BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18912_g1_i1 len=1295 path=[2617:0-637 675:638-663 701:664-895
933:896-1294]

Length=1295
                                                                      Score     E

ref|XP_009590849.1|  PREDICTED: GDSL esterase/lipase LIP-4-like i...    484   5e-166   
ref|XP_011079509.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     473   1e-161   
ref|XP_010322302.1|  PREDICTED: GDSL esterase/lipase LIP-4-like i...    470   1e-160   
ref|XP_010038311.1|  PREDICTED: GDSL esterase/lipase At1g09390-li...    466   4e-159   
ref|XP_004229369.1|  PREDICTED: GDSL esterase/lipase LIP-4-like i...    465   6e-159   
ref|XP_006349250.1|  PREDICTED: GDSL esterase/lipase LIP-4-like         462   5e-158   
ref|XP_009762956.1|  PREDICTED: GDSL esterase/lipase LIP-4-like         457   4e-156   
ref|XP_002279341.1|  PREDICTED: GDSL esterase/lipase LIP-4              451   2e-153   Vitis vinifera
ref|XP_010270891.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     440   5e-149   
ref|XP_002515225.1|  zinc finger protein, putative                      438   3e-148   Ricinus communis
ref|XP_008447456.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     437   9e-148   
gb|EYU29018.1|  hypothetical protein MIMGU_mgv1a008515mg                436   3e-147   
ref|XP_004163919.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     434   3e-146   
ref|XP_004150835.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     432   1e-145   
emb|CAN71137.1|  hypothetical protein VITISV_025410                     430   2e-145   Vitis vinifera
ref|XP_010038312.1|  PREDICTED: GDSL esterase/lipase At1g09390-li...    431   2e-145   
ref|XP_011003171.1|  PREDICTED: GDSL esterase/lipase At1g09390          430   7e-145   
gb|KDP28305.1|  hypothetical protein JCGZ_14076                         429   9e-145   
ref|XP_002301534.1|  hypothetical protein POPTR_0002s19180g             426   9e-144   Populus trichocarpa [western balsam poplar]
ref|XP_011081091.1|  PREDICTED: GDSL esterase/lipase LIP-4-like i...    420   4e-141   
ref|XP_010094417.1|  GDSL esterase/lipase                               427   4e-141   
gb|KCW50135.1|  hypothetical protein EUGRSUZ_K03565                     419   8e-141   
ref|XP_010038310.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     419   9e-141   
ref|XP_010270892.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     419   1e-140   
ref|XP_011081092.1|  PREDICTED: GDSL esterase/lipase LIP-4-like i...    411   1e-137   
ref|XP_009796574.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     410   5e-137   
ref|XP_009620892.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     409   7e-137   
ref|XP_008811524.1|  PREDICTED: GDSL esterase/lipase LIP-4-like         409   8e-137   
gb|KDP23357.1|  hypothetical protein JCGZ_23190                         409   1e-136   
ref|XP_008453214.1|  PREDICTED: GDSL esterase/lipase At1g09390          408   1e-136   
ref|XP_006344804.1|  PREDICTED: GDSL esterase/lipase At1g09390-li...    408   3e-136   
ref|XP_009616811.1|  PREDICTED: GDSL esterase/lipase At1g09390          407   3e-136   
ref|XP_009794850.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     407   5e-136   
ref|XP_011092184.1|  PREDICTED: GDSL esterase/lipase At1g09390          405   5e-135   
ref|XP_004158741.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     404   5e-135   
ref|XP_004144804.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     404   5e-135   
ref|XP_004230336.1|  PREDICTED: GDSL esterase/lipase At1g09390          402   3e-134   
ref|XP_002891991.1|  GDSL-motif lipase/hydrolase family protein         402   4e-134   
ref|XP_007031217.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    402   4e-134   
ref|XP_010914677.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     402   6e-134   
emb|CBI37000.3|  unnamed protein product                                401   9e-134   
ref|XP_002272500.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     401   1e-133   Vitis vinifera
ref|XP_010909995.1|  PREDICTED: GDSL esterase/lipase LIP-4-like i...    400   2e-133   
ref|XP_010909997.1|  PREDICTED: GDSL esterase/lipase LIP-4-like         399   1e-132   
ref|XP_010941498.1|  PREDICTED: GDSL esterase/lipase LIP-4-like         398   1e-132   
ref|XP_008811523.1|  PREDICTED: GDSL esterase/lipase LIP-4-like         398   2e-132   
ref|XP_003554606.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     395   3e-131   
emb|CDY41697.1|  BnaA09g15250D                                          395   3e-131   
ref|XP_006392404.1|  hypothetical protein EUTSA_v10023535mg             395   4e-131   
emb|CDY64753.1|  BnaA06g37930D                                          395   4e-131   
ref|XP_010914676.1|  PREDICTED: GDSL esterase/lipase LIP-4-like         394   5e-131   
ref|XP_009148237.1|  PREDICTED: GDSL esterase/lipase At1g09390          394   7e-131   
ref|XP_009113364.1|  PREDICTED: GDSL esterase/lipase LIP-4              394   8e-131   
emb|CDX94973.1|  BnaC05g06980D                                          393   1e-130   
ref|NP_176059.1|  GDSL esterase/lipase LIP-4                            393   2e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302361.1|  hypothetical protein CARUB_v10020428mg             394   2e-130   
ref|XP_004494523.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     393   2e-130   
gb|EYU46852.1|  hypothetical protein MIMGU_mgv1a010014mg                390   4e-130   
ref|XP_010415016.1|  PREDICTED: GDSL esterase/lipase LIP-4-like i...    392   7e-130   
ref|XP_006417577.1|  hypothetical protein EUTSA_v10007968mg             391   9e-130   
ref|XP_009393150.1|  PREDICTED: GDSL esterase/lipase At1g09390 is...    391   1e-129   
ref|XP_010674543.1|  PREDICTED: GDSL esterase/lipase At1g09390          390   1e-129   
ref|NP_172410.1|  GDSL esterase/lipase                                  390   2e-129   Arabidopsis thaliana [mouse-ear cress]
emb|CDP15217.1|  unnamed protein product                                390   2e-129   
ref|XP_010553708.1|  PREDICTED: GDSL esterase/lipase At1g09390          390   4e-129   
ref|XP_006480703.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     390   4e-129   
ref|XP_011081093.1|  PREDICTED: GDSL esterase/lipase LIP-4-like i...    389   5e-129   
ref|XP_011038990.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     389   7e-129   
ref|XP_011081094.1|  PREDICTED: GDSL esterase/lipase LIP-4-like i...    387   3e-128   
ref|XP_010458221.1|  PREDICTED: GDSL esterase/lipase At1g09390          387   6e-128   
gb|KFK43235.1|  hypothetical protein AALP_AA1G097500                    386   7e-128   
ref|XP_002889747.1|  GDSL-motif lipase/hydrolase family protein         386   8e-128   
ref|XP_009412146.1|  PREDICTED: GDSL esterase/lipase LIP-4-like         386   8e-128   
ref|XP_002512551.1|  zinc finger protein, putative                      386   1e-127   Ricinus communis
ref|XP_002277053.2|  PREDICTED: GDSL esterase/lipase At1g09390          384   5e-127   Vitis vinifera
ref|XP_004968679.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     385   6e-127   
ref|XP_010475774.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     384   8e-127   
ref|XP_006303656.1|  hypothetical protein CARUB_v10011694mg             382   3e-126   
ref|XP_007163304.1|  hypothetical protein PHAVU_001G223500g             382   4e-126   
emb|CBI39639.3|  unnamed protein product                                384   4e-126   
ref|XP_010092937.1|  GDSL esterase/lipase                               380   1e-125   
ref|XP_010489961.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     382   2e-125   
ref|XP_002306255.2|  GDSL-motif lipase/hydrolase family protein         379   2e-125   Populus trichocarpa [western balsam poplar]
ref|XP_006645844.1|  PREDICTED: GDSL esterase/lipase LIP-4-like         379   5e-125   
ref|XP_010026885.1|  PREDICTED: GDSL esterase/lipase LIP-4-like         379   5e-125   
ref|XP_003626167.1|  GDSL esterase/lipase                               379   5e-125   
gb|AES82385.2|  GDSL-like lipase/acylhydrolase                          378   9e-125   
ref|XP_006841596.1|  hypothetical protein AMTR_s00003p00205650          379   9e-125   
ref|XP_008246380.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     378   1e-124   
gb|EEC70553.1|  hypothetical protein OsI_01706                          379   1e-124   Oryza sativa Indica Group [Indian rice]
ref|XP_007207545.1|  hypothetical protein PRUPE_ppa017417mg             377   3e-124   
gb|EEE54472.1|  hypothetical protein OsJ_01574                          376   9e-124   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009393151.1|  PREDICTED: GDSL esterase/lipase At1g09390 is...    375   1e-123   
gb|EAY73836.1|  hypothetical protein OsI_01712                          375   2e-123   Oryza sativa Indica Group [Indian rice]
gb|KHN03916.1|  GDSL esterase/lipase                                    375   2e-123   
ref|XP_009383944.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     375   2e-123   
ref|XP_003521655.1|  PREDICTED: GDSL esterase/lipase At1g09390          375   2e-123   
ref|XP_010318022.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     373   2e-123   
ref|XP_009590850.1|  PREDICTED: GDSL esterase/lipase LIP-4-like i...    372   1e-122   
ref|XP_007207559.1|  hypothetical protein PRUPE_ppa016576mg             372   2e-122   
ref|XP_003565727.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     372   2e-122   
ref|XP_003565728.2|  PREDICTED: GDSL esterase/lipase LIP-4-like i...    371   7e-122   
ref|XP_008388450.1|  PREDICTED: GDSL esterase/lipase At1g09390          370   2e-121   
ref|XP_006645847.1|  PREDICTED: GDSL esterase/lipase LIP-4-like         370   2e-121   
ref|XP_009335511.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     368   5e-121   
ref|XP_010070070.1|  PREDICTED: GDSL esterase/lipase At1g09390          369   9e-121   
ref|XP_004163922.1|  PREDICTED: GDSL esterase/lipase At3g62280-like     369   1e-120   
gb|EPS71679.1|  hypothetical protein M569_03079                         366   4e-120   
ref|XP_008246276.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     368   1e-119   
ref|NP_001136917.1|  hypothetical protein precursor                     366   1e-119   Zea mays [maize]
gb|KHG08253.1|  hypothetical protein F383_34955                         362   3e-119   
ref|XP_010921570.1|  PREDICTED: GDSL esterase/lipase At1g09390          364   3e-119   
tpg|DAA54477.1|  TPA: hypothetical protein ZEAMMB73_818689              366   4e-119   
ref|XP_010559217.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     363   5e-119   
ref|XP_010559175.1|  PREDICTED: GDSL esterase/lipase At3g62280-like     363   7e-119   
tpg|DAA54475.1|  TPA: alpha-L-fucosidase 2                              363   2e-118   
ref|XP_002272542.2|  PREDICTED: GDSL esterase/lipase At3g62280          362   2e-118   Vitis vinifera
ref|XP_002455579.1|  hypothetical protein SORBIDRAFT_03g013370          364   2e-118   Sorghum bicolor [broomcorn]
ref|XP_008246381.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     362   2e-118   
dbj|BAJ98083.1|  predicted protein                                      362   4e-118   
dbj|BAJ88733.1|  predicted protein                                      362   4e-118   
ref|XP_007207836.1|  hypothetical protein PRUPE_ppa023404mg             359   5e-118   
gb|ACG28441.1|  alpha-L-fucosidase 2 precursor                          361   7e-118   Zea mays [maize]
ref|XP_007051220.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    360   1e-117   
ref|NP_001152225.1|  alpha-L-fucosidase 2 precursor                     360   2e-117   Zea mays [maize]
ref|XP_007205390.1|  hypothetical protein PRUPE_ppa007411mg             357   2e-116   
ref|XP_002886995.1|  carboxylic ester hydrolase                         355   1e-115   
ref|XP_002878447.1|  carboxylic ester hydrolase                         353   4e-115   
ref|XP_004302302.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     352   7e-115   
ref|NP_191787.2|  GDSL esterase/lipase                                  352   1e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010679450.1|  PREDICTED: GDSL esterase/lipase At3g62280          352   2e-114   
ref|XP_004968678.1|  PREDICTED: GDSL esterase/lipase LIP-4-like         352   2e-114   
ref|XP_009401648.1|  PREDICTED: GDSL esterase/lipase At1g09390          351   5e-114   
ref|XP_007051219.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    350   5e-114   
ref|XP_006292520.1|  hypothetical protein CARUB_v10018750mg             348   4e-113   
ref|NP_001042924.1|  Os01g0329900                                       350   7e-113   Oryza sativa Japonica Group [Japonica rice]
emb|CDY25101.1|  BnaC06g18430D                                          347   2e-112   
ref|XP_010413293.1|  PREDICTED: GDSL esterase/lipase At3g62280          346   4e-112   
ref|XP_010468971.1|  PREDICTED: GDSL esterase/lipase At3g62280-like     344   2e-111   
ref|XP_009104379.1|  PREDICTED: GDSL esterase/lipase At3g62280          343   5e-111   
gb|ACN33401.1|  unknown                                                 345   6e-111   Zea mays [maize]
ref|NP_001151259.1|  alpha-L-fucosidase 2                               345   6e-111   Zea mays [maize]
gb|KFK35412.1|  hypothetical protein AALP_AA5G281200                    342   8e-111   
ref|XP_010512615.1|  PREDICTED: GDSL esterase/lipase At3g62280-like     342   1e-110   
ref|XP_006402391.1|  hypothetical protein EUTSA_v10006046mg             342   2e-110   
emb|CDX67886.1|  BnaA07g19260D                                          338   3e-109   
ref|XP_004968676.1|  PREDICTED: GDSL esterase/lipase At1g09390-li...    338   4e-108   
ref|XP_006354219.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     333   4e-108   
ref|XP_006645843.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     336   6e-108   
gb|AAC23651.1|  lipase homolog                                          332   1e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002455576.1|  hypothetical protein SORBIDRAFT_03g013350          333   2e-106   Sorghum bicolor [broomcorn]
dbj|BAK01974.1|  predicted protein                                      332   6e-106   
ref|XP_003565731.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     331   1e-105   
ref|XP_010481241.1|  PREDICTED: GDSL esterase/lipase LIP-4              323   4e-104   
gb|EAY73827.1|  hypothetical protein OsI_01703                          325   3e-103   Oryza sativa Indica Group [Indian rice]
gb|EAZ11710.1|  hypothetical protein OsJ_01572                          325   3e-103   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010666891.1|  PREDICTED: uncharacterized protein LOC104884004    331   2e-101   
ref|XP_010278961.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     318   3e-101   
ref|XP_003568872.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     318   2e-100   
gb|KDP23550.1|  hypothetical protein JCGZ_23383                         316   3e-100   
ref|XP_006344805.1|  PREDICTED: GDSL esterase/lipase At1g09390-li...    313   8e-100   
dbj|BAJ90505.1|  predicted protein                                      316   1e-99    
dbj|BAJ97279.1|  predicted protein                                      316   1e-99    
emb|CDX95282.1|  BnaC09g15880D                                          313   7e-99    
ref|XP_010255785.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    312   8e-99    
emb|CAN71136.1|  hypothetical protein VITISV_025409                     311   8e-99    Vitis vinifera
ref|XP_002284922.1|  PREDICTED: GDSL esterase/lipase At1g54790          310   3e-98    Vitis vinifera
gb|ACF78634.1|  unknown                                                 311   4e-98    Zea mays [maize]
ref|XP_010255784.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    311   6e-98    
ref|XP_009602454.1|  PREDICTED: GDSL esterase/lipase At1g54790          310   7e-98    
ref|XP_004958745.1|  PREDICTED: GDSL esterase/lipase LIP-4-like         311   8e-98    
ref|NP_001130430.1|  uncharacterized protein LOC100191527               311   9e-98    Zea mays [maize]
dbj|BAG94628.1|  unnamed protein product                                306   1e-97    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004977099.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     311   1e-97    
ref|XP_009773596.1|  PREDICTED: GDSL esterase/lipase At1g54790          309   2e-97    
ref|NP_001266522.1|  alpha-L-fucosidase 2 precursor                     310   3e-97    
ref|XP_007030927.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    307   6e-97    
ref|XP_006850822.1|  hypothetical protein AMTR_s00025p00126710          307   6e-97    
ref|XP_002512338.1|  Alpha-L-fucosidase 2 precursor, putative           307   7e-97    Ricinus communis
ref|XP_010415017.1|  PREDICTED: GDSL esterase/lipase LIP-4-like i...    304   8e-97    
gb|KEH24462.1|  GDSL-like lipase/acylhydrolase                          303   9e-97    
ref|XP_010255795.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     305   4e-96    
emb|CAB71888.1|  putative protein                                       304   5e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010025155.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    304   2e-95    
ref|XP_007030926.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    303   3e-95    
ref|XP_010414921.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    303   3e-95    
ref|NP_001174207.1|  Os05g0133401                                       302   3e-95    
gb|AAT85172.1|  hypothetical protein                                    302   3e-95    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011099272.1|  PREDICTED: GDSL esterase/lipase At1g54790          303   4e-95    
ref|XP_004494637.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    303   5e-95    
ref|XP_010068405.1|  PREDICTED: GDSL esterase/lipase LIP-4-like         298   5e-95    
ref|XP_010414922.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    302   8e-95    
ref|XP_009420985.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     302   8e-95    
ref|XP_010938793.1|  PREDICTED: GDSL esterase/lipase At1g54790          302   8e-95    
ref|XP_004230167.1|  PREDICTED: GDSL esterase/lipase At1g54790          302   8e-95    
ref|XP_008246516.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    301   1e-94    
ref|XP_010511213.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    302   1e-94    
ref|XP_009405865.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     301   1e-94    
emb|CDP17963.1|  unnamed protein product                                301   1e-94    
gb|KDO46014.1|  hypothetical protein CISIN_1g0171852mg                  298   2e-94    
ref|XP_008812793.1|  PREDICTED: GDSL esterase/lipase At1g54790          301   3e-94    
ref|XP_006361875.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     300   4e-94    
ref|XP_004494638.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    299   1e-93    
dbj|BAJ97713.1|  predicted protein                                      301   1e-93    
ref|XP_008246517.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    298   1e-93    
ref|XP_004139196.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     298   2e-93    
gb|KCW63693.1|  hypothetical protein EUGRSUZ_G01346                     295   2e-93    
gb|KGN60869.1|  hypothetical protein Csa_2G020920                       298   2e-93    
ref|XP_010511214.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    298   2e-93    
ref|XP_006654078.1|  PREDICTED: GDSL esterase/lipase LIP-4-like         300   2e-93    
ref|NP_001054715.1|  Os05g0159200                                       300   2e-93    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010414923.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    298   3e-93    
ref|XP_006302395.1|  hypothetical protein CARUB_v10020463mg             297   5e-93    
ref|XP_011023543.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    297   5e-93    
ref|NP_001185228.1|  GDSL esterase/lipase                               297   5e-93    
ref|XP_010025156.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    297   6e-93    
gb|KHG09761.1|  hypothetical protein F383_12143                         297   8e-93    
ref|XP_002894604.1|  hypothetical protein ARALYDRAFT_474754             296   8e-93    
ref|XP_004156431.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     296   1e-92    
gb|EPS58572.1|  hypothetical protein M569_16239                         296   1e-92    
ref|XP_002455582.1|  hypothetical protein SORBIDRAFT_03g013400          293   1e-92    Sorghum bicolor [broomcorn]
gb|AAM61525.1|  early nodule-specific protein, putative                 296   1e-92    Arabidopsis thaliana [mouse-ear cress]
ref|NP_564668.1|  GDSL esterase/lipase                                  296   2e-92    Arabidopsis thaliana [mouse-ear cress]
gb|KDP21506.1|  hypothetical protein JCGZ_21977                         296   2e-92    
ref|XP_002440646.1|  hypothetical protein SORBIDRAFT_09g004550          298   2e-92    Sorghum bicolor [broomcorn]
ref|XP_010256199.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     296   2e-92    
ref|XP_006655015.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     296   2e-92    
ref|XP_003566681.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     295   2e-92    
ref|XP_010278953.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     295   3e-92    
gb|EEE62413.1|  hypothetical protein OsJ_17204                          297   3e-92    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006577256.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    295   3e-92    
ref|XP_008455108.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     297   5e-92    
emb|CAN82038.1|  hypothetical protein VITISV_033903                     295   5e-92    Vitis vinifera
ref|XP_006471886.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    295   6e-92    
ref|XP_002319029.2|  GDSL-motif lipase/hydrolase family protein         294   7e-92    Populus trichocarpa [western balsam poplar]
ref|XP_010025157.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    297   9e-92    
ref|XP_004156481.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     294   1e-91    
ref|XP_006392486.1|  hypothetical protein EUTSA_v10023524mg             294   1e-91    
gb|ACU22979.1|  unknown                                                 293   2e-91    Glycine max [soybeans]
ref|XP_011023542.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    293   2e-91    
ref|XP_004139365.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     293   2e-91    
ref|XP_006382647.1|  hypothetical protein POPTR_0005s04100g             293   2e-91    
ref|XP_003568873.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     295   3e-91    
ref|XP_002319556.2|  hypothetical protein POPTR_0013s02730g             293   3e-91    Populus trichocarpa [western balsam poplar]
ref|XP_002524808.1|  Alpha-L-fucosidase 2 precursor, putative           294   3e-91    Ricinus communis
ref|XP_006471885.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    292   5e-91    
ref|XP_011048918.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    292   6e-91    
ref|XP_004977098.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     293   6e-91    
ref|XP_007147074.1|  hypothetical protein PHAVU_006G094100g             291   9e-91    
ref|XP_006577255.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    291   9e-91    
ref|XP_004302457.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    290   2e-90    
ref|XP_003536096.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    290   2e-90    
gb|ABD32376.1|  Lipolytic enzyme, G-D-S-L                               290   4e-90    Medicago truncatula
gb|ACU17816.1|  unknown                                                 290   4e-90    Glycine max [soybeans]
ref|XP_003554666.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    290   4e-90    
ref|XP_008656487.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     291   5e-90    
gb|AFK34131.1|  unknown                                                 289   7e-90    
ref|XP_006382646.1|  GDSL-motif lipase/hydrolase family protein         289   1e-89    
ref|XP_003554667.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    288   1e-89    
gb|KHG03048.1|  hypothetical protein F383_28241                         288   1e-89    
ref|XP_007207217.1|  hypothetical protein PRUPE_ppa001667mg             300   1e-89    
ref|XP_010675010.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    288   2e-89    
ref|XP_009335632.1|  PREDICTED: GDSL esterase/lipase At1g54790          288   2e-89    
emb|CDX71574.1|  BnaC04g18090D                                          288   3e-89    
ref|XP_010111858.1|  GDSL esterase/lipase                               288   4e-89    
ref|XP_003626321.1|  GDSL esterase/lipase                               290   4e-89    
ref|XP_004150839.1|  PREDICTED: GDSL esterase/lipase At3g62280-like     284   5e-89    
ref|XP_004139194.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     287   6e-89    
ref|XP_008370518.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     287   6e-89    
ref|XP_010675009.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    287   6e-89    
ref|XP_011048917.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    287   9e-89    
ref|XP_010553741.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    286   9e-89    
ref|XP_011010771.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    286   9e-89    
ref|XP_008455044.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     286   9e-89    
ref|XP_009373966.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    286   1e-88    
ref|XP_010553740.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    286   1e-88    
gb|KDP26685.1|  hypothetical protein JCGZ_17843                         286   2e-88    
ref|XP_010230852.1|  PREDICTED: GDSL esterase/lipase LIP-4-like i...    284   2e-88    
ref|XP_004156429.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     285   2e-88    
ref|XP_009373965.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    285   2e-88    
ref|XP_009123459.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    285   3e-88    
ref|XP_006433175.1|  hypothetical protein CICLE_v10000365mg             295   4e-88    
ref|XP_007050689.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    285   4e-88    
gb|AFM93776.1|  putative lipolytic protein                              285   4e-88    
ref|XP_008388596.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    284   6e-88    
ref|XP_006654372.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    284   1e-87    
ref|XP_009123458.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    283   1e-87    
gb|AES82539.2|  GDSL-like lipase/acylhydrolase                          283   1e-87    
ref|XP_008345621.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    283   2e-87    
ref|XP_008388597.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    283   2e-87    
ref|XP_002301566.1|  hypothetical protein POPTR_0002s22450g             282   3e-87    
ref|XP_004962147.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     282   4e-87    
ref|XP_008455063.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    282   5e-87    
ref|XP_004302456.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    281   5e-87    
gb|KHN43360.1|  GDSL esterase/lipase                                    276   6e-87    
ref|NP_974029.1|  GDSL esterase/lipase                                  282   7e-87    
ref|XP_003554066.1|  PREDICTED: GDSL esterase/lipase At3g26430          281   9e-87    
gb|KHN34622.1|  GDSL esterase/lipase                                    281   1e-86    
gb|KHG21223.1|  hypothetical protein F383_05901                         281   2e-86    
gb|EAY97978.1|  hypothetical protein OsI_19897                          280   2e-86    
ref|XP_008455055.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    280   3e-86    
dbj|BAH00916.1|  unnamed protein product                                280   3e-86    
gb|KEH20768.1|  GDSL-like lipase/acylhydrolase                          280   4e-86    
ref|XP_010248683.1|  PREDICTED: GDSL esterase/lipase At3g26430          279   5e-86    
ref|XP_010682312.1|  PREDICTED: uncharacterized protein LOC104897187    290   7e-86    
gb|KCW62932.1|  hypothetical protein EUGRSUZ_G00524                     276   7e-86    
ref|XP_006470339.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     278   1e-85    
ref|XP_008447455.1|  PREDICTED: GDSL esterase/lipase At3g62280          276   1e-85    
gb|AFW77932.1|  hypothetical protein ZEAMMB73_209815                    278   2e-85    
ref|XP_010682277.1|  PREDICTED: GDSL esterase/lipase At3g26430          278   2e-85    
ref|XP_006438237.1|  hypothetical protein CICLE_v10031879mg             277   3e-85    
gb|KDO68828.1|  hypothetical protein CISIN_1g046546mg                   276   3e-85    
ref|XP_006446489.1|  hypothetical protein CICLE_v10015583mg             277   3e-85    
ref|XP_010044559.1|  PREDICTED: GDSL esterase/lipase At3g26430-li...    278   3e-85    
ref|XP_006480105.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     276   4e-85    
gb|EEE62411.1|  hypothetical protein OsJ_17202                          273   1e-84    
ref|XP_006421383.1|  hypothetical protein CICLE_v10005152mg             276   1e-84    
emb|CDP13237.1|  unnamed protein product                                276   1e-84    
gb|KDO82202.1|  hypothetical protein CISIN_1g017691mg                   275   1e-84    
ref|XP_006483961.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     276   2e-84    
ref|XP_007044833.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    276   2e-84    
ref|XP_006852384.1|  hypothetical protein AMTR_s00049p00231110          274   3e-84    
ref|XP_004173555.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    274   4e-84    
ref|XP_004504128.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     275   4e-84    
ref|XP_010682276.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     275   6e-84    
ref|XP_009334073.1|  PREDICTED: GDSL esterase/lipase At3g27950          273   8e-84    
ref|XP_004141116.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     273   8e-84    
ref|XP_002530044.1|  Alpha-L-fucosidase 2 precursor, putative           274   9e-84    
ref|XP_002285512.1|  PREDICTED: GDSL esterase/lipase At3g26430          273   1e-83    
ref|XP_007216369.1|  hypothetical protein PRUPE_ppa019167mg             272   1e-83    
ref|XP_011087101.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     273   2e-83    
ref|XP_003566260.1|  PREDICTED: GDSL esterase/lipase At1g54790          273   2e-83    
ref|XP_008464934.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     271   7e-83    
ref|XP_010652105.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     271   1e-82    
ref|XP_004304620.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     270   1e-82    
ref|XP_010090352.1|  GDSL esterase/lipase                               280   1e-82    
emb|CBI32324.3|  unnamed protein product                                271   1e-82    
ref|XP_004239139.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     270   1e-82    
ref|XP_010322965.1|  PREDICTED: GDSL esterase/lipase At3g27950          270   2e-82    
ref|XP_002530043.1|  Alpha-L-fucosidase 2 precursor, putative           270   2e-82    
dbj|BAD54729.1|  putative lipase homolog                                271   2e-82    
gb|EMT12796.1|  GDSL esterase/lipase                                    266   3e-82    
ref|XP_004493252.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     269   4e-82    
gb|EYU30623.1|  hypothetical protein MIMGU_mgv1a007766mg                270   5e-82    
ref|XP_003531330.1|  PREDICTED: GDSL esterase/lipase At3g26430 is...    269   6e-82    
gb|KHN29023.1|  GDSL esterase/lipase                                    269   6e-82    
ref|XP_003624763.1|  GDSL esterase/lipase                               269   7e-82    
ref|XP_010044558.1|  PREDICTED: GDSL esterase/lipase At3g26430-li...    269   1e-81    
emb|CBI34924.3|  unnamed protein product                                268   1e-81    
ref|XP_008230605.1|  PREDICTED: GDSL esterase/lipase At3g27950          268   1e-81    
ref|XP_004142807.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     268   1e-81    
ref|XP_007161910.1|  hypothetical protein PHAVU_001G107900g             268   2e-81    
ref|XP_008458758.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     267   2e-81    
ref|XP_009617545.1|  PREDICTED: GDSL esterase/lipase At3g27950 is...    268   2e-81    
ref|XP_007044830.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    268   2e-81    
ref|XP_002274412.3|  PREDICTED: GDSL esterase/lipase At3g27950          268   2e-81    
ref|XP_009771354.1|  PREDICTED: GDSL esterase/lipase At5g14450 is...    268   2e-81    
ref|XP_010243019.1|  PREDICTED: GDSL esterase/lipase At5g14450 is...    267   2e-81    
ref|XP_010029184.1|  PREDICTED: GDSL esterase/lipase At3g27950 is...    267   3e-81    
dbj|BAG09557.1|  acetylcholinesterase                                   267   3e-81    
ref|XP_006382645.1|  hypothetical protein POPTR_0005s04100g             267   3e-81    
emb|CBI16797.3|  unnamed protein product                                267   3e-81    
ref|XP_006347466.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     266   3e-81    
gb|KHN43265.1|  GDSL esterase/lipase                                    278   3e-81    
ref|XP_008379791.1|  PREDICTED: GDSL esterase/lipase At3g27950          266   4e-81    
ref|XP_010029183.1|  PREDICTED: GDSL esterase/lipase At3g27950 is...    266   5e-81    
ref|XP_002530042.1|  Alpha-L-fucosidase 2 precursor, putative           266   6e-81    
emb|CDP13238.1|  unnamed protein product                                266   8e-81    
ref|XP_010044562.1|  PREDICTED: GDSL esterase/lipase At3g26430-li...    266   8e-81    
gb|KDP45344.1|  hypothetical protein JCGZ_09593                         265   1e-80    
ref|XP_009386685.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     266   1e-80    
ref|XP_008221893.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     266   1e-80    
emb|CBI16798.3|  unnamed protein product                                266   1e-80    
ref|XP_009778765.1|  PREDICTED: GDSL esterase/lipase At3g27950-li...    265   1e-80    
ref|XP_009406370.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     266   1e-80    
ref|XP_007227131.1|  hypothetical protein PRUPE_ppa026073mg             265   1e-80    
emb|CDP02115.1|  unnamed protein product                                265   2e-80    
ref|XP_002517326.1|  Alpha-L-fucosidase 2 precursor, putative           264   2e-80    
ref|XP_004156679.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     265   2e-80    
ref|XP_009779717.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    265   3e-80    
ref|XP_007159263.1|  hypothetical protein PHAVU_002G223300g             264   3e-80    
ref|XP_010100372.1|  GDSL esterase/lipase                               265   4e-80    
ref|XP_007044832.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    276   4e-80    
gb|KDP46394.1|  hypothetical protein JCGZ_10234                         264   5e-80    
ref|XP_007031629.1|  Esterase, putative                                 264   5e-80    
ref|XP_006446639.1|  hypothetical protein CICLE_v10015574mg             264   5e-80    
ref|XP_007199058.1|  hypothetical protein PRUPE_ppa018616mg             263   6e-80    
gb|EMT11340.1|  GDSL esterase/lipase                                    260   7e-80    
ref|XP_003589576.1|  Early nodulin                                      264   7e-80    
ref|XP_008340092.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     265   9e-80    
ref|XP_006357593.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     263   9e-80    
ref|XP_011034054.1|  PREDICTED: GDSL esterase/lipase At3g26430-li...    263   1e-79    
ref|XP_003591059.1|  GDSL esterase/lipase                               263   1e-79    
ref|XP_006446637.1|  hypothetical protein CICLE_v10015586mg             263   1e-79    
emb|CDY18785.1|  BnaAnng02500D                                          262   1e-79    
ref|XP_009124066.1|  PREDICTED: GDSL esterase/lipase At3g05180-like     262   2e-79    
ref|XP_009771352.1|  PREDICTED: GDSL esterase/lipase At5g14450 is...    263   2e-79    
ref|XP_009771353.1|  PREDICTED: GDSL esterase/lipase At5g14450 is...    263   2e-79    
ref|XP_004298997.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     263   2e-79    
gb|AGZ15410.1|  acetylcholinesterase                                    262   2e-79    
ref|XP_007044829.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    262   2e-79    
ref|XP_008458756.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     262   3e-79    
ref|XP_004239137.1|  PREDICTED: GDSL esterase/lipase At3g26430-li...    261   3e-79    
ref|XP_011097365.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     261   3e-79    
gb|ACJ85056.1|  unknown                                                 261   3e-79    
ref|XP_010029093.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     262   4e-79    
ref|XP_002871620.1|  GDSL-motif lipase/hydrolase family protein         261   4e-79    
ref|XP_003547701.1|  PREDICTED: GDSL esterase/lipase At5g14450 is...    261   4e-79    
ref|XP_008235068.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     261   4e-79    
ref|XP_007227294.1|  hypothetical protein PRUPE_ppa017062mg             261   5e-79    
ref|XP_007215529.1|  hypothetical protein PRUPE_ppa007107mg             261   5e-79    
ref|XP_010320940.1|  PREDICTED: GDSL esterase/lipase At3g26430-li...    261   6e-79    
gb|KCW59731.1|  hypothetical protein EUGRSUZ_H02484                     261   7e-79    
ref|XP_004159075.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     261   7e-79    
ref|XP_010100371.1|  GDSL esterase/lipase                               261   9e-79    
ref|XP_002311760.2|  GDSL-motif lipase/hydrolase family protein         261   1e-78    
ref|XP_004142359.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     260   1e-78    
ref|XP_009359342.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    263   1e-78    
ref|XP_007031628.1|  Esterase, putative isoform 2                       260   1e-78    
ref|XP_008221990.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    260   1e-78    
gb|KEH22102.1|  GDSL-like lipase/acylhydrolase                          260   1e-78    
ref|XP_007031463.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    260   2e-78    
ref|XP_010044555.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     260   2e-78    
emb|CDY53232.1|  BnaCnng24650D                                          259   2e-78    
ref|XP_007201349.1|  hypothetical protein PRUPE_ppa007674mg             259   2e-78    
ref|XP_003624771.1|  GDSL esterase/lipase                               259   2e-78    
ref|XP_006470214.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     259   3e-78    
ref|XP_009121660.1|  PREDICTED: GDSL esterase/lipase At5g14450          259   3e-78    
ref|XP_002875415.1|  hypothetical protein ARALYDRAFT_484583             258   3e-78    
ref|XP_008446147.1|  PREDICTED: GDSL esterase/lipase At3g26430          259   3e-78    
ref|XP_006852383.1|  hypothetical protein AMTR_s00049p00230810          259   3e-78    
emb|CDY13633.1|  BnaA06g32900D                                          259   3e-78    
ref|XP_006357594.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     259   3e-78    
ref|XP_007221845.1|  hypothetical protein PRUPE_ppa024482mg             259   3e-78    
ref|XP_007223054.1|  hypothetical protein PRUPE_ppa006965mg             259   3e-78    
ref|XP_009779715.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     259   3e-78    
ref|XP_008230503.1|  PREDICTED: GDSL esterase/lipase At5g14450-li...    259   4e-78    
ref|XP_010248682.1|  PREDICTED: GDSL esterase/lipase At5g14450          259   4e-78    
gb|KCW86642.1|  hypothetical protein EUGRSUZ_B03271                     260   4e-78    
ref|XP_002513811.1|  Esterase precursor, putative                       259   4e-78    
ref|XP_006438239.1|  hypothetical protein CICLE_v10031753mg             259   4e-78    
ref|XP_010909996.1|  PREDICTED: GDSL esterase/lipase LIP-4-like i...    256   4e-78    
ref|XP_006470213.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     258   5e-78    
ref|XP_002300062.1|  hypothetical protein POPTR_0001s35620g             258   5e-78    
gb|AAC26810.1|  early nodule-specific protein                           258   5e-78    
ref|XP_009611346.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     258   6e-78    
ref|XP_010453569.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     259   6e-78    
gb|KEH40536.1|  GDSL-like lipase/acylhydrolase                          258   6e-78    
gb|KDO49031.1|  hypothetical protein CISIN_1g016659mg                   258   6e-78    
ref|XP_010420084.1|  PREDICTED: GDSL esterase/lipase At5g14450          258   7e-78    
gb|AAL68832.1|AF463407_3  Enod8.1                                       258   1e-77    
ref|XP_004489281.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     258   1e-77    
ref|XP_008379194.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     258   1e-77    
ref|XP_010044556.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     258   1e-77    
emb|CAN71345.1|  hypothetical protein VITISV_024250                     258   1e-77    
ref|XP_011003110.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     258   1e-77    
ref|XP_003589586.1|  Enod8.3                                            258   2e-77    
ref|XP_007159696.1|  hypothetical protein PHAVU_002G259500g             257   2e-77    
ref|XP_002521491.1|  Esterase precursor, putative                       258   2e-77    
gb|KHN33853.1|  Esterase                                                257   2e-77    
ref|XP_007224356.1|  hypothetical protein PRUPE_ppa020848mg             257   2e-77    
ref|XP_003524542.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     257   2e-77    
ref|XP_006408104.1|  hypothetical protein EUTSA_v10020927mg             257   2e-77    
ref|XP_010243018.1|  PREDICTED: GDSL esterase/lipase At5g14450 is...    257   2e-77    
ref|XP_004290682.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     256   2e-77    
ref|XP_007031630.1|  Esterase, putative                                 257   2e-77    
ref|XP_010554006.1|  PREDICTED: GDSL esterase/lipase At3g27950          256   2e-77    
ref|XP_006292652.1|  hypothetical protein CARUB_v10018895mg             256   3e-77    
ref|XP_006852386.1|  hypothetical protein AMTR_s00049p00231360          256   3e-77    
gb|EYU34754.1|  hypothetical protein MIMGU_mgv11b006645mg               257   3e-77    
ref|XP_002285509.2|  PREDICTED: uncharacterized protein LOC100264440    267   3e-77    
ref|XP_004158356.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     256   3e-77    
ref|XP_010243017.1|  PREDICTED: GDSL esterase/lipase At5g14450 is...    256   3e-77    
emb|CDY09855.1|  BnaC09g43060D                                          256   3e-77    
ref|XP_010551928.1|  PREDICTED: GDSL esterase/lipase At5g14450          256   4e-77    
ref|XP_006289899.1|  hypothetical protein CARUB_v10003515mg             256   4e-77    
ref|XP_008219729.1|  PREDICTED: esterase-like                           256   5e-77    
ref|XP_007141047.1|  hypothetical protein PHAVU_008G162800g             256   6e-77    
ref|NP_001241984.1|  uncharacterized protein LOC100785435 precursor     256   6e-77    
ref|XP_008365369.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     256   6e-77    
ref|XP_011097366.1|  PREDICTED: GDSL esterase/lipase At5g14450-li...    254   8e-77    
ref|XP_010492254.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     256   9e-77    
ref|XP_009152056.1|  PREDICTED: GDSL esterase/lipase At3g26430          255   9e-77    
emb|CDX83618.1|  BnaC07g23580D                                          255   1e-76    
ref|XP_008219730.1|  PREDICTED: LOW QUALITY PROTEIN: esterase-like      255   1e-76    
ref|XP_002284695.1|  PREDICTED: esterase                                255   1e-76    
gb|KHN23536.1|  GDSL esterase/lipase                                    255   1e-76    
ref|XP_010100370.1|  GDSL esterase/lipase                               265   1e-76    
ref|XP_010044557.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     255   1e-76    
ref|XP_010029090.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     255   1e-76    
ref|XP_006852380.1|  hypothetical protein AMTR_s00049p00229270          255   1e-76    
ref|XP_009147268.1|  PREDICTED: GDSL esterase/lipase At3g05180          255   1e-76    
ref|XP_010912877.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     255   1e-76    
ref|XP_010929893.1|  PREDICTED: alpha-L-fucosidase 3                    255   1e-76    
ref|NP_189434.1|  GDSL esterase/lipase                                  254   1e-76    
gb|KGN59717.1|  hypothetical protein Csa_3G840430                       254   1e-76    
ref|XP_010089185.1|  GDSL esterase/lipase                               255   1e-76    
ref|XP_010546666.1|  PREDICTED: GDSL esterase/lipase At3g05180          255   1e-76    
ref|XP_011101808.1|  PREDICTED: GDSL esterase/lipase At5g14450          255   1e-76    
ref|XP_010430826.1|  PREDICTED: GDSL esterase/lipase At3g27950          254   2e-76    



>ref|XP_009590849.1| PREDICTED: GDSL esterase/lipase LIP-4-like isoform X1 [Nicotiana 
tomentosiformis]
Length=382

 Score =   484 bits (1246),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 237/374 (63%), Positives = 289/374 (77%), Gaps = 11/374 (3%)
 Frame = +3

Query  12    HTDMDTNQRA-AMFVFITCSAFLVLSS-PPLAAAECIRNPVIFNFGDSNSDTGGYPAAHG  185
             +  M T+ R  + FV   C + L +S    +   EC +N VIFNFGDSNSDTGGY AAHG
Sbjct  14    YMKMKTSSRTNSTFVLFACFSMLCISQLANVVVCECSKNMVIFNFGDSNSDTGGYAAAHG  73

Query  186   NIFGYPDGRTFFH-RSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGG  362
               FG+PDGRTFFH + SDRLCDGR+I+DFLCE++   YLSPYLE++ P+F NGVNFAIGG
Sbjct  74    IRFGFPDGRTFFHDQPSDRLCDGRIILDFLCESLNMSYLSPYLESVKPNFNNGVNFAIGG  133

Query  363   SQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGA  542
             + TLPK  LF+LSTQ+LQF RF+ R L+  SKG    L EEDF+NA+YMIDIGQNDIA A
Sbjct  134   ATTLPKNALFTLSTQVLQFIRFKARYLQLQSKGLKD-LAEEDFKNAIYMIDIGQNDIANA  192

Query  543   FSYLSKA-QVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPN  719
             FSYLS+A QV+EKIPSFISEI+ A+W IY   G+ FWVHNTGP+GCLP+ LAT       
Sbjct  193   FSYLSQASQVLEKIPSFISEIQAAIWGIYNNSGKNFWVHNTGPLGCLPQKLATRN----G  248

Query  720   TEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGF  899
             +   + GCIKS+NEAA  FN +L  LCE+LR +MKDATIVYV+IY IKY+LI+NS+ YG 
Sbjct  249   SNLNDYGCIKSMNEAADAFNNQLRALCEQLRLQMKDATIVYVNIYAIKYDLIANSSAYGI  308

Query  900   ENPLMACCGGGGAP--YNANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLST  1073
             +NPLM CCG GG P  YN+NI+C QSG+S+C+DGS YISWDGVHYTE ANA+VA+ +LST
Sbjct  309   QNPLMVCCGYGGPPYNYNSNITCRQSGYSLCEDGSAYISWDGVHYTEYANAIVASKILST  368

Query  1074  NYSTPPFNFDYFCS  1115
             NYSTPP N ++FC+
Sbjct  369   NYSTPPLNLNHFCT  382



>ref|XP_011079509.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Sesamum indicum]
Length=377

 Score =   473 bits (1216),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 221/343 (64%), Positives = 268/343 (78%), Gaps = 4/343 (1%)
 Frame = +3

Query  93    PLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFL  272
             P  A +C +NPVIFNFGDSNSDTGGY AA G  FGYPDGR FFH+ + RLCDGRL+IDFL
Sbjct  35    PFVACQCNKNPVIFNFGDSNSDTGGYSAALGFNFGYPDGRAFFHQPTGRLCDGRLVIDFL  94

Query  273   CENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFH  452
             CE++K +YL+PYL++L P+F NGVNFAI GS T P++V FSL  Q+LQF RF  RSL F 
Sbjct  95    CESLKTNYLTPYLDSLEPNFTNGVNFAISGSATFPRYVPFSLDVQVLQFRRFHNRSLGFQ  154

Query  453   SKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKV  632
             SKG   ++ EEDF NALY IDIGQND+  AF+ LS A V+ KIPSFISEI+DA+WAIY V
Sbjct  155   SKGFKNLVTEEDFRNALYTIDIGQNDLTAAFNSLSYADVVAKIPSFISEIRDAMWAIYLV  214

Query  633   GGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELR  812
             GG+ FWVHNTGP+GCLP  L T K     T+F++ GCIKSLN+ A+ FN KL  LC+ELR
Sbjct  215   GGKNFWVHNTGPLGCLPEKLGTRKTNA--TDFDKYGCIKSLNDGAKVFNAKLDGLCQELR  272

Query  813   HEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNAN--ISCGQSGFSVC  986
              +MK+ +IVYVD+Y+IKY+LI+NSA YGF+NPLMACCG GGAPYN N  I C   G+ VC
Sbjct  273   QQMKNVSIVYVDMYSIKYDLIANSAAYGFKNPLMACCGYGGAPYNYNPDIKCRDRGYEVC  332

Query  987   KDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCS  1115
             +    YISWDGVHYTE ANA++A+ +LSTNYS PP  F++FC+
Sbjct  333   EQELAYISWDGVHYTETANAIIASKILSTNYSVPPLGFNFFCN  375



>ref|XP_010322302.1| PREDICTED: GDSL esterase/lipase LIP-4-like isoform X1 [Solanum 
lycopersicum]
Length=364

 Score =   470 bits (1209),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 223/359 (62%), Positives = 281/359 (78%), Gaps = 10/359 (3%)
 Frame = +3

Query  48    FVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHR  227
             F+ + C  FL+     +   EC +N VIFNFGDSNSDTGGYPAAHG  FGYPDGR FFH+
Sbjct  13    FMLLVC--FLMCQLANVVVCECNKNMVIFNFGDSNSDTGGYPAAHGIRFGYPDGRAFFHQ  70

Query  228   SSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQ  407
              SDRLCDGRLI+DFLCEN+   YL+PYLE++ P+FKNGVNFAIGG+  LPK VLFSLSTQ
Sbjct  71    PSDRLCDGRLILDFLCENLNMSYLTPYLESVRPNFKNGVNFAIGGATILPKNVLFSLSTQ  130

Query  408   LLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKA-QVIEKIP  584
             +LQF RF    L+  SK +  ++ + D E A+YM+DIGQND+AGAF+YLS+A QVIEKIP
Sbjct  131   VLQFVRF----LQLQSKVSEELVDKVDLEKAIYMVDIGQNDLAGAFTYLSQAYQVIEKIP  186

Query  585   SFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEA  764
             SFISEI+DA+  IYK GG+ FW+HNTGP+GCLP+ +AT  V + N + ++ GC+KS+NEA
Sbjct  187   SFISEIQDAILGIYKHGGKNFWIHNTGPLGCLPQKVATRNVSNLN-DIDDHGCVKSMNEA  245

Query  765   AQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP-  941
             AQ FN +L  LCE+LR +MKD TIVYVD+Y IKY+LI+NS+ YG +NPLM CCG GG P 
Sbjct  246   AQAFNNQLRALCEQLRLQMKDTTIVYVDMYAIKYDLIANSSTYGIQNPLMVCCGYGGPPY  305

Query  942   -YNANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCS  1115
              YN NI+C QSG ++C++   Y+SWDGVHYTE AN++ A+ +LSTNYSTPP +  +FC+
Sbjct  306   NYNPNITCRQSGCTLCEESGAYVSWDGVHYTEFANSIFASKILSTNYSTPPLDLHHFCT  364



>ref|XP_010038311.1| PREDICTED: GDSL esterase/lipase At1g09390-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW50136.1| hypothetical protein EUGRSUZ_K03566 [Eucalyptus grandis]
Length=371

 Score =   466 bits (1200),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 219/357 (61%), Positives = 275/357 (77%), Gaps = 6/357 (2%)
 Frame = +3

Query  57    ITCSAFLVLSS--PPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRS  230
             +TC+  LVLS   P L A++C R P++FNFGDSNSDTGGY  A G  FG PDGRTFFH  
Sbjct  16    LTCTVALVLSLGLPSLVASQCKRKPIVFNFGDSNSDTGGYSVALGANFGLPDGRTFFHEG  75

Query  231   SDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQL  410
             + RLCDGRLIIDFLCE +   YLSPYLE+L P+F NG NFAIGGS TLP+   FSL  Q+
Sbjct  76    TGRLCDGRLIIDFLCEGLNTSYLSPYLESLGPNFSNGANFAIGGSATLPRSKPFSLDVQV  135

Query  411   LQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSF  590
             LQF RFR+RS    S+G   ++GE+ F++ALY IDIGQND+AG F YL  +QV++ IPSF
Sbjct  136   LQFLRFRSRSPLLLSRGYTNLVGEDSFKDALYTIDIGQNDLAGEFGYLPYSQVVQNIPSF  195

Query  591   ISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQ  770
             I EI+ A+W IYK GG+ FWVHNTGP+GCLP+ LATT      ++ +E GC++ LN+AAQ
Sbjct  196   IEEIRLAIWGIYKSGGKNFWVHNTGPLGCLPQKLATTA--HDASDADEHGCLRFLNDAAQ  253

Query  771   EFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--Y  944
              FN +L  LCEELR +MKDATIVYVD++TIKY+LI+N A+YGFE+PLM CCG GG P  Y
Sbjct  254   VFNRQLQSLCEELRSQMKDATIVYVDVFTIKYDLITNHAVYGFEDPLMVCCGNGGPPYNY  313

Query  945   NANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCS  1115
             N NI+C +SG++VC   S+++SWDGVHYTE AN+ V + +LSTNYSTPP +F++FC+
Sbjct  314   NVNITCLKSGYTVCDQASRFVSWDGVHYTEAANSFVVSRILSTNYSTPPVSFNFFCN  370



>ref|XP_004229369.1| PREDICTED: GDSL esterase/lipase LIP-4-like isoform X2 [Solanum 
lycopersicum]
Length=362

 Score =   465 bits (1197),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 223/359 (62%), Positives = 280/359 (78%), Gaps = 12/359 (3%)
 Frame = +3

Query  48    FVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHR  227
             F+ + C  FL+     +   EC +N VIFNFGDSNSDTGGYPAAHG  FGYPDGR FFH+
Sbjct  13    FMLLVC--FLMCQLANVVVCECNKNMVIFNFGDSNSDTGGYPAAHGIRFGYPDGRAFFHQ  70

Query  228   SSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQ  407
              SDRLCDGRLI+DFLCEN+   YL+PYLE++ P+FKNGVNFAIGG+  LPK VLFSLSTQ
Sbjct  71    PSDRLCDGRLILDFLCENLNMSYLTPYLESVRPNFKNGVNFAIGGATILPKNVLFSLSTQ  130

Query  408   LLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKA-QVIEKIP  584
             +LQF RF    L+  SK    ++ + D E A+YM+DIGQND+AGAF+YLS+A QVIEKIP
Sbjct  131   VLQFVRF----LQLQSK--EELVDKVDLEKAIYMVDIGQNDLAGAFTYLSQAYQVIEKIP  184

Query  585   SFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEA  764
             SFISEI+DA+  IYK GG+ FW+HNTGP+GCLP+ +AT  V + N + ++ GC+KS+NEA
Sbjct  185   SFISEIQDAILGIYKHGGKNFWIHNTGPLGCLPQKVATRNVSNLN-DIDDHGCVKSMNEA  243

Query  765   AQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP-  941
             AQ FN +L  LCE+LR +MKD TIVYVD+Y IKY+LI+NS+ YG +NPLM CCG GG P 
Sbjct  244   AQAFNNQLRALCEQLRLQMKDTTIVYVDMYAIKYDLIANSSTYGIQNPLMVCCGYGGPPY  303

Query  942   -YNANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCS  1115
              YN NI+C QSG ++C++   Y+SWDGVHYTE AN++ A+ +LSTNYSTPP +  +FC+
Sbjct  304   NYNPNITCRQSGCTLCEESGAYVSWDGVHYTEFANSIFASKILSTNYSTPPLDLHHFCT  362



>ref|XP_006349250.1| PREDICTED: GDSL esterase/lipase LIP-4-like [Solanum tuberosum]
Length=329

 Score =   462 bits (1188),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 216/333 (65%), Positives = 271/333 (81%), Gaps = 8/333 (2%)
 Frame = +3

Query  126   VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSP  305
             VIFNFGDSNSDTGGYPAAHG  FGYPDGR FFH+ SDRLCDGRLI+DFLCEN+   YL+P
Sbjct  2     VIFNFGDSNSDTGGYPAAHGIRFGYPDGRAFFHQPSDRLCDGRLILDFLCENLNMSYLTP  61

Query  306   YLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEE  485
             YLE++ P+FKNGVNFAIGG+  LPK VLFSLSTQ+LQF RF    L+  SKG+  ++ + 
Sbjct  62    YLESVRPNFKNGVNFAIGGATILPKNVLFSLSTQVLQFVRF----LQLQSKGSEELVDKL  117

Query  486   DFENALYMIDIGQNDIAGAFSYLSKA-QVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNT  662
             D + A+YMIDIGQND+AGAF+YLS+A QVIEKIP+FISEI+DA+  IYK GG+ FW+HNT
Sbjct  118   DLKKAIYMIDIGQNDLAGAFTYLSQASQVIEKIPTFISEIQDAILGIYKHGGKNFWIHNT  177

Query  663   GPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVY  842
             GP+GCLP+ +AT    + N + ++ GC+KS+NEAAQ FN +L  LCE+LR +MKD TIVY
Sbjct  178   GPLGCLPQKVATRNASNSN-DVDDHGCVKSMNEAAQAFNHQLRALCEQLRLQMKDTTIVY  236

Query  843   VDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQSGFSVCKDGSKYISWD  1016
             VD+Y IKY+LI+NS+ YG +NPLM CCG GG P  YN+NI+C QSG ++C++   Y+SWD
Sbjct  237   VDMYAIKYDLIANSSTYGIQNPLMVCCGYGGPPYNYNSNITCRQSGCTLCEESGAYVSWD  296

Query  1017  GVHYTEDANAMVAASVLSTNYSTPPFNFDYFCS  1115
             GVHYTE AN++VA+ +LSTNYSTPP +  +FC+
Sbjct  297   GVHYTEFANSIVASKILSTNYSTPPLDLHHFCT  329



>ref|XP_009762956.1| PREDICTED: GDSL esterase/lipase LIP-4-like [Nicotiana sylvestris]
 ref|XP_009762957.1| PREDICTED: GDSL esterase/lipase LIP-4-like [Nicotiana sylvestris]
Length=333

 Score =   457 bits (1176),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 221/334 (66%), Positives = 269/334 (81%), Gaps = 6/334 (2%)
 Frame = +3

Query  126   VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFH-RSSDRLCDGRLIIDFLCENVKADYLS  302
             VIFNFGDSNSDTGGY AAHG  FGYPDGR+FFH   SDRLCDGRLI+DFLCE++   YL+
Sbjct  2     VIFNFGDSNSDTGGYCAAHGIRFGYPDGRSFFHDHPSDRLCDGRLILDFLCESLNMSYLN  61

Query  303   PYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGE  482
              YLE++ P+FKNG NFAIGG+  LPK  LF+LSTQ+LQF RF+ RSL+  S G    L E
Sbjct  62    AYLESVRPNFKNGENFAIGGATILPKNALFTLSTQVLQFIRFKARSLQLQSIGLKD-LAE  120

Query  483   EDFENALYMIDIGQNDIAGAFSYLSK-AQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHN  659
             +DF+NA+YMIDIGQNDIA  FSYLSK +QV+EKIPSFISEI+ AVW IY  GG+ FW+HN
Sbjct  121   DDFKNAIYMIDIGQNDIANEFSYLSKVSQVLEKIPSFISEIQAAVWGIYNRGGKNFWIHN  180

Query  660   TGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIV  839
             TGP+GCLP+ LAT    +   + ++ GCIKS+NEAA+ FN +L  LCE+LR +MKDATIV
Sbjct  181   TGPLGCLPQKLATRNASNLK-DLDDYGCIKSMNEAAETFNNQLRALCEQLRLQMKDATIV  239

Query  840   YVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQSGFSVCKDGSKYISW  1013
             YVDIY IKY+LI++S+ YG +NPLM CCG GG P  YN+NI+C QSG+S+C++GS YISW
Sbjct  240   YVDIYAIKYDLIAHSSAYGIQNPLMVCCGFGGPPYNYNSNITCRQSGYSLCEEGSAYISW  299

Query  1014  DGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCS  1115
             DGVHYTE ANA+VA+ +LSTNYSTPP    +FC+
Sbjct  300   DGVHYTEYANAIVASKILSTNYSTPPLELHHFCT  333



>ref|XP_002279341.1| PREDICTED: GDSL esterase/lipase LIP-4 [Vitis vinifera]
 emb|CBI37001.3| unnamed protein product [Vitis vinifera]
Length=369

 Score =   451 bits (1161),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 218/357 (61%), Positives = 270/357 (76%), Gaps = 4/357 (1%)
 Frame = +3

Query  54    FITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSS  233
             FI+ S  L +  P      C R+PVIFN GDSNSDTGG+ +  G I   P+GR FFH+ +
Sbjct  15    FISISVILSVCFPLNVECGCSRSPVIFNMGDSNSDTGGFYSGLGIIMPPPEGRAFFHKFA  74

Query  234   DRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLL  413
              RL DGRLIIDFLCEN+  +YL+PYLE+L P+F NG NFAI GS+TLP++  FSL  Q  
Sbjct  75    GRLSDGRLIIDFLCENLNTNYLTPYLESLGPNFSNGANFAISGSRTLPRYDPFSLGVQGR  134

Query  414   QFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFI  593
             Q  RF+TRS+E  SKG  G++GEEDF+NALYMIDIGQND+ G FSYL   QVIEKIP+FI
Sbjct  135   QLFRFQTRSIELTSKGVKGLIGEEDFKNALYMIDIGQNDLVGPFSYLPYPQVIEKIPTFI  194

Query  594   SEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQE  773
             +EIK A+ +IY+ GG+KFWVHNTGP GCLP+ LATT      ++ ++ GC++S N+ A+E
Sbjct  195   AEIKFAILSIYQHGGKKFWVHNTGPFGCLPQQLATTSKN--ASDIDQYGCLQSRNDGARE  252

Query  774   FNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN--  947
             FN +L  LCEELR E+KDATIVYVDI+ IKY+LI+NS +YGFENPLMACCG GG PYN  
Sbjct  253   FNKQLKALCEELRDEIKDATIVYVDIFAIKYDLIANSTLYGFENPLMACCGYGGPPYNFD  312

Query  948   ANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
                 C   G +VC++GSKYISWDGVHYTE ANA VA+ ++ST+YS+PP  FD+FC T
Sbjct  313   PKFQCTAPGSNVCEEGSKYISWDGVHYTEAANAFVASKIVSTDYSSPPLKFDFFCKT  369



>ref|XP_010270891.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Nelumbo nucifera]
Length=370

 Score =   440 bits (1132),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 207/354 (58%), Positives = 270/354 (76%), Gaps = 5/354 (1%)
 Frame = +3

Query  69    AFLVLSSPPLAAAECI-RNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLC  245
             +F V+  P  A ++C  RNPV+ NFGDSNSDTGG+    G     P+GRTFFH SS+RL 
Sbjct  19    SFPVIFLPLFAHSQCNGRNPVVLNFGDSNSDTGGFAVGLGLPIRPPNGRTFFHGSSNRLS  78

Query  246   DGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNR  425
             DGRL+IDFLCE++   YL+PYLE+L P+F+NG NFAI GS TLPKFV FSL  Q+LQF R
Sbjct  79    DGRLVIDFLCESLNMSYLTPYLESLEPNFRNGANFAISGSSTLPKFVPFSLDIQVLQFLR  138

Query  426   FRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIK  605
             F+ RSL+  S+G+ G++ EE F NALY +DIGQND+  +F+YLS A++I++IPSF+ EIK
Sbjct  139   FQARSLQLLSQGSRGLVDEEGFRNALYTLDIGQNDLVASFTYLSYAEIIKRIPSFLEEIK  198

Query  606   DAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVK  785
              A+W+IY  GG+ FW+HNTGP+GCLP+ L+ T      +  +  GC++S N+AA+ FN  
Sbjct  199   SAIWSIYLHGGKNFWIHNTGPLGCLPQMLSITSRNV--SGLDPYGCLQSPNDAAKVFNEG  256

Query  786   LSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPY--NANIS  959
             L  LCEELR +MK+ATIVYVDIY+IKY+LI+NS  YGF++PLM CCG GG PY  N N++
Sbjct  257   LRALCEELRSQMKNATIVYVDIYSIKYDLIANSTKYGFQHPLMVCCGYGGPPYNFNPNVT  316

Query  960   CGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCSTN  1121
             CGQ+G+++C++GSKYISWDG HYTE AN +VA+ +LS NYS P   FDYFC T+
Sbjct  317   CGQTGYNICEEGSKYISWDGTHYTEAANEIVASKILSANYSIPNLKFDYFCHTS  370



>ref|XP_002515225.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF47209.1| zinc finger protein, putative [Ricinus communis]
Length=362

 Score =   438 bits (1127),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 211/364 (58%), Positives = 273/364 (75%), Gaps = 6/364 (2%)
 Frame = +3

Query  30    NQRAAMFVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDG  209
             + RAA    +    F  L  P    ++C R PV+F FGDSN+DTG Y +  G +FG P+G
Sbjct  2     SMRAAEIPLLLFIIFCFL--PLFVQSQCRRAPVVFAFGDSNTDTGAYFSGLGMLFGTPNG  59

Query  210   RTFFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVL  389
             RT+F+R S RL DGRL IDFLCE++ + YL+PYLE L P F+NGVNFA  G+ T P+F  
Sbjct  60    RTYFNRPSGRLSDGRLAIDFLCESLNSSYLTPYLEPLGPDFRNGVNFAFAGAATSPRFKP  119

Query  390   FSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQV  569
             FSL  Q+LQF  FR RS E   KG N ++ EEDF++ALY+IDIGQND+AG+F +LS  +V
Sbjct  120   FSLDVQVLQFTHFRARSPELILKGHNELVNEEDFKDALYLIDIGQNDLAGSFEHLSYEEV  179

Query  570   IEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIK  749
             I KIPS I EI  A+  IY+ GGR FWVHNTGP+GCLPR L+ T+ +   ++F+E GC+ 
Sbjct  180   IAKIPSIIVEIDYAIQGIYQQGGRNFWVHNTGPLGCLPRILSITEKKA--SDFDEHGCLW  237

Query  750   SLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGG  929
              LN+A++EFN +L  LCEELR E++D+T+VYVD+Y+IKY+L +N+A YGFENPLMACCG 
Sbjct  238   PLNDASKEFNKQLHALCEELRSELEDSTLVYVDMYSIKYDLFANAATYGFENPLMACCGH  297

Query  930   GGAP--YNANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFD  1103
             GGAP  YN NI+CG SG +VC +GSKYI+WDGVHYTE ANA+VA+++LSTNYSTP   F+
Sbjct  298   GGAPYNYNKNITCGVSGHNVCDEGSKYINWDGVHYTEAANAIVASNILSTNYSTPQIKFN  357

Query  1104  YFCS  1115
             +FC+
Sbjct  358   FFCN  361



>ref|XP_008447456.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Cucumis melo]
Length=376

 Score =   437 bits (1125),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 211/374 (56%), Positives = 273/374 (73%), Gaps = 5/374 (1%)
 Frame = +3

Query  6     NKHTDMDTNQRAAMFVFITCSAFLVLSSP-PL-AAAECIRNPVIFNFGDSNSDTGGYPAA  179
             N  T+M+  +R + F F     F +LS P PL   ++CI+ PVIFNFGDSNSDTGG    
Sbjct  2     NLITEMEEEKRTS-FPFPLFVIFFLLSLPGPLFVHSQCIQKPVIFNFGDSNSDTGGLSEG  60

Query  180   HGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIG  359
              G  FG P GRTFFH+ + RLCDGRL+IDFLCE+V +DYL+PYL ++ P+F NG NFAI 
Sbjct  61    LGIKFGLPTGRTFFHKPAGRLCDGRLMIDFLCESVSSDYLTPYLRSVGPNFTNGANFAIS  120

Query  360   GSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAG  539
             GS TLPK   F+L  Q++QF +F++RSLE   KG   ++ EE F NALY IDIGQND+A 
Sbjct  121   GSATLPKDRPFNLYVQIMQFLQFQSRSLELIPKGYKDLVDEEGFNNALYTIDIGQNDLAA  180

Query  540   AFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPN  719
             AF+YL  +QVI+KIPSF+SEIKDA+W +Y+ GGRKFW+HNTGP+GCLP+ LA        
Sbjct  181   AFTYLPYSQVIQKIPSFVSEIKDAIWNLYQHGGRKFWIHNTGPLGCLPQKLAAAYANANA  240

Query  720   TEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGF  899
             ++ +  GC++SLN AA+EFN +L   C ELR  + + TIVYVD+Y IKY++I+NS   GF
Sbjct  241   SDIDNHGCLQSLNNAAKEFNTQLRVACGELRSALTNVTIVYVDVYAIKYDIIANSVSNGF  300

Query  900   ENPLMACCGGGGAPYNAN--ISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLST  1073
             ENPL+ CCG GG PYN N  ++CGQ GF+ C +G KY+SWDGVHYTE ANA+ A+ +LS+
Sbjct  301   ENPLIVCCGYGGPPYNFNQSVTCGQPGFNTCNEGLKYVSWDGVHYTEAANAVFASKILSS  360

Query  1074  NYSTPPFNFDYFCS  1115
              YS+P   F++FCS
Sbjct  361   QYSSPKLPFNFFCS  374



>gb|EYU29018.1| hypothetical protein MIMGU_mgv1a008515mg [Erythranthe guttata]
Length=371

 Score =   436 bits (1121),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 212/358 (59%), Positives = 270/358 (75%), Gaps = 6/358 (2%)
 Frame = +3

Query  57    ITCSAFL-VLSSPPLAAAECIRN--PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHR  227
             ++  AFL ++ S PL  + C RN  P+IFNFGDSNSDTGG+ A  G + GYP GR FF R
Sbjct  8     VSLPAFLSLIISLPLVVSHCSRNTPPLIFNFGDSNSDTGGFTAGTGLVAGYPYGRAFFPR  67

Query  228   SSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQ  407
              + R  DGRL+IDFLCEN+   YLSPYL++L P F NGVNFAI G+  LP FV F+L+ Q
Sbjct  68    PTGRASDGRLVIDFLCENLDTRYLSPYLDSLEPDFTNGVNFAICGACALPTFVPFNLNIQ  127

Query  408   LLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPS  587
             +LQF  F  RSLE  +KG   ++GEEDF+NALY  DIGQND++G+F  LS  QVIEKIPS
Sbjct  128   ILQFKLFYNRSLELRAKGRTNLVGEEDFKNALYTFDIGQNDLSGSFGALSYTQVIEKIPS  187

Query  588   FISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAA  767
             FI EI+DA+ AI+ +GG+ FWVHNTGP+GCLPR LA     +  ++F++ GCIKS+NE A
Sbjct  188   FIFEIRDAISAIHLLGGKNFWVHNTGPLGCLPRELAIRSNLNA-SDFDQYGCIKSMNEGA  246

Query  768   QEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN  947
             Q FN KL+ L +ELR E++D+TIVYVD+Y+IKY LISNS+ YGFENPLM CCG GGAPYN
Sbjct  247   QAFNTKLNALIQELRSELEDSTIVYVDMYSIKYELISNSSNYGFENPLMTCCGYGGAPYN  306

Query  948   --ANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCS  1115
               ++ +C  SGF+VC++ + +ISWDG HYTE AN + A+ +LST+YSTPP  F +FC+
Sbjct  307   YDSDRNCLTSGFTVCEEATPHISWDGTHYTEAANTIFASKILSTDYSTPPLEFSFFCN  364



>ref|XP_004163919.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Cucumis sativus]
Length=375

 Score =   434 bits (1115),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 200/344 (58%), Positives = 259/344 (75%), Gaps = 2/344 (1%)
 Frame = +3

Query  90    PPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDF  269
             P    ++CI+ PVIFNFGDSNSDTGG+    G  FG P GRTFFH+ + RLCDGRL+IDF
Sbjct  31    PLFVHSQCIQKPVIFNFGDSNSDTGGFSEGLGIKFGLPTGRTFFHKPAGRLCDGRLMIDF  90

Query  270   LCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEF  449
             LCE+V +DYL+PYL ++ P+F NG NFAI GS TLPK   F+L  Q++QF +F++RSLE 
Sbjct  91    LCESVNSDYLTPYLRSVGPNFTNGANFAISGSATLPKDRPFNLYIQIMQFLQFQSRSLEL  150

Query  450   HSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYK  629
               KG   ++ EE F NALY IDIGQND+A AF+YLS +QVI++IPSF+SEIK+A+W IY+
Sbjct  151   IPKGYKDLVDEEGFNNALYTIDIGQNDLAAAFTYLSYSQVIQQIPSFVSEIKNAIWTIYQ  210

Query  630   VGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEEL  809
              GGR FW+HNTGP+GCLP+ LAT       ++ +  GC++S N AA+EFN +L   C EL
Sbjct  211   HGGRNFWIHNTGPLGCLPQKLATAYADANASDIDNHGCLQSFNNAAKEFNTQLRVACGEL  270

Query  810   RHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNAN--ISCGQSGFSV  983
             R  + +ATIVYVD+Y IKY+LI+NS   GFENPL+ CCG GG PYN N  ++CGQ GF+ 
Sbjct  271   RSALTNATIVYVDVYAIKYDLITNSVSNGFENPLIVCCGYGGPPYNFNQTVTCGQPGFNT  330

Query  984   CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCS  1115
             C +G KY+SWDGVHYTE ANA+ A+ +LS+ YS+P   F++FC+
Sbjct  331   CNEGLKYVSWDGVHYTEAANAVFASMILSSQYSSPKLPFNFFCN  374



>ref|XP_004150835.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Cucumis sativus]
 gb|KGN58540.1| hypothetical protein Csa_3G669600 [Cucumis sativus]
Length=375

 Score =   432 bits (1110),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 199/344 (58%), Positives = 258/344 (75%), Gaps = 2/344 (1%)
 Frame = +3

Query  90    PPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDF  269
             P    ++CI+ PVIFNFGDSNSDTGG+    G  FG P GRTFFH+ + RLCDGRL+IDF
Sbjct  31    PLFVHSQCIQKPVIFNFGDSNSDTGGFSEGLGIKFGLPTGRTFFHKPAGRLCDGRLMIDF  90

Query  270   LCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEF  449
             LCE+V +DYL+PYL ++ P+F NG NFAI GS TLPK   F+L  Q++QF +F++RSLE 
Sbjct  91    LCESVNSDYLTPYLRSVGPNFTNGANFAISGSATLPKDRPFNLYIQIMQFLQFQSRSLEL  150

Query  450   HSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYK  629
               KG   ++ EE F NALY IDIGQND+A AF+YLS  QVI++IPSF+SEIK+A+W IY+
Sbjct  151   IPKGYKDLVDEEGFNNALYTIDIGQNDLAAAFTYLSYPQVIQQIPSFVSEIKNAIWTIYQ  210

Query  630   VGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEEL  809
              GGR FW+HNTGP+GCLP+ LAT       ++ +  GC++S N AA+EFN +L   C EL
Sbjct  211   HGGRNFWIHNTGPLGCLPQKLATAYADANASDIDNHGCLQSFNNAAKEFNTQLRVACGEL  270

Query  810   RHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNAN--ISCGQSGFSV  983
             R  + +AT+VYVD+Y IKY+LI+NS   GFENPL+ CCG GG PYN N  ++CGQ GF+ 
Sbjct  271   RSALTNATLVYVDVYAIKYDLITNSVSNGFENPLIVCCGYGGPPYNFNQTVTCGQPGFNT  330

Query  984   CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCS  1115
             C +G KY+SWDGVHYTE ANA+ A+ +LS+ YS+P   F++FC+
Sbjct  331   CNEGLKYVSWDGVHYTEAANAVFASMILSSQYSSPKLPFNFFCN  374



>emb|CAN71137.1| hypothetical protein VITISV_025410 [Vitis vinifera]
Length=327

 Score =   430 bits (1105),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 205/328 (63%), Positives = 254/328 (77%), Gaps = 4/328 (1%)
 Frame = +3

Query  141   GDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEAL  320
             GDSNSDTGG+ +  G I   P+GR FFH+ +  L DGRLIIDFLCEN+  +YL+PYLE+L
Sbjct  2     GDSNSDTGGFYSGLGIIMPPPEGRAFFHKFAGXLSDGRLIIDFLCENLTTNYLTPYLESL  61

Query  321   TPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEEDFENA  500
              P+F NG NFAI GS+TLP++  FSL  Q  Q  RF+TRS+E  SKG  G++GEEDF+NA
Sbjct  62    GPNFSNGANFAISGSRTLPRYDPFSLGVQGRQLFRFQTRSIELTSKGVKGLIGEEDFKNA  121

Query  501   LYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCL  680
             LYMIDIGQND+ G FSYL   QVIEKIP+FI+EIK A+ +IY+ GG+KFWVHNTGP GCL
Sbjct  122   LYMIDIGQNDLVGPFSYLPYPQVIEKIPTFIAEIKFAILSIYQHGGKKFWVHNTGPFGCL  181

Query  681   PRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTI  860
             P+ LATT      ++ ++ GC++S N+ A+EFN +L  LCEELR E+KDATIVYVDI+ I
Sbjct  182   PQQLATTSKN--ASDIDQYGCLQSRNDGAREFNKQLKALCEELRDEIKDATIVYVDIFAI  239

Query  861   KYNLISNSAIYGFENPLMACCGGGGAPYN--ANISCGQSGFSVCKDGSKYISWDGVHYTE  1034
             KY+LI+NS +YGFENPLMACCG GG PYN      C   G +VC++GSKYISWDGVHYTE
Sbjct  240   KYDLIANSTLYGFENPLMACCGYGGPPYNFDPKFQCTAPGSNVCEEGSKYISWDGVHYTE  299

Query  1035  DANAMVAASVLSTNYSTPPFNFDYFCST  1118
              ANA VA+ ++ST+YS+PP  FD+FC T
Sbjct  300   AANAFVASKIVSTDYSSPPLKFDFFCKT  327



>ref|XP_010038312.1| PREDICTED: GDSL esterase/lipase At1g09390-like isoform X2 [Eucalyptus 
grandis]
Length=354

 Score =   431 bits (1107),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 209/357 (59%), Positives = 261/357 (73%), Gaps = 23/357 (6%)
 Frame = +3

Query  57    ITCSAFLVLSS--PPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRS  230
             +TC+  LVLS   P L A++C R P++FNFGDSNSDTGGY  A G  FG PDGRTFFH  
Sbjct  16    LTCTVALVLSLGLPSLVASQCKRKPIVFNFGDSNSDTGGYSVALGANFGLPDGRTFFHEG  75

Query  231   SDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQL  410
             + RLCDGRLIIDFLCE +   YLSPYLE+L P+F NG NFAIGGS TLP+   FSL  Q+
Sbjct  76    TGRLCDGRLIIDFLCEGLNTSYLSPYLESLGPNFSNGANFAIGGSATLPRSKPFSLDVQV  135

Query  411   LQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSF  590
             LQF RFR+RS    S+G   ++GE+ F++ALY IDIGQND+AG F YL  +Q        
Sbjct  136   LQFLRFRSRSPLLLSRGYTNLVGEDSFKDALYTIDIGQNDLAGEFGYLPYSQ--------  187

Query  591   ISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQ  770
                       IYK GG+ FWVHNTGP+GCLP+ LATT      ++ +E GC++ LN+AAQ
Sbjct  188   ---------GIYKSGGKNFWVHNTGPLGCLPQKLATTA--HDASDADEHGCLRFLNDAAQ  236

Query  771   EFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--Y  944
              FN +L  LCEELR +MKDATIVYVD++TIKY+LI+N A+YGFE+PLM CCG GG P  Y
Sbjct  237   VFNRQLQSLCEELRSQMKDATIVYVDVFTIKYDLITNHAVYGFEDPLMVCCGNGGPPYNY  296

Query  945   NANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCS  1115
             N NI+C +SG++VC   S+++SWDGVHYTE AN+ V + +LSTNYSTPP +F++FC+
Sbjct  297   NVNITCLKSGYTVCDQASRFVSWDGVHYTEAANSFVVSRILSTNYSTPPVSFNFFCN  353



>ref|XP_011003171.1| PREDICTED: GDSL esterase/lipase At1g09390 [Populus euphratica]
Length=367

 Score =   430 bits (1105),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 206/354 (58%), Positives = 267/354 (75%), Gaps = 4/354 (1%)
 Frame = +3

Query  60    TCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDR  239
             T +  L    P L   +C RNPVIF FGDSNSDTG Y +  G +FG P+GR++F++ + R
Sbjct  15    TPTMILCFFFPLLINCQCSRNPVIFIFGDSNSDTGAYYSGLGLMFGVPNGRSYFNQPTGR  74

Query  240   LCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQF  419
             LCDGRL+ID LCE++   YL+PYLE L P F+NGVNFA  G+ T P++  FSL  Q+LQF
Sbjct  75    LCDGRLVIDLLCESLNTSYLTPYLEPLGPDFRNGVNFAFSGAATQPRYKPFSLDVQILQF  134

Query  420   NRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISE  599
              RFR RS E  SKG    + E+ F++A+++IDIGQND+AG+F YLS  QVI+ I SFI E
Sbjct  135   LRFRARSPELFSKGYKDFVDEDAFKDAIHIIDIGQNDLAGSFEYLSYEQVIKNISSFIKE  194

Query  600   IKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFN  779
             I  A+  IY+ GGR FW+HNTGP+GCLP+ LAT   R  +++F++ GC+K+LN+AA++FN
Sbjct  195   INYAMQNIYQHGGRNFWIHNTGPLGCLPQKLATFDKR--SSDFDQYGCLKALNDAAKQFN  252

Query  780   VKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNAN--  953
              +L  LCEELR E+K++TIVYVD+Y+IKY+LI+N+  YGFEN LMACCG GG PYN N  
Sbjct  253   DQLRVLCEELRSELKNSTIVYVDMYSIKYDLIANATTYGFENSLMACCGYGGPPYNYNPI  312

Query  954   ISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCS  1115
             I+C + G+SVC+ GSK+ISWDGVHYTE ANA+VA+ +LSTNYSTP   F YFCS
Sbjct  313   ITCSRPGYSVCERGSKFISWDGVHYTEAANAVVASKILSTNYSTPQIKFSYFCS  366



>gb|KDP28305.1| hypothetical protein JCGZ_14076 [Jatropha curcas]
Length=362

 Score =   429 bits (1104),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 205/368 (56%), Positives = 271/368 (74%), Gaps = 8/368 (2%)
 Frame = +3

Query  21    MDTNQRAAMFVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGY  200
             MD +     F       FL    P    ++C +NPV+F FGDSN+DTG Y +  G +FG 
Sbjct  1     MDESLTKVPFFLTVVFCFL----PLYVQSQCKKNPVVFTFGDSNTDTGAYFSGLGMLFGA  56

Query  201   PDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPK  380
             P+GRT+F++ S RL DGRL+IDFLCE++  +YL+PYL+ L P+FK GVNFA  G+ T P+
Sbjct  57    PNGRTYFNKPSGRLSDGRLVIDFLCESLNINYLTPYLQPLGPNFKYGVNFAFSGAATSPR  116

Query  381   FVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSK  560
             F  FSL  Q+LQF  FRTRS +  S+G   ++ EEDFE+ALY+ DIGQND+A +F YLS 
Sbjct  117   FKPFSLDVQILQFIHFRTRSPDLLSQGYKDLISEEDFEDALYIFDIGQNDLAASFEYLSH  176

Query  561   AQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETG  740
              +V+ KIPS I EI  A+  IY  GGR FWVHNTGP+GCLPR L+ T+     ++F+E G
Sbjct  177   EEVMRKIPSIIEEIDYAIQDIYDHGGRNFWVHNTGPLGCLPRILSITE--KTASDFDEHG  234

Query  741   CIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMAC  920
             C++ +N AA+EFN +L DLC +LR E++D++IVYVD+Y+IKY+L +N A YGF NPLMAC
Sbjct  235   CLQPINNAAKEFNQQLHDLCVQLRTELEDSSIVYVDMYSIKYDLFANPATYGFVNPLMAC  294

Query  921   CGGGGAP--YNANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPF  1094
             CG GGAP  YN NI+CG+SG +VC +GSKYI+WDGVHYTE ANA+VA+ +LS+NYS+P  
Sbjct  295   CGYGGAPYNYNRNITCGKSGHNVCGEGSKYINWDGVHYTEAANAIVASKILSSNYSSPQT  354

Query  1095  NFDYFCST  1118
             NF++FC+T
Sbjct  355   NFNFFCNT  362



>ref|XP_002301534.1| hypothetical protein POPTR_0002s19180g [Populus trichocarpa]
 gb|EEE80807.1| hypothetical protein POPTR_0002s19180g [Populus trichocarpa]
Length=350

 Score =   426 bits (1096),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 202/344 (59%), Positives = 264/344 (77%), Gaps = 4/344 (1%)
 Frame = +3

Query  90    PPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDF  269
             P L   +C RNPVIF FGDSNSDTG Y +  G +FG P+GR++F++ S RLCDGRL+ID 
Sbjct  8     PLLINCQCSRNPVIFIFGDSNSDTGAYYSGLGLMFGVPNGRSYFNQPSGRLCDGRLVIDL  67

Query  270   LCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEF  449
             LCE++   YL+PYLE L P F+NGVNFA  G+ T P++  FSL  Q+LQF RFR RS E 
Sbjct  68    LCESLNTSYLTPYLEPLGPDFRNGVNFAFSGAATQPRYKPFSLDVQILQFLRFRARSPEL  127

Query  450   HSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYK  629
              SKG    + E+ F++A+++IDIGQND+AG+F YLS  QVI+ I S+I EI  A+  IY+
Sbjct  128   FSKGYKDFVDEDAFKDAIHIIDIGQNDLAGSFEYLSYEQVIKNISSYIKEINYAMQNIYQ  187

Query  630   VGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEEL  809
              GGR FW+HNTGP+GCLP+ LAT   +  +++F++ GC+K+LN+AA++FN +L  LCEEL
Sbjct  188   HGGRNFWIHNTGPLGCLPQKLATFDKK--SSDFDQYGCLKALNDAAKQFNDQLRVLCEEL  245

Query  810   RHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNAN--ISCGQSGFSV  983
             R E+K++TIVYVD+Y+IKY+LI+N+  YGF N LMACCG GG PYN N  I+C ++G+SV
Sbjct  246   RSELKNSTIVYVDMYSIKYDLIANATTYGFGNSLMACCGYGGPPYNYNPIITCSRAGYSV  305

Query  984   CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCS  1115
             C+ GSK+ISWDGVHYTE ANA+VA+ +LSTNYSTP   F YFCS
Sbjct  306   CEGGSKFISWDGVHYTEAANAVVASKILSTNYSTPQIKFSYFCS  349



>ref|XP_011081091.1| PREDICTED: GDSL esterase/lipase LIP-4-like isoform X1 [Sesamum 
indicum]
Length=372

 Score =   420 bits (1080),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 204/345 (59%), Positives = 259/345 (75%), Gaps = 5/345 (1%)
 Frame = +3

Query  96    LAAAECIRN-PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFL  272
             L   +C R  PVIFNFGDSNSDTGG+ A  G    YP GR FF R + R  DGRL+IDFL
Sbjct  22    LVLPQCTRKTPVIFNFGDSNSDTGGFVAGLGLDIAYPYGRAFFRRPTGRASDGRLVIDFL  81

Query  273   CENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFV-LFSLSTQLLQFNRFRTRSLEF  449
             CE +   YLSPYL++L P F NG NFAI G+ TLP  +  F+L  Q+LQF  F  R +E 
Sbjct  82    CEYLDTRYLSPYLDSLEPDFTNGANFAIVGAATLPNSIPSFNLGIQILQFKHFYNRYVEL  141

Query  450   HSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYK  629
             HS+G    L ++DF++ALY++DIGQND++G+F  LS AQVIE+IPSFISEIKDA+W IY 
Sbjct  142   HSRGKPNFLDKDDFKSALYILDIGQNDLSGSFWSLSYAQVIERIPSFISEIKDAMWGIYA  201

Query  630   VGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEEL  809
             VGGR FWVHNTGP+GCLPR LA    R+  ++++E GCI SLN+ A+ FN KL  LC++L
Sbjct  202   VGGRNFWVHNTGPLGCLPRELAIRSNRNV-SDYDEYGCITSLNQGAKAFNAKLEALCQQL  260

Query  810   RHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN--ANISCGQSGFSV  983
               +M++ATIVYVD+Y+IKY LI+NS +YGF+NPLMACCG GGAPYN     +C  S  +V
Sbjct  261   PSQMENATIVYVDVYSIKYGLIANSTLYGFKNPLMACCGYGGAPYNYEEGRTCLGSEHTV  320

Query  984   CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
             C++G ++ISWDGVHY+E ANA+VA+ +LST+YS+PP  FD+FCST
Sbjct  321   CEEGIQHISWDGVHYSEAANAIVASKLLSTHYSSPPLPFDFFCST  365



>ref|XP_010094417.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB55998.1| GDSL esterase/lipase [Morus notabilis]
Length=561

 Score =   427 bits (1098),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 201/339 (59%), Positives = 258/339 (76%), Gaps = 4/339 (1%)
 Frame = +3

Query  99    AAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCE  278
             + +EC R PVIFNFGDSNSDTGG+    G  FG P GR FFH  + RLCDGRL+IDFLCE
Sbjct  193   STSECNRKPVIFNFGDSNSDTGGFSLGSGFTFGPPTGRAFFHHPTGRLCDGRLMIDFLCE  252

Query  279   NVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSK  458
             ++  DYL+PY+++L P+F  G NFA+ G+ T P+   F+L  Q+ QF +FRTRS+E  SK
Sbjct  253   SLNMDYLTPYMQSLGPNFTYGANFAVSGASTQPERKPFNLDGQIRQFLQFRTRSIELISK  312

Query  459   GTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGG  638
             G   ++G E+F N+LY IDIGQND+A +F+YLS +QVI+KIPSFI+EI+ ++  +Y+ G 
Sbjct  313   GYKDLVGGEEFINSLYTIDIGQNDLAASFTYLSYSQVIDKIPSFIAEIQTSIQTLYQNGA  372

Query  639   RKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHE  818
             + FWVHNTGP+GCLP+ L+ T      ++ +  GCI+ +NEAA+ FN +L  L E+LR E
Sbjct  373   KNFWVHNTGPLGCLPQILSVTN--HSASDIDNYGCIQYMNEAAKAFNKQLYALYEQLRSE  430

Query  819   MKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN--ANISCGQSGFSVCKD  992
             MKDATIV+VDIY+IKY +ISN +IYGFENPLMACCG GG PYN   N +CG  GF+VC+D
Sbjct  431   MKDATIVHVDIYSIKYGVISNPSIYGFENPLMACCGYGGPPYNYKLNHACGVPGFNVCED  490

Query  993   GSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYF  1109
             GSK+ISWDGVHYTE ANA+ A+ +LSTNYSTPP  F YF
Sbjct  491   GSKFISWDGVHYTEAANAVFASKILSTNYSTPPLKFQYF  529



>gb|KCW50135.1| hypothetical protein EUGRSUZ_K03565, partial [Eucalyptus grandis]
Length=348

 Score =   419 bits (1076),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 197/350 (56%), Positives = 255/350 (73%), Gaps = 4/350 (1%)
 Frame = +3

Query  75    LVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGR  254
             L L  P  AA+ C R PVIFNFGDSNSDTGG+ A  G  F  P GRTFFH ++ RLCDGR
Sbjct  1     LCLGLPSSAASRCKRKPVIFNFGDSNSDTGGFSAGLGINFTLPAGRTFFHEATGRLCDGR  60

Query  255   LIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRT  434
             L IDFLCE++   +LSPYLE+L P+F NG NFA+ G+ T+P++  FSL  QL QF  F +
Sbjct  61    LTIDFLCESLNTSFLSPYLESLGPNFSNGANFAVAGAATIPRYQPFSLGVQLRQFLLFPS  120

Query  435   RSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAV  614
             RS    S+G   ++GE+ F +ALY IDIGQND+   F+ L  +QVI  I  F+ EI+ A+
Sbjct  121   RSPLLLSRGHANLVGEDGFADALYTIDIGQNDLVIQFTTLPYSQVIGNISVFVEEIRFAI  180

Query  615   WAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSD  794
             W+IY+ GG+ FWVHNTGP+GCLP  L TT      ++ +E GC++S N+AA+EFN +L  
Sbjct  181   WSIYQSGGKNFWVHNTGPLGCLPNILVTTA--HDASDIDELGCLRSHNDAAREFNRRLQS  238

Query  795   LCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQ  968
             LCEELR  MK+ATIVY+D++ IKY+LI+N   +GFENPLMACCG GG P  YN NI+CG+
Sbjct  239   LCEELRCRMKNATIVYIDVFAIKYDLIANHVEHGFENPLMACCGNGGPPYNYNPNITCGR  298

Query  969   SGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
             SG++VC + S+++SWDGVHY E AN+ VA  +LS+NYSTPP  FD+FC+ 
Sbjct  299   SGYTVCNEASRHVSWDGVHYIEAANSFVATRILSSNYSTPPVAFDFFCNV  348



>ref|XP_010038310.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Eucalyptus grandis]
Length=373

 Score =   419 bits (1078),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 197/350 (56%), Positives = 255/350 (73%), Gaps = 4/350 (1%)
 Frame = +3

Query  75    LVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGR  254
             L L  P  AA+ C R PVIFNFGDSNSDTGG+ A  G  F  P GRTFFH ++ RLCDGR
Sbjct  26    LCLGLPSSAASRCKRKPVIFNFGDSNSDTGGFSAGLGINFTLPAGRTFFHEATGRLCDGR  85

Query  255   LIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRT  434
             L IDFLCE++   +LSPYLE+L P+F NG NFA+ G+ T+P++  FSL  QL QF  F +
Sbjct  86    LTIDFLCESLNTSFLSPYLESLGPNFSNGANFAVAGAATIPRYQPFSLGVQLRQFLLFPS  145

Query  435   RSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAV  614
             RS    S+G   ++GE+ F +ALY IDIGQND+   F+ L  +QVI  I  F+ EI+ A+
Sbjct  146   RSPLLLSRGHANLVGEDGFADALYTIDIGQNDLVIQFTTLPYSQVIGNISVFVEEIRFAI  205

Query  615   WAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSD  794
             W+IY+ GG+ FWVHNTGP+GCLP  L TT      ++ +E GC++S N+AA+EFN +L  
Sbjct  206   WSIYQSGGKNFWVHNTGPLGCLPNILVTTA--HDASDIDELGCLRSHNDAAREFNRRLQS  263

Query  795   LCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQ  968
             LCEELR  MK+ATIVY+D++ IKY+LI+N   +GFENPLMACCG GG P  YN NI+CG+
Sbjct  264   LCEELRCRMKNATIVYIDVFAIKYDLIANHVEHGFENPLMACCGNGGPPYNYNPNITCGR  323

Query  969   SGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
             SG++VC + S+++SWDGVHY E AN+ VA  +LS+NYSTPP  FD+FC+ 
Sbjct  324   SGYTVCNEASRHVSWDGVHYIEAANSFVATRILSSNYSTPPVAFDFFCNV  373



>ref|XP_010270892.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Nelumbo nucifera]
Length=372

 Score =   419 bits (1077),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 205/362 (57%), Positives = 266/362 (73%), Gaps = 8/362 (2%)
 Frame = +3

Query  36    RAAMFVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRT  215
             R ++  FI  + FL L   PL A    +NPVIFNFGDSNSDTGG  A  G     P GRT
Sbjct  14    RRSVAPFIIATLFLSL---PLPAYSLCKNPVIFNFGDSNSDTGGLVAGLGYNIRLPYGRT  70

Query  216   FFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFS  395
             FF RS+ RL DGRL+IDFLCE++   YLSPYL++L  +F NG NFAI GS TLP+FV FS
Sbjct  71    FFQRSTGRLSDGRLVIDFLCESLNTSYLSPYLDSLGSNFTNGANFAIVGSATLPRFVPFS  130

Query  396   LSTQLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVI  572
             L+ Q++QF  F+TRSL+  ++ +  ++  E F+NALYMIDIGQND+A +FS  LS A+V+
Sbjct  131   LNVQVMQFLHFKTRSLQITTRDSRHLVDGEAFQNALYMIDIGQNDLADSFSKNLSYARVV  190

Query  573   EKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKS  752
             E+IPS ++EIK+AV  IY  GGR FW+H+TGP+GCLP+ L  T V     + +  GC++S
Sbjct  191   ERIPSILAEIKNAVKTIYDQGGRNFWIHSTGPLGCLPQKL--TMVPKTRGDLDRYGCLRS  248

Query  753   LNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGG  932
              N+AA+ FN  L  LCE++R E++++TIVYVDI+ IKY+LI+N   YGF+ PLMACCG G
Sbjct  249   YNDAAKVFNGGLVALCEQMRSELRNSTIVYVDIFAIKYDLIANPTKYGFQKPLMACCGNG  308

Query  933   GAPYNANI--SCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDY  1106
             G PYN NI  +C Q G +VCK+GS+++SWDGVHYTE AN ++A+ +LSTNYSTP F FDY
Sbjct  309   GPPYNYNINVTCSQIGSNVCKEGSRFVSWDGVHYTEAANEVIASKILSTNYSTPQFKFDY  368

Query  1107  FC  1112
             FC
Sbjct  369   FC  370



>ref|XP_011081092.1| PREDICTED: GDSL esterase/lipase LIP-4-like isoform X2 [Sesamum 
indicum]
Length=366

 Score =   411 bits (1057),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 202/345 (59%), Positives = 257/345 (74%), Gaps = 11/345 (3%)
 Frame = +3

Query  96    LAAAECIRN-PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFL  272
             L   +C R  PVIFNFGDSNSDTGG+ A  G    YP GR FF R + R  DGRL+IDFL
Sbjct  22    LVLPQCTRKTPVIFNFGDSNSDTGGFVAGLGLDIAYPYGRAFFRRPTGRASDGRLVIDFL  81

Query  273   CENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFV-LFSLSTQLLQFNRFRTRSLEF  449
             CE +   YLSPYL++L P F NG NFAI G+ TLP  +  F+L  Q+LQF  F  R +E 
Sbjct  82    CEYLDTRYLSPYLDSLEPDFTNGANFAIVGAATLPNSIPSFNLGIQILQFKHFYNRYVEL  141

Query  450   HSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYK  629
             HS+       ++DF++ALY++DIGQND++G+F  LS AQVIE+IPSFISEIKDA+W IY 
Sbjct  142   HSRD------KDDFKSALYILDIGQNDLSGSFWSLSYAQVIERIPSFISEIKDAMWGIYA  195

Query  630   VGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEEL  809
             VGGR FWVHNTGP+GCLPR LA    R+  ++++E GCI SLN+ A+ FN KL  LC++L
Sbjct  196   VGGRNFWVHNTGPLGCLPRELAIRSNRNV-SDYDEYGCITSLNQGAKAFNAKLEALCQQL  254

Query  810   RHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN--ANISCGQSGFSV  983
               +M++ATIVYVD+Y+IKY LI+NS +YGF+NPLMACCG GGAPYN     +C  S  +V
Sbjct  255   PSQMENATIVYVDVYSIKYGLIANSTLYGFKNPLMACCGYGGAPYNYEEGRTCLGSEHTV  314

Query  984   CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
             C++G ++ISWDGVHY+E ANA+VA+ +LST+YS+PP  FD+FCST
Sbjct  315   CEEGIQHISWDGVHYSEAANAIVASKLLSTHYSSPPLPFDFFCST  359



>ref|XP_009796574.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Nicotiana sylvestris]
Length=368

 Score =   410 bits (1053),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 202/368 (55%), Positives = 261/368 (71%), Gaps = 6/368 (2%)
 Frame = +3

Query  21    MDTNQRAAMFVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGY  200
             MD  +R   F+    S  + L  P    ++C  N VI NFGDSNSDTGGY    G I   
Sbjct  1     MDLKERIFYFLSFIISLIIGLFFPLSVDSQCNGNLVIINFGDSNSDTGGYVIIRGMIGQL  60

Query  201   PDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPK  380
             P   T  H  + R+CDG+L+IDFLCE+VK  YL+P++E++  +F NGVNFAI GS+TLP 
Sbjct  61    PKKHTINHDLAGRMCDGKLVIDFLCESVKNGYLTPFMESMGKNFTNGVNFAIAGSKTLPA  120

Query  381   FVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSK  560
                F+L  Q+ QF+RFR+ SLE   KG   +LG+ED  NALY IDIGQND+ G F  LS 
Sbjct  121   SDSFNLKIQIAQFHRFRSLSLELFDKGNGNLLGDEDLRNALYTIDIGQNDLDGVFGGLSY  180

Query  561   AQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLAT-TKVRDPNTEFEET  737
              + I KIP FI EI++A+ AIY+ GG+ FWVHNTGP+GCLP++L T  K +D   +++E 
Sbjct  181   EKAILKIPDFIYEIENAIKAIYEEGGKNFWVHNTGPIGCLPKSLTTYNKYKD---DYDEH  237

Query  738   GCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMA  917
             GC++SLNE A+ FN KL  L E+LR E+K+ TIVYVD+Y+IKY+LI+NS+ YGF NPLMA
Sbjct  238   GCLRSLNEGAKIFNDKLYLLSEKLRDELKNTTIVYVDVYSIKYDLIANSSNYGFVNPLMA  297

Query  918   CCGGGGAPYN--ANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPP  1091
             CCG GG PYN  +N  CGQ  +++C+D SKYISWDG HYTE ANA+VA+ +LS+NYSTPP
Sbjct  298   CCGYGGPPYNFESNNKCGQGNYTICEDRSKYISWDGAHYTEAANAVVASKILSSNYSTPP  357

Query  1092  FNFDYFCS  1115
               F+ FC+
Sbjct  358   LKFNSFCN  365



>ref|XP_009620892.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Nicotiana tomentosiformis]
Length=368

 Score =   409 bits (1052),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 203/368 (55%), Positives = 258/368 (70%), Gaps = 6/368 (2%)
 Frame = +3

Query  21    MDTNQRAAMFVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGY  200
             MD  +R    +    S  +    P    ++C  + VI NFGDSNSDTGGY    G I   
Sbjct  1     MDLKERIFYLLSFIISLVVGFFFPLSVDSQCNGSLVIVNFGDSNSDTGGYVIVRGMIGQL  60

Query  201   PDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPK  380
             P   T  H  + R+CDGRL+IDFLCE+VK  YL+P++E++  +F NGVNFAI GS+TLP 
Sbjct  61    PKKHTISHDLAGRMCDGRLVIDFLCESVKNGYLTPFMESMGKNFTNGVNFAIAGSKTLPA  120

Query  381   FVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSK  560
                F+L  Q+ QF+RFR+ SLE   KG   +LG+ED  NALY IDIGQND+ G F  LS 
Sbjct  121   SDSFNLKIQIAQFHRFRSLSLELFDKGNGNLLGDEDLRNALYTIDIGQNDLDGVFGALSY  180

Query  561   AQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLAT-TKVRDPNTEFEET  737
              + I KIP FI EI+ A+  IY+ GG+ FWVHNTGP+GCLP++LAT  K +D   +++E 
Sbjct  181   EKAILKIPDFIFEIETAIKEIYEEGGKNFWVHNTGPIGCLPKSLATYNKYKD---DYDEH  237

Query  738   GCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMA  917
             GC+ SLNE A+ FN KL  LCE+LR EMK+ TIVY+D+Y+IKY+LI+NS+ YGF NPLMA
Sbjct  238   GCLISLNEGAKIFNDKLYLLCEKLRDEMKNITIVYLDVYSIKYDLIANSSNYGFVNPLMA  297

Query  918   CCGGGGAPYN--ANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPP  1091
             CCG GG PYN  +N  CGQ  +++C+D SKYISWDG HYTE+ANA VA+ +LSTNYSTPP
Sbjct  298   CCGYGGPPYNYESNNKCGQGNYTICEDRSKYISWDGAHYTEEANAAVASKILSTNYSTPP  357

Query  1092  FNFDYFCS  1115
               FD FC+
Sbjct  358   LKFDSFCN  365



>ref|XP_008811524.1| PREDICTED: GDSL esterase/lipase LIP-4-like [Phoenix dactylifera]
Length=372

 Score =   409 bits (1052),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 200/360 (56%), Positives = 255/360 (71%), Gaps = 7/360 (2%)
 Frame = +3

Query  48    FVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHR  227
             F+F+   A L L  P L  + C  N V+FNFGDSNSDTGG  A  G     P+GR FFHR
Sbjct  17    FLFLVVVATLTL--PALVESACGSNAVVFNFGDSNSDTGGLMAGLGYQIFPPEGRLFFHR  74

Query  228   SSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQ  407
             S+ RLCDGRLI+DFLCE++   YLSPYLE++   F+NG NFAI GS  LP  + FSL  Q
Sbjct  75    STGRLCDGRLILDFLCESLHMSYLSPYLESVGSDFRNGANFAIAGSTALPPDIPFSLHIQ  134

Query  408   LLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAF-SYLSKAQVIEKIP  584
             + QF RF+ RSLE  ++G+ G++ +E F  ALY IDIGQND++ AF + L   QVI++IP
Sbjct  135   VNQFLRFKARSLELIAQGSKGLINQEGFHKALYAIDIGQNDLSAAFGANLPYDQVIQRIP  194

Query  585   SFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEA  764
             S ISEIK AV  +Y  GG+ FW+HNTGP+GCLP+ L+    R  ++  +  GC+   N A
Sbjct  195   SVISEIKTAVKTLYSSGGKSFWIHNTGPLGCLPQKLSLP--RKDSSSLDRYGCLVPFNNA  252

Query  765   AQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPY  944
             A+EFN +L+ LC+ELR E+ DATIVY DI+TIKY++I+N A YGFENPLMACCG GG PY
Sbjct  253   AKEFNAQLNILCDELRSELNDATIVYTDIFTIKYDIIANHASYGFENPLMACCGYGGPPY  312

Query  945   --NANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
               N NI+CG +   VC +GSKY++WDGVHY E ANA+VA+ +LST YS P   FD+FC+ 
Sbjct  313   NFNQNITCGNAACPVCPEGSKYVNWDGVHYAEAANAIVASKILSTEYSKPKVKFDFFCTA  372



>gb|KDP23357.1| hypothetical protein JCGZ_23190 [Jatropha curcas]
Length=366

 Score =   409 bits (1051),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 198/343 (58%), Positives = 255/343 (74%), Gaps = 8/343 (2%)
 Frame = +3

Query  96    LAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLC  275
             L A++C  +PVIFNFGDSNSDTGG  A  G     P+GR FFHRS+ RL DGRL+IDFLC
Sbjct  26    LVASQCKNSPVIFNFGDSNSDTGGLTAGLGFPVNLPNGRLFFHRSTGRLSDGRLLIDFLC  85

Query  276   ENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFH  452
             +++ A +L+PYL++L  S F NGVNFA+ GS TLPKFV FSL+ Q++QF  F+ R+LE  
Sbjct  86    QSLNASFLNPYLDSLAGSRFSNGVNFAVVGSSTLPKFVPFSLNIQIMQFLHFKARALELV  145

Query  453   SKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVWAIYK  629
             + G+  ++ ++ F+NALYMIDIGQNDIA +FS  LS  QV+++IPSFI EI++A+  +Y 
Sbjct  146   NAGSQNLISDDGFQNALYMIDIGQNDIADSFSKNLSYVQVVKRIPSFIQEIENAMKTLYD  205

Query  630   VGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEEL  809
              GGRKFW+HNTGP+GCLP+ LA TK +D     +  GCI S N AA+ FN  L   C+ +
Sbjct  206   HGGRKFWIHNTGPLGCLPQKLALTKTKD----LDSHGCISSYNSAARLFNEGLRRACQRM  261

Query  810   RHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANI--SCGQSGFSV  983
             R ++  ATIVYVDIY+IKY+LI+NS+ YGF NPLMACCG GG PYN NI  +CGQ G+ V
Sbjct  262   RSQLTGATIVYVDIYSIKYDLIANSSKYGFSNPLMACCGYGGPPYNYNIGVTCGQPGYHV  321

Query  984   CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             C   S  +SWDG+HYTE ANA++A  VLST YS+P  +FD+FC
Sbjct  322   CDGKSPSVSWDGIHYTEAANAILATKVLSTAYSSPRLSFDFFC  364



>ref|XP_008453214.1| PREDICTED: GDSL esterase/lipase At1g09390 [Cucumis melo]
Length=362

 Score =   408 bits (1049),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 205/343 (60%), Positives = 254/343 (74%), Gaps = 11/343 (3%)
 Frame = +3

Query  105   AECI-RNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCEN  281
             + CI R PVIFNFGDSNSDTGG  A  G     P+GR+FF RS+ RL DGRL+IDFLCE+
Sbjct  22    SHCIARPPVIFNFGDSNSDTGGLVAGLGFPVLLPNGRSFFRRSTGRLSDGRLLIDFLCES  81

Query  282   VKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSK  458
             +  + L+PY+++L  S FKNG NFAI GS TLPK+V FSL+ Q++QF  FR+R LE  + 
Sbjct  82    LNTNLLNPYMDSLAGSNFKNGANFAIVGSSTLPKYVPFSLNIQVMQFLHFRSRMLELLNG  141

Query  459   --GTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVWAIYK  629
               G   ++ +  F NALYMIDIGQNDIA +F+  LS +QVI  IPSFISEIK+A+ A+Y 
Sbjct  142   NLGHGNLIDDSGFRNALYMIDIGQNDIADSFAKNLSYSQVINLIPSFISEIKNAMKALYD  201

Query  630   VGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEEL  809
              GGRKFW+HNTGP+GCLP+ L+      P  + +  GCI S N AA  FN  L  LC+ +
Sbjct  202   QGGRKFWIHNTGPLGCLPQKLSLF----PTKDLDRHGCISSFNAAATLFNTALKSLCQNM  257

Query  810   RHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANI--SCGQSGFSV  983
             R+E+KDA IVYVDIYTIKYNLI+NS++YGF NPLMACCG GG PYN NI  +CGQ G+ V
Sbjct  258   RNELKDANIVYVDIYTIKYNLIANSSLYGFPNPLMACCGAGGPPYNYNIRVTCGQPGYEV  317

Query  984   CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             C + SK+ISWDG+HY+E AN +VA+ VLST YSTPP  FD+FC
Sbjct  318   CNEDSKFISWDGIHYSEAANKIVASKVLSTAYSTPPLPFDFFC  360



>ref|XP_006344804.1| PREDICTED: GDSL esterase/lipase At1g09390-like isoform X1 [Solanum 
tuberosum]
Length=371

 Score =   408 bits (1048),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 199/362 (55%), Positives = 264/362 (73%), Gaps = 6/362 (2%)
 Frame = +3

Query  36    RAAMFVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRT  215
             +A+ ++ +  S  L   S P+ + +C   PVIFNFGDSNSDTGG  A  G     P+GRT
Sbjct  12    QASAYIILFISFILSSFSNPVQS-QCKNRPVIFNFGDSNSDTGGLVAGLGYPINLPNGRT  70

Query  216   FFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFS  395
             FF RS+ RL DGRLI+DFLC++V   +LSPYL+++  SF NG NFAI GS+ LPK+  F+
Sbjct  71    FFRRSTGRLSDGRLILDFLCQSVNTRFLSPYLDSVGSSFLNGANFAIAGSRLLPKYEPFA  130

Query  396   LSTQLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFS-YLSKAQVI  572
             L+ Q+LQF  F+ RS+E  S G+  ++GEE F NAL+MIDIGQND+A +F+  LS  +V+
Sbjct  131   LNIQVLQFLHFKGRSIELVSAGSGNLVGEEGFRNALFMIDIGQNDLADSFANNLSYTEVV  190

Query  573   EKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKS  752
             + IPSF++EI++A+  +Y  GGRKFWVHNTGP+GCLP+ L  T V+  +++ +  GC+ +
Sbjct  191   KMIPSFVTEIRNAIQVMYSQGGRKFWVHNTGPLGCLPQKL--TLVQKVSSDLDPHGCLAN  248

Query  753   LNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGG  932
              N AA+ FN  L  L +ELR EMKDATIVYVDIY IKY+LI+NS+ YGF NPLMACCG G
Sbjct  249   YNSAAKLFNEGLRHLLQELRSEMKDATIVYVDIYAIKYDLIANSSSYGFSNPLMACCGYG  308

Query  933   GAPYN--ANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDY  1106
             G PYN    +SCGQ  + VC +GS++ISWDGVHYTE AN ++A+ +LS +YSTP   FD+
Sbjct  309   GPPYNYRKGVSCGQHDYQVCSEGSEFISWDGVHYTEAANRIIASMILSMDYSTPRIGFDF  368

Query  1107  FC  1112
             FC
Sbjct  369   FC  370



>ref|XP_009616811.1| PREDICTED: GDSL esterase/lipase At1g09390 [Nicotiana tomentosiformis]
Length=367

 Score =   407 bits (1047),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 199/363 (55%), Positives = 263/363 (72%), Gaps = 7/363 (2%)
 Frame = +3

Query  33    QRAAMFVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGR  212
             Q+A+ +V +  +      +P LA  +C   PVIFNFGDSNSDTGG  A  G     P+GR
Sbjct  8     QQASAYVVVISALSSCFINPVLA--QCKNAPVIFNFGDSNSDTGGLVAGLGYPINLPNGR  65

Query  213   TFFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLF  392
             TFF RS+ RL DGRLI+DFLC++V   +LSPYL+++  +F NG NFAI GS+ LPK+  F
Sbjct  66    TFFGRSTGRLSDGRLILDFLCQSVNTRFLSPYLDSVGSTFLNGANFAIAGSRLLPKYEPF  125

Query  393   SLSTQLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQV  569
             +L+ Q++QF  F+ RS+E  S G+  ++G+E F NAL MIDIGQNDIA +F+  +S  +V
Sbjct  126   ALNIQVMQFLHFKDRSIELVSAGSGNLVGDEGFHNALSMIDIGQNDIADSFAKNMSYIEV  185

Query  570   IEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIK  749
             ++ IPSF++EIK+A+  IY  GGRKFWVHNTGP+GCLP+ L  T V+  +++ +  GC+ 
Sbjct  186   VKMIPSFVTEIKNAIQVIYSQGGRKFWVHNTGPLGCLPQKL--TLVQKVSSDLDPHGCLA  243

Query  750   SLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGG  929
             S N AAQ FN  L  +C+EL  EMKDATIVYVDIY IKY+LI+NS+ YGF NPLMACCG 
Sbjct  244   SYNSAAQLFNEGLRHVCQELGSEMKDATIVYVDIYAIKYDLIANSSNYGFSNPLMACCGY  303

Query  930   GGAPYN--ANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFD  1103
             GG PYN    ++CG  G+ VC +GS+++SWDGVHYTE AN ++A+ +LST YSTP   FD
Sbjct  304   GGPPYNYRKGVTCGHPGYQVCSEGSEFLSWDGVHYTEAANRVIASKILSTEYSTPRIGFD  363

Query  1104  YFC  1112
             +FC
Sbjct  364   FFC  366



>ref|XP_009794850.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Nicotiana sylvestris]
Length=367

 Score =   407 bits (1046),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 197/363 (54%), Positives = 263/363 (72%), Gaps = 7/363 (2%)
 Frame = +3

Query  33    QRAAMFVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGR  212
             Q+A+ +V +         +P LA  +C   PVIFNFGDSNSDTGG  A  G     P+GR
Sbjct  8     QQASAYVIVISVLSSCFLNPVLA--QCKNAPVIFNFGDSNSDTGGLVAGLGYPINLPNGR  65

Query  213   TFFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLF  392
             TFF RS+ RL DGRLI+DFLC++V   +LSPYL+++  +F NG NFAI GS+ LPK+  F
Sbjct  66    TFFRRSTGRLSDGRLILDFLCQSVNTRFLSPYLDSVGSTFLNGANFAIAGSRLLPKYEPF  125

Query  393   SLSTQLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQV  569
             +L+ Q++QF  F+ RS+E  S G+  ++G+E F NAL+MIDIGQND+A +F+  +S  +V
Sbjct  126   ALNIQVMQFLHFKDRSIELVSAGSGNLVGDEGFRNALFMIDIGQNDLADSFARNMSYTEV  185

Query  570   IEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIK  749
             ++ IPSF++EI++A+  IY  GGRKFWVHNTGP+GCLP+ L  T V+  +++ +  GC+ 
Sbjct  186   VKMIPSFVTEIRNAIQVIYSQGGRKFWVHNTGPLGCLPQKL--TLVQKVSSDLDPHGCLA  243

Query  750   SLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGG  929
             S N AA+ FN  L  +C+EL  EMKDATIVYVDIY IKY+LI+NS+ YGF NPLMACCG 
Sbjct  244   SYNSAAKLFNEGLRHVCQELGSEMKDATIVYVDIYAIKYDLIANSSNYGFSNPLMACCGY  303

Query  930   GGAPYN--ANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFD  1103
             GG PYN    ++CG  G+ VC +GS++ISWDGVHYTE AN ++A+ +LST YSTP   FD
Sbjct  304   GGPPYNYRKGVTCGHPGYQVCSEGSEFISWDGVHYTEAANRVIASKILSTEYSTPRIGFD  363

Query  1104  YFC  1112
             +FC
Sbjct  364   FFC  366



>ref|XP_011092184.1| PREDICTED: GDSL esterase/lipase At1g09390 [Sesamum indicum]
Length=375

 Score =   405 bits (1040),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 202/360 (56%), Positives = 259/360 (72%), Gaps = 10/360 (3%)
 Frame = +3

Query  42    AMFVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFF  221
             A+F+F      + L  P LA + C + P+IFNFGDSNSDTGG  A  G     P+GRTFF
Sbjct  22    ALFLFT-----VFLCVPHLAYSACGKPPIIFNFGDSNSDTGGIVAGLGIPVRLPNGRTFF  76

Query  222   HRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLS  401
              RS+ RLCDGRL+IDFLC+++    L+PYLE+L  SF NG NFAI GS TLPK V F+L+
Sbjct  77    GRSTGRLCDGRLVIDFLCQSLNTSLLNPYLESLGSSFSNGANFAIAGSATLPKRVPFALN  136

Query  402   TQLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEK  578
              Q++QF  F+ RS E  + G N ++G + F +ALYMIDIGQND+A +F+  LS  QV++K
Sbjct  137   IQVMQFMHFKDRSAELAATGANHLIGYDRFGDALYMIDIGQNDLADSFAKGLSYVQVVKK  196

Query  579   IPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLN  758
             IPS ++EIK+AV  IY+ GGRKFWVHNTGP+GCLP+ LA  K  + + + +  GCI S N
Sbjct  197   IPSVLAEIKNAVKNIYERGGRKFWVHNTGPLGCLPQKLALAK--NISHDLDSFGCISSYN  254

Query  759   EAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGA  938
             + A+ FN  L  +  ELR EM+DATIVYVD+YTIK +LI+NS  YGF +PLMACCG GG 
Sbjct  255   DVAKLFNEGLRQISVELRSEMEDATIVYVDMYTIKLDLIANSTKYGFSSPLMACCGSGGP  314

Query  939   PYN--ANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             PYN    ISCG  G+ VC   S+ +SWDGVHYT+ ANA++A+ +LST+YSTPP  FD+FC
Sbjct  315   PYNYERGISCGFPGYQVCDQSSQSVSWDGVHYTQAANALIASKILSTDYSTPPVMFDFFC  374



>ref|XP_004158741.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Cucumis sativus]
Length=362

 Score =   404 bits (1039),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 203/345 (59%), Positives = 252/345 (73%), Gaps = 11/345 (3%)
 Frame = +3

Query  99    AAAECI-RNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLC  275
             A + CI R PVIFNFGDSNSDTGG  A  G     P+GR+FF RS+ RL DGRL+IDFLC
Sbjct  20    ACSHCIARPPVIFNFGDSNSDTGGLVAGLGFPVLLPNGRSFFRRSTGRLSDGRLLIDFLC  79

Query  276   ENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEF-  449
             E++    L+PY+++L  S FKNG NFAI GS TLPK+V FSL+ QL+QF  FR+R+LE  
Sbjct  80    ESLNTKLLNPYMDSLAGSNFKNGANFAIVGSSTLPKYVPFSLNIQLMQFLHFRSRTLELL  139

Query  450   -HSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVWAI  623
               + G   ++ +  F NALYMIDIGQNDIA +FS  LS +QVI  IPS ISEIK+AV A+
Sbjct  140   NANPGHGNLIDDSGFRNALYMIDIGQNDIADSFSKNLSYSQVINLIPSIISEIKNAVKAL  199

Query  624   YKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCE  803
             Y+ GGRKFW+HNTGP+GCLP+ ++      P    +  GCI S N  A  FN  L  LC+
Sbjct  200   YEQGGRKFWIHNTGPLGCLPQKISLF----PMKGLDRHGCISSFNAVATLFNTALRSLCQ  255

Query  804   ELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANI--SCGQSGF  977
              +R E+KD +IVYVDIY IKY+LI+NS++YGF NPLMACCG GG PYN NI  +CGQ G+
Sbjct  256   NMRDELKDTSIVYVDIYAIKYDLIANSSLYGFSNPLMACCGAGGPPYNYNIRVTCGQPGY  315

Query  978   SVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
              VC + SK+ISWDG+HY+E+AN +VA+ VLST YSTPP  FD+FC
Sbjct  316   EVCNEDSKFISWDGIHYSEEANKIVASKVLSTAYSTPPLPFDFFC  360



>ref|XP_004144804.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Cucumis sativus]
 gb|KGN61022.1| hypothetical protein Csa_2G034750 [Cucumis sativus]
Length=362

 Score =   404 bits (1039),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 203/345 (59%), Positives = 252/345 (73%), Gaps = 11/345 (3%)
 Frame = +3

Query  99    AAAECI-RNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLC  275
             A + CI R PVIFNFGDSNSDTGG  A  G     P+GR+FF RS+ RL DGRL+IDFLC
Sbjct  20    ACSHCIARPPVIFNFGDSNSDTGGLVAGLGFPVLLPNGRSFFRRSTGRLSDGRLLIDFLC  79

Query  276   ENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEF-  449
             E++    L+PY+++L  S FKNG NFAI GS TLPK+V FSL+ QL+QF  FR+R+LE  
Sbjct  80    ESLNTKLLNPYMDSLAGSNFKNGANFAIVGSSTLPKYVPFSLNIQLMQFLHFRSRTLELL  139

Query  450   -HSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVWAI  623
               + G   ++ +  F NALYMIDIGQNDIA +FS  LS +QVI  IPS ISEIK+AV A+
Sbjct  140   NANPGHGNLIDDSGFRNALYMIDIGQNDIADSFSKNLSYSQVINLIPSIISEIKNAVKAL  199

Query  624   YKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCE  803
             Y+ GGRKFW+HNTGP+GCLP+ ++      P    +  GCI S N  A  FN  L  LC+
Sbjct  200   YEQGGRKFWIHNTGPLGCLPQKISLF----PMKGLDRHGCISSFNAVATLFNTALRSLCQ  255

Query  804   ELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANI--SCGQSGF  977
              +R E+KD +IVYVDIY IKY+LI+NS++YGF NPLMACCG GG PYN NI  +CGQ G+
Sbjct  256   NMRDELKDTSIVYVDIYAIKYDLIANSSLYGFSNPLMACCGAGGPPYNYNIRVTCGQPGY  315

Query  978   SVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
              VC + SK+ISWDG+HY+E+AN +VA+ VLST YSTPP  FD+FC
Sbjct  316   EVCNEDSKFISWDGIHYSEEANKIVASKVLSTAYSTPPLPFDFFC  360



>ref|XP_004230336.1| PREDICTED: GDSL esterase/lipase At1g09390 [Solanum lycopersicum]
Length=371

 Score =   402 bits (1034),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 196/359 (55%), Positives = 261/359 (73%), Gaps = 10/359 (3%)
 Frame = +3

Query  45    MFVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFH  224
             +F+F   S+F   S+P    ++C   PVIFNFGDSNSDTGG  A  G     P+GR FF 
Sbjct  19    LFIFFILSSF---SNP--VQSQCKNRPVIFNFGDSNSDTGGLVAGLGYPINLPNGRNFFR  73

Query  225   RSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLST  404
             RS+ RL DGRLI+DFLC++V   +L PYL+++  SF NG NFAI GS+ LPK+  F+L+ 
Sbjct  74    RSTGRLSDGRLILDFLCQSVNTRFLCPYLDSVGSSFLNGANFAIAGSRLLPKYEPFALNI  133

Query  405   QLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKI  581
             Q+LQF  F+ RS+E  S G+  ++G+E F NAL+MIDIGQND+A +F+  LS  +V++ I
Sbjct  134   QVLQFLHFKDRSIELVSAGSGNLVGDEGFRNALFMIDIGQNDLADSFAKNLSYTEVVKMI  193

Query  582   PSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNE  761
             PSF++EI++A+  IY  GGRKFWVHNTGP+GCLP+ L  T V+  +++ +  GC+ + N 
Sbjct  194   PSFVTEIRNAIQVIYSQGGRKFWVHNTGPLGCLPQKL--TLVQKVSSDLDPHGCLANYNS  251

Query  762   AAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP  941
             AA+ FN  L  L +ELR EMKDAT+VYVDIY IKY+LI+NS+ YGF NPLMACCG GG P
Sbjct  252   AAKLFNEGLRHLLQELRSEMKDATMVYVDIYAIKYDLIANSSSYGFSNPLMACCGYGGPP  311

Query  942   YN--ANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             YN    ++CGQ  + VC +GS++ISWDGVHYTE AN ++A+ +LS +YSTP   FD+FC
Sbjct  312   YNYRKGVTCGQHDYQVCSEGSEFISWDGVHYTEAANRVIASKILSMDYSTPRIGFDFFC  370



>ref|XP_002891991.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH68250.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=373

 Score =   402 bits (1034),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 203/370 (55%), Positives = 260/370 (70%), Gaps = 14/370 (4%)
 Frame = +3

Query  27    TNQRAAMFVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPD  206
             +N  +  FV +     L+L  P  AAA C   PVIFNFGDSNSDTGG  A  G   G+P+
Sbjct  8     SNTFSIFFVTLVSLPLLILRQPT-AAASCTTPPVIFNFGDSNSDTGGLVAGLGYPVGFPN  66

Query  207   GRTFFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKF  383
             GR FF RS+ RL DGRL+IDFLC+++    L PYL++L  + F+NG NFA+ GS TLPK 
Sbjct  67    GRLFFRRSTGRLSDGRLLIDFLCQSLNTSLLRPYLDSLGGTRFQNGANFAVVGSSTLPKN  126

Query  384   VLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLG----EEDFENALYMIDIGQNDIAGAFSY  551
             V FSL+ QL+QF+ F++RSLE  S  TN + G     + F+NALYMIDIGQNDIA +F+ 
Sbjct  127   VPFSLNIQLMQFSHFKSRSLELASS-TNSLKGMFISNDGFKNALYMIDIGQNDIAHSFAR  185

Query  552   -LSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEF  728
               S +Q ++ IP  I+EIK  +  +Y  GGR+FW+HNTGP+GCLP+ L+  K +D     
Sbjct  186   GNSYSQTVKLIPQIITEIKSGIKRLYDEGGRRFWIHNTGPLGCLPQKLSMVKSKD----L  241

Query  729   EETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENP  908
             ++ GC+ S N AA  FN  L  +CEELR +++DATI+Y+DIY IKY LI+NS  YGFE P
Sbjct  242   DQHGCLASYNSAANLFNQGLDHMCEELRTKLRDATIIYIDIYAIKYTLIANSNQYGFERP  301

Query  909   LMACCGGGGAP--YNANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYS  1082
             LMACCG GGAP  YN NI+CG  G +VC++GS+YISWDG+HYTE ANA+VA  VLS +YS
Sbjct  302   LMACCGYGGAPYNYNVNITCGHKGSNVCEEGSRYISWDGIHYTETANAIVAMKVLSMHYS  361

Query  1083  TPPFNFDYFC  1112
              PP  FD+FC
Sbjct  362   KPPTPFDFFC  371



>ref|XP_007031217.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
 gb|EOY11719.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
Length=375

 Score =   402 bits (1034),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 195/349 (56%), Positives = 254/349 (73%), Gaps = 8/349 (2%)
 Frame = +3

Query  84    SSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLII  263
             S P   A++C   P+IFNFGDSNSDTGG  +  G     P+GR+FF R + RL DGRL+I
Sbjct  31    SFPHAVASQCKNRPIIFNFGDSNSDTGGLASGLGFPINLPNGRSFFRRPTGRLSDGRLLI  90

Query  264   DFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRS  440
             DFLC+++ A YLSPYL++L  S F NG NFA+ GS TLPK+V FSL+ Q++QF  F+ RS
Sbjct  91    DFLCQSLNASYLSPYLDSLGGSKFTNGANFAVVGSSTLPKYVPFSLNIQVMQFLHFKARS  150

Query  441   LEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVW  617
             LE  + G+  ++ EE F NALY+IDIGQNDIA +F   LS  QV ++IPS I+EIK+AV 
Sbjct  151   LELVNAGSRNLINEEGFRNALYIIDIGQNDIADSFDKNLSYVQVTKRIPSIITEIKNAVK  210

Query  618   AIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDL  797
              +Y  GGRKFW+HNTGP+GCLP+ L   + +D     +  GC+ S N AA  FN  L  L
Sbjct  211   TLYNQGGRKFWIHNTGPLGCLPQKLWLVQKKD----LDPHGCLSSYNSAALLFNEVLRRL  266

Query  798   CEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANI--SCGQS  971
             C+ELR E+ D+TIVYVDIY IKY+LI+NS+ YGF +PLMACCG GG PYN NI  +CGQ 
Sbjct  267   CQELRSELADSTIVYVDIYAIKYDLIANSSKYGFSSPLMACCGSGGPPYNYNIRVTCGQP  326

Query  972   GFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
             G+ VC +GS++++WDG+HYTE AN+++A+ VLST YS+P   FD+FC +
Sbjct  327   GYQVCNEGSRFLNWDGIHYTEAANSIIASRVLSTAYSSPRTTFDFFCRS  375



>ref|XP_010914677.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Elaeis guineensis]
Length=369

 Score =   402 bits (1033),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 196/356 (55%), Positives = 250/356 (70%), Gaps = 9/356 (3%)
 Frame = +3

Query  69    AFLVL----SSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSD  236
             AFL+L    + P L  + C  N  +FNFGDSNSDTGG  A  G     P GR FFHRS+ 
Sbjct  15    AFLLLVVVSTLPALVESTCGSNAAVFNFGDSNSDTGGLMAGLGYQISPPQGRIFFHRSTG  74

Query  237   RLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQ  416
             RLCDGRLI+DFLCE++   YLSPYLE+L   F+NG NFAI GS TLP  + FSL  Q+ Q
Sbjct  75    RLCDGRLILDFLCESLNTSYLSPYLESLGSDFRNGANFAIIGSATLPPDIPFSLHIQVNQ  134

Query  417   FNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAF-SYLSKAQVIEKIPSFI  593
             F RF+ RSLE  ++G+ G++ EE F+ ALY IDIGQND++ AF + L   QVI++IPS I
Sbjct  135   FLRFKARSLELIAQGSKGLINEEGFQKALYAIDIGQNDLSDAFGANLPYDQVIQRIPSVI  194

Query  594   SEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQE  773
             S+IK A+  +Y  GG+ FW+HN GP+GCLP+ L+    R  N+  ++ GC+ S N AA+E
Sbjct  195   SQIKTAIKTLYGSGGKNFWIHNAGPLGCLPQKLSLP--RKDNSNLDQYGCLMSFNNAAKE  252

Query  774   FNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPY--N  947
              N +LS LC++LR E+   TIVY DI+TIKY +I+N   YGFENPLMACCG GG PY  N
Sbjct  253   LNAQLSILCDKLRSELIGVTIVYTDIFTIKYEIIANHTTYGFENPLMACCGYGGPPYNFN  312

Query  948   ANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCS  1115
              NI+CG +   VC +GSKY++WDGVHY E ANAMVA+ +L+T YS P   FD+FC+
Sbjct  313   QNITCGNAACPVCPEGSKYVNWDGVHYAEAANAMVASKILTTEYSKPKVKFDFFCN  368



>emb|CBI37000.3| unnamed protein product [Vitis vinifera]
Length=364

 Score =   401 bits (1031),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 191/336 (57%), Positives = 249/336 (74%), Gaps = 5/336 (1%)
 Frame = +3

Query  111   CIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKA  290
             C R+PVIFN GDSNSDTG      G +   P GR  FHR   R+ DGRLIIDFLCEN+  
Sbjct  31    CSRSPVIFNMGDSNSDTGSVLNGFGFVRPPPFGR-LFHRYVGRVSDGRLIIDFLCENLTT  89

Query  291   DYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNG  470
              YL+PYL+++  SF NG NFA+GG +T P+F  F+L  Q +QF  F+ +S+E  SKG   
Sbjct  90    SYLTPYLKSMGSSFTNGANFAVGGGKTFPRFDFFNLGLQSVQFFWFQNQSIELTSKGYKD  149

Query  471   MLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFW  650
              + EEDF+ ALYM+DIGQND+A AF   S AQV+E+IP+F++EI+ A+ ++Y+ GGRKFW
Sbjct  150   FVKEEDFKRALYMVDIGQNDLALAFGNSSYAQVVERIPTFMAEIEYAIVSLYQHGGRKFW  209

Query  651   VHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDA  830
             VHNTGP+GCLP+ L    +   + +F+  GC+KS N AA++FN +L  LC++LR  MKD 
Sbjct  210   VHNTGPLGCLPQQL--VNISRSSDDFDNHGCLKSRNNAAKKFNKQLKALCKKLRAAMKDV  267

Query  831   TIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNAN--ISCGQSGFSVCKDGSKY  1004
             TIVYVDI+ IKY+LI+N+ +YGFENPLM CCG GG PYN +  I CG  GFSVC++GSKY
Sbjct  268   TIVYVDIFAIKYDLIANAKLYGFENPLMVCCGHGGPPYNFDNLIQCGGVGFSVCEEGSKY  327

Query  1005  ISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             +SWDG+HYT+ AN  VA+ +LSTN+STPP +FD+FC
Sbjct  328   VSWDGIHYTQLANQFVASKILSTNFSTPPLHFDFFC  363



>ref|XP_002272500.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Vitis vinifera]
Length=366

 Score =   401 bits (1030),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 191/336 (57%), Positives = 249/336 (74%), Gaps = 5/336 (1%)
 Frame = +3

Query  111   CIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKA  290
             C R+PVIFN GDSNSDTG      G +   P GR  FHR   R+ DGRLIIDFLCEN+  
Sbjct  33    CSRSPVIFNMGDSNSDTGSVLNGFGFVRPPPFGR-LFHRYVGRVSDGRLIIDFLCENLTT  91

Query  291   DYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNG  470
              YL+PYL+++  SF NG NFA+GG +T P+F  F+L  Q +QF  F+ +S+E  SKG   
Sbjct  92    SYLTPYLKSMGSSFTNGANFAVGGGKTFPRFDFFNLGLQSVQFFWFQNQSIELTSKGYKD  151

Query  471   MLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFW  650
              + EEDF+ ALYM+DIGQND+A AF   S AQV+E+IP+F++EI+ A+ ++Y+ GGRKFW
Sbjct  152   FVKEEDFKRALYMVDIGQNDLALAFGNSSYAQVVERIPTFMAEIEYAIVSLYQHGGRKFW  211

Query  651   VHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDA  830
             VHNTGP+GCLP+ L    +   + +F+  GC+KS N AA++FN +L  LC++LR  MKD 
Sbjct  212   VHNTGPLGCLPQQLVN--ISRSSDDFDNHGCLKSRNNAAKKFNKQLKALCKKLRAAMKDV  269

Query  831   TIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNAN--ISCGQSGFSVCKDGSKY  1004
             TIVYVDI+ IKY+LI+N+ +YGFENPLM CCG GG PYN +  I CG  GFSVC++GSKY
Sbjct  270   TIVYVDIFAIKYDLIANAKLYGFENPLMVCCGHGGPPYNFDNLIQCGGVGFSVCEEGSKY  329

Query  1005  ISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             +SWDG+HYT+ AN  VA+ +LSTN+STPP +FD+FC
Sbjct  330   VSWDGIHYTQLANQFVASKILSTNFSTPPLHFDFFC  365



>ref|XP_010909995.1| PREDICTED: GDSL esterase/lipase LIP-4-like isoform X1 [Elaeis 
guineensis]
Length=369

 Score =   400 bits (1028),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 198/356 (56%), Positives = 252/356 (71%), Gaps = 9/356 (3%)
 Frame = +3

Query  69    AFLVL----SSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSD  236
             AFL+L    + P L  + C  N V+FNFGDSNSDTGG  A  G     P GR FFHRS+ 
Sbjct  15    AFLLLVVVSTLPALVESACGSNAVVFNFGDSNSDTGGLMAGLGYQISPPHGRIFFHRSTG  74

Query  237   RLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQ  416
             RLCDGRLI+DFLCE++   YLSPYLE+L   F+NG NFAI GS  LP  + FSL  Q+ Q
Sbjct  75    RLCDGRLILDFLCESLNTSYLSPYLESLGSDFRNGANFAIIGSTALPPDIPFSLHIQVNQ  134

Query  417   FNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAF-SYLSKAQVIEKIPSFI  593
             F RF+ RSLE  ++G+ G++ EE F+ ALY IDIGQND++ AF + L   QVI++IPS I
Sbjct  135   FLRFKARSLELIAQGSKGLINEEGFQEALYAIDIGQNDLSAAFGANLPYDQVIQRIPSVI  194

Query  594   SEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQE  773
             S+IK A+  +Y  GG+ FW+HNTGP+GCLP+ L +   +D N+  ++ GC+   N AA+E
Sbjct  195   SQIKTAIKTLYGNGGKNFWIHNTGPLGCLPQKL-SLPWKD-NSNLDQYGCLIPFNNAAEE  252

Query  774   FNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPY--N  947
              N +LS LCEELR E+  ATIVY DI+TIKY +I+N   YGFENPLMACCG GG PY  N
Sbjct  253   LNAQLSILCEELRSELNGATIVYTDIFTIKYEIIANHTTYGFENPLMACCGYGGPPYNFN  312

Query  948   ANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCS  1115
              NI+CG +   VC +GSKY++WDGVHY E ANA+VA+ +L+T YS P   FD+FC+
Sbjct  313   QNITCGNAACPVCPEGSKYVNWDGVHYAEAANAIVASKILTTEYSKPKVKFDFFCN  368



>ref|XP_010909997.1| PREDICTED: GDSL esterase/lipase LIP-4-like [Elaeis guineensis]
Length=365

 Score =   399 bits (1024),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 192/342 (56%), Positives = 246/342 (72%), Gaps = 6/342 (2%)
 Frame = +3

Query  105   AECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENV  284
             ++C+ NPV+FNFGDSNSDTGG  A  GN+F  PDGR FFHRS+ RLCDGRLIIDFLCE++
Sbjct  26    SKCVSNPVLFNFGDSNSDTGGSAAGLGNVFPLPDGRVFFHRSTGRLCDGRLIIDFLCESL  85

Query  285   KADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFV-LFSLSTQLLQFNRFRTRSLEFHSKG  461
                YLSPYLE+L  +F NG +FAI G+ T P     FSL+TQ+ QF  F++RSLE  S+G
Sbjct  86    NTSYLSPYLESLGSNFSNGADFAIAGAATQPYSTNPFSLNTQVRQFLHFKSRSLELISQG  145

Query  462   TNGMLGEEDFENALYMIDIGQNDIAGAFSYLSK-AQVIEKIPSFISEIKDAVWAIYKVGG  638
               G++ E+ F+ ALY IDIGQND+ GAF   S   QVI KIP FIS+IK+ V  +Y  G 
Sbjct  146   FEGLINEKGFQKALYAIDIGQNDLTGAFGGNSTYDQVIAKIPIFISQIKNVVKTLYANGA  205

Query  639   RKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHE  818
             + FW+HNTGP+GCLP  L+    R  N+  +  GC+   N A++EFN +LS +C+EL  E
Sbjct  206   KNFWIHNTGPLGCLPEKLSLP--RKDNSSLDPYGCLVPFNNASKEFNAQLSSVCDELTSE  263

Query  819   MKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN--ANISCGQSGFSVCKD  992
             +KDATI+Y+DI+ IKY++++N   YGFE+P + CCG GG PYN   NI CG    +VC D
Sbjct  264   LKDATIIYIDIFAIKYDIVANYTKYGFESPEIVCCGYGGPPYNFDPNIRCGNPSSNVCAD  323

Query  993   GSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
             GSKYISWDGVHYTE ANA+VA+ +L+T YS P   FD FC++
Sbjct  324   GSKYISWDGVHYTEAANAIVASKILTTEYSKPSVEFDNFCTS  365



>ref|XP_010941498.1| PREDICTED: GDSL esterase/lipase LIP-4-like [Elaeis guineensis]
Length=360

 Score =   398 bits (1023),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 196/349 (56%), Positives = 247/349 (71%), Gaps = 9/349 (3%)
 Frame = +3

Query  75    LVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGR  254
             ++ S P L  + C  N V+FNFGDSNSDTGG+ A  G+    P+GR FFHR + R CDGR
Sbjct  16    VIYSLPALVESACGSNAVVFNFGDSNSDTGGFVAGLGSPISLPEGRVFFHRPTGRYCDGR  75

Query  255   LIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRT  434
             LI+DFLCE++K +YLSPYLE+L   F+NG NFAI GS TLP  V FSL  Q+ QF RF++
Sbjct  76    LILDFLCESLKTNYLSPYLESLGSDFRNGANFAIAGSTTLPPNVPFSLHIQVNQFLRFKS  135

Query  435   RSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAF-SYLSKAQVIEKIPSFISEIKDA  611
             RSLE +++G    + EE F  ALY IDIGQND++  F + L   QVI+KIP  ISEIK A
Sbjct  136   RSLELNARGP---INEEGFRKALYAIDIGQNDLSAFFDANLPYDQVIQKIPIVISEIKTA  192

Query  612   VWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLS  791
             +  +Y  GG+ FW+HNTGP+GCLP  L+  K    N+  ++ GC+   N AA+EFN +L 
Sbjct  193   IKTLYDNGGKNFWIHNTGPLGCLPVKLSLWK---DNSSLDQYGCLMPFNNAAKEFNAQLG  249

Query  792   DLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPY--NANISCG  965
              LC+ELR E+KDATIVY DI+TIKY++I+N   YGFE+ LMACCG GG PY  N NI+CG
Sbjct  250   ALCDELRSELKDATIVYTDIFTIKYDIIANHTTYGFESSLMACCGYGGPPYNFNLNITCG  309

Query  966   QSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
                  VC +GSKY+SWDGVHY E ANA+VA+ +L+T YS P   FDYFC
Sbjct  310   NPACPVCPEGSKYVSWDGVHYAEAANAIVASKILTTEYSKPKVRFDYFC  358



>ref|XP_008811523.1| PREDICTED: GDSL esterase/lipase LIP-4-like [Phoenix dactylifera]
Length=364

 Score =   398 bits (1022),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 196/345 (57%), Positives = 244/345 (71%), Gaps = 6/345 (2%)
 Frame = +3

Query  96    LAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLC  275
             L  ++C  NPV+FNFGDSNSDTGG  A  GN F  P GR FFHRS+ RLCDGRLI+DFLC
Sbjct  22    LVESKCESNPVLFNFGDSNSDTGGSAAGFGNAFPLPHGRVFFHRSTGRLCDGRLIVDFLC  81

Query  276   ENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFV-LFSLSTQLLQFNRFRTRSLEFH  452
             E++   YLSPYLE++  +F NG +FAI G+ T P     FSL TQ+ QF  F++RSLE  
Sbjct  82    ESLNISYLSPYLESIGLNFSNGADFAIAGAATQPYSTNPFSLGTQVRQFLHFKSRSLELI  141

Query  453   SKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSK-AQVIEKIPSFISEIKDAVWAIYK  629
             S+G  G++ EE F+ ALY IDIGQND+ GA    S   Q   KIP FISEIK+A+  +Y 
Sbjct  142   SQGFEGLINEEGFQKALYAIDIGQNDLTGALGGNSTYDQATAKIPIFISEIKNAIKTLYA  201

Query  630   VGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEEL  809
              GGR FW+HNTGP+GCLP  L+    R  N+  +  GC+ + N AA+EFN +LS LC+EL
Sbjct  202   NGGRNFWIHNTGPLGCLPEKLSLP--RKDNSSLDPYGCLVTFNNAAKEFNAQLSSLCDEL  259

Query  810   RHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNAN--ISCGQSGFSV  983
               E+KDATI Y+DI+ IKY++I+N   YGFE+ ++ CCG GG PYN N  I CG    SV
Sbjct  260   SSELKDATITYIDIFAIKYDIIANYTKYGFESAVIVCCGYGGPPYNFNPSIRCGNPSCSV  319

Query  984   CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
             C DGSKYISWDGVHYTE ANA+VA+ +L+T+YS P   FDYFC+T
Sbjct  320   CADGSKYISWDGVHYTEAANAIVASKILTTDYSKPRVKFDYFCTT  364



>ref|XP_003554606.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Glycine max]
Length=364

 Score =   395 bits (1014),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 191/358 (53%), Positives = 253/358 (71%), Gaps = 13/358 (4%)
 Frame = +3

Query  51    VFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRS  230
             VF++C      ++  LA   C + PV+F FGDSNSDTGG  +  G     P+GR FFHRS
Sbjct  14    VFVSC-----FTAIALAGTGCDKAPVVFVFGDSNSDTGGLASGLGFPINLPNGRNFFHRS  68

Query  231   SDRLCDGRLIIDFLCENVKADYLSPYLEALT-PSFKNGVNFAIGGSQTLPKFVLFSLSTQ  407
             + RL DGRL+ID LC+++ A  L PYL+AL+  SF NG NFA+ GS TLPK+V FSL+ Q
Sbjct  69    TGRLSDGRLVIDLLCQSLNASLLVPYLDALSGTSFTNGANFAVVGSSTLPKYVPFSLNIQ  128

Query  408   LLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIP  584
             ++QF RF+ RSLE  + GT  ++ +E F  ALY+IDIGQND+A +F+  LS  QVI+KIP
Sbjct  129   VMQFRRFKARSLELVTTGTRNLINDEGFHGALYLIDIGQNDLADSFAKNLSYVQVIKKIP  188

Query  585   SFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEA  764
               I+EI++AV ++Y  G RKFWVHNTGP+GCLP+ LA  + +D     +  GC+ S N A
Sbjct  189   VVITEIENAVKSLYNEGARKFWVHNTGPLGCLPKVLALAQKKD----LDSLGCLSSYNSA  244

Query  765   AQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPY  944
             A+ FN  L    ++LR E+KDAT+VYVDIY IKY+LI+N+A YGF NPLM CCG GG PY
Sbjct  245   ARLFNEALLHSSQKLRSELKDATLVYVDIYAIKYDLITNAAKYGFSNPLMVCCGYGGPPY  304

Query  945   N--ANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             N    ++CGQ G+ VC +G++Y+SWDG+H TE AN ++A+ +LS  YSTP   FD+FC
Sbjct  305   NFDVRVTCGQPGYQVCDEGARYVSWDGIHQTEAANTLIASKILSMAYSTPRIPFDFFC  362



>emb|CDY41697.1| BnaA09g15250D [Brassica napus]
Length=375

 Score =   395 bits (1015),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 196/345 (57%), Positives = 248/345 (72%), Gaps = 11/345 (3%)
 Frame = +3

Query  99    AAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCE  278
             AAA C   PVIFNFGDSNSDTGG  A  G + G P+GR+FF RS+ RLCDGRL+IDFLC+
Sbjct  33    AAAGCQAPPVIFNFGDSNSDTGGLVAGLGYLVGLPNGRSFFRRSTGRLCDGRLLIDFLCQ  92

Query  279   NVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHS  455
             ++    L PYL++L  S F+NG NFAI GS TLPK + FSL+ QL+QF  F++RSLE  S
Sbjct  93    SLNTSLLRPYLDSLDGSRFQNGANFAIVGSTTLPKNIPFSLNIQLMQFLHFKSRSLELAS  152

Query  456   KG--TNGM-LGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVWAI  623
                 + GM + E  F NALYMIDIGQNDIA +FS   S +Q ++ IP FISEIK ++  +
Sbjct  153   TSNPSKGMFISESGFRNALYMIDIGQNDIARSFSIGNSYSQTVKLIPQFISEIKTSIKRL  212

Query  624   YKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCE  803
             Y  GGR+FW+HNTGP+GCLP+ L+  + +D     ++ GC+ S N AA+ FN  L  +CE
Sbjct  213   YDEGGRRFWIHNTGPLGCLPQKLSMAQSKD----LDQHGCLASYNAAAKLFNQMLDHMCE  268

Query  804   ELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQSGF  977
              LR E++DATI+Y+DIY IKY+LI+NS  YGFE PLMACCG GG+P  YNA I+C   G 
Sbjct  269   RLRIELRDATIIYIDIYVIKYSLIANSKAYGFERPLMACCGYGGSPYNYNAKITCAHRGA  328

Query  978   SVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             +VC  GS+++SWDG+HYTE ANA+VA  VLS  YS P   FD+FC
Sbjct  329   NVCDKGSRFVSWDGIHYTETANAIVAMKVLSMQYSKPKAPFDFFC  373



>ref|XP_006392404.1| hypothetical protein EUTSA_v10023535mg [Eutrema salsugineum]
 gb|ESQ29690.1| hypothetical protein EUTSA_v10023535mg [Eutrema salsugineum]
Length=371

 Score =   395 bits (1014),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 204/362 (56%), Positives = 249/362 (69%), Gaps = 9/362 (2%)
 Frame = +3

Query  42    AMFVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFF  221
             + F  I  S  L+    P AAA C   PVIFNFGDSNSDTGG  A  G   G+P+GR FF
Sbjct  12    SFFFTIFVSLVLLSLRQPSAAAICQAPPVIFNFGDSNSDTGGLVAGLGYPIGFPNGRLFF  71

Query  222   HRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSL  398
              RS+ RL DGRL+IDFLC+++    L PYL++L  S F+NG NFAI GS TLPK V F+L
Sbjct  72    RRSTGRLSDGRLLIDFLCQSLNTSLLRPYLDSLGGSRFQNGANFAIVGSTTLPKNVPFAL  131

Query  399   STQLLQFNRFRTRSLEFHSKGTNGMLGEED-FENALYMIDIGQNDIAGAFSY-LSKAQVI  572
             + QL+QF  F++RSLE  S     M   ED F+NALYMIDIGQNDIA +FS   S +Q +
Sbjct  132   NIQLMQFLHFKSRSLELASTSNGSMFISEDGFKNALYMIDIGQNDIARSFSKGNSYSQTV  191

Query  573   EKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKS  752
             E IP  ISEIK  +  +Y  GGR+FW+HNTGP+GCLP+ L+  K RD     ++ GC+ S
Sbjct  192   ELIPQIISEIKTVMKKLYDEGGRRFWIHNTGPLGCLPQKLSMVKRRD----LDQHGCLTS  247

Query  753   LNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGG  932
              N AA+ FN  L  +CEELR E++DATI+YVDIY IKY+LI NS  YGF  PLMACCG G
Sbjct  248   YNSAAKLFNQILDHMCEELRTELRDATIIYVDIYAIKYSLIVNSNKYGFGRPLMACCGYG  307

Query  933   GAP--YNANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDY  1106
             G+P  YN NI+CG  G +VC  GS +ISWDG+HYTE ANA+VA  +LS  YS PP  F +
Sbjct  308   GSPYNYNVNITCGHRGSNVCDKGSHFISWDGIHYTETANAIVAVKLLSMQYSKPPTPFHF  367

Query  1107  FC  1112
             FC
Sbjct  368   FC  369



>emb|CDY64753.1| BnaA06g37930D [Brassica napus]
Length=371

 Score =   395 bits (1014),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 200/363 (55%), Positives = 250/363 (69%), Gaps = 11/363 (3%)
 Frame = +3

Query  48    FVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHR  227
             F+        +L      A  C   PVIFNFGDSNSDTGG  A  G   G P+GR+FF R
Sbjct  12    FLLSLLLVIFILRQHLAVAGGCQYPPVIFNFGDSNSDTGGLAAGLGYTIGLPNGRSFFRR  71

Query  228   SSDRLCDGRLIIDFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLST  404
             S+ RL DGRLIIDFLC+++    L+PYL++L  S F+NGVNFAI GS TLP++V F L+ 
Sbjct  72    STGRLSDGRLIIDFLCQSLNTSLLNPYLDSLVGSKFQNGVNFAIVGSTTLPRYVPFVLNI  131

Query  405   QLLQFNRFRTRSLEFHSKG---TNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVI  572
             QL+QF  F++R+LE  S        M+ E  F NALYMIDIGQNDIA +FS  LS +QV+
Sbjct  132   QLMQFLHFKSRALELASTSDPLKEMMITENGFRNALYMIDIGQNDIADSFSKGLSYSQVV  191

Query  573   EKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKS  752
             + IP+ ISEIK A+  +Y  GGRKFWVHNTGP+GCLP+ L+       +   ++ GC+ S
Sbjct  192   KHIPNVISEIKSAIKTLYDEGGRKFWVHNTGPLGCLPQKLSMVH----SEALDKHGCLSS  247

Query  753   LNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGG  932
              N AA+ FN  L  +C ELR E++DA IVYVDIYTIKY+LI+NS  +GFE PLMACCG G
Sbjct  248   YNSAAKLFNEGLDHMCRELRTELRDADIVYVDIYTIKYDLIANSTNHGFEKPLMACCGYG  307

Query  933   GAP--YNANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDY  1106
             G P  YN NI+CG  G + C +GS++ISWDG+HYTE ANA+VA  VLS  YS+PP  F +
Sbjct  308   GPPYNYNVNITCGHGGSNSCDEGSRFISWDGIHYTETANAIVAMKVLSMQYSSPPTPFHF  367

Query  1107  FCS  1115
             FCS
Sbjct  368   FCS  370



>ref|XP_010914676.1| PREDICTED: GDSL esterase/lipase LIP-4-like [Elaeis guineensis]
Length=363

 Score =   394 bits (1013),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 196/359 (55%), Positives = 253/359 (70%), Gaps = 7/359 (2%)
 Frame = +3

Query  51    VFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRS  230
             V +   A LV+       ++C+ NPV+FNFGDSNSDTGG  A  GN+F  PDGR FFHR 
Sbjct  7     VRLVVMALLVVFLTASVESKCVSNPVLFNFGDSNSDTGGSAAGLGNVFP-PDGRVFFHRP  65

Query  231   SDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFV-LFSLSTQ  407
             + RLCDGRLIIDFLCE+++  YL PYLE+L  +F NG +FAI G+ TLP     FSL+TQ
Sbjct  66    TGRLCDGRLIIDFLCESLRTSYLRPYLESLGSNFSNGADFAIAGAGTLPSSTNPFSLNTQ  125

Query  408   LLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSK-AQVIEKIP  584
             + QF  F++RSLE  S+G  G++ EE F+ ALY IDIGQND+ GAF   S   QVI KIP
Sbjct  126   VRQFLHFKSRSLELISQGFEGLINEEGFQKALYAIDIGQNDLTGAFVGNSAYDQVIAKIP  185

Query  585   SFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEA  764
              FIS+I++AV  +Y  G + FW+HNTGP+GCLP  L+  +  D  +  +  GC+   N A
Sbjct  186   IFISQIENAVKTLYANGAKNFWIHNTGPLGCLPEKLSPPRKDD--SSLDPYGCLVPFNNA  243

Query  765   AQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPY  944
             ++EFN +LS +C++L  E+KDATI+YVDI+ IKY++I+N   YGFE+P++ CCG GG PY
Sbjct  244   SKEFNAQLSSICDKLSSELKDATIIYVDIFAIKYDIIANYTKYGFESPVIVCCGYGGPPY  303

Query  945   NAN--ISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCS  1115
             N N  I CG    +VC DGSK ISWDGVHYTE ANA+VA+ +L+T YS P   FDYFC+
Sbjct  304   NFNPSIRCGNPSCNVCADGSKCISWDGVHYTEAANAIVASKILTTEYSKPKVKFDYFCT  362



>ref|XP_009148237.1| PREDICTED: GDSL esterase/lipase At1g09390 [Brassica rapa]
 ref|XP_009148239.1| PREDICTED: GDSL esterase/lipase At1g09390 [Brassica rapa]
Length=371

 Score =   394 bits (1012),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 200/363 (55%), Positives = 249/363 (69%), Gaps = 11/363 (3%)
 Frame = +3

Query  48    FVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHR  227
             F+        VL      A  C   PVIFNFGDSNSDTGG  A  G   G P+GR+FF R
Sbjct  12    FLLSLLLVIFVLRQHLAVAGGCQYPPVIFNFGDSNSDTGGLAAGLGYTIGLPNGRSFFRR  71

Query  228   SSDRLCDGRLIIDFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLST  404
             S+ RL DGRLIIDFLC+++    L+PYL++L  S F+NGVNFAI GS TLP++V F L+ 
Sbjct  72    STGRLSDGRLIIDFLCQSLNTSLLNPYLDSLVGSKFQNGVNFAIVGSTTLPRYVPFVLNI  131

Query  405   QLLQFNRFRTRSLEFHSKG---TNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVI  572
             QL+QF  F++R+LE  S        M+ E  F NALYMIDIGQNDIA +FS  LS +QV+
Sbjct  132   QLMQFLHFKSRALELASTSDPLKEMMITENGFRNALYMIDIGQNDIADSFSKGLSYSQVV  191

Query  573   EKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKS  752
             + IP+ ISEIK A+  +Y  GGRKFWVHNTGP+GCLP+ L        +   ++ GC+ S
Sbjct  192   KHIPNVISEIKSAIKTLYDEGGRKFWVHNTGPLGCLPQKLTMVH----SEALDKHGCLSS  247

Query  753   LNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGG  932
              N AA+ FN  L  +C E+R E++DA IVYVDIYTIKY+LI+NS  +GFE PLMACCG G
Sbjct  248   YNSAAKLFNEGLDHMCREMRTELRDADIVYVDIYTIKYDLIANSTNHGFEKPLMACCGYG  307

Query  933   GAP--YNANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDY  1106
             G P  YN NI+CG  G + C +GS++ISWDG+HYTE ANA+VA  VLS  YS+PP  F +
Sbjct  308   GPPYNYNVNITCGHGGSNSCDEGSRFISWDGIHYTETANAIVAMKVLSMQYSSPPTPFHF  367

Query  1107  FCS  1115
             FCS
Sbjct  368   FCS  370



>ref|XP_009113364.1| PREDICTED: GDSL esterase/lipase LIP-4 [Brassica rapa]
Length=375

 Score =   394 bits (1012),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 196/345 (57%), Positives = 248/345 (72%), Gaps = 11/345 (3%)
 Frame = +3

Query  99    AAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCE  278
             AAA C   PVIFNFGDSNSDTGG  A  G + G P+GR+FF RS+ RLCDGRL+IDFLC+
Sbjct  33    AAAGCQAPPVIFNFGDSNSDTGGLVAGLGYLVGLPNGRSFFRRSTGRLCDGRLLIDFLCQ  92

Query  279   NVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHS  455
             ++    L PYL++L  S F+NG NFAI GS TLPK V FSL+ QL+QF  F+++SLE  S
Sbjct  93    SLNTSLLRPYLDSLDGSRFQNGANFAIVGSTTLPKNVPFSLNIQLMQFLHFKSKSLELAS  152

Query  456   KG--TNGM-LGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVWAI  623
                 + GM + E  F NALYMIDIGQNDIA +FS   S +Q ++ IP FISEIK ++  +
Sbjct  153   TSNPSKGMFISESGFRNALYMIDIGQNDIARSFSIGNSYSQTVKLIPQFISEIKTSIKRL  212

Query  624   YKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCE  803
             Y  GGR+FW+HNTGP+GCLP+ L+  + +D     ++ GC+ S N AA+ FN  L  +CE
Sbjct  213   YDEGGRRFWIHNTGPLGCLPQKLSMAQSKD----LDQHGCLASYNAAAKLFNQMLDHMCE  268

Query  804   ELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQSGF  977
              LR E++DATI+Y+DIY IKY+LI+NS  YGFE PLMACCG GG+P  YNA I+C   G 
Sbjct  269   RLRIELRDATIIYIDIYAIKYSLIANSKAYGFERPLMACCGYGGSPYNYNAKITCAHRGA  328

Query  978   SVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             +VC  GS+++SWDG+HYTE ANA+VA  VLS  YS P   FD+FC
Sbjct  329   NVCDKGSRFVSWDGIHYTETANAIVAMKVLSMQYSKPKAPFDFFC  373



>emb|CDX94973.1| BnaC05g06980D [Brassica napus]
Length=368

 Score =   393 bits (1010),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 201/362 (56%), Positives = 248/362 (69%), Gaps = 11/362 (3%)
 Frame = +3

Query  51    VFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRS  230
              F    A  +L      A  C   PVIFNFGDSNSDTGG  A  G   G P+GR+FF RS
Sbjct  10    TFFLLLAIFILRQHLAVAGGCQYPPVIFNFGDSNSDTGGLAAGLGYTIGLPNGRSFFRRS  69

Query  231   SDRLCDGRLIIDFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLSTQ  407
             + RL DGRLIIDFLCE++    L+PYL++L  S F+NGVNFAI GS TLP++V F L+ Q
Sbjct  70    TGRLSDGRLIIDFLCESLNKSLLNPYLDSLVGSKFQNGVNFAIVGSTTLPRYVPFVLNIQ  129

Query  408   LLQFNRFRTRSLEFHSKG---TNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIE  575
             L+QF  F++R+LE  S        M+ E  F  ALYMIDIGQNDIA +FS  LS +QV++
Sbjct  130   LMQFLHFKSRALELASTSDPLKEMMITENGFRTALYMIDIGQNDIADSFSKGLSYSQVVK  189

Query  576   KIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSL  755
              IP+ ISEIK A+  +Y  GGRKFWVHNTGP+GCLP+ L+    +      ++ GC+ S 
Sbjct  190   HIPNVISEIKSAIKTLYDEGGRKFWVHNTGPLGCLPQKLSMVHSK----ALDKHGCLSSY  245

Query  756   NEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGG  935
             N AA+ FN  L  +C ELR E++DA IVYVDIYTIKY+LI+NS  +GFE PLMACCG GG
Sbjct  246   NSAAKLFNEGLDHMCRELRTELRDADIVYVDIYTIKYDLIANSTNHGFEKPLMACCGYGG  305

Query  936   AP--YNANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYF  1109
              P  YN NI+CG  G + C +GS++ISWDG+HYTE ANA+VA  VLS  YSTPP  F + 
Sbjct  306   PPYNYNVNITCGHGGSNSCDEGSRFISWDGIHYTETANAIVAMKVLSMQYSTPPTPFHFS  365

Query  1110  CS  1115
             CS
Sbjct  366   CS  367



>ref|NP_176059.1| GDSL esterase/lipase LIP-4 [Arabidopsis thaliana]
 sp|Q9FXB6.1|LIP4_ARATH RecName: Full=GDSL esterase/lipase LIP-4; AltName: Full=Extracellular 
lipase LIP-4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG09098.1|AC009323_9 Similar to nodulins [Arabidopsis thaliana]
 gb|AEE33421.1| GDSL esterase/lipase LIP-4 [Arabidopsis thaliana]
Length=373

 Score =   393 bits (1010),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 198/369 (54%), Positives = 259/369 (70%), Gaps = 12/369 (3%)
 Frame = +3

Query  27    TNQRAAMFVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPD  206
             +N  +  F+ +   A L+L  P   AA C   PVIFNFGDSNSDTGG  A  G   G+P+
Sbjct  8     SNTFSFFFITLVSLALLILRQPS-RAASCTARPVIFNFGDSNSDTGGLVAGLGYPIGFPN  66

Query  207   GRTFFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKF  383
             GR FF RS+ RL DGRL+IDFLC+++    L PYL++L  + F+NG NFAI GS TLPK 
Sbjct  67    GRLFFRRSTGRLSDGRLLIDFLCQSLNTSLLRPYLDSLGRTRFQNGANFAIAGSPTLPKN  126

Query  384   VLFSLSTQLLQFNRFRTRSLEFHSKGTN--GM-LGEEDFENALYMIDIGQNDIAGAFSY-  551
             V FSL+ Q+ QF+ F++RSLE  S   +  GM +    F+NALYMIDIGQNDIA +F+  
Sbjct  127   VPFSLNIQVKQFSHFKSRSLELASSSNSLKGMFISNNGFKNALYMIDIGQNDIARSFARG  186

Query  552   LSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFE  731
              S +Q ++ IP  I+EIK ++  +Y  GGR+FW+HNTGP+GCLP+ L+  K +D     +
Sbjct  187   NSYSQTVKLIPQIITEIKSSIKRLYDEGGRRFWIHNTGPLGCLPQKLSMVKSKD----LD  242

Query  732   ETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPL  911
             + GC+ S N AA  FN  L  +CEELR E++DATI+Y+DIY IKY+LI+NS  YGF++PL
Sbjct  243   QHGCLVSYNSAATLFNQGLDHMCEELRTELRDATIIYIDIYAIKYSLIANSNQYGFKSPL  302

Query  912   MACCGGGGAPYNAN--ISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYST  1085
             MACCG GG PYN N  I+CG  G +VC++GS++ISWDG+HYTE ANA+VA  VLS +YS 
Sbjct  303   MACCGYGGTPYNYNVKITCGHKGSNVCEEGSRFISWDGIHYTETANAIVAMKVLSMHYSK  362

Query  1086  PPFNFDYFC  1112
             PP  F +FC
Sbjct  363   PPTPFHFFC  371



>ref|XP_006302361.1| hypothetical protein CARUB_v10020428mg, partial [Capsella rubella]
 gb|EOA35259.1| hypothetical protein CARUB_v10020428mg, partial [Capsella rubella]
Length=391

 Score =   394 bits (1011),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 198/348 (57%), Positives = 250/348 (72%), Gaps = 13/348 (4%)
 Frame = +3

Query  93    PLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFL  272
             P AAA C   PVIFNFGDSNSDTGG  A  G   G P+GR FF RS+ RL DGRL+IDFL
Sbjct  47    PSAAASCTTPPVIFNFGDSNSDTGGLVAGLGYPIGLPNGRLFFRRSTGRLSDGRLLIDFL  106

Query  273   CENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEF  449
             C+++  + L PYL++L  + F+NG NFAI GS TLPK V FSLS QL+QF+ F++RSLE 
Sbjct  107   CQSLNTNLLRPYLDSLGGTKFQNGANFAIVGSTTLPKNVPFSLSIQLMQFSHFKSRSLEL  166

Query  450   HSKGTNGM----LGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAV  614
              S  +N +    + ++ F NALYMIDIGQNDIA +F+   S +Q +  IP  ISEIK  +
Sbjct  167   ASS-SNSLKSMYISQDGFRNALYMIDIGQNDIARSFAKGNSYSQTVMLIPQVISEIKSGI  225

Query  615   WAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSD  794
               +Y  GGRKFW+HNTGP+GCLP+ L+  K +D     ++ GC+ S N AA+ FN +L  
Sbjct  226   KRLYDEGGRKFWIHNTGPLGCLPQKLSMVKSKD----LDQHGCLASYNSAAKVFNQRLDH  281

Query  795   LCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNAN--ISCGQ  968
             +C ELR+++KDATIV VDIYTIKY+LI+NS  YGFE PLMACCG GG+PYN N  I+CG 
Sbjct  282   MCMELRNQLKDATIVNVDIYTIKYSLIANSNEYGFERPLMACCGYGGSPYNYNVKITCGH  341

Query  969   SGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
              G +VC  GS+++SWDG+HYTE ANA+VA  VLS +YS PP  F +FC
Sbjct  342   RGSNVCDKGSRFVSWDGIHYTETANAIVAMKVLSMHYSNPPTPFHFFC  389



>ref|XP_004494523.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Cicer arietinum]
Length=376

 Score =   393 bits (1009),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 188/352 (53%), Positives = 255/352 (72%), Gaps = 8/352 (2%)
 Frame = +3

Query  69    AFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCD  248
             AF  L    ++ + C +  VIF FGDSNSDTGG  +  G     P+GRTFFHRS+ RL D
Sbjct  27    AFCCLGLADVSVSGCNKAAVIFVFGDSNSDTGGLTSGLGFPINIPNGRTFFHRSTGRLSD  86

Query  249   GRLIIDFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNR  425
             GRL+ID LC+++  ++L+PYL+AL+ S F NG NFA+ GS TLPK+V FSL+ Q++QF  
Sbjct  87    GRLVIDLLCQSLNTNFLTPYLDALSGSTFTNGANFAVVGSSTLPKYVPFSLNIQVMQFQH  146

Query  426   FRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEI  602
             F+ RSLE  + GT  M+ +E F +ALY+IDIGQND+A +FS  LS  QVI+KIP+ I+EI
Sbjct  147   FKARSLELVTAGTKNMINDEGFRDALYLIDIGQNDLADSFSKNLSYPQVIKKIPTVITEI  206

Query  603   KDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNV  782
             ++A+ ++Y  GGRKFW+HNTGP GCLP+ +A ++ +D     +  GC+ S N AA+ FN 
Sbjct  207   ENAIKSLYNEGGRKFWLHNTGPFGCLPKLIALSQKKD----LDSLGCLSSYNSAARLFNE  262

Query  783   KLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN--ANI  956
              L+ L ++LR ++KDAT+VYVDIY IKY+LI+N+  YGF NPLM CCG GG PYN    +
Sbjct  263   ALNHLSQKLRIQLKDATLVYVDIYAIKYDLITNATKYGFSNPLMVCCGYGGPPYNFDVRV  322

Query  957   SCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             +CGQ G+ VC +GS+Y+SWDG+H+TE AN  +A+ +LST YSTP   F +FC
Sbjct  323   TCGQPGYQVCDEGSQYVSWDGIHFTEAANTWIASKILSTAYSTPRIPFSFFC  374



>gb|EYU46852.1| hypothetical protein MIMGU_mgv1a010014mg [Erythranthe guttata]
Length=324

 Score =   390 bits (1003),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 187/312 (60%), Positives = 235/312 (75%), Gaps = 6/312 (2%)
 Frame = +3

Query  192   FGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQT  371
             FGYP GR+FFHRS+ RL DGRL+IDFLCEN+K +YL+PYLE+L P F NG NFA GG+ T
Sbjct  5     FGYPYGRSFFHRSTGRLSDGRLVIDFLCENLKTNYLTPYLESLGPDFTNGANFAAGGATT  64

Query  372   LPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY  551
             LP+ V F+L+ QLLQF RF   SL+ HSKG   ++ ++DF  ALY IDIGQ D+  A + 
Sbjct  65    LPRNVPFNLNVQLLQFTRFHNHSLQLHSKGLKKVIRDKDFRKALYTIDIGQFDLWVALNS  124

Query  552   LSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFE  731
              S A+ IEKIPSFISEI+DA+ AIY++GGRKFW+HNTGP+GCLP  LAT K     T+ +
Sbjct  125   FSYAEAIEKIPSFISEIRDAILAIYRLGGRKFWIHNTGPLGCLPAELATRKTNV--TDLD  182

Query  732   ETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPL  911
             + GCIKSLNE A+ FN KL+ LC+ELR ++ D+T+VYVDIY+IKYNLI+NS  YGFENPL
Sbjct  183   QYGCIKSLNEGAKAFNAKLNHLCQELRIQINDSTVVYVDIYSIKYNLIANSTHYGFENPL  242

Query  912   MACCGGGGAPYNAN--ISCGQ--SGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNY  1079
               CCG GGAPYN +  I C     G ++C+  S  I+WDG HY+E ANA VA+ +LST Y
Sbjct  243   TVCCGYGGAPYNFDHYIKCRDIIKGANLCEQRSPRINWDGTHYSEPANAFVASEILSTKY  302

Query  1080  STPPFNFDYFCS  1115
             STP   F++FC+
Sbjct  303   STPRLKFNFFCN  314



>ref|XP_010415016.1| PREDICTED: GDSL esterase/lipase LIP-4-like isoform X1 [Camelina 
sativa]
Length=373

 Score =   392 bits (1006),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 197/364 (54%), Positives = 254/364 (70%), Gaps = 11/364 (3%)
 Frame = +3

Query  42    AMFVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFF  221
             ++F  I  S  L+    P  AA C   PVIFNFGDSNSDTGG  A  G   G+P+GR FF
Sbjct  12    SIFFIIFVSLVLLSLRQPSEAASCTTPPVIFNFGDSNSDTGGLVAGLGYPVGFPNGRLFF  71

Query  222   HRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSL  398
              RS+ RL DGRL+IDFLC+++    L PYL++L  + F+NG NFAI GS TLPK V FSL
Sbjct  72    RRSTGRLSDGRLLIDFLCQSLNTSLLRPYLDSLGGTRFQNGANFAIVGSATLPKNVPFSL  131

Query  399   STQLLQFNRFRTRSLEFHSKGTN--GM-LGEEDFENALYMIDIGQNDIAGAFSY-LSKAQ  566
             S QL+QF+ F++RSLE  S   +  GM + E+ F+NALYMIDIGQNDI+ +F+   S +Q
Sbjct  132   SIQLMQFSHFKSRSLELASSSNSLKGMYISEDGFKNALYMIDIGQNDISHSFAKGNSYSQ  191

Query  567   VIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCI  746
              ++ IP  +SEI+  +  +Y  GGR+FW+HNTGP+GCLP+ L+    +D     ++ GC+
Sbjct  192   TVKLIPQIVSEIQSGIKRLYDEGGRRFWIHNTGPLGCLPQKLSMVTSKD----LDQHGCL  247

Query  747   KSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCG  926
              S N AA+ FN +L  +CEELR ++KDATI+YVDIYTIKY+LI+NS  YGF  PLMACCG
Sbjct  248   ASYNSAAKLFNQRLDHMCEELRSQLKDATIIYVDIYTIKYSLIANSNEYGFGRPLMACCG  307

Query  927   GGGAP--YNANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNF  1100
              GG P  YN NI+CG  G +VC  GS+++SWDG+HYTE ANA+VA  VLS  YS P   F
Sbjct  308   YGGTPYNYNMNITCGHRGSNVCDKGSRFVSWDGIHYTETANAIVAMKVLSMQYSNPSNPF  367

Query  1101  DYFC  1112
              +FC
Sbjct  368   HFFC  371



>ref|XP_006417577.1| hypothetical protein EUTSA_v10007968mg [Eutrema salsugineum]
 gb|ESQ35930.1| hypothetical protein EUTSA_v10007968mg [Eutrema salsugineum]
Length=371

 Score =   391 bits (1005),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 199/362 (55%), Positives = 249/362 (69%), Gaps = 11/362 (3%)
 Frame = +3

Query  48    FVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHR  227
             F+F      L L      A  C   PVIFNFGDSNSDTGG  A  G   G P+GR+FF R
Sbjct  12    FLFSLLPVILNLKQHLAVAGVCQYPPVIFNFGDSNSDTGGLVAGLGYAIGLPNGRSFFRR  71

Query  228   SSDRLCDGRLIIDFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLST  404
             S+ RL DGRLIIDFLC+++    L+PYL++L  S F+NG NFAI GS TLP++V F L+ 
Sbjct  72    STGRLSDGRLIIDFLCQSLNTSLLNPYLDSLVGSKFQNGANFAIVGSTTLPRYVPFVLNI  131

Query  405   QLLQFNRFRTRSLEFHSKG---TNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVI  572
             QL+QF  F++R+LE  S        M+ +  F NALYMIDIGQNDIA +FS  LS  QV+
Sbjct  132   QLMQFLHFKSRALELASTSDPLKEMMISDSGFRNALYMIDIGQNDIADSFSKGLSYTQVV  191

Query  573   EKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKS  752
             + IP+ ISEI+ A+  +Y  GGRKFWVHNTGP+GCLP+ L+  + +     F++ GC+ S
Sbjct  192   KLIPNVISEIRSAIKTLYDEGGRKFWVHNTGPLGCLPQKLSMVQSK----AFDKHGCLAS  247

Query  753   LNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGG  932
              N AA+ FN  L   C ELR E+++A IVYVDIY IKY+LI+NS  YGFE PLMACCG G
Sbjct  248   YNSAAKLFNEGLDHTCRELRTELRNADIVYVDIYAIKYDLIANSTNYGFEKPLMACCGYG  307

Query  933   GAP--YNANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDY  1106
             G P  YN NI+CG  G + C++GS++ISWDG+HYTE ANA+VA  VLS  YSTPP  F +
Sbjct  308   GPPYNYNVNITCGHGGSNACEEGSRFISWDGIHYTETANAIVAMKVLSMQYSTPPTPFHF  367

Query  1107  FC  1112
             FC
Sbjct  368   FC  369



>ref|XP_009393150.1| PREDICTED: GDSL esterase/lipase At1g09390 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=372

 Score =   391 bits (1005),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 194/339 (57%), Positives = 236/339 (70%), Gaps = 5/339 (1%)
 Frame = +3

Query  111   CIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKA  290
             C    V+FNFGDSNSDTGG  A  G +    +GR FF RSS RLCDGRL+IDFLCE++  
Sbjct  36    CGSGAVVFNFGDSNSDTGGLTAGLGILLPQEEGRVFFRRSSGRLCDGRLVIDFLCESLNT  95

Query  291   DYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNG  470
              YLSPY+E L   F +G NFA+ GS T P  V F+L+ Q+ QF RF+ RSLE  ++G   
Sbjct  96    SYLSPYMEPLGADFSSGANFAVAGSCTRPPDVPFALAVQVRQFLRFKLRSLELVAQGAED  155

Query  471   MLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVWAIYKVGGRKF  647
             ++  E F NA+Y IDIGQND+A AFS  LS  QVIE++PS I EIK A+  +Y  GG+KF
Sbjct  156   LIDAEGFRNAIYAIDIGQNDLAAAFSANLSYVQVIERVPSVIHEIKKAIENLYDNGGKKF  215

Query  648   WVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKD  827
             WVHNTGP+GCLP+ LA    R  N+  +  GC+   N AA+EFN +LS LC+ L  E+K+
Sbjct  216   WVHNTGPLGCLPQKLALP--RKHNSSLDPYGCLIPFNNAAKEFNAQLSALCDNLNSELKN  273

Query  828   ATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNAN--ISCGQSGFSVCKDGSK  1001
             ATIVY DIY+IKY+LI+N   YGFE  LMACCG GG PYN N  I CG  G  VC  GSK
Sbjct  274   ATIVYTDIYSIKYDLIANHTAYGFETALMACCGYGGPPYNFNQRIECGAFGSQVCPLGSK  333

Query  1002  YISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
             YISWDGVHYTE ANA+VA+ +L+T YS P   FDYFC+ 
Sbjct  334   YISWDGVHYTEAANAIVASKILTTKYSKPNLAFDYFCTA  372



>ref|XP_010674543.1| PREDICTED: GDSL esterase/lipase At1g09390 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010674544.1| PREDICTED: GDSL esterase/lipase At1g09390 [Beta vulgaris subsp. 
vulgaris]
Length=362

 Score =   390 bits (1003),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 194/362 (54%), Positives = 252/362 (70%), Gaps = 9/362 (2%)
 Frame = +3

Query  48    FVFITCSAFLVLSSPPL----AAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRT  215
             FV +T S+ +VL    +    A   C + PVIFNFGDSNSDTGG  +  G     P+GR+
Sbjct  3     FVTVTLSSMVVLVVIEMHFGVAFGGCQKTPVIFNFGDSNSDTGGLTSGLGYQINPPNGRS  62

Query  216   FFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFS  395
             FF R + RL DGRLIIDFLC+++   +LSPYLE+L  +F+NG NFAI GS TLP++  F+
Sbjct  63    FFGRPAGRLSDGRLIIDFLCQSLNTKFLSPYLESLGSNFENGANFAIVGSTTLPEYKPFA  122

Query  396   LSTQLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVI  572
             L+ Q++QF+ FR+RSLE  + G  G   E+ F NALYMIDIGQND+A +FS   S AQV+
Sbjct  123   LNVQVMQFHHFRSRSLELAATGAKGFFDEQQFRNALYMIDIGQNDLADSFSKNHSYAQVV  182

Query  573   EKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKS  752
             + IP  I EIK AV  +Y  GGRKFW+HNTGP+GCLP+ L+   V+    + +  GCI S
Sbjct  183   KIIPLVIGEIKKAVKTLYDQGGRKFWIHNTGPLGCLPQKLSL--VQHKEGDVDTAGCISS  240

Query  753   LNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGG  932
              N AAQ FN  L   C+E++ E+ DATIV+VDIY+IKY++IS+   +GF +PLMACCG G
Sbjct  241   YNSAAQLFNAALLHSCQEMKSELADATIVHVDIYSIKYDIISHGVKHGFSSPLMACCGSG  300

Query  933   GAPYNANI--SCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDY  1106
             G PYN NI  +CG  G   C +GS+ +SWDG+HYTE ANA+VA  +LS +YSTP   FD+
Sbjct  301   GPPYNYNIHMTCGNYGSQPCNNGSQSVSWDGIHYTEAANAIVAKRILSMDYSTPKMPFDF  360

Query  1107  FC  1112
             FC
Sbjct  361   FC  362



>ref|NP_172410.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|O80522.1|GDL2_ARATH RecName: Full=GDSL esterase/lipase At1g09390; AltName: Full=Extracellular 
lipase At1g09390; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC33199.1| Similar to nodulins and lipase [Arabidopsis thaliana]
 gb|AAO22702.1| putative lipase [Arabidopsis thaliana]
 gb|AAO42391.1| putative lipase [Arabidopsis thaliana]
 gb|AEE28436.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=370

 Score =   390 bits (1002),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 197/362 (54%), Positives = 251/362 (69%), Gaps = 11/362 (3%)
 Frame = +3

Query  48    FVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHR  227
             F+ +     L+L      A  C   PVIFNFGDSNSDTGG  A  G   G P+GR+FF R
Sbjct  11    FLLVLLPFILILRQNLAVAGGCQVPPVIFNFGDSNSDTGGLVAGLGYSIGLPNGRSFFQR  70

Query  228   SSDRLCDGRLIIDFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLST  404
             S+ RL DGRL+IDFLC+++    L+PYL++L  S F+NG NFAI GS TLP++V F+L+ 
Sbjct  71    STGRLSDGRLVIDFLCQSLNTSLLNPYLDSLVGSKFQNGANFAIVGSSTLPRYVPFALNI  130

Query  405   QLLQFNRFRTRSLEFHSKG---TNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVI  572
             QL+QF  F++R+LE  S        M+GE  F NALYMIDIGQNDIA +FS  LS ++V+
Sbjct  131   QLMQFLHFKSRALELASISDPLKEMMIGESGFRNALYMIDIGQNDIADSFSKGLSYSRVV  190

Query  573   EKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKS  752
             + IP+ ISEIK A+  +Y  GGRKFWVHNTGP+GCLP+ L+    +     F++ GC+ +
Sbjct  191   KLIPNVISEIKSAIKILYDEGGRKFWVHNTGPLGCLPQKLSMVHSKG----FDKHGCLAT  246

Query  753   LNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGG  932
              N AA+ FN  L  +C +LR E+K+A IVYVDIY IKY+LI+NS  YGFE PLMACCG G
Sbjct  247   YNAAAKLFNEGLDHMCRDLRTELKEANIVYVDIYAIKYDLIANSNNYGFEKPLMACCGYG  306

Query  933   GAP--YNANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDY  1106
             G P  YN NI+CG  G   C +GS++ISWDG+HYTE ANA+VA  VLS  +STPP  F +
Sbjct  307   GPPYNYNVNITCGNGGSKSCDEGSRFISWDGIHYTETANAIVAMKVLSMQHSTPPTPFHF  366

Query  1107  FC  1112
             FC
Sbjct  367   FC  368



>emb|CDP15217.1| unnamed protein product [Coffea canephora]
Length=382

 Score =   390 bits (1003),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 200/347 (58%), Positives = 252/347 (73%), Gaps = 5/347 (1%)
 Frame = +3

Query  84    SSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLII  263
             S P     EC   PVIFNFGDSNSDTGG  A  G    +P+GRTFF RS+ RL DGRLII
Sbjct  38    SLPNSVLGECKNPPVIFNFGDSNSDTGGLVAGLGYSINFPNGRTFFRRSTGRLSDGRLII  97

Query  264   DFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSL  443
             DFLC++V   +LSPYL+++  +F NG NFAI GS TLPK V FSL+ Q++QF  F+ RS+
Sbjct  98    DFLCQSVYTTFLSPYLDSMGSTFLNGANFAIAGSSTLPKNVPFSLNIQVMQFVHFKDRSI  157

Query  444   EFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVWA  620
             +  S G+   +G   F N LY+IDIGQND+A +F+  LS  +V++KIPS I EIK AV  
Sbjct  158   QLVSAGSLHFIGAAGFRNGLYVIDIGQNDLADSFAKNLSYKEVVKKIPSVILEIKYAVED  217

Query  621   IYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLC  800
             IY  GGRKFWVHNTGP+GCLP+ L+T  V+    + +  GCI S N+AA+ FN  L  LC
Sbjct  218   IYAQGGRKFWVHNTGPLGCLPQKLST--VQKAPDDLDSYGCISSYNDAARVFNEALLLLC  275

Query  801   EELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN--ANISCGQSG  974
             EELR+E KDATIVYVD+YTIKY+LI+NS  YGF +PL+ACCG GG PYN    ++CG  G
Sbjct  276   EELRYEKKDATIVYVDVYTIKYDLIANSTKYGFSSPLVACCGFGGPPYNYDVRVTCGHPG  335

Query  975   FSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCS  1115
             + VC + SKY+SWDG+HYTE AN+++A+ +LST+YSTP   FDYFC+
Sbjct  336   YQVCDEDSKYVSWDGIHYTEAANSIIASKILSTDYSTPRIAFDYFCN  382



>ref|XP_010553708.1| PREDICTED: GDSL esterase/lipase At1g09390 [Tarenaya hassleriana]
Length=398

 Score =   390 bits (1003),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 191/350 (55%), Positives = 249/350 (71%), Gaps = 11/350 (3%)
 Frame = +3

Query  84    SSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLII  263
             S+   A + C   PVIFNFGDSNSDTGG  A  G     P+GR+FF +S+ RL DGRL++
Sbjct  51    SAAATAESRCQIPPVIFNFGDSNSDTGGLVAGLGFSVNLPNGRSFFRQSTGRLSDGRLVL  110

Query  264   DFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRS  440
             DFLC+++    L+PYL++L  S F+NG NFAI GS TLP+FV F+L+ QL+QF  F++R+
Sbjct  111   DFLCQSLNTSLLNPYLDSLAGSRFQNGANFAIVGSSTLPRFVPFALNIQLMQFLHFKSRA  170

Query  441   LEFHSKG---TNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKD  608
             LE  S        M+ E+ F +ALYMIDIGQNDIA +FS   S ++V+++IP+ ISEIKD
Sbjct  171   LELASSSDPLREMMISEDGFRSALYMIDIGQNDIADSFSKGHSFSRVVKEIPNVISEIKD  230

Query  609   AVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKL  788
             AV  +Y  GGRKFW+HNTGP+GCLP+ L   + +D     +E GC+ S N AA+ FN  L
Sbjct  231   AVKTLYNQGGRKFWIHNTGPLGCLPQKLEMVQKKD----LDEHGCLASYNSAAKLFNEGL  286

Query  789   SDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISC  962
               +C +LR E++DAT+VYVD+Y IKY+LI+N+  YGFE PLMACCG GG P  YN NI+C
Sbjct  287   DHMCRDLRTELRDATVVYVDVYAIKYDLIANATKYGFEKPLMACCGFGGPPYNYNVNITC  346

Query  963   GQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             G  G   C +GS++++WDG+HYTE ANAMVA  VLS  YSTP   FD+FC
Sbjct  347   GHEGAKACDEGSRFLNWDGIHYTETANAMVAMKVLSMQYSTPRTRFDFFC  396



>ref|XP_006480703.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Citrus sinensis]
Length=378

 Score =   390 bits (1001),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 199/367 (54%), Positives = 261/367 (71%), Gaps = 12/367 (3%)
 Frame = +3

Query  39    AAMFVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTF  218
             ++   F  C  FL  +SP   AA+C   PVIFNFGDSNSDTGG  A  G     P+GRTF
Sbjct  17    SSFLFFGLCVCFL--ASP--VAAQCKNPPVIFNFGDSNSDTGGLFAGLGFPVDLPNGRTF  72

Query  219   FHRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFS  395
             F RS+ RL DGRL+IDFLC+++ A  LSPY+++L+ S F NG NFA+ GS TLPK+V FS
Sbjct  73    FGRSTGRLSDGRLLIDFLCQSLNASLLSPYMDSLSESKFNNGANFAVVGSSTLPKYVPFS  132

Query  396   LSTQLLQFNRFRTRSLEFHSKGTNG---MLGEEDFENALYMIDIGQNDIAGAFSY-LSKA  563
             L+ Q++QF  F+ R+LE  + G  G    + +E F NALYMIDIGQND+A +FS  L+  
Sbjct  133   LNIQVMQFLHFKARTLELVTAGKIGSGNFINDEGFRNALYMIDIGQNDLADSFSKNLTYV  192

Query  564   QVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGC  743
             +VI++IPS I+EIK+AV  +Y  GGRKFW+HNTGP+GCLP+ L+  ++     + +  GC
Sbjct  193   EVIKRIPSVITEIKNAVKTLYDHGGRKFWIHNTGPLGCLPQKLSLIQLLQ-KKDLDTYGC  251

Query  744   IKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACC  923
             I S N AA+ FN  L   C++++ E++DATIV+VDI+++KY+LI+NS  YGF NPLMACC
Sbjct  252   ISSYNAAARLFNEALLHFCQQMKSELEDATIVHVDIFSVKYDLIANSTKYGFSNPLMACC  311

Query  924   GGGGAPYNANI--SCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
             G GG PYN NI  +CG  G  VC +GSK ISWDG+HYTE ANA++A+ VLS  YSTP   
Sbjct  312   GFGGPPYNYNIQVTCGHRGCPVCAEGSKSISWDGIHYTEAANAIIASKVLSMAYSTPRTP  371

Query  1098  FDYFCST  1118
             FD+FC +
Sbjct  372   FDFFCRS  378



>ref|XP_011081093.1| PREDICTED: GDSL esterase/lipase LIP-4-like isoform X3 [Sesamum 
indicum]
Length=352

 Score =   389 bits (998),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 194/344 (56%), Positives = 246/344 (72%), Gaps = 23/344 (7%)
 Frame = +3

Query  96    LAAAECIRN-PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFL  272
             L   +C R  PVIFNFGDSNSDTGG+ A  G    YP GR FF R + R  DGRL+IDFL
Sbjct  22    LVLPQCTRKTPVIFNFGDSNSDTGGFVAGLGLDIAYPYGRAFFRRPTGRASDGRLVIDFL  81

Query  273   CENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFH  452
             CE +   YLSPYL++L P F NG NFAI G+ TLP                    S+   
Sbjct  82    CEYLDTRYLSPYLDSLEPDFTNGANFAIVGAATLPN-------------------SIPSF  122

Query  453   SKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKV  632
             + G    L ++DF++ALY++DIGQND++G+F  LS AQVIE+IPSFISEIKDA+W IY V
Sbjct  123   NLGKPNFLDKDDFKSALYILDIGQNDLSGSFWSLSYAQVIERIPSFISEIKDAMWGIYAV  182

Query  633   GGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELR  812
             GGR FWVHNTGP+GCLPR LA    R+  ++++E GCI SLN+ A+ FN KL  LC++L 
Sbjct  183   GGRNFWVHNTGPLGCLPRELAIRSNRNV-SDYDEYGCITSLNQGAKAFNAKLEALCQQLP  241

Query  813   HEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN--ANISCGQSGFSVC  986
              +M++ATIVYVD+Y+IKY LI+NS +YGF+NPLMACCG GGAPYN     +C  S  +VC
Sbjct  242   SQMENATIVYVDVYSIKYGLIANSTLYGFKNPLMACCGYGGAPYNYEEGRTCLGSEHTVC  301

Query  987   KDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
             ++G ++ISWDGVHY+E ANA+VA+ +LST+YS+PP  FD+FCST
Sbjct  302   EEGIQHISWDGVHYSEAANAIVASKLLSTHYSSPPLPFDFFCST  345



>ref|XP_011038990.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Populus euphratica]
Length=365

 Score =   389 bits (998),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 190/342 (56%), Positives = 246/342 (72%), Gaps = 8/342 (2%)
 Frame = +3

Query  99    AAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCE  278
              A++C   P+IFNFGDSNSDTGG  A  G     P+GRTFFHRS+ RL DGRL+IDFLC+
Sbjct  26    VASQCKNPPIIFNFGDSNSDTGGLVAGLGFPVNLPNGRTFFHRSTGRLSDGRLLIDFLCQ  85

Query  279   NVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHS  455
             ++ A +LSPYL++L  S F NG NFA+ GS TLPK+V FSL+ QL+QF  F+ R+LE  +
Sbjct  86    SLNASFLSPYLDSLGGSGFTNGANFAVVGSSTLPKYVPFSLNIQLMQFLHFKARTLELVT  145

Query  456   KGTNGMLGEEDFENALYMIDIGQNDIAGAFS-YLSKAQVIEKIPSFISEIKDAVWAIYKV  632
              G    + +E   NALY+IDIGQNDIA +FS  LS AQV ++IPS I EI +AV  +Y  
Sbjct  146   AGFGNFITDEGLRNALYIIDIGQNDIADSFSKKLSYAQVTKRIPSVILEIGNAVKVLYNQ  205

Query  633   GGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELR  812
             GGRKFW+HNTGP+GCLP+ L+  + +D     +  GCI   N AA  FN  L  LCE + 
Sbjct  206   GGRKFWIHNTGPLGCLPQKLSLVQKKD----LDPIGCISDYNRAAGLFNEGLRRLCERMG  261

Query  813   HEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANI--SCGQSGFSVC  986
              ++  ATIVYVDIY+IKY+LI+NS+ YGF +PLMACCG GG PYN +I  +C Q G+ VC
Sbjct  262   SQLSGATIVYVDIYSIKYDLIANSSKYGFSSPLMACCGSGGPPYNYDIRVTCSQPGYQVC  321

Query  987   KDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
              +GS+Y+SWDG+HYTE AN+++A+ VLS  +S+P   FD+FC
Sbjct  322   DEGSRYVSWDGIHYTEAANSIIASKVLSMAHSSPSIPFDFFC  363



>ref|XP_011081094.1| PREDICTED: GDSL esterase/lipase LIP-4-like isoform X4 [Sesamum 
indicum]
Length=346

 Score =   387 bits (993),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 194/344 (56%), Positives = 245/344 (71%), Gaps = 29/344 (8%)
 Frame = +3

Query  96    LAAAECIRN-PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFL  272
             L   +C R  PVIFNFGDSNSDTGG+ A  G    YP GR FF R + R  DGRL+IDFL
Sbjct  22    LVLPQCTRKTPVIFNFGDSNSDTGGFVAGLGLDIAYPYGRAFFRRPTGRASDGRLVIDFL  81

Query  273   CENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFH  452
             CE +   YLSPYL++L P F NG NFAI G+ TLP          +  FN          
Sbjct  82    CEYLDTRYLSPYLDSLEPDFTNGANFAIVGAATLPN--------SIPSFN----------  123

Query  453   SKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKV  632
                    L ++DF++ALY++DIGQND++G+F  LS AQVIE+IPSFISEIKDA+W IY V
Sbjct  124   -------LDKDDFKSALYILDIGQNDLSGSFWSLSYAQVIERIPSFISEIKDAMWGIYAV  176

Query  633   GGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELR  812
             GGR FWVHNTGP+GCLPR LA    R+  ++++E GCI SLN+ A+ FN KL  LC++L 
Sbjct  177   GGRNFWVHNTGPLGCLPRELAIRSNRNV-SDYDEYGCITSLNQGAKAFNAKLEALCQQLP  235

Query  813   HEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN--ANISCGQSGFSVC  986
              +M++ATIVYVD+Y+IKY LI+NS +YGF+NPLMACCG GGAPYN     +C  S  +VC
Sbjct  236   SQMENATIVYVDVYSIKYGLIANSTLYGFKNPLMACCGYGGAPYNYEEGRTCLGSEHTVC  295

Query  987   KDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
             ++G ++ISWDGVHY+E ANA+VA+ +LST+YS+PP  FD+FCST
Sbjct  296   EEGIQHISWDGVHYSEAANAIVASKLLSTHYSSPPLPFDFFCST  339



>ref|XP_010458221.1| PREDICTED: GDSL esterase/lipase At1g09390 [Camelina sativa]
Length=372

 Score =   387 bits (993),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 197/350 (56%), Positives = 250/350 (71%), Gaps = 13/350 (4%)
 Frame = +3

Query  96    LAAAE-CIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFL  272
             LA AE C   PVIFNFGDSNSDTGG  A  G   G P+GR+FF RS+ RL DGRL+IDFL
Sbjct  27    LAVAEGCQHPPVIFNFGDSNSDTGGLTAGLGYYIGLPNGRSFFRRSTGRLSDGRLVIDFL  86

Query  273   CENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEF  449
             CE++    L+PYL++L  S F+NG NFAI GS TLP++V F+L+ QL+QF  F++R+LE 
Sbjct  87    CESLNTSLLNPYLDSLVGSKFQNGANFAIVGSSTLPRYVPFALNIQLMQFLHFKSRALEL  146

Query  450   HSKG---TNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKI-PSFISEIKDAV  614
              S        M+ E  F NALYMIDIGQNDIA +FS  LS ++V++ I P+ ISEIK A+
Sbjct  147   ASTSDPLKEMMISESGFRNALYMIDIGQNDIANSFSKGLSYSRVVKLIIPNVISEIKSAI  206

Query  615   WAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSD  794
               +Y  GGRKFWVHNTGP+GCLP+ L+  + +     F++ GC+ S N AA+ FN  L  
Sbjct  207   KILYDEGGRKFWVHNTGPLGCLPQKLSMVQSK----VFDKHGCLVSYNAAAKLFNEGLDH  262

Query  795   LCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQ  968
             +C ELR E+++A IVYVDIY IKY+LI+NS  YGFE PLMACCG GG P  YN NI+CG 
Sbjct  263   MCGELRTELREANIVYVDIYAIKYDLITNSTNYGFEKPLMACCGYGGPPYNYNVNITCGN  322

Query  969   SGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
              G   C++GS++ISWDG+HYTE ANA+++  VLS  YSTPP  F +FC +
Sbjct  323   GGSKSCEEGSRFISWDGIHYTETANAIISMKVLSMQYSTPPTPFHFFCGS  372



>gb|KFK43235.1| hypothetical protein AALP_AA1G097500 [Arabis alpina]
Length=372

 Score =   386 bits (992),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 196/347 (56%), Positives = 244/347 (70%), Gaps = 15/347 (4%)
 Frame = +3

Query  99    AAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCE  278
              A  C   PVIFNFGDSNSDTGG  A  G   G P+GR+FF RS+ RL DGRL+IDFLC+
Sbjct  30    VAGGCQYPPVIFNFGDSNSDTGGLVAGLGYTIGLPNGRSFFRRSTGRLSDGRLVIDFLCQ  89

Query  279   NVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHS  455
             ++    L+PYL++L  S F+NG NFAI GS TLP++V F L+ QL+QF  F+ R++E  S
Sbjct  90    SLNTSLLNPYLDSLVGSKFQNGANFAIVGSSTLPRYVPFVLNVQLMQFLHFKARAIELAS  149

Query  456   -----KGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVW  617
                  KG   M+ E  F NALYMIDIGQNDIA +FS  LS + V++ IP+ ISEIK AV 
Sbjct  150   TSDPLKGM--MVSESGFRNALYMIDIGQNDIADSFSKGLSYSGVVKLIPNVISEIKSAVK  207

Query  618   AIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDL  797
              +Y  GGRKFWVHNTGP+GCLP+ L+  K +D    F++ GC+   N AA+ FN  L  +
Sbjct  208   TLYDEGGRKFWVHNTGPLGCLPQKLSMVKSKD----FDKHGCLARYNSAAKLFNEGLEHM  263

Query  798   CEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQS  971
             C ELR E+++A IVYVDIY IKY+LI+NS  YGFE PLMACCG GG P  YN NI+CG  
Sbjct  264   CRELRIELREANIVYVDIYAIKYDLIANSTNYGFEKPLMACCGYGGPPYNYNVNITCGHG  323

Query  972   GFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             G + C++ S++ISWDG+HYTE AN +VA  VLS  YSTPP  F +FC
Sbjct  324   GSNSCEERSRFISWDGIHYTETANTIVAMKVLSMQYSTPPTPFHFFC  370



>ref|XP_002889747.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH66006.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=370

 Score =   386 bits (992),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 195/362 (54%), Positives = 249/362 (69%), Gaps = 11/362 (3%)
 Frame = +3

Query  48    FVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHR  227
             F+ +     L+L      A  C   PVIFNFGDSNSDTGG  A  G     P GR+FF R
Sbjct  11    FILVLFPVILILRHNLAVAGGCRLPPVIFNFGDSNSDTGGLVAGLGYSIVLPYGRSFFER  70

Query  228   SSDRLCDGRLIIDFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLST  404
             S+ RL DGRL+IDFLC+++    L+PYL++L  S F+NG NFAI GS TLP++V F+L+ 
Sbjct  71    STGRLSDGRLVIDFLCQSLNTSLLNPYLDSLVGSKFQNGANFAIVGSSTLPRYVPFALNI  130

Query  405   QLLQFNRFRTRSLEFHSKG---TNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVI  572
             QL+QF  F++R+LE  S        ++ +  F NALYMIDIGQNDIA +FS  LS ++V+
Sbjct  131   QLMQFLHFKSRALELASTSDPLKEMLISDSGFRNALYMIDIGQNDIADSFSKGLSYSRVV  190

Query  573   EKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKS  752
             + IP+ ISEIK A+  +Y  GGRKFWVHNTGP+GCLP+ L+    +     F++ GC+ S
Sbjct  191   KLIPNVISEIKSAIKILYDEGGRKFWVHNTGPLGCLPQKLSMVHSK----AFDKHGCLAS  246

Query  753   LNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGG  932
              N AA+ FN  L  +C ELR E+K+A IVYVDIY IKY+LI+NS  YGFE PLMACCG G
Sbjct  247   YNAAAKLFNEGLDHMCRELRMELKEANIVYVDIYAIKYDLIANSNSYGFEKPLMACCGYG  306

Query  933   GAP--YNANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDY  1106
             G P  YN NI+CG  G   C++GS++ISWDG+HYTE ANA++A  VLS  YSTPP  F +
Sbjct  307   GPPYNYNVNITCGNGGSQSCEEGSRFISWDGIHYTETANAVIAMKVLSMQYSTPPTPFHF  366

Query  1107  FC  1112
             FC
Sbjct  367   FC  368



>ref|XP_009412146.1| PREDICTED: GDSL esterase/lipase LIP-4-like [Musa acuminata subsp. 
malaccensis]
Length=371

 Score =   386 bits (992),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 197/337 (58%), Positives = 241/337 (72%), Gaps = 5/337 (1%)
 Frame = +3

Query  117   RNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADY  296
             R PVIFNFGDSNSDTGG  A  G +    +GR FFHR S RLCDGRL+IDFLCE++ + Y
Sbjct  37    RRPVIFNFGDSNSDTGGLAAGLGLLLAQQEGRAFFHRPSGRLCDGRLVIDFLCESLHSIY  96

Query  297   LSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGML  476
             LSPY+E+L   F+NG NFA+ GS T P  V FSL+ Q+ QF RF+ RSLE  ++G  G+ 
Sbjct  97    LSPYMESLGSDFRNGANFAVIGSCTRPPNVPFSLAVQVQQFLRFKLRSLELVAQGAKGLT  156

Query  477   GEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWV  653
               E F+NALY IDIGQND+A AFS  L+ A+VI KIPS I EIK A+  +Y  GG+ FWV
Sbjct  157   DAEGFQNALYAIDIGQNDLAAAFSANLTYAKVIRKIPSIIHEIKKAIKNLYDNGGKNFWV  216

Query  654   HNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDAT  833
             HNTGP+GCLP+ LA  +  D  +  +  GC+   N AA+EFN +LS LC+EL  ++K+AT
Sbjct  217   HNTGPLGCLPQKLALPRKND--SRLDPYGCLIPFNNAAKEFNAQLSALCDELNSKLKNAT  274

Query  834   IVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNAN--ISCGQSGFSVCKDGSKYI  1007
             IVY DIY+IKY+LI+N   YGFE  LMACCG GG PYN N  + CG  G  VC  GSKYI
Sbjct  275   IVYTDIYSIKYDLIANFTKYGFETALMACCGYGGPPYNFNQTMECGSFGSQVCPLGSKYI  334

Query  1008  SWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
             SWDGVHYTE ANA+VA+ +L+T YS P   FDYFC+ 
Sbjct  335   SWDGVHYTEAANAIVASKILTTKYSKPNLAFDYFCTA  371



>ref|XP_002512551.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF50003.1| zinc finger protein, putative [Ricinus communis]
Length=366

 Score =   386 bits (991),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 187/341 (55%), Positives = 245/341 (72%), Gaps = 8/341 (2%)
 Frame = +3

Query  102   AAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCEN  281
             A++C   PV+FNFGDSNSDTGG  A  G    +P+GR FF RS+ RL DGRL+IDFLC++
Sbjct  28    ASQCKNPPVLFNFGDSNSDTGGLVAGLGFPVNFPNGRLFFRRSTGRLSDGRLLIDFLCQS  87

Query  282   VKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSK  458
             +  + LSPYL++L  S F NG NFA+ GS TLPK+V FSL+ Q++QF  F+ R+LE  + 
Sbjct  88    LNTNLLSPYLDSLGGSKFTNGANFAVVGSSTLPKYVPFSLNIQIMQFLHFKARALEAVNA  147

Query  459   GTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVWAIYKVG  635
             G+  M+ +E F NALYMIDIGQND+A +FS  LS AQV ++IPS + EI+ AV  +Y  G
Sbjct  148   GSGNMISDEGFRNALYMIDIGQNDLADSFSKNLSYAQVTKRIPSVVQEIEIAVKTLYDQG  207

Query  636   GRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRH  815
             GRKFW+HNTGP+GCLP+ L   +      E +  GCI S N AA+ FN  L   C+++R 
Sbjct  208   GRKFWIHNTGPLGCLPQKLTLVQ----KEELDSHGCISSYNNAARLFNEALRRRCQKMRS  263

Query  816   EMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANI--SCGQSGFSVCK  989
             ++  ATI YVD+Y+IKY+LI+NS+ YGF  PLMACCG GG PYN NI  +CGQ G+ VC 
Sbjct  264   QLAGATIAYVDMYSIKYDLIANSSKYGFSRPLMACCGNGGPPYNYNIKVTCGQPGYQVCD  323

Query  990   DGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             +GS ++SWDG+HYTE AN ++A+ +LST YS P   FD+FC
Sbjct  324   EGSPFLSWDGIHYTEAANGIIASKLLSTAYSFPRTTFDFFC  364



>ref|XP_002277053.2| PREDICTED: GDSL esterase/lipase At1g09390 [Vitis vinifera]
Length=375

 Score =   384 bits (987),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 181/345 (52%), Positives = 251/345 (73%), Gaps = 5/345 (1%)
 Frame = +3

Query  90    PPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDF  269
             P    ++C   PVIF+FGDSNSDTGG  A  G    +P+GRTFF RS+ RL DGRLIID 
Sbjct  32    PNPVLSQCHHTPVIFSFGDSNSDTGGLVAGLGFPVNFPNGRTFFRRSTGRLSDGRLIIDL  91

Query  270   LCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEF  449
             LC+++ A++LSPYL+++  +F NG NFAI GS TLPK++ F+L+ Q++QF  F+  SL+ 
Sbjct  92    LCQSLSANFLSPYLDSVKSNFTNGANFAIVGSSTLPKYIPFALNIQVMQFLHFKASSLDP  151

Query  450   HSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVWAIY  626
                G   ++ +E F NALY+ DIGQND+A +FS  LS AQV+++IP  ++EIK A+  +Y
Sbjct  152   MVAGPRHLINDEGFRNALYLFDIGQNDLADSFSKNLSYAQVVKRIPFILAEIKYAIQTMY  211

Query  627   KVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEE  806
               GGRKFW+HNTGP+GCLP+ L+    +    + +  GC+ + N+ A+ FN  L  LC+E
Sbjct  212   DQGGRKFWIHNTGPLGCLPQKLSLVPKKP--GDLDPYGCLSAYNDVARLFNEGLRHLCQE  269

Query  807   LRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANI--SCGQSGFS  980
             +R ++KD+TIVYVDI+ IKY+LI+NS  +GF +PLMACCG GG PYN NI  +CGQ G  
Sbjct  270   MRSQLKDSTIVYVDIFAIKYDLIANSTKHGFSSPLMACCGYGGPPYNYNIRVTCGQPGHQ  329

Query  981   VCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCS  1115
             VCK+GS+++SWDG+H+TE AN +VA+ +LS +YSTP   FD+FC+
Sbjct  330   VCKEGSQFVSWDGIHFTEAANTIVASKILSMDYSTPRIPFDFFCN  374



>ref|XP_004968679.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Setaria italica]
Length=388

 Score =   385 bits (988),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 185/344 (54%), Positives = 240/344 (70%), Gaps = 6/344 (2%)
 Frame = +3

Query  99    AAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCE  278
             A   C R PV+F FGDSN+DTGG  A  G  +  P+GR FF R++ RLCDGRL+ID+LCE
Sbjct  47    AGEGCARPPVVFAFGDSNTDTGGVAAGLGYYYPLPEGRAFFRRATGRLCDGRLVIDYLCE  106

Query  279   NVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSK  458
             ++   YLSPYLEAL   F +G NFAI GS TLP+ V FSL  Q+ QF  F+ RS E  + 
Sbjct  107   SLNTSYLSPYLEALGSDFTSGANFAISGSSTLPRSVPFSLHVQVQQFLHFKQRSFELVAH  166

Query  459   GTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQ--VIEKIPSFISEIKDAVWAIYKV  632
             G +  +  + F NALY+IDIGQND++ AF   S  +  V +KIP+ ISEIKDA+  +Y  
Sbjct  167   GGSAPVDADGFRNALYLIDIGQNDLSAAFGSGSPYEDIVRQKIPAIISEIKDAIMTLYYN  226

Query  633   GGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELR  812
             G + FWVH TGP+GCLP+ LA  +  D  ++ + +GC+K+LN  A EFN +L  +C+ELR
Sbjct  227   GAKNFWVHGTGPLGCLPQKLAAPRADD--SDLDYSGCLKTLNNGAYEFNNQLCAVCDELR  284

Query  813   HEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQSGFSVC  986
              +++  TIVY D+  IKY LI+N + YGFE PLMACCG GG P  YNAN+SC   GF VC
Sbjct  285   SQLRGTTIVYTDVLLIKYELIANHSAYGFEEPLMACCGYGGPPYNYNANVSCLGPGFRVC  344

Query  987   KDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
             +DG+K++SWDGVHYT+ ANA+VA  +LS N+STP   FDYFC +
Sbjct  345   EDGAKFVSWDGVHYTDAANAVVAEKILSGNFSTPKLPFDYFCKS  388



>ref|XP_010475774.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Camelina sativa]
Length=373

 Score =   384 bits (986),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 202/377 (54%), Positives = 256/377 (68%), Gaps = 15/377 (4%)
 Frame = +3

Query  21    MDTNQRAAMFVFITCSAFLVLSSPP--LAAAE-CIRNPVIFNFGDSNSDTGGYPAAHGNI  191
             M T      + F+      V+ +PP  L  AE C   PVIFNFGDSNSDTGG  A  G  
Sbjct  1     MATTLALHSYSFVLFILLPVIFNPPHHLVVAEGCQHPPVIFNFGDSNSDTGGLTAGLGYY  60

Query  192   FGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQ  368
              G P+GR+FF RS+ RL DGRL+IDFLCE++    L+PYL++L  S F+NG NFAI GS 
Sbjct  61    IGLPNGRSFFRRSTGRLSDGRLVIDFLCESLNTSLLNPYLDSLVGSKFQNGANFAIVGSS  120

Query  369   TLPKFVLFSLSTQLLQFNRFRTRSLEFHSKG---TNGMLGEEDFENALYMIDIGQNDIAG  539
             TLP++V F+L+ QL+QF  F++R+LE  S        M+ E  F +ALYM DIGQNDIA 
Sbjct  121   TLPRYVPFALNIQLMQFLHFKSRALELASTSDPLKEMMISESGFRHALYMFDIGQNDIAN  180

Query  540   AFSY-LSKAQVIEKI-PSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRD  713
             +FS  LS ++V++ I P+ ISEIK A+  +Y  GGRKFWVHNTGP+GCLP+ L+  + + 
Sbjct  181   SFSKGLSYSRVVKLIIPNVISEIKSAIKILYDEGGRKFWVHNTGPLGCLPQKLSMVQSK-  239

Query  714   PNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIY  893
                 F++ GC+ S N AA+ FN  L  +C ELR E+++A IVYVDIY IKY+LI+NS  Y
Sbjct  240   ---VFDKHGCLVSYNAAAKLFNEGLDHMCGELRTELREANIVYVDIYAIKYDLIANSTNY  296

Query  894   GFENPLMACCGGGGAP--YNANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVL  1067
             GFE PLMACCG GG P  YN NI+CG      C +GS+YISWDG+HYTE ANA+VA  VL
Sbjct  297   GFEKPLMACCGYGGPPYNYNVNITCGNGVSKSCDEGSRYISWDGIHYTETANAIVAMKVL  356

Query  1068  STNYSTPPFNFDYFCST  1118
             S  YSTPP  F +FC +
Sbjct  357   SMQYSTPPTPFHFFCGS  373



>ref|XP_006303656.1| hypothetical protein CARUB_v10011694mg [Capsella rubella]
 gb|EOA36554.1| hypothetical protein CARUB_v10011694mg [Capsella rubella]
Length=372

 Score =   382 bits (982),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 200/369 (54%), Positives = 255/369 (69%), Gaps = 21/369 (6%)
 Frame = +3

Query  57    ITCSAFLVLSSPP--------LAAAE-CIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDG  209
             + C  F +L+  P        LA AE C   PVIFNFGDSNSDTGG  A  G   G P+G
Sbjct  6     LHCYYFFLLTLLPVIFDLRHHLAVAEGCQSPPVIFNFGDSNSDTGGLTAGLGYYIGLPNG  65

Query  210   RTFFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFV  386
             R+FF RS+ RL DGRL+IDFLCE++    L+PYL++L  S F+NG NFAI GS TLP++V
Sbjct  66    RSFFRRSTGRLSDGRLVIDFLCESLNTSLLNPYLDSLVGSKFQNGANFAIVGSSTLPRYV  125

Query  387   LFSLSTQLLQFNRFRTRSLEFHSKG---TNGMLGEEDFENALYMIDIGQNDIAGAFSY-L  554
              F+L+ QL+QF  F++R+LE  S        M+ E  F NALYMIDIGQNDIA +FS  L
Sbjct  126   PFALNIQLMQFQHFKSRALELASTSDPLKEMMISESGFRNALYMIDIGQNDIADSFSKGL  185

Query  555   SKAQVIE-KIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFE  731
             S ++V +  IP+ ISEIK A+  +Y  GGRKFWVHNTGP+GCLP+ L+  + +     F+
Sbjct  186   SYSRVSKLVIPNVISEIKSAIKILYNEGGRKFWVHNTGPLGCLPQKLSMVQSK----VFD  241

Query  732   ETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPL  911
             + GC+ S N AA+ FN  L  +C ELR E+++A IV+VDI  IKY+LI+NS+ YGFE PL
Sbjct  242   KYGCLASYNAAAKLFNEGLDHMCRELRTELREANIVHVDISAIKYDLIANSSNYGFEKPL  301

Query  912   MACCGGGGAP--YNANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYST  1085
             MACCG GG P  YN NI+CG  G   C++GS++ISWDG+HYTE ANA+VA  +LS  YST
Sbjct  302   MACCGYGGPPYNYNVNITCGNGGSKSCEEGSRFISWDGIHYTETANAIVAMKLLSMQYST  361

Query  1086  PPFNFDYFC  1112
             PP  F +FC
Sbjct  362   PPTPFHFFC  370



>ref|XP_007163304.1| hypothetical protein PHAVU_001G223500g [Phaseolus vulgaris]
 gb|ESW35298.1| hypothetical protein PHAVU_001G223500g [Phaseolus vulgaris]
Length=361

 Score =   382 bits (980),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 184/337 (55%), Positives = 244/337 (72%), Gaps = 8/337 (2%)
 Frame = +3

Query  111   CIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKA  290
             C   PV+F FGDSNSDTGG  +  G     P+GRTFF RS+ RL DGRL+ID LC+++ A
Sbjct  26    CDTPPVVFVFGDSNSDTGGLASGLGFPINLPNGRTFFRRSTGRLSDGRLVIDLLCQSLNA  85

Query  291   DYLSPYLEALT-PSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTN  467
               L PYL+AL+  SF NG NFA+ GS TLPK+V FSL+ Q++Q+ RF+ RSLE  + G  
Sbjct  86    SLLVPYLDALSGTSFTNGANFAVVGSSTLPKYVPFSLNIQVMQYRRFKARSLELVTAGAR  145

Query  468   GMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVWAIYKVGGRK  644
               + +E F NALY+IDIGQND+A +F+  LS AQVI+KIPSFI+EI++AV  ++  G RK
Sbjct  146   NFISDEGFRNALYLIDIGQNDLADSFAKNLSYAQVIKKIPSFITEIENAVKNLHNEGARK  205

Query  645   FWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMK  824
             FWVHNTGP+GCLP+ LA  + +D     +  GC+ S N AA+ FN  L  L ++LR E+K
Sbjct  206   FWVHNTGPLGCLPKILALAQKKD----LDSLGCLSSYNSAARLFNEALLLLSQKLRSELK  261

Query  825   DATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN--ANISCGQSGFSVCKDGS  998
             D+T+VYVDIY IK++LI+N+A YGF NPLM CCG GG PYN    ++CGQ G+ VC +G+
Sbjct  262   DSTLVYVDIYGIKHDLITNAAKYGFSNPLMVCCGFGGPPYNFDVRVTCGQPGYQVCGEGA  321

Query  999   KYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYF  1109
             +Y+SWDG+H+TE AN ++A+ +LS  YSTP   F +F
Sbjct  322   RYVSWDGIHHTEAANTLIASKILSMAYSTPRTPFHFF  358



>emb|CBI39639.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   384 bits (986),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 181/345 (52%), Positives = 251/345 (73%), Gaps = 5/345 (1%)
 Frame = +3

Query  90    PPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDF  269
             P    ++C   PVIF+FGDSNSDTGG  A  G    +P+GRTFF RS+ RL DGRLIID 
Sbjct  90    PNPVLSQCHHTPVIFSFGDSNSDTGGLVAGLGFPVNFPNGRTFFRRSTGRLSDGRLIIDL  149

Query  270   LCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEF  449
             LC+++ A++LSPYL+++  +F NG NFAI GS TLPK++ F+L+ Q++QF  F+  SL+ 
Sbjct  150   LCQSLSANFLSPYLDSVKSNFTNGANFAIVGSSTLPKYIPFALNIQVMQFLHFKASSLDP  209

Query  450   HSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVWAIY  626
                G   ++ +E F NALY+ DIGQND+A +FS  LS AQV+++IP  ++EIK A+  +Y
Sbjct  210   MVAGPRHLINDEGFRNALYLFDIGQNDLADSFSKNLSYAQVVKRIPFILAEIKYAIQTMY  269

Query  627   KVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEE  806
               GGRKFW+HNTGP+GCLP+ L+    +    + +  GC+ + N+ A+ FN  L  LC+E
Sbjct  270   DQGGRKFWIHNTGPLGCLPQKLSLVPKKP--GDLDPYGCLSAYNDVARLFNEGLRHLCQE  327

Query  807   LRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANI--SCGQSGFS  980
             +R ++KD+TIVYVDI+ IKY+LI+NS  +GF +PLMACCG GG PYN NI  +CGQ G  
Sbjct  328   MRSQLKDSTIVYVDIFAIKYDLIANSTKHGFSSPLMACCGYGGPPYNYNIRVTCGQPGHQ  387

Query  981   VCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCS  1115
             VCK+GS+++SWDG+H+TE AN +VA+ +LS +YSTP   FD+FC+
Sbjct  388   VCKEGSQFVSWDGIHFTEAANTIVASKILSMDYSTPRIPFDFFCN  432



>ref|XP_010092937.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB52990.1| GDSL esterase/lipase [Morus notabilis]
Length=364

 Score =   380 bits (976),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 184/345 (53%), Positives = 250/345 (72%), Gaps = 10/345 (3%)
 Frame = +3

Query  99    AAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCE  278
               ++C   P+IFNFGDSNSDTGG  A  G     P+GR+FF RS+ RL DGRL IDFLC+
Sbjct  25    VVSQCKNRPIIFNFGDSNSDTGGLVAGLGFPVNLPNGRSFFRRSTGRLSDGRLTIDFLCQ  84

Query  279   NVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHS  455
             ++    LSPYL++L  + F +G NFA+ GS TLPK+V FSL+ Q++QF  F++R+LE  +
Sbjct  85    SLNTSLLSPYLDSLAGTKFTSGANFAVVGSSTLPKYVPFSLNIQVMQFLHFKSRTLELFT  144

Query  456   KGT-NGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVWAIYK  629
              G+   ++ ++ F NALY+IDIGQNDIA +F+  +S  QV+++IP    EIK AV A+Y 
Sbjct  145   AGSEQNLINDDGFGNALYIIDIGQNDIADSFAKNMSSVQVLKRIPLITIEIKAAVKALYD  204

Query  630   VGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEEL  809
              GGR FW+HNTGP+GCLP+ L+  K      + ++ GCI S N+AA+ FN +L  +  ++
Sbjct  205   QGGRNFWLHNTGPLGCLPQKLSLVK-----KDLDQYGCISSYNDAAKLFNEELRRVSLKM  259

Query  810   RHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANI--SCGQSGFSV  983
             R EMKDA IVYVDI++IKY+LI+N   YGF +PLMACCG GG PYN NI  +CGQ G+ V
Sbjct  260   RSEMKDAKIVYVDIFSIKYDLIANHTKYGFSSPLMACCGYGGPPYNYNIHFTCGQPGYQV  319

Query  984   CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
             C +GS+++SWDG+HYTE AN++VA+ +LST YSTP   FD+FCS+
Sbjct  320   CDEGSRFVSWDGIHYTEAANSVVASKILSTAYSTPRVKFDFFCSS  364



>ref|XP_010489961.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Camelina sativa]
Length=430

 Score =   382 bits (982),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 204/370 (55%), Positives = 257/370 (69%), Gaps = 19/370 (5%)
 Frame = +3

Query  42    AMFVFITCSAFLVLSSPP--LAAAE-CIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGR  212
             + F+FI      V+ SP   LA AE C   PVIFNFGDSNSDTGG  A  G   G P+GR
Sbjct  69    SFFLFILLP---VIFSPRHHLAVAEGCQHPPVIFNFGDSNSDTGGLTAGLGYYIGLPNGR  125

Query  213   TFFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVL  389
             +FF RS+ RL DGRL+IDFLCE++    L+PYL++L  S F+NG NFAI GS TLP++V 
Sbjct  126   SFFRRSTGRLSDGRLVIDFLCESLNTSLLNPYLDSLVGSKFQNGANFAIVGSSTLPRYVP  185

Query  390   FSLSTQLLQFNRFRTRSLEFHSKG---TNGMLGEEDFENALYMIDIGQNDIAGAFSY-LS  557
             F+L+ QL+QF  F++R+LE  S        M+ E  F NALYMIDIGQNDIA +FS  LS
Sbjct  186   FALNIQLMQFLHFKSRALELASTSDPLKEMMISESGFRNALYMIDIGQNDIANSFSKGLS  245

Query  558   KAQVIEKI-PSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEE  734
              ++V++ I P+ ISEIK A+  +Y  GGRKFWVHNTGP+GCLP+ L+    +     F++
Sbjct  246   YSRVVKLIIPNVISEIKSAIKLLYD-GGRKFWVHNTGPLGCLPQKLSMVHSK----VFDK  300

Query  735   TGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLM  914
              GC+ S N AA+ FN  L  +C ELR E+++A IVYVDIY IKY+LI+NS+ YGFE PLM
Sbjct  301   HGCLVSYNAAAKLFNEGLDHMCGELRTELREANIVYVDIYAIKYDLITNSSNYGFEKPLM  360

Query  915   ACCGGGGAP--YNANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTP  1088
             ACCG GG P  YN NI+CG      C +GS++ISWDG+HYTE ANA+VA  VLS  YSTP
Sbjct  361   ACCGYGGPPYNYNVNITCGNGVSKSCDEGSRFISWDGIHYTETANAIVAMKVLSMQYSTP  420

Query  1089  PFNFDYFCST  1118
             P  F +FC +
Sbjct  421   PTPFHFFCGS  430



>ref|XP_002306255.2| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
 gb|EEE93251.2| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
Length=331

 Score =   379 bits (973),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 187/337 (55%), Positives = 242/337 (72%), Gaps = 17/337 (5%)
 Frame = +3

Query  114   IRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKAD  293
             I  P+IFNFGDSNSDTGG  A  G     P+GRTFFHRS+ RL DGRL+IDFLC+++ A 
Sbjct  6     INPPIIFNFGDSNSDTGGLVAGLGFPVNLPNGRTFFHRSTGRLSDGRLLIDFLCQSLNAS  65

Query  294   YLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNG  470
             +LSPYL++L  S F NG NFA+ GS TLPK+V FSL+ QL+QF  F+ R+LE  + G   
Sbjct  66    FLSPYLDSLGGSGFTNGANFAVVGSSTLPKYVPFSLNIQLMQFLHFKARTLELVTAG---  122

Query  471   MLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVWAIYKVGGRKF  647
                     NALY+IDIGQNDIA +FS  +S AQV ++IPS I EI++AV  +Y  GGRKF
Sbjct  123   ------LRNALYIIDIGQNDIADSFSKNMSYAQVTKRIPSVILEIENAVKVLYNQGGRKF  176

Query  648   WVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKD  827
             W+HNTGP+GCLP+ L+  + +D     +  GCI   N AA  FN  L  LCE +R ++  
Sbjct  177   WIHNTGPLGCLPQKLSLAQKKD----LDPIGCISDYNRAAGLFNEGLRRLCERMRSQLSG  232

Query  828   ATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANI--SCGQSGFSVCKDGSK  1001
             ATIVYVDIY+IKY+LI+NS+ YGF +PLMACCG GG PYN +I  +C Q G+ VC +GS+
Sbjct  233   ATIVYVDIYSIKYDLIANSSKYGFSSPLMACCGSGGPPYNYDIRLTCSQPGYQVCDEGSR  292

Query  1002  YISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             Y++WDG+HYTE AN+++A+ VLS  +S+P   FD+FC
Sbjct  293   YVNWDGIHYTEAANSIIASKVLSMAHSSPSIPFDFFC  329



>ref|XP_006645844.1| PREDICTED: GDSL esterase/lipase LIP-4-like [Oryza brachyantha]
Length=362

 Score =   379 bits (973),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 181/332 (55%), Positives = 227/332 (68%), Gaps = 4/332 (1%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLS  302
             PV+FNFGDSNSDTGG  AA G     P+GR FFH  + R CDGRL IDFLCE +   YLS
Sbjct  31    PVVFNFGDSNSDTGGMAAAMGWRIRPPEGRAFFHHPTGRFCDGRLTIDFLCERLNISYLS  90

Query  303   PYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGE  482
             PYL+AL   + NG NFAI GS TLP+  LF+L  Q+ QF  FR RSLE  S+G  G +  
Sbjct  91    PYLKALGSDYSNGANFAIAGSTTLPRDALFALHIQVQQFLYFRDRSLELISQGLPGPVDA  150

Query  483   EDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNT  662
             E F+NALYMIDIGQNDI    SYLS  QV+ + P  ++EIKDA+  +Y  G R FW+H T
Sbjct  151   EGFQNALYMIDIGQNDINALLSYLSYDQVVARFPPILAEIKDAIQTLYSNGSRNFWIHGT  210

Query  663   GPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVY  842
             G +GCLP+ L+  +  D  ++ +  GC+K+ N AA  FN  L  LC++L  +M+DA IVY
Sbjct  211   GALGCLPQKLSIPRKND--SDLDSNGCLKTYNRAAVAFNAALGSLCDQLSAQMRDAAIVY  268

Query  843   VDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANI--SCGQSGFSVCKDGSKYISWD  1016
              D++ +KY+L++N   YGF+ PLMACCG GG+PYN NI  SC     SVC DGSK++SWD
Sbjct  269   TDLFPLKYDLVANHTKYGFDKPLMACCGYGGSPYNYNISVSCQSKNASVCDDGSKFVSWD  328

Query  1017  GVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             GVH TE ANA+VA  +LS++YS P   FD FC
Sbjct  329   GVHLTEAANAIVAQGILSSDYSRPKIKFDQFC  360



>ref|XP_010026885.1| PREDICTED: GDSL esterase/lipase LIP-4-like [Eucalyptus grandis]
 gb|KCW60477.1| hypothetical protein EUGRSUZ_H03206 [Eucalyptus grandis]
Length=355

 Score =   379 bits (972),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 182/348 (52%), Positives = 238/348 (68%), Gaps = 17/348 (5%)
 Frame = +3

Query  75    LVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGR  254
             L L  P  AA+ C + PVIFNFGDSNSDTGG+ A  G     P+GRTFFH ++ RLCDGR
Sbjct  25    LCLGLPSSAASPCKKKPVIFNFGDSNSDTGGWSAGLGIDVALPNGRTFFHEATGRLCDGR  84

Query  255   LIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRT  434
             L IDFLCE++   +LSPYLE+L P+F +G NFA+ G+ T P+   FSL  QL QF  FR+
Sbjct  85    LTIDFLCESLNTSFLSPYLESLGPNFSDGANFAVSGAATTPRDQPFSLGVQLRQFLLFRS  144

Query  435   RSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAV  614
             RS    S+G   ++GE+ F +ALY IDIGQND+   F  L   QVI  IP+FI EI+ A+
Sbjct  145   RSPLLLSRGHANLVGEDGFADALYTIDIGQNDLTAQFRTLPYLQVIGNIPTFIEEIRFAI  204

Query  615   WAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSD  794
             W+IY  GG+ FW+HNTGP+GCLP  L         ++ +E GC++S N+AA+EFN +L  
Sbjct  205   WSIYHSGGKNFWLHNTGPLGCLPGILVAAG--HDASDIDELGCLRSRNDAAREFNRRLQS  262

Query  795   LCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANISCGQSG  974
             LCEELR +MK+ATIVYVD++ IKYNLI+N  I+GFENP  AC   G              
Sbjct  263   LCEELRTQMKNATIVYVDVFAIKYNLIANYTIHGFENPSKACYNNG--------------  308

Query  975   FSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
              +VC++ S+++SWDG+HYTE AN+ VA+ +LS NYSTPP  F++FC+ 
Sbjct  309   -TVCEESSRHVSWDGIHYTEAANSFVASRILSANYSTPPITFNFFCNV  355



>ref|XP_003626167.1| GDSL esterase/lipase [Medicago truncatula]
Length=355

 Score =   379 bits (972),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 181/339 (53%), Positives = 246/339 (73%), Gaps = 9/339 (3%)
 Frame = +3

Query  111   CIRNP-VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVK  287
             C   P V+F FGDSNSDTGG  +  G     P+GRTFFHRS+ RL DGRL+IDFLC+++ 
Sbjct  20    CSSKPAVVFVFGDSNSDTGGLVSGLGFPVNLPNGRTFFHRSTGRLSDGRLVIDFLCQSLN  79

Query  288   ADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGT  464
               +L+PYL++++ S F NG NFA+ GS TLPK++ FSL+ Q++QF  F+ RSL+  + G 
Sbjct  80    TRFLTPYLDSMSGSTFTNGANFAVVGSSTLPKYLPFSLNIQVMQFQHFKARSLQLATSGA  139

Query  465   NGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVWAIYKVGGR  641
               M+ ++ F +ALY+IDIGQND+A +F+  LS  QVI++IP+ I+EI++AV ++Y  GGR
Sbjct  140   KNMINDQGFRDALYLIDIGQNDLADSFTKNLSYVQVIKRIPTVITEIENAVKSLYNEGGR  199

Query  642   KFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEM  821
             KFWVHNTGP GCLP+ +A ++ +D     +  GC+ S N AA+ FN  L    ++LR E+
Sbjct  200   KFWVHNTGPFGCLPKLIALSQKKD----LDSFGCLSSYNSAARLFNEALYHSSQKLRTEL  255

Query  822   KDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN--ANISCGQSGFSVCKDG  995
             KDAT+VYVDIY IK +LI+N+  YGF NPLM CCG GG PYN  A ++CGQ G+ VC +G
Sbjct  256   KDATLVYVDIYAIKNDLITNATKYGFTNPLMVCCGFGGPPYNFDARVTCGQPGYQVCDEG  315

Query  996   SKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             S+Y+SWDG+HYTE AN  +A+ +LST YSTP   F +FC
Sbjct  316   SRYVSWDGIHYTEAANTWIASKILSTAYSTPRIPFGFFC  354



>gb|AES82385.2| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=365

 Score =   378 bits (971),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 181/339 (53%), Positives = 246/339 (73%), Gaps = 9/339 (3%)
 Frame = +3

Query  111   CIRNP-VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVK  287
             C   P V+F FGDSNSDTGG  +  G     P+GRTFFHRS+ RL DGRL+IDFLC+++ 
Sbjct  30    CSSKPAVVFVFGDSNSDTGGLVSGLGFPVNLPNGRTFFHRSTGRLSDGRLVIDFLCQSLN  89

Query  288   ADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGT  464
               +L+PYL++++ S F NG NFA+ GS TLPK++ FSL+ Q++QF  F+ RSL+  + G 
Sbjct  90    TRFLTPYLDSMSGSTFTNGANFAVVGSSTLPKYLPFSLNIQVMQFQHFKARSLQLATSGA  149

Query  465   NGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVWAIYKVGGR  641
               M+ ++ F +ALY+IDIGQND+A +F+  LS  QVI++IP+ I+EI++AV ++Y  GGR
Sbjct  150   KNMINDQGFRDALYLIDIGQNDLADSFTKNLSYVQVIKRIPTVITEIENAVKSLYNEGGR  209

Query  642   KFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEM  821
             KFWVHNTGP GCLP+ +A ++ +D     +  GC+ S N AA+ FN  L    ++LR E+
Sbjct  210   KFWVHNTGPFGCLPKLIALSQKKD----LDSFGCLSSYNSAARLFNEALYHSSQKLRTEL  265

Query  822   KDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN--ANISCGQSGFSVCKDG  995
             KDAT+VYVDIY IK +LI+N+  YGF NPLM CCG GG PYN  A ++CGQ G+ VC +G
Sbjct  266   KDATLVYVDIYAIKNDLITNATKYGFTNPLMVCCGFGGPPYNFDARVTCGQPGYQVCDEG  325

Query  996   SKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             S+Y+SWDG+HYTE AN  +A+ +LST YSTP   F +FC
Sbjct  326   SRYVSWDGIHYTEAANTWIASKILSTAYSTPRIPFGFFC  364



>ref|XP_006841596.1| hypothetical protein AMTR_s00003p00205650 [Amborella trichopoda]
 gb|ERN03271.1| hypothetical protein AMTR_s00003p00205650 [Amborella trichopoda]
Length=376

 Score =   379 bits (972),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 190/348 (55%), Positives = 245/348 (70%), Gaps = 16/348 (5%)
 Frame = +3

Query  117   RNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADY  296
             + P+IFNFGDSNSDTGG  A  G   G P+GRTFF+  + R CDGRL IDFLCE++ A Y
Sbjct  31    KEPIIFNFGDSNSDTGGLLAGLGLPVGPPNGRTFFNEPTGRFCDGRLAIDFLCESLNASY  90

Query  297   LSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGT---N  467
             LS YLE+L P+FKNG NFAI GS TLP F  F+L+ Q+ QF RF+TR+L+   K     +
Sbjct  91    LSAYLESLAPNFKNGANFAIAGSATLPPFQPFALNIQVSQFLRFKTRTLQLIKKDASLGS  150

Query  468   GMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVWAIYKVGGRK  644
              +  E  F+ ALY  DIGQND++ AFS  L+  QVI KIP+ +S+IK A+  I++ GGRK
Sbjct  151   SLPSENGFQEALYAFDIGQNDLSHAFSKNLTYQQVIRKIPTILSQIKSAIELIHQQGGRK  210

Query  645   FWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMK  824
             FWVHNTGP+GCLP+ +A    +  N   +  GC+   NEAA+  N+ L  +C ELR E+ 
Sbjct  211   FWVHNTGPLGCLPQKVAMFGGK--NVALDAAGCLSYFNEAAKVLNLGLRRVCAELRAELH  268

Query  825   DATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNAN--ISCGQSGF-------  977
             DATI+YVDIY IKY+LI N + YGFE+PLMACCG GG P+N N  + CGQSG+       
Sbjct  269   DATIIYVDIYAIKYDLIVNYSKYGFESPLMACCGYGGPPFNFNDKVRCGQSGYINGRMVS  328

Query  978   -SVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
                CK+G +++SWDG+HYTE ANA++++ +LSTNYS PP  FD+FCST
Sbjct  329   AEACKEGLRFVSWDGIHYTEAANAIISSKILSTNYSQPPLRFDWFCST  376



>ref|XP_008246380.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Prunus mume]
Length=368

 Score =   378 bits (970),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 192/363 (53%), Positives = 245/363 (67%), Gaps = 16/363 (4%)
 Frame = +3

Query  48    FVFITCSA-FLVLSSPPLAAAECIRNPV-IFNFGDSNSDTGGYPAAHGNIFGYPDGRTFF  221
              +F  C A  L++ +  +    C + PV IFNFGDSNSDTGG  A  G     P+GRTFF
Sbjct  16    LIFTLCGAVLLIILTSSVDGQLCSKRPVHIFNFGDSNSDTGGLAAGLGYSVNPPNGRTFF  75

Query  222   HRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSL  398
               S+ RL DGRLIID LC+++    LSPYL++L  S F NG NFA+ GS T+PK V FSL
Sbjct  76    SSSTGRLSDGRLIIDLLCQSLNVSLLSPYLDSLAGSNFSNGANFAVVGSSTMPKRVPFSL  135

Query  399   STQLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIE  575
             S Q++QF  F+       + G   ++ +E F  ALYMIDIGQND++ +F+  LS  QV E
Sbjct  136   SIQVMQFIHFKA------TAGFKHLINDEGFRKALYMIDIGQNDLSDSFTKDLSYVQVTE  189

Query  576   KIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSL  755
             +IPS I EIK AV A+Y  GGR FW+HNTGP+GCLP+ L+  + +D     +  GC+ S 
Sbjct  190   RIPSVIEEIKSAVKALYDQGGRNFWIHNTGPLGCLPQKLSLVEKKD----LDSYGCLSSY  245

Query  756   NEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGG  935
             N AA+ FN  L DLC  +R E+KDA IVYVDIY IKY+LI+NS  YGF  PLMACCG GG
Sbjct  246   NAAARSFNEALLDLCNAMRSELKDAVIVYVDIYAIKYDLIANSTKYGFSMPLMACCGNGG  305

Query  936   APYNANIS--CGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYF  1109
              PYN N+   CGQ G  VC +GS+++SWDG+HYTE AN +VA+ +LSTNYSTP   F++F
Sbjct  306   LPYNFNVRGLCGQPGSHVCDEGSRFVSWDGIHYTEAANTIVASKILSTNYSTPRIPFEFF  365

Query  1110  CST  1118
             C +
Sbjct  366   CGS  368



>gb|EEC70553.1| hypothetical protein OsI_01706 [Oryza sativa Indica Group]
Length=385

 Score =   379 bits (972),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 183/332 (55%), Positives = 225/332 (68%), Gaps = 4/332 (1%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLS  302
             PV+FNFGDSNSDTGG  AA G     P+GR FFH  + R CDGRL IDFLCE++   YLS
Sbjct  54    PVVFNFGDSNSDTGGMAAAMGWRIRRPEGRAFFHHPTGRFCDGRLTIDFLCESLNIGYLS  113

Query  303   PYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGE  482
             PYL+AL   + NG NFAI GS TLP+  LFSL  Q+ QF  FR RSLE  S+G  G +  
Sbjct  114   PYLKALGSDYSNGANFAIAGSATLPRDTLFSLHIQVKQFLFFRDRSLELISQGLPGPVDA  173

Query  483   EDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNT  662
             E F NALYMIDIGQND+    SYLS  QV+ + P  + EIKDA+  +Y  G R FWVH T
Sbjct  174   EGFRNALYMIDIGQNDVNALLSYLSYDQVVARFPPILDEIKDAIQTLYDNGSRNFWVHGT  233

Query  663   GPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVY  842
             G +GCLP+ L+  +  D  ++ +  GC+K+ N AA  FN  L  LC++L  +MKDATIVY
Sbjct  234   GALGCLPQKLSIPRKND--SDLDSNGCLKTYNRAAVTFNAALGSLCDQLSTQMKDATIVY  291

Query  843   VDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANIS--CGQSGFSVCKDGSKYISWD  1016
              D++ +KY+LI+N   YGF+ PLM CCG GG PYN NI+  C     SVC DGSK++SWD
Sbjct  292   TDLFPLKYDLIANRTKYGFDKPLMTCCGYGGPPYNYNITIGCQDKNASVCDDGSKFVSWD  351

Query  1017  GVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             GVH TE ANA+VA  +LS++YS P   FD FC
Sbjct  352   GVHLTEAANAIVAKGILSSDYSRPKIKFDQFC  383



>ref|XP_007207545.1| hypothetical protein PRUPE_ppa017417mg [Prunus persica]
 gb|EMJ08744.1| hypothetical protein PRUPE_ppa017417mg [Prunus persica]
Length=370

 Score =   377 bits (968),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 190/366 (52%), Positives = 246/366 (67%), Gaps = 13/366 (4%)
 Frame = +3

Query  30    NQRAAMFVFITCSAFLVLSSPPLAAAECIRNPV-IFNFGDSNSDTGGYPAAHGNIFGYPD  206
             +Q   + + ++ +  L++ S  +    C   PV IFNFGDSNSDTGG  A  G     P+
Sbjct  11    DQSVGLILTLSGAVLLIILSSSVDGQLCSTRPVHIFNFGDSNSDTGGLAAGLGYSVNPPN  70

Query  207   GRTFFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKF  383
             GRTFF  S+ RL DGRL+ID LC+++    LSPYL++L  S F NG NFA+ GS T+PK 
Sbjct  71    GRTFFGSSTGRLSDGRLVIDLLCQSLNVSLLSPYLDSLAGSNFSNGANFAVVGSSTIPKR  130

Query  384   VLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSK  560
             V FSL+ Q++QF  F+       + G+   + +E F  ALYMIDIGQND++ +F+  LS 
Sbjct  131   VPFSLNIQVMQFIHFKA----IAAAGSKHWINDEGFRKALYMIDIGQNDLSDSFTKGLSY  186

Query  561   AQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETG  740
              QV E IPS I EIK AV A+Y  GGR FW+HNTGP+GCLP+ L+  + +D     +  G
Sbjct  187   VQVTETIPSVIEEIKSAVKALYDQGGRNFWIHNTGPLGCLPQKLSLVEKKD----LDPYG  242

Query  741   CIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMAC  920
             C+ S N AA+ FN  L DLC+ +R E+KDA IVYVDIY IKY+LI+NS  YGF  PLMAC
Sbjct  243   CLSSYNAAARSFNEALLDLCKAMRSELKDAVIVYVDIYAIKYDLIANSTKYGFSTPLMAC  302

Query  921   CGGGGAPYNANIS--CGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPF  1094
             CG GG PYN N+   CGQ G  VC +GS+++SWDG+HYTE AN +VA+ +LSTNYSTP  
Sbjct  303   CGNGGPPYNFNVRGLCGQPGSHVCDEGSRFVSWDGIHYTEAANTIVASKILSTNYSTPRI  362

Query  1095  NFDYFC  1112
              FD+FC
Sbjct  363   PFDFFC  368



>gb|EEE54472.1| hypothetical protein OsJ_01574 [Oryza sativa Japonica Group]
Length=384

 Score =   376 bits (966),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 182/331 (55%), Positives = 225/331 (68%), Gaps = 3/331 (1%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLS  302
             PV+FNFGDSNSDTGG  AA G     P+GR FFH  + R CDGRL IDFLCE++   YLS
Sbjct  54    PVVFNFGDSNSDTGGMAAAMGWRIRRPEGRAFFHHPTGRFCDGRLTIDFLCESLNIGYLS  113

Query  303   PYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGE  482
             PYL+AL   + NG NFAI GS TLP+  LFSL  Q+ QF  FR RSLE  S+G  G +  
Sbjct  114   PYLKALGSDYSNGANFAIAGSATLPRDTLFSLHIQVKQFLFFRDRSLELISQGLPGPVDA  173

Query  483   EDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNT  662
             E F NALYMIDIGQND+    SYLS  QV+ + P  + EIKDA+  +Y  G R FWVH T
Sbjct  174   EGFRNALYMIDIGQNDVNALLSYLSYDQVVARFPPILDEIKDAIQTLYDNGSRNFWVHGT  233

Query  663   GPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVY  842
             G +GCLP+ L+  +  D  ++ +  GC+K+ N AA  FN  L  LC++L  +MKDATIVY
Sbjct  234   GALGCLPQKLSIPRKND--SDLDSNGCLKTYNRAAVTFNAALGSLCDQLSTQMKDATIVY  291

Query  843   VDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANISCG-QSGFSVCKDGSKYISWDG  1019
              D++ +KY+LI+N   YGF+ PLM CCG GG PYN NI+ G Q   + C DGSK++SWDG
Sbjct  292   TDLFPLKYDLIANRTKYGFDKPLMTCCGYGGPPYNYNITIGCQDKNASCDDGSKFVSWDG  351

Query  1020  VHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             VH TE ANA+VA  +LS++YS P   FD FC
Sbjct  352   VHLTEAANAIVAKGILSSDYSRPKIKFDQFC  382



>ref|XP_009393151.1| PREDICTED: GDSL esterase/lipase At1g09390 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=364

 Score =   375 bits (964),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 187/325 (58%), Positives = 228/325 (70%), Gaps = 5/325 (2%)
 Frame = +3

Query  111   CIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKA  290
             C    V+FNFGDSNSDTGG  A  G +    +GR FF RSS RLCDGRL+IDFLCE++  
Sbjct  36    CGSGAVVFNFGDSNSDTGGLTAGLGILLPQEEGRVFFRRSSGRLCDGRLVIDFLCESLNT  95

Query  291   DYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNG  470
              YLSPY+E L   F +G NFA+ GS T P  V F+L+ Q+ QF RF+ RSLE  ++G   
Sbjct  96    SYLSPYMEPLGADFSSGANFAVAGSCTRPPDVPFALAVQVRQFLRFKLRSLELVAQGAED  155

Query  471   MLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVWAIYKVGGRKF  647
             ++  E F NA+Y IDIGQND+A AFS  LS  QVIE++PS I EIK A+  +Y  GG+KF
Sbjct  156   LIDAEGFRNAIYAIDIGQNDLAAAFSANLSYVQVIERVPSVIHEIKKAIENLYDNGGKKF  215

Query  648   WVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKD  827
             WVHNTGP+GCLP+ LA    R  N+  +  GC+   N AA+EFN +LS LC+ L  E+K+
Sbjct  216   WVHNTGPLGCLPQKLALP--RKHNSSLDPYGCLIPFNNAAKEFNAQLSALCDNLNSELKN  273

Query  828   ATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNAN--ISCGQSGFSVCKDGSK  1001
             ATIVY DIY+IKY+LI+N   YGFE  LMACCG GG PYN N  I CG  G  VC  GSK
Sbjct  274   ATIVYTDIYSIKYDLIANHTAYGFETALMACCGYGGPPYNFNQRIECGAFGSQVCPLGSK  333

Query  1002  YISWDGVHYTEDANAMVAASVLSTN  1076
             YISWDGVHYTE ANA+VA+ +L+TN
Sbjct  334   YISWDGVHYTEAANAIVASKILTTN  358



>gb|EAY73836.1| hypothetical protein OsI_01712 [Oryza sativa Indica Group]
 gb|EAZ11717.1| hypothetical protein OsJ_01579 [Oryza sativa Japonica Group]
Length=366

 Score =   375 bits (963),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 179/343 (52%), Positives = 236/343 (69%), Gaps = 7/343 (2%)
 Frame = +3

Query  105   AECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENV  284
             A C R PV+F FGDSN+DTGG  A  G  F  P+GR FF R++ RLCDGRL+ID LCE++
Sbjct  26    ASCARRPVVFAFGDSNTDTGGIAAGMGYYFPLPEGRAFFRRATGRLCDGRLVIDHLCESL  85

Query  285   KADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGT  464
                YLSPYLE L   F NG NFAI G+ T P+   FSL  Q+ QF  F+ RSLE  S+G 
Sbjct  86    NMSYLSPYLEPLGTDFTNGANFAISGAATAPRNAAFSLHIQVQQFIHFKQRSLELASRGE  145

Query  465   NGMLGEEDFENALYMIDIGQNDIAGAFSY--LSKAQVI-EKIPSFISEIKDAVWAIYKVG  635
                +  + F NALY+IDIGQND++ AFS   L    V+ ++ P+ +SEIKDA+ ++Y  G
Sbjct  146   AVPVDADGFRNALYLIDIGQNDLSAAFSAGGLPYDDVVRQRFPAILSEIKDAIQSLYYNG  205

Query  636   GRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRH  815
              +  W+H TGP+GCLP+ LA  +  D   + + +GC+K+LN  A EFN +LS +C++L  
Sbjct  206   AKNLWIHGTGPLGCLPQKLAVPRADD--GDLDPSGCLKTLNAGAYEFNSQLSSICDQLSS  263

Query  816   EMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNA--NISCGQSGFSVCK  989
             +++ ATIV+ DI  IKY+LI+N + YGFE PLMACCG GG PYN   N+SC  +G+ VC+
Sbjct  264   QLRGATIVFTDILAIKYDLIANHSSYGFEEPLMACCGHGGPPYNYDFNVSCLGAGYRVCE  323

Query  990   DGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
             DGSK++SWDGVHYT+ ANA+VA  +LS +YS P   F YFCS 
Sbjct  324   DGSKFVSWDGVHYTDAANAVVAGKILSADYSRPKLPFSYFCSA  366



>gb|KHN03916.1| GDSL esterase/lipase [Glycine soja]
Length=366

 Score =   375 bits (963),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 189/346 (55%), Positives = 251/346 (73%), Gaps = 8/346 (2%)
 Frame = +3

Query  96    LAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLC  275
             +A A C + PV+F FGDSNSDTGG  +  G     P+GR FFHRS+ RL DGRL+ID LC
Sbjct  22    IALAGCDKAPVLFVFGDSNSDTGGLASGLGFPINPPNGRNFFHRSTGRLSDGRLLIDLLC  81

Query  276   ENVKADYLSPYLEALT-PSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFH  452
              ++ A  L PYL+AL+  SF NG NFA+ GS TLPK+V FSL+ Q++QF RF+ RSLE  
Sbjct  82    LSLNASLLVPYLDALSGTSFTNGANFAVVGSSTLPKYVPFSLNIQVMQFRRFKARSLELV  141

Query  453   SKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVWAIYK  629
             + G   ++ +E F +ALY+IDIGQND+A +F+  LS AQVI+KIP+ I+EI++AV  +Y 
Sbjct  142   TAGARNLINDEGFRDALYLIDIGQNDLADSFAKNLSYAQVIKKIPAVITEIENAVKNLYN  201

Query  630   VGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEEL  809
              G RKFWVHNTGP+GCLP+ LA  + +D     +  GC+ S N AA+ FN +L    ++L
Sbjct  202   DGARKFWVHNTGPLGCLPKILALAQKKD----LDSLGCLSSYNSAARLFNEELLHSTQKL  257

Query  810   RHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN--ANISCGQSGFSV  983
             R E+KDAT+VYVDIYTIKY+LI+N+A YGF NPLM CCG GG PYN    ++CGQ G+ V
Sbjct  258   RSELKDATLVYVDIYTIKYDLITNAAKYGFSNPLMVCCGYGGPPYNFDVRVTCGQPGYQV  317

Query  984   CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCSTN  1121
             C +G++Y+SWDG+H TE AN ++A+ +LS  YSTP   FD+FC+ +
Sbjct  318   CDEGARYVSWDGIHQTEAANTLIASKILSMAYSTPRTPFDFFCTND  363



>ref|XP_009383944.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Musa acuminata 
subsp. malaccensis]
Length=368

 Score =   375 bits (962),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 185/351 (53%), Positives = 243/351 (69%), Gaps = 10/351 (3%)
 Frame = +3

Query  72    FLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDG  251
              L+L SP +A ++C    V+FNFGDSNSDTGG  A  G   G P GR FFHR + R CDG
Sbjct  22    ILLLCSPAVAHSKC----VLFNFGDSNSDTGGLMAGLGLYLGPPSGRQFFHRPTGRFCDG  77

Query  252   RLIIDFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRF  428
             RL IDFLCE +K  YLSPYLE+L  S F +GVNFA+ G+ T    + F LSTQ+LQF  F
Sbjct  78    RLYIDFLCERLKMSYLSPYLESLPGSNFTHGVNFAVAGAATESTAIPFPLSTQVLQFLHF  137

Query  429   RTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIK  605
             + R+ E   +G+  +L E++F+NA+Y IDIGQND++  FS  LS A+V+ KIPS +S I 
Sbjct  138   KNRTRELRPQGSGSLLSEKEFQNAVYSIDIGQNDVSTPFSANLSYAEVVVKIPSILSRIG  197

Query  606   DAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVK  785
              A+  +++ GGRKFW++NTGP+GCLP+ LA  K  D  +E +  GC+  LN+AA+ FN  
Sbjct  198   AAIELLHENGGRKFWIYNTGPLGCLPQKLALLKKDD--SELDSLGCLADLNDAAKAFNAG  255

Query  786   LSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNAN--IS  959
             LS+LC+ LR + K+ATIVY D+Y IK +LI+N   YGFENPLMACCG GG PYN    ++
Sbjct  256   LSELCDRLRSDFKNATIVYTDVYAIKQDLIANHTKYGFENPLMACCGYGGPPYNYKFRMT  315

Query  960   CGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             CG+   + C +GS+YISWDGVH TE AN+++A+ +LS  YSTP       C
Sbjct  316   CGEPTVTACAEGSRYISWDGVHNTEAANSIIASKILSAKYSTPQIKLKDLC  366



>ref|XP_003521655.1| PREDICTED: GDSL esterase/lipase At1g09390 [Glycine max]
Length=363

 Score =   375 bits (962),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 189/343 (55%), Positives = 249/343 (73%), Gaps = 8/343 (2%)
 Frame = +3

Query  96    LAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLC  275
             +A A C + PV+F FGDSNSDTGG  +  G     P+GR FFHRS+ RL DGRL+ID LC
Sbjct  23    IALAGCDKAPVLFVFGDSNSDTGGLASGLGFPINPPNGRNFFHRSTGRLSDGRLLIDLLC  82

Query  276   ENVKADYLSPYLEALT-PSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFH  452
              ++ A  L PYL+AL+  SF NG NFA+ GS TLPK+V FSL+ Q++QF RF+ RSLE  
Sbjct  83    LSLNASLLVPYLDALSGTSFTNGANFAVVGSSTLPKYVPFSLNIQVMQFRRFKARSLELV  142

Query  453   SKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVWAIYK  629
             + G   ++ +E F +ALY+IDIGQND+A +F+  LS AQVI+KIP+ I+EI++AV  +Y 
Sbjct  143   TAGARNLINDEGFRDALYLIDIGQNDLADSFAKNLSYAQVIKKIPAVITEIENAVKNLYN  202

Query  630   VGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEEL  809
              G RKFWVHNTGP+GCLP+ LA  + +D     +  GC+ S N AA+ FN +L    ++L
Sbjct  203   DGARKFWVHNTGPLGCLPKILALAQKKD----LDSLGCLSSYNSAARLFNEELLHSTQKL  258

Query  810   RHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN--ANISCGQSGFSV  983
             R E+KDAT+VYVDIYTIKY+LI+N+A YGF NPLM CCG GG PYN    ++CGQ G+ V
Sbjct  259   RSELKDATLVYVDIYTIKYDLITNAAKYGFSNPLMVCCGYGGPPYNFDVRVTCGQPGYQV  318

Query  984   CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             C +G++Y+SWDG+H TE AN ++A+ +LS  YSTP   FD+FC
Sbjct  319   CDEGARYVSWDGIHQTEAANTLIASKILSMAYSTPRTPFDFFC  361



>ref|XP_010318022.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Solanum lycopersicum]
Length=313

 Score =   373 bits (957),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 176/307 (57%), Positives = 226/307 (74%), Gaps = 4/307 (1%)
 Frame = +3

Query  201   PDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPK  380
             P   TF H  S R+CDG+LIIDFLCE+V   YL+P++E++  +F NGVNFAI GS+TLPK
Sbjct  6     PKIHTFNHDLSGRMCDGKLIIDFLCESVGNGYLTPFMESIGKNFTNGVNFAIAGSKTLPK  65

Query  381   FVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSK  560
              + F+L  Q  QFNRFR+ SLE  +KG   +LG+ED  NALY IDIGQND+ G FS ++ 
Sbjct  66    LIFFNLHIQFAQFNRFRSLSLELFNKGDGNLLGDEDLRNALYTIDIGQNDLDGIFSKVTN  125

Query  561   AQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETG  740
              + I KIP  ISEI++ +  IY+ GG  FWVHNTGP+GCLP++LAT K  +  ++++E G
Sbjct  126   EKAILKIPDIISEIENVIKGIYEQGGNNFWVHNTGPLGCLPKSLATYKKNE--SDYDENG  183

Query  741   CIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMAC  920
             C+ S NE A+ FN KL  LCE+LR EMK+ TIVYVDIY+IKY+LI+NS+ YGF NPLM C
Sbjct  184   CLISFNEGAKIFNNKLQVLCEKLRDEMKNITIVYVDIYSIKYDLIANSSNYGFVNPLMGC  243

Query  921   CGGGGAPYN--ANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPF  1094
             CG GG PYN  +N  CGQ  +++C+D  KYISWDG+HYTE AN  VA+ +LST+YSTPP 
Sbjct  244   CGYGGPPYNFESNNKCGQGNYTICEDRFKYISWDGIHYTEAANGFVASKILSTHYSTPPL  303

Query  1095  NFDYFCS  1115
                 FC+
Sbjct  304   KLHSFCN  310



>ref|XP_009590850.1| PREDICTED: GDSL esterase/lipase LIP-4-like isoform X2 [Nicotiana 
tomentosiformis]
Length=341

 Score =   372 bits (955),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 187/304 (62%), Positives = 229/304 (75%), Gaps = 9/304 (3%)
 Frame = +3

Query  12   HTDMDTNQRA-AMFVFITCSAFLVLSS-PPLAAAECIRNPVIFNFGDSNSDTGGYPAAHG  185
            +  M T+ R  + FV   C + L +S    +   EC +N VIFNFGDSNSDTGGY AAHG
Sbjct  14   YMKMKTSSRTNSTFVLFACFSMLCISQLANVVVCECSKNMVIFNFGDSNSDTGGYAAAHG  73

Query  186  NIFGYPDGRTFFH-RSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGG  362
              FG+PDGRTFFH + SDRLCDGR+I+DFLCE++   YLSPYLE++ P+F NGVNFAIGG
Sbjct  74   IRFGFPDGRTFFHDQPSDRLCDGRIILDFLCESLNMSYLSPYLESVKPNFNNGVNFAIGG  133

Query  363  SQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGA  542
            + TLPK  LF+LSTQ+LQF RF+ R L+  SKG    L EEDF+NA+YMIDIGQNDIA A
Sbjct  134  ATTLPKNALFTLSTQVLQFIRFKARYLQLQSKGLKD-LAEEDFKNAIYMIDIGQNDIANA  192

Query  543  FSYLSKA-QVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPN  719
            FSYLS+A QV+EKIPSFISEI+ A+W IY   G+ FWVHNTGP+GCLP+ LAT       
Sbjct  193  FSYLSQASQVLEKIPSFISEIQAAIWGIYNNSGKNFWVHNTGPLGCLPQKLATRN----G  248

Query  720  TEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGF  899
            +   + GCIKS+NEAA  FN +L  LCE+LR +MKDATIVYV+IY IKY+LI+NS+ YG+
Sbjct  249  SNLNDYGCIKSMNEAADAFNNQLRALCEQLRLQMKDATIVYVNIYAIKYDLIANSSAYGW  308

Query  900  ENPL  911
             + L
Sbjct  309  VSNL  312



>ref|XP_007207559.1| hypothetical protein PRUPE_ppa016576mg, partial [Prunus persica]
 gb|EMJ08758.1| hypothetical protein PRUPE_ppa016576mg, partial [Prunus persica]
Length=348

 Score =   372 bits (954),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 188/354 (53%), Positives = 240/354 (68%), Gaps = 13/354 (4%)
 Frame = +3

Query  66    SAFLVLSSPPLAAAECIRNPV-IFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRL  242
             +  L++ S  +    C   PV IFNFGDSNSDTGG  A  G     P+GRTFF  S+ RL
Sbjct  1     AVLLIILSSSVDGQLCSTRPVHIFNFGDSNSDTGGLAAGLGYSVNPPNGRTFFGSSTGRL  60

Query  243   CDGRLIIDFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLSTQLLQF  419
              DGRL+ID LC+++    LSPYL++L  S F NG NFA+ GS T+PK V FSL+ Q++QF
Sbjct  61    SDGRLVIDLLCQSLNLSLLSPYLDSLVGSNFSNGANFAVVGSSTIPKRVPFSLNIQVMQF  120

Query  420   NRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFIS  596
               F+       + G+   + +EDF  ALYMIDIGQND++ +F+  LS  QV E+IPS I 
Sbjct  121   IHFKA----IAAAGSKHWINDEDFRKALYMIDIGQNDLSDSFTNDLSYVQVTERIPSVIE  176

Query  597   EIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEF  776
             EIK AV A+Y  GGR FW+HNTGP+GCLP+ L+  + +D     +  GC+ S N AA+ F
Sbjct  177   EIKSAVKALYDQGGRNFWIHNTGPLGCLPQKLSLVEKKD----LDPYGCLSSYNAAARSF  232

Query  777   NVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANI  956
             N  L  LC  +R E+KDA IVYVDIY IKY+LI+NS  YGF  PLMACCG GG PYN N+
Sbjct  233   NEALLHLCNGMRSELKDAVIVYVDIYAIKYDLIANSTKYGFSTPLMACCGNGGPPYNFNV  292

Query  957   S--CGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
                CGQ G  VC +G++++SWDG+HYTE AN +VA+ +LSTNYSTP   FD+FC
Sbjct  293   RGLCGQPGSHVCDEGTRFVSWDGIHYTEAANTIVASKILSTNYSTPRIPFDFFC  346



>ref|XP_003565727.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Brachypodium 
distachyon]
Length=373

 Score =   372 bits (956),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 177/340 (52%), Positives = 240/340 (71%), Gaps = 6/340 (2%)
 Frame = +3

Query  111   CIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKA  290
             C R PV+F  GDSN+DTGG  AA G+    P+GRT F RS+ RLCDGRL++D+LCE++  
Sbjct  36    CARRPVVFALGDSNTDTGGMGAALGSYLPLPEGRTHFRRSTGRLCDGRLVVDYLCESLNM  95

Query  291   DYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNG  470
              YLSPYLEAL   F NG NFAI G+ T+P+   F+L  Q+ QF  F+ RSL+  S+G + 
Sbjct  96    SYLSPYLEALGSDFSNGANFAIAGAATMPRDRPFALHVQVQQFLHFKQRSLDLASRGESM  155

Query  471   MLGEEDFENALYMIDIGQNDIAGAF-SYLSKAQVI-EKIPSFISEIKDAVWAIYKVGGRK  644
              +    F +ALY+IDIGQND++ AF S +    VI ++IP+ +SEIKDA+  +Y  G + 
Sbjct  156   PVDAHGFRDALYLIDIGQNDLSAAFSSRVPYDDVISQRIPAILSEIKDAIMTLYYNGAKN  215

Query  645   FWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMK  824
             FWVH TGP+GCLP+ LA  +  D + ++   GC+K+LN A+ EFN +L  +C++LR ++K
Sbjct  216   FWVHGTGPLGCLPQKLAEPRTDDSDLDYN--GCLKTLNSASYEFNNQLCSICDKLRTQLK  273

Query  825   DATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNA--NISCGQSGFSVCKDGS  998
              ATIVY D+  IKY+LI+N   YGFE PL+ACCG GG PYN   N+SC   G+  C+DGS
Sbjct  274   GATIVYTDLLAIKYDLIANHTGYGFEEPLLACCGYGGPPYNYSFNVSCLGPGYRACEDGS  333

Query  999   KYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
             K+++WDGVHYT+ ANA+VAA +LS+ +STP   F YFC+T
Sbjct  334   KFVNWDGVHYTDAANAVVAAKILSSEFSTPKLPFGYFCNT  373



>ref|XP_003565728.2| PREDICTED: GDSL esterase/lipase LIP-4-like isoform X1 [Brachypodium 
distachyon]
Length=378

 Score =   371 bits (953),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 179/334 (54%), Positives = 226/334 (68%), Gaps = 4/334 (1%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLS  302
             PV+FNFGDSNSDTGG  AA G     P+GR FFH  + R CDGRL+IDFLCE +   YLS
Sbjct  47    PVVFNFGDSNSDTGGMAAAKGWHITPPEGRAFFHHPTGRFCDGRLVIDFLCERLNITYLS  106

Query  303   PYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGE  482
             PYL+A   ++ NGVNFAI GS TLP+ VLF+L  Q+ +F  F+ RSLE  S+G    +  
Sbjct  107   PYLKAFGSNYSNGVNFAIAGSTTLPRDVLFALHVQVQEFMFFKARSLELISQGQQAPIDA  166

Query  483   EDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNT  662
             E FENALY IDIGQND+    S L   QV+ K P  ++EIKDAV  +Y  G R FW+H T
Sbjct  167   EGFENALYTIDIGQNDVNALLSNLPYDQVVAKFPPILAEIKDAVQTLYFNGSRNFWIHGT  226

Query  663   GPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVY  842
             G +GCLP+ LA  +  D  ++ ++ GC+ + N AA  FN  L  LC++L  +MKDATIVY
Sbjct  227   GALGCLPQKLAIPRKND--SDLDQNGCLNTYNRAAVAFNAVLGSLCDQLNVQMKDATIVY  284

Query  843   VDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANI--SCGQSGFSVCKDGSKYISWD  1016
              D++ IKY+L++N   YGF++PLM CCG GG PYN ++  SC     +VC DGSK+ISWD
Sbjct  285   TDLFAIKYDLVANHTKYGFDSPLMTCCGYGGPPYNYDLSRSCQSPNATVCADGSKFISWD  344

Query  1017  GVHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
             GVH TE ANA+VAA +LS+ YS P   FD FC  
Sbjct  345   GVHLTEAANAIVAAGILSSAYSKPNLKFDQFCKV  378



>ref|XP_008388450.1| PREDICTED: GDSL esterase/lipase At1g09390 [Malus domestica]
Length=359

 Score =   370 bits (949),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 189/368 (51%), Positives = 247/368 (67%), Gaps = 20/368 (5%)
 Frame = +3

Query  27    TNQRAAMFVFITCSAFLVLSSPPLAAAECIRNP--VIFNFGDSNSDTGGYPAAHGNIFGY  200
             T        F      ++LS    A+ +  RNP  +IFNFGDSNSDTGG  A  G     
Sbjct  4     TQSLGLTLTFFGAVLLIILS----ASVDGQRNPRPIIFNFGDSNSDTGGLVAGLGFSVNP  59

Query  201   PDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLP  377
             P GRTFF RS+ RL DGRL++D LC+++    LSPYL++L  S F NG NFA+ GS TLP
Sbjct  60    PYGRTFFRRSTGRLSDGRLVLDLLCQSLNGGLLSPYLDSLAGSRFTNGANFAVVGSSTLP  119

Query  378   KFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-L  554
             K V FSL+ Q++QF  F+       + G+  ++ +E F  ALYMIDIGQND+A +F   L
Sbjct  120   KRVPFSLNIQVMQFIHFKA------TAGSKHLISDEGFRKALYMIDIGQNDLADSFGKNL  173

Query  555   SKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEE  734
             S AQV ++IPS I+ IK+AV A+Y  GGR FW+HNTGP+GCLP+ L+  + +D     + 
Sbjct  174   SYAQVTKRIPSVIAAIKNAVQALYDQGGRNFWIHNTGPLGCLPQKLSLVQKKD----LDP  229

Query  735   TGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLM  914
              GC+ S N AA+ FN  L  LC  +R ++KDATIVYVD+Y IKY+LI+N+  YGF +PLM
Sbjct  230   HGCLSSYNAAARLFNEGLRHLCNGMRPQLKDATIVYVDVYAIKYDLIANAMKYGFSSPLM  289

Query  915   ACCGGGGAPYNANI--SCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTP  1088
             ACCG GG PYN NI  +CG  G +VC +GS+Y+SWDG+H+TE AN +VA+ +LST YSTP
Sbjct  290   ACCGNGGPPYNYNIGLTCGHRGSNVCDEGSRYVSWDGIHFTEAANTIVASKILSTKYSTP  349

Query  1089  PFNFDYFC  1112
                FD+FC
Sbjct  350   SIPFDFFC  357



>ref|XP_006645847.1| PREDICTED: GDSL esterase/lipase LIP-4-like [Oryza brachyantha]
Length=377

 Score =   370 bits (950),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/337 (53%), Positives = 234/337 (69%), Gaps = 6/337 (2%)
 Frame = +3

Query  117   RNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADY  296
             R PV+F FGDSN+DTGG  A  G  F  P GR FF R++ RLCDGRL+ID LCE++   Y
Sbjct  43    RRPVVFAFGDSNTDTGGVAAGMGLYFPLPSGRAFFRRAAGRLCDGRLVIDHLCESLNMSY  102

Query  297   LSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGML  476
             LSPYLEAL   F NG NFAI G+ T P+   FSL  Q+ QF  F+ RSLE  S+G    +
Sbjct  103   LSPYLEALGTDFTNGANFAISGAGTAPRNTAFSLHIQVQQFLHFKQRSLELASRGEAVPV  162

Query  477   GEEDFENALYMIDIGQNDIAGAFS-YLSKAQVI-EKIPSFISEIKDAVWAIYKVGGRKFW  650
                 F NALY+IDIGQND++ AFS  L    VI +++P+ +SEIKDA+ ++Y  G + FW
Sbjct  163   DAVGFRNALYLIDIGQNDLSAAFSGGLPYGDVIRQRLPAILSEIKDAIQSLYYNGAKNFW  222

Query  651   VHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDA  830
             +H TGP+GCLP+ LA  +  D   + + +GC+K+LN  + EFN +LS +C++L  +++ A
Sbjct  223   IHGTGPLGCLPQKLAVPRADD--GDLDSSGCLKTLNAGSVEFNGQLSSICDQLSSQLRGA  280

Query  831   TIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNAN--ISCGQSGFSVCKDGSKY  1004
             T+V+ D+  IKY LI+N + YGFE PLMACCG GG PYN +  +SC  +G+ VC+DGSKY
Sbjct  281   TVVFTDVLAIKYELIANHSSYGFEEPLMACCGHGGPPYNYDFGVSCLGAGYRVCEDGSKY  340

Query  1005  ISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCS  1115
             +SWDGVHYTE ANA+VA  +LS  YSTP   F YFC+
Sbjct  341   VSWDGVHYTEAANAVVAGKILSGEYSTPRLPFSYFCN  377



>ref|XP_009335511.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Pyrus x bretschneideri]
Length=359

 Score =   368 bits (945),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 189/370 (51%), Positives = 249/370 (67%), Gaps = 20/370 (5%)
 Frame = +3

Query  27    TNQRAAMFVFITCSAFLVLSSPPLAAAECIRNP--VIFNFGDSNSDTGGYPAAHGNIFGY  200
             T        F      ++LS    A+ +  RNP  +IFNFGDSNSDTGG  A  G     
Sbjct  4     TQSLGLTLTFFGTVLLIILS----ASVDGQRNPRPIIFNFGDSNSDTGGLVAGLGFSINP  59

Query  201   PDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLP  377
             P GRTFF RS+ RL DGRL++D LC+++  + LSPYL++L  S F NG NFA+ GS TLP
Sbjct  60    PYGRTFFRRSTGRLSDGRLVLDLLCQSLNGNLLSPYLDSLAGSRFTNGANFAVVGSSTLP  119

Query  378   KFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-L  554
             K V FSL+ Q++QF  F+       + G+  ++ +E F  ALYMIDIGQND+A +F   L
Sbjct  120   KRVPFSLNIQVMQFIHFKA------TAGSKHLISDEGFRKALYMIDIGQNDLADSFGKNL  173

Query  555   SKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEE  734
             S A+V ++IPS I+ IK AV A+Y  GGR FW+HNTGP+GCLP+ L+  + ++     + 
Sbjct  174   SYAEVTKRIPSVIAAIKSAVQALYDHGGRNFWIHNTGPLGCLPQKLSLVQKKN----LDL  229

Query  735   TGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLM  914
              GC+ S N AA+ FN  L  LC  +R ++KDATIVYVD+Y IKY+LI+NSA YGF +PLM
Sbjct  230   YGCLSSYNAAARLFNEGLRHLCNGMRPQLKDATIVYVDVYAIKYDLIANSAKYGFSSPLM  289

Query  915   ACCGGGGAPYNANI--SCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTP  1088
             ACCG GG PYN NI  +CG  G +VC +GS+Y+SWDG+H+TE AN +VA+ +LST YSTP
Sbjct  290   ACCGNGGPPYNYNIGLTCGHPGSNVCDEGSRYVSWDGIHFTEAANTIVASKILSTKYSTP  349

Query  1089  PFNFDYFCST  1118
                FD+FC +
Sbjct  350   SIPFDFFCRS  359



>ref|XP_010070070.1| PREDICTED: GDSL esterase/lipase At1g09390 [Eucalyptus grandis]
 gb|KCW58641.1| hypothetical protein EUGRSUZ_H01304 [Eucalyptus grandis]
Length=376

 Score =   369 bits (946),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 183/348 (53%), Positives = 242/348 (70%), Gaps = 14/348 (4%)
 Frame = +3

Query  87    SPPLAAAECIR----NPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGR  254
             +PP +AA         PV+FNFGDSNSDTGG  A  G     P+GR+FF RS+ RLCDGR
Sbjct  21    APPRSAASGCGGGGGRPVVFNFGDSNSDTGGLAAGLGFPVNPPNGRSFFGRSTGRLCDGR  80

Query  255   LIIDFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFR  431
             L+IDFLC+++   +L PYL++L  S F NG NFA+ GS TLPK+V FSL+ Q++QF  F+
Sbjct  81    LVIDFLCQSLNTSFLIPYLDSLAGSKFTNGANFAVVGSSTLPKYVPFSLNIQVMQFLHFK  140

Query  432   TRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKD  608
              R  E  S G+   +  ++F  ALYM+DIGQND+A +FS  L+ ++VI  +PS I EIK 
Sbjct  141   GRITELASAGSEVPVSVDEFTQALYMVDIGQNDLADSFSKNLTYSEVINTVPSIIGEIKT  200

Query  609   AVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKL  788
             A+  +Y  G R FWVHNTGP+GCLP+ L+  + +D     +E GC+ S N AA+ FN  L
Sbjct  201   AIKTLYDQGARNFWVHNTGPLGCLPQKLSLVEKKD----LDENGCLSSYNSAARIFNEGL  256

Query  789   SDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANI--SC  962
               LC+E+R E+ DATI +VDIY IKY+LI+N++ YGF +PLM CCG GG PYN NI  +C
Sbjct  257   LKLCQEMRSELADATITHVDIYAIKYDLIANASKYGFSSPLMTCCGNGGPPYNYNIRVTC  316

Query  963   GQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTP--PFNF  1100
             G  G   C +GS++ISWDG+HYTE AN+++A+ +LST YSTP  P NF
Sbjct  317   GTPGCEACSNGSQHISWDGIHYTEAANSIIASKILSTAYSTPRTPLNF  364



>ref|XP_004163922.1| PREDICTED: GDSL esterase/lipase At3g62280-like [Cucumis sativus]
Length=395

 Score =   369 bits (946),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 190/363 (52%), Positives = 245/363 (67%), Gaps = 17/363 (5%)
 Frame = +3

Query  24    DTNQRAAMFVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYP  203
             D  ++   F F   S F + + P  ++     +P + NFGDSNSDTGG  A  G   G P
Sbjct  32    DPKKKKNHFWFYVIS-FAIFNIPSTSST----SPTLINFGDSNSDTGGVLAGTGLPIGLP  86

Query  204   DGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKF  383
              G TFFHR + RL DGRLIIDF CE +K  YLSPYLEAL P+F +GVNFA+ G+ T+P+F
Sbjct  87    HGITFFHRGTGRLGDGRLIIDFFCEELKLSYLSPYLEALAPNFTSGVNFAVSGATTVPQF  146

Query  384   VLFSLSTQLLQFNRFRTRSLEFHSKGT-NGMLGEEDFENALYMIDIGQNDIAGAF--SYL  554
             V F+L  Q+ QF  F+ RSLE  S G    M+ EE F   +YMIDIGQNDI  A   S L
Sbjct  147   VPFALDVQVRQFIHFKNRSLELQSFGKIEKMVDEEGFRKGIYMIDIGQNDILVALYQSNL  206

Query  555   SKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNT--EF  728
             +   V +KIPSF++EIK A+  +Y  GGRKFW+HNTGP+GC P+ LA      P+T  + 
Sbjct  207   TYKSVAQKIPSFLAEIKLAIQNLYANGGRKFWIHNTGPLGCSPKELAL----HPHTHNDV  262

Query  729   EETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFEN-  905
             ++ GC+K  N+ A+ FN  L ++C+ELR ++KDA I+YVDIYTIKYNL ++   YG EN 
Sbjct  263   DQIGCLKVHNQVAKFFNKGLKNVCKELRSQLKDAIIIYVDIYTIKYNLFAHPKAYGLEND  322

Query  906   PLMACCGGGGAP--YNANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNY  1079
             PLMACCG GGAP  YN   +CGQ G+S+C + SK I WDGVHYTE AN +VA+S+ S+++
Sbjct  323   PLMACCGYGGAPNNYNVKATCGQPGYSICSNPSKSIIWDGVHYTEAANHLVASSIFSSHF  382

Query  1080  STP  1088
             STP
Sbjct  383   STP  385



>gb|EPS71679.1| hypothetical protein M569_03079, partial [Genlisea aurea]
Length=353

 Score =   366 bits (939),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 181/339 (53%), Positives = 235/339 (69%), Gaps = 8/339 (2%)
 Frame = +3

Query  111   CIRN-PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVK  287
             C+ N P+IFNFGDSNSDTGG  +  G     P+GRTFF  S+ RL DGRL+IDFLCE++ 
Sbjct  17    CLCNAPIIFNFGDSNSDTGGISSGVGFPVNLPNGRTFFGLSTGRLSDGRLLIDFLCESIN  76

Query  288   ADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTN  467
               +L PYL+     F NG NFAI GS TLP++  F+L+ Q++QF   + RS +  + G+ 
Sbjct  77    TSFLRPYLDPFDSIFTNGANFAIAGSATLPRYTPFALNIQVMQFKYLKLRSAQLAAAGSK  136

Query  468   GMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIE-KIPSFISEIKDAVWAIYKVGGRK  644
              ++G++ F  ALYMIDIGQNDIA +   L+K Q ++ KIP  ++EIK A+  +Y  GGRK
Sbjct  137   NVIGDDMFGKALYMIDIGQNDIADS---LTKGQSVKAKIPQVLAEIKGAIVELYGEGGRK  193

Query  645   FWVHNTGPVGCLPRTLATTKVRDPNTEFEET-GCIKSLNEAAQEFNVKLSDLCEELRHEM  821
             FWVHNTGP+GCLP+ LA    R    +  +  GCI S N AA+E N  LS +C ELR +M
Sbjct  194   FWVHNTGPIGCLPQKLADYTNRTSAKKLVDAHGCISSYNSAAKELNDGLSIVCSELRSQM  253

Query  822   KDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN--ANISCGQSGFSVCKDG  995
             KDATIVYVDIY+IK ++I N   YG  NPLMACCG GG PYN   +++CG SG+ VC   
Sbjct  254   KDATIVYVDIYSIKLDVIVNYTNYGLTNPLMACCGSGGPPYNYDRSVTCGFSGYEVCDAT  313

Query  996   SKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             S+Y+SWDGVHYT+ AN++++A VLS  YSTP   FD+FC
Sbjct  314   SRYVSWDGVHYTDAANSVISAKVLSMEYSTPAAGFDFFC  352



>ref|XP_008246276.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Prunus mume]
Length=441

 Score =   368 bits (945),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 186/365 (51%), Positives = 246/365 (67%), Gaps = 15/365 (4%)
 Frame = +3

Query  33    QRAAMFVFITCSAFLVLSSPPLAAAECIRNPV-IFNFGDSNSDTGGYPAAHGNIFGYPDG  209
             Q   + + ++ +  L++ S  +        PV IFNFGDSNSDTGG  A  G     P+G
Sbjct  84    QSVGLILTLSGAVLLIILSASVDGHLGPTRPVHIFNFGDSNSDTGGLVAGLGYSVNPPNG  143

Query  210   RTFFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFV  386
             RTFF RS+ RL DGRL+ID LC+++    LSPYL++L  S F NG NFA+ GS TLPK V
Sbjct  144   RTFFRRSTGRLSDGRLVIDLLCQSLNVSLLSPYLDSLAGSGFSNGANFAVVGSSTLPKRV  203

Query  387   LFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKA  563
              FSL+ Q++QF  F+       + G+  ++ ++ F  ALYMIDIGQND+A +F+  LS A
Sbjct  204   PFSLNIQVMQFIHFKA------TAGSKHLINDDGFRKALYMIDIGQNDLADSFAKNLSYA  257

Query  564   QVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGC  743
             QV ++IPS I+EIK AV A+Y  GGR FW+HNTGP+GCLP+ L+  + +D    F+  GC
Sbjct  258   QVTKRIPSVIAEIKSAVKALYDQGGRNFWIHNTGPLGCLPQKLSLVEKKD----FDPYGC  313

Query  744   IKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACC  923
             + + N AA+ FN  L  LC  +R E+KDA IVYVDIY IKY+LI+NS  YGF  PLMACC
Sbjct  314   LSTYNAAARLFNEALRHLCNGMRSELKDAVIVYVDIYAIKYDLIANSTKYGFSRPLMACC  373

Query  924   GGGGAPYNANI--SCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
             G GG PYN N+  +CG  G  VC +GS +++WDG+HYTE AN +VA+ +LS N+STP   
Sbjct  374   GNGGPPYNYNVGLTCGHPGSQVCDEGSLFVNWDGIHYTEAANTIVASKILSKNFSTPRVP  433

Query  1098  FDYFC  1112
             FD+FC
Sbjct  434   FDFFC  438



>ref|NP_001136917.1| hypothetical protein precursor [Zea mays]
 gb|ACF82886.1| unknown [Zea mays]
 tpg|DAA54478.1| TPA: hypothetical protein ZEAMMB73_818689 [Zea mays]
Length=383

 Score =   366 bits (939),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 174/335 (52%), Positives = 230/335 (69%), Gaps = 6/335 (2%)
 Frame = +3

Query  126   VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSP  305
             V+F FGDSN+DTGG  A  G+ +  P+GR FF RS+ RLCDGRL+ID+LCE++   YLSP
Sbjct  51    VVFAFGDSNTDTGGVAAGLGHYYPLPEGRVFFRRSTGRLCDGRLVIDYLCESLNMSYLSP  110

Query  306   YLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEE  485
             YLEA+   F  G NFAI GS TLP+ V F+L  Q+ QF   + RSL+  + G    +  +
Sbjct  111   YLEAVGSDFTGGANFAISGSSTLPRNVPFALHVQVQQFLHLKQRSLDLAAHGGTAPVDAD  170

Query  486   DFENALYMIDIGQNDIAGAFSYLSKAQ--VIEKIPSFISEIKDAVWAIYKVGGRKFWVHN  659
              F NALY+IDIGQND++ AF   +     V  +IP+ +SEIKDA+  +Y  G + FWVH 
Sbjct  171   GFRNALYLIDIGQNDLSAAFGSGAPYDDVVHHRIPAIVSEIKDAIMTLYYNGAKNFWVHG  230

Query  660   TGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIV  839
             TGP+GCLP+ LA  +  D  ++ +  GC+K+LN+ A EFN +L   C+ LR +++ ATIV
Sbjct  231   TGPLGCLPQKLAAPRPDD--SDLDYNGCLKTLNDGAYEFNGQLCAACDGLRSQLRGATIV  288

Query  840   YVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQSGFSVCKDGSKYISW  1013
             Y D+  +KY+LI+N   YGFE PLMACCG GG P  YNAN+SC   GF VC+DG+K++SW
Sbjct  289   YTDVLLVKYDLIANHTAYGFEEPLMACCGYGGPPYNYNANVSCLGPGFRVCEDGTKFVSW  348

Query  1014  DGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
             DGVHYT+ ANA+VAA + S  +STP   FDYFC  
Sbjct  349   DGVHYTDAANALVAAKIFSGQFSTPQMPFDYFCQA  383



>gb|KHG08253.1| hypothetical protein F383_34955 [Gossypium arboreum]
Length=290

 Score =   362 bits (928),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 170/282 (60%), Positives = 223/282 (79%), Gaps = 4/282 (1%)
 Frame = +3

Query  276   ENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHS  455
             E++  DYL+PYL +L P+F NGVNFAI GS TLP++V FSL  Q+ QF RFR+RS     
Sbjct  9     ESLNTDYLTPYLNSLGPNFTNGVNFAIIGSATLPRYVPFSLFVQVSQFLRFRSRSPALML  68

Query  456   KGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVG  635
              G   ++G EDFENALY IDIGQND+A +F  L+ +QVIE+IPSFI+EIK+A+W IY+ G
Sbjct  69    NGYKDLVGNEDFENALYTIDIGQNDLAASFDNLTYSQVIERIPSFITEIKNAIWNIYEKG  128

Query  636   GRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRH  815
             G+KFWVHNTGP+GCLP+ LA    R+  TE +E GC++ LN AA+ FN +L  LCE+LR 
Sbjct  129   GKKFWVHNTGPLGCLPQKLALL-ARNA-TELDEHGCLQPLNNAAKTFNAQLRVLCEQLRR  186

Query  816   EMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQSGFSVCK  989
             E+ + TIVYVDIY+IKY+LI+N++ YGFE+PLMACCG GG P  YNANI+CG++G++VC 
Sbjct  187   ELINVTIVYVDIYSIKYDLIANASNYGFESPLMACCGNGGPPYNYNANINCGRTGYTVCH  246

Query  990   DGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCS  1115
             +GSK+ISWDGVHYTE ANA+  + +LST+YSTP  +F++FC+
Sbjct  247   EGSKFISWDGVHYTEAANAIFTSKILSTHYSTPQLSFNFFCN  288



>ref|XP_010921570.1| PREDICTED: GDSL esterase/lipase At1g09390 [Elaeis guineensis]
Length=368

 Score =   364 bits (935),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 178/346 (51%), Positives = 238/346 (69%), Gaps = 9/346 (3%)
 Frame = +3

Query  84    SSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLII  263
             S P +  ++CI    +FNFGDSNSDTGG  A  G   G P GR FFH+++ R CDG+L I
Sbjct  27    SLPTVVHSKCI----LFNFGDSNSDTGGLMAGLGLYLGPPAGRQFFHKTTGRFCDGQLYI  82

Query  264   DFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSL  443
             DF+CE++K ++LSPYLE+   +F +GVNFA+ G+ T P  + F+LSTQ+LQF  F+ R+ 
Sbjct  83    DFICESLKINFLSPYLESSGSNFSHGVNFAVAGAATEPTAIPFTLSTQVLQFFHFKNRTR  142

Query  444   EFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVWA  620
             E  ++G   ++ E+ F NA+Y  D+GQNDI+ A S  +S + VIEKIPS +S IKDA+ +
Sbjct  143   ELRAQGLGLLISEKGFRNAVYSFDMGQNDISIALSSNVSYSAVIEKIPSILSRIKDAIKS  202

Query  621   IYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLC  800
             IYK GGRKFWV+NTGP+GCLP+ LA  K  D  +  +  GC+ ++N AA+EFN  L  LC
Sbjct  203   IYKNGGRKFWVYNTGPLGCLPQMLAFLKKND--SVLDAVGCLATVNNAAKEFNAGLWGLC  260

Query  801   EELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANIS--CGQSG  974
              ++  + KDAT+VY D++ IKY LI+N A YGF NPLMACCG GG PYN   S  CG+  
Sbjct  261   NQISSKYKDATVVYTDMFAIKYGLITNHAKYGFVNPLMACCGYGGTPYNYRFSMQCGEPN  320

Query  975   FSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
              + C  GS+YISWDGVHYTE AN+++A+ +LS  YS P       C
Sbjct  321   VTACPVGSRYISWDGVHYTEAANSIIASKILSAKYSEPQIKLKNLC  366



>tpg|DAA54477.1| TPA: hypothetical protein ZEAMMB73_818689 [Zea mays]
Length=435

 Score =   366 bits (940),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 174/334 (52%), Positives = 230/334 (69%), Gaps = 6/334 (2%)
 Frame = +3

Query  126   VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSP  305
             V+F FGDSN+DTGG  A  G+ +  P+GR FF RS+ RLCDGRL+ID+LCE++   YLSP
Sbjct  103   VVFAFGDSNTDTGGVAAGLGHYYPLPEGRVFFRRSTGRLCDGRLVIDYLCESLNMSYLSP  162

Query  306   YLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEE  485
             YLEA+   F  G NFAI GS TLP+ V F+L  Q+ QF   + RSL+  + G    +  +
Sbjct  163   YLEAVGSDFTGGANFAISGSSTLPRNVPFALHVQVQQFLHLKQRSLDLAAHGGTAPVDAD  222

Query  486   DFENALYMIDIGQNDIAGAFSYLSKAQ--VIEKIPSFISEIKDAVWAIYKVGGRKFWVHN  659
              F NALY+IDIGQND++ AF   +     V  +IP+ +SEIKDA+  +Y  G + FWVH 
Sbjct  223   GFRNALYLIDIGQNDLSAAFGSGAPYDDVVHHRIPAIVSEIKDAIMTLYYNGAKNFWVHG  282

Query  660   TGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIV  839
             TGP+GCLP+ LA  +  D  ++ +  GC+K+LN+ A EFN +L   C+ LR +++ ATIV
Sbjct  283   TGPLGCLPQKLAAPRPDD--SDLDYNGCLKTLNDGAYEFNGQLCAACDGLRSQLRGATIV  340

Query  840   YVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQSGFSVCKDGSKYISW  1013
             Y D+  +KY+LI+N   YGFE PLMACCG GG P  YNAN+SC   GF VC+DG+K++SW
Sbjct  341   YTDVLLVKYDLIANHTAYGFEEPLMACCGYGGPPYNYNANVSCLGPGFRVCEDGTKFVSW  400

Query  1014  DGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCS  1115
             DGVHYT+ ANA+VAA + S  +STP   FDYFC 
Sbjct  401   DGVHYTDAANALVAAKIFSGQFSTPQMPFDYFCQ  434



>ref|XP_010559217.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Tarenaya hassleriana]
Length=365

 Score =   363 bits (933),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 172/339 (51%), Positives = 236/339 (70%), Gaps = 4/339 (1%)
 Frame = +3

Query  105   AECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENV  284
             ++C RNPV+FNFGDSNSDTG      G     P GRTFFH  + R  DGRLIIDF+CE +
Sbjct  29    SQCKRNPVLFNFGDSNSDTGSSDYGLGQTVAPPYGRTFFHHPAGRPSDGRLIIDFICEGL  88

Query  285   KADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGT  464
              A +L+PYLE + P+F +G NFA+ G+  L +   F++  QL QF  FR RS    S+G 
Sbjct  89    GASFLTPYLEPIAPNFTSGANFALSGAAILSRPKPFNVDVQLAQFLHFRNRSALLASQGY  148

Query  465   NGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRK  644
              G++ EE+F NALY +DIGQND+A +F  L+  QV++KIPSF++E+K+ +  IY  GGR 
Sbjct  149   RGLVREEEFSNALYTLDIGQNDLAASFLNLTFDQVVDKIPSFMAELKNTIRVIYDHGGRN  208

Query  645   FWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMK  824
             FWVHNTGP+GC+P  L  T +    T+ +   C K++NEA++ FN +L   C+ELR +++
Sbjct  209   FWVHNTGPLGCVP--LMLTLIEHVPTDLDVNRCHKNMNEASKIFNDQLRAACDELRSDLE  266

Query  825   DATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANI--SCGQSGFSVCKDGS  998
               T+VYVDI++IK++LI+N+  YGFE+P MACCG GG PYN      CGQ+G +VC +G 
Sbjct  267   GVTVVYVDIHSIKFDLIANATKYGFEDPFMACCGSGGPPYNFRFGAQCGQNGSTVCTEGL  326

Query  999   KYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCS  1115
             KY SWDGVH TE AN  +++ +LSTNYS+PP   ++FC+
Sbjct  327   KYNSWDGVHLTEAANHFISSKLLSTNYSSPPLPLNHFCN  365



>ref|XP_010559175.1| PREDICTED: GDSL esterase/lipase At3g62280-like [Tarenaya hassleriana]
Length=364

 Score =   363 bits (932),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 180/336 (54%), Positives = 232/336 (69%), Gaps = 7/336 (2%)
 Frame = +3

Query  117   RNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADY  296
             +NP++ NFGDSNSDTGG  A  G   G P G TFFHR + RL DGRLI+DFLC+++K  Y
Sbjct  30    KNPILINFGDSNSDTGGVLAGVGLPIGLPHGITFFHRGTGRLGDGRLILDFLCDHLKIGY  89

Query  297   LSPYLEALTPSFKNGVNFAIGGSQTLP-KFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGM  473
             +SPYL++L+P+F +GVNFA+ G+   P  FV F LS Q+ QF RFR RSLE HS G   +
Sbjct  90    MSPYLDSLSPNFTSGVNFAVSGATASPLSFVAFPLSIQIRQFIRFRNRSLELHSSGRQDL  149

Query  474   LGEEDFENALYMIDIGQNDIAGAF--SYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKF  647
             +GE  F NALYMIDIGQND+  A   S L+   V++KIPS + EIK AV ++Y  GGRKF
Sbjct  150   MGENGFRNALYMIDIGQNDLLLALYDSNLTYTPVVQKIPSMLLEIKKAVQSVYLYGGRKF  209

Query  648   WVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKD  827
             W+HNTGP+GC P+ LA     +  ++ +  GCI+  N+ A+ FN  L  L +E+R + KD
Sbjct  210   WIHNTGPMGCAPKELALHPHNE--SDLDPIGCIRVHNDVAKAFNAGLRRLFKEVRSQFKD  267

Query  828   ATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQSGFSVCKDGSK  1001
             AT V+VDIY+IKY L SN   YGFE+P MACCG GG P  Y+   +CGQ G ++C+D +K
Sbjct  268   ATFVHVDIYSIKYRLFSNYKKYGFEDPFMACCGYGGRPNNYDRRATCGQPGSTICRDVTK  327

Query  1002  YISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYF  1109
              I WDGVHY++ AN  VA++VLS  YSTP    D F
Sbjct  328   SIVWDGVHYSDAANRAVASAVLSNRYSTPHIPLDRF  363



>tpg|DAA54475.1| TPA: alpha-L-fucosidase 2 [Zea mays]
Length=381

 Score =   363 bits (931),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 174/332 (52%), Positives = 223/332 (67%), Gaps = 4/332 (1%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLS  302
             PV+FNFGDSNSDTGG  AA G     P+GR FF R + R CDGRL IDFLCE++   YLS
Sbjct  50    PVLFNFGDSNSDTGGMAAAKGWHLTRPEGRAFFPRPTGRFCDGRLAIDFLCESLNISYLS  109

Query  303   PYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGE  482
             P+L+AL  ++ NG NFAI G+ T P+ V F+L  Q+ +F  FR RSLE   +G +G +  
Sbjct  110   PFLKALGSNYSNGANFAIAGAATQPRDVPFALHIQVQEFLYFRDRSLELIDQGLSGPIDA  169

Query  483   EDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNT  662
             + F+NALYMIDIGQND+    S L   QVI K P  ++EIKDAV  +Y  G R FW+H T
Sbjct  170   QGFQNALYMIDIGQNDVNALLSNLPYDQVIAKFPPILAEIKDAVQTLYSNGSRNFWIHGT  229

Query  663   GPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVY  842
             G +GCLP+ LA  +  D  ++ ++ GC+K+ N AA  FN  L  LC+EL  +MKDAT+VY
Sbjct  230   GALGCLPQKLAIPRKND--SDLDQYGCLKTYNRAAVAFNAALGSLCDELSAQMKDATLVY  287

Query  843   VDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANIS--CGQSGFSVCKDGSKYISWD  1016
              D++ IKY L++N   YGF+ PLM CCG GG PYN + S  C     + C DGSK++SWD
Sbjct  288   TDLFPIKYGLVANHTKYGFDKPLMTCCGYGGPPYNYDFSKGCQSKDVAACDDGSKFVSWD  347

Query  1017  GVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             GVH TE ANA+VA ++LS+ YS P   FD FC
Sbjct  348   GVHLTEAANAVVARAILSSQYSKPSLKFDQFC  379



>ref|XP_002272542.2| PREDICTED: GDSL esterase/lipase At3g62280 [Vitis vinifera]
 emb|CBI37002.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   362 bits (930),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 181/357 (51%), Positives = 237/357 (66%), Gaps = 9/357 (3%)
 Frame = +3

Query  45    MFVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFH  224
             + + +   AFL +S+      E    P++ NFGDSNSDTGG  A  G   G P G TFFH
Sbjct  10    LILLVWMWAFLGMSTLSACTEE---RPILVNFGDSNSDTGGVLAGTGLPIGLPHGITFFH  66

Query  225   RSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLST  404
             R + RL DGRLIIDF CE++   YLSPYL++L P+F +GVNFA+ G+ TLP+FV F+L  
Sbjct  67    RGTGRLGDGRLIIDFFCEHLNLSYLSPYLDSLVPNFSSGVNFAVSGATTLPQFVPFALDV  126

Query  405   QLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAF--SYLSKAQVIEK  578
             Q+ QF RF+ RS E  S+G+  ++  + F +A+YMIDIGQND+  A   S L+   V+EK
Sbjct  127   QIRQFIRFKNRSQELISQGSRNLINVKGFRDAIYMIDIGQNDLLLALYASNLTYPPVLEK  186

Query  579   IPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLN  758
             IPSF++EIK A+  +Y+ G RKFW+HNTGP+GC P+ LA       N++ +  GC++  N
Sbjct  187   IPSFLAEIKLAIQNLYQFGARKFWIHNTGPLGCAPKELALHP--HTNSDLDRIGCLEVHN  244

Query  759   EAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGA  938
             + A+ FN  L  +CEE+R   KDATIVYVDIY IKY+L      YGFE P MACCG GG 
Sbjct  245   KVAKAFNKGLRVICEEMRLMYKDATIVYVDIYAIKYDLFDKYKKYGFEAPFMACCGYGGP  304

Query  939   P--YNANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFD  1103
             P  Y+   +CGQ G+S+CK+ S  I WDGVHYTE AN +  AS+LS +YSTP    D
Sbjct  305   PNNYDRKATCGQPGYSICKNASSSIVWDGVHYTEAANQVSTASILSGHYSTPRVKLD  361



>ref|XP_002455579.1| hypothetical protein SORBIDRAFT_03g013370 [Sorghum bicolor]
 gb|EES00699.1| hypothetical protein SORBIDRAFT_03g013370 [Sorghum bicolor]
Length=427

 Score =   364 bits (935),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 175/332 (53%), Positives = 223/332 (67%), Gaps = 4/332 (1%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLS  302
             PV+FNFGDSNSDTGG  AA G     P+GR FF R + R CDGRL IDFLCE++   YLS
Sbjct  96    PVLFNFGDSNSDTGGMAAARGWHLTRPEGRAFFPRPTGRFCDGRLTIDFLCESLNISYLS  155

Query  303   PYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGE  482
             P+L+AL  ++ NG NFAI G+ TLP+ V F+L  Q+ +F  FR RSLE   +G +G +  
Sbjct  156   PFLKALGSNYSNGANFAIAGAATLPRDVPFALHIQVQEFLYFRDRSLELSDQGLSGPIDA  215

Query  483   EDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNT  662
             + F+NALYMIDIGQND+    S L   QVI K P  ++EIKDAV  +Y    + FW+H T
Sbjct  216   QGFQNALYMIDIGQNDVNALLSNLPYDQVIAKFPPILAEIKDAVQTLYSNASKNFWIHGT  275

Query  663   GPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVY  842
             G +GCLP+ LA  +  D  ++ ++ GC+K+ N AA  FN  L  LC+EL  +MKDATIVY
Sbjct  276   GALGCLPQKLAIPRKND--SDLDQYGCLKTYNRAAVAFNTALGSLCDELSVQMKDATIVY  333

Query  843   VDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNA--NISCGQSGFSVCKDGSKYISWD  1016
              D++ IKY+LI+N   YGF+ PLM CCG GG PYN   N  C     + C DGSK++SWD
Sbjct  334   TDLFPIKYDLIANHTKYGFDKPLMTCCGYGGPPYNYDFNKGCQSKDVTACDDGSKFVSWD  393

Query  1017  GVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             GVH TE ANA+VA ++LS+ YS P   FD FC
Sbjct  394   GVHLTEAANAVVAKAILSSQYSKPNLKFDQFC  425



>ref|XP_008246381.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Prunus mume]
Length=359

 Score =   362 bits (929),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 187/366 (51%), Positives = 240/366 (66%), Gaps = 24/366 (7%)
 Frame = +3

Query  30    NQRAAMFVFITCSAFLVLSSPPLAAAECIRNPV-IFNFGDSNSDTGGYPAAHGNIFGYPD  206
             +Q   + + ++    L++ S  +    C   PV IFNFGDSNSDTGG  A  G     P+
Sbjct  11    DQSVGLIITLSGVVLLIVLSSSVDGQLCPTRPVQIFNFGDSNSDTGGLVAGLGFSVNPPN  70

Query  207   GRTFFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKF  383
             GRTFF RS+ RL DGRL+ID LC+++    LSPYL++L  S F NG NFA+  S T+PK 
Sbjct  71    GRTFFSRSTGRLSDGRLVIDLLCQSLNVSLLSPYLDSLAGSIFSNGANFAVASSSTIPKR  130

Query  384   VLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSK  560
               FSLS Q++QF  F+             ++G   F  ALYMIDIGQND++  F+  LS 
Sbjct  131   FPFSLSIQVMQFIHFK------------AIVG---FRKALYMIDIGQNDLSDCFTKNLSY  175

Query  561   AQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETG  740
              Q+ E+IPS I EIK AV A+Y  GGR FW+HNTGP+GCLP+ L+  + +D     +  G
Sbjct  176   VQITERIPSVIEEIKSAVKALYDQGGRNFWIHNTGPLGCLPQKLSLVEKKD----LDPYG  231

Query  741   CIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMAC  920
             C+ S N AA+ FN  L DLC  +R E+KDA IVYVDIY IKY+LI+NS  YGF  PLMAC
Sbjct  232   CLSSYNAAARSFNEALLDLCIAMRSELKDAVIVYVDIYAIKYDLIANSTKYGFSMPLMAC  291

Query  921   CGGGGAPYNANIS--CGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPF  1094
             CG GG PYN N    CG+ G  VC++GS+++SWDG+HYTE AN +VA+ +LSTNYSTP  
Sbjct  292   CGNGGPPYNFNAGRLCGRPGSHVCEEGSRFVSWDGIHYTEAANTIVASKILSTNYSTPRI  351

Query  1095  NFDYFC  1112
              FD+FC
Sbjct  352   PFDFFC  357



>dbj|BAJ98083.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   362 bits (928),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 185/348 (53%), Positives = 246/348 (71%), Gaps = 6/348 (2%)
 Frame = +3

Query  93    PLAAAE--CIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIID  266
             P AAAE  C R PV+F FGDSN+DTGG  AA G+ F  P+GR  F RS+ RLCDGRL+ID
Sbjct  30    PAAAAEEGCTRRPVVFAFGDSNTDTGGAAAALGSYFPLPEGRAHFRRSTGRLCDGRLVID  89

Query  267   FLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLE  446
             +LCE++   YLSPY+EAL   F NG NFAI GS T+P+   F+L  Q+ QF  F+ RSL+
Sbjct  90    YLCESLNMSYLSPYMEALGSDFSNGANFAIAGSGTMPRDRPFALHVQVQQFIHFKQRSLQ  149

Query  447   FHSKGTNGMLGEEDFENALYMIDIGQNDIAGAF-SYLSKAQVI-EKIPSFISEIKDAVWA  620
               S G    +  + F NALY++DIGQND++GAF S L+   VI ++IP+ +SEI+DA+  
Sbjct  150   LISHGETAPVDADGFRNALYLVDIGQNDLSGAFSSRLAYDDVIHQRIPAILSEIQDAIVT  209

Query  621   IYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLC  800
             +Y  G + FWVH TGP+GCLP  LA  +  D   + ++ GC+++LN A+ EFN +L  +C
Sbjct  210   LYYNGAKNFWVHGTGPLGCLPEKLAEPRGDDEGGDLDDGGCLRTLNNASYEFNDQLCTVC  269

Query  801   EELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQSG  974
              +L  ++K ATIVY D+ +IK++LI+N + YGFE PLMACCG GG P  YNA++SC  +G
Sbjct  270   NKLTSQLKGATIVYTDVLSIKHDLIANHSGYGFEEPLMACCGYGGPPYNYNASVSCLGAG  329

Query  975   FSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
             + VC+DGSK++SWDGVHYT  ANA+VAA +LS  +STP   F YFC T
Sbjct  330   YRVCEDGSKFVSWDGVHYTNAANAVVAAKILSAEFSTPSVPFGYFCKT  377



>dbj|BAJ88733.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=397

 Score =   362 bits (930),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 179/334 (54%), Positives = 232/334 (69%), Gaps = 4/334 (1%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLS  302
             PV+FNFGDSNSDTGG  AA G     P+GR FFHR + R CDGRLIIDFLCE++   YLS
Sbjct  66    PVVFNFGDSNSDTGGMAAAKGWRIAPPEGRAFFHRPTGRFCDGRLIIDFLCESLNISYLS  125

Query  303   PYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGE  482
             PYL+AL  ++ NGVNFAI GS TLP+ VLF+L  Q+ +F  F+ RSLE  ++G    +  
Sbjct  126   PYLKALGSNYSNGVNFAISGSTTLPRDVLFTLHGQVQEFFFFKARSLELINQGQQVPIDA  185

Query  483   EDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNT  662
             E F+NALY IDIGQNDI    S L   QV+ K P  ++EIKDAV  +Y  G + FW+H T
Sbjct  186   EAFQNALYTIDIGQNDINALLSNLPYDQVVAKFPPILAEIKDAVQLLYANGSQNFWIHGT  245

Query  663   GPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVY  842
             G +GCLP+ LA  +  D  ++ ++ GC+K+ N AA  FN  L  LC++L  E+K+AT+VY
Sbjct  246   GALGCLPQKLAIPRKND--SDLDQNGCLKTYNRAAVAFNAALGSLCDQLNVELKNATVVY  303

Query  843   VDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANI--SCGQSGFSVCKDGSKYISWD  1016
              D++TIKY+L++N   YGF++PLM CCG GG PYN ++  SC     +VC DGSK++SWD
Sbjct  304   TDLFTIKYDLVANHTKYGFDSPLMTCCGYGGPPYNYDLSRSCQSPNATVCADGSKFVSWD  363

Query  1017  GVHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
             GVH TE ANA  AA++LS++YS P   FD FC T
Sbjct  364   GVHLTEAANAAAAAAILSSSYSRPKLKFDQFCKT  397



>ref|XP_007207836.1| hypothetical protein PRUPE_ppa023404mg, partial [Prunus persica]
 gb|EMJ09035.1| hypothetical protein PRUPE_ppa023404mg, partial [Prunus persica]
Length=325

 Score =   359 bits (922),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 181/332 (55%), Positives = 228/332 (69%), Gaps = 14/332 (4%)
 Frame = +3

Query  129   IFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSPY  308
             IFNFGDSNSDTGG  A  G     P+GRTFF +S+ RL DGRL+ID LC+++    LSPY
Sbjct  2     IFNFGDSNSDTGGLVAGLGFSVNPPNGRTFFGKSTGRLSDGRLVIDLLCQSLNMSLLSPY  61

Query  309   LEALTPS-FKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEE  485
             L++L  S F NG NFA+  S T+PK   FSLS Q++QF  F+       + G+  ++ +E
Sbjct  62    LDSLAGSIFSNGANFAVAASCTIPKRFPFSLSIQVMQFIHFKA------TAGSKHLINDE  115

Query  486   DFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNT  662
              F  ALYMIDIGQND++ +F+  LS  QV E IPS I EIK AV A+Y  GGR FW+HNT
Sbjct  116   GFRKALYMIDIGQNDLSYSFTKNLSYVQVTETIPSVIEEIKSAVKALYDQGGRNFWIHNT  175

Query  663   GPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVY  842
             GP+GCLP+ L+  + +D     +  GC+ S N AA+ FN  L  LC  +R E+KDA IVY
Sbjct  176   GPLGCLPQKLSLVEKKD----LDPYGCLSSYNAAARSFNEALLHLCNAMRSELKDAVIVY  231

Query  843   VDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANIS--CGQSGFSVCKDGSKYISWD  1016
             VDIY IKY+LI+NS  YGF  PLMACCG GG PYN N    CG+ G  VC +GS+++SWD
Sbjct  232   VDIYAIKYDLIANSTKYGFSTPLMACCGNGGPPYNFNAGRLCGRPGSHVCDEGSRFVSWD  291

Query  1017  GVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             G+HYTE AN +VA+ +LSTNYSTP   FD+FC
Sbjct  292   GIHYTEAANTIVASKILSTNYSTPRIPFDFFC  323



>gb|ACG28441.1| alpha-L-fucosidase 2 precursor [Zea mays]
Length=382

 Score =   361 bits (927),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 173/332 (52%), Positives = 223/332 (67%), Gaps = 4/332 (1%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLS  302
             PV+FNFGDSNSDTGG  AA G     P+GR FF R + R CDGRL IDFLCE++   YLS
Sbjct  51    PVLFNFGDSNSDTGGMAAAKGWHLTRPEGRAFFPRPTGRFCDGRLAIDFLCESLNISYLS  110

Query  303   PYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGE  482
             P+L+AL  ++ NG NFAI G+ T P+ V F+L  Q+ +F  FR RSLE   +G +G +  
Sbjct  111   PFLKALGSNYSNGANFAIAGAATQPRDVPFALHIQVQEFLYFRDRSLELIDQGLSGPIDA  170

Query  483   EDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNT  662
             + F+NALYMIDIGQND+    S     QVI K P  ++EIKDAV  +Y  G R FW+H T
Sbjct  171   QGFQNALYMIDIGQNDVNALLSNSPYDQVIAKFPPILAEIKDAVQTLYSNGSRNFWIHGT  230

Query  663   GPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVY  842
             G +GCLP+ LA  +  D  ++ ++ GC+K+ N AA  FN  L  LC+EL  +MKDAT+VY
Sbjct  231   GALGCLPQKLAIPRKND--SDLDQYGCLKTYNRAAVAFNAALGSLCDELSAQMKDATLVY  288

Query  843   VDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANIS--CGQSGFSVCKDGSKYISWD  1016
              D++ IKY+L++N   YGF+ PLM CCG GG PYN + S  C     + C DGSK++SWD
Sbjct  289   TDLFPIKYDLVANHTKYGFDKPLMTCCGYGGPPYNYDFSKGCQSKDVAACDDGSKFVSWD  348

Query  1017  GVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             GVH TE ANA+VA ++LS+ YS P   FD FC
Sbjct  349   GVHLTEAANAVVARAILSSQYSKPSLKFDQFC  380



>ref|XP_007051220.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
 gb|EOX95377.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
Length=369

 Score =   360 bits (924),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 180/350 (51%), Positives = 235/350 (67%), Gaps = 8/350 (2%)
 Frame = +3

Query  72    FLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDG  251
             FL ++    ++   IR   IFNFGDSNSDTGG  A  G   G P G TFFHR + RL DG
Sbjct  19    FLAMTDISESSPAGIRR--IFNFGDSNSDTGGVLAGTGLPIGLPHGITFFHRGTGRLGDG  76

Query  252   RLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFR  431
             RLIIDF CE++   YLSPYL++L P+F +GVNFA+ G+ TLP+FV F+L  Q+ QF RF+
Sbjct  77    RLIIDFFCEHLNLSYLSPYLDSLAPNFTSGVNFAVSGAMTLPQFVPFALDVQVRQFIRFK  136

Query  432   TRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAF--SYLSKAQVIEKIPSFISEIK  605
              RSLE  + G    + E+ F +ALYMIDIGQND+  A   S L+   V E+IPSF++EIK
Sbjct  137   NRSLELQTTGLGDFIDEKGFRDALYMIDIGQNDLLMALYASNLTCEPVAEQIPSFLAEIK  196

Query  606   DAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVK  785
              A+  IY  GGRKFW+HNTGP+GC P+ LA       N + +  GC +  N+ A+ FN  
Sbjct  197   LAIQNIYSYGGRKFWIHNTGPLGCAPKELALHS--HTNKDLDRIGCFRVHNDLAKAFNKG  254

Query  786   LSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANIS  959
             L ++C+E+R  +KDATIVY+D+YTIKYN+ +    YGFE P MACCG GG P  Y+   +
Sbjct  255   LRNICKEMRTVLKDATIVYIDVYTIKYNIFTKYKKYGFEYPFMACCGYGGPPNNYDQKAT  314

Query  960   CGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYF  1109
             CGQ G S+C + S+ I WDGVHY+E +N +VA S+LS +YSTP    + F
Sbjct  315   CGQPGSSICNNVSRSIVWDGVHYSEASNRVVATSILSGHYSTPQMKLENF  364



>ref|NP_001152225.1| alpha-L-fucosidase 2 precursor [Zea mays]
 gb|ACG46483.1| alpha-L-fucosidase 2 precursor [Zea mays]
Length=384

 Score =   360 bits (925),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 173/332 (52%), Positives = 223/332 (67%), Gaps = 4/332 (1%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLS  302
             PV+FNFGDSNSDTGG  AA G     P+GR FF R + R CDGRL IDFLCE++   YLS
Sbjct  53    PVLFNFGDSNSDTGGMAAAKGWHLTRPEGRAFFPRPTGRFCDGRLAIDFLCESLNISYLS  112

Query  303   PYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGE  482
             P+L+AL  ++ NG NFAI G+ T P+ V F+L  Q+ +F  FR RSLE   +G +G +  
Sbjct  113   PFLKALGSNYSNGANFAIAGAATQPRDVPFALHIQVQEFLYFRDRSLELIDQGLSGPIDA  172

Query  483   EDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNT  662
             + F+NALYMIDIGQND+    S L   QVI K P  ++EIKDAV  +Y  G   FW+H T
Sbjct  173   QGFQNALYMIDIGQNDVNALLSNLPYDQVIAKFPPILAEIKDAVQTLYSNGSLNFWIHGT  232

Query  663   GPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVY  842
             G +GCLP+ LA  +  D  ++ ++ GC+K+ N AA  FN  L  LC+EL  +MKDAT+VY
Sbjct  233   GALGCLPQKLAIPRKND--SDLDQYGCLKTYNRAAVAFNAALGSLCDELSAQMKDATLVY  290

Query  843   VDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANIS--CGQSGFSVCKDGSKYISWD  1016
              D++ IKY L++N   YGF+ PLM CCG GG PYN + S  C     + C+DGSK++SWD
Sbjct  291   TDLFPIKYGLVANHTKYGFDKPLMTCCGYGGPPYNYDFSKGCQSKDVAACEDGSKFVSWD  350

Query  1017  GVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             GVH TE ANA+VA ++LS+ YS P   FD FC
Sbjct  351   GVHLTEAANAVVAKAILSSQYSKPSLKFDQFC  382



>ref|XP_007205390.1| hypothetical protein PRUPE_ppa007411mg [Prunus persica]
 gb|EMJ06589.1| hypothetical protein PRUPE_ppa007411mg [Prunus persica]
Length=369

 Score =   357 bits (916),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 189/368 (51%), Positives = 243/368 (66%), Gaps = 16/368 (4%)
 Frame = +3

Query  33    QRAAMFVFITCSAFLVLSSPPLAAAECIRNPV-IFNFGDSNSDTGGYPAAHGNIFGYPDG  209
             Q   + + ++ +  L++ S  +        PV IFNFGDSNSDTGG  A  G     P+G
Sbjct  12    QSVGLILTLSGAVLLIILSASVDGHLGPTRPVHIFNFGDSNSDTGGLVAGLGYFVNPPNG  71

Query  210   RTFFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFV  386
             RTFF RS+ RL DGRL+ID LC+++    LSPYL++L  S F NG NFAI GS TLPK V
Sbjct  72    RTFFRRSTGRLSDGRLVIDLLCQSLNVSLLSPYLDSLAGSRFSNGANFAIVGSSTLPKRV  131

Query  387   LFSLSTQLLQFNRFR-TRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSK  560
              FSL+ Q++QF  F+ T  +E            ED   ALYMIDIGQND+A +F+  LS 
Sbjct  132   PFSLNIQVMQFIHFKATADIEL----VKIFFCCED--KALYMIDIGQNDLADSFTKNLSY  185

Query  561   AQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETG  740
             AQV ++IPS I+EIK AV A+Y  GGR FW+HNTGP+GCLP+ L+  +    N + +  G
Sbjct  186   AQVTKRIPSVIAEIKSAVKALYDQGGRNFWIHNTGPLGCLPQKLSLVE----NKDLDPYG  241

Query  741   CIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMAC  920
             C+ S N AA+ FN  L  LC  +R E+KDA IVYVDIY IKY+LI+NS  YGF  PLMAC
Sbjct  242   CLSSYNAAARLFNEALRHLCNGMRSELKDAVIVYVDIYAIKYDLIANSTKYGFSRPLMAC  301

Query  921   CGGGGAPYNANI--SCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPF  1094
             CG GG PYN N+  +CG  G  VC +GS +++WDG+HYTE AN +VA+ +LS N+STP  
Sbjct  302   CGNGGPPYNYNVGLTCGHPGSQVCDEGSLFVNWDGIHYTEAANTIVASKILSMNFSTPRI  361

Query  1095  NFDYFCST  1118
              FD+FC +
Sbjct  362   PFDFFCCS  369



>ref|XP_002886995.1| carboxylic ester hydrolase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63254.1| carboxylic ester hydrolase [Arabidopsis lyrata subsp. lyrata]
Length=365

 Score =   355 bits (911),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 181/358 (51%), Positives = 236/358 (66%), Gaps = 8/358 (2%)
 Frame = +3

Query  48    FVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHR  227
             F FI C + +V S+  +++ +  +  ++ NFGDSNSDTGG  A  G   G P G TFFHR
Sbjct  11    FFFILCLSLMVCSNSEISS-KSNKKRILINFGDSNSDTGGVLAGVGLPIGLPHGITFFHR  69

Query  228   SSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQ  407
              + RL DGRLI+DF CE++K  YLSPYL++L+P+FK GVNFA+ G+  LP F  F L+ Q
Sbjct  70    GTGRLGDGRLIVDFFCEHLKMTYLSPYLDSLSPNFKRGVNFAVSGATALPVFS-FPLAIQ  128

Query  408   LLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAF--SYLSKAQVIEKI  581
             + QF  F+ RS E  S G   ++ +  F+NALYMIDIGQND+  A   S L+   V+EKI
Sbjct  129   IRQFVHFKNRSQELISSGRRDLIDDNGFKNALYMIDIGQNDLLLALYDSNLTYTPVVEKI  188

Query  582   PSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNE  761
             PS + EIK A+  +Y  GGRKFWVHNTGP+GC P+ LA     D  ++ +  GC +  NE
Sbjct  189   PSMLLEIKKAIQTVYLYGGRKFWVHNTGPLGCAPKELAIHPHND--SDLDPIGCFRVHNE  246

Query  762   AAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP  941
              A+ FN  L  LC ELR + KDAT+VYVDIY+IKY L ++   YGF +PLMACCG GG P
Sbjct  247   VAEAFNKGLFSLCNELRSQFKDATLVYVDIYSIKYKLSADFKRYGFVDPLMACCGYGGRP  306

Query  942   --YNANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYF  1109
               Y+   +CGQ G ++C+D +K I WDGVHYTE AN +V  +VL+  YS P    D F
Sbjct  307   NNYDRKATCGQPGSTICRDVTKAIVWDGVHYTEAANRVVVDAVLTNRYSYPKIPLDRF  364



>ref|XP_002878447.1| carboxylic ester hydrolase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54706.1| carboxylic ester hydrolase [Arabidopsis lyrata subsp. lyrata]
Length=365

 Score =   353 bits (907),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 181/358 (51%), Positives = 235/358 (66%), Gaps = 8/358 (2%)
 Frame = +3

Query  48    FVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHR  227
             F FI C + +V S+  +++ +  +  ++ NFGDSNSDTGG  A  G   G P G TFFHR
Sbjct  11    FFFILCLSLMVCSNSEISS-KSNKKRILINFGDSNSDTGGVLAGVGLPIGLPHGITFFHR  69

Query  228   SSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQ  407
              + RL DGRLI+DF CE++K  YLSPYL++L+P+FK GVNFA+ G+  LP F  F L+ Q
Sbjct  70    GTGRLGDGRLIVDFFCEHLKMTYLSPYLDSLSPNFKRGVNFAVSGATALPVFS-FPLAIQ  128

Query  408   LLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAF--SYLSKAQVIEKI  581
             + QF  F+ RS E  S G   ++ +  F+NALYMIDIGQND+  A   S L+   V+EKI
Sbjct  129   IRQFVHFKNRSQELISSGRRDLIDDNGFKNALYMIDIGQNDLLLALYDSNLTYTPVVEKI  188

Query  582   PSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNE  761
             PS + EIK A+  +Y  GGRKFWVHNTGP+GC P+ LA     D  ++ +  GC +  NE
Sbjct  189   PSMLLEIKKAIQTVYLYGGRKFWVHNTGPLGCAPKELAIHPHND--SDLDPIGCFRVHNE  246

Query  762   AAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP  941
              A+ FN  L  LC ELR + KDAT+VYVDIY+IKY L ++   YGF +PLMACCG GG P
Sbjct  247   VAEAFNKGLFSLCNELRSQFKDATLVYVDIYSIKYKLSADFKRYGFVDPLMACCGYGGRP  306

Query  942   --YNANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYF  1109
               Y+   +CGQ G ++C+D +K I WDGVHYTE AN  V  +VL+  YS P    D F
Sbjct  307   NNYDRKATCGQPGSTICRDVTKAIVWDGVHYTEAANRFVVDAVLTNRYSYPKIPLDRF  364



>ref|XP_004302302.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Fragaria vesca 
subsp. vesca]
Length=356

 Score =   352 bits (904),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 184/333 (55%), Positives = 235/333 (71%), Gaps = 14/333 (4%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLS  302
             PVIFNFGDSNSDTGG  A  G     P GRT+FHRS+ R+ DGRLIIDFLC+++    L+
Sbjct  31    PVIFNFGDSNSDTGGLIAGLGYTINPPYGRTYFHRSTGRMSDGRLIIDFLCQSLNTSLLA  90

Query  303   PYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLG  479
             PYL++L+ S F NG NFAI GS T PK + FSLS Q++QF  F+       + G   ++ 
Sbjct  91    PYLDSLSGSKFTNGANFAIVGSSTFPKRIPFSLSIQVMQFLHFKA------TAGAKDLID  144

Query  480   EEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVH  656
             EE F  ALYMIDIGQND+A  FS  LS  Q+ +KIP   +EIK+AV  +Y  GGR FW+H
Sbjct  145   EEGFRKALYMIDIGQNDLAQLFSKNLSLTQITKKIPPITTEIKNAVKTLYDQGGRNFWIH  204

Query  657   NTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATI  836
             NTGP+GCLP+ L++ + RD +T     GC+ + N AA+ FNV L   C+E+R E+KD  +
Sbjct  205   NTGPLGCLPQKLSSVQQRDMDTY----GCLSTYNAAARLFNVGLRHTCDEMRFELKDVKV  260

Query  837   VYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNAN--ISCGQSGFSVCKDGSKYIS  1010
             VYVD+Y IKY+LI+NS  YGF +PLMACCG GG PYN N  ++CG  G  VCKD S++IS
Sbjct  261   VYVDVYAIKYDLIANSTKYGFTSPLMACCGNGGPPYNYNMRLTCGYPGSQVCKDTSQFIS  320

Query  1011  WDGVHYTEDANAMVAASVLSTNYSTPPFNFDYF  1109
             WDG+HYTE AN +VA+ +LST+YS PP  FD+F
Sbjct  321   WDGIHYTEAANTIVASKILSTDYSIPPIPFDFF  353



>ref|NP_191787.2| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q6NLP7.1|GDL60_ARATH RecName: Full=GDSL esterase/lipase At3g62280; AltName: Full=Extracellular 
lipase At3g62280; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAS76770.1| At3g62280 [Arabidopsis thaliana]
 dbj|BAD94911.1| putative protein [Arabidopsis thaliana]
 gb|AEE80331.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=365

 Score =   352 bits (904),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 177/335 (53%), Positives = 225/335 (67%), Gaps = 7/335 (2%)
 Frame = +3

Query  117   RNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADY  296
             + P++ NFGDSNSDTGG  A  G   G P G TFFHR + RL DGRLI+DF CE++K  Y
Sbjct  33    KKPILINFGDSNSDTGGVLAGVGLPIGLPHGITFFHRGTGRLGDGRLIVDFYCEHLKMTY  92

Query  297   LSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGML  476
             LSPYL++L+P+FK GVNFA+ G+  LP F  F L+ Q+ QF  F+ RS E  S G   ++
Sbjct  93    LSPYLDSLSPNFKRGVNFAVSGATALPIFS-FPLAIQIRQFVHFKNRSQELISSGRRDLI  151

Query  477   GEEDFENALYMIDIGQNDIAGAF--SYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFW  650
              +  F NALYMIDIGQND+  A   S L+ A V+EKIPS + EIK A+  +Y  GGRKFW
Sbjct  152   DDNGFRNALYMIDIGQNDLLLALYDSNLTYAPVVEKIPSMLLEIKKAIQTVYLYGGRKFW  211

Query  651   VHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDA  830
             VHNTGP+GC P+ LA     D  ++ +  GC +  NE A+ FN  L  LC ELR + KDA
Sbjct  212   VHNTGPLGCAPKELAIHLHND--SDLDPIGCFRVHNEVAKAFNKGLLSLCNELRSQFKDA  269

Query  831   TIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQSGFSVCKDGSKY  1004
             T+VYVDIY+IKY L ++  +YGF +PLMACCG GG P  Y+   +CGQ G ++C+D +K 
Sbjct  270   TLVYVDIYSIKYKLSADFKLYGFVDPLMACCGYGGRPNNYDRKATCGQPGSTICRDVTKA  329

Query  1005  ISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYF  1109
             I WDGVHYTE AN  V  +VL+  YS P  + D F
Sbjct  330   IVWDGVHYTEAANRFVVDAVLTNRYSYPKNSLDRF  364



>ref|XP_010679450.1| PREDICTED: GDSL esterase/lipase At3g62280 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010679451.1| PREDICTED: GDSL esterase/lipase At3g62280 [Beta vulgaris subsp. 
vulgaris]
Length=371

 Score =   352 bits (904),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 175/333 (53%), Positives = 229/333 (69%), Gaps = 6/333 (2%)
 Frame = +3

Query  117   RNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADY  296
             R P++ NFGDSNSDTGG  A  G   G P G TFFHR + RL DGRLIIDF CE++K  Y
Sbjct  36    RKPLVINFGDSNSDTGGVLAGTGLPIGLPHGITFFHRGTGRLGDGRLIIDFFCEHLKLGY  95

Query  297   LSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGML  476
             LSPYL++L+P+F +GVNFA+ G+  LPKF+ F+LS Q+ QF  F+ RSLE  S G+  ++
Sbjct  96    LSPYLDSLSPNFTSGVNFAVSGATLLPKFLPFALSVQVRQFIHFKNRSLELLSLGSKDLI  155

Query  477   GEEDFENALYMIDIGQNDIAGAF--SYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFW  650
              EE F +ALYMIDIGQND+  A   S L+   V ++IP F+ EIK AV  +Y+ GGR+FW
Sbjct  156   NEEGFHSALYMIDIGQNDLLMALYGSNLTYEPVAQQIPFFLEEIKLAVQTMYQYGGRRFW  215

Query  651   VHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDA  830
             +HNTGP+GC P+ LA       +++ ++ GC++  N+ A+ FN  L  L  +LR   KDA
Sbjct  216   IHNTGPLGCQPKELA-LHYSPKSSDLDQAGCLRVHNQVAKTFNKGLRLLSHDLRLVYKDA  274

Query  831   TIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN--ANISCGQSGFSVCKDGSKY  1004
              IVYVD+Y+IKY+L +N   YGF+NP +ACC G GAPYN   N +CGQ G S+C + S+ 
Sbjct  275   VIVYVDVYSIKYSLSANPEKYGFKNPFVACC-GHGAPYNYDRNATCGQPGSSICSNVSQS  333

Query  1005  ISWDGVHYTEDANAMVAASVLSTNYSTPPFNFD  1103
             I WDGVHYTE AN +VA  +LS  YSTP    +
Sbjct  334   IVWDGVHYTEAANRVVATKILSGQYSTPLLKLE  366



>ref|XP_004968678.1| PREDICTED: GDSL esterase/lipase LIP-4-like [Setaria italica]
Length=389

 Score =   352 bits (904),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 168/332 (51%), Positives = 221/332 (67%), Gaps = 4/332 (1%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLS  302
             PV+FNFGDSNSDTGG  AA G     P+GR FF R + R CDGRL +DFLCE++   YLS
Sbjct  58    PVLFNFGDSNSDTGGMAAAKGWHLTRPEGRAFFPRPTGRFCDGRLTVDFLCESLNISYLS  117

Query  303   PYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGE  482
             P+L+AL  ++ NG NFA  G+ T P+ V F+L  Q+ +F  FR RSLE   +G +G +  
Sbjct  118   PFLKALGSNYSNGANFASAGAATQPRDVPFALHIQVQEFLYFRDRSLELIDQGLSGPIDA  177

Query  483   EDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNT  662
             + F+NALYMIDIGQND+    S L   QV+ K P  ++EIKDAV  +Y  G R FW+H T
Sbjct  178   QGFQNALYMIDIGQNDVNALLSNLPYDQVVAKFPPILAEIKDAVQTLYSNGSRNFWIHGT  237

Query  663   GPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVY  842
             G +GCLP+ LA  +  D  ++ ++ GC+K+ N AA  FN  L  LC++L  +M DATIVY
Sbjct  238   GALGCLPQKLAIPRKND--SDLDQYGCLKTYNRAAVAFNSALGSLCDQLSAQMNDATIVY  295

Query  843   VDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNA--NISCGQSGFSVCKDGSKYISWD  1016
              D++ IKY+L++N   YGF+ PL+ CCG GG PYN   N  C     + C DGSK++SWD
Sbjct  296   TDLFPIKYDLVANHTKYGFDKPLLTCCGYGGPPYNYDFNKGCQSKDVTACDDGSKFVSWD  355

Query  1017  GVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             GVH TE ANA+VA ++LS+ YS P   F+ FC
Sbjct  356   GVHLTEAANAVVAKAILSSQYSKPSLKFNQFC  387



>ref|XP_009401648.1| PREDICTED: GDSL esterase/lipase At1g09390 [Musa acuminata subsp. 
malaccensis]
Length=374

 Score =   351 bits (901),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 165/336 (49%), Positives = 237/336 (71%), Gaps = 5/336 (1%)
 Frame = +3

Query  126   VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSP  305
             V+FNFGDSNSDTGG+ A  G   G P GR FFH+++ R  DGRL +DF+CE +K  YLS 
Sbjct  39    VLFNFGDSNSDTGGFAAGLGFYLGPPSGRQFFHKTTGRFSDGRLYVDFICEGLKMSYLSH  98

Query  306   YLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEE  485
             YLE+   +F +GVNFA+ G+        F LSTQ+LQF  F+ R+ E  ++G+  ++ E+
Sbjct  99    YLESSGSNFSHGVNFAVVGAAVDLPGNPFPLSTQVLQFLHFKNRTRELMTEGSGSLVTEK  158

Query  486   DFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNT  662
             +F++A+Y IDIGQND+A AF   LS  QV+ KIP+ +++I+DA+ ++++ GGRKFW++NT
Sbjct  159   EFKHAVYSIDIGQNDLAKAFYLNLSYPQVLLKIPTMLNKIEDAIKSMFENGGRKFWIYNT  218

Query  663   GPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVY  842
             GP+GCLP+TLA  +  D  ++ +  GC+ + N+AA+ +N  LSDLCE++R E+K+A IVY
Sbjct  219   GPLGCLPQTLALHRKND--SQLDAFGCLSAYNDAAKAYNYGLSDLCEKMRQELKNAVIVY  276

Query  843   VDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN--ANISCGQSGFSVCKDGSKYISWD  1016
             VD+++IKY+LI+N   Y  E PLMACCG GG PYN    ++CGQ   + C +GS+Y+SWD
Sbjct  277   VDMFSIKYDLIANHTQYSIEKPLMACCGHGGPPYNYKERMTCGQPTATACPEGSRYVSWD  336

Query  1017  GVHYTEDANAMVAASVLSTNYSTPPFNFDYFCSTNS  1124
             GVHYTE AN ++A+ +LS  YS P  +    C   +
Sbjct  337   GVHYTETANGIIASKILSAKYSQPQTDLRSLCEEQT  372



>ref|XP_007051219.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
[Theobroma cacao]
 gb|EOX95376.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
[Theobroma cacao]
Length=332

 Score =   350 bits (897),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 168/296 (57%), Positives = 215/296 (73%), Gaps = 3/296 (1%)
 Frame = +3

Query  51   VFITCSAFLVLSSPPLAA-AECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHR  227
            +F     F  L   PL    +C + P+IFNFGDSNSDTGG+    G  F  P+GRT+FH+
Sbjct  14   LFTLHVIFCTLPLLPLPVHCQCTKTPIIFNFGDSNSDTGGFADGLGLNFAPPNGRTYFHQ  73

Query  228  SSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQ  407
             + RL DGRL+IDFL E++   YL+PYL++L P+F NG NFAI GS TLP+FV FSL  Q
Sbjct  74   PAGRLSDGRLMIDFLRESLNTSYLTPYLDSLGPNFSNGANFAIRGSATLPRFVPFSLDVQ  133

Query  408  LLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPS  587
            + QF RFR RS    SKG   ++G+ DF+NALY IDIGQND+AG+F YL+ AQVI+KIPS
Sbjct  134  VSQFLRFRARSPALMSKGYKDLVGDGDFQNALYTIDIGQNDLAGSFDYLTYAQVIDKIPS  193

Query  588  FISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAA  767
            FI+EIK A+W IY+ GG+ FWVHNTGP+GC P+ LA        +E +E GC+  LN AA
Sbjct  194  FITEIKYAIWNIYQSGGKNFWVHNTGPLGCAPQKLALHGQNA--SELDEHGCLHPLNNAA  251

Query  768  QEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGG  935
            + FN +L  LCE+LR ++ +ATIVYVD+Y+IKY+LI+N+  YGF+NPLMACCG GG
Sbjct  252  KAFNAQLRALCEQLRPQLTNATIVYVDLYSIKYDLIANAPNYGFQNPLMACCGNGG  307



>ref|XP_006292520.1| hypothetical protein CARUB_v10018750mg [Capsella rubella]
 gb|EOA25418.1| hypothetical protein CARUB_v10018750mg [Capsella rubella]
Length=365

 Score =   348 bits (894),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 178/358 (50%), Positives = 234/358 (65%), Gaps = 8/358 (2%)
 Frame = +3

Query  48    FVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHR  227
             F  I C + LV S+  + + +  + P++ NFGDSNSDTGG  A  G   G P G TFFH+
Sbjct  11    FFLILCLSLLVCSNS-VNSYKSNKKPILINFGDSNSDTGGVLAGVGLPIGLPHGITFFHK  69

Query  228   SSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQ  407
              + RL DGRLI+DF CE++K  YLSPYL++L+P+FK GVNFA+ G+  LP F  F L+ Q
Sbjct  70    GTGRLGDGRLIVDFFCEHLKMSYLSPYLDSLSPNFKRGVNFAVSGATALPVFS-FPLAIQ  128

Query  408   LLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAF--SYLSKAQVIEKI  581
             + QF  F+ RS E  S G   ++ ++ F+NALYMIDIGQND+  A   S L+   V++KI
Sbjct  129   IRQFVHFKNRSQELISSGRRDLIDDKGFKNALYMIDIGQNDLLLALYDSNLTYTPVVDKI  188

Query  582   PSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNE  761
             PS + EIK A+  +Y  GGRKFWVHNTGP+GC P+ LA        ++ +  GC +  NE
Sbjct  189   PSMLLEIKKAIQTVYLYGGRKFWVHNTGPLGCAPKELAIHP--HNGSDLDPIGCFRVHNE  246

Query  762   AAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP  941
              A+ FN  L  LC+ELR + +DATIVYVDIY+IKY L ++   YGF +PLMACCG GG P
Sbjct  247   VAKAFNKGLFRLCDELRSQFRDATIVYVDIYSIKYKLSADFKRYGFVDPLMACCGYGGRP  306

Query  942   --YNANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYF  1109
               Y+   +CGQ G ++C D +K I WDGVHYTE AN  V  +V +  YS P  + D F
Sbjct  307   NNYDRKATCGQPGSTICPDVTKAIVWDGVHYTEAANRFVVDAVFTNRYSYPKISLDRF  364



>ref|NP_001042924.1| Os01g0329900 [Oryza sativa Japonica Group]
 dbj|BAD54714.1| putative early nodule-specific protein ENOD8 [Oryza sativa Japonica 
Group]
 dbj|BAF04838.1| Os01g0329900 [Oryza sativa Japonica Group]
Length=436

 Score =   350 bits (898),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 169/327 (52%), Positives = 220/327 (67%), Gaps = 5/327 (2%)
 Frame = +3

Query  126   VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSP  305
             VIFNFGDSNSDTGG  AA G     P+GRT+F R + R+ DGRL+IDF+CE++   +LSP
Sbjct  100   VIFNFGDSNSDTGGMAAAMGLNIALPEGRTYFRRPTGRISDGRLVIDFICESLNTPHLSP  159

Query  306   YLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEE  485
             YL++L   F NGVNFAIGGS   P    FSL  QL QF  FRTRS+E  ++G    +  +
Sbjct  160   YLKSLGSDFSNGVNFAIGGSTATPGGSTFSLDVQLHQFLYFRTRSIELINQGVRTPIDRD  219

Query  486   DFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTG  665
              F NA+Y IDIGQND+A A+  L   QV+ KIP+ ++ IK  + A+Y  GGRKFWVH TG
Sbjct  220   GFRNAIYTIDIGQNDLA-AYMNLPYDQVLAKIPTIVAHIKYTIEALYGHGGRKFWVHGTG  278

Query  666   PVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYV  845
              +GCLP+ L+    RD +++ +  GC+K+ N AA+EFN +L   C  LR  M DA +V+ 
Sbjct  279   ALGCLPQKLSIP--RDDDSDLDGNGCLKTYNAAAREFNAQLGAACRRLRQRMADAAVVFT  336

Query  846   DIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNAN--ISCGQSGFSVCKDGSKYISWDG  1019
             D+Y  KY+L++N  ++G E PLMACCG GG PYN N    C  +   +C  G+++ SWDG
Sbjct  337   DVYAAKYDLVANHTLHGIERPLMACCGNGGPPYNYNHFKMCMSAEMELCDMGARFASWDG  396

Query  1020  VHYTEDANAMVAASVLSTNYSTPPFNF  1100
             VHYTE ANA+VAA VL+  YSTPP  F
Sbjct  397   VHYTEAANAIVAARVLTGEYSTPPVRF  423



>emb|CDY25101.1| BnaC06g18430D [Brassica napus]
Length=365

 Score =   347 bits (889),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 169/335 (50%), Positives = 225/335 (67%), Gaps = 7/335 (2%)
 Frame = +3

Query  117   RNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADY  296
             + P++ NFGDSNSDTGG  A  G   G P G TFFH+ + RL DGRLI+DF CE++K  Y
Sbjct  33    KKPILINFGDSNSDTGGVLAGVGLPIGLPHGITFFHKGTGRLGDGRLILDFFCEHLKMPY  92

Query  297   LSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGML  476
             LSPYL++L+P+FK GVNFA+ G+  LP F  F L+ Q+ Q+ RF+ RS E  S G   ++
Sbjct  93    LSPYLDSLSPNFKRGVNFAVSGATVLPMFS-FPLAVQIRQYVRFKNRSQELISSGKRDLI  151

Query  477   GEEDFENALYMIDIGQNDIAGAF--SYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFW  650
              +  F+NALYMIDIGQND+  A   S L+   V+EKIP  + EIK A+  +Y  GGRKFW
Sbjct  152   DDNGFKNALYMIDIGQNDLLQALYNSNLTYTTVVEKIPPMLLEIKKAIQTVYLYGGRKFW  211

Query  651   VHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDA  830
             VHNTGP+GC P+ LA     D  ++ +  GC +  N+ A+ FN  L  L  E+R ++KDA
Sbjct  212   VHNTGPLGCAPKELAINPHND--SDLDPIGCFRVHNDVAKTFNKGLFSLVSEMRAQLKDA  269

Query  831   TIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQSGFSVCKDGSKY  1004
             T+VYVDIY+IKY L ++S  YGF +PLMACCG GG P  Y+   +CGQ G ++C+D +K 
Sbjct  270   TLVYVDIYSIKYKLSADSKRYGFVDPLMACCGFGGRPNNYDRKATCGQPGSTICRDVTKA  329

Query  1005  ISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYF  1109
             + WDGVHYTE AN  V  ++LS  Y+ P  + + F
Sbjct  330   VVWDGVHYTEAANRFVVDAILSNRYTYPKISLNRF  364



>ref|XP_010413293.1| PREDICTED: GDSL esterase/lipase At3g62280 [Camelina sativa]
Length=365

 Score =   346 bits (887),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 174/356 (49%), Positives = 234/356 (66%), Gaps = 7/356 (2%)
 Frame = +3

Query  54    FITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSS  233
             F+T    L++ S  + +++  + P++ NFGDSNSDTGG  A  G   G P G TFFHR +
Sbjct  12    FLTLCISLLVCSNSVISSKSNKKPILINFGDSNSDTGGVLAGVGLPIGLPHGITFFHRGT  71

Query  234   DRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLL  413
              RL DGRLI+DF C+++K  YLSPYL++L+P+FK GVNFA+ G+  LP F  F L+ Q+ 
Sbjct  72    GRLGDGRLIVDFFCKHLKMTYLSPYLDSLSPNFKRGVNFAVSGATALPVFS-FPLAIQIR  130

Query  414   QFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAF--SYLSKAQVIEKIPS  587
             QF  F+ RS E  S G   ++ +  ++NALYMIDIGQND+  A   S L+   V++KIPS
Sbjct  131   QFVHFKNRSQELISSGRRDLIDDNGYKNALYMIDIGQNDLLLALYDSNLTYTPVVQKIPS  190

Query  588   FISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAA  767
              + EIK A+  +Y  GGRKFWVHNTGP+GC P+ LA     +  ++ +  GC +  NE A
Sbjct  191   MLLEIKKAIQTVYLYGGRKFWVHNTGPLGCAPKELAIHPHNE--SDLDRIGCFRVHNEVA  248

Query  768   QEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--  941
             + FN  L  LC ELR + KDAT+VYVDIY+IK  L ++   YGF +PLMACCG GG P  
Sbjct  249   KAFNKGLLSLCNELRSQFKDATLVYVDIYSIKCKLSADFKRYGFVDPLMACCGYGGRPNN  308

Query  942   YNANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYF  1109
             Y+   +CGQ G ++C++ +K I WDGVHYTE AN  V  +VL+  YS P  + D F
Sbjct  309   YDRKATCGQPGSTICRNVTKAIVWDGVHYTEAANRFVVDAVLTNRYSYPKISLDGF  364



>ref|XP_010468971.1| PREDICTED: GDSL esterase/lipase At3g62280-like [Camelina sativa]
Length=365

 Score =   344 bits (882),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 173/333 (52%), Positives = 222/333 (67%), Gaps = 7/333 (2%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLS  302
             P++ NFGDSNSDTGG  A  G   G P G TFFHR + RL DGRLI+DF CE++K  YLS
Sbjct  35    PILINFGDSNSDTGGVLAGVGLPIGLPHGITFFHRGTGRLGDGRLIVDFFCEHLKMTYLS  94

Query  303   PYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGE  482
             PYL++L+P+FK GVNFA+ G+  LP F  F L+ Q+ QF  F+ RS E  S G   ++ +
Sbjct  95    PYLDSLSPNFKRGVNFAVSGATALPVFS-FPLAIQIRQFVHFKNRSQELISSGRRDLIDD  153

Query  483   EDFENALYMIDIGQNDIAGAF--SYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVH  656
             + F+NALYMIDIGQND+  A   S L+   V+EKIPS + EIK A+  +Y  GGRKFWVH
Sbjct  154   KGFKNALYMIDIGQNDLLLALYDSNLTYTPVVEKIPSMLLEIKKAIQTVYLYGGRKFWVH  213

Query  657   NTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATI  836
             NTGP+GC P+ LA     +  ++ +  GC +  NE A+ FN  L  LC ELR + KDAT+
Sbjct  214   NTGPLGCAPKELAIHPHNE--SDLDRIGCFRVHNEVAKAFNKGLLSLCNELRSQFKDATL  271

Query  837   VYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQSGFSVCKDGSKYIS  1010
             VYVDIY+IKY L ++   YGF +PLMACCG GG P  Y+   +CGQ G ++C++ +K   
Sbjct  272   VYVDIYSIKYKLSADFKRYGFVDPLMACCGYGGRPNNYDRKATCGQPGSTICRNVTKATV  331

Query  1011  WDGVHYTEDANAMVAASVLSTNYSTPPFNFDYF  1109
             WDGVHYTE AN  V  +VL+  YS P    D F
Sbjct  332   WDGVHYTEAANRFVFDAVLTNRYSYPKIPLDGF  364



>ref|XP_009104379.1| PREDICTED: GDSL esterase/lipase At3g62280 [Brassica rapa]
Length=365

 Score =   343 bits (880),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 167/335 (50%), Positives = 223/335 (67%), Gaps = 7/335 (2%)
 Frame = +3

Query  117   RNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADY  296
             + P++ NFGDSNSDTGG  A  G   G P G TFFH+ + RL DGRLI+DF CE++K  Y
Sbjct  33    KKPILINFGDSNSDTGGVLAGVGLPIGLPHGITFFHKGTGRLGDGRLILDFFCEHLKMPY  92

Query  297   LSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGML  476
             LSPYL++L+P+FK GVNFA+ G+  LP F  F L+ Q+ Q+ RF+ RS E  S G   ++
Sbjct  93    LSPYLDSLSPNFKRGVNFAVSGATALPMFS-FPLAVQIRQYVRFKNRSQELTSSGRRDLI  151

Query  477   GEEDFENALYMIDIGQNDIAGAF--SYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFW  650
              +  F+NALYMIDIGQND+  A   S L+   V+EKIP  + EIK A+  +Y  GGRKFW
Sbjct  152   DDNGFKNALYMIDIGQNDLLQALYDSNLTYTTVVEKIPPMLLEIKKAIQTVYLYGGRKFW  211

Query  651   VHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDA  830
             VHNTGP+GC P+ LA     +  ++ +  GC +  N+ A+ FN  L  L  E+R ++KDA
Sbjct  212   VHNTGPLGCAPKELAINPHNE--SDLDPIGCFRVHNDVAKTFNKGLFSLVNEMRTQLKDA  269

Query  831   TIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQSGFSVCKDGSKY  1004
             T+VY+DIY+IKY L ++S  YGF +PLMACCG GG P  Y+   +CGQ G ++C+D +K 
Sbjct  270   TLVYIDIYSIKYKLSADSKRYGFVDPLMACCGFGGRPNNYDRKATCGQPGSTICRDVTKA  329

Query  1005  ISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYF  1109
             + WDGVHYTE AN  V  ++LS  Y+ P      F
Sbjct  330   VVWDGVHYTEAANRFVVDAILSNRYTYPKIPLSRF  364



>gb|ACN33401.1| unknown [Zea mays]
 tpg|DAA54473.1| TPA: alpha-L-fucosidase 2 [Zea mays]
Length=419

 Score =   345 bits (884),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 165/323 (51%), Positives = 217/323 (67%), Gaps = 3/323 (1%)
 Frame = +3

Query  126   VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSP  305
             VIFNFGDSNSDTGG  A +G     P+GRTFF R + RL DGRL+IDF+CE++   +LSP
Sbjct  82    VIFNFGDSNSDTGGMAAVNGMNINLPEGRTFFRRPTGRLSDGRLVIDFICESLHTPFLSP  141

Query  306   YLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEE  485
             YL+AL   F NGVNFAIGGS   P    FSL  QL Q+  FR RS+E  + G    +  E
Sbjct  142   YLKALGADFSNGVNFAIGGSTATPGGSPFSLDVQLHQWLYFRARSMEMINLGQRPPIDRE  201

Query  486   DFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTG  665
              F  A+Y IDIGQND++ A+ +L   QV+ KIP F+++IK  +  +Y  G RKFW+H TG
Sbjct  202   GFRKAIYTIDIGQNDVS-AYMHLPYDQVLAKIPGFVAQIKYTIETLYSHGARKFWIHGTG  260

Query  666   PVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYV  845
              +GCLP+ LA  +  D   + +  GC+K+ N AA+ FN  L D C +LR  M DA +V+V
Sbjct  261   ALGCLPQKLAIPRDADDGDQLDAHGCLKTYNNAAKRFNALLGDACAQLRRRMVDAALVFV  320

Query  846   DIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNAN--ISCGQSGFSVCKDGSKYISWDG  1019
             D+Y +KY+L++N   +G E PLMACCG GG PYN N   +C  +   +C  G+++ISWDG
Sbjct  321   DMYAVKYDLVANHTTHGIEKPLMACCGYGGPPYNYNHFKACMSAEMQLCDVGTRFISWDG  380

Query  1020  VHYTEDANAMVAASVLSTNYSTP  1088
             VH+TE ANA+VAA VL+ +YSTP
Sbjct  381   VHFTEAANAIVAAKVLTGDYSTP  403



>ref|NP_001151259.1| alpha-L-fucosidase 2 [Zea mays]
 gb|ACG42154.1| alpha-L-fucosidase 2 precursor [Zea mays]
Length=417

 Score =   345 bits (884),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 165/323 (51%), Positives = 217/323 (67%), Gaps = 3/323 (1%)
 Frame = +3

Query  126   VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSP  305
             VIFNFGDSNSDTGG  A +G     P+GRTFF R + RL DGRL+IDF+CE++   +LSP
Sbjct  80    VIFNFGDSNSDTGGMAAVNGMNINLPEGRTFFRRPTGRLSDGRLVIDFICESLHTPFLSP  139

Query  306   YLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEE  485
             YL+AL   F NGVNFAIGGS   P    FSL  QL Q+  FR RS+E  + G    +  E
Sbjct  140   YLKALGADFSNGVNFAIGGSTATPGGSPFSLDVQLHQWLYFRARSMEMINLGQRPPIDRE  199

Query  486   DFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTG  665
              F  A+Y IDIGQND++ A+ +L   QV+ KIP F+++IK  +  +Y  G RKFW+H TG
Sbjct  200   GFRKAIYTIDIGQNDVS-AYMHLPYDQVLAKIPGFVAQIKYTIETLYSHGARKFWIHGTG  258

Query  666   PVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYV  845
              +GCLP+ LA  +  D   + +  GC+K+ N AA+ FN  L D C +LR  M DA +V+V
Sbjct  259   ALGCLPQKLAIPRDADDGDQLDAHGCLKTYNNAAKRFNALLGDACAQLRRRMVDAALVFV  318

Query  846   DIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNAN--ISCGQSGFSVCKDGSKYISWDG  1019
             D+Y +KY+L++N   +G E PLMACCG GG PYN N   +C  +   +C  G+++ISWDG
Sbjct  319   DMYAVKYDLVANHTTHGIEKPLMACCGYGGPPYNYNHFKACMSAEMQLCDVGTRFISWDG  378

Query  1020  VHYTEDANAMVAASVLSTNYSTP  1088
             VH+TE ANA+VAA VL+ +YSTP
Sbjct  379   VHFTEAANAIVAAKVLTGDYSTP  401



>gb|KFK35412.1| hypothetical protein AALP_AA5G281200, partial [Arabis alpina]
Length=348

 Score =   342 bits (877),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 176/340 (52%), Positives = 225/340 (66%), Gaps = 8/340 (2%)
 Frame = +3

Query  48    FVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHR  227
             F  ++C + LV S+   ++    + P++ NFGDSNSDTGG  A  G   G P G TFFHR
Sbjct  11    FFLVSCLSLLVCSNSENSSNSRNK-PILINFGDSNSDTGGVLAGVGLPIGLPHGITFFHR  69

Query  228   SSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQ  407
              + RL DGRLIIDF CE++K  YLSPYL++L+P+FK GVNFA+ G+  LP F  F L+ Q
Sbjct  70    GTGRLGDGRLIIDFFCEHLKMSYLSPYLDSLSPNFKRGVNFAVSGATALPVFS-FPLAVQ  128

Query  408   LLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAF--SYLSKAQVIEKI  581
             + QF RF+ RS E  S G   ++ +  F+NALYMIDIGQND+  A   S L+   V+EKI
Sbjct  129   IRQFVRFKKRSQELISSGRKDLIDDIGFKNALYMIDIGQNDLLLALYDSNLTYTVVVEKI  188

Query  582   PSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNE  761
             PS + EIK A+  +Y  GGRKFWVHNTGP+GC P+ LA     +  ++ +  GC +  NE
Sbjct  189   PSMLLEIKKAIQTVYLCGGRKFWVHNTGPLGCAPKELAINPHNE--SDLDPIGCFRVHNE  246

Query  762   AAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP  941
              A+ FN  L  LC E+R + KD T+VYVDIY+IKY L  +   YGF +PLMACCG GG P
Sbjct  247   VAKAFNKGLLSLCNEMRSQFKDVTLVYVDIYSIKYKLSKDFKRYGFVDPLMACCGFGGKP  306

Query  942   --YNANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVA  1055
               Y+   +CGQSG ++C D SK I WDGVHYTE AN  VA
Sbjct  307   NNYDRKATCGQSGSTICSDVSKAIVWDGVHYTEAANRFVA  346



>ref|XP_010512615.1| PREDICTED: GDSL esterase/lipase At3g62280-like [Camelina sativa]
Length=365

 Score =   342 bits (877),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 172/333 (52%), Positives = 220/333 (66%), Gaps = 7/333 (2%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLS  302
             P++ NFGDSNSDTGG  A  G   G P G TFFHR + RL DGRLI+DF CE++K  YLS
Sbjct  35    PILINFGDSNSDTGGVLAGVGLPIGLPHGITFFHRGTGRLGDGRLIVDFFCEHLKMTYLS  94

Query  303   PYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGE  482
             PYL++L+P+FK GVNFA+ G+  LP F  F L+ Q+ QF  F+ RS E  S G   ++ E
Sbjct  95    PYLDSLSPNFKRGVNFAVSGATALPVFS-FPLAIQIRQFVHFKNRSQELISSGRRDLIDE  153

Query  483   EDFENALYMIDIGQNDIAGAF--SYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVH  656
               ++NALYMIDIGQND+  A   S L+   V+EKIPS + EIK  +  +Y  GGRKFWVH
Sbjct  154   NGYKNALYMIDIGQNDLLLALYDSNLTYTPVVEKIPSMLLEIKKVIQTVYLYGGRKFWVH  213

Query  657   NTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATI  836
             NTGP+GC P+ LA     +  ++ +  GC +  NE A  FN  L  LC ELR + KD T+
Sbjct  214   NTGPLGCAPKELAIYPHNE--SDLDPIGCFRVHNEVATAFNKGLLSLCNELRSQFKDVTL  271

Query  837   VYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQSGFSVCKDGSKYIS  1010
             VYVDIY+IKY L ++   YGF +PLMACCG GG P  Y+   +CGQ G ++C++ +K I 
Sbjct  272   VYVDIYSIKYKLSADFNRYGFVDPLMACCGYGGRPNNYDRKATCGQPGSTICRNVTKAIV  331

Query  1011  WDGVHYTEDANAMVAASVLSTNYSTPPFNFDYF  1109
             WDGVHYTE AN  V  +VL+  YS P  + D F
Sbjct  332   WDGVHYTEAANRFVVDAVLTNRYSYPKISLDGF  364



>ref|XP_006402391.1| hypothetical protein EUTSA_v10006046mg [Eutrema salsugineum]
 gb|ESQ43844.1| hypothetical protein EUTSA_v10006046mg [Eutrema salsugineum]
Length=365

 Score =   342 bits (876),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 170/326 (52%), Positives = 220/326 (67%), Gaps = 7/326 (2%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLS  302
             P++ NFGDSNSDTGG  A  G   G P G TFFHR + RL DGRLIIDFLCE++K  YLS
Sbjct  35    PILINFGDSNSDTGGVLAGVGLPIGLPHGITFFHRGTGRLGDGRLIIDFLCEHLKMTYLS  94

Query  303   PYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGE  482
             PYL++L+P+FK GVNFA+ G+  LP F  F L+ Q+ QF RF+ R  E  + G   ++ +
Sbjct  95    PYLDSLSPNFKRGVNFAVSGATALPVFS-FPLAVQIRQFIRFKNRCQELITSGRRDLIDD  153

Query  483   EDFENALYMIDIGQNDIAGAF--SYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVH  656
             + F+NALYMIDIGQND+  A   S L+   V+EKIP  + EI+ A+  ++  GGRKFWVH
Sbjct  154   KGFKNALYMIDIGQNDLLLALYDSNLTYTSVVEKIPPMLLEIQKAIQTVHLYGGRKFWVH  213

Query  657   NTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATI  836
             NTGP+GC P+ LA     D  ++ +  GC +  N+ A+ FN  L  L +E+R + KDAT+
Sbjct  214   NTGPLGCAPKELAINPHND--SDLDPIGCFRVHNDVAKAFNKGLFSLIKEMRSQFKDATL  271

Query  837   VYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQSGFSVCKDGSKYIS  1010
             VYVDIY+IKY L  +   YGF +PLMACCG GG P  Y+   +CGQ G ++C+D +K I 
Sbjct  272   VYVDIYSIKYKLSQDFKRYGFVDPLMACCGYGGKPNNYDRKATCGQPGSTICRDVTKAIV  331

Query  1011  WDGVHYTEDANAMVAASVLSTNYSTP  1088
             WDGVHYTE AN  V  +VLS  YS P
Sbjct  332   WDGVHYTEAANRFVVDAVLSNRYSYP  357



>emb|CDX67886.1| BnaA07g19260D [Brassica napus]
Length=365

 Score =   338 bits (868),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 165/335 (49%), Positives = 222/335 (66%), Gaps = 7/335 (2%)
 Frame = +3

Query  117   RNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADY  296
             + P++ NFG+SNSDTGG  A  G   G P G TFFH+ + RL DGRLI+DF CE++K  Y
Sbjct  33    KKPILINFGNSNSDTGGVLAGVGLPIGLPHGITFFHKGTGRLGDGRLILDFFCEHLKMPY  92

Query  297   LSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGML  476
             LSPYL++L+P+FK GVNFA+ G+  LP F  F L+ Q+ Q+  F+ RS E  S G   ++
Sbjct  93    LSPYLDSLSPNFKRGVNFAVSGATALPMFS-FPLAVQIRQYVHFKNRSQELISSGKRDLI  151

Query  477   GEEDFENALYMIDIGQNDIAGAF--SYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFW  650
              +  F+NALYMIDIGQND+  A   S L+   V+EKIP  + EIK A+  +Y  GGRKFW
Sbjct  152   DDNGFKNALYMIDIGQNDLLQALYNSNLTYTTVVEKIPPMLLEIKKAIQTVYLYGGRKFW  211

Query  651   VHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDA  830
             VHNTGP+GC P+ LA     +  ++ +  GC +  N+ A+ FN  L  L  E+R ++KDA
Sbjct  212   VHNTGPLGCAPKELAINPHNE--SDLDPIGCFRVHNDVAKTFNKGLFSLVNEMRAQLKDA  269

Query  831   TIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQSGFSVCKDGSKY  1004
             T+VY+DIY+IKY L ++S  YGF +PLMACCG GG P  Y+   +CGQ G ++C+D +K 
Sbjct  270   TLVYIDIYSIKYKLSADSKRYGFVDPLMACCGFGGRPNNYDRKATCGQPGSTICRDVTKA  329

Query  1005  ISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYF  1109
             + WDGVHYTE AN  V  ++LS  Y+ P      F
Sbjct  330   VVWDGVHYTEAANRFVVDAILSNRYTYPKIPLSRF  364



>ref|XP_004968676.1| PREDICTED: GDSL esterase/lipase At1g09390-like isoform X1 [Setaria 
italica]
 ref|XP_004968677.1| PREDICTED: GDSL esterase/lipase At1g09390-like isoform X2 [Setaria 
italica]
Length=444

 Score =   338 bits (868),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 163/323 (50%), Positives = 218/323 (67%), Gaps = 5/323 (2%)
 Frame = +3

Query  126   VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSP  305
             VIFNFGDSNSDTGG  A +G     P+GRTFF R + RL DGRL+IDF+CE++   YLSP
Sbjct  108   VIFNFGDSNSDTGGMAAVNGMNINLPEGRTFFRRPTGRLSDGRLVIDFICESLHTPYLSP  167

Query  306   YLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEE  485
             YL+AL   F+NGVNFAIGGS   P    FSL  QL Q+  FR RS+E  + G    +  +
Sbjct  168   YLKALGADFRNGVNFAIGGSTATPGGSPFSLDVQLHQWLYFRARSMEMINLGQRPPIDRD  227

Query  486   DFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTG  665
              F  A+Y IDIGQND++ A+ +L   QV+ KIP+ +++IK  +  +Y  G RKFW+H TG
Sbjct  228   GFRRAIYTIDIGQNDLS-AYMHLPFDQVVAKIPAIVAQIKYTIETLYAHGARKFWIHGTG  286

Query  666   PVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYV  845
              +GCLP+ LA    RD N + +  GC+K+ N AA+ FN +L++   +LR    DA +V+V
Sbjct  287   ALGCLPQKLAIP--RDDNADLDAHGCLKTYNAAARRFNAQLAEALAQLRRRTVDAALVFV  344

Query  846   DIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNAN--ISCGQSGFSVCKDGSKYISWDG  1019
             D+Y IKY+L++N   +G   PLMACCG GG PYN N   +C  +   +C  G+++ISWDG
Sbjct  345   DMYAIKYDLVANHTAHGIARPLMACCGYGGPPYNYNHFKACMSAEMQLCDVGARFISWDG  404

Query  1020  VHYTEDANAMVAASVLSTNYSTP  1088
             VH+TE ANA+VAA VL+ +YSTP
Sbjct  405   VHFTEAANAIVAAKVLTGDYSTP  427



>ref|XP_006354219.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Solanum tuberosum]
Length=296

 Score =   333 bits (854),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/282 (56%), Positives = 209/282 (74%), Gaps = 4/282 (1%)
 Frame = +3

Query  276   ENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHS  455
             E+V   YL+P++E++  +F NGVNFAI GS+TLP+   F+L  Q  QF+RF++ SLE  +
Sbjct  12    ESVGNGYLTPFMESIGKNFTNGVNFAIAGSKTLPRLDSFNLHIQFAQFHRFQSLSLELFN  71

Query  456   KGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVG  635
             KG   +LG++D  NALY IDIGQND+ G F  L   + I KIP  ISEI++ + AIY+ G
Sbjct  72    KGDGNLLGDKDLRNALYTIDIGQNDLDGIFGGLIYEKAILKIPDIISEIENVIKAIYEQG  131

Query  636   GRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRH  815
             G+ FWVHNTGP+GCLP++LAT K  +   +++E GC+ SLNE A+ FN KL  +CE+LR 
Sbjct  132   GKNFWVHNTGPLGCLPKSLATYKKNE--NDYDENGCLISLNEGAKIFNNKLQLICEKLRD  189

Query  816   EMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN--ANISCGQSGFSVCK  989
             EMK+ TIVYVDIY+IKY+LI+NS+ YGF NPLM CCG GG PYN  +N  CGQ  +++C+
Sbjct  190   EMKNITIVYVDIYSIKYDLIANSSTYGFVNPLMGCCGYGGPPYNFESNNKCGQGNYTICE  249

Query  990   DGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCS  1115
             D  KYISWDG+HYTE AN  VA+ +LST+YSTPP  F+ FC+
Sbjct  250   DRFKYISWDGIHYTEAANGFVASKILSTHYSTPPLKFNNFCN  291



>ref|XP_006645843.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Oryza brachyantha]
Length=385

 Score =   336 bits (861),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 165/327 (50%), Positives = 219/327 (67%), Gaps = 5/327 (2%)
 Frame = +3

Query  126   VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSP  305
             VIFNFGDSNSDTGG  AA G     P+GRT+F R + R+ DGRL+IDF+CE++K  +L P
Sbjct  51    VIFNFGDSNSDTGGMAAAMGMNIALPEGRTYFRRPTGRISDGRLVIDFICESLKTPHLGP  110

Query  306   YLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEE  485
             Y+++L   F NGVNFAIGGS   P    FSL  QL QF  FR RS+E  ++G    +  +
Sbjct  111   YMKSLGSDFSNGVNFAIGGSTATPGGSTFSLDVQLHQFLYFRARSMELINQGVRTPIDRD  170

Query  486   DFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTG  665
              F NA+Y IDIGQND++ A+ +L   QV+ KIP+ ++ IK  + A+Y  GGRKFWVH TG
Sbjct  171   GFRNAIYAIDIGQNDVS-AYMHLPYDQVLAKIPTVVAHIKYTIEALYGHGGRKFWVHGTG  229

Query  666   PVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYV  845
              +GCLP+ L+    RD + + +  GC+ + N AA+EFN +L+  C  LR  M DA +V+ 
Sbjct  230   ALGCLPQKLSIP--RDDDGDLDGNGCLSTYNAAAREFNAQLAAACGRLRQRMADAAVVFT  287

Query  846   DIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNAN--ISCGQSGFSVCKDGSKYISWDG  1019
             D+Y IKY+L++N++ +G E PLMACCG GG PYN N    C  +   +C   +++ SWDG
Sbjct  288   DVYPIKYDLVANASRHGIERPLMACCGNGGPPYNYNHFKMCMSAEMELCDMDARFASWDG  347

Query  1020  VHYTEDANAMVAASVLSTNYSTPPFNF  1100
             VHYTE ANA+VAA VLS  YSTPP   
Sbjct  348   VHYTEAANAIVAAKVLSGEYSTPPVRL  374



>gb|AAC23651.1| lipase homolog, partial [Arabidopsis thaliana]
Length=301

 Score =   332 bits (851),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 166/304 (55%), Positives = 218/304 (72%), Gaps = 11/304 (4%)
 Frame = +3

Query  141   GDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEAL  320
             GDSNSDTGG  A  G   G+P+GR FF RS+ RL DGRL+IDFLC+++    L PYL++L
Sbjct  1     GDSNSDTGGLVAGLGYPIGFPNGRLFFRRSTGRLSDGRLLIDFLCQSLNTSLLRPYLDSL  60

Query  321   TPS-FKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTN--GM-LGEED  488
               + F+N  NFAI GS TLPK V FSL+ Q+ QF+ F++RSLE  S   +  GM +    
Sbjct  61    GRTRFQNVANFAIAGSSTLPKNVPFSLNIQVKQFSHFKSRSLELASSSNSLKGMFISNNG  120

Query  489   FENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTG  665
             F+NALYMIDIGQNDIA +F+   S +Q ++ IP  I+EIK ++  +Y   GR+FW+HNTG
Sbjct  121   FKNALYMIDIGQNDIALSFARGNSYSQTVKLIPQIITEIKSSIKRLYDEEGRRFWIHNTG  180

Query  666   PVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYV  845
             P+GCLP+ L+  K +D     ++ GC+ S N AA  FN  L  +CEELR E++DATI+Y+
Sbjct  181   PLGCLPQKLSMVKSKD----LDQLGCLVSYNSAATLFNQGLDHMCEELRTELRDATIIYI  236

Query  846   DIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNAN--ISCGQSGFSVCKDGSKYISWDG  1019
             DIY IKY+LI+NS  YGF++PLMACCG GG PYN N  I+CG  G +VCK+GS++ISWDG
Sbjct  237   DIYAIKYSLIANSNQYGFKSPLMACCGYGGTPYNYNVKITCGHKGSNVCKEGSRFISWDG  296

Query  1020  VHYT  1031
             +HYT
Sbjct  297   IHYT  300



>ref|XP_002455576.1| hypothetical protein SORBIDRAFT_03g013350 [Sorghum bicolor]
 gb|EES00696.1| hypothetical protein SORBIDRAFT_03g013350 [Sorghum bicolor]
Length=425

 Score =   333 bits (854),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/333 (51%), Positives = 222/333 (67%), Gaps = 5/333 (2%)
 Frame = +3

Query  126   VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSP  305
             +IFNFGDSNSDTGG  A +G     P+GRTFF R + RL DGRL+IDF+CE++   YLSP
Sbjct  90    IIFNFGDSNSDTGGMAAVNGMNLNLPEGRTFFRRPTGRLSDGRLVIDFICESLHTPYLSP  149

Query  306   YLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEE  485
             YL+AL   F NGVNFAIGGS   P    FSL  QL Q+  FR RS+E  + G    +  E
Sbjct  150   YLKALGADFSNGVNFAIGGSTATPGGSPFSLDVQLHQWLYFRARSMEMINLGQRPPIDRE  209

Query  486   DFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTG  665
              F  A+Y IDIGQND++ A+ +L   QV+ KIP F++ IK  +  +Y  G RKFW+H TG
Sbjct  210   GFRKAIYTIDIGQNDVS-AYMHLPYDQVLAKIPGFVAHIKYTIETLYSHGARKFWIHGTG  268

Query  666   PVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYV  845
              +GCLP+ LA    RD +T+ +  GC+ + N AA+ FN  LSD C +LR  M DA +V+V
Sbjct  269   ALGCLPQKLAIP--RDDDTDLDAHGCLNTYNAAAKRFNALLSDACAQLRRRMVDAALVFV  326

Query  846   DIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNAN--ISCGQSGFSVCKDGSKYISWDG  1019
             D+YTIKY+L++N  ++G E PLMACCG GG PYN N   +C  +   +C  G+++ISWDG
Sbjct  327   DMYTIKYDLVANHTMHGIEKPLMACCGYGGPPYNYNHFKACMSAEMQLCDVGTRFISWDG  386

Query  1020  VHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
             VH TE ANA+VAA VL+ +YSTP    D   ++
Sbjct  387   VHLTEAANAVVAAKVLTGDYSTPRVTIDRLVNS  419



>dbj|BAK01974.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=437

 Score =   332 bits (852),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 163/327 (50%), Positives = 215/327 (66%), Gaps = 6/327 (2%)
 Frame = +3

Query  117   RNPV-IFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKAD  293
             R+PV IFNFGDSNSDTGG  AA G     P+GRT+F R + RL DGRL+IDF+CE++   
Sbjct  98    RSPVVIFNFGDSNSDTGGMAAASGLNIALPEGRTYFRRPTGRLSDGRLVIDFICESLNTP  157

Query  294   YLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGM  473
             +LSPYL+AL   F NG NFAIGGS   P    FSL  QL QF  FRTRS E  +KG    
Sbjct  158   HLSPYLKALGSDFSNGANFAIGGSTATPGGSPFSLDVQLHQFLYFRTRSFELLNKGERTP  217

Query  474   LGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWV  653
             +  + F NA+Y +DIG ND++ A+ +L   QV+ KIPS +  IK  +  +Y  G RKFW+
Sbjct  218   IDRDGFRNAIYAMDIGHNDLS-AYLHLPYDQVLAKIPSIVGHIKFGIETLYAHGARKFWI  276

Query  654   HNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDAT  833
             H TG +GCLP+ L+    RD +++ +  GC+K  N  A+ FN KL++ C +LR  M DAT
Sbjct  277   HGTGALGCLPQKLSIP--RDDDSDLDGNGCLKKYNNVAKAFNAKLAETCNQLRQRMADAT  334

Query  834   IVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNAN--ISCGQSGFSVCKDGSKYI  1007
             IV+ D++ IKY+L++N   YG E PLMACCG GG P+N N    C      +C   +++I
Sbjct  335   IVFTDLFAIKYDLVANHTKYGVERPLMACCGNGGPPHNYNHFKMCMSGEMQLCDMDARFI  394

Query  1008  SWDGVHYTEDANAMVAASVLSTNYSTP  1088
             SWDGVH+TE ANA+VA+ +L+  YS P
Sbjct  395   SWDGVHFTEFANAIVASKLLTGEYSKP  421



>ref|XP_003565731.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Brachypodium 
distachyon]
Length=425

 Score =   331 bits (849),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 165/327 (50%), Positives = 218/327 (67%), Gaps = 6/327 (2%)
 Frame = +3

Query  117   RNPV-IFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKAD  293
             R+PV IFNFGDSNSDTGG  AA G     P+GRT+F R + RL DGRL+IDF+CE++   
Sbjct  85    RSPVVIFNFGDSNSDTGGMAAAKGLNINLPEGRTYFRRPTGRLSDGRLVIDFICESLNTP  144

Query  294   YLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGM  473
             +LSPYL+AL   F+NGVNFAIGGS   P    FSL  QL QF  FRTRS E   KG    
Sbjct  145   HLSPYLKALGSDFRNGVNFAIGGSTATPGGSPFSLDVQLHQFLYFRTRSFELLHKGERTP  204

Query  474   LGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWV  653
             +  E F NA+Y IDIG ND++ A+ +L   QV+ KIPS I+ IK ++  +Y  G RKFW+
Sbjct  205   IDHEGFRNAIYAIDIGHNDLS-AYLHLPYDQVLAKIPSIIAPIKFSIETLYAHGARKFWI  263

Query  654   HNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDAT  833
             H TG +GCLP+ L+    RD +++ +  GC+ + N  A+ FN KLS+ C  LR+ M DAT
Sbjct  264   HGTGALGCLPQKLSIP--RDDDSDLDANGCLTTYNAVAKAFNGKLSESCGLLRNRMADAT  321

Query  834   IVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNAN--ISCGQSGFSVCKDGSKYI  1007
             IV+ D++ IKY+L++N   YG E PLMACCG GG PYN N    C      +C   +++I
Sbjct  322   IVFTDLFAIKYDLVANHTRYGIEKPLMACCGNGGPPYNYNHFKMCMSGEMQLCDIDARFI  381

Query  1008  SWDGVHYTEDANAMVAASVLSTNYSTP  1088
             +WDGVH TE AN+++A+ +L+ +YS P
Sbjct  382   NWDGVHLTEVANSIIASKLLTGDYSKP  408



>ref|XP_010481241.1| PREDICTED: GDSL esterase/lipase LIP-4, partial [Camelina sativa]
Length=292

 Score =   323 bits (827),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 159/294 (54%), Positives = 210/294 (71%), Gaps = 11/294 (4%)
 Frame = +3

Query  252   RLIIDFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRF  428
             RL+IDF C+++    L PYL++L  + F+NG NFAI GS TLPK V FSLS QL+QF+ F
Sbjct  1     RLLIDFFCQSLNTSLLRPYLDSLGGTRFQNGANFAIVGSATLPKNVPFSLSIQLMQFSHF  60

Query  429   RTRSLEFHSKGTN--GM-LGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFIS  596
             ++RSLE  S   +  GM + E  F+NALYMIDIGQNDI+ +F+   S +Q ++ IP  +S
Sbjct  61    KSRSLELASSSNSLKGMYISENGFKNALYMIDIGQNDISHSFAEGNSYSQTVKLIPQIVS  120

Query  597   EIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEF  776
             EI+  +  +Y  GGR+FW+HNTGP+GCLP+ L+  K +D     ++ GC+ S N AA+ F
Sbjct  121   EIQSGIMRLYNEGGRRFWIHNTGPLGCLPQKLSMVKSKD----LDQHGCLASYNSAAKLF  176

Query  777   NVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNA  950
             N +L  +CEELR ++KDATI+YVDIYTIKY+LI+NS  YGF  PLMACCG  G P  YN 
Sbjct  177   NQRLDHMCEELRSQLKDATIIYVDIYTIKYSLIANSNEYGFGRPLMACCGYEGTPYNYNV  236

Query  951   NISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             NI+CG  G +VC  GS+++SWDG+HYTE ANA+VA  VLS +YS P   F +FC
Sbjct  237   NITCGHKGSNVCDKGSRFVSWDGIHYTETANAIVAMKVLSMHYSKPSTPFHFFC  290



>gb|EAY73827.1| hypothetical protein OsI_01703 [Oryza sativa Indica Group]
Length=419

 Score =   325 bits (833),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 163/327 (50%), Positives = 209/327 (64%), Gaps = 22/327 (7%)
 Frame = +3

Query  126   VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSP  305
             VIFNFGDSNSDTGG  AA G     P+GRT+F R + R+ DGRL+IDF+CE++   +LSP
Sbjct  100   VIFNFGDSNSDTGGMAAAMGLNIALPEGRTYFRRPTGRISDGRLVIDFICESLNTPHLSP  159

Query  306   YLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEE  485
             YL++L   F NGVNFAIGGS   P    FSL  QL QF  FRTRS+E  ++G    +  +
Sbjct  160   YLKSLGSDFSNGVNFAIGGSTATPGGSTFSLDVQLHQFLYFRTRSIELINQGVRTPIDRD  219

Query  486   DFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTG  665
              F NA+Y IDIGQND+A A+  L   Q                 A+Y  GGRKFWVH TG
Sbjct  220   GFRNAIYTIDIGQNDLA-AYMNLPYDQ-----------------ALYGHGGRKFWVHGTG  261

Query  666   PVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYV  845
              +GCLP+ L+    RD +++ +  GC+K+ N AA+EFN +L   C  LR  M DA +V+ 
Sbjct  262   ALGCLPQKLSIP--RDDDSDLDGNGCLKTYNAAAREFNAQLGAACRRLRQRMADAAVVFT  319

Query  846   DIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNAN--ISCGQSGFSVCKDGSKYISWDG  1019
             D+Y  KY+L++N  ++G E PLMACCG GG PYN N    C  +   +C  G+++ SWDG
Sbjct  320   DVYAAKYDLVANHTLHGIERPLMACCGNGGPPYNYNHFKMCMSAEMELCDMGARFASWDG  379

Query  1020  VHYTEDANAMVAASVLSTNYSTPPFNF  1100
             VHYTE ANA+VAA VL+  YSTPP  F
Sbjct  380   VHYTEAANAIVAARVLTGEYSTPPVRF  406



>gb|EAZ11710.1| hypothetical protein OsJ_01572 [Oryza sativa Japonica Group]
Length=419

 Score =   325 bits (832),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 163/327 (50%), Positives = 209/327 (64%), Gaps = 22/327 (7%)
 Frame = +3

Query  126   VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSP  305
             VIFNFGDSNSDTGG  AA G     P+GRT+F R + R+ DGRL+IDF+CE++   +LSP
Sbjct  100   VIFNFGDSNSDTGGMAAAMGLNIALPEGRTYFRRPTGRISDGRLVIDFICESLNTPHLSP  159

Query  306   YLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEE  485
             YL++L   F NGVNFAIGGS   P    FSL  QL QF  FRTRS+E  ++G    +  +
Sbjct  160   YLKSLGSDFSNGVNFAIGGSTATPGGSTFSLDVQLHQFLYFRTRSIELINQGVRTPIDRD  219

Query  486   DFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTG  665
              F NA+Y IDIGQND+A A+  L   Q                 A+Y  GGRKFWVH TG
Sbjct  220   GFRNAIYTIDIGQNDLA-AYMNLPYDQ-----------------ALYGHGGRKFWVHGTG  261

Query  666   PVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYV  845
              +GCLP+ L+    RD +++ +  GC+K+ N AA+EFN +L   C  LR  M DA +V+ 
Sbjct  262   ALGCLPQKLSIP--RDDDSDLDGNGCLKTYNAAAREFNAQLGAACRRLRQRMADAAVVFT  319

Query  846   DIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNAN--ISCGQSGFSVCKDGSKYISWDG  1019
             D+Y  KY+L++N  ++G E PLMACCG GG PYN N    C  +   +C  G+++ SWDG
Sbjct  320   DVYAAKYDLVANHTLHGIERPLMACCGNGGPPYNYNHFKMCMSAEMELCDMGARFASWDG  379

Query  1020  VHYTEDANAMVAASVLSTNYSTPPFNF  1100
             VHYTE ANA+VAA VL+  YSTPP  F
Sbjct  380   VHYTEAANAIVAARVLTGEYSTPPVRF  406



>ref|XP_010666891.1| PREDICTED: uncharacterized protein LOC104884004 [Beta vulgaris 
subsp. vulgaris]
Length=788

 Score =   331 bits (848),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/334 (49%), Positives = 221/334 (66%), Gaps = 6/334 (2%)
 Frame = +3

Query  126   VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSP  305
             ++FNFGDSNSD G   A  G   G P G+ FFHR + R C+GRL IDF+C+++  D LS 
Sbjct  453   ILFNFGDSNSDPGALMAVLGLYLGPPSGQQFFHRPTGRFCNGRLYIDFICQSLNIDLLSA  512

Query  306   YLEALTPSFKNGVNFAIGGSQT-LPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGE  482
             YLE+    F +GVNFA+ G+ T +  +  FSLSTQ  Q+  F+ R+ E   +G   M+ E
Sbjct  513   YLESSGSDFTHGVNFAVSGASTEVSLYNPFSLSTQAGQYGHFQNRTRELRRRGKGSMINE  572

Query  483   EDFENALYMIDIGQNDIAGAFSYLSKAQ-VIEKIPSFISEIKDAVWAIYKVGGRKFWVHN  659
             ++F NA+Y IDIGQNDI  A    S  Q V+ KIP  +  I+++  A+YK+G RKFW++N
Sbjct  573   KEFRNAVYSIDIGQNDINLALVANSSYQEVVNKIPIILERIENSTKALYKIGARKFWIYN  632

Query  660   TGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIV  839
             TGP+GCLP+TLA  K  D  +E +E GC+   N AA+ FN  LS LC+++R E+ DA +V
Sbjct  633   TGPLGCLPQTLALRKKND--SELDELGCLALYNNAAKAFNEGLSKLCDKIRSELVDAFVV  690

Query  840   YVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN--ANISCGQSGFSVCKDGSKYISW  1013
             ++D+Y IKY+L +N   YGFE PLMACCG GG PYN     +CG+   + C D S+ +SW
Sbjct  691   HIDMYAIKYDLFANPVRYGFEKPLMACCGTGGPPYNYVNKKTCGEPTATACADPSRSVSW  750

Query  1014  DGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCS  1115
             DGVHYTE ANA++A+ +LS  +S P F    FC+
Sbjct  751   DGVHYTEAANAVIASKILSGEFSKPLFRLKSFCT  784


 Score =   330 bits (847),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 173/368 (47%), Positives = 236/368 (64%), Gaps = 18/368 (5%)
 Frame = +3

Query  90    PPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDF  269
             P L+ A+   N ++FNFGDSN+D G   AA G   G P G+ FFHR + R C+GRL IDF
Sbjct  25    PALSLAQ--SNCILFNFGDSNTDPGALIAAFGLYLGPPTGQQFFHRPTGRFCNGRLYIDF  82

Query  270   LCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTL-----PKFVLFSLSTQLLQFNRFRT  434
             +C++++ ++LS YLE+    F  GVNFA+ G+ T+     P    FSLSTQ  QF  F+ 
Sbjct  83    ICQSLEINFLSAYLESSGSEFSYGVNFAVSGASTVVSGNNP----FSLSTQTGQFRHFQN  138

Query  435   RSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQ-VIEKIPSFISEIKDA  611
             R+ E   +G   ++ EE+F NA+Y IDIGQNDI  AF   S  Q VI  IPS +  I+++
Sbjct  139   RTRELREQGEGSVISEENFRNAIYSIDIGQNDITLAFRANSSYQHVINTIPSILERIEES  198

Query  612   VWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLS  791
             + A+Y++G RKFWV+NTGP+GCLP+TLA  K  D  +E +E GC++  N AA+ FN  L 
Sbjct  199   MKALYRLGARKFWVYNTGPIGCLPQTLALQKKND--SEVDELGCLRVYNNAAKAFNEGLR  256

Query  792   DLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN--ANISCG  965
             +LC+++R E+ DA IV+ D++ IKY+L +N   YGFENPLMACCG GG PYN     +CG
Sbjct  257   NLCDKIRSELHDAIIVHTDMFAIKYDLFANPGKYGFENPLMACCGKGGPPYNYVDKKACG  316

Query  966   QS-GFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCSTNS*LRYQI  1142
             +S   + C D S+ + WDGVHYTE ANA+ A+ +LS  YS P    +  C     L YQ+
Sbjct  317   RSPSVTACSDPSRSVIWDGVHYTEAANAVTASKILSGEYSEPFIRLESLCGGYI-LYYQL  375

Query  1143  RSAPTPYN  1166
              + P   N
Sbjct  376   VAIPACLN  383



>ref|XP_010278961.1| PREDICTED: GDSL esterase/lipase At1g54790-like [Nelumbo nucifera]
Length=382

 Score =   318 bits (816),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 172/361 (48%), Positives = 231/361 (64%), Gaps = 21/361 (6%)
 Frame = +3

Query  72    FLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAH-GNIFGYPDGRTFFHRSSDRLCD  248
              + L S PLA       P +FNFGDSNSDTGG  AA  G     P+G+T+FH+ S R CD
Sbjct  13    LIFLFSSPLAETIDFSYPAVFNFGDSNSDTGGLVAAGIGESLDPPNGQTYFHKPSGRFCD  72

Query  249   GRLIIDFLCENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLP----KFVLFSLSTQLL  413
             GRLIIDFL + +   +L+ YL+++ TP+F+ G NFA  GS  LP        FS   Q+ 
Sbjct  73    GRLIIDFLMDAMDLPFLNAYLDSVGTPTFQKGCNFAAAGSTILPATASSVSPFSFGIQVA  132

Query  414   QFNRFRTRSLEF--HSKGTNGMLGEED-FENALYMIDIGQNDIAGAFSYLSKAQVIEKIP  584
             QF RF+ R LE    SK  N  L  E  F  +LYM DIGQND+AGAF   ++ QVI  IP
Sbjct  133   QFFRFKARVLELLSKSKKPNKYLPLEGYFNQSLYMFDIGQNDLAGAFYSKTEDQVIASIP  192

Query  585   SFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEA  764
             + + E +  +  +Y  G R+FWVHNTGP+GCLP+ +AT   +DP ++ +E GC+ S N A
Sbjct  193   TILLEFEAGIKRLYDQGARRFWVHNTGPLGCLPQNIATFG-KDP-SKLDELGCVSSHNRA  250

Query  765   AQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP-  941
             A+ FN++L  LC +L+ +  DA I YVD+++IK NLI+N + YGFE P+M CCG GGAP 
Sbjct  251   AKLFNLQLHALCRKLQGQFIDANITYVDVFSIKVNLIANYSRYGFEQPIMTCCGYGGAPL  310

Query  942   -YNANISCGQS----GFSV----CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPF  1094
              Y+  ISCGQ+    G SV    C D ++Y++WDG+HYTE AN  V++ +L+  YS PPF
Sbjct  311   NYDIRISCGQTKTLNGSSVTAKGCNDTTEYVNWDGIHYTEAANQYVSSQILTGKYSDPPF  370

Query  1095  N  1097
             +
Sbjct  371   S  371



>ref|XP_003568872.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Brachypodium 
distachyon]
Length=438

 Score =   318 bits (816),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/323 (47%), Positives = 208/323 (64%), Gaps = 4/323 (1%)
 Frame = +3

Query  126   VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSP  305
             V+FNFGDSNSDTGG  A  G     P+GR FFH  + RL DGR+++DF+CE +   +LSP
Sbjct  102   VVFNFGDSNSDTGGVAAIMGIRIASPEGRAFFHHPTGRLSDGRVVLDFICETLNTHHLSP  161

Query  306   YLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEE  485
             Y++ L   + NGVNFAI GS   P    FSL  Q+ QF  F+ R  +   +G    +   
Sbjct  162   YMKPLGSDYTNGVNFAIAGSTATPGDTPFSLDVQIDQFIFFQDRCNDSTERGETFPIEMR  221

Query  486   DFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTG  665
             DF NALY +DIGQND+ G   YL   +V+EK+P F++EI+ A+  ++K G RKFW+H TG
Sbjct  222   DFGNALYTMDIGQNDVTGIL-YLPYDKVLEKLPHFVAEIRKAIEILHKNGARKFWIHGTG  280

Query  666   PVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYV  845
              +GCLP+ LA    +D +   +E GCI   N AA++FN  LS+ C++LR  +K +TI++V
Sbjct  281   ALGCLPQKLAMHG-KDADLSLDEHGCIIKFNNAAKKFNELLSEACDDLRLNLKKSTIIFV  339

Query  846   DIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN--ANISCGQSGFSVCKDGSKYISWDG  1019
             D++ IKY+L++N   YG E PLM CCG GG PYN     SC  +   +CK   K+ISWDG
Sbjct  340   DMFAIKYDLVANHTKYGIEKPLMTCCGHGGPPYNYDPKRSCMGTDMDLCKPSEKFISWDG  399

Query  1020  VHYTEDANAMVAASVLSTNYSTP  1088
             VH+T+ AN+MVA   +S  YS P
Sbjct  400   VHFTDAANSMVATMAISGEYSIP  422



>gb|KDP23550.1| hypothetical protein JCGZ_23383 [Jatropha curcas]
Length=382

 Score =   316 bits (809),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 166/372 (45%), Positives = 233/372 (63%), Gaps = 21/372 (6%)
 Frame = +3

Query  39    AAMFVFITCSAFLVLSSPPLAAAECIRN-PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRT  215
             AA    +   A L    PPL A     N P +FNFGDSNSDTG   A  G +   P+G+ 
Sbjct  2     AARIYAVHLLALLFFIIPPLKAKSIDFNYPAVFNFGDSNSDTGDLVAGLGILLESPNGQF  61

Query  216   FFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLPKFVL-  389
             +F   S R CDGRLI+DFL + +   +L+ YLE++  P+F+ G NFA  GS+ LP     
Sbjct  62    YFKTPSGRFCDGRLIVDFLMDAMDLPFLNAYLESVGLPNFRKGCNFAAAGSKILPATATS  121

Query  390   ---FSLSTQLLQFNRFRTRSLEFHSKGT--NGMLGEED-FENALYMIDIGQNDIAGAFSY  551
                FSL  Q+ QF RF+ R+LE  +KG   +  L  ED F+NALYM DIGQND+AGAF  
Sbjct  122   VSPFSLGVQVNQFLRFKARALELIAKGRKFDKYLPTEDYFQNALYMFDIGQNDLAGAFYS  181

Query  552   LSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFE  731
              +  Q++  IP+ + E +  +  +Y  G RKFW+HNTGP+GCLP+ +A     DP ++ +
Sbjct  182   QTFDQIVASIPNILVEFEAGIKKLYDQGARKFWIHNTGPLGCLPQNVAKFGT-DP-SKLD  239

Query  732   ETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPL  911
             + GC+   N+AA+ FN++L  LC++L+ +  D+ + YVDIYTIK NLI+N + YGFE P+
Sbjct  240   DLGCVSGHNQAAKLFNLQLHALCKKLQDQYTDSNVTYVDIYTIKSNLIANYSRYGFEQPI  299

Query  912   MACCGGGGAP--YNANISCGQS--------GFSVCKDGSKYISWDGVHYTEDANAMVAAS  1061
             MACCG GG P  Y++ I+CGQ+            C D ++Y++WDG+HYTE AN  V++ 
Sbjct  300   MACCGYGGPPLNYDSRINCGQTKVLNGTTVSVKACDDSTEYVNWDGIHYTEAANQYVSSQ  359

Query  1062  VLSTNYSTPPFN  1097
             +L+  YS PPF+
Sbjct  360   ILTGKYSDPPFS  371



>ref|XP_006344805.1| PREDICTED: GDSL esterase/lipase At1g09390-like isoform X2 [Solanum 
tuberosum]
Length=321

 Score =   313 bits (801),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 156/291 (54%), Positives = 210/291 (72%), Gaps = 4/291 (1%)
 Frame = +3

Query  36   RAAMFVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRT  215
            +A+ ++ +  S  L   S P+ + +C   PVIFNFGDSNSDTGG  A  G     P+GRT
Sbjct  12   QASAYIILFISFILSSFSNPVQS-QCKNRPVIFNFGDSNSDTGGLVAGLGYPINLPNGRT  70

Query  216  FFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFS  395
            FF RS+ RL DGRLI+DFLC++V   +LSPYL+++  SF NG NFAI GS+ LPK+  F+
Sbjct  71   FFRRSTGRLSDGRLILDFLCQSVNTRFLSPYLDSVGSSFLNGANFAIAGSRLLPKYEPFA  130

Query  396  LSTQLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFS-YLSKAQVI  572
            L+ Q+LQF  F+ RS+E  S G+  ++GEE F NAL+MIDIGQND+A +F+  LS  +V+
Sbjct  131  LNIQVLQFLHFKGRSIELVSAGSGNLVGEEGFRNALFMIDIGQNDLADSFANNLSYTEVV  190

Query  573  EKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKS  752
            + IPSF++EI++A+  +Y  GGRKFWVHNTGP+GCLP+ L  T V+  +++ +  GC+ +
Sbjct  191  KMIPSFVTEIRNAIQVMYSQGGRKFWVHNTGPLGCLPQKL--TLVQKVSSDLDPHGCLAN  248

Query  753  LNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFEN  905
             N AA+ FN  L  L +ELR EMKDATIVYVDIY IKY+LI+NS+ YGF N
Sbjct  249  YNSAAKLFNEGLRHLLQELRSEMKDATIVYVDIYAIKYDLIANSSSYGFFN  299



>dbj|BAJ90505.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=437

 Score =   316 bits (810),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/340 (46%), Positives = 212/340 (62%), Gaps = 8/340 (2%)
 Frame = +3

Query  84    SSPPLAAAECIRNP---VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGR  254
              +P  AAA+    P   V+FNFGDSNSDTGG  A  G     P+GR FFH  + RL DGR
Sbjct  85    QAPTKAAAKVATKPKEVVVFNFGDSNSDTGGVAAIMGIRIAPPEGRAFFHHPTGRLSDGR  144

Query  255   LIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRT  434
             +++DF+CE +   +LSPY++ L   + NGVNFAI G+   P    FSL  Q+ QF  +R 
Sbjct  145   VVLDFICETLNTHHLSPYMKPLGSDYSNGVNFAIAGATATPGDTPFSLDVQIDQFVFYRD  204

Query  435   RSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAV  614
             R  E  ++     L   DFE ALY +DIGQNDI     YL   QV+ K+P F++EI+ A+
Sbjct  205   RCNESITRDEPAPLNMLDFERALYTMDIGQNDITSIL-YLPYDQVLAKLPHFVAEIRKAI  263

Query  615   WAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSD  794
               ++K G RKFW+H TG +GCLP  LA  +  D   + +E GCI   N AA+ FN  LS+
Sbjct  264   EILHKNGARKFWIHGTGALGCLPAKLAMPRASD--GDLDEHGCIAKFNNAAKRFNTLLSE  321

Query  795   LCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN--ANISCGQ  968
              C++LR  +K ++I++VD++ IKY+L++N   +G E PLM CCG GG PYN     SC  
Sbjct  322   TCDDLRLLLKKSSIIFVDMFAIKYDLVANHTKHGIEKPLMTCCGHGGPPYNYDPKRSCMG  381

Query  969   SGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTP  1088
             S   +CK G K+ISWDGVH+T+ AN++VA+  +   YS P
Sbjct  382   SDMDLCKLGDKFISWDGVHFTDAANSIVASMAIGGEYSVP  421



>dbj|BAJ97279.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=437

 Score =   316 bits (810),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/340 (46%), Positives = 212/340 (62%), Gaps = 8/340 (2%)
 Frame = +3

Query  84    SSPPLAAAECIRNP---VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGR  254
              +P  AAA+    P   V+FNFGDSNSDTGG  A  G     P+GR FFH  + RL DGR
Sbjct  85    QAPTKAAAKVATKPKEVVVFNFGDSNSDTGGVAAIMGIRIAPPEGRAFFHHPTGRLSDGR  144

Query  255   LIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRT  434
             +++DF+CE +   +LSPY++ L   + NGVNFAI G+   P    FSL  Q+ QF  +R 
Sbjct  145   VVLDFICETLNTHHLSPYMKPLGSDYSNGVNFAIAGATATPGDTPFSLDVQIDQFVFYRD  204

Query  435   RSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAV  614
             R  E  ++     L   DFE ALY +DIGQNDI     YL   QV+ K+P F++EI+ A+
Sbjct  205   RCNESITRDEPAPLNMLDFERALYTMDIGQNDITSIL-YLPYDQVLAKLPHFVAEIRKAI  263

Query  615   WAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSD  794
               ++K G RKFW+H TG +GCLP  LA  +  D   + +E GCI   N AA+ FN  LS+
Sbjct  264   EILHKNGARKFWIHGTGALGCLPAKLAMPRASD--GDLDEHGCIAKFNNAAKRFNTLLSE  321

Query  795   LCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN--ANISCGQ  968
              C++LR  +K ++I++VD++ IKY+L++N   +G E PLM CCG GG PYN     SC  
Sbjct  322   TCDDLRLLLKKSSIIFVDMFAIKYDLVANHTKHGIEKPLMTCCGHGGPPYNYDPKRSCMG  381

Query  969   SGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTP  1088
             S   +CK G K+ISWDGVH+T+ AN++VA+  +   YS P
Sbjct  382   SDMDLCKLGDKFISWDGVHFTDAANSIVASMAIGGEYSVP  421



>emb|CDX95282.1| BnaC09g15880D [Brassica napus]
Length=391

 Score =   313 bits (801),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 156/289 (54%), Positives = 204/289 (71%), Gaps = 11/289 (4%)
 Frame = +3

Query  267   FLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSL  443
              L +++    L PYL++L  S F+NG NFAI GS TLP+ V FSL+ QL+QF  F++RSL
Sbjct  105   LLGQSLNTSLLRPYLDSLGESKFQNGANFAIVGSTTLPRNVPFSLNIQLMQFLHFKSRSL  164

Query  444   EFHSKG--TNGM-LGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDA  611
             E  S    + GM + E  F NALYMIDIGQNDIA +FS   S +Q ++ IP FISEIK +
Sbjct  165   ELASTSNPSKGMFISESGFRNALYMIDIGQNDIARSFSLGNSYSQTVKLIPQFISEIKTS  224

Query  612   VWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLS  791
             +  +Y  GGR+FW+HNTGP+GCLP+ L+  + +D     ++ GC+ S N AA+ FN  L 
Sbjct  225   IKRLYDEGGRRFWIHNTGPLGCLPQKLSMAQRKD----LDQHGCLASYNAAAKLFNQMLD  280

Query  792   DLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNAN--ISCG  965
              +CE+LR E++DATI+Y+DIY IKY+LI+NS  YGFE PLMACCG GG+PYN N  I+C 
Sbjct  281   HMCEKLRIELRDATIIYIDIYAIKYSLIANSKGYGFERPLMACCGYGGSPYNYNSKITCS  340

Query  966   QSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
               G +VC  GS+++SWDG+HYTE ANA+VA  VLS  YS P   FD+FC
Sbjct  341   HRGANVCDKGSRFVSWDGIHYTETANAIVAMKVLSMQYSKPKAPFDFFC  389



>ref|XP_010255785.1| PREDICTED: GDSL esterase/lipase At1g54790-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010255786.1| PREDICTED: GDSL esterase/lipase At1g54790-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010255787.1| PREDICTED: GDSL esterase/lipase At1g54790-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010255788.1| PREDICTED: GDSL esterase/lipase At1g54790-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010255789.1| PREDICTED: GDSL esterase/lipase At1g54790-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010255790.1| PREDICTED: GDSL esterase/lipase At1g54790-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010255791.1| PREDICTED: GDSL esterase/lipase At1g54790-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010255792.1| PREDICTED: GDSL esterase/lipase At1g54790-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010255793.1| PREDICTED: GDSL esterase/lipase At1g54790-like isoform X2 [Nelumbo 
nucifera]
Length=382

 Score =   312 bits (800),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 171/367 (47%), Positives = 232/367 (63%), Gaps = 24/367 (7%)
 Frame = +3

Query  57    ITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAH-GNIFGYPDGRTFFHRSS  233
             +  SAF + S  PL  A   + P +FNFGDSNSDTGG  AA  GN    P+G+T+F   S
Sbjct  9     LLASAFFLFS--PLGLAIDFKYPAVFNFGDSNSDTGGLIAAGIGNPLNPPNGQTYFLXPS  66

Query  234   DRLCDGRLIIDFLCENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLPKFVL-----FS  395
              R CDGRLIIDFL + +    L+ YL+++  PSF+ G NFA  GS  LP+ V      FS
Sbjct  67    GRFCDGRLIIDFLMDAMNLPSLNAYLDSVGAPSFRRGCNFAAAGSTILPQTVTSAISPFS  126

Query  396   LSTQLLQFNRFRTRSLEFHSKGT--NGMLGEED-FENALYMIDIGQNDIAGAFSYLSKAQ  566
                Q+ QF +F+ R L+  SKG   N  L ++  F+  LYM DIGQND+   F   ++ Q
Sbjct  127   FEVQVTQFLQFKARVLDLLSKGKELNKYLPQKKYFDQGLYMFDIGQNDLNREFYSKTEDQ  186

Query  567   VIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCI  746
             VI  IP+ +SE +  +  +Y  G R+FW+HNTGP+GC+ R +A    +DP +E +  GC+
Sbjct  187   VIASIPTILSEFEAGIMRLYDQGARRFWIHNTGPLGCVARNVAIFG-KDP-SELDGLGCV  244

Query  747   KSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCG  926
              SLN AA  FN++L  LC++L+ +  D  ++YVDIY+IK NLI+N + YGFE P+MACCG
Sbjct  245   SSLNHAANLFNLQLHALCKKLQGQFPDTNVIYVDIYSIKANLIANHSQYGFEQPIMACCG  304

Query  927   GGGAP--YNANISCGQS----GFSV----CKDGSKYISWDGVHYTEDANAMVAASVLSTN  1076
              GGAP  Y+  I CGQ+    G SV    C D +KY++WDGVHYTE AN  V++ +L+  
Sbjct  305   YGGAPLNYDNRILCGQTKTLNGSSVTAKGCNDTTKYVNWDGVHYTEAANQYVSSQILAGK  364

Query  1077  YSTPPFN  1097
             YS PPF+
Sbjct  365   YSDPPFS  371



>emb|CAN71136.1| hypothetical protein VITISV_025409 [Vitis vinifera]
Length=362

 Score =   311 bits (798),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 166/357 (46%), Positives = 221/357 (62%), Gaps = 15/357 (4%)
 Frame = +3

Query  45    MFVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFH  224
             + + +   AFL +S+      E    P++ NFGDSNSDTGG  A  G   G P     F 
Sbjct  10    LILLVWMWAFLGMSTLSACTEE---RPILVNFGDSNSDTGGVLAGTGLPIGPPPWDHIFP  66

Query  225   RSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLST  404
             +          I  +   N    YLSPYL++L P+F +GVNFA+ G+ TLP+FV F+L  
Sbjct  67    QRH------WPIRGWPPYNRLLLYLSPYLDSLXPNFSSGVNFAVSGATTLPQFVPFALDV  120

Query  405   QLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAF--SYLSKAQVIEK  578
             Q+ QF RF+ RS E  S+G+  ++  + F +A+YMIDIGQND+  A   S L+   V+EK
Sbjct  121   QIXQFIRFKNRSQELISQGSRNLINVKGFRDAIYMIDIGQNDLLLALYASNLTYPPVLEK  180

Query  579   IPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLN  758
             IPSF++EIK A+  +Y+ G RKFW+HNTGP+GC P+ LA       N++ +  GC++  N
Sbjct  181   IPSFLAEIKLAIQNLYQFGARKFWIHNTGPLGCAPKELALHP--HTNSDLDRIGCLEVHN  238

Query  759   EAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGA  938
             + A+ FN  L  +CEE+R   KDATIVYVDIY IKY+L      YGFE P MACCG GG 
Sbjct  239   KVAKAFNKGLRVICEEMRLMYKDATIVYVDIYAIKYDLFDKYKKYGFEAPFMACCGYGGP  298

Query  939   P--YNANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFD  1103
             P  Y+   +CGQ G+S+CK+ S  I WDGVHYTE AN +  AS+LS +YSTP    D
Sbjct  299   PNNYDRKATCGQPGYSICKNASSSIVWDGVHYTEAANQVSTASILSGHYSTPRVKLD  355



>ref|XP_002284922.1| PREDICTED: GDSL esterase/lipase At1g54790 [Vitis vinifera]
 emb|CBI36737.3| unnamed protein product [Vitis vinifera]
Length=380

 Score =   310 bits (795),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 159/361 (44%), Positives = 229/361 (63%), Gaps = 21/361 (6%)
 Frame = +3

Query  69    AFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCD  248
             AF+ + SP LA +     P +FNFGDSNSDTGG  A  G+    P+G+ FF R + R CD
Sbjct  12    AFIFIFSP-LAHSIQFNFPAVFNFGDSNSDTGGLVAGIGDRLDPPNGQIFFKRPAGRFCD  70

Query  249   GRLIIDFLCENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLPK----FVLFSLSTQLL  413
             GRLIIDFL + +   +L+PYL+++  P+F+ G NFA  GS  LP        FS   Q+ 
Sbjct  71    GRLIIDFLMDAMDLPFLNPYLDSIGAPTFRKGCNFAAAGSTVLPASANAVSPFSFGIQVA  130

Query  414   QFNRFRTRSLEFHSKG---TNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIP  584
             QF RF+ R L+   KG      +  E+ F+  LYM DIGQND+AGAF   S  Q++  IP
Sbjct  131   QFMRFKIRVLQLLEKGRKFQKYIPQEDSFQKGLYMFDIGQNDLAGAFYSKSLDQILASIP  190

Query  585   SFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEA  764
             + + E +  +  +Y  G R FW+HNTGP+GCL + +A     DP ++ +E GC+   N+A
Sbjct  191   TILVEFETGIQELYDQGARNFWIHNTGPLGCLTQNIAKFGT-DP-SKLDELGCVSGHNQA  248

Query  765   AQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP-  941
             A+ FN++L  LC++ + +  DA +++VDIYTIKYNLI+N + YGFE+PLMACCG GG P 
Sbjct  249   ARLFNLQLQALCKKFQGQHPDAKVIHVDIYTIKYNLIANYSRYGFEHPLMACCGYGGLPL  308

Query  942   -YNANISCGQS----GFSV----CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPF  1094
              Y++ + CG++    G  +    C D ++Y++WDG+HY+E AN  V++ +L+  YS PPF
Sbjct  309   NYDSRVPCGKTKVVNGTEITAKGCSDSTEYVNWDGIHYSEAANQYVSSQILTGKYSDPPF  368

Query  1095  N  1097
             +
Sbjct  369   S  369



>gb|ACF78634.1| unknown [Zea mays]
Length=420

 Score =   311 bits (798),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/323 (46%), Positives = 214/323 (66%), Gaps = 5/323 (2%)
 Frame = +3

Query  126   VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSP  305
             V+FNFGDSNSDTGG  A  G     P+GR +FH  + RL DGR+I+DF+CE++   +LSP
Sbjct  86    VLFNFGDSNSDTGGVAAVMGIRIAPPEGRAYFHHPTGRLSDGRVILDFICESLGMPHLSP  145

Query  306   YLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEE  485
             +++ L  +F NGVNFAI GS  +P    FSL  Q+ QF  F+ R L+   +G +  + E+
Sbjct  146   FMKPLGSNFSNGVNFAIAGSTAMPGVTTFSLDVQVDQFVFFKERCLDSIERGESAPIVEK  205

Query  486   DFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTG  665
              F +A+Y +DIG NDI G   +L    ++E +P  I+EIK A+  +++ G RKFW+H TG
Sbjct  206   AFPDAIYTMDIGHNDINGVL-HLPYHTMLENLPPVIAEIKKAIERLHENGARKFWIHGTG  264

Query  666   PVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYV  845
              +GC+P+ L+    RD +++ +E GCI S+N   ++FN  LS+  +ELR  +K +TIV+V
Sbjct  265   ALGCMPQKLSMP--RDDDSDLDEHGCIASINNVCKKFNSLLSEALDELRLTLKSSTIVFV  322

Query  846   DIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANI--SCGQSGFSVCKDGSKYISWDG  1019
             D++ IKY+L++N   YG E PLM CCG GG PYN +   SC  S   +CK G K+ISWDG
Sbjct  323   DMFAIKYDLVANHTKYGIEKPLMTCCGHGGPPYNYDPKESCMTSDKYLCKLGEKFISWDG  382

Query  1020  VHYTEDANAMVAASVLSTNYSTP  1088
             VH+T+ AN +VA+ VLS  Y+ P
Sbjct  383   VHFTDAANGIVASKVLSGEYNIP  405



>ref|XP_010255784.1| PREDICTED: GDSL esterase/lipase At1g54790-like isoform X1 [Nelumbo 
nucifera]
Length=414

 Score =   311 bits (797),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 171/367 (47%), Positives = 232/367 (63%), Gaps = 24/367 (7%)
 Frame = +3

Query  57    ITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAH-GNIFGYPDGRTFFHRSS  233
             +  SAF + S  PL  A   + P +FNFGDSNSDTGG  AA  GN    P+G+T+F   S
Sbjct  41    LLASAFFLFS--PLGLAIDFKYPAVFNFGDSNSDTGGLIAAGIGNPLNPPNGQTYFLXPS  98

Query  234   DRLCDGRLIIDFLCENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLPKFVL-----FS  395
              R CDGRLIIDFL + +    L+ YL+++  PSF+ G NFA  GS  LP+ V      FS
Sbjct  99    GRFCDGRLIIDFLMDAMNLPSLNAYLDSVGAPSFRRGCNFAAAGSTILPQTVTSAISPFS  158

Query  396   LSTQLLQFNRFRTRSLEFHSKGT--NGMLGEED-FENALYMIDIGQNDIAGAFSYLSKAQ  566
                Q+ QF +F+ R L+  SKG   N  L ++  F+  LYM DIGQND+   F   ++ Q
Sbjct  159   FEVQVTQFLQFKARVLDLLSKGKELNKYLPQKKYFDQGLYMFDIGQNDLNREFYSKTEDQ  218

Query  567   VIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCI  746
             VI  IP+ +SE +  +  +Y  G R+FW+HNTGP+GC+ R +A    +DP +E +  GC+
Sbjct  219   VIASIPTILSEFEAGIMRLYDQGARRFWIHNTGPLGCVARNVAIFG-KDP-SELDGLGCV  276

Query  747   KSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCG  926
              SLN AA  FN++L  LC++L+ +  D  ++YVDIY+IK NLI+N + YGFE P+MACCG
Sbjct  277   SSLNHAANLFNLQLHALCKKLQGQFPDTNVIYVDIYSIKANLIANHSQYGFEQPIMACCG  336

Query  927   GGGAP--YNANISCGQS----GFSV----CKDGSKYISWDGVHYTEDANAMVAASVLSTN  1076
              GGAP  Y+  I CGQ+    G SV    C D +KY++WDGVHYTE AN  V++ +L+  
Sbjct  337   YGGAPLNYDNRILCGQTKTLNGSSVTAKGCNDTTKYVNWDGVHYTEAANQYVSSQILAGK  396

Query  1077  YSTPPFN  1097
             YS PPF+
Sbjct  397   YSDPPFS  403



>ref|XP_009602454.1| PREDICTED: GDSL esterase/lipase At1g54790 [Nicotiana tomentosiformis]
Length=381

 Score =   310 bits (793),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 158/352 (45%), Positives = 221/352 (63%), Gaps = 20/352 (6%)
 Frame = +3

Query  93    PLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFL  272
             PLA       P +FNFGDSNSDTGG  A  G+    P+G+T+F + S R CDGRLIIDFL
Sbjct  20    PLANTIDFDYPAVFNFGDSNSDTGGLVAGVGDRLEPPNGQTYFQKPSGRFCDGRLIIDFL  79

Query  273   CENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLPKFVL----FSLSTQLLQFNRFRTR  437
              + +   +L+ YL+++  P+F+ G NFA  GS  LP        FS   Q+ QF RF+ R
Sbjct  80    MDAMDLPFLNSYLDSIGAPTFRKGANFAAAGSTILPATASSVSPFSFGIQVAQFFRFKNR  139

Query  438   SLEFHSKGTNG---MLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKD  608
              LE  +K       +  ++ F+  LYM DIGQND+AG F   +  Q++  IP+ + E +D
Sbjct  140   VLEIQAKTRKYDKYVPAQDFFQKGLYMFDIGQNDLAGGFYSKTLDQILASIPTILVEFED  199

Query  609   AVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKL  788
              V  +Y +G R FWVHNTGP+GCL + +A  K     ++ +E GC+ S N+AA+  N++L
Sbjct  200   GVKRLYDLGARNFWVHNTGPLGCLGQNIA--KFGTDASKLDELGCVSSHNQAAKILNLQL  257

Query  789   SDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISC  962
               LC++L+ +  DA I +VDI+TIK NLI+N++ YGFE PLMACCG GG P  Y++ ++C
Sbjct  258   YALCKKLQGQYTDANITHVDIFTIKSNLIANNSRYGFEQPLMACCGYGGPPLNYDSRVAC  317

Query  963   GQSGF--------SVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPF  1094
             GQ+            C D S+YI+WDG+HYTE AN +VA+ +L+  YS PPF
Sbjct  318   GQTKVVDGNNVTAKACNDSSEYINWDGIHYTETANQLVASQILTGKYSDPPF  369



>ref|XP_004958745.1| PREDICTED: GDSL esterase/lipase LIP-4-like [Setaria italica]
Length=407

 Score =   311 bits (796),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 163/367 (44%), Positives = 219/367 (60%), Gaps = 16/367 (4%)
 Frame = +3

Query  51    VFITCSAFLVLSSP------PLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGR  212
             V I  S++   S+P      PLA  EC    V+FNFGDSNSDTG   A  G     P GR
Sbjct  48    VVIVPSSWPFTSAPDFKKQQPLAPPEC----VVFNFGDSNSDTGNLVAGAGFRLHQPVGR  103

Query  213   TFFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLF  392
              FF + S R  DGRL I F+CE +  D+LSPY+E+   +F++G NFA+ G+        F
Sbjct  104   RFFGKPSGRFSDGRLYIVFICERLGLDHLSPYMESSGVNFRHGANFAVAGAMVAGAAGTF  163

Query  393   SLSTQLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQV  569
              L+TQ+ QF  F+ R+ +   +G    +  ++F+NA+Y  DIGQND+  AFS  LS  +V
Sbjct  164   ELATQVRQFRHFKARTEDLRPRGLGSGITSQEFQNAVYTFDIGQNDLQAAFSAGLSYERV  223

Query  570   IEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIK  749
             +E+IP+ ++ IK+AV  +++ GGRKF ++NTGPVGCLP  LA    R    E +  GC+ 
Sbjct  224   LERIPAIVTRIKNAVTMLHEAGGRKFVLYNTGPVGCLPSMLAR---RRRGGELDRAGCLV  280

Query  750   SLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGG  929
               N  A  FN +L  LC ELR E+ ++T+V VD++ IKY L++N   +GF  PLM CCG 
Sbjct  281   DHNGVAGAFNAQLGRLCGELRAELANSTVVCVDMHAIKYGLVANHTAHGFSEPLMTCCGS  340

Query  930   GGAPYN--ANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFD  1103
             GG PYN     +CG      C DG   ISWDG+HYTE AN +VA  VLS  YS PP    
Sbjct  341   GGPPYNYRPGKACGSPKVKACADGDHRISWDGLHYTEAANRVVADEVLSAEYSDPPLRLQ  400

Query  1104  YFCSTNS  1124
               C++ S
Sbjct  401   TLCTSPS  407



>ref|NP_001130430.1| uncharacterized protein LOC100191527 [Zea mays]
 gb|ACG39197.1| alpha-L-fucosidase 2 precursor [Zea mays]
 gb|AFW77229.1| alpha-L-fucosidase 2 [Zea mays]
Length=434

 Score =   311 bits (797),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 150/323 (46%), Positives = 214/323 (66%), Gaps = 5/323 (2%)
 Frame = +3

Query  126   VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSP  305
             V+FNFGDSNSDTGG  A  G     P+GR +FH  + RL DGR+I+DF+CE++   +LSP
Sbjct  100   VLFNFGDSNSDTGGVAAVMGIRIAPPEGRAYFHHPTGRLSDGRVILDFICESLGMPHLSP  159

Query  306   YLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEE  485
             +++ L  +F NGVNFAI GS  +P    FSL  Q+ QF  F+ R L+   +G +  + E+
Sbjct  160   FMKPLGSNFSNGVNFAIAGSTAMPGVTTFSLDVQVDQFVFFKERCLDSIERGESAPIVEK  219

Query  486   DFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTG  665
              F +A+Y +DIG NDI G   +L    ++E +P  I+EIK A+  +++ G RKFW+H TG
Sbjct  220   AFPDAIYTMDIGHNDINGVL-HLPYHTMLENLPPVIAEIKKAIERLHENGARKFWIHGTG  278

Query  666   PVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYV  845
              +GC+P+ L+    RD +++ +E GCI S+N   ++FN  LS+  +ELR  +K +TIV+V
Sbjct  279   ALGCMPQKLSMP--RDDDSDLDEHGCIASINNVCKKFNSLLSEALDELRLTLKSSTIVFV  336

Query  846   DIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANI--SCGQSGFSVCKDGSKYISWDG  1019
             D++ IKY+L++N   YG E PLM CCG GG PYN +   SC  S   +CK G K+ISWDG
Sbjct  337   DMFAIKYDLVANHTKYGIEKPLMTCCGHGGPPYNYDPKESCMTSDKYLCKLGEKFISWDG  396

Query  1020  VHYTEDANAMVAASVLSTNYSTP  1088
             VH+T+ AN +VA+ VLS  Y+ P
Sbjct  397   VHFTDAANGIVASKVLSGEYNIP  419



>dbj|BAG94628.1| unnamed protein product [Oryza sativa Japonica Group]
Length=287

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/282 (52%), Positives = 188/282 (67%), Gaps = 3/282 (1%)
 Frame = +3

Query  276   ENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHS  455
             E++   YLSPYL+AL   + NG NFAI GS TLP+  LFSL  Q+ QF  FR RSLE  S
Sbjct  8     ESLNIGYLSPYLKALGSDYSNGANFAIAGSATLPRDTLFSLHIQVKQFLFFRDRSLELIS  67

Query  456   KGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVG  635
             +G  G +  E F NALYMIDIGQND+    SYLS  QV+ + P  + EIKDA+  +Y  G
Sbjct  68    QGLPGPVDAEGFRNALYMIDIGQNDVNALLSYLSYDQVVARFPPILDEIKDAIQTLYDNG  127

Query  636   GRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRH  815
              R FWVH TG +GCLP+ L+  +  D  ++ +  GC+K+ N AA  FN  L  LC++L  
Sbjct  128   SRNFWVHGTGALGCLPQKLSIPRKND--SDLDSNGCLKTYNRAAVTFNAALGSLCDQLST  185

Query  816   EMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANISCG-QSGFSVCKD  992
             +MKDATIVY D++ +KY+LI+N   YGF+ PLM CCG GG PYN NI+ G Q   + C D
Sbjct  186   QMKDATIVYTDLFPLKYDLIANRTKYGFDKPLMTCCGYGGPPYNYNITIGCQDKNASCDD  245

Query  993   GSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
             GSK++SWDGVH TE ANA+VA  +LS++YS P   FD FC  
Sbjct  246   GSKFVSWDGVHLTEAANAIVAKGILSSDYSRPKIKFDQFCKV  287



>ref|XP_004977099.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Setaria italica]
Length=430

 Score =   311 bits (796),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/333 (46%), Positives = 209/333 (63%), Gaps = 5/333 (2%)
 Frame = +3

Query  126   VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSP  305
             V+FNFGDSNSDTGG  A  G     P+GR +FH  + RL DGR+I+DF+CE++   +LSP
Sbjct  96    VLFNFGDSNSDTGGVAAVMGIRIAPPEGRAYFHYPTGRLSDGRVILDFICESLGTHHLSP  155

Query  306   YLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEE  485
             +++ L   F NGVNFAI GS  +P    FSL  Q+ QF  F+ R L+   +G +  + E 
Sbjct  156   FMKPLGSDFTNGVNFAIAGSTAMPGVTTFSLDVQVDQFIFFKERCLDLIERGESAPVDEL  215

Query  486   DFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTG  665
              F+ ALY +DIG NDI G   ++   +++  +P  I EIK A+  ++K G RKFW+H TG
Sbjct  216   GFQTALYTMDIGHNDINGIL-HMPYDEMLANLPPVIVEIKKAIERLHKNGARKFWIHGTG  274

Query  666   PVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYV  845
              +GC+P+ LA    RD ++  +E GCI S+N   ++FN  LS+  +ELR  +K + IV+V
Sbjct  275   ALGCMPQKLAMP--RDDDSGLDEHGCIASINNVCKKFNSLLSEALDELRLTLKKSAIVFV  332

Query  846   DIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN--ANISCGQSGFSVCKDGSKYISWDG  1019
             D++ IKY+L+ N   YG E PLM CCG GG PYN     SC  S   +CK G K+ISWDG
Sbjct  333   DMFAIKYDLVVNHKKYGIEKPLMTCCGHGGPPYNYDPKKSCMTSDEDLCKLGEKFISWDG  392

Query  1020  VHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
             VH+T+ AN +VA+ VLS  YS P        ST
Sbjct  393   VHFTDAANGIVASKVLSGEYSIPRVKLASLVST  425



>ref|XP_009773596.1| PREDICTED: GDSL esterase/lipase At1g54790 [Nicotiana sylvestris]
Length=381

 Score =   309 bits (791),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 162/367 (44%), Positives = 226/367 (62%), Gaps = 23/367 (6%)
 Frame = +3

Query  48    FVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHR  227
             F+ I    F+ L   PLA       P +FNFGDSNSDTGG  A  G+    P+G+T+F +
Sbjct  8     FLHILALFFICL---PLANTIDFNYPAVFNFGDSNSDTGGLVAGVGDRLEPPNGQTYFQK  64

Query  228   SSDRLCDGRLIIDFLCENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLP----KFVLF  392
              S R CDGRLIIDFL + +   +L+ YL+++  P+F+ GVNFA  GS  LP        F
Sbjct  65    PSGRFCDGRLIIDFLMDAMDLPFLNSYLDSIGAPTFRKGVNFAAAGSTILPATASSVSPF  124

Query  393   SLSTQLLQFNRFRTRSLEFHSKGTNG---MLGEEDFENALYMIDIGQNDIAGAFSYLSKA  563
             S   Q+ QF RF+ R LE  +K       +  ++ F+  LYM DIGQND+AG F   +  
Sbjct  125   SFGIQVAQFFRFKNRVLEIQAKTRKYDKYVPAQDFFQKGLYMFDIGQNDLAGGFYSKTLD  184

Query  564   QVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGC  743
             Q++  IP+ + E +D V  +Y +G R FWVHNTGP+GCL + +A  K    +++ +E GC
Sbjct  185   QILASIPTILVEFEDGVKRLYDLGARNFWVHNTGPLGCLGQNIA--KFGTDSSKLDELGC  242

Query  744   IKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACC  923
             + S N+AA+  N++L  LC++L+ +  DA I +VDI+TIK NLI+N + YGFE PLMACC
Sbjct  243   VSSHNQAAKILNLQLYALCKKLQSQYADANITHVDIFTIKSNLIANYSRYGFEQPLMACC  302

Query  924   GGGGAP--YNANISCGQSGF--------SVCKDGSKYISWDGVHYTEDANAMVAASVLST  1073
             G GG P  Y++ ++CG +            C D S+YI+WDG+HYTE AN  VA+ +L+ 
Sbjct  303   GYGGPPLNYDSRVACGLTKVIDGNNVTAKACNDSSEYINWDGIHYTETANQFVASQILTG  362

Query  1074  NYSTPPF  1094
              YS PPF
Sbjct  363   KYSDPPF  369



>ref|NP_001266522.1| alpha-L-fucosidase 2 precursor [Zea mays]
 gb|ACG35266.1| alpha-L-fucosidase 2 precursor [Zea mays]
Length=434

 Score =   310 bits (794),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 150/323 (46%), Positives = 213/323 (66%), Gaps = 5/323 (2%)
 Frame = +3

Query  126   VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSP  305
             V+FNFGDSNSDTGG  A  G     P+GR +FH  + RL DGR+I+DF+CE++   +LSP
Sbjct  100   VLFNFGDSNSDTGGVAAVMGIRIAPPEGRAYFHHPTGRLSDGRVILDFICESLGTPHLSP  159

Query  306   YLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEE  485
             +++ L  +F NGVNFAI GS  +P    FSL  Q+ QF  F+ R L+   +G +  + E+
Sbjct  160   FMKPLGSNFSNGVNFAIAGSTAMPGVTTFSLDVQVDQFVFFKERCLDSIERGESAPIVEK  219

Query  486   DFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTG  665
              F +A+Y +DIG NDI G   +L    ++E +P  I+EIK A+  +++ G RKFW+H TG
Sbjct  220   AFPDAIYTMDIGHNDINGVL-HLPYHTMLENLPPVIAEIKKAIERLHENGARKFWIHGTG  278

Query  666   PVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYV  845
              +GC+P+ L+    RD ++  +E GCI S+N   ++FN  LS+  +ELR  +K +TIV+V
Sbjct  279   ALGCMPQKLSMP--RDDDSGLDEHGCIASINNVCKKFNSLLSEALDELRLTLKSSTIVFV  336

Query  846   DIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANI--SCGQSGFSVCKDGSKYISWDG  1019
             D++ IKY+L++N   YG E PLM CCG GG PYN +   SC  S   +CK G K+ISWDG
Sbjct  337   DMFAIKYDLVANHTKYGIEKPLMTCCGHGGPPYNYDPKESCMTSDKYLCKLGEKFISWDG  396

Query  1020  VHYTEDANAMVAASVLSTNYSTP  1088
             VH+T+ AN +VA+ VLS  Y+ P
Sbjct  397   VHFTDAANGIVASKVLSGEYNIP  419



>ref|XP_007030927.1| GDSL-like Lipase/Acylhydrolase superfamily protein isoform 2 
[Theobroma cacao]
 gb|EOY11429.1| GDSL-like Lipase/Acylhydrolase superfamily protein isoform 2 
[Theobroma cacao]
Length=380

 Score =   307 bits (787),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 158/345 (46%), Positives = 216/345 (63%), Gaps = 24/345 (7%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLS  302
             PV+FNFGDSNSDTG   AA G+    P+G+ +F   + R CDGRLIIDFL + +   +L+
Sbjct  29    PVVFNFGDSNSDTGELVAALGDFLELPNGQAYFKAPTGRFCDGRLIIDFLMDAMDLPFLN  88

Query  303   PYLEAL-TPSFKNGVNFAIGGSQTLP----KFVLFSLSTQLLQFNRFRTRSLEFHSKGTN  467
              YL+++ TPSF+ G NFA  GS  LP        FSL  Q+ QF RF+ R LE  +KG  
Sbjct  89    AYLDSIGTPSFRKGCNFAAAGSTILPPTANAVSPFSLGVQVAQFFRFKARVLELLAKGKK  148

Query  468   GMLG-----EEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKV  632
               LG     E+ F+  LYMIDIGQND+AGAF   +  Q++  IPS + E +  V  +Y  
Sbjct  149   --LGKYLPTEDSFQKGLYMIDIGQNDLAGAFYSKTYDQILALIPSVMIEFETGVKKLYDQ  206

Query  633   GGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELR  812
             G R FW+HNTGP+GCL + +A  K     +  +E GC+   N+AA+ FN++L  LC++L+
Sbjct  207   GARNFWIHNTGPLGCLAQNVA--KFGTDASSLDELGCVSKHNQAAKVFNLQLHALCKKLQ  264

Query  813   HEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQSGF---  977
              +  D+   YVDIYTIK NLI+N +  GFE P+MACCG GG P  Y++ I+CG++     
Sbjct  265   GQYTDSNFTYVDIYTIKSNLIANYSKLGFEQPIMACCGYGGGPLNYDSRIACGKTKVING  324

Query  978   -----SVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
                    C D S+Y++WDG+HYTE AN  V+  +L+  YS PPF+
Sbjct  325   TSMTAKACNDSSEYVNWDGIHYTEAANQYVSTQILTGKYSDPPFS  369



>ref|XP_006850822.1| hypothetical protein AMTR_s00025p00126710 [Amborella trichopoda]
 gb|ERN12403.1| hypothetical protein AMTR_s00025p00126710 [Amborella trichopoda]
Length=383

 Score =   307 bits (787),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 159/360 (44%), Positives = 231/360 (64%), Gaps = 20/360 (6%)
 Frame = +3

Query  72    FLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDG  251
             F++  +  L     +  P IFNFGDSNSDTG   A  G     P+GR++F R + R CDG
Sbjct  13    FIIFQNSHLVEGVDLNPPAIFNFGDSNSDTGDLVAGVGEPLDPPNGRSYFSRPAGRFCDG  72

Query  252   RLIIDFLCENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTL----PKFVLFSLSTQLLQ  416
             RLIIDFL + +   +L+ YL++L +PSF+ G NFA  GS  L         FS   Q+ Q
Sbjct  73    RLIIDFLADEMNLPFLNAYLDSLGSPSFRKGSNFAAAGSTILRATAESVSPFSFRIQVAQ  132

Query  417   FNRFRTRSLEFHSKG--TNGML-GEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPS  587
             F RF+ R LE  +KG  TN ++  E+DF++ALY  DIGQND+AGAF   S+ QV+  IP+
Sbjct  133   FLRFKARVLELLAKGGKTNKIIPREDDFDDALYTFDIGQNDLAGAFYSKSEDQVLASIPT  192

Query  588   FISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAA  767
              +SE + ++  IY  G RKFW+HNTGP+GCLP+ +A    ++P ++ +E GC+ S N+A+
Sbjct  193   ILSEFETSLKKIYDSGARKFWIHNTGPLGCLPQNIAAFG-KEP-SKLDELGCVISHNKAS  250

Query  768   QEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--  941
             + FN++L  LC +L+ ++  A + YVD+++IK +LISN + YGFE+   ACCG GG P  
Sbjct  251   KLFNLQLHALCSKLQGQLTGANVTYVDVFSIKLSLISNYSRYGFEHSTTACCGYGGPPLN  310

Query  942   YNANISCGQSG--------FSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
             Y++ I+CGQ+            C D ++Y+SWDG+HYTE AN  V++ +L+  Y+ PPF+
Sbjct  311   YDSRIACGQTKNLNGNQVTAQACNDATEYVSWDGIHYTEAANRYVSSQILTGKYADPPFS  370



>ref|XP_002512338.1| Alpha-L-fucosidase 2 precursor, putative [Ricinus communis]
 gb|EEF49790.1| Alpha-L-fucosidase 2 precursor, putative [Ricinus communis]
Length=380

 Score =   307 bits (787),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 160/367 (44%), Positives = 229/367 (62%), Gaps = 20/367 (5%)
 Frame = +3

Query  51    VFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRS  230
             +F   +  L+   P +A +     P +FNFGDSNSDTG   AA G +   P+G+++F   
Sbjct  5     IFTLHTLILLFIIPTMAKSVDFNYPAVFNFGDSNSDTGDLVAAFGILLESPNGQSYFKTP  64

Query  231   SDRLCDGRLIIDFLCENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLP----KFVLFS  395
             S R CDGRLI+DFL + +   +L+ YLE+   P+F+ G NFA  GS+ LP        FS
Sbjct  65    SGRFCDGRLIVDFLMDEMDLPFLNAYLESTGLPNFRKGCNFAAAGSKILPATASSVSPFS  124

Query  396   LSTQLLQFNRFRTRSLEFHSKGTN---GMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQ  566
             L  Q+ QF RF+ R+LE  SKG      +  E+ F   LYM DIGQND+AGAF   +  Q
Sbjct  125   LGIQVNQFLRFKARALELLSKGKKFEKYLPAEDYFVKGLYMFDIGQNDLAGAFYSRTFDQ  184

Query  567   VIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCI  746
             ++  IPS + E +  +  ++  G R FW+HNTGP+GCL + +A     DP ++ +E GC+
Sbjct  185   IVASIPSILVEFEAGIQRLHDQGARNFWIHNTGPLGCLTQNVAKFGT-DP-SKLDELGCV  242

Query  747   KSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCG  926
                N+AA+ FN++L  LC++L+ +  D+ I YVDIYTIK NLI+N + YGFE P+MACCG
Sbjct  243   SGHNQAAKLFNLQLHALCKKLQGQYADSNITYVDIYTIKSNLIANYSRYGFEQPIMACCG  302

Query  927   GGGAP--YNANISCGQS----GFSV----CKDGSKYISWDGVHYTEDANAMVAASVLSTN  1076
              GG P  Y+  ++CGQ+    G +V    C D ++Y++WDG+HYTE AN  V++ +L+  
Sbjct  303   YGGPPLNYDTRVNCGQTKVLNGTTVSAKACDDSTEYVNWDGIHYTEAANQYVSSQILTGK  362

Query  1077  YSTPPFN  1097
             YS PPF+
Sbjct  363   YSDPPFS  369



>ref|XP_010415017.1| PREDICTED: GDSL esterase/lipase LIP-4-like isoform X2 [Camelina 
sativa]
Length=306

 Score =   304 bits (779),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 152/277 (55%), Positives = 199/277 (72%), Gaps = 11/277 (4%)
 Frame = +3

Query  303   PYLEALTPS-FKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTN--GM  473
             PYL++L  + F+NG NFAI GS TLPK V FSLS QL+QF+ F++RSLE  S   +  GM
Sbjct  32    PYLDSLGGTRFQNGANFAIVGSATLPKNVPFSLSIQLMQFSHFKSRSLELASSSNSLKGM  91

Query  474   -LGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVWAIYKVGGRKF  647
              + E+ F+NALYMIDIGQNDI+ +F+   S +Q ++ IP  +SEI+  +  +Y  GGR+F
Sbjct  92    YISEDGFKNALYMIDIGQNDISHSFAKGNSYSQTVKLIPQIVSEIQSGIKRLYDEGGRRF  151

Query  648   WVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKD  827
             W+HNTGP+GCLP+ L+    +D     ++ GC+ S N AA+ FN +L  +CEELR ++KD
Sbjct  152   WIHNTGPLGCLPQKLSMVTSKD----LDQHGCLASYNSAAKLFNQRLDHMCEELRSQLKD  207

Query  828   ATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQSGFSVCKDGSK  1001
             ATI+YVDIYTIKY+LI+NS  YGF  PLMACCG GG P  YN NI+CG  G +VC  GS+
Sbjct  208   ATIIYVDIYTIKYSLIANSNEYGFGRPLMACCGYGGTPYNYNMNITCGHRGSNVCDKGSR  267

Query  1002  YISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             ++SWDG+HYTE ANA+VA  VLS  YS P   F +FC
Sbjct  268   FVSWDGIHYTETANAIVAMKVLSMQYSNPSNPFHFFC  304



>gb|KEH24462.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=266

 Score =   303 bits (776),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 141/265 (53%), Positives = 193/265 (73%), Gaps = 7/265 (3%)
 Frame = +3

Query  327   SFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALY  506
             +F NG NFA+ GS TLPK++ FSL+ Q++QF  F+ RSL+  + G   M+ ++ F +ALY
Sbjct  5     TFTNGANFAVVGSSTLPKYLPFSLNIQVMQFQHFKARSLQLATSGAKNMINDQGFRDALY  64

Query  507   MIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLP  683
             +IDIGQND+A +F+  LS  QVI++IP+ I+EI++AV ++Y  GGRKFWVHNTGP GCLP
Sbjct  65    LIDIGQNDLADSFTKNLSYVQVIKRIPTVITEIENAVKSLYNEGGRKFWVHNTGPFGCLP  124

Query  684   RTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIK  863
             + +A ++ +D     +  GC+ S N AA+ FN  L    ++LR E+KDAT+VYVDIY IK
Sbjct  125   KLIALSQKKD----LDSFGCLSSYNSAARLFNEALYHSSQKLRTELKDATLVYVDIYAIK  180

Query  864   YNLISNSAIYGFENPLMACCGGGGAPYN--ANISCGQSGFSVCKDGSKYISWDGVHYTED  1037
              +LI+N+  YGF NPLM CCG GG PYN  A ++CGQ G+ VC +GS+Y+SWDG+HYTE 
Sbjct  181   NDLITNATKYGFTNPLMVCCGFGGPPYNFDARVTCGQPGYQVCDEGSRYVSWDGIHYTEA  240

Query  1038  ANAMVAASVLSTNYSTPPFNFDYFC  1112
             AN  +A+ +LST YSTP   F +FC
Sbjct  241   ANTWIASKILSTAYSTPRIPFGFFC  265



>ref|XP_010255795.1| PREDICTED: GDSL esterase/lipase At1g54790-like [Nelumbo nucifera]
Length=380

 Score =   305 bits (782),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 165/366 (45%), Positives = 230/366 (63%), Gaps = 23/366 (6%)
 Frame = +3

Query  54    FITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSS  233
             F+  + FL   S P   A   +   +FNFGDSNSDTG   A  G+    P+G+T+F + S
Sbjct  9     FLALAFFL---SSPTGEAVVFKYLAVFNFGDSNSDTGELVAGMGDHLDPPNGQTYFLKPS  65

Query  234   DRLCDGRLIIDFLCENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLPKFVL----FSL  398
              R CDGRLI+DFL E +   +L+ YL+++  PSF+ G NFA   S  LP        FS 
Sbjct  66    GRFCDGRLIVDFLMEAMDLPFLNAYLDSVGAPSFRKGCNFAAAASAILPATAYSISPFSF  125

Query  399   STQLLQFNRFRTRSLEFHSKGT--NGMLGEED-FENALYMIDIGQNDIAGAFSYLSKAQV  569
               Q+ QF +F+ R L+  SKG   N  L +++ FE  LYM DIGQND AGAF   ++ Q+
Sbjct  126   GIQVSQFIQFKARVLDLLSKGKKLNKYLPQKNYFEQGLYMFDIGQNDFAGAFYSKTEDQI  185

Query  570   IEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIK  749
             I  IP+ + E +  +  +Y  G R+FW+HNTGP+GCL + +AT   +DP ++ +E GC+ 
Sbjct  186   IASIPTILLEFEAGIKRLYDQGARRFWIHNTGPLGCLAQNIATFG-KDP-SKLDELGCVS  243

Query  750   SLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGG  929
             S N AA  FN++L  LC++L+ +  D  + YVDIY+IK NLI+N + YGF+ P+MACCG 
Sbjct  244   SHNRAANLFNLQLHALCKKLQSQFPDVNVTYVDIYSIKANLIANYSQYGFQQPIMACCGY  303

Query  930   GGAP--YNANISCGQS----GFSV----CKDGSKYISWDGVHYTEDANAMVAASVLSTNY  1079
             GGAP  Y++ ISCGQ+    G SV    C D +KY++WDG+HYTE AN  V+  +L+  Y
Sbjct  304   GGAPLNYDSRISCGQTKTLNGSSVTAKGCNDSTKYVNWDGIHYTEAANRFVSTQILTGKY  363

Query  1080  STPPFN  1097
             S PPF+
Sbjct  364   SDPPFS  369



>emb|CAB71888.1| putative protein [Arabidopsis thaliana]
Length=343

 Score =   304 bits (778),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 161/335 (48%), Positives = 208/335 (62%), Gaps = 29/335 (9%)
 Frame = +3

Query  117   RNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADY  296
             + P++ NFGDSNSDTGG  A  G   G P G TFFHR + RL DGRLI+DF CE++K  Y
Sbjct  33    KKPILINFGDSNSDTGGVLAGVGLPIGLPHGITFFHRGTGRLGDGRLIVDFYCEHLKMTY  92

Query  297   LSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGML  476
             LSPYL++L+P+FK GVNFA+ G+  LP F  F L+ Q+ QF  F+ RS E  S G   ++
Sbjct  93    LSPYLDSLSPNFKRGVNFAVSGATALPIFS-FPLAIQIRQFVHFKNRSQELISSGRRDLI  151

Query  477   GEEDFENALYMIDIGQNDIAGAF--SYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFW  650
              +  F NALYMIDIGQND+  A   S L+ A V+EKIPS + EIK A+      G     
Sbjct  152   DDNGFRNALYMIDIGQNDLLLALYDSNLTYAPVVEKIPSMLLEIKKAIQ-----GELAIH  206

Query  651   VHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDA  830
             +HN                   +++ +  GC +  NE A+ FN  L  LC ELR + KDA
Sbjct  207   LHN-------------------DSDLDPIGCFRVHNEVAKAFNKGLLSLCNELRSQFKDA  247

Query  831   TIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQSGFSVCKDGSKY  1004
             T+VYVDIY+IKY L ++  +YGF +PLMACCG GG P  Y+   +CGQ G ++C+D +K 
Sbjct  248   TLVYVDIYSIKYKLSADFKLYGFVDPLMACCGYGGRPNNYDRKATCGQPGSTICRDVTKA  307

Query  1005  ISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYF  1109
             I WDGVHYTE AN  V  +VL+  YS P  + D F
Sbjct  308   IVWDGVHYTEAANRFVVDAVLTNRYSYPKNSLDRF  342



>ref|XP_010025155.1| PREDICTED: GDSL esterase/lipase At1g54790 isoform X1 [Eucalyptus 
grandis]
 gb|KCW61753.1| hypothetical protein EUGRSUZ_H04457 [Eucalyptus grandis]
Length=381

 Score =   304 bits (778),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 163/376 (43%), Positives = 226/376 (60%), Gaps = 25/376 (7%)
 Frame = +3

Query  21    MDTNQRAAMFVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGY  200
             M T       V  + S FL     PLA +     P +FNFGDSNSDTG   AA G     
Sbjct  1     MPTKILPLFHVLFSFSIFL-----PLATSTDFNFPAVFNFGDSNSDTGELVAALGIRLNP  55

Query  201   PDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLP  377
             P+G T+F   + R CDGRLI+DFL + +   +L+ YL+++  P+F+ G NFA   S  LP
Sbjct  56    PNGDTYFKAPAGRFCDGRLIVDFLMDAMDLPFLNAYLDSIGIPNFRRGCNFATAASTILP  115

Query  378   ----KFVLFSLSTQLLQFNRFRTRSLEFHSKG---TNGMLGEEDFENALYMIDIGQNDIA  536
                     FS   Q+ QF RF+ R LE  +KG      +  EE F   LYM DIGQND+A
Sbjct  116   ATATSLSPFSFGVQVSQFLRFKARVLELLAKGKKLVKYLPAEEYFAQGLYMFDIGQNDLA  175

Query  537   GAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDP  716
             G F   S  Q++  IP+ + E ++    +Y  GGR FW+HNTGP+GC+ + +A     DP
Sbjct  176   GPFYSKSLDQILALIPTILVEFENGFKTLYDQGGRNFWIHNTGPLGCITQNIAKFGT-DP  234

Query  717   NTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYG  896
              ++ +E GC+   N+AA+ FN++L+ LC +LR +  DA I YVDI++IK NLI+N + YG
Sbjct  235   -SKLDEIGCVSGHNQAAKLFNLQLNALCAKLRGQYTDANITYVDIFSIKSNLIANYSRYG  293

Query  897   FENPLMACCGGGGAP--YNANISCGQS----GFSV----CKDGSKYISWDGVHYTEDANA  1046
             FE P MACCG GGAP  Y++ +SCGQ+    G +V    C D ++Y++WDG+HYTE AN 
Sbjct  294   FEQPFMACCGYGGAPLNYDSRVSCGQTKVLNGTTVTAKACDDSTEYVNWDGIHYTEAANQ  353

Query  1047  MVAASVLSTNYSTPPF  1094
              +++ +L+  YS PPF
Sbjct  354   FISSQILTGKYSDPPF  369



>ref|XP_007030926.1| GDSL-like Lipase/Acylhydrolase superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY11428.1| GDSL-like Lipase/Acylhydrolase superfamily protein isoform 1 
[Theobroma cacao]
Length=381

 Score =   303 bits (776),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 160/355 (45%), Positives = 217/355 (61%), Gaps = 24/355 (7%)
 Frame = +3

Query  93    PLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFL  272
             PL  +   + P IFNFGDSNSDTG   AA       P G+++F   S R CDGRLIIDFL
Sbjct  20    PLTNSITFKYPAIFNFGDSNSDTGELVAAGIESLEPPHGQSYFQTPSGRYCDGRLIIDFL  79

Query  273   CENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLP----KFVLFSLSTQLLQFNRFRTR  437
              + +   +L+ YL+++ TPSF+ G NFA  GS  LP        FSL  Q+ QF RF+ R
Sbjct  80    MDAMDLPFLNAYLDSIGTPSFRKGCNFAAAGSTILPPTANAVSPFSLGVQVAQFFRFKAR  139

Query  438   SLEFHSKGTNGMLG-----EEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEI  602
              LE  +KG    LG     E+ F+  LYMIDIGQND+AGAF   +  Q++  IPS + E 
Sbjct  140   VLELLAKGKK--LGKYLPTEDSFQKGLYMIDIGQNDLAGAFYSKTYDQILALIPSVMIEF  197

Query  603   KDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNV  782
             +  V  +Y  G R FW+HNTGP+GCL + +A  K     +  +E GC+   N+AA+ FN+
Sbjct  198   ETGVKKLYDQGARNFWIHNTGPLGCLAQNVA--KFGTDASSLDELGCVSKHNQAAKVFNL  255

Query  783   KLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANI  956
             +L  LC++L+ +  D+   YVDIYTIK NLI+N +  GFE P+MACCG GG P  Y++ I
Sbjct  256   QLHALCKKLQGQYTDSNFTYVDIYTIKSNLIANYSKLGFEQPIMACCGYGGGPLNYDSRI  315

Query  957   SCGQSGF--------SVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
             +CG++            C D S+Y++WDG+HYTE AN  V+  +L+  YS PPF+
Sbjct  316   ACGKTKVINGTSMTAKACNDSSEYVNWDGIHYTEAANQYVSTQILTGKYSDPPFS  370



>ref|XP_010414921.1| PREDICTED: GDSL esterase/lipase At1g54790-like isoform X1 [Camelina 
sativa]
Length=392

 Score =   303 bits (777),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 171/380 (45%), Positives = 234/380 (62%), Gaps = 33/380 (9%)
 Frame = +3

Query  45    MFVFITCSA---------FLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFG  197
             +FVFI  +          F+ +S  P + +  ++ P I N GDSNSDTG   +A      
Sbjct  4     LFVFIPMAPIVNNLSIVLFIFISFLPSSLSTILKYPAIINLGDSNSDTGNLISAGIETVN  63

Query  198   YPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTL  374
              P G+T+F+  S R CDGRLI+DFL + +   +L+PYL++L  P+FK G NFA  GS  L
Sbjct  64    PPYGQTYFNLPSGRYCDGRLIVDFLLDAMDMPFLNPYLDSLGLPNFKKGCNFAAAGSTIL  123

Query  375   P----KFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGE------EDFENALYMIDIGQ  524
             P        FS   Q+ QF RF+TRSLE  SK T G   E      + +   LYMIDIGQ
Sbjct  124   PANPTSVSPFSFDLQISQFIRFKTRSLELLSK-TVGRRYEKYLPPLDYYSKGLYMIDIGQ  182

Query  525   NDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTK  704
             NDIAGAF   S  QV+  IPS +   +  +  +Y+ GGR FW+HN+GP+GCL + +A   
Sbjct  183   NDIAGAFYSKSLDQVLASIPSILETFELGLKRLYEEGGRNFWIHNSGPLGCLAQNIAKFG  242

Query  705   VRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNS  884
               DP T+ +E GC+ S N+AA+ FN++L  L  + + +  D+ + YVDI++IK NLI+N 
Sbjct  243   T-DP-TKLDEFGCVSSHNQAAKLFNLQLHALSNKFQAQFPDSNVTYVDIFSIKSNLIANY  300

Query  885   AIYGFENPLMACCGGGGAP--YNANISCGQS----GFSV----CKDGSKYISWDGVHYTE  1034
             + +GFENPLMACCG GGAP  Y++ I+CGQ+    G SV    C D S+YI+WDG+HYTE
Sbjct  301   SRFGFENPLMACCGVGGAPLNYDSRITCGQTKVIDGISVTAKACNDSSEYINWDGIHYTE  360

Query  1035  DANAMVAASVLSTNYSTPPF  1094
              AN  V++ +L+  YS PPF
Sbjct  361   AANHFVSSQILTGKYSDPPF  380



>ref|NP_001174207.1| Os05g0133401 [Oryza sativa Japonica Group]
 dbj|BAH92935.1| Os05g0133401 [Oryza sativa Japonica Group]
Length=365

 Score =   302 bits (774),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 163/349 (47%), Positives = 217/349 (62%), Gaps = 14/349 (4%)
 Frame = +3

Query  90    PPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDF  269
             P +A   C    V+FNFGDSNSDTG  PAA G   G P GR FFHR + R  DGRL IDF
Sbjct  22    PGIAVGRC----VVFNFGDSNSDTGSLPAAFGFYLGPPAGRRFFHRQTGRWSDGRLYIDF  77

Query  270   LCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVL-FSLSTQLLQFNRFRTRSLE  446
             + E +K  YLSPY+E+    F +GVNFA+ G+    K  +   L TQ+ QF  F+ R+ E
Sbjct  78    IAEKLKISYLSPYMESSGSDFTSGVNFAVAGAAVTQKSAIPLGLDTQVNQFLHFKNRTRE  137

Query  447   FHSKGTNGMLGEEDFENALYMIDIGQNDIAGAF-SYLSKAQVIEKIPSFISEIKDAVWAI  623
                +G   M+ E +F +A+Y IDIGQNDI  AF + L+  +V  ++ +  + + DAV A+
Sbjct  138   LRPRGAGSMIAESEFRDAVYAIDIGQNDITLAFLANLTLPEVERELAASAAMVADAVRAL  197

Query  624   YKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCE  803
                G RKFWV+NTGP+GCLP+TLA  +   P  E +  GC+   N AA+ FN +L+  C 
Sbjct  198   RASGARKFWVYNTGPIGCLPQTLALRQ--KPGDELDAAGCLAEYNAAARSFNAELAAACR  255

Query  804   ELRHEM----KDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN-ANI-SCG  965
              L  E+      AT+V  D+Y IKY L +N + YGFE PLMACCG GG PYN AN+ +CG
Sbjct  256   RLAAELGGGEDGATVVCTDMYAIKYELFANHSRYGFERPLMACCGHGGPPYNYANLKTCG  315

Query  966   QSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             Q   + C +G +++ WDGVHYTEDANA+VA  +LS ++S+P       C
Sbjct  316   QPTATACPEGERHVIWDGVHYTEDANAIVARKILSGDFSSPRTKLKALC  364



>gb|AAT85172.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EEC78468.1| hypothetical protein OsI_18341 [Oryza sativa Indica Group]
Length=363

 Score =   302 bits (774),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 163/349 (47%), Positives = 217/349 (62%), Gaps = 14/349 (4%)
 Frame = +3

Query  90    PPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDF  269
             P +A   C    V+FNFGDSNSDTG  PAA G   G P GR FFHR + R  DGRL IDF
Sbjct  20    PGIAVGRC----VVFNFGDSNSDTGSLPAAFGFYLGPPAGRRFFHRQTGRWSDGRLYIDF  75

Query  270   LCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVL-FSLSTQLLQFNRFRTRSLE  446
             + E +K  YLSPY+E+    F +GVNFA+ G+    K  +   L TQ+ QF  F+ R+ E
Sbjct  76    IAEKLKISYLSPYMESSGSDFTSGVNFAVAGAAVTQKSAIPLGLDTQVNQFLHFKNRTRE  135

Query  447   FHSKGTNGMLGEEDFENALYMIDIGQNDIAGAF-SYLSKAQVIEKIPSFISEIKDAVWAI  623
                +G   M+ E +F +A+Y IDIGQNDI  AF + L+  +V  ++ +  + + DAV A+
Sbjct  136   LRPRGAGSMIAESEFRDAVYAIDIGQNDITLAFLANLTLPEVERELAASAAMVADAVRAL  195

Query  624   YKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCE  803
                G RKFWV+NTGP+GCLP+TLA  +   P  E +  GC+   N AA+ FN +L+  C 
Sbjct  196   RASGARKFWVYNTGPIGCLPQTLALRQ--KPGDELDAAGCLAEYNAAARSFNAELAAACR  253

Query  804   ELRHEM----KDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN-ANI-SCG  965
              L  E+      AT+V  D+Y IKY L +N + YGFE PLMACCG GG PYN AN+ +CG
Sbjct  254   RLAAELGGGEDGATVVCTDMYAIKYELFANHSRYGFERPLMACCGHGGPPYNYANLKTCG  313

Query  966   QSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
             Q   + C +G +++ WDGVHYTEDANA+VA  +LS ++S+P       C
Sbjct  314   QPTATACPEGERHVIWDGVHYTEDANAIVARKILSGDFSSPRTKLKALC  362



>ref|XP_011099272.1| PREDICTED: GDSL esterase/lipase At1g54790 [Sesamum indicum]
Length=381

 Score =   303 bits (775),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 156/359 (43%), Positives = 224/359 (62%), Gaps = 20/359 (6%)
 Frame = +3

Query  72    FLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDG  251
              L++   PL+ +     P +FNFGDSNSDTGG  A        P+G+ +F + S R CDG
Sbjct  13    LLLIICLPLSTSIDFNYPAVFNFGDSNSDTGGLVAGLAEALDPPNGQIYFQKPSGRFCDG  72

Query  252   RLIIDFLCENVKADYLSPYLEALT-PSFKNGVNFAIGGSQTLP----KFVLFSLSTQLLQ  416
             RLIIDFL + +   +L+PYL+++  PSF+ G NFA  GS  LP        FS   Q+ Q
Sbjct  73    RLIIDFLMDAMDLPFLNPYLDSIAAPSFRRGCNFAAAGSTILPATASSVSPFSFGIQVAQ  132

Query  417   FNRFRTRSLEFHSKGTNG---MLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPS  587
             F RF+ +  +  +K       +  ++ F+ ALYM DIGQND+AGAF   +  Q++  IP+
Sbjct  133   FFRFKAKVEDILAKTRKYDKYIPAQDYFQKALYMFDIGQNDLAGAFYSKTLDQILASIPT  192

Query  588   FISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAA  767
              + E +  + ++Y  G R FW+HNTGP+GCLP+ +A  K    + + +E GC+ S N+A+
Sbjct  193   ILLEFEHGIESLYDQGARNFWIHNTGPLGCLPQNIA--KFGTDSLKLDELGCVSSHNQAS  250

Query  768   QEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--  941
             +  N++L  LC++L+ +  DA I +VDI+TIK NLI+N + YGFE PLMACCG GG P  
Sbjct  251   RLLNLQLRALCKKLQGQYPDANITHVDIFTIKSNLIANYSRYGFEQPLMACCGYGGPPLN  310

Query  942   YNANISCGQS----GFSV----CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPF  1094
             Y++ I+CGQ+    G SV    C D ++Y++WDG+HYTE AN  VA+ V +  YS PPF
Sbjct  311   YDSGIACGQTKVLNGSSVTAKGCNDSTEYVNWDGIHYTEAANQYVASQVFTGKYSDPPF  369



>ref|XP_004494637.1| PREDICTED: GDSL esterase/lipase At1g54790-like isoform X1 [Cicer 
arietinum]
Length=384

 Score =   303 bits (775),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 155/343 (45%), Positives = 215/343 (63%), Gaps = 20/343 (6%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLS  302
             P +FN GDSNSDTG   A  G     P+G+ +F   S R CDGRLI+DFL + +   +L+
Sbjct  33    PAVFNLGDSNSDTGELAAGLGFQLAPPNGQNYFKTPSGRACDGRLILDFLMDALDLPFLN  92

Query  303   PYLEAL-TPSFKNGVNFAIGGSQTLP----KFVLFSLSTQLLQFNRFRTRSLEFHSKGTN  467
              YL++L  P+F+ G NFA  GS  LP        FS   Q+ QF RF+ R+LE  +KG  
Sbjct  93    AYLDSLGLPNFRKGCNFAAAGSTILPATASSISPFSFGIQVSQFLRFKARALELLAKGRK  152

Query  468   ---GMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGG  638
                 +  E+ FE  LYM DIGQND+AGAF   +  Q++  IP+ + E +  +  +Y  G 
Sbjct  153   FDKYVPSEDIFEKGLYMFDIGQNDLAGAFYSKTLDQILASIPTILLEFETGIKRLYDDGA  212

Query  639   RKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHE  818
             R FW+HNTGP+GCLP+ +A     DP ++ +E GC+ S N+AA+ FN++L  LC +L+ +
Sbjct  213   RYFWIHNTGPLGCLPQNVAKFGT-DP-SKLDEFGCVSSHNQAAKTFNLQLHALCSKLQGQ  270

Query  819   MKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQSGF-----  977
               D+ + YVDI+TIK NLI+N + YGFE P+MACCG GG P  Y++ +SCGQ+       
Sbjct  271   YPDSNVTYVDIFTIKSNLIANYSRYGFEQPIMACCGSGGPPLNYDSRVSCGQTKILNGTT  330

Query  978   ---SVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
                  C D S+YI+WDG+HYTE AN  VA+ +L+  YS PPF+
Sbjct  331   ISAKACNDSSEYINWDGIHYTETANQYVASQILTGKYSDPPFS  373



>ref|XP_010068405.1| PREDICTED: GDSL esterase/lipase LIP-4-like [Eucalyptus grandis]
Length=266

 Score =   298 bits (764),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 141/283 (50%), Positives = 192/283 (68%), Gaps = 17/283 (6%)
 Frame = +3

Query  270   LCENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEF  449
             +CE++   +LSPYLE+L P+F +G NFA+ G+ T P+   FSL  QL QF  FR+RS   
Sbjct  1     MCESLNTSFLSPYLESLGPNFSDGANFAVSGAATTPRDQPFSLGVQLRQFLLFRSRSPLL  60

Query  450   HSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYK  629
              S+G   ++GE+ F +ALY IDIGQND+   F  L   QVI  IP+FI EI+ A+W+IY 
Sbjct  61    LSRGHANLVGEDGFADALYTIDIGQNDLTAQFRTLPYLQVIGNIPTFIEEIRFAIWSIYH  120

Query  630   VGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEEL  809
              GG+ FW+HNTGP+GCLP  L         ++ +E GC++S N+AA+EFN +L  LCEEL
Sbjct  121   SGGKNFWLHNTGPLGCLPGILVAAG--HDASDIDELGCLRSRNDAAREFNRRLQSLCEEL  178

Query  810   RHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANISCGQSGFSVCK  989
             R +MK+ATIVYVD++ IKYNLI+N  I+GFENP  AC   G               +VC+
Sbjct  179   RTQMKNATIVYVDVFAIKYNLIANYTIHGFENPSKACYNNG---------------TVCE  223

Query  990   DGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
             + S+++SWDG+HYTE AN+ VA+ +LS NYSTPP  F++FC+ 
Sbjct  224   ESSRHVSWDGIHYTEAANSFVASRILSANYSTPPITFNFFCNV  266



>ref|XP_010414922.1| PREDICTED: GDSL esterase/lipase At1g54790-like isoform X2 [Camelina 
sativa]
Length=391

 Score =   302 bits (774),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 170/378 (45%), Positives = 232/378 (61%), Gaps = 30/378 (8%)
 Frame = +3

Query  45    MFVFITCSA---------FLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFG  197
             +FVFI  +          F+ +S  P + +  ++ P I N GDSNSDTG   +A      
Sbjct  4     LFVFIPMAPIVNNLSIVLFIFISFLPSSLSTILKYPAIINLGDSNSDTGNLISAGIETVN  63

Query  198   YPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTL  374
              P G+T+F+  S R CDGRLI+DFL + +   +L+PYL++L  P+FK G NFA  GS  L
Sbjct  64    PPYGQTYFNLPSGRYCDGRLIVDFLLDAMDMPFLNPYLDSLGLPNFKKGCNFAAAGSTIL  123

Query  375   P----KFVLFSLSTQLLQFNRFRTRSLEFHSKG---TNGMLGEEDF-ENALYMIDIGQND  530
             P        FS   Q+ QF RF+TRSLE  SK        L   D+    LYMIDIGQND
Sbjct  124   PANPTSVSPFSFDLQISQFIRFKTRSLELLSKTGRRYEKYLPPLDYYSKGLYMIDIGQND  183

Query  531   IAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVR  710
             IAGAF   S  QV+  IPS +   +  +  +Y+ GGR FW+HN+GP+GCL + +A     
Sbjct  184   IAGAFYSKSLDQVLASIPSILETFELGLKRLYEEGGRNFWIHNSGPLGCLAQNIAKFGT-  242

Query  711   DPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAI  890
             DP T+ +E GC+ S N+AA+ FN++L  L  + + +  D+ + YVDI++IK NLI+N + 
Sbjct  243   DP-TKLDEFGCVSSHNQAAKLFNLQLHALSNKFQAQFPDSNVTYVDIFSIKSNLIANYSR  301

Query  891   YGFENPLMACCGGGGAP--YNANISCGQS----GFSV----CKDGSKYISWDGVHYTEDA  1040
             +GFENPLMACCG GGAP  Y++ I+CGQ+    G SV    C D S+YI+WDG+HYTE A
Sbjct  302   FGFENPLMACCGVGGAPLNYDSRITCGQTKVIDGISVTAKACNDSSEYINWDGIHYTEAA  361

Query  1041  NAMVAASVLSTNYSTPPF  1094
             N  V++ +L+  YS PPF
Sbjct  362   NHFVSSQILTGKYSDPPF  379



>ref|XP_009420985.1| PREDICTED: GDSL esterase/lipase At1g54790-like [Musa acuminata 
subsp. malaccensis]
Length=381

 Score =   302 bits (773),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 164/367 (45%), Positives = 233/367 (63%), Gaps = 24/367 (7%)
 Frame = +3

Query  51    VFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAH-GNIFGYPDGRTFFHR  227
             VF    AF +LS   LA+A     P +FNFGDSNSDTG   AA  G     P+G+T+F R
Sbjct  8     VFAAVCAFCLLS---LASAVDFNYPAVFNFGDSNSDTGDLVAAGIGEPLLPPNGQTYFSR  64

Query  228   SSDRLCDGRLIIDFLCENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLP----KFVLF  392
              + R CDGRLIIDFL + +    L+ YL+++  P F  G NFA  GS  LP        F
Sbjct  65    PAGRFCDGRLIIDFLMDAMDMPLLNAYLDSIGAPIFHKGCNFAAAGSTILPATANSISPF  124

Query  393   SLSTQLLQFNRFRTRSLEFHSKGTN--GMLGEED-FENALYMIDIGQNDIAGAFSYLSKA  563
             S   Q+ QF +F+ R L+  +KG      + + D F   LYM DIGQND+AGAF Y ++ 
Sbjct  125   SFGVQVAQFFKFKDRVLQLLAKGKKFKKYIPQADYFSRGLYMFDIGQNDLAGAFYYKTED  184

Query  564   QVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGC  743
             QVI  IP+ + E ++ +  +Y+ G R+FW+HNTGP+GCL + +A    +DP ++ +E GC
Sbjct  185   QVIASIPTILLEFENGLKKLYEQGARRFWIHNTGPLGCLAQNIAFF-AKDP-SKLDEIGC  242

Query  744   IKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACC  923
             + S N+AA+ FN++L  LC +L+    DA+I Y+D+++IK+NLI+N + YGFENP+ ACC
Sbjct  243   VSSHNQAARLFNLQLHALCTKLQGVFGDASITYIDVFSIKFNLIANYSRYGFENPITACC  302

Query  924   GGGGAP--YNANISCGQS----GFSV----CKDGSKYISWDGVHYTEDANAMVAASVLST  1073
             G GG P  Y++ ISCGQ+    G SV    C D ++Y++WDG+HYTE AN  V++ +L+ 
Sbjct  303   GYGGLPLNYDSRISCGQTKVLDGGSVMAKACDDTTEYVNWDGIHYTEAANHHVSSQILTG  362

Query  1074  NYSTPPF  1094
              ++ PPF
Sbjct  363   KFADPPF  369



>ref|XP_010938793.1| PREDICTED: GDSL esterase/lipase At1g54790 [Elaeis guineensis]
Length=378

 Score =   302 bits (773),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 161/359 (45%), Positives = 225/359 (63%), Gaps = 21/359 (6%)
 Frame = +3

Query  78    VLSSPPLAAAECIRN-PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGR  254
             +L   P A A+   N P +FNFGDSNSDTG   AA       P+G+T+F R + R CDGR
Sbjct  11    ILLLIPFAFADVSFNYPAVFNFGDSNSDTGVRIAAGLESLELPNGQTYFRRPAGRFCDGR  70

Query  255   LIIDFLCENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLP----KFVLFSLSTQLLQF  419
             LIIDFL + +   +L+ YL+++  PSF+ G NFA  GS  LP        FS   Q+ QF
Sbjct  71    LIIDFLMDAMDMPFLNAYLDSVGAPSFQKGCNFAAAGSAILPATASSVSPFSFGIQVAQF  130

Query  420   NRFRTRSLEFHSKG---TNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSF  590
              RF+ R LE   +G   T  +   + F   LYM DIGQND+AGAF   ++ QVI  IP+ 
Sbjct  131   FRFKDRVLELLGEGNKYTRYIPMVDFFSQGLYMFDIGQNDLAGAFYSKTEDQVIASIPTI  190

Query  591   ISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQ  770
             + E +  +  +Y  G R+FW+HNTGP+GCLP+ +AT   +DP  + +E GC+ + N AA+
Sbjct  191   LVEFETGLKQLYNQGARRFWIHNTGPLGCLPQNIATFG-KDP-LKLDELGCVNAHNRAAK  248

Query  771   EFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--Y  944
              FN++L  LC +L+ +  DA + Y+DI++IKYNL++N + YGFE+P  ACCG GG P  Y
Sbjct  249   LFNLQLHALCTKLQGQFADANVTYIDIFSIKYNLVANFSRYGFEHPTTACCGYGGPPLNY  308

Query  945   NANISCGQS----GFSV----CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
             ++ I CGQ+    G SV    C D ++Y+SWDG+HYTE  N  V++ +L+  YS PPF+
Sbjct  309   DSRIPCGQTKIFNGSSVTAKGCNDTTEYVSWDGIHYTEAGNLHVSSQILTGKYSDPPFS  367



>ref|XP_004230167.1| PREDICTED: GDSL esterase/lipase At1g54790 [Solanum lycopersicum]
Length=381

 Score =   302 bits (773),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 161/358 (45%), Positives = 219/358 (61%), Gaps = 20/358 (6%)
 Frame = +3

Query  75    LVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGR  254
             L+    PLA       P +FNFGDSNSDTGG  A  G+    P+G+T+F   S R CDGR
Sbjct  14    LIFICLPLANTIDFNYPAVFNFGDSNSDTGGLVAGVGDRLEPPNGQTYFKNPSGRFCDGR  73

Query  255   LIIDFLCENVKADYLSPYLEALT-PSFKNGVNFAIGGSQTLPKFVL----FSLSTQLLQF  419
             LIIDFL + +   +L+ YL+++  PSFK G NFA  GS  LP        FS   Q+ QF
Sbjct  74    LIIDFLMDAMDLPFLNSYLDSVAAPSFKKGANFAAAGSTILPATASSVSPFSFGIQVAQF  133

Query  420   NRFRTRSLEFHSKGT--NGMLGEEDF-ENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSF  590
              RF+ R  E  +K    +  L  +DF +  LYM DIGQND+AG F   +  Q++  IP+ 
Sbjct  134   LRFKNRVSEIQAKTRKYDKYLPAQDFFQKGLYMFDIGQNDLAGGFYSKTLDQILASIPTI  193

Query  591   ISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQ  770
             +S  +D V  +Y +G R FWVHNTGP+GCL + +A  K     ++ +E GC+ S N+AA+
Sbjct  194   LSGFEDGVKRLYDLGARNFWVHNTGPLGCLGQNIA--KFGTDVSKLDELGCVSSHNQAAK  251

Query  771   EFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--Y  944
               N++L  LC++L+ +  DA I +VDI++IK NLI+N +  GFE PLMACCG GG P  Y
Sbjct  252   LLNLQLYALCKKLQGQYSDANITHVDIFSIKSNLIANYSRNGFEQPLMACCGYGGPPLNY  311

Query  945   NANISCGQSGF--------SVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPF  1094
             ++ I+CGQ+            C D S+YI+WDG+HYTE AN  VA+ +L+  YS PPF
Sbjct  312   DSRIACGQTKVLDGNNVTAKACNDSSEYINWDGIHYTETANQFVASQILTGKYSDPPF  369



>ref|XP_008246516.1| PREDICTED: GDSL esterase/lipase At1g54790 isoform X1 [Prunus 
mume]
Length=380

 Score =   301 bits (772),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 164/359 (46%), Positives = 223/359 (62%), Gaps = 20/359 (6%)
 Frame = +3

Query  75    LVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGR  254
             L+  S PLA +    +P +FNFGDSNSDTG   +A       P+G+ +F   S R  DGR
Sbjct  13    LISISLPLAKSIHFDHPAVFNFGDSNSDTGNLVSAGIETLVSPNGQIYFKNPSGRYSDGR  72

Query  255   LIIDFLCENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLPKFVL----FSLSTQLLQF  419
             LI+DFL   ++  +L+ YL+++  PSFK G NFA  GS  LP        FS   Q+ QF
Sbjct  73    LIVDFLMNAMELPFLNAYLDSVGLPSFKKGCNFAAAGSTILPATATSICPFSFGIQVNQF  132

Query  420   NRFRTRSLEFHSKGTN--GMLGEEDF-ENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSF  590
              RF+ R LE  +KG N    L  EDF    LYM DIGQND+AGAF   +  Q++  IP+ 
Sbjct  133   LRFKARVLELLAKGKNFSKYLPTEDFFSKGLYMFDIGQNDLAGAFYSKTLDQILASIPTI  192

Query  591   ISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQ  770
             + E +  +  +Y  GGR FW+HNTGP+GCL + +A     DP +  +E GC+ S NEAA+
Sbjct  193   LLEFETGLKKLYDQGGRNFWIHNTGPLGCLTQNVAKFGT-DP-SRLDERGCVSSHNEAAK  250

Query  771   EFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--Y  944
              FN++L  L ++L+ +  DA +VYVDI+ IKY LISN + YGFE  +MACCG GG P  Y
Sbjct  251   LFNLQLHALTKKLQGQYADANVVYVDIFLIKYELISNYSRYGFEQSIMACCGYGGPPLNY  310

Query  945   NANISCGQS----GFSV----CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
             ++ I+CGQ+    G SV    C+D + Y+SWDG+HYTE AN  V++ +L+  YS PPF+
Sbjct  311   DSQITCGQTKTLNGTSVTAKGCRDSTDYVSWDGIHYTEAANQFVSSKILTGKYSDPPFS  369



>ref|XP_010511213.1| PREDICTED: GDSL esterase/lipase At1g54790 isoform X1 [Camelina 
sativa]
Length=392

 Score =   302 bits (773),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 167/361 (46%), Positives = 225/361 (62%), Gaps = 21/361 (6%)
 Frame = +3

Query  72    FLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDG  251
             F+ +S  P + +  ++ P I N GDSNSDTG   +A       P G+T+F+  S R CDG
Sbjct  23    FIFISFLPSSLSTILKYPAIINLGDSNSDTGNLISAGIESVNPPYGQTYFNLPSGRYCDG  82

Query  252   RLIIDFLCENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLP----KFVLFSLSTQLLQ  416
             RLI+DFL + +   +L+PYL++L  P+FK G NFA  GS  LP        FS   Q+ Q
Sbjct  83    RLIVDFLLDAMDMPFLNPYLDSLGLPNFKKGCNFAAAGSTILPANPTSVSPFSFDLQISQ  142

Query  417   FNRFRTRSLEFHSKG---TNGMLGEEDF-ENALYMIDIGQNDIAGAFSYLSKAQVIEKIP  584
             F RF+TRSLE  SK        L   D+    LYMIDIGQNDIAGAF   S  QV+  IP
Sbjct  143   FIRFKTRSLELLSKTGRRYEKYLPPLDYYSKGLYMIDIGQNDIAGAFYSKSLDQVLASIP  202

Query  585   SFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEA  764
             S +   +  +  +Y  GGR FW+HNTGP+GCL + +A     DP T+ +E GC+ S N+A
Sbjct  203   SILETFEAGLKRLYVEGGRNFWIHNTGPLGCLAQNIAKFGT-DP-TKLDEFGCVSSHNQA  260

Query  765   AQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP-  941
             A+ FN++L  L  + + +  D+ + YVDI++IK NLI+N + +GFENPLMACCG GGAP 
Sbjct  261   AKLFNLQLHALSNKFQAQFPDSNVTYVDIFSIKSNLIANYSRFGFENPLMACCGVGGAPL  320

Query  942   -YNANISCGQS----GFSV----CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPF  1094
              Y+  I+CGQ+    G SV    C D S+YI+WDG+HYTE AN  V++ +L+  YS PPF
Sbjct  321   NYDTRITCGQTKVIDGISVTAKACNDSSEYINWDGIHYTEAANNFVSSQILTGKYSDPPF  380

Query  1095  N  1097
             +
Sbjct  381   S  381



>ref|XP_009405865.1| PREDICTED: GDSL esterase/lipase At1g54790-like [Musa acuminata 
subsp. malaccensis]
Length=380

 Score =   301 bits (772),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 155/343 (45%), Positives = 218/343 (64%), Gaps = 21/343 (6%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAH-GNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYL  299
             P +FNFGDSNSDTG   AA  G+    P+GR +F + + R CDGRLIIDFL + +   +L
Sbjct  28    PAVFNFGDSNSDTGDLIAAGIGDPLLPPNGRAYFSKPAGRFCDGRLIIDFLMDAMDMPFL  87

Query  300   SPYLEAL-TPSFKNGVNFAIGGSQTLP--KFVL--FSLSTQLLQFNRFRTRSLEFHSKGT  464
             + YL+++  PSF+ G NFA  GS  LP  K+ +  FS   Q+ QF RF+ + L+  +KG 
Sbjct  88    NAYLDSVGAPSFQKGCNFAAAGSTILPATKYSVSPFSFDIQVAQFFRFKNQVLQLQTKGK  147

Query  465   N---GMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVG  635
                  +   + F+  LYM DIGQND+AGAF   ++ QVI  IP  +SE +  +  +Y  G
Sbjct  148   KIRKSIPQADYFDQGLYMFDIGQNDLAGAFYSKTEEQVIASIPKILSEFESGLKKLYDQG  207

Query  636   GRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRH  815
              RKFW+HNTGP+GCL + +     +DP ++ ++ GC+ S N AA+ FN++L  LC +LR 
Sbjct  208   ARKFWIHNTGPLGCLSQNIVIFG-KDP-SKLDKFGCVSSHNRAAKLFNIQLHTLCTKLRG  265

Query  816   EMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQSGF----  977
                DATI Y+D++TIK+NLI+N + YGFENP+ ACCG  G P  Y+  I+CGQ+      
Sbjct  266   VFADATITYIDVFTIKFNLIANFSRYGFENPIAACCGYSGLPLNYDPRIACGQTKVLKGR  325

Query  978   ----SVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPF  1094
                   C D ++YI+WDG+HYTE AN  V++ +L+  YS PPF
Sbjct  326   SATAKACNDATEYINWDGIHYTEAANLHVSSQILTGRYSDPPF  368



>emb|CDP17963.1| unnamed protein product [Coffea canephora]
Length=380

 Score =   301 bits (772),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 152/342 (44%), Positives = 219/342 (64%), Gaps = 20/342 (6%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLS  302
             P +FNFGDSNSDTGG  A  G     P+G+T+F + S R CDGRLIIDFL + ++  YL+
Sbjct  29    PAVFNFGDSNSDTGGLVAGVGESLLPPNGQTYFKKPSGRFCDGRLIIDFLMDALELPYLN  88

Query  303   PYLEAL-TPSFKNGVNFAIGGSQTLPK----FVLFSLSTQLLQFNRFRTRSLEFHSKGTN  467
             PYL+++  PSFK G +FA+  S  LP        FS   Q+ QF RF++R L+   KG  
Sbjct  89    PYLDSIGAPSFKRGCDFAVAASTILPATANAISPFSFGVQVDQFIRFKSRVLDLQPKGRK  148

Query  468   G---MLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGG  638
                 +   + F+  LY  DIGQND+AGAF   +  Q+I  IP+ ++E +  +  +Y  G 
Sbjct  149   SDKYIPAADVFQKGLYTFDIGQNDLAGAFYSKTYDQIIASIPTILAEFEAGIKKLYDEGA  208

Query  639   RKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHE  818
             R FW+HNTGP+GCL + +A     DP ++ +E GC+ + N+A++  N++L  LC++L+ +
Sbjct  209   RNFWIHNTGPLGCLAQNIAKFGT-DP-SKLDELGCVITHNQASKLLNLQLYALCKKLQGQ  266

Query  819   MKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQS----GFS  980
               DA + +VDI++IK NLI+N + YGFE P+M CCG GG P  Y++ I+CGQ+    G S
Sbjct  267   YSDANVTHVDIFSIKSNLIANYSKYGFEQPIMVCCGTGGPPLNYDSRITCGQTKVLNGTS  326

Query  981   V----CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPF  1094
             V    C D ++Y++WDG+HYTE AN  VA+ +L+  YS PPF
Sbjct  327   VTVKACNDSTEYVNWDGIHYTEAANHFVASQILTGKYSDPPF  368



>gb|KDO46014.1| hypothetical protein CISIN_1g0171852mg, partial [Citrus sinensis]
Length=298

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 154/287 (54%), Positives = 204/287 (71%), Gaps = 7/287 (2%)
 Frame = +3

Query  39   AAMFVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTF  218
            ++   F  C  FL  +SP   AA+C   PVIFNFGDSNSDTGG  A  G     P+GRTF
Sbjct  17   SSFLFFGLCVCFL--ASP--VAAQCKNPPVIFNFGDSNSDTGGLFAGLGFPVDLPNGRTF  72

Query  219  FHRSSDRLCDGRLIIDFLCENVKADYLSPYLEALTPS-FKNGVNFAIGGSQTLPKFVLFS  395
            F RS+ RL DGRL+IDFLC+++ A  LSPYL++L+ S F NG NFA+ GS TLPK+V FS
Sbjct  73   FGRSTGRLSDGRLLIDFLCQSLNASLLSPYLDSLSGSKFNNGANFAVVGSSTLPKYVPFS  132

Query  396  LSTQLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVI  572
            L+ Q++QF  F+ R+LE  + G+   + +E F NALYM DIGQND+A +FS  L+  +VI
Sbjct  133  LNIQVMQFLHFKARTLELVTAGSGNFIDDEGFRNALYMTDIGQNDLADSFSKNLTYIEVI  192

Query  573  EKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKS  752
            ++IPS ISEIK+AV  +Y  GGRKFW+HNTGP+GCLP+ L+  ++     + +  GCI S
Sbjct  193  KRIPSVISEIKNAVKTLYDHGGRKFWIHNTGPLGCLPQKLSLIQLLQ-KKDLDTYGCISS  251

Query  753  LNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIY  893
             N AA+ FN  L  LC+++R E+KDATIV+VDI++IKY+LI+NS  Y
Sbjct  252  YNAAARLFNEALLHLCQKMRSELKDATIVHVDIFSIKYDLIANSTKY  298



>ref|XP_008812793.1| PREDICTED: GDSL esterase/lipase At1g54790 [Phoenix dactylifera]
Length=384

 Score =   301 bits (770),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 165/363 (45%), Positives = 227/363 (63%), Gaps = 24/363 (7%)
 Frame = +3

Query  66    SAFLVLSSPPLAAAECIRN-PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRL  242
             S FL++   PLA A+   N P IFNFGDSNSDTG   AA       P+G ++F R   R 
Sbjct  16    SIFLLI---PLAFADISFNYPAIFNFGDSNSDTGARIAAGLESLEPPNGGSYFRRPVGRF  72

Query  243   CDGRLIIDFLCENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLP----KFVLFSLSTQ  407
             CDGRLIIDFL + +   +L+ YL+++  PSF+ G NFA  GS  LP        FS   Q
Sbjct  73    CDGRLIIDFLTDAMDMPFLNAYLDSVGAPSFQKGCNFAAAGSTILPATASSVSPFSFGIQ  132

Query  408   LLQFNRFRTRSLEFHSKGTN--GMLGEEDF-ENALYMIDIGQNDIAGAFSYLSKAQVIEK  578
             + QF RF+ R LE  + G      + + DF    LYM D+GQND+AGAF   +  QVI  
Sbjct  133   VAQFFRFKDRVLELLATGNKYKRYIPQVDFFSQGLYMFDMGQNDLAGAFYSKTDDQVIAS  192

Query  579   IPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLN  758
             IP+ + E +  +  +Y  G R+FW+HNTGP+GCLP+ +     +DP ++ +E GC+ S N
Sbjct  193   IPTILVEFQTGLKQLYDQGARRFWIHNTGPLGCLPQNIGIFG-KDP-SKLDELGCVNSQN  250

Query  759   EAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGA  938
              AA+ FN++L  LC +L+ E  DA I Y+DI++IKYNLI+N + YGFE+P+ ACCG GG 
Sbjct  251   RAAKLFNLQLHALCTKLQGEFADANITYIDIFSIKYNLIANFSRYGFEHPITACCGYGGP  310

Query  939   P--YNANISCGQS----GFSV----CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTP  1088
             P  Y++ ISCGQ+    G SV    C D + Y++WDG+HYT+ AN  V++ +L+  YS P
Sbjct  311   PLNYDSRISCGQTKIFNGSSVTAKGCNDTTDYVNWDGIHYTDAANLHVSSQILTGKYSDP  370

Query  1089  PFN  1097
             PF+
Sbjct  371   PFS  373



>ref|XP_006361875.1| PREDICTED: GDSL esterase/lipase At1g54790-like [Solanum tuberosum]
Length=381

 Score =   300 bits (768),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 156/352 (44%), Positives = 217/352 (62%), Gaps = 20/352 (6%)
 Frame = +3

Query  93    PLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFL  272
             PLA       P +FNFGDSNSDTGG  A  G+    P+G+T+F   S R CDGRLIIDFL
Sbjct  20    PLANTIDFNYPAVFNFGDSNSDTGGLVAGVGDRLEPPNGQTYFKNPSGRFCDGRLIIDFL  79

Query  273   CENVKADYLSPYLEALT-PSFKNGVNFAIGGSQTLPKFVL----FSLSTQLLQFNRFRTR  437
              + +   +L+ YL+++  PSF+ G NFA  GS  LP        FS   Q+ QF+RF+ R
Sbjct  80    MDAMDLPFLNSYLDSVAAPSFRKGANFAAAGSTILPATASSVSPFSFGIQVAQFSRFKNR  139

Query  438   SLEFHSKGTNG---MLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKD  608
               E  +K       +  ++ F+  LYM DIGQND+AG F   +  Q++  IP+ ++  +D
Sbjct  140   VSEIQAKTRKYDKYVPAQDFFQKGLYMFDIGQNDLAGGFYSKTLDQILASIPTILTGFED  199

Query  609   AVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKL  788
              V  +Y +G R FWVHNTGP+GCL + +A  K     ++ +E GC+ S N+AA+  N++L
Sbjct  200   GVKRLYDLGARNFWVHNTGPLGCLGQNIA--KFGTDVSKLDELGCVSSHNQAAKLLNLQL  257

Query  789   SDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISC  962
               LC++L+ +  DA I +VDI++IK NLI+N +  GFE PLMACCG GG P  Y++ I+C
Sbjct  258   YALCKKLQGQYSDANITHVDIFSIKSNLIANYSRNGFEQPLMACCGYGGPPLNYDSRIAC  317

Query  963   GQSGF--------SVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPF  1094
             GQ+            C D S+YI+WDG+HYTE AN  VA+ +L+  YS PPF
Sbjct  318   GQTKVLDGNNVTAKACNDSSEYINWDGIHYTETANQFVASQILTGKYSDPPF  369



>ref|XP_004494638.1| PREDICTED: GDSL esterase/lipase At1g54790-like isoform X2 [Cicer 
arietinum]
Length=381

 Score =   299 bits (766),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 156/343 (45%), Positives = 214/343 (62%), Gaps = 20/343 (6%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLS  302
             P  FN GDSNSDTG   AA       P G+T+FH  S R  DGRLI+DFL + +   +L+
Sbjct  30    PAAFNLGDSNSDTGTLIAAGIESLYPPYGQTYFHVPSGRYSDGRLIVDFLMDALDLPFLN  89

Query  303   PYLEAL-TPSFKNGVNFAIGGSQTLP----KFVLFSLSTQLLQFNRFRTRSLEFHSKGTN  467
              YL++L  P+F+ G NFA  GS  LP        FS   Q+ QF RF+ R+LE  +KG  
Sbjct  90    AYLDSLGLPNFRKGCNFAAAGSTILPATASSISPFSFGIQVSQFLRFKARALELLAKGRK  149

Query  468   ---GMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGG  638
                 +  E+ FE  LYM DIGQND+AGAF   +  Q++  IP+ + E +  +  +Y  G 
Sbjct  150   FDKYVPSEDIFEKGLYMFDIGQNDLAGAFYSKTLDQILASIPTILLEFETGIKRLYDDGA  209

Query  639   RKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHE  818
             R FW+HNTGP+GCLP+ +A     DP ++ +E GC+ S N+AA+ FN++L  LC +L+ +
Sbjct  210   RYFWIHNTGPLGCLPQNVAKFGT-DP-SKLDEFGCVSSHNQAAKTFNLQLHALCSKLQGQ  267

Query  819   MKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQSGF-----  977
               D+ + YVDI+TIK NLI+N + YGFE P+MACCG GG P  Y++ +SCGQ+       
Sbjct  268   YPDSNVTYVDIFTIKSNLIANYSRYGFEQPIMACCGSGGPPLNYDSRVSCGQTKILNGTT  327

Query  978   ---SVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
                  C D S+YI+WDG+HYTE AN  VA+ +L+  YS PPF+
Sbjct  328   ISAKACNDSSEYINWDGIHYTETANQYVASQILTGKYSDPPFS  370



>dbj|BAJ97713.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=437

 Score =   301 bits (770),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 153/324 (47%), Positives = 201/324 (62%), Gaps = 12/324 (4%)
 Frame = +3

Query  126   VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSP  305
             V+FNFGDSNSDTGG  AA G     P+GRT+F R + RL DGR+IIDF+C ++K   L+P
Sbjct  104   VLFNFGDSNSDTGGVAAAGGIHIMPPEGRTYFRRPTGRLSDGRVIIDFICASLKTHELNP  163

Query  306   YLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEE  485
             YL+A+   + NGVNFA+ GS        +SL+ Q+ QF  F+ RSLE    G  G + +E
Sbjct  164   YLKAVGSDYSNGVNFAMAGSTVSHGVSPYSLNVQVDQFVYFKRRSLELIELGLKGPVNKE  223

Query  486   DFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTG  665
              FENALYM+DIG ND+AG     S  Q  +K+   + EI DA+  +Y  G RKFW+H TG
Sbjct  224   GFENALYMMDIGHNDVAGVMHTPSD-QWDKKLRQIVGEIGDAMRILYDNGARKFWIHGTG  282

Query  666   PVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYV  845
              +GCLP  +    V++   E +  GC+ S N AAQ FN KLSDLC+E+R  +KDAT+VY 
Sbjct  283   ALGCLPALV----VQEKGGEHDAHGCLASHNRAAQAFNKKLSDLCDEVRLRLKDATVVYT  338

Query  846   DIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN---ANISCGQSGFSVCKDGSKYISWD  1016
             D++ IKY  ++N   YG E PLM CCG GG PYN       CG     +C    K +SWD
Sbjct  339   DMFAIKYGFVANHTKYGIEWPLMVCCGNGGPPYNFMPGKYGCGD----LCGPEEKVLSWD  394

Query  1017  GVHYTEDANAMVAASVLSTNYSTP  1088
             GVH+T+  + + A   +S  YS P
Sbjct  395   GVHFTDFGSGLAAKHAMSGEYSKP  418



>ref|XP_008246517.1| PREDICTED: GDSL esterase/lipase At1g54790 isoform X2 [Prunus 
mume]
Length=376

 Score =   298 bits (764),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 168/373 (45%), Positives = 226/373 (61%), Gaps = 29/373 (8%)
 Frame = +3

Query  33    QRAAMFVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGR  212
             + A + +F   S FL +S P          P +FNFGDSNSDTG   A  G     P G+
Sbjct  4     KNAILQIFSLLSIFLPISKPKF------YYPAVFNFGDSNSDTGELAAGLGF---QPYGQ  54

Query  213   TFFHRSSDRLCDGRLIIDFLCENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLPKFVL  389
             T+F   S R  DGRL+IDFL   ++  +L+ YL+++  PSFK G NFA  GS  LP    
Sbjct  55    TYFKTPSGRFSDGRLMIDFLMNAMELPFLNAYLDSVGLPSFKKGCNFAAAGSTILPATAT  114

Query  390   ----FSLSTQLLQFNRFRTRSLEFHSKGTN--GMLGEEDF-ENALYMIDIGQNDIAGAFS  548
                 FS   Q+ QF RF+ R LE  +KG N    L  EDF    LYM DIGQND+AGAF 
Sbjct  115   SICPFSFGIQVNQFLRFKARVLELLAKGKNFSKYLPTEDFFSKGLYMFDIGQNDLAGAFY  174

Query  549   YLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEF  728
               +  Q++  IP+ + E +  +  +Y  GGR FW+HNTGP+GCL + +A     DP +  
Sbjct  175   SKTLDQILASIPTILLEFETGLKKLYDQGGRNFWIHNTGPLGCLTQNVAKFGT-DP-SRL  232

Query  729   EETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENP  908
             +E GC+ S NEAA+ FN++L  L ++L+ +  DA +VYVDI+ IKY LISN + YGFE  
Sbjct  233   DERGCVSSHNEAAKLFNLQLHALTKKLQGQYADANVVYVDIFLIKYELISNYSRYGFEQS  292

Query  909   LMACCGGGGAP--YNANISCGQS----GFSV----CKDGSKYISWDGVHYTEDANAMVAA  1058
             +MACCG GG P  Y++ I+CGQ+    G SV    C+D + Y+SWDG+HYTE AN  V++
Sbjct  293   IMACCGYGGPPLNYDSQITCGQTKTLNGTSVTAKGCRDSTDYVSWDGIHYTEAANQFVSS  352

Query  1059  SVLSTNYSTPPFN  1097
              +L+  YS PPF+
Sbjct  353   KILTGKYSDPPFS  365



>ref|XP_004139196.1| PREDICTED: GDSL esterase/lipase At1g54790-like [Cucumis sativus]
Length=379

 Score =   298 bits (764),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 158/353 (45%), Positives = 215/353 (61%), Gaps = 20/353 (6%)
 Frame = +3

Query  93    PLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFL  272
             P A +     P +FNFGDSNSDTG   ++     G P G  FF   S R CDGRLI+DFL
Sbjct  18    PTARSSHFNRPAVFNFGDSNSDTGCLVSSGIEAIGPPYGHLFFGNPSGRYCDGRLILDFL  77

Query  273   CENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLP----KFVLFSLSTQLLQFNRFRTR  437
              + +   YL+PYL++L  P+F+ G N+A   S  LP     F  FS   Q+ QF  F+ R
Sbjct  78    LDAMDMPYLNPYLDSLGAPNFRKGCNYAAAASTVLPATPTSFSPFSFGVQVNQFIHFKAR  137

Query  438   SLEFHSKGT--NGMLGEED-FENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKD  608
              LE  SKG   +  L +ED FE  LYM DIGQND+A AF   +  Q++  IP+ ++  + 
Sbjct  138   VLELRSKGKKLDKYLPDEDYFEKGLYMFDIGQNDLAIAFYSKTLDQILASIPTILAVFET  197

Query  609   AVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKL  788
              +  +Y  G R FW+HNTGP+GCL + +A     DP +  +E GC+ S N+AA+ FN++L
Sbjct  198   GLQKLYDQGARNFWIHNTGPLGCLAQNVARFGT-DP-SNLDELGCVSSHNQAAKLFNLQL  255

Query  789   SDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISC  962
               LC+EL+ E  D  + YVDIYTIK NLI+N + +GFE P+MACCG GG P  Y++ I C
Sbjct  256   HALCKELQEEYTDTNVTYVDIYTIKSNLIANYSRFGFEQPIMACCGYGGPPLNYDSRIIC  315

Query  963   GQSGF--------SVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
             GQ+            C D S+YI+WDG+HY+E AN  V++ +L+  YS PPF+
Sbjct  316   GQTKILNGTVVTAKGCDDSSEYINWDGIHYSEAANQYVSSQILTGKYSDPPFS  368



>gb|KCW63693.1| hypothetical protein EUGRSUZ_G01346, partial [Eucalyptus grandis]
Length=264

 Score =   295 bits (754),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/281 (50%), Positives = 190/281 (68%), Gaps = 17/281 (6%)
 Frame = +3

Query  276   ENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHS  455
             E++   +LSPYLE+L P+F +G NFA+ G+ T P+   FSL  QL QF  FR+RS    S
Sbjct  1     ESLNTSFLSPYLESLGPNFSDGANFAVSGAATTPRDQPFSLGVQLRQFLLFRSRSPLLLS  60

Query  456   KGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVG  635
             +G   ++GE+ F +ALY IDIGQND+   F  L   QVI  IP+FI EI+ A+W+IY  G
Sbjct  61    RGHANLVGEDGFADALYTIDIGQNDLTAQFRTLPYLQVIGNIPTFIEEIRFAIWSIYHSG  120

Query  636   GRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRH  815
             G+ FW+HNTGP+GCLP  L         ++ +E GC++S N+AA+EFN +L  LCEELR 
Sbjct  121   GKNFWLHNTGPLGCLPGILVAAG--HDASDIDELGCLRSRNDAAREFNRRLQSLCEELRT  178

Query  816   EMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANISCGQSGFSVCKDG  995
             +MK+ATIVYVD++ IKYNLI+N  I+GFENP  AC   G               +VC++ 
Sbjct  179   QMKNATIVYVDVFAIKYNLIANYTIHGFENPSKACYNNG---------------TVCEES  223

Query  996   SKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
             S+++SWDG+HYTE AN+ VA+ +LS NYSTPP  F++FC+ 
Sbjct  224   SRHVSWDGIHYTEAANSFVASRILSANYSTPPITFNFFCNV  264



>gb|KGN60869.1| hypothetical protein Csa_2G020920 [Cucumis sativus]
Length=379

 Score =   298 bits (764),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 158/353 (45%), Positives = 215/353 (61%), Gaps = 20/353 (6%)
 Frame = +3

Query  93    PLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFL  272
             P A +     P +FNFGDSNSDTG   ++     G P G  FF   S R CDGRLI+DFL
Sbjct  18    PTARSSHFNRPAVFNFGDSNSDTGCLVSSGIEAIGPPYGHLFFGNPSGRYCDGRLILDFL  77

Query  273   CENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLP----KFVLFSLSTQLLQFNRFRTR  437
              + +   YL+PYL++L  P+F+ G N+A   S  LP     F  FS   Q+ QF  F+ R
Sbjct  78    LDAMDMPYLNPYLDSLGAPNFRKGCNYAAAASTVLPATPTSFSPFSFGVQVNQFIHFKAR  137

Query  438   SLEFHSKGT--NGMLGEED-FENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKD  608
              LE  SKG   +  L +ED FE  LYM DIGQND+A AF   +  Q++  IP+ ++  + 
Sbjct  138   VLELRSKGKKLDKYLPDEDYFEKGLYMFDIGQNDLAIAFYSKTLDQILASIPTILAVFET  197

Query  609   AVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKL  788
              +  +Y  G R FW+HNTGP+GCL + +A     DP +  +E GC+ S N+AA+ FN++L
Sbjct  198   GLQKLYDQGARNFWIHNTGPLGCLAQNVARFGT-DP-SNLDELGCVSSHNQAAKLFNLQL  255

Query  789   SDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISC  962
               LC+EL+ E  D  + YVDIYTIK NLI+N + +GFE P+MACCG GG P  Y++ I C
Sbjct  256   HALCKELQEEYTDTNVTYVDIYTIKSNLIANYSRFGFEQPIMACCGYGGPPLNYDSRIIC  315

Query  963   GQSGF--------SVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
             GQ+            C D S+YI+WDG+HY+E AN  V++ +L+  YS PPF+
Sbjct  316   GQTKILNGTVVTAKGCDDSSEYINWDGIHYSEAANKYVSSQILTGKYSDPPFS  368



>ref|XP_010511214.1| PREDICTED: GDSL esterase/lipase At1g54790 isoform X2 [Camelina 
sativa]
Length=382

 Score =   298 bits (764),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 165/343 (48%), Positives = 215/343 (63%), Gaps = 25/343 (7%)
 Frame = +3

Query  132   FNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSPYL  311
             FNFGDSNSDTG   A  G     P G+  F  SS R CDGRL+IDFL + +   +L+PYL
Sbjct  33    FNFGDSNSDTGDLVAGLGIRLDLPYGQNSFKTSSQRFCDGRLLIDFLMDAMDMPFLNPYL  92

Query  312   EAL-TPSFKNGVNFAIGGSQTLP----KFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGML  476
             ++L  P+FK G NFA  GS  LP        FS   Q+ QF RF+TRSLE  SK   G  
Sbjct  93    DSLGLPNFKKGCNFAAAGSTILPANPTSVSPFSFDLQISQFIRFKTRSLELLSK--TGRR  150

Query  477   GE------EDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGG  638
              E      + +   LYMIDIGQNDIAGAF   S  QV+  IPS +   +  +  +Y  GG
Sbjct  151   YEKYLPPLDYYSKGLYMIDIGQNDIAGAFYSKSLDQVLASIPSILETFEAGLKRLYVEGG  210

Query  639   RKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHE  818
             R FW+HNTGP+GCL + +A     DP T+ +E GC+ S N+AA+ FN++L  L  + + +
Sbjct  211   RNFWIHNTGPLGCLAQNIAKFGT-DP-TKLDEFGCVSSHNQAAKLFNLQLHALSNKFQAQ  268

Query  819   MKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQS----GFS  980
               D+ + YVDI++IK NLI+N + +GFENPLMACCG GGAP  Y+  I+CGQ+    G S
Sbjct  269   FPDSNVTYVDIFSIKSNLIANYSRFGFENPLMACCGVGGAPLNYDTRITCGQTKVIDGIS  328

Query  981   V----CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
             V    C D S+YI+WDG+HYTE AN  V++ +L+  YS PPF+
Sbjct  329   VTAKACNDSSEYINWDGIHYTEAANNFVSSQILTGKYSDPPFS  371



>ref|XP_006654078.1| PREDICTED: GDSL esterase/lipase LIP-4-like [Oryza brachyantha]
Length=430

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/321 (46%), Positives = 206/321 (64%), Gaps = 9/321 (3%)
 Frame = +3

Query  129   IFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSPY  308
             +FNFGDSNSDTGG  AA G     P+GRT+FH  + RL DGR+IIDF+CE++    L+PY
Sbjct  100   LFNFGDSNSDTGGVAAAGGIRIMPPEGRTYFHHPTGRLSDGRVIIDFICESLNTRELNPY  159

Query  309   LEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEED  488
             L+++   + NGVNFA+ GS        +SL+ Q+ QF  F+ RSLE   +G  G + +E 
Sbjct  160   LKSIGSDYSNGVNFAMAGSTVSHGVSPYSLNVQVDQFVYFKHRSLELFERGQKGPVSKEG  219

Query  489   FENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGP  668
             FENALYM+DIG ND+AG   +    +  +K    + EIKDA+  +Y  G RKFW+H TG 
Sbjct  220   FENALYMMDIGHNDVAGVM-HTPSDKWDKKFTEIVGEIKDAIRILYDNGARKFWIHGTGA  278

Query  669   VGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVD  848
             +GCLP  +   K      + +  GC+   N+AAQ+FN KLSDLC+E+R ++K+AT+VY D
Sbjct  279   LGCLPALVVQEK-----GKHDAHGCLAKYNKAAQQFNTKLSDLCDEMRLQLKNATVVYTD  333

Query  849   IYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANISCGQSGF-SVCKDGSKYISWDGVH  1025
             ++ IKY+ ++N   YG + PLM CCG GG PY  N   G+ G   +C+ GSK +SWDGVH
Sbjct  334   MFAIKYDFVANHTKYGIKWPLMVCCGNGGPPY--NFKPGKFGCDDLCEPGSKVLSWDGVH  391

Query  1026  YTEDANAMVAASVLSTNYSTP  1088
             +T+  + + A   +S  YS P
Sbjct  392   FTDFGSGLAAKLAMSGEYSKP  412



>ref|NP_001054715.1| Os05g0159200 [Oryza sativa Japonica Group]
 gb|AAV43918.1| putative GDSL lipase/acylhydrolase [Oryza sativa Japonica Group]
 dbj|BAF16629.1| Os05g0159200 [Oryza sativa Japonica Group]
 gb|EAY96636.1| hypothetical protein OsI_18549 [Oryza sativa Indica Group]
Length=431

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 150/322 (47%), Positives = 207/322 (64%), Gaps = 9/322 (3%)
 Frame = +3

Query  126   VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSP  305
             V+FNFGDSNSDTGG  AA G     P+GRT+FH  + RL DGR+IIDF+CE++    L+P
Sbjct  100   VLFNFGDSNSDTGGVAAAGGIRIMPPEGRTYFHHPTGRLSDGRVIIDFICESLNTRELNP  159

Query  306   YLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEE  485
             YL+++   + NGVNFA+ GS        +SL+ Q+ QF  F+ RSLE   +G  G + +E
Sbjct  160   YLKSIGSDYSNGVNFAMAGSTVSHGVSPYSLNVQVDQFVYFKHRSLELFERGQKGPVSKE  219

Query  486   DFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTG  665
              FENALYM+DIG ND+AG     S     +K    +SEIKDA+  +Y  G RKFW+H TG
Sbjct  220   GFENALYMMDIGHNDVAGVMHTPSD-NWDKKFSKIVSEIKDAIRILYDNGARKFWIHGTG  278

Query  666   PVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYV  845
              +GCLP  +   K      E +  GC+ + N+AA++FN KLS LC+E+R ++K+AT+VY 
Sbjct  279   ALGCLPALVVQEK-----GEHDAHGCLANYNKAARQFNKKLSHLCDEMRLQLKNATVVYT  333

Query  846   DIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANISCGQSGF-SVCKDGSKYISWDGV  1022
             D++ IKY+ ++N   YG + PLM CCG GG PY  N   G+ G   +C+ GSK +SWDGV
Sbjct  334   DMFAIKYDFVANHTKYGIKWPLMVCCGNGGPPY--NFKPGKFGCDDLCEPGSKVLSWDGV  391

Query  1023  HYTEDANAMVAASVLSTNYSTP  1088
             H+T+  + + A   +S  YS P
Sbjct  392   HFTDFGSGLAAKLAMSGEYSKP  413



>ref|XP_010414923.1| PREDICTED: GDSL esterase/lipase At1g54790-like isoform X3 [Camelina 
sativa]
Length=382

 Score =   298 bits (763),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 164/342 (48%), Positives = 216/342 (63%), Gaps = 25/342 (7%)
 Frame = +3

Query  132   FNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSPYL  311
             FNFGDSNSDTG   A  G     P G+  F  SS R CDGRL+IDFL + +   +L+PYL
Sbjct  33    FNFGDSNSDTGDLVAGLGIRLDLPYGQNSFKTSSQRFCDGRLLIDFLMDAMDMPFLNPYL  92

Query  312   EAL-TPSFKNGVNFAIGGSQTLP----KFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGML  476
             ++L  P+FK G NFA  GS  LP        FS   Q+ QF RF+TRSLE  SK   G  
Sbjct  93    DSLGLPNFKKGCNFAAAGSTILPANPTSVSPFSFDLQISQFIRFKTRSLELLSK--TGRR  150

Query  477   GE------EDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGG  638
              E      + +   LYMIDIGQNDIAGAF   S  QV+  IPS +   +  +  +Y+ GG
Sbjct  151   YEKYLPPLDYYSKGLYMIDIGQNDIAGAFYSKSLDQVLASIPSILETFELGLKRLYEEGG  210

Query  639   RKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHE  818
             R FW+HN+GP+GCL + +A     DP T+ +E GC+ S N+AA+ FN++L  L  + + +
Sbjct  211   RNFWIHNSGPLGCLAQNIAKFGT-DP-TKLDEFGCVSSHNQAAKLFNLQLHALSNKFQAQ  268

Query  819   MKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQS----GFS  980
               D+ + YVDI++IK NLI+N + +GFENPLMACCG GGAP  Y++ I+CGQ+    G S
Sbjct  269   FPDSNVTYVDIFSIKSNLIANYSRFGFENPLMACCGVGGAPLNYDSRITCGQTKVIDGIS  328

Query  981   V----CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPF  1094
             V    C D S+YI+WDG+HYTE AN  V++ +L+  YS PPF
Sbjct  329   VTAKACNDSSEYINWDGIHYTEAANHFVSSQILTGKYSDPPF  370



>ref|XP_006302395.1| hypothetical protein CARUB_v10020463mg [Capsella rubella]
 gb|EOA35293.1| hypothetical protein CARUB_v10020463mg [Capsella rubella]
Length=382

 Score =   297 bits (761),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 159/341 (47%), Positives = 217/341 (64%), Gaps = 21/341 (6%)
 Frame = +3

Query  132   FNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSPYL  311
             FNFGDSNSDTG   A  G     P G++ F  SS R CDGRL+IDFL + +   +L+PYL
Sbjct  33    FNFGDSNSDTGDLVAGLGIRLDLPYGQSSFKTSSQRFCDGRLLIDFLMDAMDMPFLNPYL  92

Query  312   EAL-TPSFKNGVNFAIGGSQTLP----KFVLFSLSTQLLQFNRFRTRSLEFHSKGTNG--  470
             ++L  P+FK G NFA  GS  LP        FS   Q+ QF RF++R+LE  SK      
Sbjct  93    DSLGLPNFKKGCNFAAAGSTILPANPTSVSPFSFDLQISQFIRFKSRALELLSKTGRKYE  152

Query  471   --MLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRK  644
               +   + +   LYMIDIGQND+AGAF   S  QVI  IPS +   +  +  +Y+ GGR 
Sbjct  153   RYLPPVDYYAKGLYMIDIGQNDLAGAFYSKSLDQVIASIPSILETFEVGLKRLYEEGGRN  212

Query  645   FWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMK  824
             FW+HNTGP+GCL + +A  K    +T+ +E GC+ S N+AA+ FN++L  L  + + +  
Sbjct  213   FWIHNTGPLGCLAQNIA--KFGTDSTKLDEFGCVSSHNQAAKLFNLQLHALSNKFQAQFP  270

Query  825   DATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQS----GFSV-  983
             D+ + YVDI++IK NLI+N + +GFENPLMACCG GGAP  Y++ I+CGQ+    G S+ 
Sbjct  271   DSNVTYVDIFSIKSNLIANYSRFGFENPLMACCGVGGAPLNYDSRITCGQTKVLDGISLT  330

Query  984   ---CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
                C D S+YI+WDG+HYTE AN  V++ +L+  YS PPF+
Sbjct  331   AKACNDSSEYINWDGIHYTEAANHFVSSQILTGKYSDPPFS  371



>ref|XP_011023543.1| PREDICTED: GDSL esterase/lipase At1g54790-like isoform X2 [Populus 
euphratica]
Length=380

 Score =   297 bits (761),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 151/343 (44%), Positives = 219/343 (64%), Gaps = 20/343 (6%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLS  302
             P +FNFGDSNSDTG   A  G +   P+G+ +F  ++ R CDGRLI+DFL + ++  +L+
Sbjct  29    PAVFNFGDSNSDTGDLAAGLGFLLDPPNGQIYFKTATGRFCDGRLIVDFLMDAMELPFLN  88

Query  303   PYLEAL-TPSFKNGVNFAIGGSQTLPKFVL----FSLSTQLLQFNRFRTRSLEFHSKGTN  467
              YLE++  P+F+ G NFA  GS  LP        FS   Q+ QF RF+ R LE  +KG  
Sbjct  89    AYLESVGVPNFRKGCNFAAAGSTILPATATSVSPFSFGVQVNQFLRFKARVLELLAKGKR  148

Query  468   ---GMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGG  638
                 +  E+ F+  LYM DIGQND+AGAF   +  Q++  IP+ + E +  +  +Y  GG
Sbjct  149   FDRYVPAEDYFQKGLYMFDIGQNDLAGAFYSKTLDQIVASIPNILVEFETGIKKLYDQGG  208

Query  639   RKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHE  818
             R FW+HNTGP+GCL + +A     DP ++ +E GC+   N+AA+  N++L  L ++L+ +
Sbjct  209   RNFWIHNTGPLGCLTQNVAKFGT-DP-SKLDELGCVSGHNQAAKLLNLQLHALTKKLQGQ  266

Query  819   MKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQS----GFS  980
               D+ I YVDIYTIK NLI+N + YGFE P+MACCG GG P  Y++ ISCGQ+    G S
Sbjct  267   YADSNITYVDIYTIKSNLIANYSRYGFEQPIMACCGYGGPPLNYDSRISCGQTKVLNGTS  326

Query  981   V----CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
             V    C D ++Y++WDG+HY+E AN  +++ +L+  +S PPF+
Sbjct  327   VTAKACSDSTEYVNWDGIHYSEAANQYISSQILTGKFSDPPFS  369



>ref|NP_001185228.1| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AAC64890.1| Similar to nodulins and lipase homolog F14J9.5 gi|3482914 from 
Arabidopsis thaliana BAC gb|AC003970. Alternate first exon 
from 72258 to 72509 [Arabidopsis thaliana]
 gb|AEE33149.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=383

 Score =   297 bits (761),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 162/371 (44%), Positives = 230/371 (62%), Gaps = 26/371 (7%)
 Frame = +3

Query  42    AMFVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFF  221
             ++ +FI  S FL     P + +  ++ P I NFGDSNSDTG   +A       P G+T+F
Sbjct  9     SIVLFILISLFL-----PSSFSIILKYPAIINFGDSNSDTGNLISAGIENVNPPYGQTYF  63

Query  222   HRSSDRLCDGRLIIDFLCENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLP----KFV  386
             +  S R CDGRLI+DFL + +   +L+PYL++L  P+FK G NFA  GS  LP       
Sbjct  64    NLPSGRYCDGRLIVDFLLDEMDLPFLNPYLDSLGLPNFKKGCNFAAAGSTILPANPTSVS  123

Query  387   LFSLSTQLLQFNRFRTRSLEFHSKGTNG----MLGEEDFENALYMIDIGQNDIAGAFSYL  554
              FS   Q+ QF RF++R++E  SK        +   + +   LYMIDIGQNDIAGAF   
Sbjct  124   PFSFDLQISQFIRFKSRAIELLSKTGRKYEKYLPPIDYYSKGLYMIDIGQNDIAGAFYSK  183

Query  555   SKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEE  734
             +  QV+  IPS +   +  +  +Y+ GGR  W+HNTGP+GCL + +A  K    +T+ +E
Sbjct  184   TLDQVLASIPSILETFEAGLKRLYEEGGRNIWIHNTGPLGCLAQNIA--KFGTDSTKLDE  241

Query  735   TGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLM  914
              GC+ S N+AA+ FN++L  +  + + +  DA + YVDI++IK NLI+N + +GFE PLM
Sbjct  242   FGCVSSHNQAAKLFNLQLHAMSNKFQAQYPDANVTYVDIFSIKSNLIANYSRFGFEKPLM  301

Query  915   ACCGGGGAP--YNANISCGQS----GFSV----CKDGSKYISWDGVHYTEDANAMVAASV  1064
             ACCG GGAP  Y++ I+CGQ+    G SV    C D S+YI+WDG+HYTE AN  V++ +
Sbjct  302   ACCGVGGAPLNYDSRITCGQTKVLDGISVTAKACNDSSEYINWDGIHYTEAANEFVSSQI  361

Query  1065  LSTNYSTPPFN  1097
             L+  YS PPF+
Sbjct  362   LTGKYSDPPFS  372



>ref|XP_010025156.1| PREDICTED: GDSL esterase/lipase At1g54790 isoform X2 [Eucalyptus 
grandis]
 gb|KCW61754.1| hypothetical protein EUGRSUZ_H04457 [Eucalyptus grandis]
Length=379

 Score =   297 bits (760),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 158/365 (43%), Positives = 223/365 (61%), Gaps = 22/365 (6%)
 Frame = +3

Query  60    TCSAFLVLSS--PPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSS  233
             TC A L L    P   + +    P +FNFGDSNSDTG   +A       P+G+++F   S
Sbjct  5     TCIAILALLCLFPLGNSIDFFNFPAVFNFGDSNSDTGNLISAGIESLNPPNGQSYFQLPS  64

Query  234   DRLCDGRLIIDFLCENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLP----KFVLFSL  398
              R CDGRLI+DFL + +   +L+ YL+++  P+F+ G NFA   S  LP        FS 
Sbjct  65    GRYCDGRLIVDFLMDAMDLPFLNAYLDSIGIPNFRRGCNFATAASTILPATATSLSPFSF  124

Query  399   STQLLQFNRFRTRSLEFHSKG---TNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQV  569
               Q+ QF RF+ R LE  +KG      +  EE F   LYM DIGQND+AG F   S  Q+
Sbjct  125   GVQVSQFLRFKARVLELLAKGKKLVKYLPAEEYFAQGLYMFDIGQNDLAGPFYSKSLDQI  184

Query  570   IEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIK  749
             +  IP+ + E ++    +Y  GGR FW+HNTGP+GC+ + +A     DP ++ +E GC+ 
Sbjct  185   LALIPTILVEFENGFKTLYDQGGRNFWIHNTGPLGCITQNIAKFGT-DP-SKLDEIGCVS  242

Query  750   SLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGG  929
               N+AA+ FN++L+ LC +LR +  DA I YVDI++IK NLI+N + YGFE P MACCG 
Sbjct  243   GHNQAAKLFNLQLNALCAKLRGQYTDANITYVDIFSIKSNLIANYSRYGFEQPFMACCGY  302

Query  930   GGAP--YNANISCGQS----GFSV----CKDGSKYISWDGVHYTEDANAMVAASVLSTNY  1079
             GGAP  Y++ +SCGQ+    G +V    C D ++Y++WDG+HYTE AN  +++ +L+  Y
Sbjct  303   GGAPLNYDSRVSCGQTKVLNGTTVTAKACDDSTEYVNWDGIHYTEAANQFISSQILTGKY  362

Query  1080  STPPF  1094
             S PPF
Sbjct  363   SDPPF  367



>gb|KHG09761.1| hypothetical protein F383_12143 [Gossypium arboreum]
Length=379

 Score =   297 bits (760),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 163/352 (46%), Positives = 211/352 (60%), Gaps = 21/352 (6%)
 Frame = +3

Query  93    PLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFL  272
             P  +   +  P +FNFGDSNSDTGG  A         +G T+FH  S R CDGRLIIDFL
Sbjct  21    PTVSPLSLNYPAVFNFGDSNSDTGGLVAGKAFPMTQFNGETYFHEPSGRFCDGRLIIDFL  80

Query  273   CENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLPKFVL----FSLSTQLLQFNRFRTR  437
              E ++  Y++PYLE++ +P+F+ G NFA GGS  LP        FS + QL QF RF+ R
Sbjct  81    MEAMEFPYMNPYLESVGSPNFQTGCNFATGGSTILPANAASTNPFSFNLQLSQFFRFKNR  140

Query  438   SLEFHSKG---TNGMLGEEDFENALYMIDIGQNDIAGAFSY-LSKAQVIEKIPSFISEIK  605
             +L   SK     + +  E DF  ALYM DIGQND+ G F +  S  QV+  I   I+E+ 
Sbjct  141   ALTLLSKDKQLQSYLPAENDFNKALYMFDIGQNDLDGVFYFPASDEQVVAFISKLITELN  200

Query  606   DAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVK  785
               +  +Y  G R FWVHNTGP+GCLPR +AT   R P +  +E GC+ S N AA  FN K
Sbjct  201   YGMKRLYDAGARNFWVHNTGPLGCLPRIIATFG-RKP-SNLDEYGCVASHNRAATVFNKK  258

Query  786   LSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN--ANIS  959
             L D+C +   +  +A I YVDIY+IK NLISN ++YGF+ PL ACCG GG P N    I+
Sbjct  259   LHDMCLQFLAQSPEANITYVDIYSIKLNLISNYSLYGFQQPLAACCGYGGPPLNFDTRIA  318

Query  960   CGQSG--------FSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPP  1091
             CG +          + C + ++YI+WDG HYTE AN  VA  +L+ NYS  P
Sbjct  319   CGVTKDLNGGIVTANPCNNTAEYINWDGTHYTEAANRFVADEILTGNYSDSP  370



>ref|XP_002894604.1| hypothetical protein ARALYDRAFT_474754 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70863.1| hypothetical protein ARALYDRAFT_474754 [Arabidopsis lyrata subsp. 
lyrata]
Length=377

 Score =   296 bits (759),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 159/344 (46%), Positives = 218/344 (63%), Gaps = 21/344 (6%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLS  302
             P  FNFGDSNSDTG   A  G     P+G+  F  SS R CDGRL+IDFL + +   +L+
Sbjct  25    PSAFNFGDSNSDTGDLVAGLGIRLDLPNGQNSFKTSSQRFCDGRLVIDFLMDEMDLPFLN  84

Query  303   PYLEAL-TPSFKNGVNFAIGGSQTLP----KFVLFSLSTQLLQFNRFRTRSLEFHSK---  458
             PYL++L  P+FK G NFA  GS  LP        FS   Q+ QF RF++R+LE  SK   
Sbjct  85    PYLDSLGLPNFKKGCNFAAAGSTILPANPTSVSPFSFDLQISQFIRFKSRALELLSKTGR  144

Query  459   GTNGMLGEEDF-ENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVG  635
               +  L   D+    LYMIDIGQND+AGAF   +  QV+  IPS +   +  +  +Y+ G
Sbjct  145   KYDKYLPPLDYYSEGLYMIDIGQNDLAGAFYSKTLDQVLASIPSILETFEAGLKRLYEEG  204

Query  636   GRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRH  815
             GR FW+HNTGP+GCL + +A  K    +T+ +E GC+ S N+AA+ FN++L  L  + + 
Sbjct  205   GRNFWIHNTGPLGCLAQNIA--KFGTDSTKLDEFGCVSSHNQAAKLFNLQLHALSNKFQA  262

Query  816   EMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQS----GF  977
             +  D+++ YVDI++IK NLI+N + +GFE PLMACCG  GAP  Y++ I+CGQ+    G 
Sbjct  263   QFPDSSVTYVDIFSIKSNLIANYSRFGFEKPLMACCGVRGAPLNYDSRITCGQTKVLDGI  322

Query  978   SV----CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
             SV    C D S+YI+WDG+HYTE AN  V++ +L+  YS PPF+
Sbjct  323   SVTAKACNDSSEYINWDGIHYTEAANQFVSSQILTGKYSDPPFS  366



>ref|XP_004156431.1| PREDICTED: GDSL esterase/lipase At1g54790-like [Cucumis sativus]
Length=379

 Score =   296 bits (759),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 157/351 (45%), Positives = 214/351 (61%), Gaps = 20/351 (6%)
 Frame = +3

Query  99    AAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCE  278
             A +     P +FNFGDSNSDTG   ++     G P G  FF   S R CDGRLI+DFL +
Sbjct  20    ARSSHFNRPAVFNFGDSNSDTGCLVSSGIETIGPPYGHLFFGNPSGRYCDGRLILDFLLD  79

Query  279   NVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLP----KFVLFSLSTQLLQFNRFRTRSL  443
              +   YL+PYL++L  P+F+ G N+A   S  LP     F  FS   Q+ QF  F+ R L
Sbjct  80    AMDMPYLNPYLDSLGAPNFRKGCNYAAAASTVLPATPTSFSPFSFGVQVNQFIHFKARVL  139

Query  444   EFHSKGT--NGMLGEED-FENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAV  614
             E  SKG   +  L +ED FE  LYM DIGQND+A AF   +  Q++  IP+ ++  +  +
Sbjct  140   ELRSKGKKLDKYLPDEDYFEKGLYMFDIGQNDLAIAFYSKTLDQILASIPTILAVFETGL  199

Query  615   WAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSD  794
               +Y  G R FW+HNTGP+GCL + +A     DP +  +E GC+ S N+AA+ FN++L  
Sbjct  200   QKLYDQGARNFWIHNTGPLGCLAQNVARFGT-DP-SNLDELGCVSSHNQAAKLFNLQLHA  257

Query  795   LCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQ  968
             LC+EL+ E  D  + YVDIYTIK NLI+N + +GFE P+MACCG GG P  Y++ I CGQ
Sbjct  258   LCKELQEEYTDTNVTYVDIYTIKSNLIANYSRFGFEQPIMACCGYGGPPLNYDSRIICGQ  317

Query  969   SGF--------SVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
             +            C D S+YI+WDG+HY+E AN  V++ +L+  YS PPF+
Sbjct  318   TKILNGTVVTAKGCDDSSEYINWDGIHYSEAANKYVSSQILTGKYSDPPFS  368



>gb|EPS58572.1| hypothetical protein M569_16239, partial [Genlisea aurea]
Length=370

 Score =   296 bits (758),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 158/359 (44%), Positives = 215/359 (60%), Gaps = 20/359 (6%)
 Frame = +3

Query  75    LVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGR  254
             + + S PL+ +     P +FNFGDSNSDTGG  A  G     P+G+  F R S R CDGR
Sbjct  3     IFIISIPLSISFDFNYPAVFNFGDSNSDTGGLVAGIGYRLDPPNGQNHFRRPSGRFCDGR  62

Query  255   LIIDFLCENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLP----KFVLFSLSTQLLQF  419
             LIID   E +    L+PYL+++  PSF+ G NFA+ GS  LP        FS   Q+ QF
Sbjct  63    LIIDLFLEAIDLPSLNPYLDSIGAPSFRKGCNFAVSGSTILPASASSVSPFSFRIQVAQF  122

Query  420   NRFRTRSLEFHS---KGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSF  590
              RF+ R+ E      K    +   E FE ALY  DIGQND+  AF   +  QVI  IP+ 
Sbjct  123   IRFKARAEEIQQQTEKYAKYVPAREYFEKALYTFDIGQNDLTAAFYSKTPDQVIASIPTI  182

Query  591   ISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQ  770
             + E ++ +  +Y  G R FW+HNTGP+GCLP+ L      DP ++ +E GC+ S NEA+ 
Sbjct  183   LQEFENGIQELYNEGARNFWIHNTGPLGCLPQNLLRFGT-DP-SKLDELGCVASHNEASS  240

Query  771   EFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--Y  944
               N++L  LC++LR +  DA+ V+ D++ IK +LI+N A YGFE PLMACCG GG+P  Y
Sbjct  241   LLNLQLHALCKKLRGQYTDASFVHTDVFAIKVDLIANHAKYGFEQPLMACCGYGGSPLNY  300

Query  945   NANISCGQS----GFSV----CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
             ++ ISCGQ+    G SV    C D + +++WDG+HYTE AN  V   +L+  YS P F+
Sbjct  301   DSRISCGQTKTLDGSSVTAVGCNDSTAFVNWDGIHYTEAANQHVTDQILTGRYSDPAFS  359



>ref|XP_002455582.1| hypothetical protein SORBIDRAFT_03g013400 [Sorghum bicolor]
 gb|EES00702.1| hypothetical protein SORBIDRAFT_03g013400 [Sorghum bicolor]
Length=293

 Score =   293 bits (750),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 147/289 (51%), Positives = 193/289 (67%), Gaps = 10/289 (3%)
 Frame = +3

Query  276   ENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHS  455
             E++   YLSPYLEA+   F  G NFAI GS TLP+ V F+L  Q+ QF   + RSL+  +
Sbjct  7     ESLNMSYLSPYLEAVGSDFTGGANFAISGSSTLPRNVPFALHVQVQQFLHLKLRSLDLIA  66

Query  456   KGTNGM----LGEEDFENALYMIDIGQNDIAGAFSYLSKAQ--VIEKIPSFISEIKDAVW  617
              G  G     +  + F NALY+IDIGQND++ AF   +     V ++IP+ +SEIKDA+ 
Sbjct  67    HGGGGGTTAPIDADGFRNALYLIDIGQNDLSAAFGSGAPYDDVVHQRIPAIVSEIKDAIM  126

Query  618   AIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDL  797
              +Y  G   FWVH TGP+GCLP+ LA  +  D  ++ + TGC+K+LN+ A EFN +L   
Sbjct  127   TLYYNGANNFWVHGTGPLGCLPQKLAAPRPDD--SDLDYTGCLKNLNDGAYEFNTQLCAA  184

Query  798   CEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQS  971
             C+ELR  ++  TIVY D+  IKY+LI+N   YGFE PLMACCG GG P  YNAN+SC   
Sbjct  185   CDELRSHLRGVTIVYTDVLLIKYDLIANHTAYGFEEPLMACCGYGGPPYNYNANVSCLGP  244

Query  972   GFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFCST  1118
             GF VC+DGSK++SWDGVHYT+ ANA+VAA +LS  +STP   FD+FC  
Sbjct  245   GFRVCEDGSKFVSWDGVHYTDAANAVVAAKILSGQFSTPKMPFDFFCQA  293



>gb|AAM61525.1| early nodule-specific protein, putative [Arabidopsis thaliana]
Length=377

 Score =   296 bits (758),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 157/344 (46%), Positives = 216/344 (63%), Gaps = 21/344 (6%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLS  302
             P  FNFGDSNSDTG   A  G     P+G+  F  SS R CDGRL+IDFL + +   +L+
Sbjct  25    PSAFNFGDSNSDTGDLVAGLGIRLDLPNGQNSFKTSSQRFCDGRLVIDFLMDEMDLPFLN  84

Query  303   PYLEAL-TPSFKNGVNFAIGGSQTLP----KFVLFSLSTQLLQFNRFRTRSLEFHSKGTN  467
             PYL++L  P+FK G NFA  GS  LP        FS   Q+ QF RF++R++E  SK   
Sbjct  85    PYLDSLGLPNFKKGCNFAAAGSTILPANPTSVSPFSFDLQISQFIRFKSRAIELLSKTGR  144

Query  468   G----MLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVG  635
                  +   + +   LYMIDIGQNDIAGAF   +  QV+  IPS +   +  +  +Y+ G
Sbjct  145   KYEKYLPPIDYYSKGLYMIDIGQNDIAGAFYSKTLDQVLASIPSILETFEAGLKRLYEEG  204

Query  636   GRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRH  815
             GR  W+HNTGP+GCL + +A  K    +T+ +E GC+ S N+AA+ FN++L  +  + + 
Sbjct  205   GRNIWIHNTGPLGCLAQNIA--KFGTDSTKLDEFGCVSSHNQAAKLFNLQLHAMSNKFQA  262

Query  816   EMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQS----GF  977
             +  DA + YVDI++IK NLI+N + +GFE PLMACCG GGAP  Y++ I+CGQ+    G 
Sbjct  263   QYPDANVTYVDIFSIKSNLIANYSRFGFEKPLMACCGVGGAPLNYDSRITCGQTKVLDGI  322

Query  978   SV----CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
             SV    C D S+YI+WDG+HYTE AN  V++ +L+  YS PPF+
Sbjct  323   SVTAKACNDSSEYINWDGIHYTEAANEFVSSQILTGKYSDPPFS  366



>ref|NP_564668.1| GDSL esterase/lipase [Arabidopsis thaliana]
 dbj|BAC42831.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64118.1| putative early nodule-specific protein [Arabidopsis thaliana]
 gb|AEE33147.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=382

 Score =   296 bits (758),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 157/344 (46%), Positives = 216/344 (63%), Gaps = 21/344 (6%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLS  302
             P  FNFGDSNSDTG   A  G     P+G+  F  SS R CDGRL+IDFL + +   +L+
Sbjct  30    PSAFNFGDSNSDTGDLVAGLGIRLDLPNGQNSFKTSSQRFCDGRLVIDFLMDEMDLPFLN  89

Query  303   PYLEAL-TPSFKNGVNFAIGGSQTLP----KFVLFSLSTQLLQFNRFRTRSLEFHSKGTN  467
             PYL++L  P+FK G NFA  GS  LP        FS   Q+ QF RF++R++E  SK   
Sbjct  90    PYLDSLGLPNFKKGCNFAAAGSTILPANPTSVSPFSFDLQISQFIRFKSRAIELLSKTGR  149

Query  468   G----MLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVG  635
                  +   + +   LYMIDIGQNDIAGAF   +  QV+  IPS +   +  +  +Y+ G
Sbjct  150   KYEKYLPPIDYYSKGLYMIDIGQNDIAGAFYSKTLDQVLASIPSILETFEAGLKRLYEEG  209

Query  636   GRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRH  815
             GR  W+HNTGP+GCL + +A  K    +T+ +E GC+ S N+AA+ FN++L  +  + + 
Sbjct  210   GRNIWIHNTGPLGCLAQNIA--KFGTDSTKLDEFGCVSSHNQAAKLFNLQLHAMSNKFQA  267

Query  816   EMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQS----GF  977
             +  DA + YVDI++IK NLI+N + +GFE PLMACCG GGAP  Y++ I+CGQ+    G 
Sbjct  268   QYPDANVTYVDIFSIKSNLIANYSRFGFEKPLMACCGVGGAPLNYDSRITCGQTKVLDGI  327

Query  978   SV----CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
             SV    C D S+YI+WDG+HYTE AN  V++ +L+  YS PPF+
Sbjct  328   SVTAKACNDSSEYINWDGIHYTEAANEFVSSQILTGKYSDPPFS  371



>gb|KDP21506.1| hypothetical protein JCGZ_21977 [Jatropha curcas]
Length=387

 Score =   296 bits (758),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 157/345 (46%), Positives = 213/345 (62%), Gaps = 24/345 (7%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLS  302
             P +FNFGDSNSDTGG  A      G P+G+TFF   + R CDGRLIIDFL E +   +L+
Sbjct  30    PAVFNFGDSNSDTGGLVAGVSFPVGPPNGQTFFLEPAGRFCDGRLIIDFLMEAMGNPFLN  89

Query  303   PYLEAL-TPSFKNGVNFAIGGSQTLP----KFVLFSLSTQLLQFNRFRTRSLEFHSKGTN  467
             PYL+++  P+F+ G NFA GGS  LP        FS   Q+ QF RF++R LE  +K  +
Sbjct  90    PYLDSVGAPNFQKGCNFATGGSTILPANAASISPFSFGIQVAQFIRFKSRVLELLAK--D  147

Query  468   GMLG-----EEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKV  632
             G L      E DF+  LYM D+GQND+ GAF   S+ QV+  IP  +SE +  +  +Y  
Sbjct  148   GELEKYLPLENDFKQGLYMFDVGQNDLDGAFYSKSEGQVVAFIPKILSEFQTGIQILYDS  207

Query  633   GGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELR  812
             G R FW+HNTGP+GCLPR ++T   +   ++ ++ GC+ S N AA  FN +L DLC + R
Sbjct  208   GARNFWIHNTGPLGCLPRIISTFGKKA--SKLDQFGCVNSHNRAATVFNKQLLDLCAQFR  265

Query  813   HEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN--ANISCGQS----G  974
                 DA + Y+DI++IK NLI+N + YGF+ PL ACCG GG P N  + I+CG +    G
Sbjct  266   ARFPDANVTYIDIFSIKSNLIANFSQYGFKQPLAACCGYGGPPLNFDSRIACGVTKNLNG  325

Query  975   FSV----CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
               V    C + ++Y++WDG HYTE AN  V+  +L  NYS PP +
Sbjct  326   SIVTARPCDNTTEYVNWDGNHYTEAANLFVSEQILVGNYSDPPLS  370



>ref|XP_002440646.1| hypothetical protein SORBIDRAFT_09g004550 [Sorghum bicolor]
 gb|EES19076.1| hypothetical protein SORBIDRAFT_09g004550 [Sorghum bicolor]
Length=439

 Score =   298 bits (762),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/324 (45%), Positives = 204/324 (63%), Gaps = 12/324 (4%)
 Frame = +3

Query  126   VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSP  305
             V+FNFGDSNSDTGG  AA G     P+GRT+FHR + RL DGR+IIDF+CE++    L+P
Sbjct  107   VLFNFGDSNSDTGGVAAASGIRIMPPEGRTYFHRPTGRLSDGRVIIDFICESLGTHELNP  166

Query  306   YLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEE  485
             YL+ +   + NGVNFA+ GS    +   +SL+ Q+ QF  FR RSLE   +G  G + +E
Sbjct  167   YLKGIGSDYSNGVNFAMAGSTVTHRASDYSLNVQVDQFVYFRHRSLEMFERGLKGPVSKE  226

Query  486   DFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTG  665
              FENALYM+DIG ND+ G  ++    Q  +KI   + E++ A+  +Y  G RKFW+H TG
Sbjct  227   GFENALYMMDIGHNDMVGV-AHTPSDQWDKKITEIVGEVRQAISILYDNGARKFWIHGTG  285

Query  666   PVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYV  845
              +GCLP  +    V++   E ++ GCI  +N AA+ +N KLS LC++LR  +K AT+VY 
Sbjct  286   ALGCLPALV----VQEKGAEKDKHGCIAGVNRAAKAYNKKLSQLCDDLRFHLKGATVVYT  341

Query  846   DIYTIKYNLISNSAIYGFENPLMACCGGGGAPYNANI---SCGQSGFSVCKDGSKYISWD  1016
             D++ IKY+ ++N   YG E P M CCG GG PYN +     CG     +C   +K +SWD
Sbjct  342   DMFAIKYDFVANHTKYGIEWPFMVCCGNGGPPYNMDQGKPGCGD----LCPPEAKVVSWD  397

Query  1017  GVHYTEDANAMVAASVLSTNYSTP  1088
             GVH+T+  + + A   +S  YS P
Sbjct  398   GVHFTDFGSGLAAKLAMSGEYSKP  421



>ref|XP_010256199.1| PREDICTED: GDSL esterase/lipase At1g54790-like [Nelumbo nucifera]
Length=377

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 163/358 (46%), Positives = 224/358 (63%), Gaps = 24/358 (7%)
 Frame = +3

Query  87    SPPLAAAECI--RNPVIFNFGDSNSDTGGYPAAH-GNIFGYPDGRTFFHRSSDRLCDGRL  257
             +P   A E +  + P +FNFGDSNSDTGG  AA  G+    P+G+T+F + S R CDGRL
Sbjct  22    TPIEEAGETVVFKYPAVFNFGDSNSDTGGLIAAGIGDRLEPPNGQTYFLKPSGRFCDGRL  81

Query  258   IIDFLCENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLPKFVL-----FSLSTQLLQF  419
             IIDFL + +    L+ YL+++  PS   G NFA   S  LP  V      FS   Q+ QF
Sbjct  82    IIDFLMDAMGQPSLNAYLDSVGAPSLSRGCNFAAAASTILPPTVTMTISPFSFGVQVTQF  141

Query  420   NRFRTRSLEFHSKGT--NGMLGEED-FENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSF  590
              +F+ R L+  SKG   N  L +++ FE  LY  DIGQND+  AF   ++ QVI+ IP+ 
Sbjct  142   LQFKARVLDLLSKGKKLNKYLPQKNYFEQGLYTFDIGQNDVNSAFYSKTEDQVIDFIPTI  201

Query  591   ISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQ  770
             + E +  +  +Y  G R+FW+HNTGP+ CL R +A    +DP ++ +E GC+ SLN AA 
Sbjct  202   LLEFEAGIKRLYDQGARRFWIHNTGPLRCLVRNIAIFG-KDP-SKLDELGCVSSLNRAAD  259

Query  771   EFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--Y  944
              FN++L  LC++L+ +  DA   YVDIY+IK NLI+N + YGF+ P+MACCG GGAP  Y
Sbjct  260   LFNLQLHTLCKKLQGQFLDANFTYVDIYSIKANLIANYSQYGFQQPIMACCGYGGAPLNY  319

Query  945   NANISCGQS----GFSV----CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPF  1094
             ++ ISCGQ+    G  V    C D +KY++WDG+HYTE AN  V+  +L+  YS PPF
Sbjct  320   DSRISCGQTKTLNGSLVTAKGCNDSTKYVNWDGIHYTEAANQFVSTQILTGKYSDPPF  377



>ref|XP_006655015.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Oryza brachyantha]
Length=408

 Score =   296 bits (759),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/324 (46%), Positives = 207/324 (64%), Gaps = 6/324 (2%)
 Frame = +3

Query  126   VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSP  305
             V+ NFGDSNSDTGG     G     P+GR +FH  + RL DGR+I+DF+CE++   +LSP
Sbjct  69    VVINFGDSNSDTGGGAGGRGIHIAPPEGRAYFHHPTGRLSDGRVILDFICESLNTHHLSP  128

Query  306   YLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEE  485
             ++  L   + NGVNFAI GS   P    FSL  QL QF  F+ R LE   +G    +  +
Sbjct  129   FMRPLGSEYSNGVNFAIAGSTATPGETTFSLDVQLDQFVFFKERCLESIERGEVAPIDSK  188

Query  486   DFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTG  665
              FENALY +DIG ND+ G   +L   +++ K+P+ ++EIK A+  ++K   RKFW+H TG
Sbjct  189   GFENALYTMDIGHNDLMGVL-HLPYHEILPKLPAIVAEIKKAIKTLHKNDARKFWIHGTG  247

Query  666   PVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYV  845
              +GCLP+ LAT K  D +   +E GCI  +N  A++FN  LS+ C++LR E  D+ IV+V
Sbjct  248   ALGCLPQKLATRK--DDDGGLDEHGCITKINNVAKKFNELLSETCDDLRLEFTDSIIVFV  305

Query  846   DIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN--ANISCGQSGFS-VCKDGSKYISWD  1016
             D++ IKY+L++N   YG + PLM CCG GG PYN    ISC  +    +CK   K+ISWD
Sbjct  306   DMFAIKYDLVANHTKYGIKKPLMTCCGHGGPPYNYDPKISCSVTDDKYMCKLDEKFISWD  365

Query  1017  GVHYTEDANAMVAASVLSTNYSTP  1088
             GVH+T+ AN +VA+ V+S  +S P
Sbjct  366   GVHFTDAANEIVASKVISGEFSIP  389



>ref|XP_003566681.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Brachypodium 
distachyon]
Length=374

 Score =   295 bits (756),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 164/344 (48%), Positives = 219/344 (64%), Gaps = 17/344 (5%)
 Frame = +3

Query  126   VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSP  305
             V+FNFGDSNSDTG + AA+G   G P GR FFHR++ R  DGRL ID L E +   YLSP
Sbjct  31    VVFNFGDSNSDTGAFTAAYGLYLGPPAGRRFFHRTTGRWSDGRLYIDLLAEKLGIAYLSP  90

Query  306   YLEALTPSFKNGVNFAIGGSQTL-----PKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNG  470
             YLE+    F  GVNFA+ G+        P  + F+++TQ  QF  F+ R+ E    G   
Sbjct  91    YLESSGADFTGGVNFAVAGAAAASHPQSPGAIPFTIATQANQFLHFKNRTTELRPSGRGS  150

Query  471   MLGEEDFENALYMIDIGQNDIAGAF-SYLSKAQVIE-----KIPSFISEIKDAVWAIYKV  632
             ML EEDF +A+Y +DIGQNDI  AF + L+  ++++      + + ++EI+ AV  ++  
Sbjct  151   MLREEDFRSAVYSMDIGQNDITVAFLANLTLPEIVDPDGGGPLAAAVAEIERAVRTLHGA  210

Query  633   GG-RKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEEL  809
             GG RKFWV+NTGP+GCLP+TLA  +   P  E +  GC+   N AA   N  L+  C  L
Sbjct  211   GGARKFWVYNTGPLGCLPQTLALRQ--RPGDELDPAGCLARYNAAAAALNAGLAAACRRL  268

Query  810   RHEMKDATIVYVDIYTIKYNLI-SNSAIYGFENPLMACCGGGGAPYN-ANI-SCGQSGFS  980
             R E+ +AT+V  D+Y IKY+L  + S  YGFE PLMACCG GG PYN AN+ +CGQ   +
Sbjct  269   RDELPEATVVCTDMYAIKYDLFAAGSGKYGFERPLMACCGHGGPPYNYANLKTCGQPTAT  328

Query  981   VCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFNFDYFC  1112
              C +G ++ISWDGVHYTEDANA+VA  +LS ++STP    +  C
Sbjct  329   ACPEGERHISWDGVHYTEDANAIVADKILSGDFSTPRTKLEALC  372



>ref|XP_010278953.1| PREDICTED: GDSL esterase/lipase At1g54790-like [Nelumbo nucifera]
Length=380

 Score =   295 bits (756),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 158/350 (45%), Positives = 215/350 (61%), Gaps = 20/350 (6%)
 Frame = +3

Query  93    PLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFL  272
             PL        P +FNFGDSNSDTGG  AA       P+G+T+F + S R CDGRLI+DFL
Sbjct  19    PLVQTVNFSYPAVFNFGDSNSDTGGLAAAIAFPVNSPNGQTYFLKPSGRFCDGRLIVDFL  78

Query  273   CENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLPKFVL----FSLSTQLLQFNRFRTR  437
              + +    L+ YL+++  P+F  G NFA GGS  LP        FS   Q+ QF RF+ R
Sbjct  79    VDAMDLPLLNAYLDSVGAPNFGTGCNFATGGSTILPANAASTSPFSFGIQVAQFLRFKAR  138

Query  438   SLEF--HSKGTNGMLGEED-FENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKD  608
              LE     KG    L  ED F+  LYM DIGQND+ GAF   S+ QV+  IP+ + E + 
Sbjct  139   VLELLAKGKGLEKFLPPEDYFKKGLYMFDIGQNDLDGAFYSTSEDQVLALIPTILQEFES  198

Query  609   AVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKL  788
              V  +Y+ G R+FW+HNTGP+GCLPR +AT    + +++ +E GC+ S N AA  FN++L
Sbjct  199   GVKKLYEQGARQFWIHNTGPLGCLPRIIAT--FGNNSSKIDELGCVSSHNRAATLFNLQL  256

Query  789   SDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISC  962
               LC +L+ +  DA + YVD+++IK NLISNS+ YGF + + ACCG GG P  Y++ ISC
Sbjct  257   HGLCRKLQSQFLDANVTYVDVFSIKLNLISNSSQYGFAHFITACCGYGGPPLNYDSRISC  316

Query  963   GQS----GFSV----CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTP  1088
             GQ+    G  V    C D  +Y++WDG HYTE AN  +++ +L+  YS P
Sbjct  317   GQTKSLNGTLVTSKPCNDTREYVNWDGNHYTEAANLHISSQILTGKYSDP  366



>gb|EEE62413.1| hypothetical protein OsJ_17204 [Oryza sativa Japonica Group]
Length=438

 Score =   297 bits (761),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 149/353 (42%), Positives = 209/353 (59%), Gaps = 35/353 (10%)
 Frame = +3

Query  126   VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLC----------  275
             V+FNFGDSNSDTGG  A  G     P+GR +FH  + RL DGR+I+DF+C          
Sbjct  70    VVFNFGDSNSDTGGVAAVMGIHIAAPEGRAYFHHPTGRLSDGRVILDFICLPFFKKKVFG  129

Query  276   --------------------ENVKADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFS  395
                                 E++   +LSP++  L   + NGVNFAI GS   P    FS
Sbjct  130   MDLEFCLRKGKEERMKEKAGESLNTHHLSPFMRPLGADYNNGVNFAIAGSTATPGETTFS  189

Query  396   LSTQLLQFNRFRTRSLEFHSKGTNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIE  575
             L  QL QF  F+ R LE   +G +  +  + FENALY +DIG ND+ G   +LS  +++ 
Sbjct  190   LDVQLDQFIFFKERCLESIERGEDAPIDSKGFENALYTMDIGHNDLMGVL-HLSYDEILR  248

Query  576   KIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSL  755
             K+P  ++EI+ A+  ++K G +KFW+H TG +GCLP+ LAT    D   + +E GCI  +
Sbjct  249   KLPPIVAEIRKAIETLHKNGAKKFWIHGTGALGCLPQKLATRGEID--RDLDEHGCITRI  306

Query  756   NEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGG  935
             N  A+ FN  LS+ C++LR +   +TIV+VD++ IKY+L++N   +G E PLM CCG GG
Sbjct  307   NNVAKRFNKLLSETCDDLRLQFASSTIVFVDMFAIKYDLVANHTKHGIEKPLMTCCGHGG  366

Query  936   APYN--ANISCGQSGFSVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTP  1088
              PYN     SC  +   +CK G K+ISWDGVH+T+ AN +VA+ V+S  +S P
Sbjct  367   PPYNYDPKKSCTANDKDLCKLGEKFISWDGVHFTDAANEIVASKVISGEFSIP  419



>ref|XP_006577256.1| PREDICTED: GDSL esterase/lipase At1g54790-like isoform X2 [Glycine 
max]
Length=379

 Score =   295 bits (755),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 158/361 (44%), Positives = 226/361 (63%), Gaps = 22/361 (6%)
 Frame = +3

Query  75    LVLSSPPLAAAECI--RNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCD  248
              +L +  LA A  +  + P +FNFGDSNSDTG   A  G +   P+G+ +F   S R CD
Sbjct  10    FILFTICLAMANSVEFKYPAVFNFGDSNSDTGELAAGLGFLVAPPNGQDYFKIPSGRFCD  69

Query  249   GRLIIDFLCENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTL----PKFVLFSLSTQLL  413
             GRLI+DFL + +   +L+ YL++L  P+F+ G NFA   +  L         FS   Q+ 
Sbjct  70    GRLIVDFLMDAMDLPFLNAYLDSLGLPNFRKGCNFAAAAATILPATASSLCPFSFGVQVS  129

Query  414   QFNRFRTRSLEFHSKGTN---GMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIP  584
             QF RF+ R+LE  +KG      +  E  FE  LYM DIGQND+AGAF   +  Q++  IP
Sbjct  130   QFLRFKARALELIAKGRKFDKYVPDENVFEKGLYMFDIGQNDLAGAFYSKTLDQILASIP  189

Query  585   SFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEA  764
             + + E++  +  +Y  G R FW+HNTGP+GCLP+ +A  K    +++ +E GC+ S N+A
Sbjct  190   TILLELEKGIKNLYDQGARYFWIHNTGPLGCLPQNIA--KFGTDSSKLDELGCVSSHNQA  247

Query  765   AQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP-  941
             A+ FN++L  LC +L+ +  D+ + YVDI+TIK NLISN + YGFE P+MACCG GG P 
Sbjct  248   AKTFNLQLHALCTKLQGQYPDSNVTYVDIFTIKSNLISNFSRYGFEQPIMACCGYGGPPL  307

Query  942   -YNANISCGQS----GFSV----CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPF  1094
              Y++ +SCG++    G ++    C D S+YISWDG+HYTE AN  VA+ +L+  YS PPF
Sbjct  308   NYDSRVSCGETKTFNGTTITAKACNDTSEYISWDGIHYTETANQYVASQILTGKYSDPPF  367

Query  1095  N  1097
             +
Sbjct  368   S  368



>ref|XP_008455108.1| PREDICTED: GDSL esterase/lipase At1g54790-like [Cucumis melo]
Length=453

 Score =   297 bits (761),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 157/353 (44%), Positives = 216/353 (61%), Gaps = 20/353 (6%)
 Frame = +3

Query  93    PLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFL  272
             P+A +     P +FNFGDSNSDTG   ++     G P G  FF   S R CDGRLI+DFL
Sbjct  92    PMARSSPFNRPAVFNFGDSNSDTGCLVSSGIETIGPPYGHLFFGNPSGRYCDGRLILDFL  151

Query  273   CENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLP----KFVLFSLSTQLLQFNRFRTR  437
              + +   YL+PYL+++  P+F+ G N+A   S  LP     F  FS   Q+ QF  F+ R
Sbjct  152   LDAMDMPYLNPYLDSIGAPNFRKGCNYAAAASTILPATPTSFSPFSFGVQVNQFIHFKAR  211

Query  438   SLEFHSKGT--NGMLGEED-FENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKD  608
              LE  SK    +  L +ED FE  LYM DIGQND+A AF   +  Q++  IP+ ++  + 
Sbjct  212   VLELRSKDKKLDKYLPDEDYFEKGLYMFDIGQNDLAIAFYSKTLDQILASIPTILAVFET  271

Query  609   AVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKL  788
              +  ++K G R FW+HNTGP+GCL + +A     DP +  +E GC+ S N+AA+ FN++L
Sbjct  272   GLQKLHKQGARNFWIHNTGPLGCLAQNVARFGT-DP-SNLDELGCVSSHNQAAKLFNLQL  329

Query  789   SDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISC  962
               LC++L+ +  DA + YVDIYTIK NLI+N + YGFE P+MACCG GG P  Y++ I C
Sbjct  330   HALCKKLQKQYTDANVTYVDIYTIKSNLIANYSRYGFEQPIMACCGYGGPPLNYDSRIVC  389

Query  963   GQSGF--------SVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
             GQ+            C D S+YI+WDG+HYTE AN  V++ +LS  Y  PPF+
Sbjct  390   GQTKILNGTVVTAKGCDDSSEYINWDGIHYTEVANQYVSSQILSGKYCDPPFS  442



>emb|CAN82038.1| hypothetical protein VITISV_033903 [Vitis vinifera]
Length=382

 Score =   295 bits (754),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 152/343 (44%), Positives = 217/343 (63%), Gaps = 21/343 (6%)
 Frame = +3

Query  69    AFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCD  248
             AF+ + SP LA +     P +FNFGDSNSDTGG  A  G+    P+G+ FF R + R CD
Sbjct  12    AFIFIFSP-LAHSIQFNFPAVFNFGDSNSDTGGLVAGIGDRLDPPNGQIFFKRPAGRFCD  70

Query  249   GRLIIDFLCENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLPK----FVLFSLSTQLL  413
             GRLIIDFL + +   +L+PYL+++  P+F+ G NFA  GS  LP        FS   Q+ 
Sbjct  71    GRLIIDFLMDAMDLPFLNPYLDSIGAPTFRKGCNFAAAGSTVLPASANAVSPFSFGIQVA  130

Query  414   QFNRFRTRSLEFHSKG---TNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIP  584
             QF RF+ R L+   KG      +  E+ F+  LYM DIGQND+AGAF   S  Q++  IP
Sbjct  131   QFMRFKIRVLQLLEKGRKFQKYIPQEDSFQKGLYMFDIGQNDLAGAFYSKSLDQILASIP  190

Query  585   SFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEA  764
             + + E +  +  +Y  G R FW+HNTGP+GCL + +A     DP ++ +E GC+   N+A
Sbjct  191   TILVEFETGIQELYDQGARNFWIHNTGPLGCLTQNIAKFGT-DP-SKLDELGCVSGHNQA  248

Query  765   AQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP-  941
             A+ FN++L  LC++ + +  DA +++VDIYTIKYNLI+N + YGFE+PLMACCG GG P 
Sbjct  249   ARLFNLQLQALCKKFQGQHPDAKVIHVDIYTIKYNLIANYSRYGFEHPLMACCGYGGLPL  308

Query  942   -YNANISCGQS----GFSV----CKDGSKYISWDGVHYTEDAN  1043
              Y++ + CG++    G  +    C D ++Y++WDG+HY+E AN
Sbjct  309   NYDSRVPCGKTKVVNGTEITAKGCSDSTEYVNWDGIHYSEAAN  351



>ref|XP_006471886.1| PREDICTED: GDSL esterase/lipase At1g54790-like isoform X2 [Citrus 
sinensis]
Length=380

 Score =   295 bits (754),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 163/366 (45%), Positives = 219/366 (60%), Gaps = 25/366 (7%)
 Frame = +3

Query  51    VFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRS  230
             +   CS  L     P A +   + P +FNFGDSNSDTG   A  G       GRT F  S
Sbjct  10    ILTLCSIIL-----PKANSLVFKYPAVFNFGDSNSDTGELSAGLGFTLDPVYGRTHFKAS  64

Query  231   SDRLCDGRLIIDFLCENVKADYLSPYLEAL-TPSFKNGVNFAIGGS---QTLPKFVL-FS  395
             S R CDGRLI+DFL + +K  +L+ YL+++  PSF+ G NFA  GS   Q  P  V  FS
Sbjct  65    SGRFCDGRLIVDFLMDAMKLPFLNAYLDSIGLPSFQKGCNFAAAGSTIHQATPTSVCPFS  124

Query  396   LSTQLLQFNRFRTRSLEFHSKGT---NGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQ  566
                Q+ QF  F+ R +E  +KG      +   + F   LY  DIGQND+AGAF   +  Q
Sbjct  125   FDIQVNQFLHFKARVVELLAKGKRLDKYIPAVDYFSKGLYTFDIGQNDLAGAFYSKTIDQ  184

Query  567   VIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCI  746
             V+  IP  + E +  +  +Y  G R FW+HNTGP+GCL + +A  K     +  +E GC+
Sbjct  185   VLASIPKILEEFETGLRRLYDEGARNFWIHNTGPLGCLAQNVA--KFGTDLSMLDELGCV  242

Query  747   KSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCG  926
                N+AA+ FN++L  LC++L+ +  D+ I YVDIYTIKY+LI+N + YGFE P+MACCG
Sbjct  243   SGHNQAAKLFNLQLHALCKKLQGDYTDSNITYVDIYTIKYSLIANYSRYGFEQPIMACCG  302

Query  927   GGGAP--YNANISCGQS----GFSV----CKDGSKYISWDGVHYTEDANAMVAASVLSTN  1076
              GGAP  YN+ ISCGQ+    G SV    C D ++Y++WDG+HYTE AN  V+  +L+  
Sbjct  303   VGGAPLNYNSGISCGQTKVINGTSVTAKACSDSTEYVNWDGIHYTEAANQYVSTQILTGK  362

Query  1077  YSTPPF  1094
             YS PPF
Sbjct  363   YSDPPF  368



>ref|XP_002319029.2| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
 gb|EEE94952.2| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
Length=380

 Score =   294 bits (753),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 150/343 (44%), Positives = 218/343 (64%), Gaps = 20/343 (6%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLS  302
             P +FNFGDSNSDTG   A  G +   P+G+ +F   + R CDGRLI+DFL + ++  +L+
Sbjct  29    PSVFNFGDSNSDTGDLAAGLGFLLDPPNGQIYFKTPTGRFCDGRLIVDFLMDAMELPFLN  88

Query  303   PYLEAL-TPSFKNGVNFAIGGSQTLPKFVL----FSLSTQLLQFNRFRTRSLEFHSKGTN  467
              YL+++  P+F+ G NFA  GS  LP        FS   Q+ QF RF+ R LE  +KG  
Sbjct  89    AYLDSVGVPNFRKGCNFAAAGSTILPATATSVSPFSFGVQVNQFLRFKARVLELLAKGKR  148

Query  468   ---GMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGG  638
                 +  E+ F+  LYM DIGQND+AGAF   +  Q++  IP+ + E +  +  +Y  GG
Sbjct  149   FDRYVPAEDYFQKGLYMFDIGQNDLAGAFYSKTLDQIVASIPNILVEFETGIKKLYDQGG  208

Query  639   RKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHE  818
             R FW+HNTGP+GCL + +A     DP ++ +E GC+   N+AA+  N++L  L ++L+ +
Sbjct  209   RNFWIHNTGPLGCLTQNVAKFGT-DP-SKLDELGCVSGHNQAAKLLNLQLHALTKKLQGQ  266

Query  819   MKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQS----GFS  980
               D+ I YVDIYTIK NLI+N + YGFE P+MACCG GG P  Y++ ISCGQ+    G S
Sbjct  267   YADSNITYVDIYTIKSNLIANYSRYGFEQPIMACCGYGGPPLNYDSRISCGQTKVLNGTS  326

Query  981   V----CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
             V    C D ++Y++WDG+HY+E AN  +++ +L+  +S PPF+
Sbjct  327   VTAKACSDSTEYVNWDGIHYSEAANQYISSQILTGKFSDPPFS  369



>ref|XP_010025157.1| PREDICTED: GDSL esterase/lipase At1g54790 isoform X3 [Eucalyptus 
grandis]
Length=470

 Score =   297 bits (760),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 158/365 (43%), Positives = 223/365 (61%), Gaps = 22/365 (6%)
 Frame = +3

Query  60    TCSAFLVLSS--PPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSS  233
             TC A L L    P   + +    P +FNFGDSNSDTG   +A       P+G+++F   S
Sbjct  96    TCIAILALLCLFPLGNSIDFFNFPAVFNFGDSNSDTGNLISAGIESLNPPNGQSYFQLPS  155

Query  234   DRLCDGRLIIDFLCENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLP----KFVLFSL  398
              R CDGRLI+DFL + +   +L+ YL+++  P+F+ G NFA   S  LP        FS 
Sbjct  156   GRYCDGRLIVDFLMDAMDLPFLNAYLDSIGIPNFRRGCNFATAASTILPATATSLSPFSF  215

Query  399   STQLLQFNRFRTRSLEFHSKG---TNGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQV  569
               Q+ QF RF+ R LE  +KG      +  EE F   LYM DIGQND+AG F   S  Q+
Sbjct  216   GVQVSQFLRFKARVLELLAKGKKLVKYLPAEEYFAQGLYMFDIGQNDLAGPFYSKSLDQI  275

Query  570   IEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIK  749
             +  IP+ + E ++    +Y  GGR FW+HNTGP+GC+ + +A     DP ++ +E GC+ 
Sbjct  276   LALIPTILVEFENGFKTLYDQGGRNFWIHNTGPLGCITQNIAKFGT-DP-SKLDEIGCVS  333

Query  750   SLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGG  929
               N+AA+ FN++L+ LC +LR +  DA I YVDI++IK NLI+N + YGFE P MACCG 
Sbjct  334   GHNQAAKLFNLQLNALCAKLRGQYTDANITYVDIFSIKSNLIANYSRYGFEQPFMACCGY  393

Query  930   GGAP--YNANISCGQS----GFSV----CKDGSKYISWDGVHYTEDANAMVAASVLSTNY  1079
             GGAP  Y++ +SCGQ+    G +V    C D ++Y++WDG+HYTE AN  +++ +L+  Y
Sbjct  394   GGAPLNYDSRVSCGQTKVLNGTTVTAKACDDSTEYVNWDGIHYTEAANQFISSQILTGKY  453

Query  1080  STPPF  1094
             S PPF
Sbjct  454   SDPPF  458


 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 45/84 (54%), Gaps = 5/84 (6%)
 Frame = +3

Query  21   MDTNQRAAMFVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGY  200
            M T       V  + S FL     PLA +     P +FNFGDSNSDTG   AA G     
Sbjct  1    MPTKILPLFHVLFSFSIFL-----PLATSTDFNFPAVFNFGDSNSDTGELVAALGIRLNP  55

Query  201  PDGRTFFHRSSDRLCDGRLIIDFL  272
            P+G T+F   + R CDGRLI+DFL
Sbjct  56   PNGDTYFKAPAGRFCDGRLIVDFL  79



>ref|XP_004156481.1| PREDICTED: GDSL esterase/lipase At1g54790-like [Cucumis sativus]
Length=389

 Score =   294 bits (752),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 160/344 (47%), Positives = 218/344 (63%), Gaps = 23/344 (7%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHR-SSDRLCDGRLIIDFLCENVKADYL  299
             P +FNFGDSNSDTG   A  G     P G T+F   SS R C+GRLIIDFL E     YL
Sbjct  35    PAVFNFGDSNSDTGELLAGKGFSLRLPYGETYFQSPSSGRFCNGRLIIDFLMEATGMPYL  94

Query  300   SPYLEAL-TPSFKNGVNFAIGGSQTLPKFVLF----SLSTQLLQFNRFRTRSLEFHSKGT  464
               YL+++  PSFK G N+A GGS  LP    F    S   Q+ QF  F++R L+  ++G 
Sbjct  95    RAYLDSVGRPSFKKGCNYAAGGSTVLPATAAFISPFSFGVQINQFLHFKSRVLQLRAQGK  154

Query  465   N---GMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVG  635
                  +  E+ F++ +YM DIGQND+  AF   SKA + + IP+ ++E +  +  +Y+ G
Sbjct  155   KIGKFLPVEKYFKDGIYMFDIGQNDLTAAF--YSKASMDQAIPTILTEFEIGLQKLYEQG  212

Query  636   GRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRH  815
              R FW+HNTGP+GCL + +AT    DP ++ +E GC+ S N+AA+ FN +L DL ++L+ 
Sbjct  213   ARNFWIHNTGPLGCLAQNIATFGT-DP-SKLDEFGCLTSHNQAAKLFNSQLHDLSKKLQS  270

Query  816   EMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQS----GF  977
             +  DATI+YVDIYTIK+NLI+N +  GFE P+M CCG GG P  Y++ ISCG +    G 
Sbjct  271   QYVDATIIYVDIYTIKFNLIANYSQLGFEQPIMTCCGFGGPPLNYDSRISCGLTKTLNGT  330

Query  978   SV----CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
              V    CKD SKY++WDGVHYTE AN  V++ +L+  Y  PPF+
Sbjct  331   VVTANGCKDSSKYVNWDGVHYTEAANEYVSSQILTGKYCDPPFS  374



>ref|XP_006392486.1| hypothetical protein EUTSA_v10023524mg [Eutrema salsugineum]
 gb|ESQ29772.1| hypothetical protein EUTSA_v10023524mg [Eutrema salsugineum]
Length=384

 Score =   294 bits (752),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 157/354 (44%), Positives = 220/354 (62%), Gaps = 21/354 (6%)
 Frame = +3

Query  93    PLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFL  272
             P + +  +R P I NFGDSNSDTG   +A       P G+T+F   S R CDGRLI+DFL
Sbjct  22    PSSLSIILRYPAIINFGDSNSDTGNLISAGIESVNPPYGQTYFRLPSGRYCDGRLIVDFL  81

Query  273   CENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLP----KFVLFSLSTQLLQFNRFRTR  437
              + +   +L+PYL++L  P+FK G NFA  GS  LP        FS   Q+ QF RF++R
Sbjct  82    LDAMDMPFLNPYLDSLGLPNFKRGCNFAAAGSTILPANPTSVSPFSFDLQISQFVRFKSR  141

Query  438   SLEFHSKGTNG----MLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIK  605
             +LE  +K        +   + +   LYMIDIGQNDIAGAF   +  QV+  IPS +   +
Sbjct  142   ALELLAKTGRKYEKYLPPLDYYSKGLYMIDIGQNDIAGAFYSKTLDQVLASIPSILETFE  201

Query  606   DAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVK  785
             + +  +Y+ GGR FW+HNTGP+GCL + +A  K    +T+ +E GC+ S N+AA+ FN++
Sbjct  202   NGLKRLYEEGGRNFWIHNTGPLGCLAQNIA--KFGTDSTKLDEFGCVSSHNQAAKLFNLQ  259

Query  786   LSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANIS  959
             L  L  + + +  D+ + Y DI++IK NLI+N + +GFENP+M CCG GGAP  Y++ IS
Sbjct  260   LHALSNKFQAQFPDSDVTYFDIFSIKSNLIANYSRFGFENPIMVCCGVGGAPLNYDSRIS  319

Query  960   CGQS----GFSV----CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
             CGQ+    G  V    C D S+YI+WDG+HYTE AN  V+  +L+  YS PPF+
Sbjct  320   CGQTKVLDGIPVTAKACNDSSEYINWDGIHYTEAANHFVSNQILTGKYSDPPFS  373



>gb|ACU22979.1| unknown [Glycine max]
Length=380

 Score =   293 bits (751),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 157/353 (44%), Positives = 222/353 (63%), Gaps = 20/353 (6%)
 Frame = +3

Query  93    PLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFL  272
             P A +  +  P +FNFGDSNSDTG   AA       P+G+T+F + S R  DGRL IDFL
Sbjct  19    PRAKSFHLDFPAVFNFGDSNSDTGALIAAAFESLYPPNGQTYFQKPSGRYSDGRLTIDFL  78

Query  273   CENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTL----PKFVLFSLSTQLLQFNRFRTR  437
              + +   +L+ YL++L  P+F+ G NFA   +  L         FS   Q+ QF RF+ R
Sbjct  79    MDAMDLPFLNAYLDSLGLPNFRKGCNFAAAAATILPATASSLCPFSFGVQVSQFLRFKAR  138

Query  438   SLEFHSKGTN---GMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKD  608
             +LE  +KG      +  E  FE  LYM DIGQND+AGAF   +  Q++  IP+ + E++ 
Sbjct  139   ALELIAKGRKFDKYVPDENVFEKGLYMFDIGQNDLAGAFYSKTLDQILASIPTILLELEK  198

Query  609   AVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKL  788
              +  +Y  GGR FW+HNTGP+GCLP+ +A  K    +++ +E GC+ S N+AA+ FN++L
Sbjct  199   GIKNLYDQGGRYFWIHNTGPLGCLPQNIA--KFGTDSSKLDELGCVSSHNQAAKTFNLQL  256

Query  789   SDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISC  962
               LC +L+ +  D+ + YVDI+TIK NLISN + YGFE P+MACCG GG P  Y++ +SC
Sbjct  257   HALCTKLQGQYPDSNVTYVDIFTIKSNLISNFSRYGFEQPIMACCGYGGPPLNYDSRVSC  316

Query  963   GQS----GFSV----CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
             G++    G ++    C D S+YISWDG+HYTE AN  VA+ +L+  YS PPF+
Sbjct  317   GETKTFNGTTITAKACNDTSEYISWDGIHYTETANQYVASQILTGKYSDPPFS  369



>ref|XP_011023542.1| PREDICTED: GDSL esterase/lipase At1g54790-like isoform X1 [Populus 
euphratica]
Length=380

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 155/353 (44%), Positives = 218/353 (62%), Gaps = 20/353 (6%)
 Frame = +3

Query  93    PLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFL  272
             PLA +   + P +FNFGDSNSDTG    A       P G   F   S R CDGRLIIDFL
Sbjct  19    PLAQSVHFKFPAVFNFGDSNSDTGNLVGAGIESIRLPYGEIHFQIPSGRYCDGRLIIDFL  78

Query  273   CENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLPKFVL----FSLSTQLLQFNRFRTR  437
              + ++  +L+ YLE++  P+F+ G NFA  GS  LP        FS   Q+ QF RF+ R
Sbjct  79    MDAMELPFLNAYLESVGVPNFRKGCNFAAAGSTILPATATSVSPFSFGVQVNQFLRFKAR  138

Query  438   SLEFHSKGTN---GMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKD  608
              LE  +KG      +  E+ F+  LYM DIGQND+AGAF   +  Q++  IP+ + E + 
Sbjct  139   VLELLAKGKRFDRYVPAEDYFQKGLYMFDIGQNDLAGAFYSKTLDQIVASIPNILVEFET  198

Query  609   AVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKL  788
              +  +Y  GGR FW+HNTGP+GCL + +A     DP ++ +E GC+   N+AA+  N++L
Sbjct  199   GIKKLYDQGGRNFWIHNTGPLGCLTQNVAKFGT-DP-SKLDELGCVSGHNQAAKLLNLQL  256

Query  789   SDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISC  962
               L ++L+ +  D+ I YVDIYTIK NLI+N + YGFE P+MACCG GG P  Y++ ISC
Sbjct  257   HALTKKLQGQYADSNITYVDIYTIKSNLIANYSRYGFEQPIMACCGYGGPPLNYDSRISC  316

Query  963   GQS----GFSV----CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
             GQ+    G SV    C D ++Y++WDG+HY+E AN  +++ +L+  +S PPF+
Sbjct  317   GQTKVLNGTSVTAKACSDSTEYVNWDGIHYSEAANQYISSQILTGKFSDPPFS  369



>ref|XP_004139365.1| PREDICTED: GDSL esterase/lipase At1g54790-like [Cucumis sativus]
 gb|KGN60875.1| hypothetical protein Csa_2G020970 [Cucumis sativus]
Length=390

 Score =   293 bits (751),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 160/345 (46%), Positives = 217/345 (63%), Gaps = 24/345 (7%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHR-SSDRLCDGRLIIDFLCENVKADYL  299
             P +FNFGDSNSDTG   A  G     P G T+F   SS R C+GRLIIDFL E     YL
Sbjct  35    PAVFNFGDSNSDTGELLAGKGFSLRLPYGETYFQSPSSGRFCNGRLIIDFLMEATGMPYL  94

Query  300   SPYLEAL-TPSFKNGVNFAIGGSQTLPKFVLF----SLSTQLLQFNRFRTRSLEFHSKGT  464
               YL+++  PSFK G N+A GGS  LP    F    S   Q+ QF  F++R L+  ++G 
Sbjct  95    RAYLDSVGRPSFKKGCNYAAGGSTVLPATAAFISPFSFGVQINQFLHFKSRVLQLRAQGD  154

Query  465   NG----MLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKV  632
                   +  E+ F++ +YM DIGQND+  AF   SKA + + IP+ ++E +  +  +Y  
Sbjct  155   KKIGKFLPVEKYFKDGIYMFDIGQNDLTAAF--YSKASMDQAIPTILTEFEIGLQKLYDQ  212

Query  633   GGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELR  812
             G R FW+HNTGP+GCL + +AT    DP ++ +E GC+ S N+AA+ FN +L DL ++L+
Sbjct  213   GARNFWIHNTGPLGCLAQNIATFGT-DP-SKLDEFGCLTSHNQAAKLFNSQLHDLSKKLQ  270

Query  813   HEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQS----G  974
              +  DATI+YVDIYTIK+NLI+N +  GFE P+M CCG GG P  Y++ ISCG +    G
Sbjct  271   SQYVDATIIYVDIYTIKFNLIANYSQLGFEQPIMTCCGFGGPPLNYDSRISCGLTKTLNG  330

Query  975   FSV----CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
               V    CKD SKY++WDGVHYTE AN  V++ +L+  Y  PPF+
Sbjct  331   TVVTANGCKDSSKYVNWDGVHYTEAANEYVSSQILTGKYCDPPFS  375



>ref|XP_006382647.1| hypothetical protein POPTR_0005s04100g [Populus trichocarpa]
 gb|ERP60444.1| hypothetical protein POPTR_0005s04100g [Populus trichocarpa]
Length=378

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/342 (44%), Positives = 213/342 (62%), Gaps = 20/342 (6%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLS  302
             P +FNFGDSNSDTG   A  G +   P+G+ +F   + R CDGRLI+DFL + ++  +L+
Sbjct  27    PAVFNFGDSNSDTGELAAGLGFLLAPPNGQIYFKTPTGRFCDGRLIVDFLMDAMELPFLN  86

Query  303   PYLEAL-TPSFKNGVNFAIGGSQTLPKFVL----FSLSTQLLQFNRFRTRSLEFHSKGT-  464
              YLE++  P+F+ G NFA  GS  LP        FS   Q+ QF RF+ R LE  +KG  
Sbjct  87    AYLESVGVPNFRKGCNFAAAGSTILPATATSVCPFSFGIQVNQFLRFKARVLELLAKGKK  146

Query  465   -NGMLGEED-FENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGG  638
              N  +  E+ FE  LYM DIGQND+AGAF   +  Q++  IP+ + E +  +  +Y  G 
Sbjct  147   FNKYIPAENYFEKGLYMFDIGQNDLAGAFYSKTFDQIVASIPNILVEFETGIKKLYDQGA  206

Query  639   RKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHE  818
             R FW+HNTGP+GCL + +A     DP ++ +E GC+   N+AA+ FN++L  L ++L+ +
Sbjct  207   RNFWIHNTGPLGCLTQNVAKFGT-DP-SKLDELGCVSGHNQAAKLFNLQLHALTKKLQDQ  264

Query  819   MKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQSGF-----  977
               D+ I YVDIYTIK NLI+N + YGFE P+MACCG GG P  Y+  I CGQ+       
Sbjct  265   HSDSNITYVDIYTIKSNLIANYSRYGFEQPIMACCGYGGPPLNYDRRIVCGQTKVLDGTS  324

Query  978   ---SVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPF  1094
                  C D ++Y++WDG+HY+E AN  +++ +L+  +S PPF
Sbjct  325   ATAQACNDSTEYVNWDGIHYSEAANQYISSQILTGKFSDPPF  366



>ref|XP_003568873.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Brachypodium 
distachyon]
Length=439

 Score =   295 bits (754),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 147/324 (45%), Positives = 198/324 (61%), Gaps = 13/324 (4%)
 Frame = +3

Query  126   VIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLSP  305
             V+FNFGDSNSDTGG  AA G     P+GRT+FHR + RL DGR+IIDF+CE++    L+P
Sbjct  107   VLFNFGDSNSDTGGVAAAGGIRIMLPEGRTYFHRPTGRLSDGRVIIDFICESLNTHELNP  166

Query  306   YLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGTNGMLGEE  485
             YL+ +   + NGVNFA+ GS        +SL+ Q+ QF  F+ RSLE   +G  G + +E
Sbjct  167   YLKGVGSDYSNGVNFAMAGSTVSHGVSPYSLNVQVDQFVYFKHRSLELFKRGLKGPVNKE  226

Query  486   DFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTG  665
              FENALYM+DIG ND+ G     S  +  +K    +SEI +A+  +Y  G RKFW+H TG
Sbjct  227   GFENALYMMDIGHNDVVGVMHTPSD-EWDKKFRKVVSEIGEAIQILYDNGARKFWIHGTG  285

Query  666   PVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYV  845
              +GCLP  +   K      E +  GC+ + N  A+ FN KLSDLC+++R  +KDAT+VY 
Sbjct  286   ALGCLPALVVQEK-----GEHDAHGCLANYNRGARAFNKKLSDLCDDMRLRLKDATVVYT  340

Query  846   DIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN---ANISCGQSGFSVCKDGSKYISWD  1016
             D++ IKY  ++N   YG E PLM CCG GG PYN       CG     +C    K +SWD
Sbjct  341   DMFAIKYGFVANHTSYGIEWPLMVCCGNGGPPYNFKPGKYGCGD----LCGPEDKVLSWD  396

Query  1017  GVHYTEDANAMVAASVLSTNYSTP  1088
             GVH+T+  + + A   +S  YS P
Sbjct  397   GVHFTDFGSGLAAKHSMSGEYSKP  420



>ref|XP_002319556.2| hypothetical protein POPTR_0013s02730g [Populus trichocarpa]
 gb|EEE95479.2| hypothetical protein POPTR_0013s02730g [Populus trichocarpa]
Length=380

 Score =   293 bits (749),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 158/369 (43%), Positives = 224/369 (61%), Gaps = 25/369 (7%)
 Frame = +3

Query  45    MFVFITCSAFLVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFH  224
             ++V    S FL     PLA +   + P +FNFGDSNSDTG    A       P G   F 
Sbjct  8     LYVLALISIFL-----PLAQSVHFKFPAVFNFGDSNSDTGNLVGAGIESIRPPYGEIHFQ  62

Query  225   RSSDRLCDGRLIIDFLCENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLPKFVL----  389
               S R CDGRLIIDFL + ++  +L+ YL+++  P+F+ G NFA  GS  LP        
Sbjct  63    IPSGRYCDGRLIIDFLMDAMELPFLNAYLDSVGVPNFRKGCNFAAAGSTILPATATSVSP  122

Query  390   FSLSTQLLQFNRFRTRSLEFHSKGTN---GMLGEEDFENALYMIDIGQNDIAGAFSYLSK  560
             FS   Q+ QF RF+ R LE  +KG      +  E+ F+  LYM DIGQND+AGAF   + 
Sbjct  123   FSFGVQVNQFLRFKARVLELLAKGKRFDRYVPAEDYFQKGLYMFDIGQNDLAGAFYSKTL  182

Query  561   AQVIEKIPSFISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETG  740
              Q++  IP+ + E +  +  +Y  GGR FW+HNTGP+GCL + +A     DP ++ +E G
Sbjct  183   DQIVASIPNILVEFETGIKKLYDQGGRNFWIHNTGPLGCLTQNVAKFGT-DP-SKLDELG  240

Query  741   CIKSLNEAAQEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMAC  920
             C+   N+AA+  N++L  L ++L+ +  D+ I YVDIYTIK NLI+N + YGFE P+MAC
Sbjct  241   CVSGHNQAAKLLNLQLHALTKKLQGQYADSNITYVDIYTIKSNLIANYSRYGFEQPIMAC  300

Query  921   CGGGGAP--YNANISCGQS----GFSV----CKDGSKYISWDGVHYTEDANAMVAASVLS  1070
             CG GG P  Y++ ISCGQ+    G SV    C D ++Y++WDG+HY+E AN  +++ +L+
Sbjct  301   CGYGGPPLNYDSRISCGQTKVLNGTSVTAKACSDSTEYVNWDGIHYSEAANQYISSQILT  360

Query  1071  TNYSTPPFN  1097
               +S PPF+
Sbjct  361   GKFSDPPFS  369



>ref|XP_002524808.1| Alpha-L-fucosidase 2 precursor, putative [Ricinus communis]
 gb|EEF37651.1| Alpha-L-fucosidase 2 precursor, putative [Ricinus communis]
Length=425

 Score =   294 bits (753),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 159/360 (44%), Positives = 216/360 (60%), Gaps = 22/360 (6%)
 Frame = +3

Query  75    LVLSSPPLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGR  254
             L+ +  P  +      P +FNFGDSNSDTGG  A      G P+G+T F   + R CDGR
Sbjct  51    LIFTFMPAVSPSNFSYPAVFNFGDSNSDTGGLVAGVAFPVGPPNGQTHFQEPAGRFCDGR  110

Query  255   LIIDFLCENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLP-----KFVLFSLSTQLLQ  416
             LIIDFL + +   +LSPYL+++  P+F  G NFA GGS  LP     +F  FS  TQ+ Q
Sbjct  111   LIIDFLMDAMDHSFLSPYLDSVGAPNFHMGCNFATGGSSILPANKSSRFP-FSFGTQVSQ  169

Query  417   FNRFRTRSLEFHSKGTN---GMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPS  587
             F  F+ R LE  +K       +  E+ F++ LY  D+GQND+ GAFS   + QV+  IP+
Sbjct  170   FIHFKARVLELIAKDRKLRKYLPLEQHFKDGLYTFDVGQNDLDGAFSSKPEDQVLAFIPN  229

Query  588   FISEIKDAVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAA  767
              +SE +  V  +Y  G R FW+HNTGP+GCLPR +AT       ++ ++ GC+ S N AA
Sbjct  230   ILSEFETGVEGLYSQGARNFWIHNTGPLGCLPRIIATFGKNA--SKLDQFGCVNSHNHAA  287

Query  768   QEFNVKLSDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN  947
               FN +L  LC +LR +  DAT+  VDI++IK NLISN + YGFE  L ACCG GG P N
Sbjct  288   TVFNTQLQSLCTKLRAQYSDATVTCVDIFSIKLNLISNFSQYGFEQSLAACCGYGGPPLN  347

Query  948   --ANISCGQSGF--------SVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
               + I+CG++          S C + +KY++WDG HYTE AN  V+  +L+ NYS PP +
Sbjct  348   FDSRIACGETKTLNGSTVTASPCNNTAKYVNWDGNHYTEAANKYVSEQILAGNYSDPPLS  407



>ref|XP_006471885.1| PREDICTED: GDSL esterase/lipase At1g54790-like isoform X1 [Citrus 
sinensis]
Length=380

 Score =   292 bits (747),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 158/352 (45%), Positives = 217/352 (62%), Gaps = 20/352 (6%)
 Frame = +3

Query  93    PLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFL  272
             P+  +   + P IFNFGDSNSDTG   AA       P+G+T+F + S R  DGRL+IDFL
Sbjct  19    PVTYSIEFKFPAIFNFGDSNSDTGNLIAAGIESLDPPNGQTYFQKPSGRYSDGRLVIDFL  78

Query  273   CENVKADYLSPYLEAL-TPSFKNGVNFAIGGS---QTLPKFVL-FSLSTQLLQFNRFRTR  437
              + +K  +L+ YL+++  PSF+ G NFA  GS   Q  P  V  FS   Q+ QF  F+ R
Sbjct  79    MDAMKLPFLNAYLDSIGLPSFQKGCNFAAAGSTIHQATPTSVCPFSFDIQVNQFLHFKAR  138

Query  438   SLEFHSKGT---NGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKD  608
              +E  +KG      +   + F   LY  DIGQND+AGAF   +  QV+  IP  + E + 
Sbjct  139   VVELLAKGKRLDKYIPAVDYFSKGLYTFDIGQNDLAGAFYSKTIDQVLASIPKILEEFET  198

Query  609   AVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKL  788
              +  +Y  G R FW+HNTGP+GCL + +A  K     +  +E GC+   N+AA+ FN++L
Sbjct  199   GLRRLYDEGARNFWIHNTGPLGCLAQNVA--KFGTDLSMLDELGCVSGHNQAAKLFNLQL  256

Query  789   SDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISC  962
               LC++L+ +  D+ I YVDIYTIKY+LI+N + YGFE P+MACCG GGAP  YN+ ISC
Sbjct  257   HALCKKLQGDYTDSNITYVDIYTIKYSLIANYSRYGFEQPIMACCGVGGAPLNYNSGISC  316

Query  963   GQS----GFSV----CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPF  1094
             GQ+    G SV    C D ++Y++WDG+HYTE AN  V+  +L+  YS PPF
Sbjct  317   GQTKVINGTSVTAKACSDSTEYVNWDGIHYTEAANQYVSTQILTGKYSDPPF  368



>ref|XP_011048918.1| PREDICTED: GDSL esterase/lipase At1g54790-like isoform X2 [Populus 
euphratica]
Length=382

 Score =   292 bits (747),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 148/342 (43%), Positives = 212/342 (62%), Gaps = 20/342 (6%)
 Frame = +3

Query  123   PVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENVKADYLS  302
             P +FNFGDSNSDTG   A  G +   P+G+T+F   + R CDGRL +DFL + ++  +L+
Sbjct  31    PAVFNFGDSNSDTGDLAAGLGFLLAPPNGQTYFKTPTGRFCDGRLTVDFLMDAMELPFLN  90

Query  303   PYLEAL-TPSFKNGVNFAIGGSQTLPKFVL----FSLSTQLLQFNRFRTRSLEFHSKGT-  464
              YLE++  P+F+ G NFA  GS  LP        FS   Q+ QF RF+ R LE  +KG  
Sbjct  91    AYLESVGVPNFRKGCNFAAAGSTILPATATSVSPFSFGVQVNQFLRFKARVLELLAKGKK  150

Query  465   -NGMLGEED-FENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGG  638
              N  +  E+ FE  LYM DIGQND+AGAF   +  Q++   P+ + E +  +  +Y  G 
Sbjct  151   FNKYIPAENYFEKGLYMFDIGQNDLAGAFYSKTFDQIVASTPNILVEFETGIKKLYDQGA  210

Query  639   RKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHE  818
             R FW+HNTGP+GCL + +A     DP ++ +E GC+   N+AA+ FN++L  L ++L+ +
Sbjct  211   RNFWIHNTGPLGCLTQNVAKFGT-DP-SKLDELGCVSGHNQAAKLFNLQLHALTKKLQDQ  268

Query  819   MKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISCGQSGF-----  977
               D+ I YVDIYTIK NLI+N + YGFE P+MACCG GG P  Y+  I CGQ+       
Sbjct  269   HSDSNITYVDIYTIKSNLIANYSRYGFEQPIMACCGYGGPPLNYDRRIVCGQTKVLDGTS  328

Query  978   ---SVCKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPF  1094
                  C D ++Y++WDG+HY+E AN  +++ +L+  +S PPF
Sbjct  329   ATAQTCNDSTEYVNWDGIHYSEAANQYISSQILTGKFSDPPF  370



>ref|XP_004977098.1| PREDICTED: GDSL esterase/lipase At1g09390-like [Setaria italica]
Length=427

 Score =   293 bits (751),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 148/331 (45%), Positives = 202/331 (61%), Gaps = 14/331 (4%)
 Frame = +3

Query  108   ECIRNPVI-FNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFLCENV  284
             E  R PV+ FNFGDSNSDTGG  AA G     P+GRT+F R + RL DGR+IIDF+CE++
Sbjct  89    ERQRPPVVLFNFGDSNSDTGGVAAAGGIRIMPPEGRTYFRRPTGRLSDGRVIIDFICESL  148

Query  285   KADYLSPYLEALTPSFKNGVNFAIGGSQTLPKFVLFSLSTQLLQFNRFRTRSLEFHSKGT  464
                 L+PYL+ +   + NG NFA+ GS        +SL+ Q+ QF  FR RSLE   +G 
Sbjct  149   GTHELNPYLKGIGSDYSNGANFAMAGSTVSHGVSPYSLNVQVDQFVYFRHRSLEMFERGL  208

Query  465   NGMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKDAVWAIYKVGGRK  644
              G + +E FENALYM+DIG ND+ G  ++    Q  +KI   + E++ A+  +Y  G RK
Sbjct  209   KGPVSKEGFENALYMMDIGHNDMVGV-AHTPSDQWDKKITEIVGEVRKAISILYDNGARK  267

Query  645   FWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKLSDLCEELRHEMK  824
             FW+H TG +GCLP  +   K      E +  GC+ S+N AA+ +N KLS LC+++R  +K
Sbjct  268   FWIHGTGALGCLPALVVQEK-----GEHDAHGCLASVNRAAKAYNKKLSQLCDDMRFHLK  322

Query  825   DATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAPYN---ANISCGQSGFSVCKDG  995
             DATIVY D++ IKY+ ++N   YG E P M CCG GG PYN       CG     +C   
Sbjct  323   DATIVYTDMFAIKYDFVANHTKYGIEWPFMVCCGNGGPPYNFKPGKFGCGD----LCPPE  378

Query  996   SKYISWDGVHYTEDANAMVAASVLSTNYSTP  1088
             +K +SWDGVH+T+  + + A   +S  YS P
Sbjct  379   AKVVSWDGVHFTDFGSGLAAKLAMSGEYSKP  409



>ref|XP_007147074.1| hypothetical protein PHAVU_006G094100g [Phaseolus vulgaris]
 gb|ESW19068.1| hypothetical protein PHAVU_006G094100g [Phaseolus vulgaris]
Length=380

 Score =   291 bits (746),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 154/353 (44%), Positives = 220/353 (62%), Gaps = 20/353 (6%)
 Frame = +3

Query  93    PLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFL  272
             P A +  +  P +FNFGDSNSDTG   AA       P+G+T+F   S R  DGRLI+DFL
Sbjct  19    PCAKSFQLDFPAVFNFGDSNSDTGALIAAGFESLYPPNGQTYFQIPSGRYSDGRLIVDFL  78

Query  273   CENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTLP----KFVLFSLSTQLLQFNRFRTR  437
              + +   +L+ YL+++  P+F+ G NFA   +  LP        FS   Q+ QF RF+ R
Sbjct  79    MDAMDLPFLNAYLDSVGLPNFRKGCNFAAAAATILPASSSSLCPFSFGVQVSQFFRFKAR  138

Query  438   SLEFHSKGTN---GMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKD  608
             +LE  +KG      +  E  FE  LYM DIGQND+AGAF   +  Q++  IP+ + E++ 
Sbjct  139   ALELIAKGRKFDKYVPDENIFEKGLYMFDIGQNDLAGAFYSKTLDQILASIPTILLELEK  198

Query  609   AVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKL  788
              +  +Y  G R FW+HNTGP+GCLP+ +A  K     ++ +E GC+ S N+AA+ FN++L
Sbjct  199   GIKNLYDQGARYFWIHNTGPLGCLPQNIA--KFGTDASKLDELGCVSSHNQAAKTFNLQL  256

Query  789   SDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISC  962
               LC +L+ +  D+ + YVDI++IK NLI+N + YGFE P+MACCG GG P  Y++ +SC
Sbjct  257   HALCTKLQGQYPDSNVTYVDIFSIKSNLIANFSRYGFEQPIMACCGFGGPPLNYDSRLSC  316

Query  963   GQS----GFSV----CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
             G++    G ++    C D S YISWDG+HYTE AN  VA+ +L+  YS PPF+
Sbjct  317   GETKTFNGTTITAQACNDSSDYISWDGIHYTETANQYVASQILTGKYSDPPFS  369



>ref|XP_006577255.1| PREDICTED: GDSL esterase/lipase At1g54790-like isoform X1 [Glycine 
max]
Length=380

 Score =   291 bits (746),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 156/353 (44%), Positives = 221/353 (63%), Gaps = 20/353 (6%)
 Frame = +3

Query  93    PLAAAECIRNPVIFNFGDSNSDTGGYPAAHGNIFGYPDGRTFFHRSSDRLCDGRLIIDFL  272
             P A +  +  P +FNFGDSNSDTG   AA       P+G+T+F + S R  DGRL IDFL
Sbjct  19    PRAKSFHLDFPAVFNFGDSNSDTGALIAAAFESLYPPNGQTYFQKPSGRYSDGRLTIDFL  78

Query  273   CENVKADYLSPYLEAL-TPSFKNGVNFAIGGSQTL----PKFVLFSLSTQLLQFNRFRTR  437
              + +   +L+ YL++L  P+F+ G NFA   +  L         FS   Q+ QF RF+ R
Sbjct  79    MDAMDLPFLNAYLDSLGLPNFRKGCNFAAAAATILPATASSLCPFSFGVQVSQFLRFKAR  138

Query  438   SLEFHSKGTN---GMLGEEDFENALYMIDIGQNDIAGAFSYLSKAQVIEKIPSFISEIKD  608
             +LE  +KG      +  E  FE  LYM DIGQND+AGAF   +  Q++  IP+ + E++ 
Sbjct  139   ALELIAKGRKFDKYVPDENVFEKGLYMFDIGQNDLAGAFYSKTLDQILASIPTILLELEK  198

Query  609   AVWAIYKVGGRKFWVHNTGPVGCLPRTLATTKVRDPNTEFEETGCIKSLNEAAQEFNVKL  788
              +  +Y  G R FW+HNTGP+GCLP+ +A  K    +++ +E GC+ S N+AA+ FN++L
Sbjct  199   GIKNLYDQGARYFWIHNTGPLGCLPQNIA--KFGTDSSKLDELGCVSSHNQAAKTFNLQL  256

Query  789   SDLCEELRHEMKDATIVYVDIYTIKYNLISNSAIYGFENPLMACCGGGGAP--YNANISC  962
               LC +L+ +  D+ + YVDI+TIK NLISN + YGFE P+MACCG GG P  Y++ +SC
Sbjct  257   HALCTKLQGQYPDSNVTYVDIFTIKSNLISNFSRYGFEQPIMACCGYGGPPLNYDSRVSC  316

Query  963   GQS----GFSV----CKDGSKYISWDGVHYTEDANAMVAASVLSTNYSTPPFN  1097
             G++    G ++    C D S+YISWDG+HYTE AN  VA+ +L+  YS PPF+
Sbjct  317   GETKTFNGTTITAKACNDTSEYISWDGIHYTETANQYVASQILTGKYSDPPFS  369



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3411484722990