumis sativus]
Length=890

 Score =   128 bits (321),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 56/96 (58%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST CE+ IVG EF ++G GFAF + SPL+VDMSTAI  LS+ G+LQRIHDKWL++ AC
Sbjct  715  FLSTRCEYSIVGQEFTKNGWGFAFPRDSPLAVDMSTAILRLSETGDLQRIHDKWLMKSAC  774

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
             SQ ++++V++L L SF  LFL+CG AC+ AL ++ 
Sbjct  775  TSQASKIEVDRLQLNSFWGLFLICGVACVLALSIYL  810



>ref|XP_004134824.1| PREDICTED: glutamate receptor 3.6-like [Cucumis sativus]
Length=932

 Score =   128 bits (321),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 56/96 (58%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST CE+ IVG EF ++G GFAF + SPL+VDMSTAI  LS+ G+LQRIHDKWL++ AC
Sbjct  757  FLSTRCEYSIVGQEFTKNGWGFAFPRDSPLAVDMSTAILRLSETGDLQRIHDKWLMKSAC  816

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
             SQ ++++V++L L SF  LFL+CG AC+ AL ++ 
Sbjct  817  TSQASKIEVDRLQLNSFWGLFLICGVACVLALSIYL  852



>ref|XP_004158839.1| PREDICTED: glutamate receptor 3.6-like [Cucumis sativus]
Length=943

 Score =   128 bits (321),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 56/96 (58%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST CE+ IVG EF ++G GFAF + SPL+VDMSTAI  LS+ G+LQRIHDKWL++ AC
Sbjct  757  FLSTRCEYSIVGQEFTKNGWGFAFPRDSPLAVDMSTAILRLSETGDLQRIHDKWLMKSAC  816

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
             SQ ++++V++L L SF  LFL+CG AC+ AL ++ 
Sbjct  817  TSQASKIEVDRLQLNSFWGLFLICGVACVLALSIYL  852



>ref|XP_007158020.1| hypothetical protein PHAVU_002G117500g [Phaseolus vulgaris]
 gb|ESW30014.1| hypothetical protein PHAVU_002G117500g [Phaseolus vulgaris]
Length=939

 Score =   128 bits (321),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 56/97 (58%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F +VG EF R+G GFAF + SPL+VDMSTAI ++ D+G+LQRIHDKWLL  AC
Sbjct  758  FLSSRCDFTVVGQEFTRNGWGFAFPRDSPLAVDMSTAILQMIDSGDLQRIHDKWLLSSAC  817

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ  +L+V +L LKSF  L+ +CG ACL AL ++ +
Sbjct  818  LSQGAKLEVERLQLKSFWGLYAICGLACLLALFMYLI  854



>ref|XP_007158021.1| hypothetical protein PHAVU_002G117500g [Phaseolus vulgaris]
 gb|ESW30015.1| hypothetical protein PHAVU_002G117500g [Phaseolus vulgaris]
Length=948

 Score =   128 bits (321),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 56/97 (58%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F +VG EF R+G GFAF + SPL+VDMSTAI ++ D+G+LQRIHDKWLL  AC
Sbjct  767  FLSSRCDFTVVGQEFTRNGWGFAFPRDSPLAVDMSTAILQMIDSGDLQRIHDKWLLSSAC  826

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ  +L+V +L LKSF  L+ +CG ACL AL ++ +
Sbjct  827  LSQGAKLEVERLQLKSFWGLYAICGLACLLALFMYLI  863



>ref|XP_010686867.1| PREDICTED: glutamate receptor 3.3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010686871.1| PREDICTED: glutamate receptor 3.3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010686877.1| PREDICTED: glutamate receptor 3.3 [Beta vulgaris subsp. vulgaris]
Length=931

 Score =   127 bits (320),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 58/96 (60%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F IVG EF RSG GFAF + SPL+ DMSTAI +LS+NG+LQRIHDKWL   +C
Sbjct  750  FLSSQCDFRIVGPEFTRSGWGFAFPRDSPLAPDMSTAILKLSENGDLQRIHDKWLTMSSC  809

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
               NTE++ +QLHL SF  LFL+ G AC+ AL ++F
Sbjct  810  SQDNTEIESSQLHLGSFVGLFLLSGIACIIALCIYF  845



>ref|XP_009372603.1| PREDICTED: glutamate receptor 3.3-like [Pyrus x bretschneideri]
Length=936

 Score =   127 bits (320),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 56/97 (58%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F +VG EF +SG GFAF + SPL+VDMSTAI +LS+NG+LQRIHDKWL++ +C
Sbjct  760  FLSSQCKFRVVGPEFTKSGWGFAFPRDSPLAVDMSTAILQLSENGDLQRIHDKWLMQSSC  819

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
                TEL+ ++LHLKSF  LFL+CG AC  +L ++ +
Sbjct  820  GLDTTELESDRLHLKSFWGLFLICGIACSVSLFIYLL  856



>ref|XP_010270511.1| PREDICTED: glutamate receptor 3.3-like isoform X4 [Nelumbo nucifera]
Length=774

 Score =   126 bits (317),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 59/102 (58%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLSTHC+F IVG  F +SG GFAF + SPL+VD+STAI  LS+NG+LQRI+DKWL R  C
Sbjct  599  FLSTHCKFRIVGQPFTKSGWGFAFRRDSPLAVDLSTAILRLSENGDLQRIYDKWLKRSIC  658

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
                TE + N+LHLKSF  LF+MCG A   AL+++ +L I +
Sbjct  659  SLVVTEFEANRLHLKSFRGLFIMCGLAFFLALVIYCLLIIRK  700



>ref|XP_011034843.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Populus euphratica]
Length=951

 Score =   127 bits (318),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 55/97 (57%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FL+  C F IVG EF +SG GFAF   SPL+VDMSTAI  LS+NG+LQRIHDKWL++  C
Sbjct  775  FLAGQCTFRIVGREFTKSGWGFAFPSDSPLAVDMSTAILALSENGDLQRIHDKWLMQSTC  834

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             S  +EL+ ++L+L+SF  LFL+CG AC  +L++H +
Sbjct  835  SSDTSELEADKLYLRSFWGLFLLCGLACFISLVIHVL  871



>ref|XP_010270510.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Nelumbo nucifera]
Length=852

 Score =   126 bits (317),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 59/102 (58%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLSTHC+F IVG  F +SG GFAF + SPL+VD+STAI  LS+NG+LQRI+DKWL R  C
Sbjct  677  FLSTHCKFRIVGQPFTKSGWGFAFRRDSPLAVDLSTAILRLSENGDLQRIYDKWLKRSIC  736

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
                TE + N+LHLKSF  LF+MCG A   AL+++ +L I +
Sbjct  737  SLVVTEFEANRLHLKSFRGLFIMCGLAFFLALVIYCLLIIRK  778



>ref|XP_011034844.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Populus euphratica]
 ref|XP_011034845.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Populus euphratica]
Length=931

 Score =   127 bits (318),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 55/97 (57%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FL+  C F IVG EF +SG GFAF   SPL+VDMSTAI  LS+NG+LQRIHDKWL++  C
Sbjct  755  FLAGQCTFRIVGREFTKSGWGFAFPSDSPLAVDMSTAILALSENGDLQRIHDKWLMQSTC  814

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             S  +EL+ ++L+L+SF  LFL+CG AC  +L++H +
Sbjct  815  SSDTSELEADKLYLRSFWGLFLLCGLACFISLVIHVL  851



>gb|KEH27628.1| glutamate receptor 3.2 [Medicago truncatula]
Length=951

 Score =   127 bits (318),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 55/97 (57%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FL++ C+F IVG EF R+G GF F + SPL++D+STAI ++ DNG+LQRIHDKWLL  AC
Sbjct  758  FLASRCKFTIVGQEFTRNGWGFGFPRDSPLAIDLSTAILQMVDNGDLQRIHDKWLLSRAC  817

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             +Q  +L+V +L LKSF  L+++CG ACL ALL++F+
Sbjct  818  LTQGAKLEVQRLKLKSFWGLYVICGSACLVALLIYFI  854



>ref|XP_003612376.1| Glutamate receptor 3.6 [Medicago truncatula]
 gb|AES95334.1| glutamate receptor 3.2 [Medicago truncatula]
Length=983

 Score =   127 bits (318),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 55/97 (57%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FL++ C+F IVG EF R+G GF F + SPL++D+STAI ++ DNG+LQRIHDKWLL  AC
Sbjct  790  FLASRCKFTIVGQEFTRNGWGFGFPRDSPLAIDLSTAILQMVDNGDLQRIHDKWLLSRAC  849

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             +Q  +L+V +L LKSF  L+++CG ACL ALL++F+
Sbjct  850  LTQGAKLEVQRLKLKSFWGLYVICGSACLVALLIYFI  886



>ref|XP_010270508.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Nelumbo nucifera]
Length=897

 Score =   126 bits (317),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 59/102 (58%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLSTHC+F IVG  F +SG GFAF + SPL+VD+STAI  LS+NG+LQRI+DKWL R  C
Sbjct  722  FLSTHCKFRIVGQPFTKSGWGFAFRRDSPLAVDLSTAILRLSENGDLQRIYDKWLKRSIC  781

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
                TE + N+LHLKSF  LF+MCG A   AL+++ +L I +
Sbjct  782  SLVVTEFEANRLHLKSFRGLFIMCGLAFFLALVIYCLLIIRK  823



>gb|EAZ02474.1| hypothetical protein OsI_24580 [Oryza sativa Indica Group]
Length=951

 Score =   126 bits (317),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 58/96 (60%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C+F  VG EF +SG GFAF + SPL+VD+STAI  LS+NG+LQRIHDKWL  G C
Sbjct  753  FLSTNCQFRTVGQEFTKSGWGFAFQRDSPLAVDLSTAILTLSENGDLQRIHDKWLSPGQC  812

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
             SQ T++  ++L+L SF  LFL+CG AC  ALL+ F
Sbjct  813  ASQGTDVGADRLNLSSFWGLFLICGVACFIALLIFF  848



>dbj|BAC10393.1| glutamate receptor, ionotropic kainate 5 precursor-like protein 
[Oryza sativa Japonica Group]
Length=955

 Score =   126 bits (317),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 58/96 (60%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C+F  VG EF +SG GFAF + SPL+VD+STAI  LS+NG+LQRIHDKWL  G C
Sbjct  752  FLSTNCQFRTVGQEFTKSGWGFAFQRDSPLAVDLSTAILTLSENGDLQRIHDKWLSPGQC  811

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
             SQ T++  ++L+L SF  LFL+CG AC  ALL+ F
Sbjct  812  ASQGTDVGADRLNLSSFWGLFLICGVACFIALLIFF  847



>ref|NP_001058687.1| Os07g0103100 [Oryza sativa Japonica Group]
 dbj|BAF20601.1| Os07g0103100 [Oryza sativa Japonica Group]
 gb|EAZ38406.1| hypothetical protein OsJ_22783 [Oryza sativa Japonica Group]
Length=956

 Score =   126 bits (317),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 58/96 (60%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C+F  VG EF +SG GFAF + SPL+VD+STAI  LS+NG+LQRIHDKWL  G C
Sbjct  753  FLSTNCQFRTVGQEFTKSGWGFAFQRDSPLAVDLSTAILTLSENGDLQRIHDKWLSPGQC  812

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
             SQ T++  ++L+L SF  LFL+CG AC  ALL+ F
Sbjct  813  ASQGTDVGADRLNLSSFWGLFLICGVACFIALLIFF  848



>ref|XP_010270507.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Nelumbo nucifera]
Length=938

 Score =   126 bits (317),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 59/102 (58%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLSTHC+F IVG  F +SG GFAF + SPL+VD+STAI  LS+NG+LQRI+DKWL R  C
Sbjct  763  FLSTHCKFRIVGQPFTKSGWGFAFRRDSPLAVDLSTAILRLSENGDLQRIYDKWLKRSIC  822

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
                TE + N+LHLKSF  LF+MCG A   AL+++ +L I +
Sbjct  823  SLVVTEFEANRLHLKSFRGLFIMCGLAFFLALVIYCLLIIRK  864



>ref|XP_011034842.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Populus euphratica]
Length=969

 Score =   126 bits (317),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 55/97 (57%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FL+  C F IVG EF +SG GFAF   SPL+VDMSTAI  LS+NG+LQRIHDKWL++  C
Sbjct  793  FLAGQCTFRIVGREFTKSGWGFAFPSDSPLAVDMSTAILALSENGDLQRIHDKWLMQSTC  852

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             S  +EL+ ++L+L+SF  LFL+CG AC  +L++H +
Sbjct  853  SSDTSELEADKLYLRSFWGLFLLCGLACFISLVIHVL  889



>gb|AFK41266.1| unknown [Lotus japonicus]
Length=225

 Score =   120 bits (300),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST C+F ++G EF R+G GFAF + SPL++DMSTAI EL++NG+LQRIHDKWLLR AC
Sbjct  43   FLSTRCDFSVIGQEFTRNGWGFAFPRDSPLALDMSTAILELAENGDLQRIHDKWLLRRAC  102

Query  213  KSQNTELQVNQLHLKSFSMLFLMCG  139
             SQ  +L+V++L+L+SF  L+L+CG
Sbjct  103  LSQGAKLEVDRLNLRSFWGLYLVCG  127



>ref|XP_008453000.1| PREDICTED: glutamate receptor 3.3 isoform X2 [Cucumis melo]
Length=833

 Score =   125 bits (315),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 55/95 (58%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  C F +VG EF +SG GFAF + SPL+VD+STAI +LS+NG+LQRIHDKWL++ AC
Sbjct  670  FLSRQCSFRVVGQEFTKSGWGFAFPRDSPLAVDLSTAILQLSENGDLQRIHDKWLVKSAC  729

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLH  109
              +N EL+ ++L LKSF  LFL+CG  C  AL ++
Sbjct  730  TMENAELESDRLQLKSFWGLFLICGIVCFIALAIY  764



>ref|XP_006646788.1| PREDICTED: glutamate receptor 3.1-like [Oryza brachyantha]
Length=937

 Score =   125 bits (315),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 57/103 (55%), Positives = 75/103 (73%), Gaps = 1/103 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C   + GS+F   G GFAF + SPL +D+STAI  LS+NGELQRIHDKWL  G C
Sbjct  756  FLSTYCRIAVAGSDFTSRGWGFAFPRDSPLQIDLSTAILSLSENGELQRIHDKWLKTGEC  815

Query  213  KSQNTE-LQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
             + NTE +  NQL L+SF  LFL+CG AC+ ALL++F++ + +
Sbjct  816  TADNTEFVDSNQLRLESFWGLFLICGVACVIALLIYFIIAVRK  858



>ref|XP_010918356.1| PREDICTED: glutamate receptor 3.1 [Elaeis guineensis]
 ref|XP_010918357.1| PREDICTED: glutamate receptor 3.1 [Elaeis guineensis]
Length=922

 Score =   125 bits (315),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 57/98 (58%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  C F IVGS+F R+G GFAF + S L+VD+STAI  LS+NG+LQRIH+KWL R AC
Sbjct  755  FLSMQCRFAIVGSQFTRNGWGFAFPRDSALAVDLSTAILTLSENGDLQRIHNKWLTRSAC  814

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             SQ+ +L+ +QL L SF  LFL+CG AC  +L+++F L
Sbjct  815  SSQSIDLESDQLDLGSFWGLFLICGMACTVSLIIYFFL  852



>ref|XP_006292183.1| hypothetical protein CARUB_v10018389mg [Capsella rubella]
 gb|EOA25081.1| hypothetical protein CARUB_v10018389mg [Capsella rubella]
Length=903

 Score =   125 bits (314),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 57/100 (57%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  CEF IVG EF ++G GFAF ++SPL+VD+S AI +LS+NG++QRI DKWLLR AC
Sbjct  743  FLSNRCEFGIVGQEFTKNGWGFAFPRNSPLAVDVSAAILQLSENGDMQRIRDKWLLRKAC  802

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGI  94
              Q  E++V++L LKSF  LF++CG AC+ AL ++ +L I
Sbjct  803  SLQGAEIEVDRLELKSFWGLFVVCGVACILALAVYTVLMI  842



>ref|XP_008452999.1| PREDICTED: glutamate receptor 3.3 isoform X1 [Cucumis melo]
Length=918

 Score =   125 bits (314),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 55/95 (58%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  C F +VG EF +SG GFAF + SPL+VD+STAI +LS+NG+LQRIHDKWL++ AC
Sbjct  755  FLSRQCSFRVVGQEFTKSGWGFAFPRDSPLAVDLSTAILQLSENGDLQRIHDKWLVKSAC  814

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLH  109
              +N EL+ ++L LKSF  LFL+CG  C  AL ++
Sbjct  815  TMENAELESDRLQLKSFWGLFLICGIVCFIALAIY  849



>ref|XP_010503841.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
 ref|XP_010503842.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
 ref|XP_010503843.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
Length=903

 Score =   125 bits (314),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 57/100 (57%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  CEF IVG EF ++G GFAF ++SPL+VD+S AI +LS+NG++QRI DKWLLR AC
Sbjct  743  FLSNRCEFGIVGKEFTKNGWGFAFPRNSPLAVDVSAAILQLSENGDMQRIRDKWLLRKAC  802

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGI  94
              Q  E++V++L LKSF  LF++CG AC+ AL ++ +L I
Sbjct  803  SLQGAEIEVDRLELKSFWGLFVVCGVACILALAVYTVLMI  842



>ref|XP_002301908.2| Glutamate receptor 3.3 precursor family protein [Populus trichocarpa]
 gb|EEE81181.2| Glutamate receptor 3.3 precursor family protein [Populus trichocarpa]
Length=931

 Score =   125 bits (314),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 54/97 (56%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FL+  C F IVG EF +SG GFAF + SPL+VDMSTAI  LS+NG+LQRIHDKWL++  C
Sbjct  755  FLAGQCTFRIVGREFTKSGWGFAFPRDSPLAVDMSTAILALSENGDLQRIHDKWLMQSTC  814

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             S  +EL+ ++L+L+SF  LFL+CG AC  +L+++ +
Sbjct  815  SSDTSELEADKLYLRSFWGLFLLCGLACFISLVIYVL  851



>ref|XP_008392995.1| PREDICTED: glutamate receptor 3.6-like [Malus domestica]
Length=832

 Score =   125 bits (313),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 54/98 (55%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FL++ CEF +VG EF ++G GFAF + SPL+VD+STAI +LS+NG+LQRI+DKWL+R  C
Sbjct  652  FLASRCEFSVVGQEFTKTGWGFAFPRDSPLAVDLSTAILKLSENGDLQRIYDKWLIRTPC  711

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             S    LQV++L +KSF  LF++CG AC  AL ++F +
Sbjct  712  ASNGGTLQVDRLKVKSFRGLFIICGAACFLALAIYFCI  749



>ref|XP_010426704.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Camelina sativa]
 ref|XP_010426705.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Camelina sativa]
Length=903

 Score =   125 bits (313),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 57/100 (57%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  CEF IVG EF ++G GFAF ++SPL+VD+S AI +LS+NG++QRI DKWLLR AC
Sbjct  743  FLSNRCEFGIVGQEFTKNGWGFAFPRNSPLAVDVSAAILQLSENGDMQRIRDKWLLRKAC  802

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGI  94
              Q  E++V++L LKSF  LF++CG AC+ AL ++ +L I
Sbjct  803  SLQGAEIEVDRLELKSFWGLFVVCGVACVLALAVYTVLMI  842



>ref|NP_190716.3| glutamate receptor 3.6 [Arabidopsis thaliana]
 sp|Q84W41.1|GLR36_ARATH RecName: Full=Glutamate receptor 3.6; AltName: Full=Ligand-gated 
ion channel 3.6; Flags: Precursor [Arabidopsis thaliana]
 gb|AAO42266.1| putative glutamate receptor [Arabidopsis thaliana]
 gb|AEE78797.1| glutamate receptor 3.6 [Arabidopsis thaliana]
Length=903

 Score =   125 bits (313),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 57/100 (57%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  CEF IVG EF ++G GFAF ++SPL+VD+S AI +LS+NG++QRI DKWLLR AC
Sbjct  743  FLSNRCEFGIVGQEFTKNGWGFAFPRNSPLAVDVSAAILQLSENGDMQRIRDKWLLRKAC  802

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGI  94
              Q  E++V++L LKSF  LF++CG AC+ AL ++ +L I
Sbjct  803  SLQGAEIEVDRLELKSFWGLFVVCGVACVLALAVYTVLMI  842



>ref|XP_002876089.1| ATGLR3.6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52348.1| ATGLR3.6 [Arabidopsis lyrata subsp. lyrata]
Length=903

 Score =   125 bits (313),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 57/100 (57%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  CEF IVG EF ++G GFAF ++SPL+VD+S AI +LS+NG++QRI DKWLLR AC
Sbjct  743  FLSNRCEFGIVGQEFTKNGWGFAFPRNSPLAVDVSAAILQLSENGDMQRIRDKWLLRKAC  802

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGI  94
              Q  E++V++L LKSF  LF++CG AC+ AL ++ +L I
Sbjct  803  SLQGAEIEVDRLELKSFWGLFVVCGVACVLALAVYTVLMI  842



>ref|XP_010515556.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
 ref|XP_010515557.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
Length=903

 Score =   125 bits (313),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 57/100 (57%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  CEF IVG EF ++G GFAF ++SPL+VD+S AI +LS+NG++QRI DKWLLR AC
Sbjct  743  FLSNRCEFGIVGKEFTKNGWGFAFPRNSPLAVDVSAAILQLSENGDMQRIRDKWLLRKAC  802

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGI  94
              Q  E++V++L LKSF  LF++CG AC+ AL ++ +L I
Sbjct  803  SLQGAEIEVDRLELKSFWGLFVVCGVACVLALAVYTVLMI  842



>emb|CAB63012.1| putative glutamate receptor [Arabidopsis thaliana]
Length=1039

 Score =   125 bits (313),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 57/100 (57%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  CEF IVG EF ++G GFAF ++SPL+VD+S AI +LS+NG++QRI DKWLLR AC
Sbjct  879  FLSNRCEFGIVGQEFTKNGWGFAFPRNSPLAVDVSAAILQLSENGDMQRIRDKWLLRKAC  938

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGI  94
              Q  E++V++L LKSF  LF++CG AC+ AL ++ +L I
Sbjct  939  SLQGAEIEVDRLELKSFWGLFVVCGVACVLALAVYTVLMI  978



>ref|XP_007043075.1| Glutamate receptor 2 isoform 1 [Theobroma cacao]
 gb|EOX98906.1| Glutamate receptor 2 isoform 1 [Theobroma cacao]
Length=944

 Score =   124 bits (312),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 60/98 (61%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS HC+F I G EF +SG GFAF K SPL++DMSTAI  LS+NGELQ+IHD+WL R AC
Sbjct  761  FLSDHCKFSIRGQEFTKSGWGFAFPKDSPLAIDMSTAILALSENGELQKIHDRWLSRKAC  820

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             S ++E +  QL L+SF  LFL+CG AC+ ALL++F L
Sbjct  821  SSDSSEAESEQLDLQSFWGLFLICGIACVLALLMYFSL  858



>gb|KHG05232.1| Glutamate receptor 3.2 -like protein [Gossypium arboreum]
Length=905

 Score =   124 bits (312),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 57/98 (58%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  CEF I G EF +   GFAF + SPL++DMSTAI  LS+NGELQ+IHDKWL R AC
Sbjct  753  FLSDRCEFSIRGQEFSKRAWGFAFPRDSPLAIDMSTAILALSENGELQKIHDKWLSRSAC  812

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             S+ +E +  QL L+SF  LFL+CG AC+ ALL++ +L
Sbjct  813  SSEKSEDEAEQLDLQSFWGLFLICGIACILALLVYSLL  850



>ref|XP_007043076.1| Glutamate receptor 2 isoform 2 [Theobroma cacao]
 gb|EOX98907.1| Glutamate receptor 2 isoform 2 [Theobroma cacao]
Length=940

 Score =   124 bits (312),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 60/98 (61%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS HC+F I G EF +SG GFAF K SPL++DMSTAI  LS+NGELQ+IHD+WL R AC
Sbjct  757  FLSDHCKFSIRGQEFTKSGWGFAFPKDSPLAIDMSTAILALSENGELQKIHDRWLSRKAC  816

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             S ++E +  QL L+SF  LFL+CG AC+ ALL++F L
Sbjct  817  SSDSSEAESEQLDLQSFWGLFLICGIACVLALLMYFSL  854



>gb|KHN35947.1| Glutamate receptor 3.6 [Glycine soja]
Length=938

 Score =   124 bits (312),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 54/102 (53%), Positives = 77/102 (75%), Gaps = 1/102 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+  ++G EF R+G GFAF + SPL+VD+STAI ++ D+G+LQRIHDKWLL  AC
Sbjct  758  FLSSRCDLTVIGQEFTRNGWGFAFPRDSPLAVDLSTAILQMIDSGDLQRIHDKWLLSSAC  817

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
             SQ  + +V +L LKSF  L+++CG ACL AL + +++ I+R
Sbjct  818  LSQGAKFEVERLQLKSFWGLYMICGLACLLALFI-YLIQIWR  858



>ref|XP_003517130.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Glycine max]
 ref|XP_006573518.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Glycine max]
Length=938

 Score =   124 bits (312),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 54/102 (53%), Positives = 77/102 (75%), Gaps = 1/102 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+  ++G EF R+G GFAF + SPL+VD+STAI ++ D+G+LQRIHDKWLL  AC
Sbjct  758  FLSSRCDLTVIGQEFTRNGWGFAFPRDSPLAVDLSTAILQMIDSGDLQRIHDKWLLSSAC  817

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
             SQ  + +V +L LKSF  L+++CG ACL AL + +++ I+R
Sbjct  818  LSQGAKFEVERLQLKSFWGLYMICGLACLLALFI-YLIQIWR  858



>ref|XP_009608800.1| PREDICTED: glutamate receptor 3.2-like [Nicotiana tomentosiformis]
Length=903

 Score =   124 bits (311),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 58/96 (60%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C F  VG EF +SG GFAF + SPL++DMSTAI +LS+NGEL++IH KWL R  C
Sbjct  746  FLSTYCGFQKVGPEFTKSGWGFAFPRDSPLAIDMSTAILQLSENGELEKIHKKWLNRKVC  805

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
              QN+E    QL LKSF  LFL+CG  C FALL++F
Sbjct  806  GGQNSEADSEQLQLKSFWGLFLICGVTCCFALLVYF  841



>ref|XP_008344238.1| PREDICTED: glutamate receptor 3.6-like [Malus domestica]
Length=406

 Score =   121 bits (303),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 53/98 (54%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FL++ CEF +VG EF ++G GFAF + SPL+VD+STA  +LS+NG+LQRI+DKWL R  C
Sbjct  226  FLASRCEFSVVGQEFTKTGWGFAFXRDSPLAVDLSTAJLKLSENGDLQRIYDKWLXRTPC  285

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             S    LQV++L  KSF  LF++CG AC  AL ++F +
Sbjct  286  ASNGGXLQVDRLXXKSFXGLFIICGAACXLALAIYFCI  323



>gb|KDP43779.1| hypothetical protein JCGZ_22406 [Jatropha curcas]
Length=860

 Score =   124 bits (310),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 56/97 (58%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS++CEF IVG EF R+G GFAF + SPL+ DMS+AI  LS++G+LQRI DKWL R AC
Sbjct  686  FLSSNCEFSIVGQEFGRNGWGFAFPRDSPLAADMSSAILTLSESGDLQRIRDKWLSRRAC  745

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             S++   + N+LHL+SF  LFL+CG ACL A +L+ +
Sbjct  746  NSEDASGEANRLHLESFWGLFLICGTACLLAFILYLV  782



>ref|XP_004145549.1| PREDICTED: glutamate receptor 3.3-like [Cucumis sativus]
 ref|XP_004157067.1| PREDICTED: glutamate receptor 3.3-like [Cucumis sativus]
 gb|KGN55521.1| hypothetical protein Csa_4G664290 [Cucumis sativus]
Length=918

 Score =   123 bits (309),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 54/95 (57%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  C F +VG EF +SG GFAF + SPL++D+STAI +LS+NG+LQRIHDKWL + AC
Sbjct  755  FLSRQCSFRVVGQEFTKSGWGFAFPRDSPLAIDLSTAILQLSENGDLQRIHDKWLAKSAC  814

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLH  109
              +N EL+ ++L LKSF  LFL+CG  C  AL ++
Sbjct  815  TMENAELESDRLQLKSFWGLFLICGIVCFIALAIY  849



>ref|XP_008337216.1| PREDICTED: glutamate receptor 3.3-like [Malus domestica]
Length=406

 Score =   120 bits (302),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 53/98 (54%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FL++ CEF +VG EF ++G GFAF + SPL+VD+STA  +LS+NG+LQRI+DKWL R  C
Sbjct  226  FLASRCEFSVVGQEFTKTGWGFAFXRDSPLAVDLSTAJLKLSENGDLQRIYDKWLXRTPC  285

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             S    LQV++L  KSF  LF++CG AC  AL ++F +
Sbjct  286  ASNGGXLQVDRLXXKSFRGLFIICGAACXLALAIYFCI  323



>ref|XP_002459199.1| hypothetical protein SORBIDRAFT_02g000430 [Sorghum bicolor]
 gb|EER95720.1| hypothetical protein SORBIDRAFT_02g000430 [Sorghum bicolor]
Length=973

 Score =   123 bits (309),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 58/97 (60%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C+F  VG EF +SG GFAF + SPL+VD+STAI  LS+NG+LQRIHDKWL  G C
Sbjct  788  FLSTNCQFRTVGQEFTKSGWGFAFQRDSPLAVDLSTAILTLSENGDLQRIHDKWLNPGTC  847

Query  213  KSQNTE-LQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
             SQ+T+ +  ++L+L SF  LFL+CG AC  ALL++F
Sbjct  848  ASQSTDSVGADRLNLSSFWGLFLICGVACFIALLIYF  884



>ref|XP_008354606.1| PREDICTED: glutamate receptor 3.6-like [Malus domestica]
Length=446

 Score =   120 bits (302),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 53/98 (54%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FL++ CEF +VG EF ++G GFAF + SPL+VD+STA  +LS+NG+LQRI+DKWL R  C
Sbjct  266  FLASRCEFSVVGQEFTKTGWGFAFXRDSPLAVDLSTAJLKLSENGDLQRIYDKWLXRTPC  325

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             S    LQV++L  KSF  LF++CG AC  AL ++F +
Sbjct  326  ASNGGXLQVDRLXXKSFXGLFIICGAACXLALAIYFCI  363



>gb|KHN46864.1| Glutamate receptor 3.2 [Glycine soja]
Length=809

 Score =   123 bits (308),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 61/106 (58%), Positives = 74/106 (70%), Gaps = 3/106 (3%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS HC+F I G EF +SG GFAF + SPL++DMSTAI  LS+NGELQRIH+KWL   AC
Sbjct  643  FLSNHCQFSIRGQEFTKSGWGFAFPRDSPLAIDMSTAILTLSENGELQRIHEKWLSEKAC  702

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR*INK  76
               +TE +  QL L SF  LFL+CG  C  ALL++F L + R  NK
Sbjct  703  GFHSTEDE--QLKLNSFRGLFLICGITCFLALLIYF-LSMVRQFNK  745



>ref|XP_007203997.1| hypothetical protein PRUPE_ppa001054mg [Prunus persica]
 gb|EMJ05196.1| hypothetical protein PRUPE_ppa001054mg [Prunus persica]
Length=922

 Score =   123 bits (308),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 56/105 (53%), Positives = 77/105 (73%), Gaps = 8/105 (8%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGF--------AFSKSSPLSVDMSTAIQELSDNGELQRIHD  238
            FLS+ C+F IVG EF ++  G         AF++ SPLSVDMSTAI +LS+NG++QRIHD
Sbjct  733  FLSSRCDFSIVGQEFTKTAWGIFVMFISNQAFARDSPLSVDMSTAILKLSENGDMQRIHD  792

Query  237  KWLLRGACKSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
            KWL+  +C SQ  +LQV++L LKSF  LF++CG AC  AL+++F+
Sbjct  793  KWLISSSCASQGAKLQVDRLQLKSFWGLFVLCGSACFLALIIYFI  837



>ref|XP_010110512.1| Glutamate receptor 3.6 [Morus notabilis]
 gb|EXC26730.1| Glutamate receptor 3.6 [Morus notabilis]
Length=961

 Score =   123 bits (309),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 55/83 (66%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS HCEF I+G EF ++G GFAF + SPL+VDMSTAI +LS+NG+LQRIHDKWL+R AC
Sbjct  796  FLSAHCEFSIIGQEFTKAGWGFAFPRDSPLAVDMSTAILKLSENGDLQRIHDKWLMRSAC  855

Query  213  KSQNTELQVNQLHLKSFSMLFLM  145
             SQ T+L+V++L LKSF  LF+M
Sbjct  856  ISQGTKLEVDRLQLKSFWGLFVM  878



>ref|XP_009401867.1| PREDICTED: glutamate receptor 3.1-like [Musa acuminata subsp. 
malaccensis]
Length=925

 Score =   123 bits (308),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 56/103 (54%), Positives = 75/103 (73%), Gaps = 1/103 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLL-RGA  217
            FLS  CEF IVGSEF ++G GFAF + SPL+VD+ST I  LS+NG+LQRIHDKWL  R  
Sbjct  760  FLSIQCEFAIVGSEFTKNGWGFAFPRDSPLAVDLSTNILTLSENGDLQRIHDKWLTGRSL  819

Query  216  CKSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
            C SQ +EL+ ++L L SF  LFL+CG  C  A+ ++F + +++
Sbjct  820  CSSQTSELESDRLQLNSFWGLFLVCGMTCTVAMFVYFAIMVHQ  862



>ref|XP_008651910.1| PREDICTED: glutamate receptor 3.4-like [Zea mays]
 tpg|DAA59327.1| TPA: hypothetical protein ZEAMMB73_851635 [Zea mays]
Length=959

 Score =   123 bits (308),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 58/97 (60%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C+F  VG EF +SG GFAF + SPL+VD+STAI  LS+NG+LQRIHDKWL  G C
Sbjct  774  FLSTNCQFRTVGQEFTKSGWGFAFQRDSPLAVDLSTAILTLSENGDLQRIHDKWLSPGTC  833

Query  213  KSQNTE-LQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
             SQ+T+ +  ++L+L SF  LFL+CG AC  ALL++F
Sbjct  834  ASQSTDGVGADRLNLGSFWGLFLICGVACFVALLIYF  870



>ref|XP_006595634.1| PREDICTED: glutamate receptor 3.2-like isoform X2 [Glycine max]
Length=909

 Score =   123 bits (308),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 61/106 (58%), Positives = 74/106 (70%), Gaps = 3/106 (3%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS HC+F I G EF +SG GFAF + SPL++DMSTAI  LS+NGELQRIH+KWL   AC
Sbjct  743  FLSNHCQFSIRGQEFTKSGWGFAFPRDSPLAIDMSTAILTLSENGELQRIHEKWLSEKAC  802

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR*INK  76
               +TE +  QL L SF  LFL+CG  C  ALL++F L + R  NK
Sbjct  803  GFHSTEDE--QLKLNSFRGLFLICGITCFLALLIYF-LSMVRQFNK  845



>ref|XP_011022198.1| PREDICTED: glutamate receptor 3.6-like [Populus euphratica]
Length=931

 Score =   123 bits (308),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 55/88 (63%), Positives = 67/88 (76%), Gaps = 0/88 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C+F IVG EF ++G GFAF + SPL+VDMS AI +LS+ GELQRIHDKWL   AC
Sbjct  763  FLSSRCDFSIVGQEFSKNGWGFAFPRDSPLAVDMSAAILKLSEGGELQRIHDKWLQSSAC  822

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFAC  130
             S+  +  +N+LHLKSF  LFLMCG AC
Sbjct  823  SSEGAKESINRLHLKSFWGLFLMCGVAC  850



>ref|XP_003545055.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Glycine max]
Length=915

 Score =   123 bits (308),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 61/106 (58%), Positives = 74/106 (70%), Gaps = 3/106 (3%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS HC+F I G EF +SG GFAF + SPL++DMSTAI  LS+NGELQRIH+KWL   AC
Sbjct  749  FLSNHCQFSIRGQEFTKSGWGFAFPRDSPLAIDMSTAILTLSENGELQRIHEKWLSEKAC  808

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR*INK  76
               +TE +  QL L SF  LFL+CG  C  ALL++F L + R  NK
Sbjct  809  GFHSTEDE--QLKLNSFRGLFLICGITCFLALLIYF-LSMVRQFNK  851



>ref|XP_003533408.1| PREDICTED: glutamate receptor 3.3-like [Glycine max]
 gb|KHN38861.1| Glutamate receptor 3.3 [Glycine soja]
Length=930

 Score =   123 bits (308),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 57/102 (56%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FL+T CEF IVG EF + G GF F + SPL++DMSTAI +LS+NG+LQRIHDKWL R AC
Sbjct  755  FLATRCEFGIVGQEFTKMGWGFGFPRESPLAIDMSTAILKLSENGDLQRIHDKWLTRSAC  814

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
             S+  +  +++L LKSF  LFL+ G AC  ALL + +   YR
Sbjct  815  SSEGAKQGIDRLELKSFWGLFLLSGIACFIALLCYVIRMAYR  856



>ref|XP_003533409.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Glycine max]
 ref|XP_006587553.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Glycine max]
 ref|XP_006587554.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Glycine max]
 ref|XP_006587555.1| PREDICTED: glutamate receptor 3.3-like isoform X4 [Glycine max]
 gb|KHN38862.1| Glutamate receptor 3.3 [Glycine soja]
Length=930

 Score =   122 bits (307),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 56/102 (55%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FL+T CE+ IVG EF + G GFAF + SPL++DMSTAI +LS+NG+LQRIHDKWL R AC
Sbjct  753  FLATRCEYGIVGQEFTKMGWGFAFPRDSPLAIDMSTAILKLSENGDLQRIHDKWLTRSAC  812

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
             S+  +  +++L L+SF  LFL+ G AC  ALL + +   YR
Sbjct  813  SSEGAKQGIDRLELESFWGLFLLSGIACFIALLCYVIRMAYR  854



>ref|XP_009403107.1| PREDICTED: glutamate receptor 3.5-like [Musa acuminata subsp. 
malaccensis]
Length=925

 Score =   122 bits (307),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 54/97 (56%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS +C++  VG EF +SG GFAF + SPL++D+STAI  LS+NG+LQRIHDKWL +  C
Sbjct  755  FLSDNCKYITVGQEFTKSGWGFAFPRDSPLALDLSTAILTLSENGDLQRIHDKWLTQSGC  814

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ+++   NQL   SF  LFL+CG ACL AL++ F+
Sbjct  815  TSQDSDTDSNQLSFASFWGLFLICGLACLMALMIFFL  851



>ref|XP_007200076.1| hypothetical protein PRUPE_ppa021130mg, partial [Prunus persica]
 gb|EMJ01275.1| hypothetical protein PRUPE_ppa021130mg, partial [Prunus persica]
Length=897

 Score =   122 bits (306),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 56/100 (56%), Positives = 75/100 (75%), Gaps = 1/100 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS +C F I G EF +SG GFAF + SPL++DMSTAI  LS+NG+LQ+IHDKWL R +C
Sbjct  742  FLSENCMFSIRGQEFTKSGWGFAFPRDSPLAIDMSTAILTLSENGDLQKIHDKWLSRKSC  801

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGI  94
             +Q ++L  +QL  +SF  L+L+CG ACL AL +HF+L +
Sbjct  802  -AQTSDLISDQLQPQSFWGLYLICGIACLIALFIHFLLAL  840



>ref|XP_004952127.1| PREDICTED: glutamate receptor 3.1-like isoform X3 [Setaria italica]
Length=934

 Score =   122 bits (306),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 58/103 (56%), Positives = 74/103 (72%), Gaps = 1/103 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C+  + GS+F   G GFAF + SPL VD+STAI  LS+NGELQRIHDKWL    C
Sbjct  756  FLSTYCKIAVAGSDFTSRGWGFAFPRDSPLQVDLSTAILTLSENGELQRIHDKWLRTSDC  815

Query  213  KSQNTE-LQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
             + NTE +  NQL L+SF  LFL+CG AC+ ALL++F + + R
Sbjct  816  SADNTEFVDSNQLRLESFMGLFLICGAACVLALLIYFGIMLRR  858



>ref|XP_004987272.1| PREDICTED: glutamate receptor 3.4-like [Setaria italica]
Length=938

 Score =   122 bits (306),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 57/97 (59%), Positives = 74/97 (76%), Gaps = 1/97 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C+F  VG EF +SG GFAF + SPL+VD+STAI  LS+NG+LQRIHDKWL  G C
Sbjct  746  FLSTNCQFRTVGQEFTKSGWGFAFQRDSPLAVDLSTAILTLSENGDLQRIHDKWLNPGTC  805

Query  213  KSQNTEL-QVNQLHLKSFSMLFLMCGFACLFALLLHF  106
             SQ+ ++   ++L+L SF  LFL+CG AC  ALL++F
Sbjct  806  DSQSADVGSADRLNLNSFWGLFLICGVACFIALLIYF  842



>ref|XP_008235912.1| PREDICTED: glutamate receptor 3.2-like [Prunus mume]
Length=932

 Score =   122 bits (306),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 57/100 (57%), Positives = 74/100 (74%), Gaps = 1/100 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS +C F I G EF +SG GFAF + SPL++DMSTAI  LS+NG+LQ+IHDKWL R  C
Sbjct  742  FLSENCMFSIRGQEFTKSGWGFAFPRDSPLTIDMSTAILTLSENGDLQKIHDKWLSRKTC  801

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGI  94
             +Q ++L  +QL L+SF  LFL+CG A L AL +HF+L +
Sbjct  802  -AQTSDLISDQLQLQSFWGLFLICGIASLIALFIHFLLAL  840



>emb|CAN64711.1| hypothetical protein VITISV_043726 [Vitis vinifera]
Length=959

 Score =   122 bits (305),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 56/98 (57%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FL++HC+F IVG +F RSG GFAF + S L+VD+STAI  LS+NG+LQRIHDKWL    C
Sbjct  786  FLASHCKFSIVGPQFTRSGWGFAFXRDSSLTVDLSTAILTLSENGDLQRIHDKWLKNKVC  845

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             S N++L  +QL  +SF  LFL+CG AC  ALL++F +
Sbjct  846  -SDNSQLGSDQLQFQSFWGLFLICGIACFLALLVYFCM  882



>ref|XP_006422389.1| hypothetical protein CICLE_v10027770mg [Citrus clementina]
 gb|ESR35629.1| hypothetical protein CICLE_v10027770mg [Citrus clementina]
 gb|KDO68412.1| hypothetical protein CISIN_1g002211mg [Citrus sinensis]
Length=843

 Score =   122 bits (305),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 57/98 (58%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS HC+F + G EF +SG GFAF + SPL++DMSTAI  LS+NGELQRIHDKWL + AC
Sbjct  659  FLSDHCQFSVRGQEFTKSGWGFAFPRDSPLAIDMSTAILTLSENGELQRIHDKWLRKKAC  718

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             S++++    QL ++SF  LFL+CG AC  ALL +F L
Sbjct  719  SSESSQSDSEQLQIQSFRGLFLICGIACFLALLAYFCL  756



>ref|XP_004952125.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Setaria italica]
 ref|XP_004952126.1| PREDICTED: glutamate receptor 3.1-like isoform X2 [Setaria italica]
Length=965

 Score =   122 bits (305),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 58/103 (56%), Positives = 74/103 (72%), Gaps = 1/103 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C+  + GS+F   G GFAF + SPL VD+STAI  LS+NGELQRIHDKWL    C
Sbjct  787  FLSTYCKIAVAGSDFTSRGWGFAFPRDSPLQVDLSTAILTLSENGELQRIHDKWLRTSDC  846

Query  213  KSQNTE-LQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
             + NTE +  NQL L+SF  LFL+CG AC+ ALL++F + + R
Sbjct  847  SADNTEFVDSNQLRLESFMGLFLICGAACVLALLIYFGIMLRR  889



>ref|XP_004290072.1| PREDICTED: glutamate receptor 3.2-like [Fragaria vesca subsp. 
vesca]
Length=939

 Score =   122 bits (305),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 56/99 (57%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS +C F I G EF +SG GFAF + SPL++DMSTAI  LS+NGELQ+IH+KWL +  C
Sbjct  741  FLSDNCMFSIRGPEFTKSGWGFAFPRDSPLAIDMSTAILTLSENGELQQIHEKWLSKKTC  800

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLG  97
             SQ ++   +QL L+SF  LFL+CG AC+ AL++HF L 
Sbjct  801  ASQTSDDVSDQLQLQSFWGLFLICGTACVIALVIHFSLA  839



>ref|XP_002279899.1| PREDICTED: glutamate receptor 3.2 [Vitis vinifera]
Length=917

 Score =   122 bits (305),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 56/98 (57%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FL++HC+F IVG +F RSG GFAF + S L+VD+STAI  LS+NG+LQRIHDKWL    C
Sbjct  744  FLASHCKFSIVGPQFTRSGWGFAFPRDSSLTVDLSTAILTLSENGDLQRIHDKWLKNKVC  803

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             S N++L  +QL  +SF  LFL+CG AC  ALL++F +
Sbjct  804  -SDNSQLGSDQLQFQSFWGLFLICGIACFLALLVYFCM  840



>ref|XP_006486565.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Citrus sinensis]
 ref|XP_006486566.1| PREDICTED: glutamate receptor 3.2-like isoform X2 [Citrus sinensis]
Length=930

 Score =   122 bits (305),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 57/98 (58%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS HC+F + G EF +SG GFAF + SPL++DMSTAI  LS+NGELQRIHDKWL + AC
Sbjct  746  FLSDHCQFSVRGQEFTKSGWGFAFPRDSPLAIDMSTAILTLSENGELQRIHDKWLRKKAC  805

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             S++++    QL ++SF  LFL+CG AC  ALL +F L
Sbjct  806  SSESSQSDSEQLQIQSFRGLFLICGIACFLALLAYFCL  843



>ref|XP_006422390.1| hypothetical protein CICLE_v10027770mg [Citrus clementina]
 ref|XP_006422391.1| hypothetical protein CICLE_v10027770mg [Citrus clementina]
 gb|ESR35630.1| hypothetical protein CICLE_v10027770mg [Citrus clementina]
 gb|ESR35631.1| hypothetical protein CICLE_v10027770mg [Citrus clementina]
 gb|KDO68408.1| hypothetical protein CISIN_1g002211mg [Citrus sinensis]
 gb|KDO68409.1| hypothetical protein CISIN_1g002211mg [Citrus sinensis]
 gb|KDO68410.1| hypothetical protein CISIN_1g002211mg [Citrus sinensis]
 gb|KDO68411.1| hypothetical protein CISIN_1g002211mg [Citrus sinensis]
Length=930

 Score =   122 bits (305),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 57/98 (58%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS HC+F + G EF +SG GFAF + SPL++DMSTAI  LS+NGELQRIHDKWL + AC
Sbjct  746  FLSDHCQFSVRGQEFTKSGWGFAFPRDSPLAIDMSTAILTLSENGELQRIHDKWLRKKAC  805

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             S++++    QL ++SF  LFL+CG AC  ALL +F L
Sbjct  806  SSESSQSDSEQLQIQSFRGLFLICGIACFLALLAYFCL  843



>gb|KDO68407.1| hypothetical protein CISIN_1g002211mg [Citrus sinensis]
Length=953

 Score =   121 bits (304),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 57/98 (58%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS HC+F + G EF +SG GFAF + SPL++DMSTAI  LS+NGELQRIHDKWL + AC
Sbjct  769  FLSDHCQFSVRGQEFTKSGWGFAFPRDSPLAIDMSTAILTLSENGELQRIHDKWLRKKAC  828

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             S++++    QL ++SF  LFL+CG AC  ALL +F L
Sbjct  829  SSESSQSDSEQLQIQSFRGLFLICGIACFLALLAYFCL  866



>ref|XP_008645171.1| PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 3.1-like [Zea 
mays]
Length=926

 Score =   121 bits (304),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 57/97 (59%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C+  + G +F   G GFAF + SPL VD+STAI  LS++GELQRIHDKWL  G C
Sbjct  756  FLSTYCKIAVAGQDFTSGGWGFAFPRDSPLQVDLSTAILTLSEDGELQRIHDKWLKTGDC  815

Query  213  KSQNTE-LQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
             S NTE +  NQL L+SF  LFL+CG AC+ ALL++F
Sbjct  816  SSDNTEFVDSNQLRLESFMGLFLICGAACVLALLIYF  852



>gb|AFW69814.1| hypothetical protein ZEAMMB73_405216 [Zea mays]
Length=901

 Score =   121 bits (304),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 57/97 (59%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C+  + G +F   G GFAF + SPL VD+STAI  LS++GELQRIHDKWL  G C
Sbjct  756  FLSTYCKIAVAGQDFTSGGWGFAFPRDSPLQVDLSTAILTLSEDGELQRIHDKWLKTGDC  815

Query  213  KSQNTE-LQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
             S NTE +  NQL L+SF  LFL+CG AC+ ALL++F
Sbjct  816  SSDNTEFVDSNQLRLESFMGLFLICGAACVLALLIYF  852



>ref|XP_007149970.1| hypothetical protein PHAVU_005G114800g [Phaseolus vulgaris]
 gb|ESW21964.1| hypothetical protein PHAVU_005G114800g [Phaseolus vulgaris]
Length=946

 Score =   121 bits (304),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 54/94 (57%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = -1

Query  387  STHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGACKS  208
            +T+C+F  VG EF +SG GFAF + SPL+VDMSTAI +LS+NG+LQ+IHDKWLL+  C +
Sbjct  776  NTNCKFRTVGQEFTKSGWGFAFQRDSPLAVDMSTAILQLSENGDLQKIHDKWLLKQDCST  835

Query  207  QNTELQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
            Q   + +N+L L SF  LFL+CG ACL AL+  F
Sbjct  836  QENNVDLNKLSLSSFWGLFLICGIACLLALIAFF  869



>ref|XP_004509457.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Cicer arietinum]
Length=845

 Score =   121 bits (303),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ CEF IVG EF R+G GFAF   SPL+VD+STAI EL++NG+LQRIHDKWLL  AC
Sbjct  665  FLSSRCEFTIVGQEFTRNGWGFAFPPDSPLAVDLSTAILELAENGDLQRIHDKWLLSSAC  724

Query  213  KSQNTELQVNQLHLKSFSMLFLMCG  139
             SQ  +L+V++L+LKSF  L+L+CG
Sbjct  725  LSQGAKLEVDRLNLKSFWGLYLVCG  749



>gb|ACN36836.1| unknown [Zea mays]
Length=376

 Score =   118 bits (295),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 72/101 (71%), Gaps = 1/101 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C+  + GS+F   G GFAF + SPL +D+STAI  LS+NGELQRIHDKWL  G C
Sbjct  206  FLSTYCKIAVAGSDFTSGGWGFAFPRDSPLQIDLSTAILTLSENGELQRIHDKWLKTGDC  265

Query  213  KSQNTE-LQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGI  94
             + N E +  NQL L+SF  LFL+CG AC+ ALL++  + I
Sbjct  266  STDNAEFVDSNQLRLESFMGLFLICGAACVLALLIYLGITI  306



>ref|XP_011079012.1| PREDICTED: glutamate receptor 3.4 [Sesamum indicum]
Length=933

 Score =   121 bits (304),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 55/94 (59%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = -1

Query  387  STHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGACKS  208
            +T C+F IVG EF RSG GFAF + SPL+VD+STAI +LS+NG+LQRIHDKWL R  C  
Sbjct  765  NTKCQFSIVGREFTRSGWGFAFQRDSPLAVDLSTAILQLSENGDLQRIHDKWLSRDGCSG  824

Query  207  QNTELQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
            Q+  +  ++L LKSF  LFL+CG AC  AL++ F
Sbjct  825  QSNPIDESRLSLKSFWGLFLICGIACSIALVIFF  858



>emb|CBI37733.3| unnamed protein product [Vitis vinifera]
Length=1147

 Score =   121 bits (304),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 56/98 (57%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = -1

Query  393   FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
             FL++HC+F IVG +F RSG GFAF + S L+VD+STAI  LS+NG+LQRIHDKWL    C
Sbjct  974   FLASHCKFSIVGPQFTRSGWGFAFPRDSSLTVDLSTAILTLSENGDLQRIHDKWLKNKVC  1033

Query  213   KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
              S N++L  +QL  +SF  LFL+CG AC  ALL++F +
Sbjct  1034  -SDNSQLGSDQLQFQSFWGLFLICGIACFLALLVYFCM  1070



>ref|XP_004509455.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Cicer arietinum]
 ref|XP_004509456.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Cicer arietinum]
Length=940

 Score =   121 bits (303),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ CEF IVG EF R+G GFAF   SPL+VD+STAI EL++NG+LQRIHDKWLL  AC
Sbjct  760  FLSSRCEFTIVGQEFTRNGWGFAFPPDSPLAVDLSTAILELAENGDLQRIHDKWLLSSAC  819

Query  213  KSQNTELQVNQLHLKSFSMLFLMCG  139
             SQ  +L+V++L+LKSF  L+L+CG
Sbjct  820  LSQGAKLEVDRLNLKSFWGLYLVCG  844



>ref|XP_002451392.1| hypothetical protein SORBIDRAFT_04g001300 [Sorghum bicolor]
 gb|EES04368.1| hypothetical protein SORBIDRAFT_04g001300 [Sorghum bicolor]
Length=874

 Score =   120 bits (302),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 57/97 (59%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C+  + GS+F  +G GFAF + SPL VD+STAI  LS+NGELQRIHDKWL    C
Sbjct  704  FLSTYCKIAVAGSDFTSTGWGFAFPRDSPLQVDLSTAILTLSENGELQRIHDKWLKTADC  763

Query  213  KSQNTE-LQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
               NTE +  NQL L+SF  LFL+CG AC+ ALL++F
Sbjct  764  SIDNTEFVDSNQLRLESFMGLFLICGAACVLALLIYF  800



>gb|EMS57750.1| Glutamate receptor 3.3 [Triticum urartu]
Length=889

 Score =   121 bits (303),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 57/97 (59%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C+  + G++F   G GFAF + SPL VD+STAI  LS+NGELQRIH KWL  G C
Sbjct  719  FLSTYCKIAVAGTDFTSRGWGFAFPRDSPLQVDLSTAILSLSENGELQRIHAKWLNTGEC  778

Query  213  KSQNTEL-QVNQLHLKSFSMLFLMCGFACLFALLLHF  106
             + N+EL   NQL L+SF  LFL+CG AC+ ALLL+F
Sbjct  779  TTDNSELVDSNQLRLESFLGLFLICGVACVLALLLYF  815



>ref|XP_004289031.1| PREDICTED: glutamate receptor 3.3-like [Fragaria vesca subsp. 
vesca]
Length=528

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C + IVG EF + G GFAF + SPL++DMSTAI +LS+NG LQ+IHDKWL++ AC
Sbjct  362  FLSSRCGYSIVGQEFTKIGWGFAFPRDSPLAIDMSTAILKLSENGNLQKIHDKWLMKSAC  421

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             ++  +  V++L LKSF  LFL+ G AC  AL+LH +
Sbjct  422  SAEGAKQAVDRLQLKSFWGLFLLSGIACFLALILHVL  458



>ref|XP_002520606.1| glutamate receptor 3 plant, putative [Ricinus communis]
 gb|EEF41779.1| glutamate receptor 3 plant, putative [Ricinus communis]
Length=924

 Score =   120 bits (302),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 54/98 (55%), Positives = 70/98 (71%), Gaps = 0/98 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS HC+F I G EF +SG GFAF + SPL++D+STAI  LS+ G+LQ+IHDKWL R  C
Sbjct  744  FLSDHCQFSIRGQEFTKSGWGFAFPRDSPLAMDISTAILTLSETGDLQKIHDKWLARKVC  803

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
             SQ ++    QL L+SF  LFL+CG AC  AL ++F +
Sbjct  804  SSQISDSGSEQLQLQSFWGLFLICGIACFLALFIYFCM  841



>ref|XP_008812266.1| PREDICTED: glutamate receptor 3.4 isoform X2 [Phoenix dactylifera]
Length=765

 Score =   120 bits (301),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 54/97 (56%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS +C+F +VG EF ++G GFAF ++SPL+ D+STAI  LS++G+LQRIHD+WL R  C
Sbjct  604  FLSIYCQFQMVGQEFTKNGWGFAFQRNSPLAEDLSTAILSLSESGDLQRIHDQWLARKGC  663

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             S+ TE   N+L L SF  LFL+CG AC  ALL+ F+
Sbjct  664  TSEVTETDTNRLSLGSFWGLFLICGLACFIALLVFFI  700



>gb|EMT02755.1| Glutamate receptor 3.3 [Aegilops tauschii]
Length=845

 Score =   120 bits (301),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 56/97 (58%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C+  + G++F   G GFAF + SPL VD+STAI  LS+NGELQRIH KWL  G C
Sbjct  675  FLSTYCKIAVAGTDFTSRGWGFAFPRDSPLQVDLSTAILSLSENGELQRIHSKWLNTGEC  734

Query  213  KSQNTE-LQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
             + N+E +  NQL L+SF  LFL+CG AC+ ALLL+F
Sbjct  735  TTDNSEFVDSNQLRLESFLGLFLICGVACVLALLLYF  771



>ref|XP_008242065.1| PREDICTED: glutamate receptor 3.6-like [Prunus mume]
Length=867

 Score =   120 bits (301),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 54/102 (53%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  C + IVG EF + G GFAF + SPL+ DMSTA+ +LS+ G+LQ+IHDKWL++ AC
Sbjct  754  FLSVRCGYSIVGQEFTKMGWGFAFPRDSPLAADMSTALLKLSEKGDLQKIHDKWLMKSAC  813

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
             +Q T+  V++L LKSF  LFL+ G AC  ALLLH +  +++
Sbjct  814  SAQGTKQAVDRLPLKSFWGLFLLSGIACFLALLLHVIRLVHK  855



>ref|XP_009399220.1| PREDICTED: glutamate receptor 3.5-like [Musa acuminata subsp. 
malaccensis]
Length=992

 Score =   120 bits (302),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 54/97 (56%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
             LS +C F IVG EF ++G GFAF + SPL+VD+STAI  LS+NG+LQRIHDKWL R  C
Sbjct  815  LLSVYCHFRIVGPEFTKNGWGFAFQRDSPLAVDLSTAILTLSENGDLQRIHDKWLSRTEC  874

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQ+T+L+ N+L L SF  LFL+ G  C+ AL+++ +
Sbjct  875  SSQDTDLEANRLSLSSFWGLFLLSGIVCVLALIVYII  911



>ref|XP_010907850.1| PREDICTED: glutamate receptor 3.4-like [Elaeis guineensis]
Length=932

 Score =   120 bits (301),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 55/96 (57%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS +C+F IVG EF ++G GF F K+SPL+ D+STAI  LS+NG+LQRIHDKWL    C
Sbjct  768  FLSMYCQFKIVGQEFTKNGWGFVFQKNSPLAEDLSTAILTLSENGDLQRIHDKWLAHKGC  827

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
              Q TE+  N+L L+SF  LFL+CG  C  ALL+ F
Sbjct  828  TLQATEMDTNRLSLQSFWGLFLICGLVCFIALLVFF  863



>ref|XP_008812265.1| PREDICTED: glutamate receptor 3.4 isoform X1 [Phoenix dactylifera]
Length=929

 Score =   120 bits (301),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/97 (56%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS +C+F +VG EF ++G GFAF ++SPL+ D+STAI  LS++G+LQRIHD+WL R  C
Sbjct  768  FLSIYCQFQMVGQEFTKNGWGFAFQRNSPLAEDLSTAILSLSESGDLQRIHDQWLARKGC  827

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             S+ TE   N+L L SF  LFL+CG AC  ALL+ F+
Sbjct  828  TSEVTETDTNRLSLGSFWGLFLICGLACFIALLVFFI  864



>gb|EEE56178.1| hypothetical protein OsJ_05129 [Oryza sativa Japonica Group]
Length=870

 Score =   120 bits (300),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 55/103 (53%), Positives = 73/103 (71%), Gaps = 1/103 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C+  + GS+F   G GFAF + SPL +D+STAI  LS+NGELQRIHDKWL    C
Sbjct  682  FLSTYCKIAVAGSDFTSRGWGFAFPRDSPLQIDLSTAILSLSENGELQRIHDKWLKTSEC  741

Query  213  KSQNTE-LQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
             + NTE +  +QL L+SF  LFL+CG AC+ ALL++F   + +
Sbjct  742  SADNTEFVDSDQLRLESFWGLFLICGIACVIALLIYFFTTVRK  784



>ref|XP_009763348.1| PREDICTED: glutamate receptor 3.2-like [Nicotiana sylvestris]
Length=902

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C F  VG EF +SG GFAF + SPL++DMSTAI +LS+NGEL++IH KWL R  C
Sbjct  745  FLSTYCGFQKVGPEFTKSGWGFAFPRDSPLAIDMSTAILQLSENGELEKIHKKWLNRKVC  804

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
              Q++E    QL LKSF  LFL+CG  C FALL++F
Sbjct  805  GGQSSEADSEQLQLKSFWGLFLICGVTCCFALLVYF  840



>ref|XP_010028854.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010028855.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010028856.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010028857.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010028858.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Eucalyptus 
grandis]
Length=912

 Score =   120 bits (301),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 55/102 (54%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS HC+F I G EF +SG GFAF + SPL+VDMSTA+  LS+NGELQ+I+D+WL R  C
Sbjct  747  FLSNHCKFSIRGEEFTKSGWGFAFPRDSPLAVDMSTALLALSENGELQKINDRWLSRKTC  806

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
             SQ +  + +QL L+SF  LFL+CG AC+ ALL++  + +++
Sbjct  807  GSQISGEESDQLRLQSFWGLFLICGVACVAALLVYVFVMLHK  848



>gb|KCW55682.1| hypothetical protein EUGRSUZ_I01532 [Eucalyptus grandis]
 gb|KCW55683.1| hypothetical protein EUGRSUZ_I01532 [Eucalyptus grandis]
Length=924

 Score =   120 bits (301),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 55/102 (54%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS HC+F I G EF +SG GFAF + SPL+VDMSTA+  LS+NGELQ+I+D+WL R  C
Sbjct  747  FLSNHCKFSIRGEEFTKSGWGFAFPRDSPLAVDMSTALLALSENGELQKINDRWLSRKTC  806

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
             SQ +  + +QL L+SF  LFL+CG AC+ ALL++  + +++
Sbjct  807  GSQISGEESDQLRLQSFWGLFLICGVACVAALLVYVFVMLHK  848



>gb|EEC72350.1| hypothetical protein OsI_05591 [Oryza sativa Indica Group]
Length=906

 Score =   120 bits (300),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 55/103 (53%), Positives = 73/103 (71%), Gaps = 1/103 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C+  + GS+F   G GFAF + SPL +D+STAI  LS+NGELQRIHDKWL    C
Sbjct  718  FLSTYCKIAVAGSDFTSRGWGFAFPRDSPLQIDLSTAILSLSENGELQRIHDKWLKTSEC  777

Query  213  KSQNTE-LQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
             + NTE +  +QL L+SF  LFL+CG AC+ ALL++F   + +
Sbjct  778  SADNTEFVDSDQLRLESFWGLFLICGIACVIALLIYFFTTVRK  820



>ref|NP_001045687.1| Os02g0117500 [Oryza sativa Japonica Group]
 dbj|BAD07727.1| putative glutamate receptor [Oryza sativa Japonica Group]
 dbj|BAF07601.1| Os02g0117500 [Oryza sativa Japonica Group]
Length=944

 Score =   120 bits (300),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 55/103 (53%), Positives = 73/103 (71%), Gaps = 1/103 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C+  + GS+F   G GFAF + SPL +D+STAI  LS+NGELQRIHDKWL    C
Sbjct  756  FLSTYCKIAVAGSDFTSRGWGFAFPRDSPLQIDLSTAILSLSENGELQRIHDKWLKTSEC  815

Query  213  KSQNTE-LQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
             + NTE +  +QL L+SF  LFL+CG AC+ ALL++F   + +
Sbjct  816  SADNTEFVDSDQLRLESFWGLFLICGIACVIALLIYFFTTVRK  858



>gb|AFW66756.1| hypothetical protein ZEAMMB73_452909 [Zea mays]
Length=951

 Score =   120 bits (300),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 56/101 (55%), Positives = 72/101 (71%), Gaps = 1/101 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C+  + GS+F   G GFAF + SPL +D+STAI  LS+NGELQRIHDKWL  G C
Sbjct  781  FLSTYCKIAVAGSDFTSGGWGFAFPRDSPLQIDLSTAILTLSENGELQRIHDKWLKTGDC  840

Query  213  KSQNTE-LQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGI  94
             + N E +  NQL L+SF  LFL+CG AC+ ALL++  + I
Sbjct  841  STDNAEFVDSNQLRLESFMGLFLICGAACVLALLIYLGITI  881



>gb|EMT17124.1| Glutamate receptor 3.1 [Aegilops tauschii]
Length=885

 Score =   120 bits (300),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 55/97 (57%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C+  + GS+F   G GFAF + SPL VD+STAI  LS+NGELQRIHDKWL  G C
Sbjct  718  FLSTYCKIAVAGSDFTSRGWGFAFPRDSPLQVDLSTAILSLSENGELQRIHDKWLKTGEC  777

Query  213  KSQNTEL-QVNQLHLKSFSMLFLMCGFACLFALLLHF  106
             +  +E+   NQL L+SF  LFL+CG AC+ +LL++F
Sbjct  778  AADESEMINSNQLRLESFWGLFLICGVACVISLLIYF  814



>ref|XP_004289032.1| PREDICTED: glutamate receptor 3.6-like [Fragaria vesca subsp. 
vesca]
Length=717

 Score =   119 bits (298),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 53/97 (55%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C + IVG EF + G GFAF + SPL++DMSTAI +LS+NG LQ+IHDKWL++ AC
Sbjct  548  FLSSRCGYSIVGQEFTKMGWGFAFPRDSPLAIDMSTAILKLSENGILQKIHDKWLMKSAC  607

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             ++  +  V++L LKSF  LFL+ G AC  AL+LH +
Sbjct  608  SAEGAKQAVDRLQLKSFWGLFLLSGIACFLALILHVL  644



>ref|XP_010515566.1| PREDICTED: glutamate receptor 3.6-like isoform X4 [Camelina sativa]
Length=701

 Score =   119 bits (298),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 55/100 (55%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  CEF IVG EF + G GFAF ++SPL+VD+S AI +LS+NG++QRI DKWLLR AC
Sbjct  594  FLSNRCEFGIVGREFTQHGWGFAFPRNSPLAVDVSVAILQLSENGDMQRIRDKWLLRKAC  653

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGI  94
              Q  E++V++L L SF  LF+MCG  C+ A+ ++ +L I
Sbjct  654  SLQGAEIKVHRLELSSFWGLFVMCGGTCVLAVAVYTVLMI  693



>ref|XP_010935350.1| PREDICTED: glutamate receptor 3.1 [Elaeis guineensis]
 ref|XP_010935351.1| PREDICTED: glutamate receptor 3.1 [Elaeis guineensis]
Length=916

 Score =   120 bits (300),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/88 (61%), Positives = 65/88 (74%), Gaps = 0/88 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FL T C+F I+GSEF +SG GF F + SPL++DMSTAI  LS+NG+LQRIHDKWL R AC
Sbjct  755  FLETKCKFAIIGSEFTKSGWGFIFPRDSPLAMDMSTAILSLSENGDLQRIHDKWLTRSAC  814

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFAC  130
             S   EL  ++L L SF  LFL+CG AC
Sbjct  815  SSATDELDSDRLQLTSFWGLFLICGVAC  842



>ref|XP_006855692.1| hypothetical protein AMTR_s00044p00137040 [Amborella trichopoda]
 gb|ERN17159.1| hypothetical protein AMTR_s00044p00137040 [Amborella trichopoda]
Length=936

 Score =   120 bits (300),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 57/105 (54%), Positives = 74/105 (70%), Gaps = 3/105 (3%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS +C+F I G +F +SG GF F + SPL+VDMSTAI +LS++G+LQRIHDKW  R  C
Sbjct  756  FLSQYCKFKIAGKQFTKSGWGFVFQRDSPLAVDMSTAILKLSESGDLQRIHDKWFARLGC  815

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFAL---LLHFMLGIYR  88
             SQ+T+++ NQL L+SF  LFL+C  A L AL   LLH +    R
Sbjct  816  SSQDTDIESNQLRLRSFWGLFLICAVASLVALAVFLLHMLYQFSR  860



>tpg|DAA59325.1| TPA: hypothetical protein ZEAMMB73_375779 [Zea mays]
Length=875

 Score =   119 bits (299),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 56/98 (57%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS++C+F  VG EF +SG GFAF   SPL+VD+STAI  LS+NG+LQRIHD WL  G C
Sbjct  687  FLSSNCQFQTVGQEFTKSGWGFAFPLDSPLAVDLSTAILTLSENGDLQRIHDNWLNTGTC  746

Query  213  KSQNTEL-QVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             SQN  +    +L L++F  LFL+CG AC+ ALL+HF+
Sbjct  747  DSQNNGVGGAERLSLRNFGGLFLICGVACVIALLIHFV  784



>ref|XP_006858062.1| hypothetical protein AMTR_s00062p00050250 [Amborella trichopoda]
 gb|ERN19529.1| hypothetical protein AMTR_s00062p00050250 [Amborella trichopoda]
Length=940

 Score =   119 bits (299),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 53/94 (56%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
             LS++C+F +VG EF +SG GFAF + SPL++DMSTA+  LS+NGELQR+HDKWL R  C
Sbjct  756  LLSSNCKFQVVGQEFTKSGWGFAFQRDSPLAIDMSTALLTLSENGELQRLHDKWLTRRGC  815

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLL  112
             +Q T+++ ++L L+SF  LFL+CG AC  AL L
Sbjct  816  NTQTTQVEPSKLGLESFWGLFLICGVACGLALFL  849



>ref|XP_010426721.1| PREDICTED: glutamate receptor 3.6-like isoform X4 [Camelina sativa]
Length=705

 Score =   119 bits (297),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 56/100 (56%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  CEF IVG EF + G GFAF ++SPL+VD+S AI +LS+NG++QRI DKWLLR AC
Sbjct  594  FLSNICEFGIVGREFTQHGWGFAFPRNSPLAVDVSVAILQLSENGDMQRIRDKWLLRKAC  653

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGI  94
              Q  EL+V++L L SF  LF+MCG  C+ A+ ++ +L I
Sbjct  654  SLQGAELKVHRLELSSFWGLFVMCGGTCVLAVAVYTVLMI  693



>ref|XP_008241922.1| PREDICTED: glutamate receptor 3.6-like [Prunus mume]
 ref|XP_008241923.1| PREDICTED: glutamate receptor 3.6-like [Prunus mume]
Length=924

 Score =   119 bits (299),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 50/102 (49%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C + IVG EF + G GFAF + SPL++DMSTA+ +LS+ G+LQ+IHDKWL++ AC
Sbjct  762  FLSSQCRYSIVGQEFTKMGWGFAFPRDSPLAIDMSTAVLKLSEKGDLQKIHDKWLMKSAC  821

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
             ++  +  V++L +KSF  LFL+ G AC  AL+LH +  +++
Sbjct  822  SAEGAKQAVDRLQIKSFWGLFLLSGIACFLALVLHVIRMVHK  863



>ref|XP_010515561.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Camelina sativa]
Length=858

 Score =   119 bits (298),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 55/100 (55%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  CEF IVG EF + G GFAF ++SPL+VD+S AI +LS+NG++QRI DKWLLR AC
Sbjct  751  FLSNRCEFGIVGREFTQHGWGFAFPRNSPLAVDVSVAILQLSENGDMQRIRDKWLLRKAC  810

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGI  94
              Q  E++V++L L SF  LF+MCG  C+ A+ ++ +L I
Sbjct  811  SLQGAEIKVHRLELSSFWGLFVMCGGTCVLAVAVYTVLMI  850



>ref|XP_010515560.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
 ref|XP_010515563.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
 ref|XP_010515564.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
Length=858

 Score =   119 bits (298),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 55/100 (55%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  CEF IVG EF + G GFAF ++SPL+VD+S AI +LS+NG++QRI DKWLLR AC
Sbjct  751  FLSNRCEFGIVGREFTQHGWGFAFPRNSPLAVDVSVAILQLSENGDMQRIRDKWLLRKAC  810

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGI  94
              Q  E++V++L L SF  LF+MCG  C+ A+ ++ +L I
Sbjct  811  SLQGAEIKVHRLELSSFWGLFVMCGGTCVLAVAVYTVLMI  850



>ref|XP_010426717.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Camelina sativa]
 ref|XP_010426719.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Camelina sativa]
 ref|XP_010426720.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Camelina sativa]
Length=854

 Score =   119 bits (297),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 56/100 (56%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  CEF IVG EF + G GFAF ++SPL+VD+S AI +LS+NG++QRI DKWLLR AC
Sbjct  743  FLSNICEFGIVGREFTQHGWGFAFPRNSPLAVDVSVAILQLSENGDMQRIRDKWLLRKAC  802

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGI  94
              Q  EL+V++L L SF  LF+MCG  C+ A+ ++ +L I
Sbjct  803  SLQGAELKVHRLELSSFWGLFVMCGGTCVLAVAVYTVLMI  842



>ref|XP_010426707.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
 ref|XP_010426708.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
 ref|XP_010426709.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
 ref|XP_010426710.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
 ref|XP_010426711.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
 ref|XP_010426713.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
 ref|XP_010426714.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Camelina sativa]
 ref|XP_010426715.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Camelina sativa]
 ref|XP_010426716.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Camelina sativa]
Length=862

 Score =   119 bits (297),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 56/100 (56%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  CEF IVG EF + G GFAF ++SPL+VD+S AI +LS+NG++QRI DKWLLR AC
Sbjct  751  FLSNICEFGIVGREFTQHGWGFAFPRNSPLAVDVSVAILQLSENGDMQRIRDKWLLRKAC  810

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGI  94
              Q  EL+V++L L SF  LF+MCG  C+ A+ ++ +L I
Sbjct  811  SLQGAELKVHRLELSSFWGLFVMCGGTCVLAVAVYTVLMI  850



>ref|XP_010515565.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Camelina sativa]
Length=830

 Score =   119 bits (297),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 55/100 (55%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS  CEF IVG EF + G GFAF ++SPL+VD+S AI +LS+NG++QRI DKWLLR AC
Sbjct  723  FLSNRCEFGIVGREFTQHGWGFAFPRNSPLAVDVSVAILQLSENGDMQRIRDKWLLRKAC  782

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGI  94
              Q  E++V++L L SF  LF+MCG  C+ A+ ++ +L I
Sbjct  783  SLQGAEIKVHRLELSSFWGLFVMCGGTCVLAVAVYTVLMI  822



>ref|XP_004966219.1| PREDICTED: glutamate receptor 3.4-like [Setaria italica]
Length=938

 Score =   119 bits (297),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 53/97 (55%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS HC F IVG EF + G GFAF + SPL+ D+STAI +LS++G+LQRIHD+W  R +C
Sbjct  753  FLSYHCNFRIVGQEFTKEGWGFAFQRDSPLAADLSTAILQLSESGQLQRIHDEWFTRPSC  812

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             S ++E+   +L L SF  LFL+C   CLFALL+ F+
Sbjct  813  SSDDSEVGATRLGLGSFWGLFLVCALICLFALLVFFI  849



>dbj|BAK06938.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=926

 Score =   118 bits (296),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 54/103 (52%), Positives = 75/103 (73%), Gaps = 1/103 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C+  + G++F   G GFAF + SPL VD+STAI  LS+NGELQRI DKW+  G C
Sbjct  756  FLSTYCKIAVAGTDFTSRGWGFAFPRDSPLQVDLSTAILSLSENGELQRIRDKWVKTGEC  815

Query  213  KSQNTE-LQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
             + N+E +  +QL L+SF  LFL+CG AC+ ALL++F + +Y+
Sbjct  816  ATDNSEFVDSDQLRLESFFGLFLICGVACVLALLIYFGIMLYK  858



>ref|XP_008241924.1| PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 3.6-like [Prunus 
mume]
Length=922

 Score =   118 bits (296),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 50/102 (49%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C + IVG EF + G GFAF + SPL++DMSTA+ +LS+ G+LQ+IHDKWL++ AC
Sbjct  760  FLSSRCGYSIVGQEFTKMGWGFAFPRDSPLAIDMSTAVLKLSEKGDLQKIHDKWLMKSAC  819

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
             ++  +  V++L +KSF  LFL+ G AC  AL+LH +  +++
Sbjct  820  SAEGAKQAVDRLQIKSFWGLFLLSGIACFLALVLHVIRMVHK  861



>ref|XP_009416682.1| PREDICTED: glutamate receptor 3.4-like, partial [Musa acuminata 
subsp. malaccensis]
Length=933

 Score =   118 bits (296),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 56/96 (58%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLST+C+F  VG EF +SG GFAF + SPL+VD+STAI  LS+NG+LQRIHDKWL    C
Sbjct  761  FLSTNCKFKTVGQEFTKSGWGFAFPRDSPLAVDLSTAILRLSENGDLQRIHDKWLPPTGC  820

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
             SQ++ +  N+L L SF  LFL+ G ACL AL++ F
Sbjct  821  SSQDSGIGSNRLSLGSFWGLFLISGLACLVALIIFF  856



>ref|XP_010276016.1| PREDICTED: glutamate receptor 3.4-like [Nelumbo nucifera]
 ref|XP_010276017.1| PREDICTED: glutamate receptor 3.4-like [Nelumbo nucifera]
Length=931

 Score =   118 bits (295),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 55/98 (56%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = -1

Query  393  FLS-THCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGA  217
            FLS  +C+F IVG EF +SG GFAF + SPL++D+STA+ +LS+NG+LQRIHDKWL    
Sbjct  757  FLSHNNCKFKIVGQEFTKSGWGFAFPRDSPLAIDLSTAVLQLSENGDLQRIHDKWLSSNG  816

Query  216  CKSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
            C  Q  E+  N+L L SF  LFL+CG AC  ALL+ F+
Sbjct  817  CSMQVAEIDSNRLSLNSFWGLFLICGIACFLALLVFFV  854



>gb|EMT00479.1| Glutamate receptor 3.1 [Aegilops tauschii]
Length=1357

 Score =   118 bits (296),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 56/97 (58%), Positives = 72/97 (74%), Gaps = 2/97 (2%)
 Frame = -1

Query  393   FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLR--G  220
             FL  H +F +VGSEF +SG GFAF + SPL+VD+ST+I +LS+NG+LQRIHDKWL     
Sbjct  1225  FLLLHPKFAVVGSEFTKSGWGFAFPRDSPLAVDLSTSILQLSENGDLQRIHDKWLANDVA  1284

Query  219   ACKSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLH  109
                SQN EL+ ++L + SFS LFL+CG ACL AL +H
Sbjct  1285  GSMSQNNELESDRLQVYSFSGLFLICGVACLIALAIH  1321



>gb|EYU33298.1| hypothetical protein MIMGU_mgv1a001051mg [Erythranthe guttata]
Length=904

 Score =   118 bits (295),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 57/98 (58%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS +C F  VG EF +SG GFAF + SPL++DMSTAI  LS+NGEL++IHDKWL    C
Sbjct  729  FLSNYCMFQAVGREFTKSGWGFAFPRDSPLAMDMSTAILALSENGELEKIHDKWLKTSDC  788

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFML  100
              Q +    +QL LKSF  LFLMCG AC  ALL++F L
Sbjct  789  -GQTSSKDSDQLQLKSFWGLFLMCGIACFLALLVYFCL  825



>ref|XP_007203444.1| hypothetical protein PRUPE_ppa022019mg, partial [Prunus persica]
 gb|EMJ04643.1| hypothetical protein PRUPE_ppa022019mg, partial [Prunus persica]
Length=895

 Score =   117 bits (294),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 50/102 (49%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS+ C + IVG EF + G GFAF + SPL++DMSTA+ +LS+ G+LQ+IHDKWL++ AC
Sbjct  750  FLSSRCGYSIVGQEFTKMGWGFAFPRDSPLAIDMSTAVLKLSEKGDLQKIHDKWLMKSAC  809

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFMLGIYR  88
             ++  +  V++L +KSF  LFL+ G AC  AL+LH +  +++
Sbjct  810  SAEGAKQAVDRLQIKSFWGLFLLSGIACFLALVLHVIRMMHK  851



>ref|XP_004487406.1| PREDICTED: glutamate receptor 3.4-like isoform X4 [Cicer arietinum]
 ref|XP_004487407.1| PREDICTED: glutamate receptor 3.4-like isoform X5 [Cicer arietinum]
Length=904

 Score =   117 bits (294),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/91 (58%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = -1

Query  387  STHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGACKS  208
            ST+C+F  VG EF +SG GFAF + SPL+VDMSTAI +LS+NG+LQ+IHDKWLL+  C +
Sbjct  738  STNCKFRTVGQEFTKSGWGFAFQRDSPLAVDMSTAILQLSENGDLQKIHDKWLLKHDCTA  797

Query  207  QNTELQVNQLHLKSFSMLFLMCGFACLFALL  115
            +  ++  N+L L SF  LFL+CG ACL AL+
Sbjct  798  KVDDVDSNELSLNSFWGLFLICGIACLLALI  828



>gb|AGN92471.1| glutamate receptor 1 [Echinochloa crus-galli]
Length=930

 Score =   117 bits (294),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 54/98 (55%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS +C F IVG +F R G GFAF + SPL+ DMSTAI +LS++G+LQRIHD+W  R  C
Sbjct  752  FLSYYCNFRIVGQQFTREGWGFAFQRDSPLAADMSTAILQLSESGQLQRIHDEWFTRPGC  811

Query  213  KS-QNTELQVNQLHLKSFSMLFLMCGFACLFALLLHFM  103
             +  +TE+   +L L SFS LFLMC   CLFAL+++F+
Sbjct  812  AADDDTEVGATRLGLGSFSGLFLMCAMTCLFALVVYFI  849



>ref|XP_004487403.1| PREDICTED: glutamate receptor 3.4-like isoform X1 [Cicer arietinum]
 ref|XP_004487404.1| PREDICTED: glutamate receptor 3.4-like isoform X2 [Cicer arietinum]
 ref|XP_004487405.1| PREDICTED: glutamate receptor 3.4-like isoform X3 [Cicer arietinum]
Length=932

 Score =   117 bits (294),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/91 (58%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = -1

Query  387  STHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGACKS  208
            ST+C+F  VG EF +SG GFAF + SPL+VDMSTAI +LS+NG+LQ+IHDKWLL+  C +
Sbjct  766  STNCKFRTVGQEFTKSGWGFAFQRDSPLAVDMSTAILQLSENGDLQKIHDKWLLKHDCTA  825

Query  207  QNTELQVNQLHLKSFSMLFLMCGFACLFALL  115
            +  ++  N+L L SF  LFL+CG ACL AL+
Sbjct  826  KVDDVDSNELSLNSFWGLFLICGIACLLALI  856



>ref|XP_008358485.1| PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 3.2-like, 
partial [Malus domestica]
Length=584

 Score =   116 bits (291),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/96 (55%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = -1

Query  393  FLSTHCEFCIVGSEFFRSGIGFAFSKSSPLSVDMSTAIQELSDNGELQRIHDKWLLRGAC  214
            FLS +CEF I GSEF +SG GFAF + SPL++DMSTAI  LS+NG+ QRI++KWL R  C
Sbjct  388  FLSENCEFSIRGSEFTKSGWGFAFPRDSPLAIDMSTAILTLSENGDXQRIYNKWLSRKIC  447

Query  213  KSQNTELQVNQLHLKSFSMLFLMCGFACLFALLLHF  106
             S+ ++   +QL L+SF  LFL+ G  C  ALL+H 
Sbjct  448  ASETSDXVSDQLQLQSFXGLFLIAGAVCFIALLIHL  483



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 514367491556