BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18901_g1_i1 len=884 path=[862:0-86 949:87-225 1088:226-275
1138:276-357 1220:358-419 1282:420-883]

Length=884
                                                                      Score     E

gb|AAG10403.1|AF233284_1  mannose-binding lectin                        148   4e-40   Convolvulus arvensis
gb|AAC49564.1|  lectin                                                  139   9e-37   Calystegia sepium
pdb|1OUW|A  Chain A, Crystal Structure Of Calystegia Sepium Agglu...    137   9e-36   
dbj|BAA14024.1|  ipomoelin                                              115   1e-27   Ipomoea batatas [batate]
pdb|3R50|A  Chain A, Structure Analysis Of A Wound-Inducible Lect...    115   2e-27   
gb|AAA87042.1|  putative 32.7 kDa jasmonate-induced protein           87.4    1e-16   Hordeum vulgare [barley]
gb|EEC68267.1|  hypothetical protein OsI_36302                        88.2    9e-16   Oryza sativa Indica Group [Indian rice]
ref|NP_001066367.1|  Os12g0198700                                     84.3    1e-15   Oryza sativa Japonica Group [Japonica rice]
gb|ABA93998.1|  NB-ARC domain containing protein, expressed           86.3    3e-15   Oryza sativa Japonica Group [Japonica rice]
gb|AAA87041.1|  putative 32.6 kDa jasmonate-induced protein           83.6    3e-15   Hordeum vulgare [barley]
gb|EMS66150.1|  hypothetical protein TRIUR3_12251                     83.2    3e-15   
gb|EEE52195.1|  hypothetical protein OsJ_34074                        85.5    5e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009589464.1|  PREDICTED: agglutinin-like                       83.2    8e-15   
ref|XP_011030089.1|  PREDICTED: jacalin-related lectin 19             80.5    8e-15   
ref|XP_009795366.1|  PREDICTED: putative late blight resistance p...  83.6    2e-14   
ref|XP_009772163.1|  PREDICTED: putative late blight resistance p...  83.6    2e-14   
ref|XP_009772162.1|  PREDICTED: putative late blight resistance p...  83.6    2e-14   
ref|XP_009772161.1|  PREDICTED: putative late blight resistance p...  83.6    2e-14   
ref|XP_004168675.1|  PREDICTED: pentatricopeptide repeat-containi...  82.8    4e-14   
gb|EAY82651.1|  hypothetical protein OsI_37872                        80.1    4e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_008677986.1|  PREDICTED: mannose/glucose-specific lectin-l...  82.4    4e-14   
ref|XP_008677991.1|  PREDICTED: mannose/glucose-specific lectin-l...  82.4    5e-14   
ref|XP_008677990.1|  PREDICTED: mannose/glucose-specific lectin-l...  82.4    5e-14   
ref|NP_001066495.1|  Os12g0247700                                     80.1    5e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008677994.1|  PREDICTED: mannose/glucose-specific lectin-l...  82.0    5e-14   
ref|XP_008677998.1|  PREDICTED: mannose/glucose-specific lectin-l...  82.0    5e-14   
ref|XP_008677996.1|  PREDICTED: mannose/glucose-specific lectin-l...  82.0    5e-14   
gb|EEC69076.1|  hypothetical protein OsI_37951                        79.0    6e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_004298564.1|  PREDICTED: uncharacterized protein LOC101299670  82.0    6e-14   
ref|XP_002318228.2|  hypothetical protein POPTR_0012s13320g           78.6    7e-14   Populus trichocarpa [western balsam poplar]
ref|XP_008677992.1|  PREDICTED: mannose/glucose-specific lectin-l...  81.3    9e-14   
ref|XP_006663483.1|  PREDICTED: probable disease resistance RPP8-...  81.6    9e-14   
gb|EMT24046.1|  hypothetical protein F775_25349                       79.0    1e-13   
gb|AAR20919.1|  jasmonate-induced protein                             79.0    1e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004982894.1|  PREDICTED: salt stress-induced protein-like      76.6    1e-13   
ref|XP_009614994.1|  PREDICTED: putative late blight resistance p...  81.3    1e-13   
ref|XP_009614993.1|  PREDICTED: putative late blight resistance p...  81.3    1e-13   
ref|XP_009614991.1|  PREDICTED: putative late blight resistance p...  81.3    1e-13   
ref|XP_002440163.1|  hypothetical protein SORBIDRAFT_09g027055        77.4    1e-13   Sorghum bicolor [broomcorn]
gb|ACF87628.1|  unknown                                               75.5    1e-13   Zea mays [maize]
gb|ABS82785.1|  jasmonate-induced protein                             78.6    1e-13   Triticum aestivum [Canadian hard winter wheat]
gb|KHN46147.1|  Agglutinin                                            80.5    2e-13   
gb|EAZ01021.1|  hypothetical protein OsI_23055                        80.1    2e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_003615697.1|  Myrosinase-binding protein-like protein          80.1    2e-13   
ref|NP_001106057.1|  PL3K2                                            75.5    2e-13   Zea mays [maize]
gb|EMT11070.1|  hypothetical protein F775_02114                       78.6    2e-13   
gb|EMS55842.1|  hypothetical protein TRIUR3_32339                     77.8    3e-13   
gb|ACG29554.1|  hypothetical protein                                  75.5    3e-13   Zea mays [maize]
ref|XP_004235622.1|  PREDICTED: jacalin-related lectin 19             76.3    3e-13   
gb|EEC68269.1|  hypothetical protein OsI_36304                        79.7    4e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_009769147.1|  PREDICTED: putative late blight resistance p...  79.7    4e-13   
ref|XP_004152769.1|  PREDICTED: pentatricopeptide repeat-containi...  79.3    4e-13   
ref|XP_006853911.1|  hypothetical protein AMTR_s00036p00183970        73.9    6e-13   
ref|XP_004960459.1|  PREDICTED: salt stress-induced protein-like      74.3    7e-13   
ref|XP_010273654.1|  PREDICTED: mannose/glucose-specific lectin-like  73.9    8e-13   
ref|XP_004298563.1|  PREDICTED: myrosinase-binding protein-like A...  77.4    8e-13   
gb|AFW60405.1|  putative protein kinase superfamily protein           78.2    8e-13   
ref|XP_004490606.1|  PREDICTED: mannose/glucose-specific lectin-l...  77.8    1e-12   
gb|KGN62634.1|  hypothetical protein Csa_2G362470                     77.8    1e-12   
ref|XP_004490607.1|  PREDICTED: mannose/glucose-specific lectin-l...  77.8    1e-12   
ref|XP_006647196.1|  PREDICTED: disease resistance protein RPM1-l...  78.2    1e-12   
ref|XP_008444758.1|  PREDICTED: LOW QUALITY PROTEIN: myrosinase-b...  77.8    1e-12   
ref|XP_006647195.1|  PREDICTED: disease resistance protein RPM1-l...  78.2    1e-12   
ref|XP_006343016.1|  PREDICTED: agglutinin-like                       74.7    1e-12   
ref|XP_006663484.1|  PREDICTED: putative disease resistance RPP13...  78.2    1e-12   
ref|XP_010088386.1|  hypothetical protein L484_008121                 74.3    1e-12   
gb|EEE60695.1|  hypothetical protein OsJ_14181                        72.0    2e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006838705.1|  hypothetical protein AMTR_s00002p00249920        77.0    2e-12   
ref|NP_001052560.1|  Os04g0369100                                     77.0    2e-12   Oryza sativa Japonica Group [Japonica rice]
emb|CAD40628.2|  OSJNBa0016N04.16                                     76.6    2e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EEE60834.1|  hypothetical protein OsJ_14451                        77.0    2e-12   Oryza sativa Japonica Group [Japonica rice]
sp|P83304.1|LEC_PARPC  RecName: Full=Mannose/glucose-specific lectin  76.3    3e-12   Parkia platycephala
emb|CDM80625.1|  unnamed protein product                              75.1    3e-12   
ref|XP_009770862.1|  PREDICTED: putative late blight resistance p...  76.6    3e-12   
ref|XP_009763421.1|  PREDICTED: putative late blight resistance p...  76.6    3e-12   
ref|XP_009614996.1|  PREDICTED: putative late blight resistance p...  76.6    3e-12   
ref|XP_006853910.1|  hypothetical protein AMTR_s00036p00183430        72.8    4e-12   
ref|XP_009763456.1|  PREDICTED: putative late blight resistance p...  76.3    4e-12   
ref|XP_010471351.1|  PREDICTED: jacalin-related lectin 19             72.4    5e-12   
ref|NP_177447.1|  Mannose-binding lectin superfamily protein          72.4    6e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ABA94002.1|  Jacalin-like lectin domain containing protein, ex...  75.9    6e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EEE52196.1|  hypothetical protein OsJ_34075                        75.9    6e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009763450.1|  PREDICTED: putative late blight resistance p...  75.9    6e-12   
gb|EYU45162.1|  hypothetical protein MIMGU_mgv1a025414mg              74.3    6e-12   
gb|EYU45843.1|  hypothetical protein MIMGU_mgv1a014002mg              72.4    7e-12   
ref|XP_009763443.1|  PREDICTED: putative late blight resistance p...  75.9    7e-12   
ref|XP_004291831.1|  PREDICTED: uncharacterized protein LOC101310192  75.5    7e-12   
gb|EAY93469.1|  hypothetical protein OsI_15270                        71.2    7e-12   Oryza sativa Indica Group [Indian rice]
ref|NP_001052399.1|  Os04g0295400                                     71.2    8e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008244753.1|  PREDICTED: agglutinin-like                       71.6    8e-12   
ref|XP_002467725.1|  hypothetical protein SORBIDRAFT_01g033090        71.2    8e-12   Sorghum bicolor [broomcorn]
gb|EMS58273.1|  hypothetical protein TRIUR3_17900                     73.6    9e-12   
ref|XP_009768640.1|  PREDICTED: putative late blight resistance p...  75.5    9e-12   
ref|XP_009768636.1|  PREDICTED: putative late blight resistance p...  75.5    9e-12   
emb|CDO97947.1|  unnamed protein product                              73.2    9e-12   
ref|XP_002467724.1|  hypothetical protein SORBIDRAFT_01g033080        70.9    1e-11   Sorghum bicolor [broomcorn]
ref|XP_010230396.1|  PREDICTED: jacalin-related lectin 3-like         72.4    1e-11   
dbj|BAK00987.1|  predicted protein                                    73.6    1e-11   
gb|KDP38566.1|  hypothetical protein JCGZ_04491                       74.7    1e-11   
ref|XP_009588771.1|  PREDICTED: agglutinin-like                       73.9    1e-11   
ref|XP_009622524.1|  PREDICTED: mannose/glucose-specific lectin-l...  74.7    1e-11   
ref|XP_011081586.1|  PREDICTED: jacalin-related lectin 19-like        73.2    1e-11   
ref|XP_007142198.1|  hypothetical protein PHAVU_008G260500g           74.3    2e-11   
ref|XP_007215056.1|  hypothetical protein PRUPE_ppa012210mg           70.9    2e-11   
gb|KDO84683.1|  hypothetical protein CISIN_1g007083mg                 73.9    2e-11   
ref|XP_006301377.1|  hypothetical protein CARUB_v10021789mg           70.9    2e-11   
ref|XP_007142199.1|  hypothetical protein PHAVU_008G260500g           73.9    2e-11   
ref|XP_010924945.1|  PREDICTED: jacalin-related lectin 19-like is...  70.9    2e-11   
gb|KDO84682.1|  hypothetical protein CISIN_1g007083mg                 73.9    2e-11   
gb|ABA94728.1|  Jacalin-like lectin domain containing protein         73.9    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010060992.1|  PREDICTED: jacalin-related lectin 3              73.6    3e-11   
ref|XP_006390600.1|  hypothetical protein EUTSA_v10019210mg           70.5    3e-11   
ref|XP_004984089.1|  PREDICTED: protein GOS9-like                     69.7    3e-11   
ref|XP_010924946.1|  PREDICTED: jacalin-related lectin 19-like is...  70.9    3e-11   
ref|XP_002439182.1|  hypothetical protein SORBIDRAFT_09g001880        72.4    3e-11   Sorghum bicolor [broomcorn]
ref|XP_010690084.1|  PREDICTED: jacalin-related lectin 19             70.5    3e-11   
ref|XP_006853909.1|  hypothetical protein AMTR_s00036p00182710        70.5    3e-11   
ref|XP_006372713.1|  hypothetical protein POPTR_0017s043602g          70.1    3e-11   
gb|KHG23822.1|  Agglutinin alpha chain                                70.1    3e-11   
ref|XP_009622525.1|  PREDICTED: agglutinin-like isoform X2            73.2    3e-11   
ref|XP_009768641.1|  PREDICTED: putative late blight resistance p...  73.6    3e-11   
ref|XP_002450764.1|  hypothetical protein SORBIDRAFT_05g017250        73.6    3e-11   Sorghum bicolor [broomcorn]
ref|XP_006473572.1|  PREDICTED: pentatricopeptide repeat-containi...  73.6    4e-11   
ref|XP_006435072.1|  hypothetical protein CICLE_v10000604mg           73.2    4e-11   
ref|XP_009127966.1|  PREDICTED: agglutinin                            69.7    4e-11   
ref|XP_006473571.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    4e-11   
ref|XP_006426466.1|  hypothetical protein CICLE_v10026553mg           69.7    5e-11   
ref|XP_011074623.1|  PREDICTED: jacalin-related lectin 3              72.8    5e-11   
ref|XP_009391787.1|  PREDICTED: agglutinin-like                       70.9    5e-11   
ref|XP_002888904.1|  predicted protein                                69.3    5e-11   
gb|EMT07650.1|  Horcolin                                              71.6    5e-11   
gb|KCW69704.1|  hypothetical protein EUGRSUZ_F03098                   70.5    5e-11   
ref|XP_008244775.1|  PREDICTED: LOW QUALITY PROTEIN: agglutinin-like  72.0    6e-11   
ref|XP_008806706.1|  PREDICTED: agglutinin-like isoform X1            69.7    6e-11   
ref|XP_008806712.1|  PREDICTED: agglutinin-like isoform X2            69.7    6e-11   
gb|AAB72098.1|  32 kDa protein                                        71.2    6e-11   Hordeum vulgare [barley]
ref|XP_003577374.2|  PREDICTED: mannose/glucose-specific lectin-l...  72.4    6e-11   
pdb|4MQ0|A  Chain A, Crystal Structure Of Parkia Biglobosa Seed L...  72.4    6e-11   
gb|EEC72970.1|  hypothetical protein OsI_06866                        72.8    6e-11   Oryza sativa Indica Group [Indian rice]
dbj|BAD23250.1|  putative LZ-NBS-LRR class RGA                        72.8    6e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663456.1|  PREDICTED: disease resistance protein RPM1-like  72.8    6e-11   
ref|XP_010237569.1|  PREDICTED: mannose/glucose-specific lectin-l...  72.4    7e-11   
ref|XP_004986922.1|  PREDICTED: horcolin-like                         68.2    8e-11   
gb|EAY80990.1|  hypothetical protein OsI_36172                        72.0    1e-10   Oryza sativa Indica Group [Indian rice]
gb|KHG26998.1|  Agglutinin                                            72.0    1e-10   
ref|XP_008221341.1|  PREDICTED: uncharacterized protein LOC103321320  72.0    1e-10   
ref|XP_011001798.1|  PREDICTED: mannose/glucose-specific lectin-l...  71.6    1e-10   
ref|XP_010533565.1|  PREDICTED: jacalin-related lectin 3 isoform X1   71.6    1e-10   
ref|XP_011001797.1|  PREDICTED: mannose/glucose-specific lectin-l...  71.6    1e-10   
gb|KFK41744.1|  hypothetical protein AALP_AA2G166700                  68.6    1e-10   
ref|XP_010533571.1|  PREDICTED: jacalin-related lectin 3 isoform X2   71.6    1e-10   
emb|CAE76026.1|  B1292H11.12                                          68.6    1e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EMT23136.1|  hypothetical protein F775_18655                       67.4    1e-10   
ref|NP_001148739.1|  LOC100282355                                     68.9    1e-10   Zea mays [maize]
ref|XP_010428208.1|  PREDICTED: jacalin-related lectin 19-like is...  68.6    1e-10   
ref|XP_010062570.1|  PREDICTED: jacalin-related lectin 19             70.1    1e-10   
ref|XP_006662244.1|  PREDICTED: uncharacterized protein LOC102708001  70.9    1e-10   
ref|XP_011001796.1|  PREDICTED: mannose/glucose-specific lectin-l...  71.2    1e-10   
ref|XP_009400545.1|  PREDICTED: agglutinin alpha chain                68.6    2e-10   
ref|XP_008654965.1|  PREDICTED: LOC100282355 isoform X4               68.9    2e-10   
ref|XP_004980504.1|  PREDICTED: protein GOS9-like                     67.0    2e-10   
ref|XP_002510452.1|  pentatricopeptide repeat-containing protein,...  71.6    2e-10   Ricinus communis
gb|EAY90359.1|  hypothetical protein OsI_11939                        67.4    2e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_004964114.1|  PREDICTED: mannose/glucose-specific lectin-like  67.0    2e-10   
ref|XP_008654962.1|  PREDICTED: LOC100282355 isoform X2               68.9    2e-10   
gb|KDO58671.1|  hypothetical protein CISIN_1g037526mg                 68.2    2e-10   
ref|XP_010477194.1|  PREDICTED: jacalin-related lectin 3-like iso...  70.9    2e-10   
ref|XP_008654961.1|  PREDICTED: LOC100282355 isoform X1               68.9    2e-10   
ref|NP_849691.1|  Mannose-binding lectin superfamily protein          70.9    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008348486.1|  PREDICTED: agglutinin alpha chain-like           68.2    2e-10   
gb|ADV38315.1|  mannose/glucose-specific lectin                       67.4    2e-10   
ref|NP_001117315.1|  Mannose-binding lectin superfamily protein       70.9    2e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AAL10685.1|  mannose-binding lectin                                67.4    2e-10   Morus nigra
ref|NP_001185041.1|  Mannose-binding lectin superfamily protein       70.9    2e-10   
ref|XP_008654963.1|  PREDICTED: LOC100282355 isoform X3               68.6    2e-10   
ref|XP_010428207.1|  PREDICTED: jacalin-related lectin 19-like is...  68.6    2e-10   
ref|XP_010477196.1|  PREDICTED: pentatricopeptide repeat-containi...  70.9    2e-10   
ref|XP_010099937.1|  hypothetical protein L484_020125                 70.1    2e-10   
gb|EMT07330.1|  Disease resistance protein RPM1                       70.9    3e-10   
ref|XP_002893063.1|  jacalin lectin family protein                    70.5    3e-10   
ref|NP_001148448.1|  jasmonate-induced protein                        67.8    3e-10   Zea mays [maize]
ref|XP_010428206.1|  PREDICTED: jacalin-related lectin 19-like is...  68.2    3e-10   
ref|XP_002893064.1|  hypothetical protein ARALYDRAFT_472198           70.9    3e-10   
ref|XP_009608039.1|  PREDICTED: putative late blight resistance p...  70.9    3e-10   
ref|XP_009608038.1|  PREDICTED: putative late blight resistance p...  70.9    3e-10   
ref|XP_009608035.1|  PREDICTED: putative late blight resistance p...  70.9    3e-10   
ref|XP_004297619.1|  PREDICTED: agglutinin-like                       69.7    3e-10   
gb|EMT33809.1|  hypothetical protein F775_16156                       67.4    3e-10   
ref|XP_009760249.1|  PREDICTED: agglutinin-like                       69.7    3e-10   
ref|XP_010935305.1|  PREDICTED: jacalin-related lectin 3-like         70.1    3e-10   
gb|ABF96452.1|  Jacalin-like lectin domain containing protein, ex...  67.4    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006372325.1|  Mannose/glucose-specific lectin family protein   70.1    3e-10   
ref|XP_006383725.1|  hypothetical protein POPTR_0005s25400g           70.1    4e-10   
gb|AAK55472.1|AC084295_5  putative salt-induced protein               67.4    4e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EEE52450.1|  hypothetical protein OsJ_34606                        69.7    4e-10   Oryza sativa Japonica Group [Japonica rice]
emb|CAJ38387.1|  jacalin-domain protein                               67.4    4e-10   Plantago major [cart-track plant]
emb|CDY48032.1|  BnaA02g16250D                                        67.8    4e-10   
gb|EMT18893.1|  Disease resistance protein RPM1                       70.1    4e-10   
ref|XP_010092355.1|  hypothetical protein L484_023733                 67.0    4e-10   
gb|AEQ30064.1|  mannose/glucose-specific lectin                       66.6    4e-10   
ref|XP_006306414.1|  hypothetical protein CARUB_v10012347mg           70.1    4e-10   
ref|XP_009599288.1|  PREDICTED: jacalin-related lectin 3 isoform X1   70.1    5e-10   
ref|XP_010233169.1|  PREDICTED: jacalin-related lectin 3-like         70.1    5e-10   
ref|NP_001050311.2|  Os03g0399800                                     67.4    5e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009599289.1|  PREDICTED: jacalin-related lectin 3 isoform X2   69.7    5e-10   
ref|XP_006362248.1|  PREDICTED: myrosinase-binding protein-like A...  69.7    5e-10   
ref|XP_006354454.1|  PREDICTED: probable disease resistance RPP8-...  68.9    5e-10   
ref|XP_006362247.1|  PREDICTED: myrosinase-binding protein-like A...  69.7    5e-10   
gb|KDP40814.1|  hypothetical protein JCGZ_24813                       67.4    5e-10   
ref|XP_002515891.1|  hypothetical protein RCOM_1485780                69.7    5e-10   Ricinus communis
ref|XP_010232946.1|  PREDICTED: uncharacterized protein LOC104583002  67.8    5e-10   
gb|AAZ73669.1|  At1g19715-like protein                                66.6    5e-10   Arabidopsis lyrata [lyrate rockcress]
ref|XP_010267066.1|  PREDICTED: jacalin-related lectin 19             67.0    6e-10   
ref|XP_009768586.1|  PREDICTED: jacalin-related lectin 3-like         67.4    6e-10   
ref|XP_007017646.1|  Mannose-binding lectin superfamily protein, ...  69.3    6e-10   
ref|XP_007024409.1|  Mannose-binding lectin superfamily protein       68.6    6e-10   
ref|XP_007017648.1|  Mannose-binding lectin superfamily protein, ...  69.7    6e-10   
ref|XP_004979671.1|  PREDICTED: mannose/glucose-specific lectin-l...  69.7    6e-10   
ref|XP_004979669.1|  PREDICTED: mannose/glucose-specific lectin-l...  69.7    6e-10   
gb|ABA94732.1|  Jacalin-like lectin domain containing protein, ex...  69.3    6e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006838698.1|  hypothetical protein AMTR_s00002p00248970        65.9    6e-10   
ref|XP_004979670.1|  PREDICTED: mannose/glucose-specific lectin-l...  69.7    6e-10   
tpg|DAA60181.1|  TPA: hypothetical protein ZEAMMB73_326702            68.6    7e-10   
ref|XP_010664949.1|  PREDICTED: pentatricopeptide repeat-containi...  69.7    7e-10   
ref|XP_010498396.1|  PREDICTED: pentatricopeptide repeat-containi...  69.7    7e-10   
gb|AGT16237.1|  Jacalin-like lectin domain containing protein         69.3    7e-10   
ref|XP_009784520.1|  PREDICTED: uncharacterized protein LOC104232941  69.3    7e-10   
ref|XP_002449838.1|  hypothetical protein SORBIDRAFT_05g024220        68.2    8e-10   Sorghum bicolor [broomcorn]
ref|XP_009367509.1|  PREDICTED: agglutinin alpha chain                66.6    8e-10   
ref|XP_009771019.1|  PREDICTED: jacalin-related lectin 3 isoform X1   69.3    8e-10   
ref|XP_009771020.1|  PREDICTED: jacalin-related lectin 3 isoform X2   69.3    8e-10   
ref|XP_006416472.1|  hypothetical protein EUTSA_v10007145mg           68.9    8e-10   
gb|AGT16242.1|  Jacalin-like lectin domain containing protein         68.9    8e-10   
gb|KCW69706.1|  hypothetical protein EUGRSUZ_F03098                   67.0    8e-10   
ref|XP_010477195.1|  PREDICTED: jacalin-related lectin 3-like iso...  68.9    8e-10   
ref|XP_004960703.1|  PREDICTED: agglutinin-like                       68.2    9e-10   
ref|XP_002461768.1|  hypothetical protein SORBIDRAFT_02g007760        68.6    9e-10   Sorghum bicolor [broomcorn]
ref|XP_010459648.1|  PREDICTED: jacalin-related lectin 3 isoform X1   68.9    9e-10   
gb|EAZ25557.1|  hypothetical protein OsJ_09383                        65.1    9e-10   Oryza sativa Japonica Group [Japonica rice]
emb|CBI19765.3|  unnamed protein product                              68.9    9e-10   
ref|XP_011015046.1|  PREDICTED: mannose/glucose-specific lectin-l...  68.6    1e-09   
ref|XP_010110011.1|  hypothetical protein L484_021900                 68.9    1e-09   
gb|AHW81907.1|  mannose-binding lectin                                65.9    1e-09   
ref|XP_010654564.1|  PREDICTED: jacalin-related lectin 19-like        66.2    1e-09   
gb|AAM46813.1|  hessian fly response gene 1 protein                   68.2    1e-09   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008677993.1|  PREDICTED: mannose/glucose-specific lectin-l...  68.9    1e-09   
emb|CDX82115.1|  BnaC02g21750D                                        67.0    1e-09   
ref|XP_008677995.1|  PREDICTED: mannose/glucose-specific lectin-l...  68.6    1e-09   
ref|XP_009614721.1|  PREDICTED: jacalin-related lectin 19             66.6    1e-09   
ref|NP_001068257.2|  Os11g0607900                                     64.3    1e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006651478.1|  PREDICTED: horcolin-like                         65.5    1e-09   
ref|XP_002510454.1|  hypothetical protein RCOM_1595950                68.6    1e-09   Ricinus communis
ref|XP_009608047.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  68.9    1e-09   
ref|XP_011015045.1|  PREDICTED: mannose/glucose-specific lectin-l...  68.6    1e-09   
gb|KHN02073.1|  Agglutinin                                            68.6    1e-09   
gb|ABA94721.1|  Jacalin-like lectin domain containing protein         68.6    1e-09   Oryza sativa Japonica Group [Japonica rice]
gb|AAZ73661.1|  At1g19715                                             65.5    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008466548.1|  PREDICTED: agglutinin-like                       68.2    1e-09   
emb|CBI35988.3|  unnamed protein product                              65.9    2e-09   
ref|XP_006602089.1|  PREDICTED: agglutinin-like                       68.2    2e-09   
gb|AAZ73664.1|  At1g19715                                             65.5    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007216928.1|  hypothetical protein PRUPE_ppa016643mg           67.8    2e-09   
ref|XP_007222058.1|  hypothetical protein PRUPE_ppa003185mg           68.2    2e-09   
ref|XP_010932865.1|  PREDICTED: jacalin-related lectin 3-like iso...  65.9    2e-09   
ref|XP_004960702.1|  PREDICTED: mannose/glucose-specific lectin-like  67.4    2e-09   
gb|AAZ73652.1|  At1g19715                                             65.1    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010932970.1|  PREDICTED: mannose/glucose-specific lectin-l...  65.5    2e-09   
ref|XP_004249154.1|  PREDICTED: jacalin-related lectin 3 isoform X2   68.2    2e-09   
ref|XP_010312054.1|  PREDICTED: jacalin-related lectin 3 isoform X1   68.2    2e-09   
ref|XP_008778289.1|  PREDICTED: mannose/glucose-specific lectin-like  67.0    2e-09   
ref|XP_011048835.1|  PREDICTED: jacalin-related lectin 3-like iso...  67.8    2e-09   
ref|XP_010232948.1|  PREDICTED: jacalin-related lectin 19-like        66.2    2e-09   
ref|XP_008388156.1|  PREDICTED: uncharacterized protein LOC103450568  67.8    3e-09   
ref|XP_004170416.1|  PREDICTED: LOW QUALITY PROTEIN: agglutinin-like  67.0    3e-09   
gb|KFK44089.1|  hypothetical protein AALP_AA1G214700                  67.8    3e-09   
gb|EEE60415.1|  hypothetical protein OsJ_13609                        63.5    3e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008804538.1|  PREDICTED: uncharacterized protein LOC103717797  67.8    3e-09   
gb|KCW67999.1|  hypothetical protein EUGRSUZ_F01690                   67.8    3e-09   
gb|KDP46650.1|  hypothetical protein JCGZ_10959                       67.4    3e-09   
gb|EEE59214.1|  hypothetical protein OsJ_11170                        67.0    3e-09   
ref|XP_011048836.1|  PREDICTED: jacalin-related lectin 3-like iso...  67.4    3e-09   
gb|KCW67998.1|  hypothetical protein EUGRSUZ_F01690                   67.8    3e-09   
ref|XP_009407881.1|  PREDICTED: inactive protein RESTRICTED TEV M...  64.7    3e-09   
ref|NP_001141303.1|  uncharacterized protein LOC100273394             66.6    3e-09   
gb|KHN32674.1|  Agglutinin alpha chain                                64.7    3e-09   
ref|XP_002300741.2|  hypothetical protein POPTR_0002s03180g           67.4    4e-09   
ref|XP_008651439.1|  PREDICTED: jasmonate-induced protein isoform X1  66.2    4e-09   
gb|EMT07336.1|  hypothetical protein F775_29709                       66.6    4e-09   
ref|XP_009622527.1|  PREDICTED: agglutinin-like isoform X4            67.0    4e-09   
ref|XP_009588746.1|  PREDICTED: putative late blight resistance p...  67.4    4e-09   
ref|XP_009588743.1|  PREDICTED: putative late blight resistance p...  67.4    4e-09   
pdb|1XXQ|A  Chain A, Structure Of A Mannose-Specific Jacalin-Rela...  63.9    4e-09   
gb|KEH39537.1|  mannose-binding lectin superfamily protein            64.3    4e-09   
ref|XP_006654724.1|  PREDICTED: agglutinin-like                       64.7    4e-09   
ref|XP_010110012.1|  hypothetical protein L484_021901                 67.0    4e-09   
ref|XP_009622528.1|  PREDICTED: agglutinin-like isoform X5            66.6    4e-09   
ref|XP_010239309.1|  PREDICTED: LOW QUALITY PROTEIN: protein GOS9...  65.5    4e-09   
gb|KEH39536.1|  mannose-binding lectin superfamily protein            64.3    4e-09   
sp|Q5U9T2.1|LECH_HORVU  RecName: Full=Horcolin; AltName: Full=Agg...  63.5    5e-09   
ref|XP_010537548.1|  PREDICTED: LOW QUALITY PROTEIN: jacalin-rela...  64.3    5e-09   
ref|XP_008377187.1|  PREDICTED: uncharacterized protein LOC103440289  67.0    5e-09   
gb|KEH39538.1|  mannose-binding lectin superfamily protein            64.3    5e-09   
ref|XP_010674585.1|  PREDICTED: uncharacterized protein LOC104890703  67.4    5e-09   
ref|XP_006372328.1|  hypothetical protein POPTR_0017s00620g           63.5    5e-09   
ref|XP_010064569.1|  PREDICTED: jacalin-related lectin 4-like         67.0    5e-09   
ref|XP_008348484.1|  PREDICTED: agglutinin-like isoform X2            63.9    5e-09   
emb|CAE76030.1|  B1292H11.16                                          63.5    5e-09   
gb|ABJ97445.1|  beta-glucosidase aggregating factor 1                 65.9    5e-09   
ref|NP_001104964.1|  beta-glucosidase aggregating factor precursor    65.9    5e-09   
ref|XP_009622526.1|  PREDICTED: agglutinin-like isoform X3            66.6    5e-09   
emb|CDM80401.1|  unnamed protein product                              65.5    5e-09   
ref|XP_010236764.1|  PREDICTED: jacalin-related lectin 19-like        63.9    5e-09   
gb|ABC70328.1|  agglutinin isoform                                    65.9    6e-09   
gb|EMS53468.1|  hypothetical protein TRIUR3_21407                     63.2    6e-09   
ref|XP_009398855.1|  PREDICTED: protein GOS9-like                     63.2    6e-09   
ref|XP_008348483.1|  PREDICTED: agglutinin-like isoform X1            63.9    6e-09   
gb|EMS65594.1|  hypothetical protein TRIUR3_06346                     65.9    6e-09   
gb|KDP46660.1|  hypothetical protein JCGZ_10969                       66.6    6e-09   
sp|P82859.1|LECA_CASCR  RecName: Full=Agglutinin; AltName: Full=CCA   65.9    6e-09   
ref|XP_010932961.1|  PREDICTED: mannose/glucose-specific lectin-l...  65.5    6e-09   
ref|XP_006644795.1|  PREDICTED: mannose/glucose-specific lectin-like  66.6    6e-09   
ref|XP_009782510.1|  PREDICTED: jacalin-related lectin 19             64.3    7e-09   
ref|XP_011001803.1|  PREDICTED: mannose/glucose-specific lectin-like  66.2    7e-09   
ref|XP_002439535.1|  hypothetical protein SORBIDRAFT_09g010668        63.2    7e-09   
gb|KEH34301.1|  mannose-binding lectin superfamily protein            66.2    7e-09   
gb|AFK34206.1|  unknown                                               63.5    7e-09   
ref|XP_008782838.1|  PREDICTED: agglutinin alpha chain-like           63.9    7e-09   
ref|XP_011028924.1|  PREDICTED: uncharacterized protein LOC105128...  66.6    8e-09   
gb|KDP31690.1|  hypothetical protein JCGZ_15015                       66.2    8e-09   
ref|XP_008671662.1|  PREDICTED: horcolin-like                         63.5    9e-09   
gb|KDP38565.1|  hypothetical protein JCGZ_04490                       65.9    9e-09   
ref|XP_008804539.1|  PREDICTED: mannose/glucose-specific lectin-like  62.8    9e-09   
tpg|DAA39774.1|  TPA: hypothetical protein ZEAMMB73_034611            62.8    1e-08   
ref|XP_004500273.1|  PREDICTED: agglutinin-like                       65.9    1e-08   
ref|XP_006654618.1|  PREDICTED: myrosinase-binding protein-like A...  65.9    1e-08   
gb|EAY92859.1|  hypothetical protein OsI_14658                        63.9    1e-08   
ref|NP_001176790.1|  Os12g0144100                                     61.6    1e-08   
ref|XP_009110261.1|  PREDICTED: agglutinin-like                       65.9    1e-08   
gb|EAY98637.1|  hypothetical protein OsI_20561                        65.9    1e-08   
ref|XP_009149456.1|  PREDICTED: agglutinin                            65.9    1e-08   
emb|CDY39357.1|  BnaC05g15300D                                        65.9    1e-08   
ref|XP_010932856.1|  PREDICTED: mannose/glucose-specific lectin-l...  64.7    1e-08   
ref|NP_001055995.1|  Os05g0508400                                     65.9    1e-08   
ref|XP_010030903.1|  PREDICTED: agglutinin alpha chain-like           61.6    1e-08   
ref|XP_010231090.1|  PREDICTED: jacalin-related lectin 19-like is...  63.5    1e-08   
ref|XP_006662272.1|  PREDICTED: uncharacterized protein LOC102701759  64.7    1e-08   
ref|XP_011028923.1|  PREDICTED: jacalin-related lectin 3-like iso...  65.5    1e-08   
ref|XP_004961357.1|  PREDICTED: agglutinin-like                       63.2    1e-08   
ref|XP_003576339.1|  PREDICTED: jacalin-related lectin 3-like         64.7    1e-08   
gb|AFW81812.1|  putative protein kinase superfamily protein           65.5    1e-08   
ref|XP_010099935.1|  hypothetical protein L484_020123                 63.5    1e-08   
gb|EEE64302.1|  hypothetical protein OsJ_19139                        65.9    1e-08   
ref|XP_008656248.1|  PREDICTED: putative receptor-like protein ki...  65.1    1e-08   
gb|EMS51533.1|  hypothetical protein TRIUR3_05238                     64.7    1e-08   
emb|CDX96652.1|  BnaA08g21950D                                        65.5    1e-08   
gb|EMT29229.1|  B3 domain-containing protein                          65.5    2e-08   
emb|CDM86052.1|  unnamed protein product                              64.7    2e-08   
ref|XP_010320393.1|  PREDICTED: jacalin-related lectin 3-like         64.7    2e-08   
emb|CDY63700.1|  BnaC08g19180D                                        65.5    2e-08   
ref|XP_003597652.1|  Agglutinin alpha chain                           65.5    2e-08   
ref|XP_008648490.1|  PREDICTED: salt stress-induced protein-like      62.0    2e-08   
ref|XP_006597184.1|  PREDICTED: agglutinin-like isoform X4            62.8    2e-08   
gb|AFW74546.1|  hypothetical protein ZEAMMB73_667809                  62.0    2e-08   
ref|XP_009338132.1|  PREDICTED: uncharacterized protein LOC103930...  65.1    2e-08   
emb|CDM86063.1|  unnamed protein product                              65.1    2e-08   
ref|XP_010231089.1|  PREDICTED: jacalin-related lectin 19-like is...  63.2    2e-08   
ref|XP_007146775.1|  hypothetical protein PHAVU_006G068800g           65.1    2e-08   
emb|CDP07465.1|  unnamed protein product                              65.1    2e-08   
gb|AFW82809.1|  hypothetical protein ZEAMMB73_630227                  62.8    2e-08   
ref|XP_004974871.1|  PREDICTED: mannose/glucose-specific lectin-like  63.2    2e-08   
ref|NP_001044410.1|  Os01g0775500                                     64.3    2e-08   
gb|EMT04092.1|  hypothetical protein F775_28592                       64.3    2e-08   
gb|AAC49284.1|  unknown                                               64.3    2e-08   
gb|EMT33622.1|  Cysteine proteinase RD21a                             65.1    2e-08   
ref|XP_009336846.1|  PREDICTED: uncharacterized protein LOC103929382  64.7    2e-08   
gb|EEC71570.1|  hypothetical protein OsI_03937                        64.7    2e-08   
ref|XP_010231088.1|  PREDICTED: jacalin-related lectin 19-like is...  63.5    2e-08   
gb|AAB22274.1|  jacalin heavy chain, agglutinin heavy chain=Thoms...  61.2    3e-08   
ref|XP_003578760.1|  PREDICTED: mannose/glucose-specific lectin-like  63.9    3e-08   
dbj|BAJ85606.1|  predicted protein                                    64.7    3e-08   
dbj|BAJ88436.1|  predicted protein                                    64.7    3e-08   
ref|XP_008391447.1|  PREDICTED: uncharacterized protein LOC103453663  63.9    3e-08   
ref|XP_004164005.1|  PREDICTED: agglutinin-like                       61.6    3e-08   
ref|XP_010092351.1|  hypothetical protein L484_023729                 62.4    3e-08   
pdb|1TOQ|A  Chain A, Crystal Structure Of A Galactose Specific Le...  61.2    3e-08   
ref|XP_009384641.1|  PREDICTED: agglutinin alpha chain-like isofo...  62.0    3e-08   
ref|XP_009602425.1|  PREDICTED: mannose/glucose-specific lectin-like  60.8    3e-08   
ref|XP_003539332.1|  PREDICTED: agglutinin-like isoform X1            64.3    3e-08   
ref|XP_009608045.1|  PREDICTED: putative late blight resistance p...  64.7    3e-08   
ref|XP_009608041.1|  PREDICTED: putative late blight resistance p...  64.7    3e-08   
pdb|3P8S|A  Chain A, Crystal Structure Of Single Chain Recombinan...  61.2    3e-08   
gb|EEE55471.1|  hypothetical protein OsJ_03649                        64.3    3e-08   
gb|KHN30030.1|  Agglutinin alpha chain                                61.6    3e-08   
gb|KHN34265.1|  Agglutinin                                            64.3    4e-08   
ref|XP_009384722.1|  PREDICTED: agglutinin alpha chain-like isofo...  61.6    4e-08   
ref|XP_006595102.1|  PREDICTED: agglutinin                            61.6    4e-08   
ref|XP_006591219.1|  PREDICTED: agglutinin-like isoform X2            63.9    4e-08   
ref|XP_008466552.1|  PREDICTED: agglutinin-like                       61.2    4e-08   
gb|EYU34206.1|  hypothetical protein MIMGU_mgv1a025615mg              63.5    4e-08   
ref|XP_002440568.1|  hypothetical protein SORBIDRAFT_09g003330        60.5    4e-08   
ref|XP_003567168.1|  PREDICTED: jacalin-related lectin 3-like         63.5    5e-08   
gb|EEE68468.1|  hypothetical protein OsJ_26865                        63.5    5e-08   
ref|XP_006342218.1|  PREDICTED: agglutinin-like                       63.2    6e-08   
ref|XP_008782839.1|  PREDICTED: agglutinin alpha chain-like           61.2    6e-08   
emb|CDM83580.1|  unnamed protein product                              63.2    6e-08   
gb|AAQ07258.1|  jacalin-like lectin                                   60.5    6e-08   
emb|CDM86053.1|  unnamed protein product                              63.2    6e-08   
ref|XP_006597181.1|  PREDICTED: agglutinin-like isoform X1            63.5    7e-08   
gb|EYU45163.1|  hypothetical protein MIMGU_mgv1a020491mg              62.4    7e-08   
gb|EAY96520.1|  hypothetical protein OsI_18424                        60.5    7e-08   
gb|ABA96465.1|  Protein GOS9, putative                                60.1    7e-08   
gb|AAL09163.1|  galactose-binding lectin                              61.2    8e-08   
ref|XP_009614655.1|  PREDICTED: mannose/glucose-specific lectin-like  60.1    8e-08   
gb|EMS47225.1|  hypothetical protein TRIUR3_25909                     62.8    9e-08   
ref|NP_001054618.1|  Os05g0143600                                     60.1    9e-08   
ref|XP_004977415.1|  PREDICTED: uncharacterized protein LOC101784...  62.4    1e-07   
dbj|BAJ84796.1|  predicted protein                                    62.8    1e-07   
gb|EMT11162.1|  hypothetical protein F775_09344                       62.8    1e-07   
ref|XP_008783084.1|  PREDICTED: inactive protein RESTRICTED TEV M...  60.8    1e-07   
ref|XP_004147859.1|  PREDICTED: myrosinase-binding protein-like A...  62.8    1e-07   
dbj|BAJ93066.1|  predicted protein                                    62.8    1e-07   
gb|AAA32679.1|  jacalin                                               60.8    1e-07   
emb|CDP17400.1|  unnamed protein product                              62.0    1e-07   
sp|P18670.2|LECA_ARTIN  RecName: Full=Agglutinin alpha chain; Alt...  59.3    1e-07   
pdb|1UGW|A  Chain A, Crystal Structure Of Jacalin- Gal Complex        59.3    1e-07   
gb|ACN33395.1|  unknown                                               62.0    1e-07   
ref|XP_009391798.1|  PREDICTED: agglutinin-like                       60.1    1e-07   
gb|EMS65495.1|  hypothetical protein TRIUR3_18396                     62.4    1e-07   
ref|XP_010026053.1|  PREDICTED: jacalin-related lectin 3-like         60.8    1e-07   
ref|XP_010227994.1|  PREDICTED: jacalin-related lectin 3-like         61.6    2e-07   
pdb|4AKD|A  Chain A, High Resolution Structure Of Mannose Binding...  59.3    2e-07   
gb|AAA32678.1|  jacalin                                               60.5    2e-07   
gb|AAB23126.1|  jacalin minor alpha'-subunit=65 kda lectin minor ...  58.9    2e-07   
ref|XP_002281330.1|  PREDICTED: jacalin-related lectin 19-like        59.3    2e-07   
gb|EMS53304.1|  hypothetical protein TRIUR3_14429                     62.0    2e-07   
gb|EMT07446.1|  hypothetical protein F775_10439                       60.8    2e-07   
dbj|BAE95375.1|  lectin                                               61.2    2e-07   
pdb|1VBP|A  Chain A, Crystal Structure Of Artocarpin-Mannopentose...  58.9    2e-07   
pdb|1VBO|A  Chain A, Crystal Structure Of Artocarpin-Mannotriose ...  58.9    2e-07   
gb|AAA32680.1|  jacalin                                               60.1    2e-07   
pdb|1J4T|A  Chain A, Structure Of Artocarpin: A Lectin With Manno...  58.9    2e-07   
pdb|1J4S|A  Chain A, Structure Of Artocarpin: A Lectin With Manno...  58.9    2e-07   
emb|CBI35989.3|  unnamed protein product                              59.7    2e-07   
ref|XP_004961574.1|  PREDICTED: mannose/glucose-specific lectin-like  62.0    2e-07   
ref|XP_003561042.1|  PREDICTED: jacalin-related lectin 3-like         61.2    3e-07   
ref|XP_006383724.1|  hypothetical protein POPTR_0005s25390g           61.6    3e-07   
gb|EMS51477.1|  Mannose/glucose-specific lectin                       61.2    3e-07   
pdb|4AK4|A  Chain A, High Resolution Structure Of Galactose Bindi...  58.2    3e-07   
pdb|4AKB|A  Chain A, Structure Of Galactose Binding Lectin From C...  58.2    3e-07   
ref|XP_010928799.1|  PREDICTED: jacalin-related lectin 19-like        59.3    3e-07   
gb|EMT31922.1|  hypothetical protein F775_02779                       58.9    3e-07   
ref|XP_011048832.1|  PREDICTED: jacalin-related lectin 3-like iso...  61.6    3e-07   
ref|XP_011048833.1|  PREDICTED: jacalin-related lectin 3-like iso...  61.2    3e-07   
ref|XP_010109960.1|  hypothetical protein L484_009242                 59.3    3e-07   
ref|XP_010100192.1|  hypothetical protein L484_015337                 58.5    3e-07   
ref|XP_003575754.1|  PREDICTED: uncharacterized protein LOC100829827  60.5    4e-07   
ref|NP_001140746.1|  hypothetical protein                             61.2    4e-07   
gb|AAY35064.1|  lectin KM+                                            58.2    4e-07   
sp|P18674.2|LECA_MACPO  RecName: Full=Agglutinin alpha chain; Alt...  57.8    5e-07   
gb|AEE92792.1|  lectin                                                58.9    5e-07   
emb|CAB40792.1|  putative lectin                                      58.2    5e-07   
ref|XP_004970153.1|  PREDICTED: myrosinase-binding protein-like A...  60.8    5e-07   
gb|KDP26963.1|  hypothetical protein JCGZ_22259                       60.1    5e-07   
gb|AAA32677.1|  jacalin                                               58.9    6e-07   
gb|AAP87359.1|  high light protein                                    57.8    6e-07   
ref|XP_002461767.1|  hypothetical protein SORBIDRAFT_02g007750        60.1    6e-07   
gb|AAY35063.1|  lectin KM+                                            57.8    6e-07   
gb|ABI24164.1|  beta-glucosidase aggregating factor                   59.7    6e-07   
ref|XP_010099939.1|  hypothetical protein L484_020127                 58.5    6e-07   
ref|XP_004979687.1|  PREDICTED: myrosinase-binding protein-like A...  60.1    6e-07   
ref|XP_010029744.1|  PREDICTED: jacalin-related lectin 4-like         60.5    8e-07   
gb|EAY82243.1|  hypothetical protein OsI_37448                        59.7    8e-07   
ref|XP_002440040.1|  hypothetical protein SORBIDRAFT_09g024950        60.1    8e-07   
ref|XP_003578759.1|  PREDICTED: mannose/glucose-specific lectin-like  59.3    8e-07   
gb|EYU36743.1|  hypothetical protein MIMGU_mgv1a007927mg              59.7    9e-07   
ref|XP_010932116.1|  PREDICTED: jacalin-related lectin 3-like iso...  57.8    9e-07   
dbj|BAG24500.1|  jacalin-related lectin                               59.3    9e-07   
ref|XP_009413935.1|  PREDICTED: protein GOS9-like                     57.0    1e-06   
ref|XP_004980207.1|  PREDICTED: mannose/glucose-specific lectin-like  55.8    1e-06   
ref|NP_001056189.1|  Os05g0541800                                     56.6    1e-06   
gb|AFW74848.1|  hypothetical protein ZEAMMB73_609032                  56.6    1e-06   
ref|XP_003573652.1|  PREDICTED: horcolin-like                         56.2    1e-06   
gb|EMS47771.1|  hypothetical protein TRIUR3_34363                     56.2    1e-06   
ref|NP_001183767.1|  hypothetical protein                             57.0    1e-06   
emb|CDM80828.1|  unnamed protein product                              56.6    1e-06   
gb|ABA94727.1|  Jacalin-like lectin domain containing protein         56.6    2e-06   
ref|XP_004979688.1|  PREDICTED: mannose/glucose-specific lectin-like  58.5    2e-06   
gb|EMT07620.1|  hypothetical protein F775_29169                       58.5    2e-06   
ref|XP_008656997.1|  PREDICTED: cysteine-rich receptor-like prote...  58.9    2e-06   
ref|XP_004147879.1|  PREDICTED: uncharacterized protein LOC101206551  59.3    2e-06   
ref|XP_010099938.1|  hypothetical protein L484_020126                 57.4    2e-06   
gb|KDP22736.1|  hypothetical protein JCGZ_02528                       58.9    2e-06   
gb|AHZ86978.1|  extracellular jacalin-like lectin                     56.2    2e-06   
gb|KDP38344.1|  hypothetical protein JCGZ_04269                       58.9    2e-06   
gb|ACR38528.1|  unknown                                               57.0    2e-06   
ref|XP_010675832.1|  PREDICTED: mannose/glucose-specific lectin-like  56.2    2e-06   
gb|AFW84361.1|  putative protein kinase superfamily protein           58.5    2e-06   
gb|KCW56881.1|  hypothetical protein EUGRSUZ_I02547                   58.9    3e-06   
ref|XP_009413293.1|  PREDICTED: protein GOS9-like                     55.8    3e-06   
ref|XP_006473897.1|  PREDICTED: uncharacterized protein LOC102623328  58.5    3e-06   



>gb|AAG10403.1|AF233284_1 mannose-binding lectin [Convolvulus arvensis]
Length=152

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 117/155 (75%), Gaps = 6/155 (4%)
 Frame = -3

Query  693  MEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtl  514
            M +  D   GP G+NGG+FWSFRP+NKINQIVI       NNPI L FS+T   GSKDT+
Sbjct  1    MTVPIDTISGPWGNNGGNFWSFRPINKINQIVI--TYSAGNNPIALTFSATKADGSKDTI  58

Query  513  tiggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYG  334
            T+GG G D+ +  +DT++I GADEY+T ISGTFG ++D   NVLRS+KF TN++ +GPYG
Sbjct  59   TVGGAGPDS-ITGTDTVDI-GADEYVTGISGTFGIYLDN--NVLRSIKFITNLKAYGPYG  114

Query  333  PNVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTYN  229
            PNVGTPF+ +   G +IVGF GR+G+YVDAIGTYN
Sbjct  115  PNVGTPFSSENVVGNEIVGFLGRSGYYVDAIGTYN  149



>gb|AAC49564.1| lectin [Calystegia sepium]
Length=153

 Score =   139 bits (351),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 115/155 (74%), Gaps = 5/155 (3%)
 Frame = -3

Query  693  MEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtl  514
            M +  D   GP G+NGG+FWSFRP+NKINQIVI S G G NNPI L FSST   GSKDT+
Sbjct  1    MAVPMDTISGPWGNNGGNFWSFRPVNKINQIVI-SYGGGGNNPIALTFSSTKADGSKDTI  59

Query  513  tiggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYG  334
            T+GGGG D+ +  ++ +NI G DEYLT ISGTFG ++D   NVLRS+ FTTN++  GPYG
Sbjct  60   TVGGGGPDS-ITGTEMVNI-GTDEYLTGISGTFGIYLDN--NVLRSITFTTNLKAHGPYG  115

Query  333  PNVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTYN  229
              VGTPF+     G +IVGF GR+G+YVDAIGTYN
Sbjct  116  QKVGTPFSSANVVGNEIVGFLGRSGYYVDAIGTYN  150



>pdb|1OUW|A Chain A, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|B Chain B, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|C Chain C, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|D Chain D, Crystal Structure Of Calystegia Sepium Agglutinin
Length=152

 Score =   137 bits (344),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 114/153 (75%), Gaps = 5/153 (3%)
 Frame = -3

Query  687  ISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtlti  508
            +  D   GP G+NGG+FWSFRP+NKINQIVI S G G NNPI L FSST   GSKDT+T+
Sbjct  2    VPMDTISGPWGNNGGNFWSFRPVNKINQIVI-SYGGGGNNPIALTFSSTKADGSKDTITV  60

Query  507  ggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPN  328
            GGGG D+ +  ++ +NI G DEYLT ISGTFG ++D   NVLRS+ FTTN++  GPYG  
Sbjct  61   GGGGPDS-ITGTEMVNI-GTDEYLTGISGTFGIYLDN--NVLRSITFTTNLKAHGPYGQK  116

Query  327  VGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTYN  229
            VGTPF+     G +IVGF GR+G+YVDAIGTYN
Sbjct  117  VGTPFSSANVVGNEIVGFLGRSGYYVDAIGTYN  149



>dbj|BAA14024.1| ipomoelin [Ipomoea batatas]
Length=154

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 95/154 (62%), Gaps = 8/154 (5%)
 Frame = -3

Query  693  MEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtl  514
            +   +D   GP+G NGG FWSFRP+  +N+IV LS     +  + LI  S   + +   +
Sbjct  5    LAAHSDARSGPVGSNGGQFWSFRPVRPLNKIV-LSFSGSPDQTLNLI--SITFSSNPTDI  61

Query  513  tiggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYG  334
               GG     +  ++T+NIDG    + EISG    +  + YNV+RS+KFTTN +E+GPYG
Sbjct  62   ITVGGVGPEPLTYTETVNIDGD---IIEISGMIANY--KGYNVIRSIKFTTNKKEYGPYG  116

Query  333  PNVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
             N GTPFN +  +G KIVGFFG +G+YVDAIG Y
Sbjct  117  ANAGTPFNIKIPDGNKIVGFFGNSGWYVDAIGAY  150



>pdb|3R50|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|E Chain E, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R51|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R51|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
Length=160

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 95/154 (62%), Gaps = 8/154 (5%)
 Frame = -3

Query  693  MEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtl  514
            +   +D   GP+G NGG FWSFRP+  +N+IV LS     +  + LI  S   + +   +
Sbjct  11   LAAHSDARSGPVGSNGGQFWSFRPVRPLNKIV-LSFSGSPDQTLNLI--SITFSSNPTDI  67

Query  513  tiggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYG  334
               GG     +  ++T+NIDG    + EISG    +  + YNV+RS+KFTTN +E+GPYG
Sbjct  68   ITVGGVGPEPLTYTETVNIDGD---IIEISGMIANY--KGYNVIRSIKFTTNKKEYGPYG  122

Query  333  PNVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
             N GTPFN +  +G KIVGFFG +G+YVDAIG Y
Sbjct  123  ANAGTPFNIKIPDGNKIVGFFGNSGWYVDAIGAY  156



>gb|AAA87042.1| putative 32.7 kDa jasmonate-induced protein [Hordeum vulgare 
subsp. vulgare]
 gb|AAB72097.1| 32 kDa protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            GA E++ E+SGTFG +    +N++ S+KF TNV+ +GP+G   GTPF   AQ  + IVGF
Sbjct  227  GASEFMKEVSGTFGIYDKDRHNIITSLKFITNVKTYGPFGEAKGTPFTIPAQKNSSIVGF  286

Query  273  FGRAGFYVDAIGTY  232
            FGR+G Y+DA+G Y
Sbjct  287  FGRSGIYLDALGVY  300



>gb|EEC68267.1| hypothetical protein OsI_36302 [Oryza sativa Indica Group]
Length=1396

 Score = 88.2 bits (217),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 40/74 (54%), Positives = 51/74 (69%), Gaps = 1/74 (1%)
 Frame = -3

Query  453   GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
             G  E+L E+SGTFG F   + N++ S+ F TN + +GPYG   GTPF+   Q+   IVGF
Sbjct  1010  GPSEFLVEVSGTFGRFR-AALNIITSLTFVTNAQSYGPYGQREGTPFHIPVQSSGCIVGF  1068

Query  273   FGRAGFYVDAIGTY  232
             FGRAG+YVDAIG Y
Sbjct  1069  FGRAGWYVDAIGIY  1082


 Score = 78.2 bits (191),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = -3

Query  453   GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
             G  E LT +SGTFG + + SY+V+ S+   TN+  +GP+G   G  FNF  Q    IVGF
Sbjct  1165  GPSELLTTVSGTFGSY-NTSYDVITSITLVTNIGCYGPFGKEKGISFNFPIQGNGSIVGF  1223

Query  273   FGRAGFYVDAIGTY  232
             FG A  Y+DAIG Y
Sbjct  1224  FGHAELYIDAIGVY  1237


 Score = 60.5 bits (145),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 32/79 (41%), Positives = 47/79 (59%), Gaps = 3/79 (4%)
 Frame = -3

Query  465   INIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNV-REFGPYGPNVGTPFNFQAQNGA  289
             IN+ G  E++T++ GTFGP+ +    V+ S+ F  N   ++GP+G   GTPF+       
Sbjct  1316  INL-GPSEFITKVHGTFGPYGEFPI-VITSLTFINNAGHQYGPFGQGGGTPFHAPISGNG  1373

Query  288   KIVGFFGRAGFYVDAIGTY  232
              IVGFFG  G  ++AIG Y
Sbjct  1374  SIVGFFGHQGACLEAIGFY  1392



>ref|NP_001066367.1| Os12g0198700 [Oryza sativa Japonica Group]
 gb|ABA96667.1| jasmonate-induced protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29386.1| Os12g0198700 [Oryza sativa Japonica Group]
 gb|EAY82558.1| hypothetical protein OsI_37779 [Oryza sativa Indica Group]
 gb|EAZ19941.1| hypothetical protein OsJ_35533 [Oryza sativa Japonica Group]
Length=307

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 53/74 (72%), Gaps = 2/74 (3%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            G+ E+L E+SGTFGP+    + V+RS+KF TN + +GP+G   GTPF+   QN + IVGF
Sbjct  232  GSSEFLKEVSGTFGPY--EGWKVIRSIKFVTNKKTYGPFGRQEGTPFSVPVQNNSTIVGF  289

Query  273  FGRAGFYVDAIGTY  232
            FGR+G Y+D +G Y
Sbjct  290  FGRSGKYLDTVGIY  303



>gb|ABA93998.1| NB-ARC domain containing protein, expressed [Oryza sativa Japonica 
Group]
Length=1384

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 39/74 (53%), Positives = 51/74 (69%), Gaps = 1/74 (1%)
 Frame = -3

Query  453   GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
             G  E+L E+SGTFG F   + +++ S+ F TN + +GPYG   GTPF+   Q+   IVGF
Sbjct  1038  GPSEFLVEVSGTFGRFR-AALDIITSLTFVTNAQSYGPYGQREGTPFHISVQSRGCIVGF  1096

Query  273   FGRAGFYVDAIGTY  232
             FGRAG+YVDAIG Y
Sbjct  1097  FGRAGWYVDAIGIY  1110


 Score = 78.6 bits (192),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = -3

Query  453   GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
             G  E LT +SGTFG + + SY+V+ S+   TN+  +GP+G   G  FNF  Q    IVGF
Sbjct  1147  GPSELLTTVSGTFGSY-NTSYDVITSITLVTNIGCYGPFGKEKGISFNFPIQGNGSIVGF  1205

Query  273   FGRAGFYVDAIGTY  232
             FG A  Y+DAIG Y
Sbjct  1206  FGHAELYIDAIGVY  1219



>gb|AAA87041.1| putative 32.6 kDa jasmonate-induced protein [Hordeum vulgare 
subsp. vulgare]
 gb|AAB72096.1| 32 kDa protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            GA E++ E+SGTFG +    +N++ S+KF TNV+ +GP+G   GTPF    Q  + IVGF
Sbjct  227  GASEFVKEVSGTFGIYDKDRHNIITSLKFITNVKTYGPFGEAKGTPFTIAVQKNSSIVGF  286

Query  273  FGRAGFYVDAIGTY  232
            F R+G Y+DA+G Y
Sbjct  287  FARSGIYLDALGVY  300



>gb|EMS66150.1| hypothetical protein TRIUR3_12251 [Triticum urartu]
Length=307

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            GA E++ E+SGT+G +    +N++ S+KF TNV+ +GP+G   GTPF    +N + IVGF
Sbjct  230  GASEFVKEVSGTYGIYDADQHNIIMSLKFITNVKAYGPFGEANGTPFTIPVENNSSIVGF  289

Query  273  FGRAGFYVDAIGTY  232
            FGR+G Y+DA+G Y
Sbjct  290  FGRSGIYLDALGVY  303



>gb|EEE52195.1| hypothetical protein OsJ_34074 [Oryza sativa Japonica Group]
Length=1311

 Score = 85.5 bits (210),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 39/74 (53%), Positives = 51/74 (69%), Gaps = 1/74 (1%)
 Frame = -3

Query  453   GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
             G  E+L E+SGTFG F   + +++ S+ F TN + +GPYG   GTPF+   Q+   IVGF
Sbjct  970   GPSEFLVEVSGTFGRFR-AALDIITSLTFVTNAQSYGPYGQREGTPFHISVQSRGCIVGF  1028

Query  273   FGRAGFYVDAIGTY  232
             FGRAG+YVDAIG Y
Sbjct  1029  FGRAGWYVDAIGIY  1042


 Score = 77.8 bits (190),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = -3

Query  453   GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
             G  E LT +SGTFG + + SY+V+ S+   TN+  +GP+G   G  FNF  Q    IVGF
Sbjct  1079  GPSELLTTVSGTFGSY-NTSYDVITSITLVTNIGCYGPFGKEKGISFNFPIQGNGSIVGF  1137

Query  273   FGRAGFYVDAIGTY  232
             FG A  Y+DAIG Y
Sbjct  1138  FGHAELYIDAIGVY  1151


 Score = 61.6 bits (148),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 47/79 (59%), Gaps = 3/79 (4%)
 Frame = -3

Query  465   INIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNV-REFGPYGPNVGTPFNFQAQNGA  289
             IN+ G  E++T++ GTFGPF +    V+ S+ F  N   ++GP+G   GTPF+       
Sbjct  1231  INL-GPSEFITKVHGTFGPFGEFPI-VITSLTFINNAGHQYGPFGQGGGTPFHAPISGNG  1288

Query  288   KIVGFFGRAGFYVDAIGTY  232
              IVGFFG  G  ++AIG Y
Sbjct  1289  SIVGFFGHQGACLEAIGFY  1307



>ref|XP_009589464.1| PREDICTED: agglutinin-like, partial [Nicotiana tomentosiformis]
Length=363

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 82/158 (52%), Gaps = 11/158 (7%)
 Frame = -3

Query  702  QETMEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSK  523
            Q + + +  I   P G  GG  W ++  + I +I+I  G    +    ++F +  + G+ 
Sbjct  31   QVSYDQADSILVEPWGGTGGSEWYYKLKSPIKEILITHGDCIES----IMFRTVTEQGTT  86

Query  522  dtltiggggtdtTVIRSDTINIDGAD-EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREF  346
                  GG       R D + I+ A  EYLT I GTFG     SY V++S+ F TN R +
Sbjct  87   IDSPKFGGDGG----RRDKVVIEAASLEYLTGIKGTFGHC--GSYLVIKSLCFETNARNY  140

Query  345  GPYGPNVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            GP+G  +GTPF+   + G  IVGF GR G Y+DAIG Y
Sbjct  141  GPFGSEIGTPFSLVMKEGGAIVGFHGRCGAYLDAIGVY  178


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 71/140 (51%), Gaps = 10/140 (7%)
 Frame = -3

Query  657  GHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltiggggtdtTVI  478
            G+ GG  W+++  + I +I+I  G   ++    ++F +  + G+       GG       
Sbjct  233  GNTGGSEWNYKLKSHIKEILIAHGDVIDS----IMFRTITEQGTTIDSPKFGGNGGR---  285

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVG-TPFNFQA  301
            R   +  +   EYL  I GTF  +   S+ V+ S+ F TN + +GP+G   G TPF+F  
Sbjct  286  REKVVIKEPPLEYLIGIKGTFRRY--GSHFVINSLCFITNAKNYGPFGSEAGGTPFSFVM  343

Query  300  QNGAKIVGFFGRAGFYVDAI  241
            + G  I GF GR G Y+DAI
Sbjct  344  KEGGAIEGFHGRCGAYLDAI  363



>ref|XP_011030089.1| PREDICTED: jacalin-related lectin 19 [Populus euphratica]
 ref|XP_011030090.1| PREDICTED: jacalin-related lectin 19 [Populus euphratica]
Length=191

 Score = 80.5 bits (197),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 82/155 (53%), Gaps = 9/155 (6%)
 Frame = -3

Query  702  QETMEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSK  523
            Q T    + I  GP G NGG+ W     + + +I I+       + I +++    KT + 
Sbjct  7    QSTARKKSTILVGPWGGNGGNSWDDGIYHGVREITIV--YDQCIDSIQVVYDKNGKTITA  64

Query  522  dtltiggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFG  343
            +     GG       R+  I +   +EYLT +SG + P +     V+RS+ F++N R FG
Sbjct  65   ENHGGVGGS------RTAEIKLRYPEEYLTSVSGHYCPVVYGGSPVIRSLTFSSNKRTFG  118

Query  342  PYGPNVGTPFNFQAQNGAKIVGFFGRAGFYVDAIG  238
            P+G   GTPF   + +GA IVGF GR+G+Y+DAIG
Sbjct  119  PFGVEEGTPFTL-SMDGASIVGFKGRSGWYLDAIG  152



>ref|XP_009795366.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795367.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795368.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795369.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795370.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795371.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795372.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795373.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795374.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795375.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=1346

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 55/157 (35%), Positives = 84/157 (54%), Gaps = 12/157 (8%)
 Frame = -3

Query  663  PLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltiggggtdtT  484
            P G  GG  W++   + I +I+I  G   +     ++F +  + G+       GG     
Sbjct  36   PWGGTGGSEWNYMLKSPIKEILIAHGDVID----SIMFRTITEQGTTIDSPKFGGDGG--  89

Query  483  VIRSDTINIDGAD-EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYG-PNVGTPFN  310
              R D + I+    EYLT I GTFG F DRS  +++S+ F TN + +GP+G    GTPF+
Sbjct  90   --RRDKVVIEATPLEYLTGIKGTFGRFYDRS--IIKSLCFITNAKNYGPFGCEAAGTPFS  145

Query  309  FQAQNGAKIVGFFGRAGFYVDAIGTYNA*LYGYSAAQ  199
               + G  IVGF GR+G ++DAIG Y   L  +++A+
Sbjct  146  LVMEEGVAIVGFHGRSGLFLDAIGVYLQKLAPHTSAK  182



>ref|XP_009772163.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X3 [Nicotiana sylvestris]
 ref|XP_009772164.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X3 [Nicotiana sylvestris]
Length=1547

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 53/149 (36%), Positives = 76/149 (51%), Gaps = 10/149 (7%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I  GP G   G  W+++  + I +I+I  G   ++     I      T S+     GG  
Sbjct  171  ILVGPWGGTSGSEWNYKLKHPIKEILIAHGYFIDSIMFRTITEQGTTTDSQKFGGNGGRI  230

Query  495  tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVG-T  319
                +  + +       EYLT I GTFG + D  + V++S+ F TN   +GP+G N G T
Sbjct  231  NKVVIAATPS-------EYLTGIKGTFGCYYD--HCVIKSLCFITNANNYGPFGSNAGGT  281

Query  318  PFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            PF+   + G  IVGF GR+GFY+DAIG Y
Sbjct  282  PFSLVMKEGVAIVGFHGRSGFYLDAIGVY  310


 Score = 68.6 bits (166),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 38/83 (46%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVG-TPFNFQAQNGAKIVGFFG  268
            E LT I GT G F    + V++S+ FTTNV+ +GP+G   G TPF+   + G  I+GF G
Sbjct  35   ERLTGIKGTLGRF--NGHLVVKSLCFTTNVKNYGPFGSEGGGTPFSHVMKEGGAIMGFHG  92

Query  267  RAGFYVDAIGTYNA*LYGYSAAQ  199
            R G Y+DAIG Y   L   ++AQ
Sbjct  93   RCGEYLDAIGVYLQKLTPLASAQ  115



>ref|XP_009772162.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X2 [Nicotiana sylvestris]
Length=1598

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 53/149 (36%), Positives = 76/149 (51%), Gaps = 10/149 (7%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I  GP G   G  W+++  + I +I+I  G   ++     I      T S+     GG  
Sbjct  223  ILVGPWGGTSGSEWNYKLKHPIKEILIAHGYFIDSIMFRTITEQGTTTDSQKFGGNGGRI  282

Query  495  tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVG-T  319
                +  + +       EYLT I GTFG + D  + V++S+ F TN   +GP+G N G T
Sbjct  283  NKVVIAATPS-------EYLTGIKGTFGCYYD--HCVIKSLCFITNANNYGPFGSNAGGT  333

Query  318  PFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            PF+   + G  IVGF GR+GFY+DAIG Y
Sbjct  334  PFSLVMKEGVAIVGFHGRSGFYLDAIGVY  362


 Score = 72.4 bits (176),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 58/170 (34%), Positives = 88/170 (52%), Gaps = 15/170 (9%)
 Frame = -3

Query  696  TMEISTDITYGPLGH-NGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGS--  526
            + +++  I  GP G  +GG  W+++  N I +I+I  G   N     ++F +  + G+  
Sbjct  9    SYDLADSILVGPWGDTSGGSEWNYKLKNPIKEILIAHGDAIN----SIMFRTITEQGTTI  64

Query  525  KdtltiggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREF  346
                  G GG    V+  +T       E LT I GT G F    + V++S+ FTTNV+ +
Sbjct  65   NSQKFGGNGGQINKVVFEET-----PLERLTGIKGTLGRF--NGHLVVKSLCFTTNVKNY  117

Query  345  GPYGPNVG-TPFNFQAQNGAKIVGFFGRAGFYVDAIGTYNA*LYGYSAAQ  199
            GP+G   G TPF+   + G  I+GF GR G Y+DAIG Y   L   ++AQ
Sbjct  118  GPFGSEGGGTPFSHVMKEGGAIMGFHGRCGEYLDAIGVYLQKLTPLASAQ  167



>ref|XP_009772161.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X1 [Nicotiana sylvestris]
Length=1599

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 53/149 (36%), Positives = 76/149 (51%), Gaps = 10/149 (7%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I  GP G   G  W+++  + I +I+I  G   ++     I      T S+     GG  
Sbjct  223  ILVGPWGGTSGSEWNYKLKHPIKEILIAHGYFIDSIMFRTITEQGTTTDSQKFGGNGGRI  282

Query  495  tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVG-T  319
                +  + +       EYLT I GTFG + D  + V++S+ F TN   +GP+G N G T
Sbjct  283  NKVVIAATPS-------EYLTGIKGTFGCYYD--HCVIKSLCFITNANNYGPFGSNAGGT  333

Query  318  PFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            PF+   + G  IVGF GR+GFY+DAIG Y
Sbjct  334  PFSLVMKEGVAIVGFHGRSGFYLDAIGVY  362


 Score = 72.4 bits (176),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 58/170 (34%), Positives = 88/170 (52%), Gaps = 15/170 (9%)
 Frame = -3

Query  696  TMEISTDITYGPLGH-NGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGS--  526
            + +++  I  GP G  +GG  W+++  N I +I+I  G   N     ++F +  + G+  
Sbjct  9    SYDLADSILVGPWGDTSGGSEWNYKLKNPIKEILIAHGDAIN----SIMFRTITEQGTTI  64

Query  525  KdtltiggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREF  346
                  G GG    V+  +T       E LT I GT G F    + V++S+ FTTNV+ +
Sbjct  65   NSQKFGGNGGQINKVVFEET-----PLERLTGIKGTLGRF--NGHLVVKSLCFTTNVKNY  117

Query  345  GPYGPNVG-TPFNFQAQNGAKIVGFFGRAGFYVDAIGTYNA*LYGYSAAQ  199
            GP+G   G TPF+   + G  I+GF GR G Y+DAIG Y   L   ++AQ
Sbjct  118  GPFGSEGGGTPFSHVMKEGGAIMGFHGRCGEYLDAIGVYLQKLTPLASAQ  167



>ref|XP_004168675.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like, 
partial [Cucumis sativus]
Length=1090

 Score = 82.8 bits (203),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 39/82 (48%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++DT+ +D  DEYLT I G +G F+      +RS+ F +N +++GPYG   GT F+F   
Sbjct  912  KTDTVKLDFPDEYLTMIRGHYGSFVSFDKVFVRSLTFMSNKKKYGPYGVEQGTIFSFPTT  971

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G KIVGF GR+G Y+DAIG Y
Sbjct  972  EG-KIVGFHGRSGLYLDAIGVY  992



>gb|EAY82651.1| hypothetical protein OsI_37872 [Oryza sativa Indica Group]
Length=304

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = -3

Query  471  DTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNG  292
            +TI +  + E+L E+SGTFG +     NV+ S+KF TNV+ +GP+G   GTPF+   QN 
Sbjct  224  NTIELS-SSEFLKEVSGTFGTYYGS--NVITSIKFVTNVKTYGPFGKQNGTPFSIPVQNN  280

Query  291  AKIVGFFGRAGFYVDAIGTY  232
            + +VGFFGR G Y+DA+G Y
Sbjct  281  SSVVGFFGRGGKYLDAVGVY  300



>ref|XP_008677986.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
 ref|XP_008677987.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
 ref|XP_008677988.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
 ref|XP_008677989.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
Length=783

 Score = 82.4 bits (202),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 63/102 (62%), Gaps = 6/102 (6%)
 Frame = -3

Query  480  IRSDTINID-GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQ  304
            IR  ++ I+ G  E+LT +SGT GPF + + NV+ S+ F TN R +GP+G   GTPF+ Q
Sbjct  335  IRVASMMIELGPSEFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQ  393

Query  303  AQNGAKIVGFFGRAGFYVDAIGTYNA*LYGYSAAQCSLGTPL  178
             QN  +IVGFFGR+G Y+ AIG Y        A    +G PL
Sbjct  394  TQNNGRIVGFFGRSGQYLYAIGVYT----NQDARVARIGRPL  431


 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFGR  265
            E+LT +SG+ G F   + NV+ S+ F TN R +GP+G   GT F+   Q    IVGFFGR
Sbjct  540  EFLTGVSGSIGTFNGHA-NVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGR  598

Query  264  AGFYVDAIGTYNA  226
            +G Y++AIG Y A
Sbjct  599  SGRYLNAIGVYTA  611


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 3/75 (4%)
 Frame = -3

Query  447  DEYLTEISGTFGPFM-DRSY-NVLRSVKFTTNV-REFGPYGPNVGTPFNFQAQNGAKIVG  277
            +E++ E++GTF P   DR+  +V+ S+   T+  +  GP+G  +G  F    Q+ ++IVG
Sbjct  699  EEFIVEVTGTFHPCAWDRTIPSVVSSLTLVTSTGKTHGPFGTQLGAAFQVPVQSDSRIVG  758

Query  276  FFGRAGFYVDAIGTY  232
            FF     Y++AIG Y
Sbjct  759  FFAHGDNYIEAIGAY  773



>ref|XP_008677991.1| PREDICTED: mannose/glucose-specific lectin-like isoform X3 [Zea 
mays]
Length=778

 Score = 82.4 bits (202),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 63/102 (62%), Gaps = 6/102 (6%)
 Frame = -3

Query  480  IRSDTINID-GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQ  304
            IR  ++ I+ G  E+LT +SGT GPF + + NV+ S+ F TN R +GP+G   GTPF+ Q
Sbjct  335  IRVASMMIELGPSEFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQ  393

Query  303  AQNGAKIVGFFGRAGFYVDAIGTYNA*LYGYSAAQCSLGTPL  178
             QN  +IVGFFGR+G Y+ AIG Y        A    +G PL
Sbjct  394  TQNNGRIVGFFGRSGQYLYAIGVYT----NQDARVARIGRPL  431


 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFGR  265
            E+LT +SG+ G F   + NV+ S+ F TN R +GP+G   GT F+   Q    IVGFFGR
Sbjct  540  EFLTGVSGSIGTFNGHA-NVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGR  598

Query  264  AGFYVDAIGTYNA  226
            +G Y++AIG Y A
Sbjct  599  SGRYLNAIGVYTA  611


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 3/75 (4%)
 Frame = -3

Query  447  DEYLTEISGTFGPFM-DRSY-NVLRSVKFTTNV-REFGPYGPNVGTPFNFQAQNGAKIVG  277
            +E++ E++GTF P   DR+  +V+ S+   T+  +  GP+G  +G  F    Q+ ++IVG
Sbjct  694  EEFIVEVTGTFHPCAWDRTIPSVVSSLTLVTSTGKTHGPFGTQLGAAFQVPVQSDSRIVG  753

Query  276  FFGRAGFYVDAIGTY  232
            FF     Y++AIG Y
Sbjct  754  FFAHGDNYIEAIGAY  768



>ref|XP_008677990.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Zea 
mays]
Length=781

 Score = 82.4 bits (202),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 63/102 (62%), Gaps = 6/102 (6%)
 Frame = -3

Query  480  IRSDTINID-GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQ  304
            IR  ++ I+ G  E+LT +SGT GPF + + NV+ S+ F TN R +GP+G   GTPF+ Q
Sbjct  333  IRVASMMIELGPSEFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQ  391

Query  303  AQNGAKIVGFFGRAGFYVDAIGTYNA*LYGYSAAQCSLGTPL  178
             QN  +IVGFFGR+G Y+ AIG Y        A    +G PL
Sbjct  392  TQNNGRIVGFFGRSGQYLYAIGVYT----NQDARVARIGRPL  429


 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFGR  265
            E+LT +SG+ G F   + NV+ S+ F TN R +GP+G   GT F+   Q    IVGFFGR
Sbjct  538  EFLTGVSGSIGTFNGHA-NVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGR  596

Query  264  AGFYVDAIGTYNA  226
            +G Y++AIG Y A
Sbjct  597  SGRYLNAIGVYTA  609


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 3/75 (4%)
 Frame = -3

Query  447  DEYLTEISGTFGPFM-DRSY-NVLRSVKFTTNV-REFGPYGPNVGTPFNFQAQNGAKIVG  277
            +E++ E++GTF P   DR+  +V+ S+   T+  +  GP+G  +G  F    Q+ ++IVG
Sbjct  697  EEFIVEVTGTFHPCAWDRTIPSVVSSLTLVTSTGKTHGPFGTQLGAAFQVPVQSDSRIVG  756

Query  276  FFGRAGFYVDAIGTY  232
            FF     Y++AIG Y
Sbjct  757  FFAHGDNYIEAIGAY  771



>ref|NP_001066495.1| Os12g0247700 [Oryza sativa Japonica Group]
 gb|ABA97248.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABB51090.1| mannose-specific jacalin-related lectin [Oryza sativa Japonica 
Group]
 dbj|BAF29514.1| Os12g0247700 [Oryza sativa Japonica Group]
 gb|EAZ20117.1| hypothetical protein OsJ_35712 [Oryza sativa Japonica Group]
Length=306

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 52/74 (70%), Gaps = 2/74 (3%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            G+ E+L E+SGTFGP+      V+ S+ F TN + +GP+G   GTPF+  AQN + IVGF
Sbjct  231  GSSEFLKEVSGTFGPY--EGSTVITSINFITNKQTYGPFGRQEGTPFSVPAQNNSSIVGF  288

Query  273  FGRAGFYVDAIGTY  232
            FGR+G Y++A+G Y
Sbjct  289  FGRSGKYINAVGVY  302



>ref|XP_008677994.1| PREDICTED: mannose/glucose-specific lectin-like isoform X6 [Zea 
mays]
Length=684

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 63/102 (62%), Gaps = 6/102 (6%)
 Frame = -3

Query  480  IRSDTINID-GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQ  304
            IR  ++ I+ G  E+LT +SGT GPF + + NV+ S+ F TN R +GP+G   GTPF+ Q
Sbjct  236  IRVASMMIELGPSEFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQ  294

Query  303  AQNGAKIVGFFGRAGFYVDAIGTYNA*LYGYSAAQCSLGTPL  178
             QN  +IVGFFGR+G Y+ AIG Y        A    +G PL
Sbjct  295  TQNNGRIVGFFGRSGQYLYAIGVYT----NQDARVARIGRPL  332


 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFGR  265
            E+LT +SG+ G F   + NV+ S+ F TN R +GP+G   GT F+   Q    IVGFFGR
Sbjct  441  EFLTGVSGSIGTFNGHA-NVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGR  499

Query  264  AGFYVDAIGTYNA  226
            +G Y++AIG Y A
Sbjct  500  SGRYLNAIGVYTA  512


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 3/75 (4%)
 Frame = -3

Query  447  DEYLTEISGTFGPFM-DRSY-NVLRSVKFTTNV-REFGPYGPNVGTPFNFQAQNGAKIVG  277
            +E++ E++GTF P   DR+  +V+ S+   T+  +  GP+G  +G  F    Q+ ++IVG
Sbjct  600  EEFIVEVTGTFHPCAWDRTIPSVVSSLTLVTSTGKTHGPFGTQLGAAFQVPVQSDSRIVG  659

Query  276  FFGRAGFYVDAIGTY  232
            FF     Y++AIG Y
Sbjct  660  FFAHGDNYIEAIGAY  674



>ref|XP_008677998.1| PREDICTED: mannose/glucose-specific lectin-like isoform X9 [Zea 
mays]
Length=616

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 63/102 (62%), Gaps = 6/102 (6%)
 Frame = -3

Query  480  IRSDTINID-GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQ  304
            IR  ++ I+ G  E+LT +SGT GPF + + NV+ S+ F TN R +GP+G   GTPF+ Q
Sbjct  168  IRVASMMIELGPSEFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQ  226

Query  303  AQNGAKIVGFFGRAGFYVDAIGTYNA*LYGYSAAQCSLGTPL  178
             QN  +IVGFFGR+G Y+ AIG Y        A    +G PL
Sbjct  227  TQNNGRIVGFFGRSGQYLYAIGVYT----NQDARVARIGRPL  264


 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFGR  265
            E+LT +SG+ G F   + NV+ S+ F TN R +GP+G   GT F+   Q    IVGFFGR
Sbjct  373  EFLTGVSGSIGTFNGHA-NVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGR  431

Query  264  AGFYVDAIGTYNA  226
            +G Y++AIG Y A
Sbjct  432  SGRYLNAIGVYTA  444


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 3/75 (4%)
 Frame = -3

Query  447  DEYLTEISGTFGPFM-DRSY-NVLRSVKFTTNV-REFGPYGPNVGTPFNFQAQNGAKIVG  277
            +E++ E++GTF P   DR+  +V+ S+   T+  +  GP+G  +G  F    Q+ ++IVG
Sbjct  532  EEFIVEVTGTFHPCAWDRTIPSVVSSLTLVTSTGKTHGPFGTQLGAAFQVPVQSDSRIVG  591

Query  276  FFGRAGFYVDAIGTY  232
            FF     Y++AIG Y
Sbjct  592  FFAHGDNYIEAIGAY  606



>ref|XP_008677996.1| PREDICTED: mannose/glucose-specific lectin-like isoform X8 [Zea 
mays]
 ref|XP_008677997.1| PREDICTED: mannose/glucose-specific lectin-like isoform X8 [Zea 
mays]
Length=652

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 63/102 (62%), Gaps = 6/102 (6%)
 Frame = -3

Query  480  IRSDTINID-GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQ  304
            IR  ++ I+ G  E+LT +SGT GPF + + NV+ S+ F TN R +GP+G   GTPF+ Q
Sbjct  204  IRVASMMIELGPSEFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQ  262

Query  303  AQNGAKIVGFFGRAGFYVDAIGTYNA*LYGYSAAQCSLGTPL  178
             QN  +IVGFFGR+G Y+ AIG Y        A    +G PL
Sbjct  263  TQNNGRIVGFFGRSGQYLYAIGVYT----NQDARVARIGRPL  300


 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFGR  265
            E+LT +SG+ G F   + NV+ S+ F TN R +GP+G   GT F+   Q    IVGFFGR
Sbjct  409  EFLTGVSGSIGTFNGHA-NVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGR  467

Query  264  AGFYVDAIGTYNA  226
            +G Y++AIG Y A
Sbjct  468  SGRYLNAIGVYTA  480


 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 3/75 (4%)
 Frame = -3

Query  447  DEYLTEISGTFGPFM-DRSY-NVLRSVKFTTNV-REFGPYGPNVGTPFNFQAQNGAKIVG  277
            +E++ E++GTF P   DR+  +V+ S+   T+  +  GP+G  +G  F    Q+ ++IVG
Sbjct  568  EEFIVEVTGTFHPCAWDRTIPSVVSSLTLVTSTGKTHGPFGTQLGAAFQVPVQSDSRIVG  627

Query  276  FFGRAGFYVDAIGTY  232
            FF     Y++AIG Y
Sbjct  628  FFAHGDNYIEAIGAY  642



>gb|EEC69076.1| hypothetical protein OsI_37951 [Oryza sativa Indica Group]
Length=250

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 53/74 (72%), Gaps = 2/74 (3%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            G+ E+L E+S TFGP+   +  V+RS+ F TN + +GP+G   GTPF+  AQN + +VGF
Sbjct  175  GSSEFLKEVSRTFGPYEGST--VIRSINFITNKQTYGPFGRQEGTPFSVPAQNNSSVVGF  232

Query  273  FGRAGFYVDAIGTY  232
            FGR+G Y++A+G Y
Sbjct  233  FGRSGKYINAVGVY  246



>ref|XP_004298564.1| PREDICTED: uncharacterized protein LOC101299670 [Fragaria vesca 
subsp. vesca]
Length=890

 Score = 82.0 bits (201),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 51/146 (35%), Positives = 75/146 (51%), Gaps = 9/146 (6%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I  GP G NGG+ W     N + +I ++       + I +++    K  + +     GG 
Sbjct  713  IILGPWGGNGGNDWDDGLYNGVREITLV--YGHCIDSIVVVYDKNGKPATSEKHGGLGGN  770

Query  495  tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTP  316
                  R+  I +   DE+L  +SG + P +     V+RS+KF +N R FGP+G   GTP
Sbjct  771  ------RTAEIKLQYPDEFLVSVSGHYCPVVYGGSPVIRSLKFESNRRTFGPFGVEEGTP  824

Query  315  FNFQAQNGAKIVGFFGRAGFYVDAIG  238
            F F   +G KIVG  GR G+Y+DAIG
Sbjct  825  FTFTV-DGGKIVGLKGRGGWYLDAIG  849



>ref|XP_002318228.2| hypothetical protein POPTR_0012s13320g [Populus trichocarpa]
 gb|EEE96448.2| hypothetical protein POPTR_0012s13320g [Populus trichocarpa]
Length=237

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 79/155 (51%), Gaps = 9/155 (6%)
 Frame = -3

Query  702  QETMEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSK  523
            Q      + I  GP G NGGD W     + + +I I+       + I +++    K  + 
Sbjct  53   QSAARKKSTILVGPWGGNGGDSWDDGIYHGVREITIV--YDQCIDSIQVVYDKNGKPITA  110

Query  522  dtltiggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFG  343
            +     GG       R+  I +   +EYLT +SG + P +     V+RS+ F++N R FG
Sbjct  111  ENHGGVGGS------RTAEIKLQYPEEYLTSVSGHYCPVVYGGSPVIRSLAFSSNKRTFG  164

Query  342  PYGPNVGTPFNFQAQNGAKIVGFFGRAGFYVDAIG  238
            P+G   GTPF   + +GA IVGF GR G+Y+DAIG
Sbjct  165  PFGVEEGTPFTL-SMDGASIVGFKGRGGWYLDAIG  198



>ref|XP_008677992.1| PREDICTED: mannose/glucose-specific lectin-like isoform X4 [Zea 
mays]
Length=760

 Score = 81.3 bits (199),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 57/92 (62%), Gaps = 5/92 (5%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            G  E+LT +SGT GPF + + NV+ S+ F TN R +GP+G   GTPF+ Q QN  +IVGF
Sbjct  322  GPSEFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGF  380

Query  273  FGRAGFYVDAIGTYNA*LYGYSAAQCSLGTPL  178
            FGR+G Y+ AIG Y        A    +G PL
Sbjct  381  FGRSGQYLYAIGVYT----NQDARVARIGRPL  408


 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFGR  265
            E+LT +SG+ G F   + NV+ S+ F TN R +GP+G   GT F+   Q    IVGFFGR
Sbjct  517  EFLTGVSGSIGTFNGHA-NVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGR  575

Query  264  AGFYVDAIGTYNA  226
            +G Y++AIG Y A
Sbjct  576  SGRYLNAIGVYTA  588


 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 3/75 (4%)
 Frame = -3

Query  447  DEYLTEISGTFGPFM-DRSY-NVLRSVKFTTNV-REFGPYGPNVGTPFNFQAQNGAKIVG  277
            +E++ E++GTF P   DR+  +V+ S+   T+  +  GP+G  +G  F    Q+ ++IVG
Sbjct  676  EEFIVEVTGTFHPCAWDRTIPSVVSSLTLVTSTGKTHGPFGTQLGAAFQVPVQSDSRIVG  735

Query  276  FFGRAGFYVDAIGTY  232
            FF     Y++AIG Y
Sbjct  736  FFAHGDNYIEAIGAY  750



>ref|XP_006663483.1| PREDICTED: probable disease resistance RPP8-like protein 4-like 
[Oryza brachyantha]
Length=1368

 Score = 81.6 bits (200),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = -3

Query  444   EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFGR  265
             E+L E+SGTFG F   + NV+ S+ F TN   +GPYG   GTPF+   Q+   IVGFFGR
Sbjct  984   EFLLEVSGTFGRFRT-ALNVMTSLTFVTNAHSYGPYGKIEGTPFHMPVQSNGCIVGFFGR  1042

Query  264   AGFYVDAIGTY  232
             AG+YVDAIG Y
Sbjct  1043  AGWYVDAIGIY  1053


 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = -3

Query  447   DEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFG  268
             +E++T + GT G + + S++V+ S+   TN+  +GP+G   G PF+F  Q    IVGFFG
Sbjct  1138  EEFITSVCGTIGSY-NTSFDVITSITLVTNIDCYGPFGQENGIPFHFPIQGNGSIVGFFG  1196

Query  267   RAGFYVDAIGTY  232
              A  YVDAIG Y
Sbjct  1197  HADIYVDAIGVY  1208


 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = -3

Query  468   TINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNV-REFGPYGPNVGTPFNFQAQNG  292
             TIN+ G  E+LT++ GTFG F D    V+ S+ F +N   ++GP+G   GTPF+      
Sbjct  1287  TINL-GPSEFLTKVLGTFGQF-DEFPIVITSLTFFSNTGHQYGPFGQGGGTPFHAPISGN  1344

Query  291   AKIVGFFGRAGFYVDAIGTY  232
               IVGFFG  G  V+AIG Y
Sbjct  1345  GSIVGFFGYQGDCVEAIGFY  1364



>gb|EMT24046.1| hypothetical protein F775_25349 [Aegilops tauschii]
Length=304

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -3

Query  459  IDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIV  280
            + G  E++ E+SGTFG +   ++N++ S+KF TNV+ +GP+G   GT F    Q  + IV
Sbjct  225  VLGTSEFVKEVSGTFGLYGRDNHNIITSLKFVTNVKTYGPFGQAKGTTFTIPVQKNSSIV  284

Query  279  GFFGRAGFYVDAIGTY  232
            GFFGR+G Y+DA+G Y
Sbjct  285  GFFGRSGIYLDALGVY  300



>gb|AAR20919.1| jasmonate-induced protein [Triticum aestivum]
Length=304

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            G  E++ E+SGTFG +   ++N++ S+KF TNV+ +GP+G   GT F    Q  + IVGF
Sbjct  227  GTSEFVKEVSGTFGLYGRDNHNIITSLKFVTNVKTYGPFGQAKGTTFTIPVQKNSSIVGF  286

Query  273  FGRAGFYVDAIGTY  232
            FGR+G Y+DA+G Y
Sbjct  287  FGRSGIYLDALGVY  300



>ref|XP_004982894.1| PREDICTED: salt stress-induced protein-like [Setaria italica]
Length=151

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 52/74 (70%), Gaps = 2/74 (3%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            GA E++ EISGT+GPF    + V+RS+ F TN+ + GP+G    TPF+   Q+GA +VGF
Sbjct  77   GAGEFVKEISGTYGPF--GGHTVVRSLTFVTNIGKHGPFGTPWQTPFSVPVQDGAHVVGF  134

Query  273  FGRAGFYVDAIGTY  232
            FGR+G  +DA+G Y
Sbjct  135  FGRSGSLLDAVGVY  148



>ref|XP_009614994.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana tomentosiformis]
Length=1334

 Score = 81.3 bits (199),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 56/159 (35%), Positives = 80/159 (50%), Gaps = 12/159 (8%)
 Frame = -3

Query  702  QETMEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSK  523
            Q + + +  I   P G  GG  W++   + I  I+I  G   +     ++F S  + G+ 
Sbjct  23   QVSYDQADSILLAPWGGTGGSEWNYMLKSPIKDILIAHGDVID----SIMFKSITEQGTT  78

Query  522  dtltiggggtdtTVIRSDTINIDGAD-EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREF  346
                  GG       R D + I+    EYLT I GTFG F   S  V++S+ F TN + +
Sbjct  79   IDSPKFGGDGG----RRDKVVIEATPLEYLTGIKGTFGCFYGHS--VIKSLCFITNAKNY  132

Query  345  GPYGPNVG-TPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            GP+G   G TPF+   + G  IVGF GR+G Y+DAIG Y
Sbjct  133  GPFGCEAGGTPFSLVMKEGVAIVGFHGRSGLYLDAIGVY  171



>ref|XP_009614993.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=1351

 Score = 81.3 bits (199),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 56/159 (35%), Positives = 80/159 (50%), Gaps = 12/159 (8%)
 Frame = -3

Query  702  QETMEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSK  523
            Q + + +  I   P G  GG  W++   + I  I+I  G   +     ++F S  + G+ 
Sbjct  23   QVSYDQADSILLAPWGGTGGSEWNYMLKSPIKDILIAHGDVID----SIMFKSITEQGTT  78

Query  522  dtltiggggtdtTVIRSDTINIDGAD-EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREF  346
                  GG       R D + I+    EYLT I GTFG F   S  V++S+ F TN + +
Sbjct  79   IDSPKFGGDGG----RRDKVVIEATPLEYLTGIKGTFGCFYGHS--VIKSLCFITNAKNY  132

Query  345  GPYGPNVG-TPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            GP+G   G TPF+   + G  IVGF GR+G Y+DAIG Y
Sbjct  133  GPFGCEAGGTPFSLVMKEGVAIVGFHGRSGLYLDAIGVY  171



>ref|XP_009614991.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009614992.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=1360

 Score = 81.3 bits (199),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 56/159 (35%), Positives = 80/159 (50%), Gaps = 12/159 (8%)
 Frame = -3

Query  702  QETMEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSK  523
            Q + + +  I   P G  GG  W++   + I  I+I  G   +     ++F S  + G+ 
Sbjct  23   QVSYDQADSILLAPWGGTGGSEWNYMLKSPIKDILIAHGDVID----SIMFKSITEQGTT  78

Query  522  dtltiggggtdtTVIRSDTINIDGAD-EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREF  346
                  GG       R D + I+    EYLT I GTFG F   S  V++S+ F TN + +
Sbjct  79   IDSPKFGGDGG----RRDKVVIEATPLEYLTGIKGTFGCFYGHS--VIKSLCFITNAKNY  132

Query  345  GPYGPNVG-TPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            GP+G   G TPF+   + G  IVGF GR+G Y+DAIG Y
Sbjct  133  GPFGCEAGGTPFSLVMKEGVAIVGFHGRSGLYLDAIGVY  171



>ref|XP_002440163.1| hypothetical protein SORBIDRAFT_09g027055 [Sorghum bicolor]
 gb|EES18593.1| hypothetical protein SORBIDRAFT_09g027055 [Sorghum bicolor]
Length=206

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAK  286
            I +   DEYLT +SG + P       V+RS+ F TN+R +GP+G   GTPF+F    G  
Sbjct  77   IKLSCPDEYLTTVSGHYAPIAHGGSPVIRSLAFRTNLRAYGPFGAAEGTPFSFPVVGGV-  135

Query  285  IVGFFGRAGFYVDAIGTYNA*L  220
            IVGF+GR+G+ +DA+G Y A L
Sbjct  136  IVGFYGRSGWQLDAVGLYVAPL  157



>gb|ACF87628.1| unknown [Zea mays]
Length=122

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 52/78 (67%), Gaps = 1/78 (1%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAK  286
            I++   DE LTEISGT GP  +   N+++S+KF TN R +GPYG + GTPF  +  N   
Sbjct  42   IDLCRFDESLTEISGTTGPAYNID-NLVKSLKFVTNKRAYGPYGRDEGTPFRVKVMNNGH  100

Query  285  IVGFFGRAGFYVDAIGTY  232
            + GFFGR+G  +DAIG Y
Sbjct  101  VAGFFGRSGDCLDAIGLY  118



>gb|ABS82785.1| jasmonate-induced protein [Triticum aestivum]
Length=304

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            G  E++ E+SGTFG +   ++N++ S+KF TNV+ +GP+G   GT F    Q  + IVGF
Sbjct  227  GTSEFVREVSGTFGLYGRDNHNIITSLKFVTNVKTYGPFGQAKGTTFTIPVQKNSSIVGF  286

Query  273  FGRAGFYVDAIGTY  232
            FGR+G Y+DA+G Y
Sbjct  287  FGRSGIYLDALGVY  300



>gb|KHN46147.1| Agglutinin [Glycine soja]
Length=597

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 78/145 (54%), Gaps = 9/145 (6%)
 Frame = -3

Query  666  GPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltiggggtdt  487
            GP G NGG  W     + + Q+VI+ G   ++  I       +K GS       GG    
Sbjct  14   GPWGGNGGSRWDDGIYSGVRQLVIVHGTGIDSIQI-----EYDKKGSSIWSEKHGGSGGR  68

Query  486  TVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNF  307
               ++D + +D  +E+LT+I G +G    R  N +RS+ F +N + +GP+G  +GT F+ 
Sbjct  69   ---KTDKVKLDCPNEFLTKIHGYYGSSNQRGPNFVRSLSFESNKKTYGPFGVELGTYFSV  125

Query  306  QAQNGAKIVGFFGRAGFYVDAIGTY  232
                GAKIVGF GR G+YVDAIG Y
Sbjct  126  PL-TGAKIVGFHGRCGWYVDAIGVY  149


 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++D I  D   E LT ISG +GP M    +V+RS+ F T  R++GPYG   GT F  + +
Sbjct  300  KNDKIVFDFPYEALTHISGYYGPLMYMGPSVIRSLTFHTTKRKYGPYGEEQGTYFTTKVK  359

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G KIVG  GR G ++DA G +
Sbjct  360  EG-KIVGIHGRKGLFLDAFGVH  380


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (61%), Gaps = 2/79 (3%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPFM-DRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGA  289
            I ++  +E LT ISG +GP   D  + +++S+ F T+  ++GP+G  VG  F      G 
Sbjct  501  IQLEYPNEVLTCISGYYGPIAKDEQHIIMKSLTFNTSRGKYGPFGEEVGKFFTSTTTEG-  559

Query  288  KIVGFFGRAGFYVDAIGTY  232
            K+VGF GR+  Y+DAIG +
Sbjct  560  KVVGFHGRSSLYLDAIGVH  578



>gb|EAZ01021.1| hypothetical protein OsI_23055 [Oryza sativa Indica Group]
Length=694

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 51/80 (64%), Gaps = 2/80 (3%)
 Frame = -3

Query  468  TINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQN-G  292
            TI++ G  EYL EISGT GPF    + V+ S+   T +R +GPYG  VG PF+   QN G
Sbjct  307  TIHL-GPSEYLIEISGTVGPFTYAPHGVITSLTLVTTIRTYGPYGELVGNPFHIPMQNKG  365

Query  291  AKIVGFFGRAGFYVDAIGTY  232
              IVGFF R G+YVDA G Y
Sbjct  366  GSIVGFFARVGWYVDAFGIY  385


 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 43/71 (61%), Gaps = 6/71 (8%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFGR  265
            E+LT  SGT G      +NV+ S+   TN R +GP+G   G PF    +N A IVGFFGR
Sbjct  470  EFLTGFSGTTG------HNVVTSLTLITNARSYGPFGQVGGAPFQVPMRNNASIVGFFGR  523

Query  264  AGFYVDAIGTY  232
            A  Y++AIG Y
Sbjct  524  ADQYLNAIGVY  534


 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 48/75 (64%), Gaps = 2/75 (3%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNG-AKIVG  277
            G  E++T + GT GPF + S +V+ S++F TN  ++GP+G  +GT F      G + IVG
Sbjct  617  GPSEFVTAVYGTVGPFGNYS-SVITSLRFVTNAGKYGPFGQGIGTHFQAPMHKGSSSIVG  675

Query  276  FFGRAGFYVDAIGTY  232
            FFGR+   V++IG Y
Sbjct  676  FFGRSSSCVESIGFY  690



>ref|XP_003615697.1| Myrosinase-binding protein-like protein [Medicago truncatula]
 gb|AES98655.1| mannose-binding lectin superfamily protein [Medicago truncatula]
Length=604

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 78/152 (51%), Gaps = 9/152 (6%)
 Frame = -3

Query  687  ISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtlti  508
            I    + GP G NGG  W     + + Q+V++ G       I  I    +K GS      
Sbjct  12   IKKPASVGPWGGNGGSRWDDGIYSGVRQLVVVHGTG-----IDSIQIEYDKKGSSIWSEK  66

Query  507  ggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPN  328
             GG       ++D + +D  DE+LT + G +G      +N++RS+ F +N + +GP+G  
Sbjct  67   HGGTGGN---KTDKVKLDYPDEFLTSVHGYYGSLNQWGHNLVRSLSFESNKKTYGPFGVE  123

Query  327  VGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
             GT F+     GAKIVGF GR G+Y+DAIG Y
Sbjct  124  QGTYFSV-PMTGAKIVGFHGRCGWYLDAIGVY  154


 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            +SD I  D   E LT ISG  GP M     V+RS+ F T  R++GP+G   GT F  + +
Sbjct  307  KSDKIVFDFPYEVLTYISGYHGPLMYMGPAVIRSLTFHTTKRKYGPFGEEQGTYFTTKVK  366

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G KIVG  GR G ++DA G +
Sbjct  367  EG-KIVGIHGRKGLFLDAFGVH  387


 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 46/79 (58%), Gaps = 2/79 (3%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPFM-DRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGA  289
            I ++   E LT ISG +G    D  + V++S+ F T+  ++GPYG  VG  F      G 
Sbjct  508  IQLEFPHEVLTCISGYYGSITKDEKHTVIKSLTFHTSRGQYGPYGEEVGKFFTSTTTEG-  566

Query  288  KIVGFFGRAGFYVDAIGTY  232
            K+VGF GR+  Y+DAIG +
Sbjct  567  KVVGFHGRSSLYLDAIGIH  585



>ref|NP_001106057.1| PL3K2 [Zea mays]
 gb|ABR68026.1| PL3K2 [Zea mays]
 gb|ACF80462.1| unknown [Zea mays]
 gb|ACG30569.1| hypothetical protein [Zea mays]
Length=151

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = -3

Query  447  DEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFG  268
            DE LTEISGT GP  +   N+++S+KF TN R +GPYG + GTPF  +  N   + GFFG
Sbjct  77   DESLTEISGTTGPAYNID-NLVKSLKFVTNKRAYGPYGRDEGTPFRVKVMNNGHVAGFFG  135

Query  267  RAGFYVDAIGTY  232
            R+G  +DAIG Y
Sbjct  136  RSGDCLDAIGLY  147



>gb|EMT11070.1| hypothetical protein F775_02114 [Aegilops tauschii]
Length=332

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = -3

Query  447  DEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFG  268
            DEYLT + G +G F D  + V+RS+ F +N+R +GPYG   G PF   A  G KI+GF  
Sbjct  257  DEYLTSVHGHYGQFKD--FVVIRSLTFVSNLRSYGPYGKEDGVPFALHAGPGGKIIGFHA  314

Query  267  RAGFYVDAIGTY  232
            R+G ++DAIGTY
Sbjct  315  RSGQFLDAIGTY  326



>gb|EMS55842.1| hypothetical protein TRIUR3_32339 [Triticum urartu]
Length=288

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            G  E++ E+SGTFG +   ++N++ S+KF TN++ +GP+G   GT F    Q  + IVGF
Sbjct  211  GTSEFVKEVSGTFGLYGRDNHNIITSLKFVTNMKTYGPFGQAKGTTFTIPVQKNSSIVGF  270

Query  273  FGRAGFYVDAIGTY  232
            FGR+G Y+DA+G Y
Sbjct  271  FGRSGIYLDALGVY  284



>gb|ACG29554.1| hypothetical protein [Zea mays]
 gb|ACG44268.1| hypothetical protein [Zea mays]
Length=151

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = -3

Query  447  DEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFG  268
            DE LTEISGT GP  +   N+++S+KF TN R +GPYG + GTPF  +  N   + GFFG
Sbjct  77   DESLTEISGTTGPAYNID-NLVKSLKFVTNKRTYGPYGRDEGTPFRVKVMNNGHVAGFFG  135

Query  267  RAGFYVDAIGTY  232
            R+G  +DAIG Y
Sbjct  136  RSGDCLDAIGLY  147



>ref|XP_004235622.1| PREDICTED: jacalin-related lectin 19 [Solanum lycopersicum]
Length=201

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/158 (35%), Positives = 81/158 (51%), Gaps = 9/158 (6%)
 Frame = -3

Query  699  ETMEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKd  520
            E  EI   I  G  G +GG  W     N + +I ++      +  I  I    ++ G   
Sbjct  5    EGSEIKKRIVIGSWGGHGGSPWDDGSFNGVREITLV-----YSLCIDSITVVYDQNGQPY  59

Query  519  tltiggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGP  340
                 GG   +   R+  I +   +EYLT +SG + P +     V+RS+ F++N R+FGP
Sbjct  60   QAEKHGGVGGS---RTAQIKLQFPEEYLTSVSGYYCPVVYGGSPVIRSLTFSSNKRKFGP  116

Query  339  YGPNVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTYNA  226
            +G   GTPF+   + G +IVGF GR+G+YVDAIG Y A
Sbjct  117  FGVEGGTPFSMPME-GGQIVGFKGRSGWYVDAIGFYIA  153



>gb|EEC68269.1| hypothetical protein OsI_36304 [Oryza sativa Indica Group]
Length=1419

 Score = 79.7 bits (195),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 37/73 (51%), Positives = 48/73 (66%), Gaps = 1/73 (1%)
 Frame = -3

Query  450   ADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFF  271
             + E L E+SGTFG F     N++ S+ F TN + +GP+G   GTPF+   Q G +IVGFF
Sbjct  1045  SSEVLVEVSGTFGRFAGFQ-NIITSLTFVTNTQSYGPFGQREGTPFHIPVQCGGRIVGFF  1103

Query  270   GRAGFYVDAIGTY  232
             GRAG+  DAIG Y
Sbjct  1104  GRAGWCFDAIGIY  1116


 Score = 70.1 bits (170),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = -3

Query  453   GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNV-REFGPYGPNVGTPFNFQAQNGAKIVG  277
             G  E+  ++SGTFGPF +   NV+ S+ F TN   ++GP+G   GTPF+        IVG
Sbjct  1342  GPSEFFVKVSGTFGPFGEFP-NVITSLTFVTNTHHQYGPFGQGGGTPFHAPMSGNGSIVG  1400

Query  276   FFGRAGFYVDAIGTY  232
             FFGR G  ++A+G Y
Sbjct  1401  FFGREGLCIEAVGFY  1415


 Score = 64.3 bits (155),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 40/69 (58%), Gaps = 1/69 (1%)
 Frame = -3

Query  438   LTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFGRAG  259
             +T + GT G +   S +V+ S+   TN   +GP+G   G PF+F  Q    IVGFFG A 
Sbjct  1192  ITRVYGTSGSYNTPS-DVVTSITLVTNAGCYGPFGQENGIPFDFPVQGNGSIVGFFGHAN  1250

Query  258   FYVDAIGTY  232
              YVDAIG Y
Sbjct  1251  LYVDAIGVY  1259



>ref|XP_009769147.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=1335

 Score = 79.7 bits (195),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 52/146 (36%), Positives = 77/146 (53%), Gaps = 12/146 (8%)
 Frame = -3

Query  663  PLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltiggggtdtT  484
            P G  GG  W++   + I +I+I+ G   +     ++F +  + G+       GG     
Sbjct  33   PWGGVGGSKWNYMLKSPIKEILIVHGDVID----SIMFRTITEQGTTIDSPKFGGDGG--  86

Query  483  VIRSDTINIDGAD-EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVG-TPFN  310
              R D + ++    EYLT I GTFG F   S  V++S+ F TN + +GP+G   G TPF+
Sbjct  87   --RRDKVVVEATPLEYLTGIKGTFGRFYGHS--VIKSLCFITNAKNYGPFGSEAGGTPFS  142

Query  309  FQAQNGAKIVGFFGRAGFYVDAIGTY  232
               + G  IVGF GR+G Y+DAIG Y
Sbjct  143  LVMKEGVAIVGFHGRSGLYLDAIGVY  168



>ref|XP_004152769.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like 
[Cucumis sativus]
Length=1463

 Score = 79.3 bits (194),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = -3

Query  477   RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
             ++DT+ +D  DEYLT I G +G F+      +RS+ F +N +++GPYG   GT F+F   
Sbjct  939   KTDTVKLDFPDEYLTMIRGHYGSFVSFDKVFVRSLTFMSNKKKYGPYGVEQGTIFSFPTT  998

Query  297   NGAKIVGFFGRAGFYVDAIGTY  232
              G KIVGF GR+G Y+DAIG Y
Sbjct  999   EG-KIVGFHGRSGLYLDAIGVY  1019


 Score = 67.4 bits (163),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = -3

Query  477   RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
             + D +  D   E LT ++G +GP M    NV++S+ F T   ++GP+G   GTPF+   +
Sbjct  1167  KYDKVIFDYPYEILTHVTGHYGPVMYMGPNVIKSLTFHTTKAKYGPFGEAQGTPFSTNVK  1226

Query  297   NGAKIVGFFGRAGFYVDAIGTY  232
              G KIVGF GR G ++DA+G +
Sbjct  1227  EG-KIVGFHGRKGLFLDALGVH  1247


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 45/79 (57%), Gaps = 2/79 (3%)
 Frame = -3

Query  465   INIDGADEYLTEISGTFGPF-MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGA  289
             + +D   E LT ISG +G    D     ++S+ F T+  +FGP+G  VG+ F      G 
Sbjct  1367  VKLDYPHEVLTCISGYYGYIGKDERQQAVKSLTFHTSRGKFGPFGEEVGSFFTSTTTEG-  1425

Query  288   KIVGFFGRAGFYVDAIGTY  232
             K+VGF GR+  Y+DAIG +
Sbjct  1426  KVVGFHGRSSLYLDAIGVH  1444



>ref|XP_006853911.1| hypothetical protein AMTR_s00036p00183970 [Amborella trichopoda]
 gb|ERN15378.1| hypothetical protein AMTR_s00036p00183970 [Amborella trichopoda]
Length=126

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            R+  I     +E++T +SG + P +     V+RS+KF TN + +GPYG   GTPF+F   
Sbjct  12   RTAHIKFQYPEEFITGVSGHYSPMVHSGTPVIRSLKFATNRKTYGPYGVEEGTPFSF-PM  70

Query  297  NGAKIVGFFGRAGFYVDAIG  238
            +G  IVGF GR+G+Y+DAIG
Sbjct  71   DGGHIVGFKGRSGWYLDAIG  90



>ref|XP_004960459.1| PREDICTED: salt stress-induced protein-like [Setaria italica]
Length=149

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 52/74 (70%), Gaps = 2/74 (3%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            GA E++ EISGT+GPF    + V+RS+ F TNV + GP+G    TPF+   Q+ A++VGF
Sbjct  75   GAGEFVKEISGTYGPF--GGHTVVRSLTFVTNVGKHGPFGNPGQTPFSVPVQDDARVVGF  132

Query  273  FGRAGFYVDAIGTY  232
            FGR+G  +DA+G Y
Sbjct  133  FGRSGSLLDAVGVY  146



>ref|XP_010273654.1| PREDICTED: mannose/glucose-specific lectin-like [Nelumbo nucifera]
Length=147

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 50/82 (61%), Gaps = 3/82 (4%)
 Frame = -3

Query  471  DTINIDGADEYLTEISGTFGPFMDRS--YNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            D I I   DEYLT ISGTFG        + V+RS++F TN R +GPYG   GT F+   +
Sbjct  64   DQIQIAWPDEYLTSISGTFGRRWKNQNGHVVVRSIQFNTNARSYGPYGSTDGTAFSLPVK  123

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G KIVGF GR G  +D+IG Y
Sbjct  124  QG-KIVGFHGRCGADLDSIGVY  144



>ref|XP_004298563.1| PREDICTED: myrosinase-binding protein-like At2g25980-like [Fragaria 
vesca subsp. vesca]
Length=379

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 54/78 (69%), Gaps = 2/78 (3%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFG--PFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNG  292
            I +D  DE+L  +SG +    ++  +  VLRS+KF TN R FGP+G  VGTPF F+ ++G
Sbjct  107  IKLDYPDEFLVSVSGYYCGVTWIVGAPVVLRSLKFETNKRTFGPFGVEVGTPFTFRVKDG  166

Query  291  AKIVGFFGRAGFYVDAIG  238
             KIVGF GR G+Y+DAIG
Sbjct  167  VKIVGFKGRNGWYLDAIG  184


 Score = 65.9 bits (159),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 55/82 (67%), Gaps = 2/82 (2%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFG--PFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNG  292
            I ++  +E++  ++G +G   ++  +  VL S++F +N R FGP+G  VGTPF F+ ++G
Sbjct  259  IKLEYPNEFIVSVTGHYGGVTWIVGAPVVLLSLRFESNRRTFGPFGVQVGTPFTFRVKDG  318

Query  291  AKIVGFFGRAGFYVDAIGTYNA  226
             +IVG  GR G+Y+DAIG + +
Sbjct  319  DQIVGLKGRNGWYLDAIGFHTS  340



>gb|AFW60405.1| putative protein kinase superfamily protein [Zea mays]
Length=634

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            G  E+LT +SGT GPF + + NV+ S+ F TN R +GP+G   GTPF+ Q QN  +IVGF
Sbjct  223  GPSEFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGF  281

Query  273  FGRAGFYVDAIG  238
            FGR+G Y+ AIG
Sbjct  282  FGRSGQYLYAIG  293


 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFGR  265
            E+LT +SG+ G F   + NV+ S+ F TN R +GP+G   GT F+   Q    IVGFFGR
Sbjct  391  EFLTGVSGSIGTFNGHA-NVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGR  449

Query  264  AGFYVDAIGTYNA  226
            +G Y++AIG Y A
Sbjct  450  SGRYLNAIGVYTA  462


 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 3/75 (4%)
 Frame = -3

Query  447  DEYLTEISGTFGPFM-DRSY-NVLRSVKFTTNV-REFGPYGPNVGTPFNFQAQNGAKIVG  277
            +E++ E++GTF P   DR+  +V+ S+   T+  +  GP+G  +G  F    Q+ ++IVG
Sbjct  550  EEFIVEVTGTFHPCAWDRTIPSVVSSLTLVTSTGKTHGPFGTQLGAAFQVPVQSDSRIVG  609

Query  276  FFGRAGFYVDAIGTY  232
            FF     Y++AIG Y
Sbjct  610  FFAHGDNYIEAIGAY  624



>ref|XP_004490606.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Cicer 
arietinum]
Length=605

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 77/152 (51%), Gaps = 9/152 (6%)
 Frame = -3

Query  687  ISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtlti  508
            I    + GP G NGG  W     + + Q+VI+ G       I  I    +K GS      
Sbjct  12   IKKPASVGPWGGNGGSRWDDGIYSGVRQLVIIHGTG-----IDSIQIEYDKKGSSIWSEK  66

Query  507  ggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPN  328
             GG       ++D + +D  DE+LT I G +G      +N++RS+ F +N + +GP+G  
Sbjct  67   HGGSGGN---KTDKVKLDYPDEFLTSIHGYYGSLNQWGHNLVRSLSFESNKKTYGPFGVE  123

Query  327  VGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
             GT F+     GAKIVGF G  G+Y+DAIG Y
Sbjct  124  HGTFFSV-PMTGAKIVGFHGSCGWYLDAIGVY  154


 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++D I  D   E LT ISG +GP M     V+RS+ F T  R++GP+G   GT F  + +
Sbjct  308  KNDKIVFDFPYEVLTHISGYYGPLMYMGPAVVRSLTFHTTKRKYGPFGEEQGTYFTTKVK  367

Query  297  NGAKIVGFFGRAGFYVDAIG  238
             G KIVG  G+ G ++DA G
Sbjct  368  EG-KIVGIHGKKGLFLDAFG  386


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 2/79 (3%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPFM-DRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGA  289
            I ++   E LT ISG +G    D +  +++S+ F T+  ++GPYG  VG  F      G 
Sbjct  509  IQLEYPHEVLTCISGYYGSITKDENQTIIKSLTFHTSRGQYGPYGEEVGKFFTSTTTEG-  567

Query  288  KIVGFFGRAGFYVDAIGTY  232
            K+VGF GR+  Y+DAIG +
Sbjct  568  KVVGFHGRSSLYLDAIGVH  586



>gb|KGN62634.1| hypothetical protein Csa_2G362470 [Cucumis sativus]
Length=598

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++DT+ +D  DEYLT I G +G F+      +RS+ F +N +++GPYG   GT F+F   
Sbjct  70   KTDTVKLDFPDEYLTMIRGHYGSFVSFDKVFVRSLTFMSNKKKYGPYGVEQGTIFSFPTT  129

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G KIVGF GR+G Y+DAIG Y
Sbjct  130  EG-KIVGFHGRSGLYLDAIGVY  150


 Score = 66.6 bits (161),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            + D +  D   E LT ++G +GP M    NV++S+ F T   ++GP+G   GTPF+   +
Sbjct  302  KYDKVIFDYPYEILTHVTGHYGPVMYMGPNVIKSLTFHTTKAKYGPFGEAQGTPFSTNVK  361

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G KIVGF GR G ++DA+G +
Sbjct  362  EG-KIVGFHGRKGLFLDALGVH  382


 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 45/79 (57%), Gaps = 2/79 (3%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPF-MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGA  289
            + +D   E LT ISG +G    D     ++S+ F T+  +FGP+G  VG+ F      G 
Sbjct  502  VKLDYPHEVLTCISGYYGYIGKDERQQAVKSLTFHTSRGKFGPFGEEVGSFFTSTTTEG-  560

Query  288  KIVGFFGRAGFYVDAIGTY  232
            K+VGF GR+  Y+DAIG +
Sbjct  561  KVVGFHGRSSLYLDAIGVH  579



>ref|XP_004490607.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Cicer 
arietinum]
Length=600

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 77/152 (51%), Gaps = 9/152 (6%)
 Frame = -3

Query  687  ISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtlti  508
            I    + GP G NGG  W     + + Q+VI+ G       I  I    +K GS      
Sbjct  7    IKKPASVGPWGGNGGSRWDDGIYSGVRQLVIIHGTG-----IDSIQIEYDKKGSSIWSEK  61

Query  507  ggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPN  328
             GG       ++D + +D  DE+LT I G +G      +N++RS+ F +N + +GP+G  
Sbjct  62   HGGSGGN---KTDKVKLDYPDEFLTSIHGYYGSLNQWGHNLVRSLSFESNKKTYGPFGVE  118

Query  327  VGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
             GT F+     GAKIVGF G  G+Y+DAIG Y
Sbjct  119  HGTFFSV-PMTGAKIVGFHGSCGWYLDAIGVY  149


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++D I  D   E LT ISG +GP M     V+RS+ F T  R++GP+G   GT F  + +
Sbjct  303  KNDKIVFDFPYEVLTHISGYYGPLMYMGPAVVRSLTFHTTKRKYGPFGEEQGTYFTTKVK  362

Query  297  NGAKIVGFFGRAGFYVDAIG  238
             G KIVG  G+ G ++DA G
Sbjct  363  EG-KIVGIHGKKGLFLDAFG  381


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 2/79 (3%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPFM-DRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGA  289
            I ++   E LT ISG +G    D +  +++S+ F T+  ++GPYG  VG  F      G 
Sbjct  504  IQLEYPHEVLTCISGYYGSITKDENQTIIKSLTFHTSRGQYGPYGEEVGKFFTSTTTEG-  562

Query  288  KIVGFFGRAGFYVDAIGTY  232
            K+VGF GR+  Y+DAIG +
Sbjct  563  KVVGFHGRSSLYLDAIGVH  581



>ref|XP_006647196.1| PREDICTED: disease resistance protein RPM1-like isoform X2 [Oryza 
brachyantha]
Length=960

 Score = 78.2 bits (191),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 56/146 (38%), Positives = 79/146 (54%), Gaps = 11/146 (8%)
 Frame = -3

Query  666  GPLGHNGGDFWSFRPMNK-INQIVILSggpgnnnPIGLIFSSTNKTGSKdtltiggggtd  490
            GP G NGG     +  +K +  + I SG   +     L FS  +K G + T ++ GG   
Sbjct  821  GPWGGNGGVTCDIKVASKRLESVTICSGIIID----ALAFSYFDKDGERHTTSLWGGLGG  876

Query  489  tTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFN  310
            +  +    IN+D   EYL E+ GT GPF + S   + S+   TNVR +GP+G   GTPF 
Sbjct  877  SVQL----INLD-EREYLVEVIGTVGPF-NVSSEAITSLTLVTNVRSYGPFGQPQGTPFR  930

Query  309  FQAQNGAKIVGFFGRAGFYVDAIGTY  232
               +  + IVGFFGR+G Y+DA+G Y
Sbjct  931  TPLKKNSCIVGFFGRSGTYLDAVGVY  956



>ref|XP_008444758.1| PREDICTED: LOW QUALITY PROTEIN: myrosinase-binding protein-like 
At3g16470 [Cucumis melo]
Length=598

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++DT+ +D  DEYLT I G +G F+      +RS+ F +N +++GPYG   GT F+F   
Sbjct  70   KTDTVKLDFPDEYLTMIRGYYGSFVSFDKVFVRSLTFMSNKKKYGPYGVEQGTVFSFPTT  129

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G KIVGF GR+G Y+DAIG Y
Sbjct  130  EG-KIVGFHGRSGLYLDAIGVY  150


 Score = 66.6 bits (161),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            + D +  D   E LT ++G +GP M    NV++S+ F T   ++GP+G   GTPF+   +
Sbjct  302  KYDKVIFDYPYEILTHVTGHYGPVMYMGPNVIKSLSFHTTKAKYGPFGEAQGTPFSTNVK  361

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G KIVGF GR G ++DA+G +
Sbjct  362  EG-KIVGFHGRKGLFLDALGVH  382


 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 45/79 (57%), Gaps = 2/79 (3%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPF-MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGA  289
            + +D   E LT ISG +G    D     ++S+ F T+  +FGP+G  VG+ F      G 
Sbjct  502  VKLDYPHEVLTCISGYYGYIGKDERQQAVKSLTFHTSRGKFGPFGEEVGSFFTSTTTEG-  560

Query  288  KIVGFFGRAGFYVDAIGTY  232
            K+VGF GR+  Y+DAIG +
Sbjct  561  KVVGFHGRSSLYLDAIGVH  579



>ref|XP_006647195.1| PREDICTED: disease resistance protein RPM1-like isoform X1 [Oryza 
brachyantha]
Length=1077

 Score = 78.2 bits (191),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 56/146 (38%), Positives = 79/146 (54%), Gaps = 11/146 (8%)
 Frame = -3

Query  666   GPLGHNGGDFWSFRPMNK-INQIVILSggpgnnnPIGLIFSSTNKTGSKdtltiggggtd  490
             GP G NGG     +  +K +  + I SG   +     L FS  +K G + T ++ GG   
Sbjct  938   GPWGGNGGVTCDIKVASKRLESVTICSGIIID----ALAFSYFDKDGERHTTSLWGGLGG  993

Query  489   tTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFN  310
             +  +    IN+D   EYL E+ GT GPF + S   + S+   TNVR +GP+G   GTPF 
Sbjct  994   SVQL----INLD-EREYLVEVIGTVGPF-NVSSEAITSLTLVTNVRSYGPFGQPQGTPFR  1047

Query  309   FQAQNGAKIVGFFGRAGFYVDAIGTY  232
                +  + IVGFFGR+G Y+DA+G Y
Sbjct  1048  TPLKKNSCIVGFFGRSGTYLDAVGVY  1073



>ref|XP_006343016.1| PREDICTED: agglutinin-like [Solanum tuberosum]
Length=201

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 81/158 (51%), Gaps = 9/158 (6%)
 Frame = -3

Query  699  ETMEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKd  520
            E  EI   I  G  G +GG  W     N + +I ++      +  I  I    ++ G   
Sbjct  5    EGSEIKKRIVIGSWGGHGGSPWDDGSFNGVREISLV-----YSLCIDSITVVYDQNGQPY  59

Query  519  tltiggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGP  340
                 GG   +   R+  I +   +EYLT +SG + P +     V+RS+ F++N R+FGP
Sbjct  60   QAEKHGGVGGS---RTAQIKLQFPEEYLTSVSGYYSPVVYGGSPVIRSLTFSSNKRKFGP  116

Query  339  YGPNVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTYNA  226
            +G   GTPF+   + G +IVGF GR+G+Y+DAIG Y A
Sbjct  117  FGVEGGTPFSMPME-GGQIVGFKGRSGWYLDAIGFYIA  153



>ref|XP_006663484.1| PREDICTED: putative disease resistance RPP13-like protein 3-like 
[Oryza brachyantha]
Length=1366

 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = -3

Query  444   EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFGR  265
             E L E+SGTFG F+    N++ S+ F TN R +GPYG   GTPF+   Q    IVGFFGR
Sbjct  980   EILVEVSGTFGRFIGFQ-NIITSLTFVTNTRSYGPYGQRKGTPFDIPVQGSGCIVGFFGR  1038

Query  264   AGFYVDAIGTY  232
             AG+ VDAIG Y
Sbjct  1039  AGWCVDAIGIY  1049


 Score = 72.4 bits (176),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = -3

Query  453   GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
             G+ E++T +SGT G +   S +V+ S+   TNV  +GP+G   G PFNF  Q   +IVGF
Sbjct  1132  GSSEFITRVSGTIGSYNTPS-DVVTSITLVTNVGCYGPFGQENGIPFNFPVQGNGRIVGF  1190

Query  273   FGRAGFYVDAIGTY  232
             FG A  YVDAIG Y
Sbjct  1191  FGHADLYVDAIGVY  1204


 Score = 57.4 bits (137),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 44/75 (59%), Gaps = 2/75 (3%)
 Frame = -3

Query  453   GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNV-REFGPYGPNVGTPFNFQAQNGAKIVG  277
             G  E+L ++ GTFGPF +   NV+ S+ F TN    +GP+G   GTPF         IVG
Sbjct  1289  GPLEFLVKVLGTFGPFGEFP-NVITSLTFVTNTDHHYGPFGQGGGTPFYGPMSGHGSIVG  1347

Query  276   FFGRAGFYVDAIGTY  232
             FFGR G  ++AIG Y
Sbjct  1348  FFGRKGPCIEAIGFY  1362



>ref|XP_010088386.1| hypothetical protein L484_008121 [Morus notabilis]
 gb|EXB34860.1| hypothetical protein L484_008121 [Morus notabilis]
Length=193

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 75/149 (50%), Gaps = 9/149 (6%)
 Frame = -3

Query  684  STDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltig  505
            S  I  GP G NGG+ W     + + +I +        + I +++    K  + +     
Sbjct  13   SKGIAVGPWGGNGGNSWDDGAYSGVREITLF--YDRCIDSIRVVYDKNGKPVAAEKHGGI  70

Query  504  gggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNV  325
            GG       R+  I ++  +EYL  +SG + P +     V+RS+   +N R FGPYG   
Sbjct  71   GGS------RTAEIKLNYPEEYLVSVSGYYCPVVHGGSPVIRSLTLKSNKRTFGPYGVEE  124

Query  324  GTPFNFQAQNGAKIVGFFGRAGFYVDAIG  238
            GTPF+F  Q G  IVGF GR G+Y+DAIG
Sbjct  125  GTPFSFPIQGGL-IVGFKGRNGWYLDAIG  152



>gb|EEE60695.1| hypothetical protein OsJ_14181 [Oryza sativa Japonica Group]
Length=95

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYG-PNVGTPFNFQAQNGAKIVG  277
            G  +++ EISGT G ++    NVLRS+K TT  R +GPYG P  G PF+F      +I G
Sbjct  17   GLMDFVMEISGTTGMWVSGMSNVLRSLKITTLKRTYGPYGNPKAGIPFSFSVDGSDRITG  76

Query  276  FFGRAGFYVDAIGTY  232
            FF RAGF  DAIG Y
Sbjct  77   FFVRAGFITDAIGVY  91



>ref|XP_006838705.1| hypothetical protein AMTR_s00002p00249920 [Amborella trichopoda]
 gb|ERN01274.1| hypothetical protein AMTR_s00002p00249920 [Amborella trichopoda]
Length=610

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 81/158 (51%), Gaps = 11/158 (7%)
 Frame = -3

Query  699  ETMEISTD--ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGS  526
            + +E+ +   ++ GP G  GG  W       + QIVI+ G        G I S   +   
Sbjct  2    QNLEVGSKKAVSVGPWGGQGGSPWDDGVHTGVKQIVIVHG--------GAIDSLRFEYDK  53

Query  525  KdtltiggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREF  346
            K               ++D + ++  +E LT +SG +GP       ++RS+ F TN++++
Sbjct  54   KGQSVWSEKHGGNGGCKTDKVKLEYPEEVLTWLSGHYGPMSSGCPTIIRSLTFQTNLKKY  113

Query  345  GPYGPNVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            GP+G   GT F+F   +G K+VGF GR+G+++D+IG +
Sbjct  114  GPFGVQQGTHFSF-TMSGGKVVGFHGRSGWHLDSIGLH  150


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            +SD +  D   E LT I+G +G        V++S+ F T   ++GPYG   G  F+ Q+ 
Sbjct  310  KSDKVVFDYPFEILTYITGNYGAAFLMGPMVIKSLTFHTTKGQYGPYGDQQGMSFSSQSV  369

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G +IVGF GR+G+Y+DAIG +
Sbjct  370  AG-RIVGFHGRSGWYLDAIGVH  390


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 2/79 (3%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPFM-DRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGA  289
            I  +  +E LT I+G +G    D    V++S+ F T+  ++GPYG  +GT F      G 
Sbjct  511  IKFEYPNEVLTCITGYYGAVARDDRLEVIKSLTFCTSRGKYGPYGEELGTYFTSNRTEG-  569

Query  288  KIVGFFGRAGFYVDAIGTY  232
            K+VGF GR+G Y+ AIG +
Sbjct  570  KVVGFHGRSGSYLYAIGVH  588



>ref|NP_001052560.1| Os04g0369100 [Oryza sativa Japonica Group]
 dbj|BAF14474.1| Os04g0369100 [Oryza sativa Japonica Group]
Length=770

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            G  EY+TE+SGT GPF      V+ S+ F TN   +GP+G   GTPF+   Q+   IVGF
Sbjct  369  GLIEYVTEVSGTIGPFDRAPAGVITSLTFITNKGSYGPFGEVRGTPFHIPVQDNGSIVGF  428

Query  273  FGRAGFYVDAIGTY  232
            F RAG+YVDA G Y
Sbjct  429  FARAGWYVDAFGIY  442



>emb|CAD40628.2| OSJNBa0016N04.16 [Oryza sativa Japonica Group]
 emb|CAD40707.2| OSJNBb0042I07.4 [Oryza sativa Japonica Group]
 emb|CAH66364.1| H0607F01.9 [Oryza sativa Indica Group]
Length=477

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            G  EY+TE+SGT GPF      V+ S+ F TN   +GP+G   GTPF+   Q+   IVGF
Sbjct  76   GLIEYVTEVSGTIGPFDRAPAGVITSLTFITNKGSYGPFGEVRGTPFHIPVQDNGSIVGF  135

Query  273  FGRAGFYVDAIGTY  232
            F RAG+YVDA G Y
Sbjct  136  FARAGWYVDAFGIY  149



>gb|EEE60834.1| hypothetical protein OsJ_14451 [Oryza sativa Japonica Group]
Length=736

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            G  EY+TE+SGT GPF      V+ S+ F TN   +GP+G   GTPF+   Q+   IVGF
Sbjct  335  GLIEYVTEVSGTIGPFDRAPAGVITSLTFITNKGSYGPFGEVRGTPFHIPVQDNGSIVGF  394

Query  273  FGRAGFYVDAIGTY  232
            F RAG+YVDA G Y
Sbjct  395  FARAGWYVDAFGIY  408



>sp|P83304.1|LEC_PARPC RecName: Full=Mannose/glucose-specific lectin, partial [Parkia 
platycephala]
 pdb|1ZGR|A Chain A, Crystal Structure Of The Parkia Platycephala Seed Lectin
 pdb|1ZGR|B Chain B, Crystal Structure Of The Parkia Platycephala Seed Lectin
 pdb|1ZGS|A Chain A, Parkia Platycephala Seed Lectin In Complex With 5-Bromo-4- 
Chloro-3-Indolyl-A-D-Mannose
 pdb|1ZGS|B Chain B, Parkia Platycephala Seed Lectin In Complex With 5-Bromo-4- 
Chloro-3-Indolyl-A-D-Mannose
Length=447

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 79/154 (51%), Gaps = 10/154 (6%)
 Frame = -3

Query  690  EISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtlt  511
            ++   I+ GP G +GGD WS+     INQI+I +G          I S   K  S     
Sbjct  296  DVEGSISIGPWGGSGGDPWSYTANEGINQIIIYAGSN--------IKSVAFKDTSGLDSA  347

Query  510  iggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRS-YNVLRSVKFTTNVREFGPYG  334
              GG         +T++I+   EYLT ISGT+G +  +  +  + S+ FTTN+  +GP+G
Sbjct  348  TFGGVNPKDTGEKNTVSINWPSEYLTSISGTYGQYKFKDVFTTITSLSFTTNLATYGPFG  407

Query  333  PNVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
                T F+    N   +VGF GRAG Y+DAIG +
Sbjct  408  KASATSFSIPIHNNM-VVGFHGRAGDYLDAIGIF  440


 Score = 62.8 bits (151),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 74/149 (50%), Gaps = 10/149 (7%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I+ GP G +GG++WSF+  + I +IVI       +       S  + +G       G   
Sbjct  6    ISVGPWGGSGGNYWSFKANHAITEIVIHVKDNIKS------ISFKDASGDISGTFGGKDP  59

Query  495  tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVG-T  319
             +        I I    EYL  ISG++G +      V+RS+ F TN+  +GP+G   G  
Sbjct  60   RENEKGDEKKIKIHWPTEYLKSISGSYGDY--NGVLVIRSLSFITNLTTYGPFGSTSGGE  117

Query  318  PFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
             F+    + + +VGF GRAG+Y+DA+G +
Sbjct  118  SFSIPIAD-SVVVGFHGRAGYYLDALGIF  145


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 51/78 (65%), Gaps = 3/78 (4%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAK  286
            + IDG  E+L  ISGT+G +  + + V+ S+ F TNV + GP+G   GT F+   + G+ 
Sbjct  217  VEIDGNLEHLKSISGTYGNY--KGFEVVTSLSFITNVTKHGPFGIASGTSFSIPIE-GSL  273

Query  285  IVGFFGRAGFYVDAIGTY  232
            + GF G++G+Y+D+IG Y
Sbjct  274  VTGFHGKSGYYLDSIGIY  291



>emb|CDM80625.1| unnamed protein product [Triticum aestivum]
 emb|CDM80626.1| unnamed protein product [Triticum aestivum]
Length=307

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = -3

Query  447  DEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFG  268
            DEYLT + G +G F  + + V+RS+KF +N+R +GPYG   G  F   A  G KI+GF  
Sbjct  232  DEYLTSVHGHYGQF--KGFVVVRSLKFVSNLRSYGPYGKEDGVSFALHAGPGGKIIGFHA  289

Query  267  RAGFYVDAIGTY  232
            R+G ++DAIGTY
Sbjct  290  RSGQFLDAIGTY  301



>ref|XP_009770862.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770863.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770864.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770865.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770866.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=1328

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 56/159 (35%), Positives = 79/159 (50%), Gaps = 17/159 (11%)
 Frame = -3

Query  693  MEISTD-ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTG---S  526
            M +  D I   P G  GG  W+++  N I +I+I  G   +     ++F +  K G    
Sbjct  1    MHVKMDSILLEPWGGTGGSKWNYKLKNPIKEILIAHGDIID----SIMFRTVTKKGITIG  56

Query  525  KdtltiggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREF  346
                   GG     VI +  +      EYLT I GTFG +   S  V++S+ F TNV+ +
Sbjct  57   SPKFGGNGGQISKVVIEATPL------EYLTGIKGTFGHYCGLS--VIKSLCFITNVKNY  108

Query  345  GPYGPNVG-TPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            GP+G   G TPF+   + G  IVGF GR G ++DAIG Y
Sbjct  109  GPFGCEAGGTPFSLVMKEGVAIVGFHGRCGAFLDAIGVY  147



>ref|XP_009763421.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009763428.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009763437.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
Length=1810

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 51/145 (35%), Positives = 74/145 (51%), Gaps = 11/145 (8%)
 Frame = -3

Query  663  PLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltiggggtdtT  484
            P G  GG  W ++  + I +I+I  G         ++F +  + G+       GG     
Sbjct  39   PWGGAGGSEWYYKLKSPIKEILIAHGDCIK----SIMFKTVTEQGTTIDSPKFGGDGG--  92

Query  483  VIRSDTINIDGAD-EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNF  307
              R D + ++    EYLT I GTFG      Y+V++S+ F TN + +GP+G   GTPF+ 
Sbjct  93   --RRDKVVMEETPLEYLTCIKGTFG--YCGGYSVVKSLCFITNAKNYGPFGCEAGTPFSL  148

Query  306  QAQNGAKIVGFFGRAGFYVDAIGTY  232
              + G  IVGF GR G Y+DAIG Y
Sbjct  149  VMKEGGAIVGFHGRCGAYLDAIGVY  173


 Score = 75.9 bits (185),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 56/159 (35%), Positives = 81/159 (51%), Gaps = 12/159 (8%)
 Frame = -3

Query  702  QETMEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSK  523
            Q + + +  I   P G  GG  W+++  + I +I+I  G        G I S   KT ++
Sbjct  208  QVSYDQADSILVEPWGGTGGSEWNYKLKSPIKEILIAHG--------GCIDSIMFKTITE  259

Query  522  dtltiggggtdtTVIRSDTINIDGAD-EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREF  346
               TI          R + +  +    E+LT I GT G F    Y+V++S+ FTTNV+ +
Sbjct  260  QGTTIDSPKFGGNGGRINKVVFEETPLEHLTGIKGTLGCF--DGYSVIKSLCFTTNVKNY  317

Query  345  GPYGPNVG-TPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            GP+G   G TPF+   + G  IVGF GR G Y+DAIG Y
Sbjct  318  GPFGSEGGGTPFSLVMKEGVAIVGFHGRCGAYLDAIGVY  356


 Score = 74.3 bits (181),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 54/150 (36%), Positives = 76/150 (51%), Gaps = 12/150 (8%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I  GP G  GG  W+++  + I +I+I  G        G I S   KT ++   TI    
Sbjct  423  ILVGPWGGTGGSEWNYKLKSYIKEILIAHG--------GCIDSIMFKTITEQGTTIDSPK  474

Query  495  tdtTVIRSDTINIDGAD-EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVG-  322
                  R + + I+    EYLT I GTFG +    + V++S+ F TN   +GP+G + G 
Sbjct  475  FGGNGGRINKVVIEATPLEYLTGIKGTFGCY--NGHCVIKSLCFITNANNYGPFGSDAGG  532

Query  321  TPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            TPF+   + G  IVGF G  G Y+DAIG Y
Sbjct  533  TPFSLVMKEGVAIVGFHGLCGAYLDAIGIY  562



>ref|XP_009614996.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009614997.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
Length=1313

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 40/84 (48%), Positives = 52/84 (62%), Gaps = 4/84 (5%)
 Frame = -3

Query  477  RSDTINIDGAD-EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVG-TPFNFQ  304
            R D + I+    EYLT I GTFG F   S  V++S+ F TN + +GP+G   G TPF+  
Sbjct  43   RRDKVVIEATPLEYLTGIKGTFGCFYGHS--VIKSLCFITNAKNYGPFGCEAGGTPFSLV  100

Query  303  AQNGAKIVGFFGRAGFYVDAIGTY  232
             + G  IVGF GR+G Y+DAIG Y
Sbjct  101  MKEGVAIVGFHGRSGLYLDAIGVY  124



>ref|XP_006853910.1| hypothetical protein AMTR_s00036p00183430 [Amborella trichopoda]
 gb|ERN15377.1| hypothetical protein AMTR_s00036p00183430 [Amborella trichopoda]
Length=191

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 62/104 (60%), Gaps = 2/104 (2%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            R+  I     +E++TE+SG + P +     V+RS+KFTTN+R +GPYG   GTPF+    
Sbjct  80   RTTHIKFQYPEEFITEVSGHYCPVVHGGTPVIRSLKFTTNMRTYGPYGVEEGTPFSC-PM  138

Query  297  NGAKIVGFFGRAGFYVDAIGTYNA*LYGYSAAQCSLGTPLCFGC  166
            +G  IVGF GR G+Y+D+I    + LY  S    ++   +C GC
Sbjct  139  DGGLIVGFKGRNGWYLDSIEFRLSRLYSSSNLLDAIKQRIC-GC  181



>ref|XP_009763456.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X4 [Nicotiana sylvestris]
Length=1606

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 56/159 (35%), Positives = 81/159 (51%), Gaps = 12/159 (8%)
 Frame = -3

Query  702  QETMEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSK  523
            Q + + +  I   P G  GG  W+++  + I +I+I  G        G I S   KT ++
Sbjct  4    QVSYDQADSILVEPWGGTGGSEWNYKLKSPIKEILIAHG--------GCIDSIMFKTITE  55

Query  522  dtltiggggtdtTVIRSDTINIDGAD-EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREF  346
               TI          R + +  +    E+LT I GT G F    Y+V++S+ FTTNV+ +
Sbjct  56   QGTTIDSPKFGGNGGRINKVVFEETPLEHLTGIKGTLGCF--DGYSVIKSLCFTTNVKNY  113

Query  345  GPYGPNVG-TPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            GP+G   G TPF+   + G  IVGF GR G Y+DAIG Y
Sbjct  114  GPFGSEGGGTPFSLVMKEGVAIVGFHGRCGAYLDAIGVY  152


 Score = 74.7 bits (182),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 54/150 (36%), Positives = 76/150 (51%), Gaps = 12/150 (8%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I  GP G  GG  W+++  + I +I+I  G        G I S   KT ++   TI    
Sbjct  219  ILVGPWGGTGGSEWNYKLKSYIKEILIAHG--------GCIDSIMFKTITEQGTTIDSPK  270

Query  495  tdtTVIRSDTINIDGAD-EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVG-  322
                  R + + I+    EYLT I GTFG +    + V++S+ F TN   +GP+G + G 
Sbjct  271  FGGNGGRINKVVIEATPLEYLTGIKGTFGCY--NGHCVIKSLCFITNANNYGPFGSDAGG  328

Query  321  TPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            TPF+   + G  IVGF G  G Y+DAIG Y
Sbjct  329  TPFSLVMKEGVAIVGFHGLCGAYLDAIGIY  358



>ref|XP_010471351.1| PREDICTED: jacalin-related lectin 19 [Camelina sativa]
Length=177

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 78/155 (50%), Gaps = 9/155 (6%)
 Frame = -3

Query  702  QETMEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSK  523
            Q+  + +  +  GP G NGG  W     + + +I +L       + I +I+    K    
Sbjct  4    QQQGDKNLTVFVGPWGGNGGTAWDDGIYHGVREIRLL--YDHCIDSITVIYDKNGKPARS  61

Query  522  dtltiggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFG  343
            +     GG       ++  I +   DEYL  +SG + P ++    V+RS+ F +N + +G
Sbjct  62   EKHGGVGGN------KTSEIKLQYPDEYLIGVSGYYCPMVNSGTPVIRSMTFKSNKQVYG  115

Query  342  PYGPNVGTPFNFQAQNGAKIVGFFGRAGFYVDAIG  238
            PYG   GTPF F   NG +IVG  GR+G+Y+D+IG
Sbjct  116  PYGVEQGTPFTFSV-NGGRIVGMNGRSGWYLDSIG  149



>ref|NP_177447.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
 sp|Q9SSM3.1|JAL19_ARATH RecName: Full=Jacalin-related lectin 19 [Arabidopsis thaliana]
 gb|AAD55651.1|AC008017_24 Similar to jacalin [Arabidopsis thaliana]
 gb|AAX49365.1| At1g73040 [Arabidopsis thaliana]
 gb|ABR46196.1| At1g73040 [Arabidopsis thaliana]
 gb|AEE35407.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
Length=176

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 79/155 (51%), Gaps = 9/155 (6%)
 Frame = -3

Query  702  QETMEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSK  523
            Q+  + +  +  GP G NGG  W     + + +I ++       + I +I+    K    
Sbjct  4    QQQGDKNLTVFVGPWGGNGGTTWDDGIYDGVREIRLV--YDHCIDSISVIYDKNGKPAKS  61

Query  522  dtltiggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFG  343
            +     GG       ++  I +   +EYLT +SG + P ++    V+RS+ F +N + +G
Sbjct  62   EKHGGVGGN------KTSEIKLQYPEEYLTGVSGYYCPMVNSGTPVIRSMTFKSNKQVYG  115

Query  342  PYGPNVGTPFNFQAQNGAKIVGFFGRAGFYVDAIG  238
            PYG   GTPF F   NG +IVG  GR+G+Y+D+IG
Sbjct  116  PYGVEQGTPFTFSV-NGGRIVGMNGRSGWYLDSIG  149



>gb|ABA94002.1| Jacalin-like lectin domain containing protein, expressed [Oryza 
sativa Japonica Group]
Length=1386

 Score = 75.9 bits (185),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 48/73 (66%), Gaps = 1/73 (1%)
 Frame = -3

Query  450   ADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFF  271
             + E L E+SGTFG F     N++ S+ F TN + +GP+G   GTPF+   Q G +IVGFF
Sbjct  1000  SSEVLVEVSGTFGRFAGFQ-NIITSLTFVTNTQSYGPFGQREGTPFHIPVQCGGRIVGFF  1058

Query  270   GRAGFYVDAIGTY  232
             GRAG+  DAIG Y
Sbjct  1059  GRAGWCFDAIGIY  1071


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = -3

Query  453   GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
             G  E++T + GT G +   S +V+ S+   TN   +GP+G   G PF+F  Q    IVGF
Sbjct  1154  GPSEFITRVYGTIGSYNTPS-DVVTSITLVTNAGCYGPFGQENGIPFDFPVQGNGSIVGF  1212

Query  273   FGRAGFYVDAIGTY  232
             FG A  YVDAIG Y
Sbjct  1213  FGHANLYVDAIGVY  1226


 Score = 63.5 bits (153),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = -3

Query  453   GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNV-REFGPYGPNVGTPFNFQAQNGAKIVG  277
             G  E+  ++SGTFGPF +   NV+ S+ F TN   ++GP+G   GTPF+        IVG
Sbjct  1309  GPSEFFVKVSGTFGPFGEFP-NVITSLTFVTNTHHQYGPFGQGGGTPFHAPMSGNGSIVG  1367

Query  276   FFGRAGFYVDAIGTY  232
             FFGR G  ++A+G Y
Sbjct  1368  FFGREGLCIEAVGFY  1382



>gb|EEE52196.1| hypothetical protein OsJ_34075 [Oryza sativa Japonica Group]
Length=1431

 Score = 75.9 bits (185),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 48/73 (66%), Gaps = 1/73 (1%)
 Frame = -3

Query  450   ADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFF  271
             + E L E+SGTFG F     N++ S+ F TN + +GP+G   GTPF+   Q G +IVGFF
Sbjct  1045  SSEVLVEVSGTFGRFAGFQ-NIITSLTFVTNTQSYGPFGQREGTPFHIPVQCGGRIVGFF  1103

Query  270   GRAGFYVDAIGTY  232
             GRAG+  DAIG Y
Sbjct  1104  GRAGWCFDAIGIY  1116


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = -3

Query  453   GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
             G  E++T + GT G +   S +V+ S+   TN   +GP+G   G PF+F  Q    IVGF
Sbjct  1199  GPSEFITRVYGTIGSYNTPS-DVVTSITLVTNAGCYGPFGQENGIPFDFPVQGNGSIVGF  1257

Query  273   FGRAGFYVDAIGTY  232
             FG A  YVDAIG Y
Sbjct  1258  FGHANLYVDAIGVY  1271


 Score = 63.5 bits (153),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = -3

Query  453   GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNV-REFGPYGPNVGTPFNFQAQNGAKIVG  277
             G  E+  ++SGTFGPF +   NV+ S+ F TN   ++GP+G   GTPF+        IVG
Sbjct  1354  GPSEFFVKVSGTFGPFGEFP-NVITSLTFVTNTHHQYGPFGQGGGTPFHAPMSGNGSIVG  1412

Query  276   FFGRAGFYVDAIGTY  232
             FFGR G  ++A+G Y
Sbjct  1413  FFGREGLCIEAVGFY  1427



>ref|XP_009763450.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X3 [Nicotiana sylvestris]
Length=1740

 Score = 75.9 bits (185),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 56/159 (35%), Positives = 81/159 (51%), Gaps = 12/159 (8%)
 Frame = -3

Query  702  QETMEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSK  523
            Q + + +  I   P G  GG  W+++  + I +I+I  G        G I S   KT ++
Sbjct  138  QVSYDQADSILVEPWGGTGGSEWNYKLKSPIKEILIAHG--------GCIDSIMFKTITE  189

Query  522  dtltiggggtdtTVIRSDTINIDGAD-EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREF  346
               TI          R + +  +    E+LT I GT G F    Y+V++S+ FTTNV+ +
Sbjct  190  QGTTIDSPKFGGNGGRINKVVFEETPLEHLTGIKGTLGCF--DGYSVIKSLCFTTNVKNY  247

Query  345  GPYGPNVG-TPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            GP+G   G TPF+   + G  IVGF GR G Y+DAIG Y
Sbjct  248  GPFGSEGGGTPFSLVMKEGVAIVGFHGRCGAYLDAIGVY  286


 Score = 75.5 bits (184),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFGR  265
            EYLT I GTFG      Y+V++S+ F TN + +GP+G   GTPF+   + G  IVGF GR
Sbjct  35   EYLTCIKGTFG--YCGGYSVVKSLCFITNAKNYGPFGCEAGTPFSLVMKEGGAIVGFHGR  92

Query  264  AGFYVDAIGTY  232
             G Y+DAIG Y
Sbjct  93   CGAYLDAIGVY  103


 Score = 74.3 bits (181),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 54/150 (36%), Positives = 76/150 (51%), Gaps = 12/150 (8%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I  GP G  GG  W+++  + I +I+I  G        G I S   KT ++   TI    
Sbjct  353  ILVGPWGGTGGSEWNYKLKSYIKEILIAHG--------GCIDSIMFKTITEQGTTIDSPK  404

Query  495  tdtTVIRSDTINIDGAD-EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVG-  322
                  R + + I+    EYLT I GTFG +    + V++S+ F TN   +GP+G + G 
Sbjct  405  FGGNGGRINKVVIEATPLEYLTGIKGTFGCY--NGHCVIKSLCFITNANNYGPFGSDAGG  462

Query  321  TPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            TPF+   + G  IVGF G  G Y+DAIG Y
Sbjct  463  TPFSLVMKEGVAIVGFHGLCGAYLDAIGIY  492



>gb|EYU45162.1| hypothetical protein MIMGU_mgv1a025414mg, partial [Erythranthe 
guttata]
Length=333

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 83/154 (54%), Gaps = 9/154 (6%)
 Frame = -3

Query  693  MEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtl  514
            M    +I+ GP G  GG  +S++  + I QIV++       +   ++F     +GS    
Sbjct  4    MVCDGEISIGPFGGPGGTAFSYKAKHAIKQIVVVCSKNNVES---IMFK--GDSGSTSEY  58

Query  513  tiggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYG  334
            +   GG   + IR+D INID   ++LT +SGT+G         ++S+KF T + E+GP+G
Sbjct  59   SKTFGGAFNSGIRTDKINIDFPLDFLTGVSGTYG---SPGQMYMQSLKFHTKLTEYGPFG  115

Query  333  PNVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
               GT F+F+   G+ I GF GRAG  +D IG Y
Sbjct  116  NTTGTSFSFRPI-GSLITGFHGRAGGCIDCIGFY  148


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 51/87 (59%), Gaps = 3/87 (3%)
 Frame = -3

Query  483  VIRSDTINIDGADEYLTEISGTFGPF--MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFN  310
            +++   I++DG  EYL  I G  GP   +    +V+RS+ F TN  ++GP G  +GT F 
Sbjct  245  IVKKIEIDVDGG-EYLVGIEGFHGPIEGITGGVSVMRSITFHTNKFKYGPSGNEIGTFFT  303

Query  309  FQAQNGAKIVGFFGRAGFYVDAIGTYN  229
                   KIVGFFG++G Y+ AIG +N
Sbjct  304  SSKGCDGKIVGFFGKSGAYLSAIGVHN  330



>gb|EYU45843.1| hypothetical protein MIMGU_mgv1a014002mg [Erythranthe guttata]
Length=204

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 74/148 (50%), Gaps = 13/148 (9%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNK--TGSKdtltigg  502
            I  GP G NGG  W     N + +I ++       + I +++   +K  +G K     G 
Sbjct  16   IVVGPWGGNGGTNWDDGSYNGVREITVM--YGRCIDSIRIVYDKNDKPVSGDKHGGAGG-  72

Query  501  ggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVG  322
                    +   I +   DE LT ++G + P +     V+RS+ F TN R FGP+G   G
Sbjct  73   -------TKIAEIKLQFPDEILTTVTGYYSPVVHGGSPVIRSLTFKTNRRTFGPFGVEEG  125

Query  321  TPFNFQAQNGAKIVGFFGRAGFYVDAIG  238
            TPF+   + G +IVGF GR G+Y+DAIG
Sbjct  126  TPFSLPME-GGQIVGFKGRGGWYLDAIG  152



>ref|XP_009763443.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X2 [Nicotiana sylvestris]
Length=1742

 Score = 75.9 bits (185),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 56/159 (35%), Positives = 81/159 (51%), Gaps = 12/159 (8%)
 Frame = -3

Query  702  QETMEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSK  523
            Q + + +  I   P G  GG  W+++  + I +I+I  G        G I S   KT ++
Sbjct  140  QVSYDQADSILVEPWGGTGGSEWNYKLKSPIKEILIAHG--------GCIDSIMFKTITE  191

Query  522  dtltiggggtdtTVIRSDTINIDGAD-EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREF  346
               TI          R + +  +    E+LT I GT G F    Y+V++S+ FTTNV+ +
Sbjct  192  QGTTIDSPKFGGNGGRINKVVFEETPLEHLTGIKGTLGCF--DGYSVIKSLCFTTNVKNY  249

Query  345  GPYGPNVG-TPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            GP+G   G TPF+   + G  IVGF GR G Y+DAIG Y
Sbjct  250  GPFGSEGGGTPFSLVMKEGVAIVGFHGRCGAYLDAIGVY  288


 Score = 74.3 bits (181),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 54/150 (36%), Positives = 76/150 (51%), Gaps = 12/150 (8%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I  GP G  GG  W+++  + I +I+I  G        G I S   KT ++   TI    
Sbjct  355  ILVGPWGGTGGSEWNYKLKSYIKEILIAHG--------GCIDSIMFKTITEQGTTIDSPK  406

Query  495  tdtTVIRSDTINIDGAD-EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVG-  322
                  R + + I+    EYLT I GTFG +    + V++S+ F TN   +GP+G + G 
Sbjct  407  FGGNGGRINKVVIEATPLEYLTGIKGTFGCY--NGHCVIKSLCFITNANNYGPFGSDAGG  464

Query  321  TPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            TPF+   + G  IVGF G  G Y+DAIG Y
Sbjct  465  TPFSLVMKEGVAIVGFHGLCGAYLDAIGIY  494


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 41/98 (42%), Positives = 55/98 (56%), Gaps = 10/98 (10%)
 Frame = -3

Query  477  RSDTINIDGA-DEYLTEISGTF---GPFMDRSYNVLRSVKFTTNVREFGPYGP-NVGTPF  313
            R D + I  +  EYLT I GTF   G  +     V+ S+ F TN + +GP+G  + GTPF
Sbjct  23   RRDKVVIKASPSEYLTGIKGTFRGCGIHL-----VINSLCFITNAKNYGPFGSKDGGTPF  77

Query  312  NFQAQNGAKIVGFFGRAGFYVDAIGTYNA*LYGYSAAQ  199
            +F  + G  I GF GR G Y+DAIG Y   L   ++AQ
Sbjct  78   SFAMKEGGAIEGFQGRCGAYLDAIGVYLQKLTSPASAQ  115



>ref|XP_004291831.1| PREDICTED: uncharacterized protein LOC101310192 [Fragaria vesca 
subsp. vesca]
Length=642

 Score = 75.5 bits (184),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            +SD I  D  +E LT I+GTFGP M    NV++S+ F T  ++ GPYG   GT F+ Q +
Sbjct  307  KSDRIIFDYPNEILTHITGTFGPVMGMGPNVIKSMSFHTTKKKHGPYGEEQGTQFSTQLR  366

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G KIVG  GR G ++DAIG +
Sbjct  367  EG-KIVGIHGRTGLFLDAIGVH  387


 Score = 72.0 bits (175),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = -3

Query  471  DTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNG  292
            DT+ +D  +E+LT   G +G   +     LRS+ F +N R +GP+G   GT F+     G
Sbjct  72   DTVQLDYPEEFLTSFHGYYGKISEWGTVSLRSITFKSNKRSYGPFGMEQGTYFSLPVTTG  131

Query  291  AKIVGFFGRAGFYVDAIGTY  232
             KIVGF G++G+YVDAIG +
Sbjct  132  NKIVGFHGKSGWYVDAIGAH  151



>gb|EAY93469.1| hypothetical protein OsI_15270 [Oryza sativa Indica Group]
Length=150

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYG-PNVGTPFNFQAQNGAKIVG  277
            G  +++ EISGT G ++    NVLRS+K TT  R +GPYG P  G PF+F      +I G
Sbjct  72   GLMDFVMEISGTTGMWVSGMRNVLRSLKITTLKRTYGPYGNPEAGIPFSFSVDGSDRITG  131

Query  276  FFGRAGFYVDAIGTY  232
            FF RAGF  DAIG Y
Sbjct  132  FFVRAGFITDAIGVY  146



>ref|NP_001052399.1| Os04g0295400 [Oryza sativa Japonica Group]
 emb|CAD40444.2| OSJNBa0041M21.2 [Oryza sativa Japonica Group]
 dbj|BAF14313.1| Os04g0295400 [Oryza sativa Japonica Group]
Length=150

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYG-PNVGTPFNFQAQNGAKIVG  277
            G  +++ EISGT G ++    NVLRS+K TT  R +GPYG P  G PF+F      +I G
Sbjct  72   GLMDFVMEISGTTGMWVSGMSNVLRSLKITTLKRTYGPYGNPKAGIPFSFSVDGSDRITG  131

Query  276  FFGRAGFYVDAIGTY  232
            FF RAGF  DAIG Y
Sbjct  132  FFVRAGFITDAIGVY  146



>ref|XP_008244753.1| PREDICTED: agglutinin-like [Prunus mume]
Length=179

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 74/146 (51%), Gaps = 9/146 (6%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I  GP G NGG  W     N + +I ++       + I +++    K    +T    GG 
Sbjct  14   IVVGPWGGNGGADWDDGVYNGVREITLV--YGHCIDSITVVYDRNGKPVKAETHGGRGGN  71

Query  495  tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTP  316
                  ++  I +   DE+L  +SG + P +     ++RS+KF +N R FGPYG   GTP
Sbjct  72   ------QTAEIKLQYPDEFLVSVSGHYCPMVYGGGPIIRSLKFQSNRRTFGPYGIEEGTP  125

Query  315  FNFQAQNGAKIVGFFGRAGFYVDAIG  238
            F F   +G KIVG  GR G+Y+DAIG
Sbjct  126  FTFTV-DGGKIVGLKGRNGWYLDAIG  150



>ref|XP_002467725.1| hypothetical protein SORBIDRAFT_01g033090 [Sorghum bicolor]
 gb|EER94723.1| hypothetical protein SORBIDRAFT_01g033090 [Sorghum bicolor]
Length=149

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 50/81 (62%), Gaps = 1/81 (1%)
 Frame = -3

Query  474  SDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQN  295
            SD +   GA EY+TE++G+ GP  D ++ +  S+KF TN   +GP+G   GTPFN    N
Sbjct  66   SDEVITLGAHEYVTEVAGSVGPIGDLTHTI-TSLKFVTNRGTYGPFGRGDGTPFNVPVLN  124

Query  294  GAKIVGFFGRAGFYVDAIGTY  232
               +VG F RA  Y+DAIG Y
Sbjct  125  NGSVVGMFARADQYLDAIGFY  145



>gb|EMS58273.1| hypothetical protein TRIUR3_17900 [Triticum urartu]
Length=304

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -3

Query  459  IDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIV  280
            + G  E++ E SGTF  +   ++N++ S+KF TN++ +GP+G   GT F    Q  + IV
Sbjct  225  VLGTSEFVKEFSGTFSLYGRDNHNIITSLKFVTNMKTYGPFGQAKGTTFTIPVQKNSNIV  284

Query  279  GFFGRAGFYVDAIGTY  232
            GFFGR+G Y+DA+G Y
Sbjct  285  GFFGRSGIYLDALGVY  300



>ref|XP_009768640.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana sylvestris]
Length=1339

 Score = 75.5 bits (184),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 54/159 (34%), Positives = 82/159 (52%), Gaps = 12/159 (8%)
 Frame = -3

Query  702  QETMEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSK  523
            Q + + +  I   P G  GG  W++   + I +I+I  G   +     ++F +  + G+ 
Sbjct  7    QVSYDQADSILMEPRGGTGGLQWNYMLKSPIKEILITHGDCID----SIMFRTVTEQGTT  62

Query  522  dtltiggggtdtTVIRSDTINIDGAD-EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREF  346
                  GG       R D + I+    EYLT I GTFG  +  S++V++S+ F TN + +
Sbjct  63   IDSPKFGGDGG----RRDKVVIEATLLEYLTGIKGTFG--LCGSHSVIKSLCFITNAKNY  116

Query  345  GPYGPNVG-TPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            GP+G   G TPF+   + G  IVGF GR G Y+DAIG Y
Sbjct  117  GPFGSEAGGTPFSLVIREGGAIVGFHGRCGAYLDAIGVY  155



>ref|XP_009768636.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009768638.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009768639.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=1355

 Score = 75.5 bits (184),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 54/159 (34%), Positives = 82/159 (52%), Gaps = 12/159 (8%)
 Frame = -3

Query  702  QETMEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSK  523
            Q + + +  I   P G  GG  W++   + I +I+I  G   +     ++F +  + G+ 
Sbjct  23   QVSYDQADSILMEPRGGTGGLQWNYMLKSPIKEILITHGDCID----SIMFRTVTEQGTT  78

Query  522  dtltiggggtdtTVIRSDTINIDGAD-EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREF  346
                  GG       R D + I+    EYLT I GTFG  +  S++V++S+ F TN + +
Sbjct  79   IDSPKFGGDGG----RRDKVVIEATLLEYLTGIKGTFG--LCGSHSVIKSLCFITNAKNY  132

Query  345  GPYGPNVG-TPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            GP+G   G TPF+   + G  IVGF GR G Y+DAIG Y
Sbjct  133  GPFGSEAGGTPFSLVIREGGAIVGFHGRCGAYLDAIGVY  171



>emb|CDO97947.1| unnamed protein product [Coffea canephora]
Length=276

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 77/158 (49%), Gaps = 13/158 (8%)
 Frame = -3

Query  699  ETMEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNK--TGS  526
            ++ E    I  GP G NGG  W     N + +I ++     ++  +  ++    K   G 
Sbjct  81   QSGEKKKRIAVGPWGGNGGSAWDDGSYNGVREITLVHARCIDSMRV--VYDKNGKPFVGE  138

Query  525  KdtltiggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREF  346
            K     G         ++  I +   DE+LT +SG   P +     V+R++ F +N R F
Sbjct  139  KHGGVGGS--------KTSEIKLQFPDEFLTSVSGFVAPVVHGGSPVIRALTFKSNKRTF  190

Query  345  GPYGPNVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            GPYG   G PF+   + G +IVGF GR+G+Y+D++G +
Sbjct  191  GPYGVEEGAPFSLPIE-GGQIVGFKGRSGWYLDSLGCH  227



>ref|XP_002467724.1| hypothetical protein SORBIDRAFT_01g033080 [Sorghum bicolor]
 gb|EER94722.1| hypothetical protein SORBIDRAFT_01g033080 [Sorghum bicolor]
Length=153

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 51/83 (61%), Gaps = 1/83 (1%)
 Frame = -3

Query  480  IRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQA  301
            ++ +TI + G DE++TE++G  GPF +   + +  +KF TN   +GP+G   GTPFN   
Sbjct  68   LKEETITL-GPDEFVTEVAGAIGPFGELITHAVAWLKFVTNRGTYGPFGHGDGTPFNVPV  126

Query  300  QNGAKIVGFFGRAGFYVDAIGTY  232
             N   IVG F RA  Y+DAIG Y
Sbjct  127  LNNGSIVGMFARADQYLDAIGFY  149



>ref|XP_010230396.1| PREDICTED: jacalin-related lectin 3-like [Brachypodium distachyon]
 ref|XP_010230397.1| PREDICTED: jacalin-related lectin 3-like [Brachypodium distachyon]
Length=246

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 50/82 (61%), Gaps = 3/82 (4%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            +   I +D  DEYLT + G +G F    ++V+R++ F +N R  GPYG + G  F   A 
Sbjct  164  KRSEICLD-KDEYLTGVKGRYGQF--DGWSVIRALTFVSNRRTIGPYGTDEGMEFELPAA  220

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G KIVGF GR+G  VDAIGTY
Sbjct  221  GGGKIVGFHGRSGGLVDAIGTY  242



>dbj|BAK00987.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 50/81 (62%), Gaps = 4/81 (5%)
 Frame = -3

Query  474  SDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQN  295
            S TI +    E+LTE+SGT     D    V+ S++F TN++ +GP+G   GTPF F    
Sbjct  224  SSTIQL-APSEFLTEVSGTIS---DSRCEVVESIQFVTNIQTYGPFGTQDGTPFTFSVPR  279

Query  294  GAKIVGFFGRAGFYVDAIGTY  232
              K+VGFFGR G ++DAIG Y
Sbjct  280  YKKVVGFFGRGGLFLDAIGIY  300



>gb|KDP38566.1| hypothetical protein JCGZ_04491 [Jatropha curcas]
Length=545

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 79/153 (52%), Gaps = 8/153 (5%)
 Frame = -3

Query  690  EISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtlt  511
            E ++ I+ GP G   G  W     N + Q+VI  G    +    + F   +K G      
Sbjct  7    ENNSYISVGPWGGQNGVRWDDGVFNSVRQVVICHGAAIES----VQFEYIDKKGISVWSD  62

Query  510  iggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGP  331
              GG      IR++ + +D  DEYL  I G +G  +D    ++RS+ F +N R++GP+G 
Sbjct  63   KHGGTGG---IRTNKVKLDFPDEYLVTIIGHYGSVVDYGPILVRSLVFESNRRKYGPFGI  119

Query  330  NVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
             +GT F+F    G K++GF GR  +Y+D+IG Y
Sbjct  120  QMGTDFSFPL-TGGKVIGFHGRCSWYLDSIGVY  151


 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = -3

Query  480  IRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQA  301
            +R D I  D   E LT I+G +G  + R   V++S+ F TN R++GP+G   G  F+   
Sbjct  264  VRIDKIAFDYPSEILTRITGYYGSTILRGPTVVKSLTFHTNKRKYGPFGDEQGISFSSAG  323

Query  300  QNGAK-IVGFFGRAGFYVDAIGTYN  229
             N  + IVGF GR G+++D+IG ++
Sbjct  324  SNNNEMIVGFHGRKGWFIDSIGVHS  348


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 2/82 (2%)
 Frame = -3

Query  474  SDTINIDGADEYLTEISGTFGPFM-DRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            S  I ++   E LT + G +G    D    V+RS+ F TN  ++GP+G  VG+ F   A+
Sbjct  439  SHLIKLEYPYEILTSVCGYYGSLTGDDCNTVIRSLTFYTNKGKYGPFGEEVGSFFT-SAK  497

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
               KIVGF GR+G Y++AIG +
Sbjct  498  TEGKIVGFHGRSGCYLNAIGVH  519



>ref|XP_009588771.1| PREDICTED: agglutinin-like [Nicotiana tomentosiformis]
Length=345

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 77/146 (53%), Gaps = 11/146 (8%)
 Frame = -3

Query  663  PLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltiggggtdtT  484
            P G  GG  W+++  + I +IVI  G   ++    ++F +  K  +       GG     
Sbjct  17   PWGGKGGSEWNYKLKSPIKEIVIAHGSIIDS----IMFRTVTKESTIVDSPKFGGNGGG-  71

Query  483  VIRSDTINIDGAD-EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYG-PNVGTPFN  310
              R D +NI+    EYLT I GT G     S+ V++S+ F TN + +GP+G    GTPF+
Sbjct  72   --RRDKVNIEATPLEYLTGIKGTLG--HHGSHLVVKSLSFITNAKNYGPFGTEGGGTPFS  127

Query  309  FQAQNGAKIVGFFGRAGFYVDAIGTY  232
               + G  IVGF GR+G Y+DAIG Y
Sbjct  128  LVMKEGGAIVGFHGRSGLYLDAIGVY  153


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 2/79 (3%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPFMDRS-YNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGA  289
            I+IDG  E L  I G + P  D    + +R + F TN  ++GPYG  +GT F+  A  G 
Sbjct  264  IHIDGESEILVGIEGFYSPVDDNGGLDTIRQIAFYTNKGKYGPYGTEIGTYFSSSAARG-  322

Query  288  KIVGFFGRAGFYVDAIGTY  232
            KIVGF G++G +++AIG +
Sbjct  323  KIVGFHGKSGVFLNAIGVH  341



>ref|XP_009622524.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Nicotiana 
tomentosiformis]
Length=569

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  477  RSDTINIDGAD-EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQA  301
            R D + I+    EYLT I GTFG     SY+V++ + F TN + +GP+G   GTPF+   
Sbjct  23   RRDKVVIEATPLEYLTGIKGTFGRC--GSYSVIKFLCFITNAKNYGPFGCEAGTPFSLVM  80

Query  300  QNGAKIVGFFGRAGFYVDAIGTY  232
            + G  IVGF GR G Y+DAIG Y
Sbjct  81   KEGGAIVGFHGRCGAYLDAIGVY  103


 Score = 66.6 bits (161),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 46/72 (64%), Gaps = 3/72 (4%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVG-TPFNFQAQNGAKIVGFFG  268
            E+LT I GTF  F    ++V++S+ F TN   +GP+G   G TPF+   + G  IVGF G
Sbjct  424  EHLTGIKGTFECF--DGHSVIKSLCFITNANNYGPFGSEAGGTPFSLVMKEGVAIVGFHG  481

Query  267  RAGFYVDAIGTY  232
            R+G Y+DAIG Y
Sbjct  482  RSGLYLDAIGVY  493


 Score = 66.2 bits (160),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 49/83 (59%), Gaps = 3/83 (4%)
 Frame = -3

Query  477  RSDTINIDGAD-EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQA  301
            R D + I  +   YLT I GTFG +   SY+V++S+ F TN + +GP+G   GTPF+   
Sbjct  206  RRDKVVIKASPLVYLTGIKGTFGRY--GSYSVIKSLCFITNAKNYGPFGFEAGTPFSLVI  263

Query  300  QNGAKIVGFFGRAGFYVDAIGTY  232
            + G  I GF G    Y+DAIG Y
Sbjct  264  KEGGAIEGFHGHCRAYLDAIGVY  286



>ref|XP_011081586.1| PREDICTED: jacalin-related lectin 19-like [Sesamum indicum]
Length=308

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 50/82 (61%), Gaps = 2/82 (2%)
 Frame = -3

Query  483  VIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQ  304
            VIR   + +   DEYLTE+SG   P   R   ++RS+KF +N R +GP+G    TPF F 
Sbjct  19   VIRLQ-VKLQFPDEYLTEVSGHCSPLGRRGNAMVRSLKFRSNWRTYGPFGVESETPFCFP  77

Query  303  AQNGAKIVGFFGRAGFYVDAIG  238
             + G  IVGF GR G YVDAIG
Sbjct  78   MEGGM-IVGFRGRCGLYVDAIG  98


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 74/150 (49%), Gaps = 9/150 (6%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I  GP G NGG  W     + + +I ++     ++  +    +    +G K     G   
Sbjct  157  IVVGPWGGNGGTAWDDGSYSGVREITLVYARCIDSIRVVYDKNGVPVSGEKHGGVGGNT-  215

Query  495  tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTP  316
                   +  I +   +E+LT ++G   P +     V+RS+ F +N R FGP+G   G P
Sbjct  216  -------TAQIKLKFPEEFLTTVTGHCSPVVCGGSPVIRSLTFKSNRRTFGPFGVEEGVP  268

Query  315  FNFQAQNGAKIVGFFGRAGFYVDAIGTYNA  226
            F+F  + G +IVGF GRAG+Y+DAIG + A
Sbjct  269  FSFPME-GGQIVGFKGRAGWYLDAIGFHIA  297



>ref|XP_007142198.1| hypothetical protein PHAVU_008G260500g [Phaseolus vulgaris]
 gb|ESW14192.1| hypothetical protein PHAVU_008G260500g [Phaseolus vulgaris]
Length=507

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 75/152 (49%), Gaps = 9/152 (6%)
 Frame = -3

Query  687  ISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtlti  508
            I    + GP G NGG  W     + + Q+VI+ G       I  I    +K GS      
Sbjct  7    IKKPQSVGPWGGNGGSPWDDGVYSGVRQLVIVHGAG-----IDSIQIEYDKKGSSIWSEK  61

Query  507  ggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPN  328
             GG       ++D +  D   E LT+I G  G F     N++RS+ F +N + +GP+G  
Sbjct  62   HGGSGGR---KTDKVKFDYPKEILTKIHGYCGSFNQLGPNLVRSLSFESNKKTYGPFGVE  118

Query  327  VGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
             GT F+     GAKIVGF GR G+Y+DAIG Y
Sbjct  119  QGTYFSVPL-TGAKIVGFHGRCGWYIDAIGVY  149


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 43/82 (52%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            +++ I  D   E LT +SG   P M      +RS+ F TN  ++GPYG   G  F  + +
Sbjct  300  KTEKIVFDFPYEVLTHVSGYCDPLMYMGPVFIRSLTFHTNKGKYGPYGDEQGNYFTTRVK  359

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
               KIVG  GR G ++DA G +
Sbjct  360  E-EKIVGIHGRKGLFLDAFGVH  380



>ref|XP_007215056.1| hypothetical protein PRUPE_ppa012210mg [Prunus persica]
 gb|EMJ16255.1| hypothetical protein PRUPE_ppa012210mg [Prunus persica]
Length=179

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 73/146 (50%), Gaps = 9/146 (6%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I  GP G NGG  W     N + +I +        + I +++    K    +T    GG 
Sbjct  14   IEVGPWGGNGGADWDDGIYNGVREITL--AYGLCIDSITVVYDRNGKPVKAETHGGRGGD  71

Query  495  tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTP  316
                  ++  I +   DE+L  +SG + P +     ++RS+KF +N R FGPYG   GTP
Sbjct  72   ------QTAEIKLQYPDEFLVSVSGHYCPMVYGGGPIIRSLKFQSNRRTFGPYGIEEGTP  125

Query  315  FNFQAQNGAKIVGFFGRAGFYVDAIG  238
            F F   +G KIVG  GR G+Y+DAIG
Sbjct  126  FTFSV-DGGKIVGLKGRNGWYLDAIG  150



>gb|KDO84683.1| hypothetical protein CISIN_1g007083mg [Citrus sinensis]
Length=528

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 74/148 (50%), Gaps = 9/148 (6%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I  GP G   G  W       + Q+VI  G   ++  I       NK GS  +   GG G
Sbjct  11   IAVGPWGGQNGTRWDDGVHTTVRQLVIAHGAGIDSIQI----EYDNKGGSCWSEKHGGNG  66

Query  495  tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTP  316
                  + D + +D  DE+LT + G +G   DR    +RS+ F +N + +GP+G   GT 
Sbjct  67   GT----KFDQVKLDDPDEFLTSVHGHYGATNDRGSVFVRSLTFQSNRKTYGPFGVEQGTY  122

Query  315  FNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            F+F    G KIVGF GR G+Y+DAIG Y
Sbjct  123  FSF-PMTGGKIVGFHGRCGWYLDAIGIY  149


 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 72/153 (47%), Gaps = 9/153 (6%)
 Frame = -3

Query  690  EISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtlt  511
            ++   ITYGP G  GG  ++      I QI +       +  +          GSK   T
Sbjct  259  KVDGAITYGPWGGTGGSMFNDGTYTGIRQINLSRNVGIVSMKVCYDQDGKAVWGSKHGGT  318

Query  510  iggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGP  331
             G         R D +  D   E LT+I+GT+GP M    N++RS+ F T   + GP+G 
Sbjct  319  GG--------FRHDRVIFDYPYEILTQITGTYGPVMYMGPNIIRSLTFHTTKGKHGPFGE  370

Query  330  NVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
              G  F+ +   G KIVGF GR G ++DAIG Y
Sbjct  371  EQGQSFSNKIGEG-KIVGFHGRDGLFLDAIGVY  402



>ref|XP_006301377.1| hypothetical protein CARUB_v10021789mg [Capsella rubella]
 gb|EOA34275.1| hypothetical protein CARUB_v10021789mg [Capsella rubella]
Length=177

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 77/155 (50%), Gaps = 9/155 (6%)
 Frame = -3

Query  702  QETMEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSK  523
            Q+  + +  +  GP G NGG  W     + + +I ++       + I +I+    K    
Sbjct  4    QQQGDKNLTVFVGPWGGNGGTAWDDGIYDGVREIRLV--YDHCIDSITVIYDKNCKPARS  61

Query  522  dtltiggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFG  343
            +     GG       ++  I +   DEYL  +SG + P +     V+RS+ F +N + +G
Sbjct  62   EKHGGLGGN------KTSEIKLQYPDEYLIGVSGYYCPLVSSGTPVIRSMTFKSNKQVYG  115

Query  342  PYGPNVGTPFNFQAQNGAKIVGFFGRAGFYVDAIG  238
            PYG   GTPF F   NG +IVG  GR+G+Y+D+IG
Sbjct  116  PYGVEQGTPFTFSV-NGGRIVGMNGRSGWYLDSIG  149



>ref|XP_007142199.1| hypothetical protein PHAVU_008G260500g [Phaseolus vulgaris]
 gb|ESW14193.1| hypothetical protein PHAVU_008G260500g [Phaseolus vulgaris]
Length=598

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 75/152 (49%), Gaps = 9/152 (6%)
 Frame = -3

Query  687  ISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtlti  508
            I    + GP G NGG  W     + + Q+VI+ G       I  I    +K GS      
Sbjct  7    IKKPQSVGPWGGNGGSPWDDGVYSGVRQLVIVHGAG-----IDSIQIEYDKKGSSIWSEK  61

Query  507  ggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPN  328
             GG       ++D +  D   E LT+I G  G F     N++RS+ F +N + +GP+G  
Sbjct  62   HGGSGGR---KTDKVKFDYPKEILTKIHGYCGSFNQLGPNLVRSLSFESNKKTYGPFGVE  118

Query  327  VGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
             GT F+     GAKIVGF GR G+Y+DAIG Y
Sbjct  119  QGTYFSVPL-TGAKIVGFHGRCGWYIDAIGVY  149


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 43/82 (52%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            +++ I  D   E LT +SG   P M      +RS+ F TN  ++GPYG   G  F  + +
Sbjct  300  KTEKIVFDFPYEVLTHVSGYCDPLMYMGPVFIRSLTFHTNKGKYGPYGDEQGNYFTTRVK  359

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
               KIVG  GR G ++DA G +
Sbjct  360  E-EKIVGIHGRKGLFLDAFGVH  380



>ref|XP_010924945.1| PREDICTED: jacalin-related lectin 19-like isoform X1 [Elaeis 
guineensis]
Length=200

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/149 (33%), Positives = 74/149 (50%), Gaps = 9/149 (6%)
 Frame = -3

Query  684  STDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltig  505
            S  +  GP G +GG+ W     N + +I ++      +  I  I    +K G        
Sbjct  11   SKTVKVGPWGGHGGNPWDDGSYNGVREITLV-----YDRCIDSIRVLYDKNGKPVLAEKH  65

Query  504  gggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNV  325
            GG      ++   + +   +E+LT +SG + P +     V+RS+ F +N R FGP+G   
Sbjct  66   GGNGGNLTVQ---VKLHYPEEFLTCVSGHYSPVVHGGSPVIRSLTFKSNQRAFGPFGVEE  122

Query  324  GTPFNFQAQNGAKIVGFFGRAGFYVDAIG  238
            GTPF F   +G  IVGF GR G+Y+DAIG
Sbjct  123  GTPFTF-PMDGGMIVGFSGRGGWYLDAIG  150



>gb|KDO84682.1| hypothetical protein CISIN_1g007083mg [Citrus sinensis]
Length=619

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 74/148 (50%), Gaps = 9/148 (6%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I  GP G   G  W       + Q+VI  G   ++  I       NK GS  +   GG G
Sbjct  11   IAVGPWGGQNGTRWDDGVHTTVRQLVIAHGAGIDSIQI----EYDNKGGSCWSEKHGGNG  66

Query  495  tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTP  316
                  + D + +D  DE+LT + G +G   DR    +RS+ F +N + +GP+G   GT 
Sbjct  67   GT----KFDQVKLDDPDEFLTSVHGHYGATNDRGSVFVRSLTFQSNRKTYGPFGVEQGTY  122

Query  315  FNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            F+F    G KIVGF GR G+Y+DAIG Y
Sbjct  123  FSF-PMTGGKIVGFHGRCGWYLDAIGIY  149


 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 72/153 (47%), Gaps = 9/153 (6%)
 Frame = -3

Query  690  EISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtlt  511
            ++   ITYGP G  GG  ++      I QI +       +  +          GSK   T
Sbjct  259  KVDGAITYGPWGGTGGSMFNDGTYTGIRQINLSRNVGIVSMKVCYDQDGKAVWGSKHGGT  318

Query  510  iggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGP  331
             G         R D +  D   E LT+I+GT+GP M    N++RS+ F T   + GP+G 
Sbjct  319  GG--------FRHDRVIFDYPYEILTQITGTYGPVMYMGPNIIRSLTFHTTKGKHGPFGE  370

Query  330  NVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
              G  F+ +   G KIVGF GR G ++DAIG Y
Sbjct  371  EQGQSFSNKIGEG-KIVGFHGRDGLFLDAIGVY  402


 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 48/79 (61%), Gaps = 2/79 (3%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPF-MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGA  289
            I ++   E LT ISG +GP   D    V+RS+ F T+  ++GP+G  VGT F      G 
Sbjct  522  IKLEYPHEVLTCISGYYGPISKDERPKVIRSLTFYTSRGKYGPFGEEVGTFFTSTTTEG-  580

Query  288  KIVGFFGRAGFYVDAIGTY  232
            K+VGF GR+ FY+DAIG +
Sbjct  581  KVVGFHGRSSFYLDAIGVH  599



>gb|ABA94728.1| Jacalin-like lectin domain containing protein [Oryza sativa Japonica 
Group]
 gb|EAZ12138.1| hypothetical protein OsJ_02021 [Oryza sativa Japonica Group]
Length=837

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            G+ E+L  + GT GPF   S  V+ SV F TNVR +GP+G   GTPF+   Q+  KIVGF
Sbjct  761  GSSEFLVRVFGTIGPFR-ASRCVVTSVTFVTNVRSYGPFGQGGGTPFDVPMQSNGKIVGF  819

Query  273  FGRAGFYVDAIGTY  232
            FG A  YV+A+G Y
Sbjct  820  FGHARSYVEALGVY  833


 Score = 63.2 bits (152),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            G  E+L E+SGT G F +   NV+ S+   TN   +G +G   G PF    Q    IVGF
Sbjct  441  GPSEFLLEVSGTIGRFANSRSNVITSLTLVTNEDRYGHFGTERGDPFCTTLQTNCSIVGF  500

Query  273  FGRAGFYVDAIGTY  232
            F RA  Y+ AIG Y
Sbjct  501  FARASRYMHAIGVY  514



>ref|XP_010060992.1| PREDICTED: jacalin-related lectin 3 [Eucalyptus grandis]
 gb|KCW67893.1| hypothetical protein EUGRSUZ_F01603 [Eucalyptus grandis]
Length=598

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            R D I +D  DE LT I+GT GP M     ++RS+ F TN  + GP+G   G  F  +++
Sbjct  304  RHDKIVLDYPDEVLTHITGTCGPLMSMGPTIIRSIAFHTNRGKHGPFGEERGASFTSKSK  363

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G KI+GF GR G ++DAIG +
Sbjct  364  EG-KIIGFHGRGGLFIDAIGIH  384


 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 52/83 (63%), Gaps = 1/83 (1%)
 Frame = -3

Query  480  IRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQA  301
             + DT+ +D  DE+L  + G +G   D    ++RS+ F +N + +GPYG   G  F+F +
Sbjct  68   CKVDTVKLDFPDEFLISVHGHYGKINDWGPILVRSLTFESNRKTYGPYGVQQGGSFSFPS  127

Query  300  QNGAKIVGFFGRAGFYVDAIGTY  232
              G KIVGF G+AG+Y+DAIG Y
Sbjct  128  TTG-KIVGFHGKAGWYLDAIGVY  149


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 49/86 (57%), Gaps = 4/86 (5%)
 Frame = -3

Query  480  IRSDTINIDGADEYLTEISGTFGPFMDRSY---NVLRSVKFTTNVREFGPYGPNVGTPFN  310
            + +  I ++  +E LT ISG +GP     +     +RS+ F T+  ++GP+G  VGT F 
Sbjct  494  LTTHRIKLEYPNEVLTCISGYYGPVGKDEWPQPQFIRSLTFHTSRGKYGPFGEEVGTFFT  553

Query  309  FQAQNGAKIVGFFGRAGFYVDAIGTY  232
                 G K+VGF GR+  Y+DAIG +
Sbjct  554  STTTEG-KVVGFHGRSSLYLDAIGVH  578



>ref|XP_006390600.1| hypothetical protein EUTSA_v10019210mg [Eutrema salsugineum]
 gb|ESQ27886.1| hypothetical protein EUTSA_v10019210mg [Eutrema salsugineum]
Length=176

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++  I +   DEYL  +SG + P +     V+RS+ F +N + +GPYG   GTPF F   
Sbjct  71   KTSEIKLQYPDEYLIGVSGYYWPVVHSGSPVIRSITFKSNKQVYGPYGVEQGTPFTFSV-  129

Query  297  NGAKIVGFFGRAGFYVDAIG  238
            NG +IVG  GR+G+Y+D+IG
Sbjct  130  NGGRIVGINGRSGWYLDSIG  149



>ref|XP_004984089.1| PREDICTED: protein GOS9-like [Setaria italica]
Length=151

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 50/80 (63%), Gaps = 3/80 (4%)
 Frame = -3

Query  471  DTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNG  292
            + I +D A EY+TE++GT GP  D  + +  S+KF TN   +GP+G   GTPFN    N 
Sbjct  71   ENITLD-ASEYVTEVAGTIGPIGDAPHTI-SSLKFVTNRATYGPFGRGAGTPFNVPLDN-  127

Query  291  AKIVGFFGRAGFYVDAIGTY  232
            A +V  F RAG Y+DAIG Y
Sbjct  128  ASVVAMFARAGDYLDAIGFY  147



>ref|XP_010924946.1| PREDICTED: jacalin-related lectin 19-like isoform X2 [Elaeis 
guineensis]
Length=197

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/149 (33%), Positives = 74/149 (50%), Gaps = 9/149 (6%)
 Frame = -3

Query  684  STDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltig  505
            S  +  GP G +GG+ W     N + +I ++      +  I  I    +K G        
Sbjct  8    SKTVKVGPWGGHGGNPWDDGSYNGVREITLV-----YDRCIDSIRVLYDKNGKPVLAEKH  62

Query  504  gggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNV  325
            GG      ++   + +   +E+LT +SG + P +     V+RS+ F +N R FGP+G   
Sbjct  63   GGNGGNLTVQ---VKLHYPEEFLTCVSGHYSPVVHGGSPVIRSLTFKSNQRAFGPFGVEE  119

Query  324  GTPFNFQAQNGAKIVGFFGRAGFYVDAIG  238
            GTPF F   +G  IVGF GR G+Y+DAIG
Sbjct  120  GTPFTF-PMDGGMIVGFSGRGGWYLDAIG  147



>ref|XP_002439182.1| hypothetical protein SORBIDRAFT_09g001880 [Sorghum bicolor]
 gb|EES17612.1| hypothetical protein SORBIDRAFT_09g001880 [Sorghum bicolor]
Length=304

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 51/80 (64%), Gaps = 3/80 (4%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAK  286
            I++D A EY+ E+SGT+G F      VL S K  TNVR +GP+    GTPF+  A   + 
Sbjct  228  IDLDDA-EYVKEVSGTYGTF--EGITVLTSFKLVTNVRTWGPWAIENGTPFSITAPTNSS  284

Query  285  IVGFFGRAGFYVDAIGTYNA  226
            IVGF+GRAG  +DAIG Y A
Sbjct  285  IVGFYGRAGRLIDAIGVYFA  304



>ref|XP_010690084.1| PREDICTED: jacalin-related lectin 19 [Beta vulgaris subsp. vulgaris]
Length=189

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/157 (32%), Positives = 78/157 (50%), Gaps = 9/157 (6%)
 Frame = -3

Query  702  QETMEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSK  523
            +E       I  GP G NGG  W     + + +I ++       + I +++   +K G  
Sbjct  6    KEQQSAKMKIAVGPWGGNGGTSWDDGCYSGVREIKLV--YDRCIDSISVVY---DKHGKL  60

Query  522  dtltiggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFG  343
                  GG   T  +    I +   +EYL  +SG + P +     V+RS+ F +N R FG
Sbjct  61   VKSQKHGGNGGTITVE---IKLIYPEEYLISVSGYYSPVVQGMTPVVRSLSFKSNRRSFG  117

Query  342  PYGPNVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            P+G   GTPF F  + G +I+GF GR+G+Y+D+IG Y
Sbjct  118  PFGVEEGTPFYFPVE-GGRIIGFKGRSGWYLDSIGFY  153



>ref|XP_006853909.1| hypothetical protein AMTR_s00036p00182710 [Amborella trichopoda]
 gb|ERN15376.1| hypothetical protein AMTR_s00036p00182710 [Amborella trichopoda]
Length=196

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 73/145 (50%), Gaps = 9/145 (6%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I  GP G  GG  W     + ++QI ++      +  I  I    +K G        GG 
Sbjct  24   IKIGPWGGQGGSPWDDGSFDGVSQITLV-----YDRCIDSIRVEYDKNGKLVMAEKHGGD  78

Query  495  tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTP  316
                   +  I +   +E++TE+SG + P +     V+RS+KF T+ R +GPYG   GTP
Sbjct  79   GGN---HTAHIKLQYPEEFITEVSGHYCPVVHGGTPVIRSLKFITSKRTYGPYGVEEGTP  135

Query  315  FNFQAQNGAKIVGFFGRAGFYVDAI  241
            F+F   +G  IVGF GR G+Y+DAI
Sbjct  136  FSF-LMDGGLIVGFKGRNGWYLDAI  159



>ref|XP_006372713.1| hypothetical protein POPTR_0017s043602g, partial [Populus trichocarpa]
 gb|ERP50510.1| hypothetical protein POPTR_0017s043602g, partial [Populus trichocarpa]
Length=173

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 76/153 (50%), Gaps = 11/153 (7%)
 Frame = -3

Query  690  EISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtlt  511
            +I   I+ GP G  GG+ WS+     INQIVI  G          I S + +  +     
Sbjct  25   DIEGTISIGPWGGQGGNPWSYMTNQGINQIVINVGSN--------IKSISFRDTTDLDSA  76

Query  510  iggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGP  331
              GG     +    T+ I+   E+L  ISGT+G F   +   + S+ FTTN   +GP+G 
Sbjct  77   TFGGNNPNDIGERKTVLINWPSEHLISISGTYGNF--STLLTITSLSFTTNRATYGPFGT  134

Query  330  NVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
              GTPF+    N   +VGF GRAG Y+DAIG +
Sbjct  135  GSGTPFSIPINNNT-VVGFHGRAGHYLDAIGIF  166



>gb|KHG23822.1| Agglutinin alpha chain [Gossypium arboreum]
Length=183

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 74/148 (50%), Gaps = 13/148 (9%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNK--TGSKdtltigg  502
            +  GP G NGG  W     N + +I ++       + I +++    K  T  K     G 
Sbjct  16   VVVGPWGGNGGTAWDDGIYNGVREITLV--YDRCIDSIRVVYDKNGKPVTAEKHGGVGGN  73

Query  501  ggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVG  322
                    ++  I +   +E+L  ++G + P +     V+RS+ F +N R FGPYG   G
Sbjct  74   --------KTAEIKLKFPEEFLISVTGYYCPVVYGGSPVIRSLTFKSNRRTFGPYGVEEG  125

Query  321  TPFNFQAQNGAKIVGFFGRAGFYVDAIG  238
            TPF F  + GA+I GF GR+G+YVD+IG
Sbjct  126  TPFAFSVE-GARIAGFNGRSGWYVDSIG  152



>ref|XP_009622525.1| PREDICTED: agglutinin-like isoform X2 [Nicotiana tomentosiformis]
Length=546

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFGR  265
            EYLT I GTFG     SY+V++ + F TN + +GP+G   GTPF+   + G  IVGF GR
Sbjct  12   EYLTGIKGTFGRC--GSYSVIKFLCFITNAKNYGPFGCEAGTPFSLVMKEGGAIVGFHGR  69

Query  264  AGFYVDAIGTY  232
             G Y+DAIG Y
Sbjct  70   CGAYLDAIGVY  80


 Score = 66.6 bits (161),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 46/72 (64%), Gaps = 3/72 (4%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVG-TPFNFQAQNGAKIVGFFG  268
            E+LT I GTF  F    ++V++S+ F TN   +GP+G   G TPF+   + G  IVGF G
Sbjct  401  EHLTGIKGTFECF--DGHSVIKSLCFITNANNYGPFGSEAGGTPFSLVMKEGVAIVGFHG  458

Query  267  RAGFYVDAIGTY  232
            R+G Y+DAIG Y
Sbjct  459  RSGLYLDAIGVY  470


 Score = 66.6 bits (161),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 49/83 (59%), Gaps = 3/83 (4%)
 Frame = -3

Query  477  RSDTINIDGAD-EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQA  301
            R D + I  +   YLT I GTFG +   SY+V++S+ F TN + +GP+G   GTPF+   
Sbjct  183  RRDKVVIKASPLVYLTGIKGTFGRY--GSYSVIKSLCFITNAKNYGPFGFEAGTPFSLVI  240

Query  300  QNGAKIVGFFGRAGFYVDAIGTY  232
            + G  I GF G    Y+DAIG Y
Sbjct  241  KEGGAIEGFHGHCRAYLDAIGVY  263



>ref|XP_009768641.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana sylvestris]
Length=1282

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 48/72 (67%), Gaps = 3/72 (4%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVG-TPFNFQAQNGAKIVGFFG  268
            EYLT I GTFG  +  S++V++S+ F TN + +GP+G   G TPF+   + G  IVGF G
Sbjct  29   EYLTGIKGTFG--LCGSHSVIKSLCFITNAKNYGPFGSEAGGTPFSLVIREGGAIVGFHG  86

Query  267  RAGFYVDAIGTY  232
            R G Y+DAIG Y
Sbjct  87   RCGAYLDAIGVY  98



>ref|XP_002450764.1| hypothetical protein SORBIDRAFT_05g017250 [Sorghum bicolor]
 gb|EES09752.1| hypothetical protein SORBIDRAFT_05g017250 [Sorghum bicolor]
Length=1080

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = -3

Query  444   EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFGR  265
             EY+ E+SGT+G        V+ S+   TN+  +GP+G   GTPF+ +    A IVGFFGR
Sbjct  1004  EYVKEVSGTYGLCSPHPDVVITSLTLVTNLCSYGPFGQPTGTPFHTRVDKTASIVGFFGR  1063

Query  264   AGFYVDAIGTY  232
             +G Y+DAIG Y
Sbjct  1064  SGIYLDAIGVY  1074



>ref|XP_006473572.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like 
isoform X2 [Citrus sinensis]
Length=1252

 Score = 73.6 bits (179),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = -3

Query  471  DTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNG  292
            D + +D  DE+LT + G +G   DR    +RS+ F +N + +GP+G   GT F+F    G
Sbjct  704  DQVKLDYPDEFLTSVHGHYGATNDRGSVFVRSLTFQSNRKTYGPFGVEQGTYFSF-PMTG  762

Query  291  AKIVGFFGRAGFYVDAIGTY  232
             KIVGF GR G+Y+DAIG Y
Sbjct  763  GKIVGFHGRCGWYLDAIGIY  782


 Score = 67.0 bits (162),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 70/148 (47%), Gaps = 9/148 (6%)
 Frame = -3

Query  675   ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
             ITYGP G  GG  ++      I QI +       +  +          GSK   T G   
Sbjct  897   ITYGPWGGTGGSMFNDGTYTGIRQINLSRNVGIVSMKVCYDQDGKAVWGSKHGGTGG---  953

Query  495   tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTP  316
                   R D +  D   E LT+I+GT+GP M    N++RS+ F T   + GP+G   G  
Sbjct  954   -----FRHDRVIFDYPYEILTQITGTYGPVMYMGPNIIRSLTFHTTKGKHGPFGEEQGQS  1008

Query  315   FNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
             F+ +   G KIVGF GR G ++DAIG Y
Sbjct  1009  FSNKIGEG-KIVGFHGRDGLFLDAIGVY  1035


 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 48/79 (61%), Gaps = 2/79 (3%)
 Frame = -3

Query  465   INIDGADEYLTEISGTFGPF-MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGA  289
             I ++   E LT ISG +GP   D    V+RS+ F T+  ++GP+G  VGT F      G 
Sbjct  1155  IKLEFPHEVLTCISGYYGPISRDERPKVIRSLTFDTSRGKYGPFGEEVGTFFTSTTTEG-  1213

Query  288   KIVGFFGRAGFYVDAIGTY  232
             K+VGF GR+ FY+DAIG +
Sbjct  1214  KVVGFHGRSSFYLDAIGVH  1232



>ref|XP_006435072.1| hypothetical protein CICLE_v10000604mg [Citrus clementina]
 gb|ESR48312.1| hypothetical protein CICLE_v10000604mg [Citrus clementina]
Length=619

 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 74/148 (50%), Gaps = 9/148 (6%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I  GP G   G  W       + Q+VI  G   ++  I       NK GS  +   GG G
Sbjct  11   IAVGPWGGQNGTRWDDGVHTTVRQLVIAHGAGIDSIQI----EYDNKGGSCWSEKHGGNG  66

Query  495  tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTP  316
                  + D + +D  DE+LT + G +G   DR    +RS+ F +N + +GP+G   GT 
Sbjct  67   GT----KFDQVKLDYPDEFLTSVHGHYGATNDRGSVFVRSLTFQSNRKTYGPFGVEQGTY  122

Query  315  FNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            F+F    G KIVGF GR G+Y+DAIG Y
Sbjct  123  FSF-PMTGGKIVGFHGRCGWYLDAIGIY  149


 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 72/153 (47%), Gaps = 9/153 (6%)
 Frame = -3

Query  690  EISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtlt  511
            ++   ITYGP G  GG  ++      I QI +       +  +          GSK   T
Sbjct  259  KVDGAITYGPWGGTGGSMFNDGTYTGIRQINLSRNVGIVSMKVCYDQDGKAVWGSKHGGT  318

Query  510  iggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGP  331
             G         R D +  D   E LT+I+GT+GP M    N++RS+ F T   + GP+G 
Sbjct  319  GG--------FRHDRVIFDYPYEILTQITGTYGPLMYMGPNIIRSLTFHTTKGKHGPFGE  370

Query  330  NVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
              G  F+ +   G KIVGF GR G ++DAIG Y
Sbjct  371  EQGQSFSNKIGEG-KIVGFHGRDGLFLDAIGVY  402


 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 48/79 (61%), Gaps = 2/79 (3%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPF-MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGA  289
            I ++   E LT ISG +GP   D    V+RS+ F T+  ++GP+G  VGT F      G 
Sbjct  522  IKLEYPHEVLTCISGYYGPISKDERPKVIRSLTFYTSRGKYGPFGEEVGTFFTSTTTEG-  580

Query  288  KIVGFFGRAGFYVDAIGTY  232
            K+VGF GR+ FY+DAIG +
Sbjct  581  KVVGFHGRSSFYLDAIGVH  599



>ref|XP_009127966.1| PREDICTED: agglutinin [Brassica rapa]
Length=176

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 78/155 (50%), Gaps = 9/155 (6%)
 Frame = -3

Query  702  QETMEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSK  523
            Q+  + +  +  GP G NGG  W     + + +I ++       + I L++    K    
Sbjct  4    QQQGDKNLSVFVGPWGGNGGTAWDDGIYHGVREIKLV--YDHCIDSISLVYDKNGKAVRS  61

Query  522  dtltiggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFG  343
            +     GG       ++  I +   +EYL  +SG + P +     V+RS+ F +N + +G
Sbjct  62   EKHGGQGGN------KTTEIKLQYPEEYLIGVSGYYCPVVHSGTPVIRSMTFKSNKQVYG  115

Query  342  PYGPNVGTPFNFQAQNGAKIVGFFGRAGFYVDAIG  238
            PYG   GTPF+F   NG +IVG  GR+G+Y+D+IG
Sbjct  116  PYGVEQGTPFSFSV-NGGRIVGMNGRSGWYLDSIG  149



>ref|XP_006473571.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like 
isoform X1 [Citrus sinensis]
Length=619

 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 74/148 (50%), Gaps = 9/148 (6%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I  GP G   G  W       + Q+VI  G   ++  I       NK GS  +   GG G
Sbjct  11   IAVGPWGGQNGTRWDDGVHTTVRQLVIAHGAGIDSIQI----EYDNKGGSCWSEKHGGNG  66

Query  495  tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTP  316
                  + D + +D  DE+LT + G +G   DR    +RS+ F +N + +GP+G   GT 
Sbjct  67   GT----KFDQVKLDYPDEFLTSVHGHYGATNDRGSVFVRSLTFQSNRKTYGPFGVEQGTY  122

Query  315  FNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            F+F    G KIVGF GR G+Y+DAIG Y
Sbjct  123  FSF-PMTGGKIVGFHGRCGWYLDAIGIY  149


 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 72/153 (47%), Gaps = 9/153 (6%)
 Frame = -3

Query  690  EISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtlt  511
            ++   ITYGP G  GG  ++      I QI +       +  +          GSK   T
Sbjct  259  KVDGAITYGPWGGTGGSMFNDGTYTGIRQINLSRNVGIVSMKVCYDQDGKAVWGSKHGGT  318

Query  510  iggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGP  331
             G         R D +  D   E LT+I+GT+GP M    N++RS+ F T   + GP+G 
Sbjct  319  GG--------FRHDRVIFDYPYEILTQITGTYGPVMYMGPNIIRSLTFHTTKGKHGPFGE  370

Query  330  NVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
              G  F+ +   G KIVGF GR G ++DAIG Y
Sbjct  371  EQGQSFSNKIGEG-KIVGFHGRDGLFLDAIGVY  402


 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 48/79 (61%), Gaps = 2/79 (3%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPF-MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGA  289
            I ++   E LT ISG +GP   D    V+RS+ F T+  ++GP+G  VGT F      G 
Sbjct  522  IKLEFPHEVLTCISGYYGPISRDERPKVIRSLTFDTSRGKYGPFGEEVGTFFTSTTTEG-  580

Query  288  KIVGFFGRAGFYVDAIGTY  232
            K+VGF GR+ FY+DAIG +
Sbjct  581  KVVGFHGRSSFYLDAIGVH  599



>ref|XP_006426466.1| hypothetical protein CICLE_v10026553mg [Citrus clementina]
 ref|XP_006466099.1| PREDICTED: agglutinin-like [Citrus sinensis]
 gb|ESR39706.1| hypothetical protein CICLE_v10026553mg [Citrus clementina]
Length=190

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            R+  I +   +E+L  +SG + P +     V+RS+ F +N R FGP+G   GTPF F + 
Sbjct  73   RTAEIKLRFPEEFLISVSGHYCPVVYGGSPVIRSLTFKSNKRTFGPFGVEEGTPFTF-SM  131

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
            +G  +VGF GR+G+YVDAIG Y
Sbjct  132  DGGLVVGFKGRSGWYVDAIGFY  153



>ref|XP_011074623.1| PREDICTED: jacalin-related lectin 3 [Sesamum indicum]
Length=670

 Score = 72.8 bits (177),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++D + ++  DE+L  + G +G   +R + ++RS+ F +N R++GP+G   GT F     
Sbjct  69   KTDKVRLEYPDEFLISVHGYYGSLQERGHVIIRSLTFESNKRKYGPFGVEKGTYFTSSTT  128

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
            +G KIVGF G+AG+Y+DAIG Y
Sbjct  129  HG-KIVGFVGKAGWYLDAIGFY  149


 Score = 66.2 bits (160),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 46/155 (30%), Positives = 73/155 (47%), Gaps = 22/155 (14%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWS------FRPMNKINQIVILSggpgnnnPIGLIFSSTNK-TGSKdt  517
            +TYGP G +GG  +        R +N    + ++S     +     ++ S N  TGS   
Sbjct  255  VTYGPWGGSGGSLFDDGVYDGIRQINVYRNVGVVSIRVCYDKDGKAVWGSKNGGTGS---  311

Query  516  ltiggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPY  337
                         +SD I  D   E LT ++G   P M    +V++S+ F T   ++GPY
Sbjct  312  ------------FKSDKIVFDYPSEILTHLTGYHAPTMIMGPDVIKSLTFHTTKGKYGPY  359

Query  336  GPNVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            G   G  F+ + + G+ +VGF GR G +VDA+G +
Sbjct  360  GEEQGEFFSTKLKEGSMVVGFHGRKGLFVDAVGVH  394


 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 50/82 (61%), Gaps = 2/82 (2%)
 Frame = -3

Query  474  SDTINIDGADEYLTEISGTFGPFM-DRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            +D + +D   E LT +SG +GP   ++   V++S+ F T+ R +GP+G  +GT F     
Sbjct  569  ADRVKLDYPHEVLTCVSGYYGPIKKEQGTKVIQSLTFHTSRRTYGPFGQELGTYFASGTT  628

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G K+VGF GR+  Y+DAIG +
Sbjct  629  EG-KVVGFHGRSSMYLDAIGVH  649



>ref|XP_009391787.1| PREDICTED: agglutinin-like [Musa acuminata subsp. malaccensis]
Length=256

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  474  SDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQN  295
            S+ +  D  DEYL  +SG +G  +   Y V++S+ F TN R +GP+G   G PF   A  
Sbjct  177  SEVVLDDERDEYLACLSGRYG--ICGGYLVIKSLTFATNKRTYGPFGVEDGAPFKLDA-G  233

Query  294  GAKIVGFFGRAGFYVDAIGTYNA  226
            G +IVGFF RAG ++DAIG Y A
Sbjct  234  GQRIVGFFARAGQFLDAIGVYTA  256



>ref|XP_002888904.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65163.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=176

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 72/143 (50%), Gaps = 9/143 (6%)
 Frame = -3

Query  666  GPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltiggggtdt  487
            GP G NGG  W     + + +I ++       + I +I+    K    +     GG    
Sbjct  16   GPWGRNGGTTWDDGIYHGVREIRLV--YDHCIDSISVIYDKNGKPAKSEKHGGVGGN---  70

Query  486  TVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNF  307
               ++  + +   DEYLT +SG +   +D    V+RS+ F +N + +GPYG   GTPF F
Sbjct  71   ---KTAELKLQYPDEYLTGVSGYYSIVVDSGTPVIRSMTFKSNKQVYGPYGVEQGTPFTF  127

Query  306  QAQNGAKIVGFFGRAGFYVDAIG  238
               NG +IVG   R+G+Y+D+IG
Sbjct  128  SV-NGGRIVGMSSRSGWYLDSIG  149



>gb|EMT07650.1| Horcolin [Aegilops tauschii]
Length=320

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 2/72 (3%)
 Frame = -3

Query  447  DEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFG  268
            DEYLT + G +G F D    V+RS+   +N+R +G YG   G PF   A  G KI+GF  
Sbjct  245  DEYLTSVHGHYGQFKDTV--VIRSLTLVSNLRSYGSYGKEDGVPFALHAGPGGKIIGFHA  302

Query  267  RAGFYVDAIGTY  232
            R+G ++DAIGTY
Sbjct  303  RSGQFLDAIGTY  314



>gb|KCW69704.1| hypothetical protein EUGRSUZ_F03098 [Eucalyptus grandis]
 gb|KCW69705.1| hypothetical protein EUGRSUZ_F03098 [Eucalyptus grandis]
Length=230

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 73/146 (50%), Gaps = 10/146 (7%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I  GP G NGG  W     + + +I ++       + I  I +  +K G        GG 
Sbjct  53   IEVGPWGGNGGISWDDGSYHGVREITLV-----FGHCIDSICAVYDKNGKPVAAEKHGGH  107

Query  495  tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTP  316
                  +S  I +   DEYL  +SG   P +     V+RS+ F +N R FGP+G   GTP
Sbjct  108  GGD---QSAEIKLQFPDEYLVSVSGYHCPVVHGGSPVIRSLTFKSNKRTFGPFGMEHGTP  164

Query  315  FNFQAQNGAKIVGFFGRAGFYVDAIG  238
            F+F +    +IVGF GR+G+Y+D+IG
Sbjct  165  FSFPSD--GRIVGFKGRSGWYLDSIG  188



>ref|XP_008244775.1| PREDICTED: LOW QUALITY PROTEIN: agglutinin-like [Prunus mume]
Length=343

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFM-DRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQA  301
            ++D I +   DE+L  +SG + P M      ++RS+KF +N R FGPYG   GTPF F  
Sbjct  235  QTDEIKLQYPDEFLVGVSGHYCPMMFGIGPRLIRSLKFQSNRRTFGPYGIEEGTPFTFTV  294

Query  300  QNGAKIVGFFGRAGFYVDAIG  238
             +G KIVG  GR+G+Y+DAIG
Sbjct  295  -DGGKIVGLKGRSGWYLDAIG  314


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 47/77 (61%), Gaps = 2/77 (3%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPFM-DRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGA  289
            I +   DEYL   SG + P M      ++RS+KF +N R FGPYG   GTPF F   +G 
Sbjct  83   IKLQYPDEYLVGASGHYCPMMFGIGPRLIRSLKFQSNRRTFGPYGIEEGTPFTFTV-DGG  141

Query  288  KIVGFFGRAGFYVDAIG  238
            +IVG  GR G+Y++AIG
Sbjct  142  QIVGLKGRDGWYLNAIG  158



>ref|XP_008806706.1| PREDICTED: agglutinin-like isoform X1 [Phoenix dactylifera]
Length=200

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAK  286
            + +   +E+LT +SG + P +     V+RS+ F +N R FGP+G   GTPF F   +G  
Sbjct  76   VKLQYPEEFLTSVSGHYSPVVRGGSPVIRSLTFKSNERAFGPFGVEEGTPFTF-PMDGGM  134

Query  285  IVGFFGRAGFYVDAIG  238
            IVGF GR+G+Y+DAIG
Sbjct  135  IVGFSGRSGWYLDAIG  150



>ref|XP_008806712.1| PREDICTED: agglutinin-like isoform X2 [Phoenix dactylifera]
Length=197

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAK  286
            + +   +E+LT +SG + P +     V+RS+ F +N R FGP+G   GTPF F   +G  
Sbjct  73   VKLQYPEEFLTSVSGHYSPVVRGGSPVIRSLTFKSNERAFGPFGVEEGTPFTF-PMDGGM  131

Query  285  IVGFFGRAGFYVDAIG  238
            IVGF GR+G+Y+DAIG
Sbjct  132  IVGFSGRSGWYLDAIG  147



>gb|AAB72098.1| 32 kDa protein [Hordeum vulgare subsp. vulgare]
Length=306

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            GA E++ E+SGTFG +    +N++ S+KF TNV+ +GP+G   GTPF    Q  + IVGF
Sbjct  227  GASEFVKEVSGTFGIYDKDLHNIITSLKFITNVKTYGPFGEAKGTPFTIAVQKNSSIVGF  286

Query  273  FGRAGFYV  250
            F R G+ +
Sbjct  287  FARTGYIL  294



>ref|XP_003577374.2| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Brachypodium 
distachyon]
Length=588

 Score = 72.4 bits (176),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFGR  265
            E+LT +SGT GP+      V++S+ F T    +GP+G   GTPF    Q+   IVGFF R
Sbjct  191  EFLTVVSGTIGPYDSAPAGVIKSLTFITTAGRYGPFGEEKGTPFQIPVQSNGSIVGFFAR  250

Query  264  AGFYVDAIGTY  232
            AG+Y+DA G Y
Sbjct  251  AGWYLDAFGIY  261


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 74/159 (47%), Gaps = 9/159 (6%)
 Frame = -3

Query  702  QETMEISTDITYGPLGHNGGDFWSFR-PMNKINQIVILSggpgnnnPIGLIFSSTNKTGS  526
            QET E       GP G NGG     + P  ++  + I SG   N+    L F      G 
Sbjct  266  QETEEAGL-AKIGPWGGNGGQVRDLKMPPQRLESVTICSGTVLNS----LTFIYHGHDGK  320

Query  525  KdtltiggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVL-RSVKFTTNVRE  349
            K T    G  T     ++DTI +  + E+LT + GT GPF   S +V+  S+   TN   
Sbjct  321  KHTAGPWGASTGNP-DQTDTILL-CSSEFLTGVRGTTGPFDPASSDVIVTSLTLITNTHS  378

Query  348  FGPYGPNVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            +GP+G   GT F         IVGFFG +  Y++AIG Y
Sbjct  379  YGPFGQGRGTSFQIPLWGKGSIVGFFGCSESYINAIGVY  417


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 44/76 (58%), Gaps = 3/76 (4%)
 Frame = -3

Query  450  ADEYLTEISGTFGPFMDRSYNVLRSVKFTTN-VREFGPYGPNVGTPFNFQAQNG--AKIV  280
            + E L  +SGT G     S N++ S+ F T+  R +GP+G   GTPF+  A  G    +V
Sbjct  509  SSEVLQGVSGTVGSSDGTSSNLVTSLTFATDQARAYGPFGAGGGTPFSAAAAAGNDGPVV  568

Query  279  GFFGRAGFYVDAIGTY  232
             FFGRAG  ++A+G Y
Sbjct  569  AFFGRAGLCLEALGVY  584



>pdb|4MQ0|A Chain A, Crystal Structure Of Parkia Biglobosa Seed Lectin (pbl) 
In Complex With Methyl Alpha D-mannopyranoside
Length=446

 Score = 72.4 bits (176),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 77/154 (50%), Gaps = 10/154 (6%)
 Frame = -3

Query  690  EISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtlt  511
            ++   I+ GP G +GGD WS+     INQI+I +G          I S   K  S     
Sbjct  295  DVEGSISIGPWGGSGGDPWSYTANEGINQIIIYAGSN--------IKSIAFKDTSGLDSA  346

Query  510  iggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRS-YNVLRSVKFTTNVREFGPYG  334
              GG         +T++I    EYLT I GT+G +  +  +  + S+ FTTN+  +GP+G
Sbjct  347  TFGGVNPKDTGEKNTVSIKWPSEYLTSIDGTYGQYKFKDVFTTVTSLSFTTNLATYGPFG  406

Query  333  PNVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
                T F+    N   +VGF GRAG Y+DAIG +
Sbjct  407  KASLTSFSIPIHNNM-VVGFHGRAGDYLDAIGIF  439


 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 52/80 (65%), Gaps = 3/80 (4%)
 Frame = -3

Query  471  DTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNG  292
            + + IDG  E+LT ISGT+G +  + + VL S+ F TNV + GP+G   GT F+ +   G
Sbjct  214  EKVEIDGNLEHLTSISGTYGNY--KGFEVLTSLSFITNVTKHGPFGIASGTSFS-RPIEG  270

Query  291  AKIVGFFGRAGFYVDAIGTY  232
            + + GF G+ G+Y+D+IG Y
Sbjct  271  SLVTGFHGKGGYYLDSIGIY  290


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 72/149 (48%), Gaps = 10/149 (7%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I+ GP G +GGD WSF+  + I +I+I       +       S  +  G       G   
Sbjct  6    ISVGPWGGSGGDHWSFKANHAITEILIHVKDNIKS------ISFKDAGGDISGTFGGKDP  59

Query  495  tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVG-T  319
             +        I I    EYL  ISG++G +      V+RS+ F TN+  +GP+G   G  
Sbjct  60   RENKKGEEKKIGIRWPTEYLKSISGSYGDY--NGILVIRSLSFITNLTTYGPFGSTSGGE  117

Query  318  PFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
             F+    + + +VGF GRAG+Y+DA+G +
Sbjct  118  SFSIPIAD-SVVVGFHGRAGYYLDALGIF  145



>gb|EEC72970.1| hypothetical protein OsI_06866 [Oryza sativa Indica Group]
Length=1072

 Score = 72.8 bits (177),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = -3

Query  444   EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFGR  265
             E+L E+ GT GPF   S   + S+   TNVR +GP+G   GTPF    +  + IVGFFGR
Sbjct  999   EFLMEVIGTVGPFNVLS-EAITSLTLVTNVRSYGPFGQPQGTPFRTPRKKNSCIVGFFGR  1057

Query  264   AGFYVDAIGTY  232
             +G Y+DA+G Y
Sbjct  1058  SGTYLDAVGVY  1068



>dbj|BAD23250.1| putative LZ-NBS-LRR class RGA [Oryza sativa Japonica Group]
 dbj|BAD23344.1| putative LZ-NBS-LRR class RGA [Oryza sativa Japonica Group]
 gb|EAZ22703.1| hypothetical protein OsJ_06375 [Oryza sativa Japonica Group]
Length=1072

 Score = 72.8 bits (177),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = -3

Query  444   EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFGR  265
             E+L E+ GT GPF   S   + S+   TNVR +GP+G   GTPF    +  + IVGFFGR
Sbjct  999   EFLMEVIGTVGPFNVLS-EAITSLTLVTNVRSYGPFGQPQGTPFRTPRKKNSCIVGFFGR  1057

Query  264   AGFYVDAIGTY  232
             +G Y+DA+G Y
Sbjct  1058  SGTYLDAVGVY  1068



>ref|XP_006663456.1| PREDICTED: disease resistance protein RPM1-like [Oryza brachyantha]
Length=1102

 Score = 72.8 bits (177),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 31/71 (44%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = -3

Query  444   EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFGR  265
             E++ E+SGT+GPF     +V+ S++  TN+R +GP+G   GT F  + +    IVGFFG 
Sbjct  1030  EFVKEVSGTYGPFFSFP-SVITSLQLRTNIRSYGPFGEPKGTTFRTRVKQNGSIVGFFGH  1088

Query  264   AGFYVDAIGTY  232
             +  Y+DAIG Y
Sbjct  1089  STVYIDAIGVY  1099



>ref|XP_010237569.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Brachypodium 
distachyon]
Length=690

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFGR  265
            E+LT +SGT GP+      V++S+ F T    +GP+G   GTPF    Q+   IVGFF R
Sbjct  293  EFLTVVSGTIGPYDSAPAGVIKSLTFITTAGRYGPFGEEKGTPFQIPVQSNGSIVGFFAR  352

Query  264  AGFYVDAIGTY  232
            AG+Y+DA G Y
Sbjct  353  AGWYLDAFGIY  363


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 74/159 (47%), Gaps = 9/159 (6%)
 Frame = -3

Query  702  QETMEISTDITYGPLGHNGGDFWSFR-PMNKINQIVILSggpgnnnPIGLIFSSTNKTGS  526
            QET E       GP G NGG     + P  ++  + I SG   N+    L F      G 
Sbjct  368  QETEEAGL-AKIGPWGGNGGQVRDLKMPPQRLESVTICSGTVLNS----LTFIYHGHDGK  422

Query  525  KdtltiggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVL-RSVKFTTNVRE  349
            K T    G  T     ++DTI +  + E+LT + GT GPF   S +V+  S+   TN   
Sbjct  423  KHTAGPWGASTGNP-DQTDTILL-CSSEFLTGVRGTTGPFDPASSDVIVTSLTLITNTHS  480

Query  348  FGPYGPNVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            +GP+G   GT F         IVGFFG +  Y++AIG Y
Sbjct  481  YGPFGQGRGTSFQIPLWGKGSIVGFFGCSESYINAIGVY  519


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 44/76 (58%), Gaps = 3/76 (4%)
 Frame = -3

Query  450  ADEYLTEISGTFGPFMDRSYNVLRSVKFTTN-VREFGPYGPNVGTPFNFQAQNG--AKIV  280
            + E L  +SGT G     S N++ S+ F T+  R +GP+G   GTPF+  A  G    +V
Sbjct  611  SSEVLQGVSGTVGSSDGTSSNLVTSLTFATDQARAYGPFGAGGGTPFSAAAAAGNDGPVV  670

Query  279  GFFGRAGFYVDAIGTY  232
             FFGRAG  ++A+G Y
Sbjct  671  AFFGRAGLCLEALGVY  686



>ref|XP_004986922.1| PREDICTED: horcolin-like [Setaria italica]
Length=132

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFGR  265
            E+LTE+SGTF     +  + + S+ F TN+R+ GP+G   GTPF+   ++G +IV  FGR
Sbjct  55   EFLTEVSGTFAYIGTQPTDAVTSLTFVTNLRKHGPFGDVDGTPFSVPVRDGGRIVALFGR  114

Query  264  AGFYVDAIGTY  232
               Y+DAIG Y
Sbjct  115  GWDYIDAIGVY  125



>gb|EAY80990.1| hypothetical protein OsI_36172 [Oryza sativa Indica Group]
Length=1081

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = -3

Query  444   EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFGR  265
             E +TE+SGT GPF  +  +V+ S++  TN+R +GP+G   GT F  + +    IVGFFGR
Sbjct  1009  EIVTEVSGTCGPF-SQFPSVVTSLQLVTNLRSYGPFGQAKGTKFRTRVKQNGSIVGFFGR  1067

Query  264   AGFYVDAIGTY  232
             +  Y+DAIG Y
Sbjct  1068  STIYLDAIGVY  1078



>gb|KHG26998.1| Agglutinin [Gossypium arboreum]
Length=600

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 75/156 (48%), Gaps = 11/156 (7%)
 Frame = -3

Query  696  TMEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdt  517
            T +    ++ GP G  GG  W       I Q+VI  G   ++  I        +  +K  
Sbjct  3    TEDDKKPVSVGPWGGQGGTSWDDGVYCTIRQLVIAHGSGIDSVQI--------EYDTKGN  54

Query  516  ltiggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPY  337
                         ++D + +D  DE+LT I G +G    R   ++RS+ F +N + +GP+
Sbjct  55   SLWSRKHGGNGGSKTDKVKLDFPDEFLTSIHGYYGSLNQRGPIIVRSLTFHSNRKAYGPF  114

Query  336  GPNVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTYN  229
            G   GT F+    N  KIVGF GR+G+Y+DAIG Y+
Sbjct  115  GIEQGTSFSM---NKGKIVGFRGRSGWYLDAIGVYS  147


 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 69/148 (47%), Gaps = 9/148 (6%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            +TYGP G  GG  +       I QIV+       +  +          GSK   T G   
Sbjct  245  LTYGPWGGQGGTKFDDGTYTGIRQIVLSRNVGIVSLKVCYDREGQAVWGSKHGGTGG---  301

Query  495  tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTP  316
                  +++ I  D   E LT I+GTF P M    NV+RS+ F TN  + GPYG   G  
Sbjct  302  -----FKTERIMFDYPSEILTHITGTFAPLMYMGPNVIRSLTFYTNKGKHGPYGDEQGPS  356

Query  315  FNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            F  +   G KIVGF GR G ++DA+G +
Sbjct  357  FTNKMNEG-KIVGFLGREGLFLDAVGVH  383


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 45/79 (57%), Gaps = 2/79 (3%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPFMDRS-YNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGA  289
            + +D   E L  ISG +G   D   + V+RS+ F T+  ++GP+G  VGT F      G 
Sbjct  503  VKLDYPHEVLICISGYYGSINDEEKFKVIRSLTFYTSRGKYGPFGEEVGTYFTSTTTQG-  561

Query  288  KIVGFFGRAGFYVDAIGTY  232
            K+VGF GR   Y+DAIG +
Sbjct  562  KVVGFHGRCSSYLDAIGVH  580



>ref|XP_008221341.1| PREDICTED: uncharacterized protein LOC103321320 [Prunus mume]
Length=622

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            +SD I  D  +E LT I+GTFG  M    NV++S+ F T  ++ GPYG   GTPF  + +
Sbjct  312  KSDKIVFDFPNEILTHITGTFGAAMMMGPNVIKSLTFHTTKKKHGPYGEEQGTPFTTKLR  371

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G KIVG  GR G ++DA+G +
Sbjct  372  EG-KIVGIHGRKGLFLDALGVH  392


 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 54/84 (64%), Gaps = 2/84 (2%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++DT+ +   +E+LT I G +G   +     +RS+KF +N + +GP+G   GT F+  A 
Sbjct  71   KTDTVKLAYPEEFLTSIEGHYGKISEWGPVSIRSLKFKSNKKTYGPFGIEQGTYFSLPAA  130

Query  297  NG--AKIVGFFGRAGFYVDAIGTY  232
                +KIVGFFG++G+++D+IG Y
Sbjct  131  RAGSSKIVGFFGKSGWFLDSIGAY  154



>ref|XP_011001798.1| PREDICTED: mannose/glucose-specific lectin-like isoform X3 [Populus 
euphratica]
Length=445

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 78/154 (51%), Gaps = 13/154 (8%)
 Frame = -3

Query  690  EISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGL-IFSSTNKTGSKdtl  514
            +I   I+ GP G  GG+ WS+     INQIVI          +GL I S + +  +    
Sbjct  297  DIEGTISIGPWGGQGGNPWSYITNRGINQIVI---------NVGLNIKSISFRDTTDLDS  347

Query  513  tiggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYG  334
               GG     +    T+ I+   E+L  ISGT+G F   +   + S+ FTTN   +GP+G
Sbjct  348  ATFGGNNPNDIGERKTVLINWPSEHLISISGTYGNF--STLLTITSLSFTTNRATYGPFG  405

Query  333  PNVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
               GTPF+    N   +VGF GRAG Y+DAIG +
Sbjct  406  TGSGTPFSIPINNNT-VVGFHGRAGHYLDAIGIF  438


 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 75/150 (50%), Gaps = 13/150 (9%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I+ GP G  GGD WS+R    I +IV+           G I S + K  S       GG 
Sbjct  8    ISLGPWGGLGGDHWSYRASGGITEIVLRVE--------GNIKSISFKDASGLVSGTFGGR  59

Query  495  tdtTVIRSD--TINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVG  322
             +    R +   I I    EYL  ISGT+G +  +   V+ S+ F TN+  +GP+G  +G
Sbjct  60   GNDPNDRGEQKKIEIQWPSEYLKSISGTYGSY--KGLLVITSLSFITNLTTYGPFGTALG  117

Query  321  TPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
              F+    + A +VGF GR G+Y+DA+G +
Sbjct  118  ETFSIPIADSA-VVGFHGRCGYYLDALGIF  146


 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 74/148 (50%), Gaps = 11/148 (7%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I+ G  G  GGD +SFR  + I +I++  G          I S + K G+       GG 
Sbjct  156  ISVGQWGGPGGDPFSFRVGSWIKEIIVHEGTN--------IKSLSFKDGNGQEYGNFGGN  207

Query  495  tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTP  316
                      I IDG  E+LT I+GT+G +      V+ S+ F TN+   GP+G   GT 
Sbjct  208  NANDTGEERRIEIDGLSEHLTSITGTYGNYAGMV--VITSLSFITNLTTHGPFGTATGTS  265

Query  315  FNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            F+   + G+ ++GF GR G Y+DAIG +
Sbjct  266  FSIPIE-GSVVIGFHGRGGHYLDAIGIH  292



>ref|XP_010533565.1| PREDICTED: jacalin-related lectin 3 isoform X1 [Tarenaya hassleriana]
Length=601

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 60/94 (64%), Gaps = 1/94 (1%)
 Frame = -3

Query  471  DTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNG  292
            D + ++  DEYLT + GT+G F       +RS+ F +N R++GP+G   GT F+   ++ 
Sbjct  74   DKVKLEYPDEYLTSVHGTYGSFDVWGTLCVRSLTFESNRRKYGPFGSESGTYFSL-PKSE  132

Query  291  AKIVGFFGRAGFYVDAIGTYNA*LYGYSAAQCSL  190
            AKIVGF G+ G+Y+DAIG +   L+  ++++ +L
Sbjct  133  AKIVGFHGKTGWYLDAIGVHIQPLHKENSSKIAL  166


 Score = 66.6 bits (161),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 53/100 (53%), Gaps = 10/100 (10%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            + D +  D   E LT I+GT+G  M    NV+RS+ F TN  + GPYG   G  F  +  
Sbjct  302  KHDKVVFDFPSEVLTRITGTYGSLMYMGPNVIRSLTFYTNKGKHGPYGEEQGPSFTNKIG  361

Query  297  NGAKIVGFFGRAGFYVDAIGTYNA*LYGYSAAQCSLGTPL  178
             G KIVGF GR G ++DAIG +          +C + TPL
Sbjct  362  EG-KIVGFLGREGLFLDAIGVH--------VHECKI-TPL  391


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = -3

Query  480  IRSDTINIDGADEYLTEISGTFGPFMDR-SYNVLRSVKFTTNVREFGPYGPNVGTPFNFQ  304
            + +  I ++   E LT +SG +GP  +  +  V++SV F T+  ++GPYG   GT +   
Sbjct  500  VATHRIKLECPHEVLTCLSGYYGPVSNSDTTKVVKSVSFYTSRGKYGPYGEENGTYYTST  559

Query  303  AQNGAKIVGFFGRAGFYVDAIGTY  232
               G K+VGF GR+  Y+DAIG +
Sbjct  560  KTEG-KVVGFHGRSSSYLDAIGVH  582



>ref|XP_011001797.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Populus 
euphratica]
Length=445

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 78/154 (51%), Gaps = 13/154 (8%)
 Frame = -3

Query  690  EISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGL-IFSSTNKTGSKdtl  514
            +I   I+ GP G  GG+ WS+     INQIVI          +GL I S + +  +    
Sbjct  297  DIEGTISIGPWGGQGGNPWSYITNRGINQIVI---------NVGLNIKSISFRDTTDLDS  347

Query  513  tiggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYG  334
               GG     +    T+ I+   E+L  ISGT+G F   +   + S+ FTTN   +GP+G
Sbjct  348  ATFGGNNPNDIGERKTVLINWPSEHLISISGTYGNF--STLLTITSLSFTTNRATYGPFG  405

Query  333  PNVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
               GTPF+    N   +VGF GRAG Y+DAIG +
Sbjct  406  TGSGTPFSIPINNNT-VVGFHGRAGHYLDAIGIF  438


 Score = 69.3 bits (168),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 76/150 (51%), Gaps = 13/150 (9%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I+ GP G  GGD WS+R    I +IV+          +G I S + K  S       GG 
Sbjct  8    ISLGPWGGLGGDHWSYRASGGITEIVL--------RVVGNIKSISFKDASGLVSGTFGGR  59

Query  495  tdtTVIRSD--TINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVG  322
             +    R +   I I    EYL  ISGT+G +  +   V+ S+ F TN+  +GP+G  +G
Sbjct  60   GNDPNDRGEQKKIEIQWPSEYLKSISGTYGSY--KGLLVITSLSFITNLTTYGPFGTALG  117

Query  321  TPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
              F+    + A +VGF GR G+Y+DA+G +
Sbjct  118  ETFSIPIADSA-VVGFHGRCGYYLDALGIF  146


 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 74/148 (50%), Gaps = 11/148 (7%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I+ G  G  GGD +SFR  + I +I++  G          I S + K G+       GG 
Sbjct  156  ISVGQWGGPGGDPFSFRVGSWIKEIIVHEGTN--------IKSLSFKDGNGQEYGKFGGK  207

Query  495  tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTP  316
                      I IDG  E+LT I+GT+G +      V+ S+ F TN+   GP+G   GT 
Sbjct  208  NANDTGEERRIEIDGLSEHLTSITGTYGNYAGMV--VITSLSFITNLTTHGPFGTATGTS  265

Query  315  FNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            F+   + G+ ++GF GR G Y+DAIG +
Sbjct  266  FSIPIE-GSVVIGFHGRGGHYLDAIGIH  292



>gb|KFK41744.1| hypothetical protein AALP_AA2G166700 [Arabis alpina]
Length=176

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++  I +   +EYL  +SG + P +     V+RS+ F +N + +GPYG   GTPF F   
Sbjct  71   KTSEIKLQYPEEYLIGVSGYYCPVIHSGTPVIRSMTFKSNKQVYGPYGIEQGTPFTFSV-  129

Query  297  NGAKIVGFFGRAGFYVDAIG  238
            NG +IVG  GR+G+Y+D+IG
Sbjct  130  NGGRIVGMNGRSGWYLDSIG  149



>ref|XP_010533571.1| PREDICTED: jacalin-related lectin 3 isoform X2 [Tarenaya hassleriana]
Length=598

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 60/94 (64%), Gaps = 1/94 (1%)
 Frame = -3

Query  471  DTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNG  292
            D + ++  DEYLT + GT+G F       +RS+ F +N R++GP+G   GT F+   ++ 
Sbjct  71   DKVKLEYPDEYLTSVHGTYGSFDVWGTLCVRSLTFESNRRKYGPFGSESGTYFSL-PKSE  129

Query  291  AKIVGFFGRAGFYVDAIGTYNA*LYGYSAAQCSL  190
            AKIVGF G+ G+Y+DAIG +   L+  ++++ +L
Sbjct  130  AKIVGFHGKTGWYLDAIGVHIQPLHKENSSKIAL  163


 Score = 66.6 bits (161),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 53/100 (53%), Gaps = 10/100 (10%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            + D +  D   E LT I+GT+G  M    NV+RS+ F TN  + GPYG   G  F  +  
Sbjct  299  KHDKVVFDFPSEVLTRITGTYGSLMYMGPNVIRSLTFYTNKGKHGPYGEEQGPSFTNKIG  358

Query  297  NGAKIVGFFGRAGFYVDAIGTYNA*LYGYSAAQCSLGTPL  178
             G KIVGF GR G ++DAIG +          +C + TPL
Sbjct  359  EG-KIVGFLGREGLFLDAIGVH--------VHECKI-TPL  388


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = -3

Query  480  IRSDTINIDGADEYLTEISGTFGPFMDR-SYNVLRSVKFTTNVREFGPYGPNVGTPFNFQ  304
            + +  I ++   E LT +SG +GP  +  +  V++SV F T+  ++GPYG   GT +   
Sbjct  497  VATHRIKLECPHEVLTCLSGYYGPVSNSDTTKVVKSVSFYTSRGKYGPYGEENGTYYTST  556

Query  303  AQNGAKIVGFFGRAGFYVDAIGTY  232
               G K+VGF GR+  Y+DAIG +
Sbjct  557  KTEG-KVVGFHGRSSSYLDAIGVH  579



>emb|CAE76026.1| B1292H11.12 [Oryza sativa Japonica Group]
 gb|EAZ29534.1| hypothetical protein OsJ_13607 [Oryza sativa Japonica Group]
Length=183

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 47/78 (60%), Gaps = 5/78 (6%)
 Frame = -3

Query  450  ADEYLTEISGTFGPFMDRSYNVLRSVKFTTNV-REFGPYG----PNVGTPFNFQAQNGAK  286
            ADE +T + GT G F D    V+ S+ F TN  + +GPYG       GTPF+    NG  
Sbjct  102  ADEQVTSVEGTIGRFRDVDEPVITSLTFRTNAGKTYGPYGGASDKQAGTPFSIPVDNGGV  161

Query  285  IVGFFGRAGFYVDAIGTY  232
            +VGF+GRAG+ +DAIG Y
Sbjct  162  VVGFWGRAGWLIDAIGVY  179



>gb|EMT23136.1| hypothetical protein F775_18655 [Aegilops tauschii]
Length=118

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 51/80 (64%), Gaps = 3/80 (4%)
 Frame = -3

Query  471  DTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNG  292
            DTIN+D A  Y+TEISGT G F   + +++ S+K  T+      YG   GTPF     +G
Sbjct  39   DTINLD-ATNYVTEISGTVGKF--GTDDIVTSLKIVTSKGVTKTYGSGTGTPFRVPVLDG  95

Query  291  AKIVGFFGRAGFYVDAIGTY  232
             KIVGFFGRAG ++DAIG Y
Sbjct  96   GKIVGFFGRAGAFLDAIGFY  115



>ref|NP_001148739.1| LOC100282355 [Zea mays]
 gb|ACG32703.1| agglutinin [Zea mays]
Length=207

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAK  286
            I +   DEYLT +SG + P       V+RS+ F TN   +GP+G   GTPF F   +G  
Sbjct  78   IKLGYPDEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGV  136

Query  285  IVGFFGRAGFYVDAIGTYNA*L  220
            IVGF GR+G+ +DA+G Y A L
Sbjct  137  IVGFCGRSGWQLDAVGLYVAPL  158



>ref|XP_010428208.1| PREDICTED: jacalin-related lectin 19-like isoform X3 [Camelina 
sativa]
Length=177

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 73/143 (51%), Gaps = 9/143 (6%)
 Frame = -3

Query  666  GPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltiggggtdt  487
            GP G NGG  W     + + +I ++       + I +I+    K    +     GG    
Sbjct  16   GPWGGNGGTAWDDGIYHGVREIRLV--YDHCIDSITVIYDKNGKPARSEKHGGVGGN---  70

Query  486  TVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNF  307
               ++  I +   +EYL  +SG + P ++    V+RS+ F +N + +GPYG   GTPF F
Sbjct  71   ---KTAEIKLQYPEEYLIGVSGYYCPVVNSGTPVIRSMTFKSNKQVYGPYGVEQGTPFTF  127

Query  306  QAQNGAKIVGFFGRAGFYVDAIG  238
               NG +IVG  GR+G+Y+D+IG
Sbjct  128  SV-NGGRIVGMNGRSGWYLDSIG  149



>ref|XP_010062570.1| PREDICTED: jacalin-related lectin 19 [Eucalyptus grandis]
Length=279

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 73/146 (50%), Gaps = 10/146 (7%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I  GP G NGG  W     + + +I ++       + I  I +  +K G        GG 
Sbjct  102  IEVGPWGGNGGISWDDGSYHGVREITLV-----FGHCIDSICAVYDKNGKPVAAEKHGGH  156

Query  495  tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTP  316
                  +S  I +   DEYL  +SG   P +     V+RS+ F +N R FGP+G   GTP
Sbjct  157  GGD---QSAEIKLQFPDEYLVSVSGYHCPVVHGGSPVIRSLTFKSNKRTFGPFGMEHGTP  213

Query  315  FNFQAQNGAKIVGFFGRAGFYVDAIG  238
            F+F +    +IVGF GR+G+Y+D+IG
Sbjct  214  FSFPSD--GRIVGFKGRSGWYLDSIG  237



>ref|XP_006662244.1| PREDICTED: uncharacterized protein LOC102708001 [Oryza brachyantha]
Length=334

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ-NGAKIVG  277
            G  E +TE+SGT GPF   + NV+ S+   TN+R +GP+G   G PF+     + + IVG
Sbjct  256  GESEVVTEVSGTIGPFHHLN-NVITSLSIVTNLRSYGPFGSAKGIPFSTSTLVSNSSIVG  314

Query  276  FFGRAGFYVDAIGTY  232
            FFGR+G Y+DAIG Y
Sbjct  315  FFGRSGSYLDAIGVY  329



>ref|XP_011001796.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Populus 
euphratica]
Length=591

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 78/154 (51%), Gaps = 13/154 (8%)
 Frame = -3

Query  690  EISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGL-IFSSTNKTGSKdtl  514
            +I   I+ GP G  GG+ WS+     INQIVI          +GL I S + +  +    
Sbjct  443  DIEGTISIGPWGGQGGNPWSYITNRGINQIVI---------NVGLNIKSISFRDTTDLDS  493

Query  513  tiggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYG  334
               GG     +    T+ I+   E+L  ISGT+G F   +   + S+ FTTN   +GP+G
Sbjct  494  ATFGGNNPNDIGERKTVLINWPSEHLISISGTYGNF--STLLTITSLSFTTNRATYGPFG  551

Query  333  PNVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
               GTPF+    N   +VGF GRAG Y+DAIG +
Sbjct  552  TGSGTPFSIPINNNT-VVGFHGRAGHYLDAIGIF  584


 Score = 68.9 bits (167),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 76/150 (51%), Gaps = 13/150 (9%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I+ GP G  GGD WS+R    I +IV+          +G I S + K  S       GG 
Sbjct  8    ISLGPWGGLGGDHWSYRASGGITEIVL--------RVVGNIKSISFKDASGLVSGTFGGR  59

Query  495  tdtTVIRSD--TINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVG  322
             +    R +   I I    EYL  ISGT+G +  +   V+ S+ F TN+  +GP+G  +G
Sbjct  60   GNDPNDRGEQKKIEIQWPSEYLKSISGTYGSY--KGLLVITSLSFITNLTTYGPFGTALG  117

Query  321  TPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
              F+    + A +VGF GR G+Y+DA+G +
Sbjct  118  ETFSIPIADSA-VVGFHGRCGYYLDALGIF  146


 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 75/149 (50%), Gaps = 11/149 (7%)
 Frame = -3

Query  678  DITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltiggg  499
             I+ G  G  GGD +SFR  + I +I++  G          I S + K G+       GG
Sbjct  155  SISVGQWGGPGGDPFSFRVGSWIKEIIVHEGTN--------IKSLSFKDGNGQEYGKFGG  206

Query  498  gtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGT  319
                       I IDG  E+LT I+GT+G +      V+ S+ F TN+   GP+G   GT
Sbjct  207  KNANDTGEERRIEIDGLSEHLTSITGTYGNYAGMV--VITSLSFITNLTTHGPFGTATGT  264

Query  318  PFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
             F+   + G+ ++GF GR G+Y+DA+G +
Sbjct  265  SFSIPIE-GSVVIGFHGRGGYYLDALGIF  292


 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 74/149 (50%), Gaps = 11/149 (7%)
 Frame = -3

Query  678  DITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltiggg  499
             I+ G  G  GGD +SFR  + I +I++  G          I S + K G+       GG
Sbjct  301  SISVGQWGGPGGDPFSFRVGSWIKEIIVHEGTN--------IKSLSFKDGNGQEYGNFGG  352

Query  498  gtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGT  319
                       I IDG  E+LT I+GT+G +      V+ S+ F TN+   GP+G   GT
Sbjct  353  NNANDTGEERRIEIDGLSEHLTSITGTYGNYAGMV--VITSLSFITNLTTHGPFGTATGT  410

Query  318  PFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
             F+   + G+ ++GF GR G Y+DAIG +
Sbjct  411  SFSIPIE-GSVVIGFHGRGGHYLDAIGIH  438



>ref|XP_009400545.1| PREDICTED: agglutinin alpha chain [Musa acuminata subsp. malaccensis]
Length=200

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAK  286
            I ++  +EYLT ISG + P       V+RS+ F +N R FGP+G   G PF    + G  
Sbjct  76   IKLEHPEEYLTTISGHYCPMAYGGSPVIRSLTFKSNQRTFGPFGVQDGIPFTLPMEGGM-  134

Query  285  IVGFFGRAGFYVDAIG  238
            IVGF GR G+Y+DAIG
Sbjct  135  IVGFSGRCGWYLDAIG  150



>ref|XP_008654965.1| PREDICTED: LOC100282355 isoform X4 [Zea mays]
Length=211

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAK  286
            I +   DEYLT +SG + P       V+RS+ F TN   +GP+G   GTPF F   +G  
Sbjct  84   IKLGYPDEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGV  142

Query  285  IVGFFGRAGFYVDAIGTYNA*L  220
            IVGF GR+G+ +DA+G Y A L
Sbjct  143  IVGFCGRSGWQLDAVGLYVAPL  164



>ref|XP_004980504.1| PREDICTED: protein GOS9-like [Setaria italica]
Length=128

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAK  286
            IN+ G  E++ E+SGT+G F     NV+ S    TN+  +GP+G   GTPF+ +      
Sbjct  47   INL-GPSEFVKEVSGTYGRFSHLP-NVITSFTLVTNLCSYGPFGQPSGTPFHTRVDRTGS  104

Query  285  IVGFFGRAGFYVDAIGTY  232
            IVGFFGR+G Y+DAIG Y
Sbjct  105  IVGFFGRSGKYLDAIGVY  122



>ref|XP_002510452.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF52639.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=1218

 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            R+D + +D  DEYL  +SG +G         +RS+ F +N R +GP+G   GT F+F   
Sbjct  691  RTDKVKLDYPDEYLASVSGHYGSLNQWGPVFVRSLTFQSNKRTYGPFGVEQGTYFSF-PM  749

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G +IVGF G+ G++VDAIG Y
Sbjct  750  TGGRIVGFHGKGGYFVDAIGIY  771


 Score = 67.0 bits (162),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            +++ I  D   E LT ISGT+GP M    N+++S+ F TN  + GP+G   G  F+ +  
Sbjct  921  KTEKITFDYPYEILTHISGTYGPLMFMGPNIIKSLTFYTNKGKHGPFGDEQGPSFSTKP-  979

Query  297  NGAKIVGFFGRAGFYVDAIG  238
            NG KIVGF G+ G ++DAIG
Sbjct  980  NGGKIVGFHGKEGLFLDAIG  999


 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 49/82 (60%), Gaps = 2/82 (2%)
 Frame = -3

Query  474   SDTINIDGADEYLTEISGTFGPF-MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
             ++ + ++   E LT ISG +GP   D    V++S+ F T+  ++GP+G  +GT F     
Sbjct  1118  TNRVKLEYPHEVLTRISGYYGPASRDERPTVVKSLTFYTSRGQYGPFGEEIGTFFTSTTT  1177

Query  297   NGAKIVGFFGRAGFYVDAIGTY  232
              G K+VGF GR G Y+DAIG +
Sbjct  1178  EG-KVVGFHGRCGAYLDAIGVH  1198



>gb|EAY90359.1| hypothetical protein OsI_11939 [Oryza sativa Indica Group]
Length=150

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = -3

Query  480  IRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQA  301
            +  +TI ++   EY+ E+ G+ GP  D ++ V+ S+K  TN R  GP+G   GTPF    
Sbjct  66   VSEETITLE-PSEYVKEVHGSVGPIGDYTH-VVTSLKLVTNQRTIGPFGNGAGTPFAVPV  123

Query  300  QNGAKIVGFFGRAGFYVDAIGTY  232
             N   +VGFF RAG Y+++IG Y
Sbjct  124  LNNGSVVGFFARAGPYLESIGIY  146



>ref|XP_004964114.1| PREDICTED: mannose/glucose-specific lectin-like [Setaria italica]
Length=118

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFGR  265
            E++ EIS TFG F      V+ S+KF TNVR FGP+   +GTPF+   Q+ + IVGFF  
Sbjct  46   EFVKEISRTFGTF--DGAIVVTSLKFVTNVRTFGPWSRGIGTPFSVPVQSRSGIVGFFAH  103

Query  264  AGFYVDAIGTY  232
             G Y+DAIG +
Sbjct  104  VGKYLDAIGVH  114



>ref|XP_008654962.1| PREDICTED: LOC100282355 isoform X2 [Zea mays]
 gb|AFW80927.1| hypothetical protein ZEAMMB73_478294 [Zea mays]
Length=237

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAK  286
            I +   DEYLT +SG + P       V+RS+ F TN   +GP+G   GTPF F   +G  
Sbjct  110  IKLGYPDEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGV  168

Query  285  IVGFFGRAGFYVDAIGTYNA*L  220
            IVGF GR+G+ +DA+G Y A L
Sbjct  169  IVGFCGRSGWQLDAVGLYVAPL  190



>gb|KDO58671.1| hypothetical protein CISIN_1g037526mg, partial [Citrus sinensis]
Length=200

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAK  286
            I +   +E+L  +SG + P +     V+RS+ F +N R FGP+G   GTPF F + +G  
Sbjct  87   IKLRFPEEFLISVSGHYCPVVYGGSPVIRSLTFKSNKRTFGPFGVEEGTPFTF-SMDGGL  145

Query  285  IVGFFGRAGFYVDAIGTY  232
            +VGF GR+G+YVDAIG Y
Sbjct  146  VVGFKGRSGWYVDAIGFY  163



>ref|XP_010477194.1| PREDICTED: jacalin-related lectin 3-like isoform X1 [Camelina 
sativa]
Length=624

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 73/147 (50%), Gaps = 6/147 (4%)
 Frame = -3

Query  672  TYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltiggggt  493
            + GP G   G  W       + QI+I     G+ + I  I     K G        GG  
Sbjct  36   SVGPWGGQSGHAWDDGMYTTVRQIII-----GHGSSIDSIQVEYEKNGCSVWSEKRGGKG  90

Query  492  dtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPF  313
                 ++D + +D   EYL  ++GT+G F       +RS+   +N R++GP+G   GT F
Sbjct  91   GKGGKKTDNVKLDYPHEYLISVNGTYGSFDAWGNTCVRSLILESNHRKYGPFGCESGTFF  150

Query  312  NFQAQNGAKIVGFFGRAGFYVDAIGTY  232
                ++G+KI+GF G+AG+Y+DAIG +
Sbjct  151  AL-PKSGSKIIGFHGKAGWYIDAIGVH  176


 Score = 69.3 bits (168),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 68/147 (46%), Gaps = 9/147 (6%)
 Frame = -3

Query  672  TYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltiggggt  493
            TYGP G  GG  +       I QI +       +  +   F      GSK   T G    
Sbjct  266  TYGPWGGTGGIMFDDGTYTGIRQINLSRSVGVVSMKVCYDFKGQAVWGSKHGGTGG----  321

Query  492  dtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPF  313
                 R D I  D   E LT ++GT+GP +    NV++S+ F TN  + GP+G   G  F
Sbjct  322  ----FRHDKIVFDYPSEVLTHVTGTYGPLVYLGPNVIKSLTFRTNKGKHGPFGEEHGPTF  377

Query  312  NFQAQNGAKIVGFFGRAGFYVDAIGTY  232
              +   G K+VGF GR G ++DAIG +
Sbjct  378  THKIDEG-KVVGFLGREGLFLDAIGVH  403


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 59/105 (56%), Gaps = 6/105 (6%)
 Frame = -3

Query  480  IRSDTINIDGADEYLTEISGTFGPF--MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNF  307
            + +  I ++  +E LT ISG +GP    DRS NV++S+ F T+  ++GPYG   GT F  
Sbjct  521  VATHRIKLEYPNETLTCISGFYGPLNNSDRS-NVVKSLSFFTSRGKYGPYGEECGTFFTS  579

Query  306  QAQNGAKIVGFFGRAGFYVDAIGTYNA*LYGYSAAQCSLGTPLCF  172
               +G K++GF GR G  +DAIG +     G  ++  S  +  CF
Sbjct  580  TTTHG-KVLGFHGRCGCNLDAIGVHMQHWLGNKSSYVSRAS--CF  621



>ref|XP_008654961.1| PREDICTED: LOC100282355 isoform X1 [Zea mays]
Length=238

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAK  286
            I +   DEYLT +SG + P       V+RS+ F TN   +GP+G   GTPF F   +G  
Sbjct  111  IKLGYPDEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGV  169

Query  285  IVGFFGRAGFYVDAIGTYNA*L  220
            IVGF GR+G+ +DA+G Y A L
Sbjct  170  IVGFCGRSGWQLDAVGLYVAPL  191



>ref|NP_849691.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
 gb|AAL32575.1| Unknown protein [Arabidopsis thaliana]
 gb|AAL91614.1| At1g19720/F14P1_33 [Arabidopsis thaliana]
 gb|AAN15429.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE29888.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
Length=595

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 67/147 (46%), Gaps = 9/147 (6%)
 Frame = -3

Query  672  TYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltiggggt  493
            TYGP G  GG  +       I QI +       +  +   F      GSK     G    
Sbjct  236  TYGPWGGTGGIMFDDGIYTGIRQINLSRNVGIVSMKVCYDFRGQAVWGSKHGGVGG----  291

Query  492  dtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPF  313
                 + D I  D   E LT ++GT+GP M    NV++S+ F TN  + GPYG   G  F
Sbjct  292  ----FKHDKIVFDYPSEVLTHVTGTYGPLMYMGPNVIKSLTFRTNRGKHGPYGEEQGPSF  347

Query  312  NFQAQNGAKIVGFFGRAGFYVDAIGTY  232
              Q   G K+VGF GR G ++D+IG +
Sbjct  348  THQMDEG-KVVGFLGREGLFLDSIGVH  373


 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 50/75 (67%), Gaps = 1/75 (1%)
 Frame = -3

Query  456  DGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVG  277
            D   EYL  ++GT+G F       +RS+ F +N R++GP+G + GT F    ++G+KI+G
Sbjct  73   DYPHEYLISVNGTYGSFDVWGTICVRSLTFESNRRKYGPFGVDSGTFFAL-PKSGSKIIG  131

Query  276  FFGRAGFYVDAIGTY  232
            F G+AG+Y+DAIG +
Sbjct  132  FHGKAGWYLDAIGVH  146


 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 56/102 (55%), Gaps = 9/102 (9%)
 Frame = -3

Query  480  IRSDTINIDGADEYLTEISGTFGPF--MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNF  307
            + +  I  +  DE +T ISG +GP    DR YNV++S+ F T+   +GPYG   GT F  
Sbjct  492  VATHRIKFEYPDESITCISGYYGPLNNSDR-YNVVKSLSFYTSRGRYGPYGEETGTFFTS  550

Query  306  QAQNGAKIVGFFGRAGFYVDAIGTYNA*LYG-----YSAAQC  196
                G K++GF GR+ F++DAIG +     G     YS A C
Sbjct  551  TTTQG-KVLGFHGRSSFHLDAIGVHMQHWLGNNKSYYSRASC  591



>ref|XP_008348486.1| PREDICTED: agglutinin alpha chain-like [Malus domestica]
Length=189

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 71/143 (50%), Gaps = 9/143 (6%)
 Frame = -3

Query  666  GPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltiggggtdt  487
            GP G NGG  W     N + +I ++       + I +++    K        I       
Sbjct  24   GPWGGNGGTPWDDGIYNGVREITVV--YGHCIDSITVVYDKNGKP------FIAETRGGR  75

Query  486  TVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNF  307
               ++  I +   DEY+  ++G +G  +     ++RS+KF +N R FGP+G + GTPF +
Sbjct  76   GGTQTAEIKLQYPDEYIVSVTGHYGTMVYGGTPIIRSLKFQSNRRTFGPFGMDEGTPFTY  135

Query  306  QAQNGAKIVGFFGRAGFYVDAIG  238
               +G KIVG  GR G+Y+DAIG
Sbjct  136  -TLDGGKIVGLKGRNGWYIDAIG  157



>gb|ADV38315.1| mannose/glucose-specific lectin [Litchi chinensis]
Length=155

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 71/149 (48%), Gaps = 5/149 (3%)
 Frame = -3

Query  684  STDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltig  505
            S  I  GP G NGG  WS+ P   +  I  +         I + F STN +    T +  
Sbjct  3    SNSIKLGPWGGNGGSSWSYNPSGSV--ITGVFVRFSAGRLISIYFKSTNVSSGTSTYSDK  60

Query  504  gggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNV  325
             GG D+       + +D  +EY T ISGT           ++S+ F T      P G   
Sbjct  61   FGGYDSNTADYTEVLVDWPEEYFTSISGT--AVTSNGLETVQSLTFHTTKGTRSPNGNTN  118

Query  324  GTPFNFQAQNGAKIVGFFGRAGFYVDAIG  238
            GTPF+   + GA+IVGFFGRAG YVDAIG
Sbjct  119  GTPFSIPME-GAQIVGFFGRAGEYVDAIG  146



>ref|NP_001117315.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
 gb|AAG12566.1|AC007797_26 Unknown protein [Arabidopsis thaliana]
 gb|AEE29889.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
Length=571

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 67/147 (46%), Gaps = 9/147 (6%)
 Frame = -3

Query  672  TYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltiggggt  493
            TYGP G  GG  +       I QI +       +  +   F      GSK     G    
Sbjct  212  TYGPWGGTGGIMFDDGIYTGIRQINLSRNVGIVSMKVCYDFRGQAVWGSKHGGVGG----  267

Query  492  dtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPF  313
                 + D I  D   E LT ++GT+GP M    NV++S+ F TN  + GPYG   G  F
Sbjct  268  ----FKHDKIVFDYPSEVLTHVTGTYGPLMYMGPNVIKSLTFRTNRGKHGPYGEEQGPSF  323

Query  312  NFQAQNGAKIVGFFGRAGFYVDAIGTY  232
              Q   G K+VGF GR G ++D+IG +
Sbjct  324  THQMDEG-KVVGFLGREGLFLDSIGVH  349


 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 50/75 (67%), Gaps = 1/75 (1%)
 Frame = -3

Query  456  DGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVG  277
            D   EYL  ++GT+G F       +RS+ F +N R++GP+G + GT F    ++G+KI+G
Sbjct  49   DYPHEYLISVNGTYGSFDVWGTICVRSLTFESNRRKYGPFGVDSGTFFAL-PKSGSKIIG  107

Query  276  FFGRAGFYVDAIGTY  232
            F G+AG+Y+DAIG +
Sbjct  108  FHGKAGWYLDAIGVH  122


 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 56/102 (55%), Gaps = 9/102 (9%)
 Frame = -3

Query  480  IRSDTINIDGADEYLTEISGTFGPF--MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNF  307
            + +  I  +  DE +T ISG +GP    DR YNV++S+ F T+   +GPYG   GT F  
Sbjct  468  VATHRIKFEYPDESITCISGYYGPLNNSDR-YNVVKSLSFYTSRGRYGPYGEETGTFFTS  526

Query  306  QAQNGAKIVGFFGRAGFYVDAIGTYNA*LYG-----YSAAQC  196
                G K++GF GR+ F++DAIG +     G     YS A C
Sbjct  527  TTTQG-KVLGFHGRSSFHLDAIGVHMQHWLGNNKSYYSRASC  567



>gb|AAL10685.1| mannose-binding lectin [Morus nigra]
Length=161

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 53/84 (63%), Gaps = 3/84 (4%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFG--PFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQ  304
            ++  I +D  +E+L  +SG  G  P +    +V+RS+ F TN + +GPYG   GTPF+  
Sbjct  76   KTVKITLDFPNEFLVSVSGYTGVLPRLATGKDVIRSLTFKTNKKTYGPYGKEEGTPFSLP  135

Query  303  AQNGAKIVGFFGRAGFYVDAIGTY  232
             +NG  IVGF GR+GF VDAIG +
Sbjct  136  IENGL-IVGFKGRSGFVVDAIGVH  158



>ref|NP_001185041.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
 sp|F4HQX1.1|JAL3_ARATH RecName: Full=Jacalin-related lectin 3; AltName: Full=Mannose-binding 
lectin superfamily protein [Arabidopsis thaliana]
 gb|AEE29890.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
Length=601

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 67/147 (46%), Gaps = 9/147 (6%)
 Frame = -3

Query  672  TYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltiggggt  493
            TYGP G  GG  +       I QI +       +  +   F      GSK     G    
Sbjct  242  TYGPWGGTGGIMFDDGIYTGIRQINLSRNVGIVSMKVCYDFRGQAVWGSKHGGVGG----  297

Query  492  dtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPF  313
                 + D I  D   E LT ++GT+GP M    NV++S+ F TN  + GPYG   G  F
Sbjct  298  ----FKHDKIVFDYPSEVLTHVTGTYGPLMYMGPNVIKSLTFRTNRGKHGPYGEEQGPSF  353

Query  312  NFQAQNGAKIVGFFGRAGFYVDAIGTY  232
              Q   G K+VGF GR G ++D+IG +
Sbjct  354  THQMDEG-KVVGFLGREGLFLDSIGVH  379


 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 50/75 (67%), Gaps = 1/75 (1%)
 Frame = -3

Query  456  DGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVG  277
            D   EYL  ++GT+G F       +RS+ F +N R++GP+G + GT F    ++G+KI+G
Sbjct  79   DYPHEYLISVNGTYGSFDVWGTICVRSLTFESNRRKYGPFGVDSGTFFAL-PKSGSKIIG  137

Query  276  FFGRAGFYVDAIGTY  232
            F G+AG+Y+DAIG +
Sbjct  138  FHGKAGWYLDAIGVH  152


 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 56/102 (55%), Gaps = 9/102 (9%)
 Frame = -3

Query  480  IRSDTINIDGADEYLTEISGTFGPF--MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNF  307
            + +  I  +  DE +T ISG +GP    DR YNV++S+ F T+   +GPYG   GT F  
Sbjct  498  VATHRIKFEYPDESITCISGYYGPLNNSDR-YNVVKSLSFYTSRGRYGPYGEETGTFFTS  556

Query  306  QAQNGAKIVGFFGRAGFYVDAIGTYNA*LYG-----YSAAQC  196
                G K++GF GR+ F++DAIG +     G     YS A C
Sbjct  557  TTTQG-KVLGFHGRSSFHLDAIGVHMQHWLGNNKSYYSRASC  597



>ref|XP_008654963.1| PREDICTED: LOC100282355 isoform X3 [Zea mays]
 ref|XP_008654964.1| PREDICTED: LOC100282355 isoform X3 [Zea mays]
Length=231

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAK  286
            I +   DEYLT +SG + P       V+RS+ F TN   +GP+G   GTPF F   +G  
Sbjct  104  IKLGYPDEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGV  162

Query  285  IVGFFGRAGFYVDAIGTYNA*L  220
            IVGF GR+G+ +DA+G Y A L
Sbjct  163  IVGFCGRSGWQLDAVGLYVAPL  184



>ref|XP_010428207.1| PREDICTED: jacalin-related lectin 19-like isoform X2 [Camelina 
sativa]
Length=218

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++  I +   +EYL  +SG + P ++    V+RS+ F +N + +GPYG   GTPF F   
Sbjct  112  KTAEIKLQYPEEYLIGVSGYYCPVVNSGTPVIRSMTFKSNKQVYGPYGVEQGTPFTFSV-  170

Query  297  NGAKIVGFFGRAGFYVDAIG  238
            NG +IVG  GR+G+Y+D+IG
Sbjct  171  NGGRIVGMNGRSGWYLDSIG  190



>ref|XP_010477196.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like 
isoform X3 [Camelina sativa]
Length=1240

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 73/147 (50%), Gaps = 6/147 (4%)
 Frame = -3

Query  672  TYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltiggggt  493
            + GP G   G  W       + QI+I     G+ + I  I     K G        GG  
Sbjct  652  SVGPWGGQSGHAWDDGMYTTVRQIII-----GHGSSIDSIQVEYEKNGCSVWSEKRGGKG  706

Query  492  dtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPF  313
                 ++D + +D   EYL  ++GT+G F       +RS+   +N R++GP+G   GT F
Sbjct  707  GKGGKKTDNVKLDYPHEYLISVNGTYGSFDAWGNTCVRSLILESNHRKYGPFGCESGTFF  766

Query  312  NFQAQNGAKIVGFFGRAGFYVDAIGTY  232
                ++G+KI+GF G+AG+Y+DAIG +
Sbjct  767  AL-PKSGSKIIGFHGKAGWYIDAIGVH  792


 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 68/147 (46%), Gaps = 9/147 (6%)
 Frame = -3

Query  672   TYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltiggggt  493
             TYGP G  GG  +       I QI +       +  +   F      GSK   T G    
Sbjct  882   TYGPWGGTGGIMFDDGTYTGIRQINLSRSVGVVSMKVCYDFKGQAVWGSKHGGTGG----  937

Query  492   dtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPF  313
                  R D I  D   E LT ++GT+GP +    NV++S+ F TN  + GP+G   G  F
Sbjct  938   ----FRHDKIVFDYPSEVLTHVTGTYGPLVYLGPNVIKSLTFRTNKGKHGPFGEEHGPTF  993

Query  312   NFQAQNGAKIVGFFGRAGFYVDAIGTY  232
               +   G K+VGF GR G ++DAIG +
Sbjct  994   THKIDEG-KVVGFLGREGLFLDAIGVH  1019


 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 4/85 (5%)
 Frame = -3

Query  480   IRSDTINIDGADEYLTEISGTFGPF--MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNF  307
             + +  I ++  +E LT ISG +GP    DRS NV++S+ F T+  ++GPYG   GT F  
Sbjct  1137  VATHRIKLEYPNETLTCISGFYGPLNNSDRS-NVVKSLSFFTSRGKYGPYGEECGTFFTS  1195

Query  306   QAQNGAKIVGFFGRAGFYVDAIGTY  232
                +G K++GF GR G  +DAIG +
Sbjct  1196  TTTHG-KVLGFHGRCGCNLDAIGVH  1219



>ref|XP_010099937.1| hypothetical protein L484_020125 [Morus notabilis]
 gb|EXB80866.1| hypothetical protein L484_020125 [Morus notabilis]
Length=351

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 58/106 (55%), Gaps = 13/106 (12%)
 Frame = -3

Query  468  TINIDGADEYLTEISGTFGPFMD--RSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQN  295
            TI++D   EY+ E+SG    + D  R Y V+RS+ F TN   +GPYG   GTPFN   QN
Sbjct  139  TISLDFPSEYIVEVSG----YTDNVRGYKVVRSLTFKTNKATYGPYGTTSGTPFNLPIQN  194

Query  294  GAKIVGFFGRAGFYVD------AIGTYNA*LYGYSAAQCSLGTPLC  175
            G  IVGF G  G+++D      A+ T ++  Y    A CS+    C
Sbjct  195  GL-IVGFKGSIGYWLDYIAIKYAVSTKSSAKYEAPNAACSIKQKAC  239



>gb|EMT07330.1| Disease resistance protein RPM1 [Aegilops tauschii]
Length=885

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFGR  265
            E + EISGTFGP+  +  ++++S+   TN+R +GP+G   GTPF+ + +    IVGFFG 
Sbjct  813  ELVLEISGTFGPY-GQFPSIIKSLMLVTNLRTYGPFGQLHGTPFHSRVKKNGTIVGFFGC  871

Query  264  AGFYVDAIGTY  232
            +G ++DAIG Y
Sbjct  872  SGEFLDAIGVY  882



>ref|XP_002893063.1| jacalin lectin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69322.1| jacalin lectin family protein [Arabidopsis lyrata subsp. lyrata]
Length=596

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 67/147 (46%), Gaps = 9/147 (6%)
 Frame = -3

Query  672  TYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltiggggt  493
            TYGP G  GG  +       I QI +       +  +   F      GSK     G    
Sbjct  236  TYGPWGGTGGIMFDDGIYTGIRQINLSRSVGIVSIKVCYDFRGQAVWGSKHGGMGG----  291

Query  492  dtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPF  313
                 + D I  D   E LT ++GT+GP M    NV++S+ F TN  + GPYG   G  F
Sbjct  292  ----FKHDKIVFDYPSEVLTHVTGTYGPLMYMGPNVIKSLTFRTNRGKHGPYGEEQGPSF  347

Query  312  NFQAQNGAKIVGFFGRAGFYVDAIGTY  232
              Q   G K+VGF GR G ++D+IG +
Sbjct  348  THQIDEG-KVVGFLGREGLFLDSIGVH  373


 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -3

Query  459  IDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIV  280
            +D   EYL  I+GT+G F       +RS+ F +N R++GP+G   GT F    ++G+KIV
Sbjct  72   LDYPHEYLISINGTYGSFDVWGTLCVRSLTFESNRRKYGPFGVESGTFFAL-PKSGSKIV  130

Query  279  GFFGRAGFYVDAIGTY  232
            GF G+AG+Y+DAIG +
Sbjct  131  GFHGKAGWYLDAIGVH  146


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 57/102 (56%), Gaps = 9/102 (9%)
 Frame = -3

Query  480  IRSDTINIDGADEYLTEISGTFGPF--MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNF  307
            + +  I ++  +E +T ISG +GP    DR YNV++S+ F T+  ++GPYG   GT F  
Sbjct  492  VATHRIKLEYPNETITCISGYYGPLNNSDR-YNVVKSLSFYTSRGKYGPYGEETGTFFTS  550

Query  306  QAQNGAKIVGFFGRAGFYVDAIGTYNA*LYG-----YSAAQC  196
                G K++GF GR+  ++DAIG +     G     YS A C
Sbjct  551  TTTQG-KVLGFHGRSSSHLDAIGVHMQHWLGNNKPYYSRASC  591



>ref|NP_001148448.1| jasmonate-induced protein [Zea mays]
 gb|ACG31498.1| jasmonate-induced protein [Zea mays]
Length=184

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 5/77 (6%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGP---NVGTPFNFQAQNGAKI  283
            G  E LTE+SGT G  +   + V+ S+KF T+++ +GP+G       TPF    Q G+ I
Sbjct  106  GDSEVLTELSGTIG--IVDGHTVITSIKFVTSLKTYGPFGAWGDGSDTPFAIPVQQGSAI  163

Query  282  VGFFGRAGFYVDAIGTY  232
            VGFF RAG Y+DA+G Y
Sbjct  164  VGFFARAGVYLDALGVY  180



>ref|XP_010428206.1| PREDICTED: jacalin-related lectin 19-like isoform X1 [Camelina 
sativa]
Length=224

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++  I +   +EYL  +SG + P ++    V+RS+ F +N + +GPYG   GTPF F   
Sbjct  118  KTAEIKLQYPEEYLIGVSGYYCPVVNSGTPVIRSMTFKSNKQVYGPYGVEQGTPFTFSV-  176

Query  297  NGAKIVGFFGRAGFYVDAIG  238
            NG +IVG  GR+G+Y+D+IG
Sbjct  177  NGGRIVGMNGRSGWYLDSIG  196



>ref|XP_002893064.1| hypothetical protein ARALYDRAFT_472198 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69323.1| hypothetical protein ARALYDRAFT_472198 [Arabidopsis lyrata subsp. 
lyrata]
Length=1490

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = -3

Query  477   RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
             + D I  D   E LT ++GT+GP M    NV++S+ F TN  + GPYG   G  F  Q  
Sbjct  1187  KHDKIVFDYPSEVLTHVTGTYGPLMYMGPNVIKSLTFRTNRGKHGPYGEEQGPSFTHQID  1246

Query  297   NGAKIVGFFGRAGFYVDAIGTY  232
              G K+VGF GR G ++D+IG +
Sbjct  1247  EG-KVVGFLGREGLFLDSIGVH  1267


 Score = 66.6 bits (161),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -3

Query  459   IDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIV  280
             +D   EYL  I+GT+G F       +RS+ F +N R++GP+G   GT F    ++G+KIV
Sbjct  966   LDYPHEYLISINGTYGSFDVWGTLCVRSLTFESNRRKYGPFGVESGTFFAL-PKSGSKIV  1024

Query  279   GFFGRAGFYVDAIGTY  232
             GF G+AG+Y+DAIG +
Sbjct  1025  GFHGKAGWYLDAIGVH  1040


 Score = 54.3 bits (129),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 57/102 (56%), Gaps = 9/102 (9%)
 Frame = -3

Query  480   IRSDTINIDGADEYLTEISGTFGPF--MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNF  307
             + +  I ++  +E +T ISG +GP    DR YNV++S+ F T+  ++GPYG   GT F  
Sbjct  1386  VATHRIKLEYPNETITCISGYYGPLNNSDR-YNVVKSLSFYTSRGKYGPYGEETGTFFTS  1444

Query  306   QAQNGAKIVGFFGRAGFYVDAIGTYNA*LYG-----YSAAQC  196
                 G K++GF GR+  ++DAIG +     G     YS A C
Sbjct  1445  TTTQG-KVLGFHGRSSSHLDAIGVHMQHWLGNNKPYYSRASC  1485



>ref|XP_009608039.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana tomentosiformis]
Length=1307

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 46/72 (64%), Gaps = 3/72 (4%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVG-TPFNFQAQNGAKIVGFFG  268
            EYLT I GTFG     S+ V++S+ F TN + +GP+G   G TPF+   + G  IVGF G
Sbjct  54   EYLTGIKGTFGRC--GSHLVIKSLCFITNAKNYGPFGSEAGGTPFSLVMREGGAIVGFHG  111

Query  267  RAGFYVDAIGTY  232
            R G Y+DAIG Y
Sbjct  112  RCGAYLDAIGVY  123



>ref|XP_009608038.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X2 [Nicotiana tomentosiformis]
Length=1338

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 46/72 (64%), Gaps = 3/72 (4%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVG-TPFNFQAQNGAKIVGFFG  268
            EYLT I GTFG     S+ V++S+ F TN + +GP+G   G TPF+   + G  IVGF G
Sbjct  85   EYLTGIKGTFGRC--GSHLVIKSLCFITNAKNYGPFGSEAGGTPFSLVMREGGAIVGFHG  142

Query  267  RAGFYVDAIGTY  232
            R G Y+DAIG Y
Sbjct  143  RCGAYLDAIGVY  154



>ref|XP_009608035.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608036.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608037.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
Length=1354

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 46/72 (64%), Gaps = 3/72 (4%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVG-TPFNFQAQNGAKIVGFFG  268
            EYLT I GTFG     S+ V++S+ F TN + +GP+G   G TPF+   + G  IVGF G
Sbjct  101  EYLTGIKGTFGRC--GSHLVIKSLCFITNAKNYGPFGSEAGGTPFSLVMREGGAIVGFHG  158

Query  267  RAGFYVDAIGTY  232
            R G Y+DAIG Y
Sbjct  159  RCGAYLDAIGVY  170



>ref|XP_004297619.1| PREDICTED: agglutinin-like [Fragaria vesca subsp. vesca]
Length=321

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 54/84 (64%), Gaps = 2/84 (2%)
 Frame = -3

Query  474  SDTINIDGADEYLTEISGTFG--PFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQA  301
            S  I ++  DE+L  ISG +    ++  +  VLRS+KF +N R FGP+G   GTPF F+ 
Sbjct  88   SAEIKLECPDEFLVSISGYYCGVTWIVGAPVVLRSLKFESNKRTFGPFGNQFGTPFTFKV  147

Query  300  QNGAKIVGFFGRAGFYVDAIGTYN  229
            ++  +IVGF GR G Y+DAIG ++
Sbjct  148  KDSDRIVGFKGRKGRYLDAIGFHS  171


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 57/80 (71%), Gaps = 3/80 (4%)
 Frame = -3

Query  465  INIDGADEYLTEISG--TFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNG  292
            + ++  +E++  +SG  ++ P+M  +  V+RS+KF +N R +GP+G  VGTPF+F+ ++G
Sbjct  242  VKLEYPNEFMVTVSGHISWVPWMSGT-RVVRSLKFDSNRRTYGPFGVQVGTPFSFRVKDG  300

Query  291  AKIVGFFGRAGFYVDAIGTY  232
             +IVG  GR+G+Y+ AIG Y
Sbjct  301  DQIVGLRGRSGWYLYAIGFY  320



>gb|EMT33809.1| hypothetical protein F775_16156 [Aegilops tauschii]
Length=177

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 75/151 (50%), Gaps = 8/151 (5%)
 Frame = -3

Query  681  TDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPI-GLIFSSTNKTGSKdtltig  505
            T +TYGP G NGG     R  + +    + S      + I  L FS ++ +G    +   
Sbjct  12   TFVTYGPWGGNGGTAHDIRAASSLR---LKSVTIPYGDIIDSLTFSYSDHSGHVHRVGPW  68

Query  504  gggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNV  325
            GG          TIN+D  D ++ EISG FGP+     NV+ S+K  T+   +GP+G   
Sbjct  69   GGTGGA---NKYTINLDPTD-FVKEISGKFGPYPLSRSNVITSLKLVTHEDTYGPFGFVE  124

Query  324  GTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            GTPF    ++G  IVGFF RA  YV  IG Y
Sbjct  125  GTPFCATLESGWAIVGFFARAERYVHKIGVY  155



>ref|XP_009760249.1| PREDICTED: agglutinin-like [Nicotiana sylvestris]
Length=345

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 82/159 (52%), Gaps = 11/159 (7%)
 Frame = -3

Query  702  QETMEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSK  523
            Q + + +  I   P G  GG  W+++  + I +IVI  G   ++    ++F +  K G+ 
Sbjct  4    QVSYDETDSILVEPWGGKGGLEWNYKLKSPIKEIVIAHGSIIDS----IMFRTITKEGTI  59

Query  522  dtltiggggtdtTVIRSDTINIDGAD-EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREF  346
                  GG       R D +NI+    EYLT I GT G +   S  V++S+ F TN + +
Sbjct  60   VDSPKFGGNGGG---RRDKVNIEATPLEYLTGIKGTLGHY--GSNLVVKSLSFITNGKNY  114

Query  345  GPYGPNVG-TPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            GP+G   G T F+   + G  IVGF GR+G Y+DAIG Y
Sbjct  115  GPFGTEAGGTLFSLVMKEGGAIVGFHGRSGLYLDAIGVY  153


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPFMDRS-YNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGA  289
            IN+DG +E L  I G + P  D    + +R + F TN  ++GPYG  +GT F+  A  G 
Sbjct  264  INVDGENELLIGIEGFYSPVDDNGGLDAIRQIAFYTNKGKYGPYGTEIGTYFSSSAARG-  322

Query  288  KIVGFFGRAGFYVDAIGTY  232
            KIVGF G++G +++AIG +
Sbjct  323  KIVGFHGKSGVFLNAIGVH  341



>ref|XP_010935305.1| PREDICTED: jacalin-related lectin 3-like [Elaeis guineensis]
Length=499

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 75/148 (51%), Gaps = 9/148 (6%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I  GP G  GG  W       I Q+V++ G   ++  I       +K GS       GG 
Sbjct  12   ILVGPWGGEGGSPWDDGVYTTIRQVVVVHGAAIDSIQI-----EYDKKGSSVWSEKHGGN  66

Query  495  tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTP  316
                  ++D I +D   E LT +SG +G     S  ++RS+ F +N  ++GP+G   G  
Sbjct  67   GG---TKTDKIKLDHPLESLTSVSGYYGSLSSGSPAIIRSLTFESNQAKYGPFGYEQGMR  123

Query  315  FNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            F+F   +G KIVGF GR+G+Y+D+IG Y
Sbjct  124  FSF-PMSGGKIVGFHGRSGWYLDSIGFY  150


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 45/84 (54%), Gaps = 2/84 (2%)
 Frame = -3

Query  480  IRSDTINIDGADEYLTEISGTFGPF-MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQ  304
            + +  I  D   E L  +SG +     D    V++S+ F T+  ++GP+G  VGT F   
Sbjct  396  VTTHRIKFDYPHEVLNCVSGYYATINRDERPTVIKSLSFYTSRGKYGPFGEEVGTHFTSA  455

Query  303  AQNGAKIVGFFGRAGFYVDAIGTY  232
               G K+VGF GR+  Y+DAIG +
Sbjct  456  TTEG-KVVGFHGRSALYLDAIGVH  478



>gb|ABF96452.1| Jacalin-like lectin domain containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAH01034.1| unnamed protein product [Oryza sativa Japonica Group]
Length=176

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = -3

Query  450  ADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFF  271
            A E +TE+ GT GPF DR  +++ S+K  T+ R  GP+G   GTPF+   +    +VGFF
Sbjct  96   AGERVTEVHGTVGPFGDRD-SLVTSLKLVTDRRTIGPFGYGAGTPFSVPVRGDGGVVGFF  154

Query  270  GRAGFYVDAIGTY  232
             RAG Y++AIG Y
Sbjct  155  VRAGAYLEAIGVY  167



>ref|XP_006372325.1| Mannose/glucose-specific lectin family protein [Populus trichocarpa]
 gb|ERP50122.1| Mannose/glucose-specific lectin family protein [Populus trichocarpa]
Length=446

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 75/153 (49%), Gaps = 11/153 (7%)
 Frame = -3

Query  690  EISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtlt  511
            +I   I+ GP G  GG  WS+     INQIVI  G          I S + +  +     
Sbjct  298  DIEGTISIGPWGGRGGSPWSYMTNRGINQIVIHVGSN--------IKSISFRDTTGLDSA  349

Query  510  iggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGP  331
              GG     +    T+ I+   E+L  ISGT+G F   +   + S+ FTTN   +GP+G 
Sbjct  350  TFGGENPNDIGERKTVLINWPSEHLISISGTYGKF--STLLTITSLSFTTNRATYGPFGT  407

Query  330  NVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
              GTPF+    N   +VGF GRAG Y+DAIG +
Sbjct  408  GSGTPFSIPINNNT-VVGFHGRAGHYLDAIGIF  439


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 71/153 (46%), Gaps = 16/153 (10%)
 Frame = -3

Query  678  DITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPI----GLIFSSTNKTGSKdtlt  511
            D+  GP G  GGD W +R  + I  IV+   G   +       GL+  +   TG+     
Sbjct  7    DVKLGPWGGLGGDRWCYRASDGITGIVLRVEGNIKSISFKDTRGLVSGTFGGTGNDPNDR  66

Query  510  iggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGP  331
                           I I    EYL  ISGT+G +      V+ S+ FTTN+   GP+G 
Sbjct  67   G----------EEKKIAIQWPTEYLKSISGTYGRYKG-VLAVITSLSFTTNLTTHGPFGT  115

Query  330  NVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
              G PF+    +G  +VGF GR G+Y+DA+G +
Sbjct  116  APGEPFSIPIADGV-VVGFHGRCGYYLDALGVF  147


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 75/148 (51%), Gaps = 11/148 (7%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I+ G  G  GGD +SFR  + I +I++  G          I S + K G+       GG 
Sbjct  157  ISVGQWGGPGGDPFSFRVGSWIKEIIVHEGTN--------IKSLSFKDGNGQEYGKFGGK  208

Query  495  tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTP  316
                      I IDG  E+LT I+GT+G +      V+ S+ F TN+  +GP+G   GT 
Sbjct  209  NANDTGEERRIEIDGLSEHLTSITGTYGDYAGMV--VITSLAFQTNLTTYGPFGNATGTS  266

Query  315  FNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            F+   + G+ ++GF GR G Y+DAIG +
Sbjct  267  FSIPIE-GSVVIGFHGRGGHYLDAIGIH  293



>ref|XP_006383725.1| hypothetical protein POPTR_0005s25400g [Populus trichocarpa]
 gb|ERP61522.1| hypothetical protein POPTR_0005s25400g [Populus trichocarpa]
Length=440

 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 77/148 (52%), Gaps = 9/148 (6%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            ++YGP G NGG+ +       + ++ +   G   +  I    +     GSK+  + G   
Sbjct  90   VSYGPWGGNGGNIFDDGVYTGVREVHLTRYGGVVSIRICYDLNGKEIWGSKNGGSGG---  146

Query  495  tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTP  316
                 IR D I  D   E LT I+G +G  + R   V++S+ F TN R++GP+G   GT 
Sbjct  147  -----IRVDKILFDYPSEILTHITGYYGSTILRGPAVVKSLTFHTNKRKYGPFGEEQGTS  201

Query  315  FNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            F+  + NG  IVGF GR G++VD+IG +
Sbjct  202  FSSASNNGI-IVGFHGRKGWFVDSIGVH  228



>gb|AAK55472.1|AC084295_5 putative salt-induced protein [Oryza sativa Japonica Group]
 gb|AAP12924.1| putative salt-induced protein [Oryza sativa Japonica Group]
 gb|EAY90358.1| hypothetical protein OsI_11938 [Oryza sativa Indica Group]
Length=191

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = -3

Query  450  ADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFF  271
            A E +TE+ GT GPF DR  +++ S+K  T+ R  GP+G   GTPF+   +    +VGFF
Sbjct  111  AGERVTEVHGTVGPFGDRD-SLVTSLKLVTDRRTIGPFGYGAGTPFSVPVRGDGGVVGFF  169

Query  270  GRAGFYVDAIGTY  232
             RAG Y++AIG Y
Sbjct  170  VRAGAYLEAIGVY  182



>gb|EEE52450.1| hypothetical protein OsJ_34606 [Oryza sativa Japonica Group]
Length=370

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 53/81 (65%), Gaps = 3/81 (4%)
 Frame = -3

Query  471  DTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNV-REFGPYGPNVGTPFNFQAQN  295
            D I + GA E++  +SGT G F     NV+ S+KFTTN+ R +GPYG   GTPF    ++
Sbjct  287  DQIRL-GAFEHIKGLSGTVGSF-GMLQNVITSLKFTTNLNRTYGPYGKGGGTPFVVPVED  344

Query  294  GAKIVGFFGRAGFYVDAIGTY  232
             A IVGFFGRAG  V+A+G Y
Sbjct  345  AASIVGFFGRAGPCVEAVGVY  365



>emb|CAJ38387.1| jacalin-domain protein [Plantago major]
Length=197

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++  I +   DE LT +SG   P +     V+RS+ F +N R FGP+G   G+PF+F  +
Sbjct  82   KTTEIKLQFPDEVLTSVSGHCCPVVHGGSPVIRSLTFKSNKRTFGPFGVEEGSPFSFPME  141

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G +IVGF GR G++VDAIG +
Sbjct  142  -GGQIVGFKGRNGWFVDAIGFH  162



>emb|CDY48032.1| BnaA02g16250D [Brassica napus]
Length=230

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++  I +   +EYL  +SG   P +     V+RS+ F +N + +GPYG   GTPF+F   
Sbjct  125  KTTEIKLQYPEEYLIGVSGYCCPVVHSGTPVIRSMTFKSNKQVYGPYGVEQGTPFSFSV-  183

Query  297  NGAKIVGFFGRAGFYVDAIG  238
            NG +IVG  GR+G+Y+D+IG
Sbjct  184  NGGRIVGMNGRSGWYLDSIG  203



>gb|EMT18893.1| Disease resistance protein RPM1 [Aegilops tauschii]
Length=809

 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 54/80 (68%), Gaps = 2/80 (3%)
 Frame = -3

Query  471  DTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNG  292
            D I+++ + E L E+SGT G +   + NV+ S+   T+ R +GP+G   G PF+ +A + 
Sbjct  728  DVIHLEPS-EILKEVSGTVGSYGALT-NVITSLTLVTSARTYGPFGKGDGIPFSMEAASN  785

Query  291  AKIVGFFGRAGFYVDAIGTY  232
            + I+GFFGR+G+Y+DAIG Y
Sbjct  786  SSIIGFFGRSGWYLDAIGVY  805



>ref|XP_010092355.1| hypothetical protein L484_023733 [Morus notabilis]
 gb|EXB51031.1| hypothetical protein L484_023733 [Morus notabilis]
Length=185

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 3/82 (4%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFG--PFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQ  304
            ++  I +D  +E+L  +SG  G  P +    +V+RS+ F TN + +GPYG   GTPF+  
Sbjct  100  KTVKITLDFPNEFLVSVSGHTGVLPRLATGKDVIRSLTFKTNQKTYGPYGKEEGTPFSLP  159

Query  303  AQNGAKIVGFFGRAGFYVDAIG  238
             +NG  IVGF GR+GF VDAIG
Sbjct  160  IENGL-IVGFKGRSGFVVDAIG  180



>gb|AEQ30064.1| mannose/glucose-specific lectin [Litchi chinensis]
 gb|AEQ30065.1| mannose/glucose-specific lectin [Litchi chinensis]
Length=155

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 71/149 (48%), Gaps = 5/149 (3%)
 Frame = -3

Query  684  STDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltig  505
            S  I  GP G N G  WS+ P   +  I  +         I + F STN +    T +  
Sbjct  3    SNSIKLGPWGGNAGSAWSYNPSGSV--ITGVFVRFSAGRLISIYFKSTNVSSGTSTYSDK  60

Query  504  gggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNV  325
             GG D+       + +D  +EY T ISGT         + ++S+ F T      P G   
Sbjct  61   FGGYDSNTADYTEVLVDWPEEYFTSISGT--AVTSNGLDTVQSLTFHTTKGTRAPNGNTN  118

Query  324  GTPFNFQAQNGAKIVGFFGRAGFYVDAIG  238
            GTPF+   + GA+IVGFFGRAG YVDAIG
Sbjct  119  GTPFSIPME-GAQIVGFFGRAGEYVDAIG  146



>ref|XP_006306414.1| hypothetical protein CARUB_v10012347mg [Capsella rubella]
 gb|EOA39312.1| hypothetical protein CARUB_v10012347mg [Capsella rubella]
Length=1361

 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            +SD + +D   EYL  +SGT+G F       +RS+   +N R++GP+G   GT F    +
Sbjct  833  KSDKVKLDYPHEYLISVSGTYGSFDAWGNICVRSLTLESNHRKYGPFGVESGTFFAL-PK  891

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
            +G KI+GF G+AG+Y DAIG +
Sbjct  892  SGTKIIGFHGKAGWYTDAIGVH  913


 Score = 66.6 bits (161),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 68/147 (46%), Gaps = 9/147 (6%)
 Frame = -3

Query  672   TYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltiggggt  493
             TYGP G  GG  +       I QI +       +  +   F      GSK   T G    
Sbjct  1003  TYGPWGGTGGIMFDDGIYTGIRQINLSRSVGVVSMKVCYDFRGQAVWGSKHGGTGG----  1058

Query  492   dtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPF  313
                  R D I  D   E LT ++GT+GP +    NV++S+ F TN  + GP+G   G  F
Sbjct  1059  ----FRHDKIVFDYPSEVLTHVTGTYGPLIYMGPNVIKSLTFRTNKGKHGPFGEEQGPSF  1114

Query  312   NFQAQNGAKIVGFFGRAGFYVDAIGTY  232
               +   G ++VGF GR G ++D+IG +
Sbjct  1115  THKMDEG-RVVGFLGREGLFLDSIGVH  1140


 Score = 57.4 bits (137),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 57/102 (56%), Gaps = 9/102 (9%)
 Frame = -3

Query  480   IRSDTINIDGADEYLTEISGTFGPF--MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNF  307
             + +  I ++  +E LT ISG +GP    DRS NV++S+ F T+  ++GPYG   GT F+ 
Sbjct  1258  VATHRIKLEYPNETLTCISGFYGPLNNSDRS-NVVKSLSFFTSRGKYGPYGEENGTFFSS  1316

Query  306   QAQNGAKIVGFFGRAGFYVDAIGTYNA*LYG-----YSAAQC  196
                 G K++GF GR+   +DAIG +     G     YS A C
Sbjct  1317  TTTQG-KVLGFHGRSSCNLDAIGVHMQHWLGNNKPYYSRASC  1357



>ref|XP_009599288.1| PREDICTED: jacalin-related lectin 3 isoform X1 [Nicotiana tomentosiformis]
Length=661

 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++D + ++  DE+LT + G +G   +R    +RS+ F +N R +GPYG   GT F     
Sbjct  69   KTDKVRLNYPDEFLTCLHGYYGSLHERGSVFVRSLTFQSNKRTYGPYGVQQGTYFTLPIS  128

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G K+VGF G++G+Y+DAIG Y
Sbjct  129  RG-KVVGFHGKSGWYLDAIGVY  149


 Score = 63.2 bits (152),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 50/82 (61%), Gaps = 2/82 (2%)
 Frame = -3

Query  474  SDTINIDGADEYLTEISGTFGPF-MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++ + ++   E LT I+G +GP   D    V++S+ F T  R+FGP+G  +GT F     
Sbjct  561  TNRVKLEYPHEVLTCITGFYGPISKDMGLKVIKSLTFHTTRRKFGPFGEELGTYFTSATT  620

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G K+VGF GR+G Y+DAIG +
Sbjct  621  EG-KVVGFHGRSGMYLDAIGVH  641


 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            +++ I  D   E LT I+G +GP M    N+++S+ F T   + GPYG   G  F+ + +
Sbjct  312  KTERIIFDYPSEILTHITGYYGPAMIMGPNIIQSLTFHTTKGKHGPYGEEQGQQFSTKLK  371

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G  IVGF GR G ++DA+G +
Sbjct  372  EGI-IVGFHGRKGLFLDALGVH  392



>ref|XP_010233169.1| PREDICTED: jacalin-related lectin 3-like [Brachypodium distachyon]
Length=1055

 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 50/83 (60%), Gaps = 1/83 (1%)
 Frame = -3

Query  480  IRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQA  301
            + +D I  D   E LT I+G +GP M     V+RS+ F TN R +GPYG   GT F+   
Sbjct  761  VPADKIAFDFPSEILTHITGFYGPTMIMGPTVVRSLTFHTNKRRYGPYGDEYGTYFSTSF  820

Query  300  QNGAKIVGFFGRAGFYVDAIGTY  232
             NG +IVGF GR G+Y+D IG +
Sbjct  821  TNG-RIVGFHGRDGWYIDGIGVH  842


 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 48/80 (60%), Gaps = 2/80 (3%)
 Frame = -3

Query  471  DTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNG  292
            D + +D  +E L  +SG +G        ++RS+ F +N  ++GP+G   GTPF+    +G
Sbjct  529  DKVKLDFPEEILVSVSGHYGSVCGTPV-IIRSLTFQSNHTKYGPFGTEDGTPFSLPVSSG  587

Query  291  AKIVGFFGRAGFYVDAIGTY  232
             KI+GF GR+G Y+ +IG Y
Sbjct  588  -KIIGFHGRSGSYLSSIGFY  606


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 44/79 (56%), Gaps = 1/79 (1%)
 Frame = -3

Query  465   INIDGADEYLTEISGTFGPF-MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGA  289
             + +D   E LT + G +     D    VLRS+ F +N   +GP+G  VG  F+  A    
Sbjct  955   VKLDSPHEVLTSVRGYYNTGGEDGGPRVLRSITFVSNRGRYGPFGDEVGVYFSSPATVEG  1014

Query  288   KIVGFFGRAGFYVDAIGTY  232
             K+VGF GR+G Y+DAIG +
Sbjct  1015  KVVGFHGRSGQYLDAIGLH  1033



>ref|NP_001050311.2| Os03g0399800 [Oryza sativa Japonica Group]
 dbj|BAF12225.2| Os03g0399800, partial [Oryza sativa Japonica Group]
Length=199

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = -3

Query  450  ADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFF  271
            A E +TE+ GT GPF DR  +++ S+K  T+ R  GP+G   GTPF+   +    +VGFF
Sbjct  119  AGERVTEVHGTVGPFGDRD-SLVTSLKLVTDRRTIGPFGYGAGTPFSVPVRGDGGVVGFF  177

Query  270  GRAGFYVDAIGTY  232
             RAG Y++AIG Y
Sbjct  178  VRAGAYLEAIGVY  190



>ref|XP_009599289.1| PREDICTED: jacalin-related lectin 3 isoform X2 [Nicotiana tomentosiformis]
Length=649

 Score = 69.7 bits (169),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++D + ++  DE+LT + G +G   +R    +RS+ F +N R +GPYG   GT F     
Sbjct  69   KTDKVRLNYPDEFLTCLHGYYGSLHERGSVFVRSLTFQSNKRTYGPYGVQQGTYFTLPIS  128

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G K+VGF G++G+Y+DAIG Y
Sbjct  129  RG-KVVGFHGKSGWYLDAIGVY  149


 Score = 63.2 bits (152),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 50/82 (61%), Gaps = 2/82 (2%)
 Frame = -3

Query  474  SDTINIDGADEYLTEISGTFGPF-MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++ + ++   E LT I+G +GP   D    V++S+ F T  R+FGP+G  +GT F     
Sbjct  549  TNRVKLEYPHEVLTCITGFYGPISKDMGLKVIKSLTFHTTRRKFGPFGEELGTYFTSATT  608

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G K+VGF GR+G Y+DAIG +
Sbjct  609  EG-KVVGFHGRSGMYLDAIGVH  629


 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            +++ I  D   E LT I+G +GP M    N+++S+ F T   + GPYG   G  F+ + +
Sbjct  312  KTERIIFDYPSEILTHITGYYGPAMIMGPNIIQSLTFHTTKGKHGPYGEEQGQQFSTKLK  371

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G  IVGF GR G ++DA+G +
Sbjct  372  EGI-IVGFHGRKGLFLDALGVH  392



>ref|XP_006362248.1| PREDICTED: myrosinase-binding protein-like At3g16470-like isoform 
X2 [Solanum tuberosum]
Length=654

 Score = 69.7 bits (169),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++D I +   DE+LT + G +G   +R    +RS+ F +N R +GPYG   GT F     
Sbjct  69   KTDKIILSYPDEFLTSMHGYYGSLYERGSVFVRSLTFESNKRTYGPYGVEQGTYFTLPIS  128

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G KIVGF G++G+Y+DAIG Y
Sbjct  129  RG-KIVGFHGKSGWYLDAIGVY  149


 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 50/82 (61%), Gaps = 2/82 (2%)
 Frame = -3

Query  474  SDTINIDGADEYLTEISGTFGPF-MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++ + ++   E LT I+G +GP   D    V++S+ F T  R+FGP+G  +GT F     
Sbjct  554  TNKVKLEFPHEVLTCITGFYGPISKDMGLKVIKSLTFHTTRRKFGPFGEELGTYFTSSTT  613

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G K+VGF GR+G Y+DAIG +
Sbjct  614  EG-KVVGFHGRSGMYLDAIGVH  634


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            +++ I  D   E LT I+G +GP M    N++ S+ F T   + GPYG   G  F+ + +
Sbjct  317  KTEKIIFDYPSEILTHITGYYGPTMIMGPNIIHSLTFHTTKGKHGPYGEEQGQQFSTKLK  376

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
            +G  IVGF GR G ++DA+G +
Sbjct  377  DGM-IVGFHGRKGMFLDALGVH  397



>ref|XP_006354454.1| PREDICTED: probable disease resistance RPP8-like protein 4-like 
[Solanum tuberosum]
Length=303

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 78/143 (55%), Gaps = 11/143 (8%)
 Frame = -3

Query  657  GHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltiggggtdtTVI  478
            G +GG  W++RP   + QIV+  G   ++    ++F S+ + G  ++ T GG G      
Sbjct  161  GGSGGSHWNYRPKGVVKQIVVKHGLIIDS----IMFKSSEENGVMESKTFGGSGGHL---  213

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQ-A  301
             +  INID   EYLT +SGT+G +    Y +++S+K  TN+   GP G  + T  NF   
Sbjct  214  -TTEINIDSPSEYLTGLSGTYGLY--GPYLIIKSIKLHTNLSHHGPMGSVIETDTNFSFI  270

Query  300  QNGAKIVGFFGRAGFYVDAIGTY  232
              G  +VGF G +G ++DA+G Y
Sbjct  271  MQGGVVVGFHGFSGLFLDAVGLY  293



>ref|XP_006362247.1| PREDICTED: myrosinase-binding protein-like At3g16470-like isoform 
X1 [Solanum tuberosum]
Length=666

 Score = 69.7 bits (169),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++D I +   DE+LT + G +G   +R    +RS+ F +N R +GPYG   GT F     
Sbjct  69   KTDKIILSYPDEFLTSMHGYYGSLYERGSVFVRSLTFESNKRTYGPYGVEQGTYFTLPIS  128

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G KIVGF G++G+Y+DAIG Y
Sbjct  129  RG-KIVGFHGKSGWYLDAIGVY  149


 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 50/82 (61%), Gaps = 2/82 (2%)
 Frame = -3

Query  474  SDTINIDGADEYLTEISGTFGPF-MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++ + ++   E LT I+G +GP   D    V++S+ F T  R+FGP+G  +GT F     
Sbjct  566  TNKVKLEFPHEVLTCITGFYGPISKDMGLKVIKSLTFHTTRRKFGPFGEELGTYFTSSTT  625

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G K+VGF GR+G Y+DAIG +
Sbjct  626  EG-KVVGFHGRSGMYLDAIGVH  646


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            +++ I  D   E LT I+G +GP M    N++ S+ F T   + GPYG   G  F+ + +
Sbjct  317  KTEKIIFDYPSEILTHITGYYGPTMIMGPNIIHSLTFHTTKGKHGPYGEEQGQQFSTKLK  376

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
            +G  IVGF GR G ++DA+G +
Sbjct  377  DGM-IVGFHGRKGMFLDALGVH  397



>gb|KDP40814.1| hypothetical protein JCGZ_24813 [Jatropha curcas]
Length=203

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 72/146 (49%), Gaps = 9/146 (6%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I  GP G NGG  W     N + +I I+       + I ++F   +K G        GG 
Sbjct  18   ILVGPWGGNGGTSWDDGIYNGVREITIV--YDRCIDSIQVVF---DKNGKPVIGEKRGGV  72

Query  495  tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTP  316
              T  I    I +   +E+L   SG + P +     V+RS+   +N R FGPYG   GTP
Sbjct  73   GGTNRIE---IKLQYPEEFLVSASGHYCPVVYGGSPVIRSLTLKSNRRTFGPYGVEEGTP  129

Query  315  FNFQAQNGAKIVGFFGRAGFYVDAIG  238
            F   + +G  IVGF GR+G+Y+D+IG
Sbjct  130  FTL-SMDGGSIVGFMGRSGWYLDSIG  154



>ref|XP_002515891.1| hypothetical protein RCOM_1485780 [Ricinus communis]
 gb|EEF46311.1| hypothetical protein RCOM_1485780 [Ricinus communis]
Length=514

 Score = 69.7 bits (169),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 73/146 (50%), Gaps = 9/146 (6%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            +  GP G NGG  W     N + +I I+       + I +++    K  + +     GG 
Sbjct  337  LLVGPWGGNGGSTWDDGVFNGVREITIV--YDHCIDSIKVVYDKNGKAVATEKHGGVGGT  394

Query  495  tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTP  316
                  +   I +   +EYL   SG + P +     V+RS+ F +N R FGP+G   GTP
Sbjct  395  ------KRTEIKLQYPEEYLVSASGNYCPVVYGGSPVIRSITFKSNRRTFGPFGIEEGTP  448

Query  315  FNFQAQNGAKIVGFFGRAGFYVDAIG  238
            F   + +G ++VGF GR+G+Y+DAIG
Sbjct  449  FTL-SMDGRRVVGFTGRSGWYLDAIG  473



>ref|XP_010232946.1| PREDICTED: uncharacterized protein LOC104583002 [Brachypodium 
distachyon]
Length=250

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 45/72 (63%), Gaps = 2/72 (3%)
 Frame = -3

Query  447  DEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFG  268
            DE+LT + G  G      + V++S+ F +N R +GPYG + G PF   A  G +IVGF G
Sbjct  154  DEHLTCVKGLLG--NHAQWFVVKSLTFVSNRRTYGPYGEDHGVPFELPAPAGGRIVGFHG  211

Query  267  RAGFYVDAIGTY  232
            R+G  +DAIGTY
Sbjct  212  RSGGLLDAIGTY  223



>gb|AAZ73669.1| At1g19715-like protein [Arabidopsis lyrata]
Length=175

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAK  286
            + +D   EYL  I+GT+G F       +RS+ F +N R++GP+G   GT F    ++G+K
Sbjct  1    VKLDYPHEYLISINGTYGSFDVWGTLCVRSLTFESNRRKYGPFGVESGTFFAL-PKSGSK  59

Query  285  IVGFFGRAGFYVDAIGTY  232
            I+GF G+AG+Y+DAIG +
Sbjct  60   IIGFHGKAGWYLDAIGVH  77



>ref|XP_010267066.1| PREDICTED: jacalin-related lectin 19 [Nelumbo nucifera]
Length=205

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/146 (33%), Positives = 72/146 (49%), Gaps = 9/146 (6%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I  GP G NGG  W     + +  I ++      +  I  I    +K+G        GG 
Sbjct  15   IVVGPWGGNGGTSWDDGSYSGVRTITLV-----YDRCIDSIRVEYDKSGKPVLAEKHGGN  69

Query  495  tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTP  316
                   + TI +   +E+LT +SG + P +     V+RS+ F +N   FGP+G   G P
Sbjct  70   GGN---HTTTIKLQYPEEFLTTVSGHYSPVVHGGTPVIRSLTFKSNQGSFGPFGVEEGMP  126

Query  315  FNFQAQNGAKIVGFFGRAGFYVDAIG  238
            F+F   +G  I+GF+GR G+Y+DAIG
Sbjct  127  FSF-PMDGGSIIGFWGRNGWYLDAIG  151



>ref|XP_009768586.1| PREDICTED: jacalin-related lectin 3-like [Nicotiana sylvestris]
Length=225

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 49/79 (62%), Gaps = 10/79 (13%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVG--------TPFNFQAQNGA  289
            EYLT I+GTFG   D S  V++S+ F TN + +GP+G + G        TPF+   + G 
Sbjct  125  EYLTGINGTFG--HDGSDLVIKSLCFITNAKSYGPFGSSYGPFGSMVGGTPFSLVMKEGV  182

Query  288  KIVGFFGRAGFYVDAIGTY  232
             IVGF GR+G Y+DAIG Y
Sbjct  183  AIVGFHGRSGLYLDAIGVY  201



>ref|XP_007017646.1| Mannose-binding lectin superfamily protein, putative isoform 
1 [Theobroma cacao]
 ref|XP_007017647.1| Mannose-binding lectin superfamily protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY14871.1| Mannose-binding lectin superfamily protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY14872.1| Mannose-binding lectin superfamily protein, putative isoform 
1 [Theobroma cacao]
Length=598

 Score = 69.3 bits (168),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 76/150 (51%), Gaps = 13/150 (9%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIF--SSTNKTGSKdtltigg  502
            ++YGP G NGG  +       I QI +       +  +G+++  +  ++ G     +  G
Sbjct  243  LSYGPWGGNGGAKFDDGTYTGIRQITL-------SRNVGIVWIKACYDRDGQAVWGSKHG  295

Query  501  ggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVG  322
            G       ++D I  D   E LT I+GTFGP M    NV++S+ F TN  + GPYG   G
Sbjct  296  GTGG---FKTDRIIFDYPSEILTHITGTFGPLMYMGPNVIKSLTFHTNKGKHGPYGDEQG  352

Query  321  TPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
              F  +   G +I+GF GR G ++DA+G Y
Sbjct  353  PSFTNKMNEG-RIIGFHGREGLFLDAVGVY  381


 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 3/82 (4%)
 Frame = -3

Query  474  SDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQN  295
            +D + +D  DE+LT + G +G   +R   ++RS+ F +N + +GPYG   GT F+     
Sbjct  69   TDKVKLDYPDEFLTSVHGYYGILHERGPILVRSLTFFSNRKAYGPYGIEQGTSFSMTR--  126

Query  294  GAKIVGFFGRAGFYVDAIGTYN  229
              KIVGF GR G ++DAIGT++
Sbjct  127  -GKIVGFHGRCGCFLDAIGTHS  147


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 45/79 (57%), Gaps = 2/79 (3%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPFM-DRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGA  289
            + +D   E L  ISG +GP   +    V+RS+ F ++  ++GP+G  +GT F      G 
Sbjct  501  VKLDHPHEVLICISGYYGPINNEEKSKVVRSLTFYSSRGKYGPFGEEIGTYFTSTTTEG-  559

Query  288  KIVGFFGRAGFYVDAIGTY  232
            K+VGF GR   Y+DAIG +
Sbjct  560  KVVGFHGRNSSYLDAIGVH  578



>ref|XP_007024409.1| Mannose-binding lectin superfamily protein [Theobroma cacao]
 gb|EOY27031.1| Mannose-binding lectin superfamily protein [Theobroma cacao]
Length=298

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++  I ++  +E+L  +SG + P +     V+RS+ F +N R FGPYG   GTPF F  +
Sbjct  185  KTAEIKLNFPEEFLISVSGHYCPVVHGGGPVIRSLTFKSNQRTFGPYGVEEGTPFTFSME  244

Query  297  NGAKIVGFFGRAGFYVDAIG  238
             G +I GF GR+G+Y+D+IG
Sbjct  245  -GGRIAGFNGRSGWYLDSIG  263



>ref|XP_007017648.1| Mannose-binding lectin superfamily protein, putative isoform 
3 [Theobroma cacao]
 gb|EOY14873.1| Mannose-binding lectin superfamily protein, putative isoform 
3 [Theobroma cacao]
Length=624

 Score = 69.7 bits (169),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 76/150 (51%), Gaps = 13/150 (9%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIF--SSTNKTGSKdtltigg  502
            ++YGP G NGG  +       I QI +       +  +G+++  +  ++ G     +  G
Sbjct  269  LSYGPWGGNGGAKFDDGTYTGIRQITL-------SRNVGIVWIKACYDRDGQAVWGSKHG  321

Query  501  ggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVG  322
            G       ++D I  D   E LT I+GTFGP M    NV++S+ F TN  + GPYG   G
Sbjct  322  GTGG---FKTDRIIFDYPSEILTHITGTFGPLMYMGPNVIKSLTFHTNKGKHGPYGDEQG  378

Query  321  TPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
              F  +   G +I+GF GR G ++DA+G Y
Sbjct  379  PSFTNKMNEG-RIIGFHGREGLFLDAVGVY  407


 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 3/82 (4%)
 Frame = -3

Query  474  SDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQN  295
            +D + +D  DE+LT + G +G   +R   ++RS+ F +N + +GPYG   GT F+     
Sbjct  69   TDKVKLDYPDEFLTSVHGYYGILHERGPILVRSLTFFSNRKAYGPYGIEQGTSFSMTR--  126

Query  294  GAKIVGFFGRAGFYVDAIGTYN  229
              KIVGF GR G ++DAIGT++
Sbjct  127  -GKIVGFHGRCGCFLDAIGTHS  147


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 45/79 (57%), Gaps = 2/79 (3%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPFM-DRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGA  289
            + +D   E L  ISG +GP   +    V+RS+ F ++  ++GP+G  +GT F      G 
Sbjct  527  VKLDHPHEVLICISGYYGPINNEEKSKVVRSLTFYSSRGKYGPFGEEIGTYFTSTTTEG-  585

Query  288  KIVGFFGRAGFYVDAIGTY  232
            K+VGF GR   Y+DAIG +
Sbjct  586  KVVGFHGRNSSYLDAIGVH  604



>ref|XP_004979671.1| PREDICTED: mannose/glucose-specific lectin-like isoform X3 [Setaria 
italica]
Length=793

 Score = 69.7 bits (169),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            G  E+LT +SG+ G F +   NV+ S+ F TNVR +GP+G   G  F+   ++   IVGF
Sbjct  562  GPSEFLTGVSGSIGSF-NTLVNVITSLTFVTNVRNYGPFGKGRGPHFHIPMESNGCIVGF  620

Query  273  FGRAGFYVDAIGTY  232
            FGRAG Y+DAIG Y
Sbjct  621  FGRAGRYLDAIGVY  634


 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            G  E+L  +SG+ G F +    V+ S+ F TN R +GP+G   G PF+ Q Q+   IVGF
Sbjct  348  GPSEFLIGVSGSIGSF-NGLKKVITSLTFVTNARSYGPFGRARGRPFHIQVQSHGCIVGF  406

Query  273  FGRAGFYVDAIGTY  232
            FG +  Y++AIG Y
Sbjct  407  FGHSRRYLEAIGFY  420


 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNV-REFGPYGPNVGTPFNFQAQNGAKIVGFFG  268
            E++ ++SGTF  +     NVL S+   TN  R +GPYG   GT F+   Q+ ++IVGFF 
Sbjct  719  EFIVKVSGTFCAWHGVK-NVLSSLTLVTNTGRSYGPYGTEFGTAFHVPEQSNSRIVGFFA  777

Query  267  RAGFYVDAIGTY  232
                Y++AIG Y
Sbjct  778  HGEDYIEAIGAY  789



>ref|XP_004979669.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Setaria 
italica]
Length=844

 Score = 69.7 bits (169),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            G  E+LT +SG+ G F +   NV+ S+ F TNVR +GP+G   G  F+   ++   IVGF
Sbjct  613  GPSEFLTGVSGSIGSF-NTLVNVITSLTFVTNVRNYGPFGKGRGPHFHIPMESNGCIVGF  671

Query  273  FGRAGFYVDAIGTY  232
            FGRAG Y+DAIG Y
Sbjct  672  FGRAGRYLDAIGVY  685


 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            G  E+L  +SG+ G F +    V+ S+ F TN R +GP+G   G PF+ Q Q+   IVGF
Sbjct  399  GPSEFLIGVSGSIGSF-NGLKKVITSLTFVTNARSYGPFGRARGRPFHIQVQSHGCIVGF  457

Query  273  FGRAGFYVDAIGTY  232
            FG +  Y++AIG Y
Sbjct  458  FGHSRRYLEAIGFY  471


 Score = 57.0 bits (136),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNV-REFGPYGPNVGTPFNFQAQNGAKIVGFFG  268
            E++ ++SGTF  +     NVL S+   TN  R +GPYG   GT F+   Q+ ++IVGFF 
Sbjct  770  EFIVKVSGTFCAWHGVK-NVLSSLTLVTNTGRSYGPYGTEFGTAFHVPEQSNSRIVGFFA  828

Query  267  RAGFYVDAIGTY  232
                Y++AIG Y
Sbjct  829  HGEDYIEAIGAY  840



>gb|ABA94732.1| Jacalin-like lectin domain containing protein, expressed [Oryza 
sativa Japonica Group]
Length=597

 Score = 69.3 bits (168),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNV-REFGPYGPNVGTPFNFQAQNGAKIVG  277
            GA E++  +SGT G F     NV+ S+KFTTN+ R +GPYG   GTPF    ++ A IVG
Sbjct  519  GAFEHIKGLSGTVGSF-GMLQNVITSLKFTTNLNRTYGPYGKGGGTPFVVPVEDAASIVG  577

Query  276  FFGRAGFYVDAIGTY  232
            FFGRAG  V+A+G Y
Sbjct  578  FFGRAGPCVEAVGVY  592


 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            G  E+LTEISGT GP++    +V++S+   TN   +GP+G   GT F+    NG+ IVGF
Sbjct  359  GPSEFLTEISGTTGPYVCAVADVVKSLTLVTNSGSYGPFGQGGGTAFHTSQSNGS-IVGF  417

Query  273  FGRAGFYVDAIGTY  232
            FGRAG ++ +IG Y
Sbjct  418  FGRAGGFLHSIGVY  431



>ref|XP_006838698.1| hypothetical protein AMTR_s00002p00248970 [Amborella trichopoda]
 gb|ERN01267.1| hypothetical protein AMTR_s00002p00248970 [Amborella trichopoda]
Length=149

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 49/81 (60%), Gaps = 7/81 (9%)
 Frame = -3

Query  480  IRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQA  301
            +R   + +D  DE +  +SG F P       ++RS  F+TN R  GPYG  +GTPF+F  
Sbjct  10   LRMCKVKLDYLDETIMSLSGHFEP------KLMRSPSFSTNRRTSGPYGLQIGTPFSFSM  63

Query  300  QNGAKIVGFFGRAGFYVDAIG  238
             +G K+VGF GRA  Y++A+G
Sbjct  64   TDG-KVVGFHGRASDYLNAMG  83



>ref|XP_004979670.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Setaria 
italica]
Length=823

 Score = 69.7 bits (169),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            G  E+LT +SG+ G F +   NV+ S+ F TNVR +GP+G   G  F+   ++   IVGF
Sbjct  592  GPSEFLTGVSGSIGSF-NTLVNVITSLTFVTNVRNYGPFGKGRGPHFHIPMESNGCIVGF  650

Query  273  FGRAGFYVDAIGTY  232
            FGRAG Y+DAIG Y
Sbjct  651  FGRAGRYLDAIGVY  664


 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            G  E+L  +SG+ G F +    V+ S+ F TN R +GP+G   G PF+ Q Q+   IVGF
Sbjct  399  GPSEFLIGVSGSIGSF-NGLKKVITSLTFVTNARSYGPFGRARGRPFHIQVQSHGCIVGF  457

Query  273  FGRAGFYVDAIGTY  232
            FG +  Y++AIG Y
Sbjct  458  FGHSRRYLEAIGFY  471


 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNV-REFGPYGPNVGTPFNFQAQNGAKIVGFFG  268
            E++ ++SGTF  +     NVL S+   TN  R +GPYG   GT F+   Q+ ++IVGFF 
Sbjct  749  EFIVKVSGTFCAWHGVK-NVLSSLTLVTNTGRSYGPYGTEFGTAFHVPEQSNSRIVGFFA  807

Query  267  RAGFYVDAIGTY  232
                Y++AIG Y
Sbjct  808  HGEDYIEAIGAY  819



>tpg|DAA60181.1| TPA: hypothetical protein ZEAMMB73_326702 [Zea mays]
Length=297

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 49/79 (62%), Gaps = 5/79 (6%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGP---NVGTPFNFQAQNGAKI  283
            G  E LTE+SGT G      + V+ S+KF T+++ +GP+G       TPF    Q G+ I
Sbjct  168  GDSEVLTELSGTIGNV--DGHTVITSIKFVTSLKTYGPFGAWGDGSDTPFAIPVQQGSAI  225

Query  282  VGFFGRAGFYVDAIGTYNA  226
            VGFF RAG Y+DA+G Y+A
Sbjct  226  VGFFARAGVYLDALGVYDA  244



>ref|XP_010664949.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 
[Vitis vinifera]
Length=1593

 Score = 69.7 bits (169),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 74/148 (50%), Gaps = 9/148 (6%)
 Frame = -3

Query  675   ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
             I+ GP G   G  W     + + Q+VI      +   I  I    +K GS       GG 
Sbjct  964   ISVGPWGGQDGLRWDDGVYSTVRQLVI-----AHGVGIDSILIEYDKNGSSVWSEKHGGS  1018

Query  495   tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTP  316
               T   R++ + +D  DE+LT I G +G  ++R    +RS+   +N R +GP+G   G  
Sbjct  1019  GGT---RTNRVKLDSPDEFLTSIHGHYGSLLERGPVFVRSLTLESNKRTYGPFGIEQGIY  1075

Query  315   FNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
             F+     G KI+GF G++G+Y+DAIG +
Sbjct  1076  FSLPT-TGGKIIGFHGKSGWYLDAIGVH  1102


 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = -3

Query  477   RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
             R+D I ID   E LT I+G + P M    N+++S+ F T   ++GP+G   GTPF+   +
Sbjct  1288  RNDKIVIDYPYEVLTHITGYYAPTMVMGPNIIKSLTFHTTKTKYGPFGEEQGTPFSSNIK  1347

Query  297   NGAKIVGFFGRAGFYVDAIGTY  232
              G  IVGF GR G ++DAIG +
Sbjct  1348  EGV-IVGFHGRTGLFIDAIGVH  1368


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 48/79 (61%), Gaps = 2/79 (3%)
 Frame = -3

Query  465   INIDGADEYLTEISGTFGPF-MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGA  289
             + ++   E ++ I G +GP  ++  +N ++S+ F T+  ++GP+G  +GT F      G 
Sbjct  1496  VKLEYPHEVVSCICGYYGPISINEPWNAIKSLTFYTSRGKYGPFGEEIGTYFTSTRTEG-  1554

Query  288   KIVGFFGRAGFYVDAIGTY  232
             K+VGF GR+  Y+DAIG +
Sbjct  1555  KVVGFHGRSSLYLDAIGVH  1573



>ref|XP_010498396.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like 
[Camelina sativa]
Length=1235

 Score = 69.7 bits (169),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -3

Query  471  DTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNG  292
            D + +D   EYL  ++GT+G F       +RS+   +N R++GP+G   GT F    ++G
Sbjct  709  DNVKLDYPHEYLISVNGTYGSFDAWGNTCVRSLTLESNHRKYGPFGCESGTFFAL-PKSG  767

Query  291  AKIVGFFGRAGFYVDAIGTY  232
            +KI+GF G+AG+Y+DAIG +
Sbjct  768  SKIIGFHGKAGWYIDAIGVH  787


 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = -3

Query  477   RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
             R D I  D   E LT ++GT+GP +    NV++S+ F TN  + GP+G   G  F  +  
Sbjct  934   RHDKIVFDYPSEVLTHVTGTYGPLVYLGPNVIKSLTFRTNKGKHGPFGEEHGPTFTHKID  993

Query  297   NGAKIVGFFGRAGFYVDAIGTY  232
              G K+VGF GR G ++DAIG +
Sbjct  994   EG-KVVGFLGREGLFLDAIGVH  1014



>gb|AGT16237.1| Jacalin-like lectin domain containing protein [Saccharum hybrid 
cultivar R570]
 gb|AGT16239.1| Jacalin-like lectin domain containing protein [Saccharum hybrid 
cultivar R570]
Length=461

 Score = 69.3 bits (168),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            G  E+L    GT GPF +   +V+ S+   TN R +GP+G   G PF    Q  + IVGF
Sbjct  354  GPSEFLMGAYGTRGPFTNSPADVVTSLTLVTNARSYGPFGHGGGRPFQVPMQGNSSIVGF  413

Query  273  FGRAGFYVDAIGTY  232
            FG AG Y+DAIG Y
Sbjct  414  FGCAGSYIDAIGVY  427



>ref|XP_009784520.1| PREDICTED: uncharacterized protein LOC104232941, partial [Nicotiana 
sylvestris]
Length=1047

 Score = 69.3 bits (168),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 3/72 (4%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGP-NVGTPFNFQAQNGAKIVGFFG  268
            EYLT I+GTFG     S+ V++S+ F TN + +GP+G  + GTPF+   + G  IVGF G
Sbjct  94   EYLTGINGTFG--YGGSHLVIKSLCFITNAKSYGPFGSKDGGTPFSLVMKEGVAIVGFHG  151

Query  267  RAGFYVDAIGTY  232
             +G Y+DAIG Y
Sbjct  152  CSGLYLDAIGVY  163



>ref|XP_002449838.1| hypothetical protein SORBIDRAFT_05g024220 [Sorghum bicolor]
 gb|EES08826.1| hypothetical protein SORBIDRAFT_05g024220 [Sorghum bicolor]
Length=281

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = -3

Query  447  DEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFG  268
             E++ E+SGTFG +  +  NV+ S+K  TNV+ +GP+G   G+ F+   Q  + + GFFG
Sbjct  207  SEFVKEVSGTFGMYA-KVVNVINSIKLVTNVKTYGPFGQENGSSFSVPVQGNSGVAGFFG  265

Query  267  RAGFYVDAIGTY  232
            R+G ++DAIG Y
Sbjct  266  RSGKFLDAIGVY  277



>ref|XP_009367509.1| PREDICTED: agglutinin alpha chain [Pyrus x bretschneideri]
Length=189

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/160 (29%), Positives = 76/160 (48%), Gaps = 19/160 (12%)
 Frame = -3

Query  702  QETMEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPI-----GLIFSSTN  538
            ++  E    +  GP G NGG  W     N + +I ++ G   ++  +     G  F +  
Sbjct  12   EQAGEKRKIMEVGPWGGNGGTPWDDGIYNGVREITLVYGHCIDSITVVYDKNGKPFKAET  71

Query  537  KTGSKdtltiggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTN  358
            + G                 ++  I +   DEY+  ++G +G  +     ++RS+KF +N
Sbjct  72   RGGRGGN-------------QTAEIKLQYPDEYIVSVTGHYGTMVYGGTPIIRSLKFQSN  118

Query  357  VREFGPYGPNVGTPFNFQAQNGAKIVGFFGRAGFYVDAIG  238
             R FGP+G + GTPF +     +KIVG  GR G+Y+DAIG
Sbjct  119  RRTFGPFGMDEGTPFTYTLDR-SKIVGLKGRNGWYIDAIG  157



>ref|XP_009771019.1| PREDICTED: jacalin-related lectin 3 isoform X1 [Nicotiana sylvestris]
Length=666

 Score = 69.3 bits (168),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++D + ++  DE+LT + G  G   +R    +RS+ F +N R +GPYG   GT F     
Sbjct  69   KTDKVRLNYPDEFLTCLHGYHGSLHERGSVFVRSLTFQSNKRTYGPYGVQQGTYFTLPIS  128

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
            +G K+VGF G++G+Y+DAIG Y
Sbjct  129  SG-KVVGFHGKSGWYLDAIGVY  149


 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (60%), Gaps = 2/82 (2%)
 Frame = -3

Query  474  SDTINIDGADEYLTEISGTFGPF-MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++ + ++   E LT I+G +GP   D    V++S+ F T  R+FGP+G  +GT F     
Sbjct  566  TNRVKLEYPHEVLTCITGFYGPISKDMGLKVIKSLTFHTTRRKFGPFGEELGTYFTSATT  625

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G K+VGF GR G Y+DAIG +
Sbjct  626  EG-KVVGFHGRNGMYLDAIGVH  646


 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            +++ I  D   E LT I+G +GP M    N+++S+ F T   + GPYG   G  F+ + +
Sbjct  317  KTEKIIFDYPSEILTHITGYYGPAMIMGPNIIQSLTFHTTKGKHGPYGEEQGQQFSTKLK  376

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G  IVGF GR G ++DA+G +
Sbjct  377  EGI-IVGFHGRKGLFLDALGVH  397



>ref|XP_009771020.1| PREDICTED: jacalin-related lectin 3 isoform X2 [Nicotiana sylvestris]
Length=654

 Score = 69.3 bits (168),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++D + ++  DE+LT + G  G   +R    +RS+ F +N R +GPYG   GT F     
Sbjct  69   KTDKVRLNYPDEFLTCLHGYHGSLHERGSVFVRSLTFQSNKRTYGPYGVQQGTYFTLPIS  128

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
            +G K+VGF G++G+Y+DAIG Y
Sbjct  129  SG-KVVGFHGKSGWYLDAIGVY  149


 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (60%), Gaps = 2/82 (2%)
 Frame = -3

Query  474  SDTINIDGADEYLTEISGTFGPF-MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++ + ++   E LT I+G +GP   D    V++S+ F T  R+FGP+G  +GT F     
Sbjct  554  TNRVKLEYPHEVLTCITGFYGPISKDMGLKVIKSLTFHTTRRKFGPFGEELGTYFTSATT  613

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G K+VGF GR G Y+DAIG +
Sbjct  614  EG-KVVGFHGRNGMYLDAIGVH  634


 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            +++ I  D   E LT I+G +GP M    N+++S+ F T   + GPYG   G  F+ + +
Sbjct  317  KTEKIIFDYPSEILTHITGYYGPAMIMGPNIIQSLTFHTTKGKHGPYGEEQGQQFSTKLK  376

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G  IVGF GR G ++DA+G +
Sbjct  377  EGI-IVGFHGRKGLFLDALGVH  397



>ref|XP_006416472.1| hypothetical protein EUTSA_v10007145mg [Eutrema salsugineum]
 gb|ESQ34825.1| hypothetical protein EUTSA_v10007145mg [Eutrema salsugineum]
Length=594

 Score = 68.9 bits (167),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 72/145 (50%), Gaps = 9/145 (6%)
 Frame = -3

Query  666  GPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltiggggtdt  487
            GP G   G  W       + QIV+      + + I  I    +K GS       GG    
Sbjct  11   GPWGGQSGHAWDDGMFTTVRQIVV-----AHGSSIDSIQVEYDKNGSSVWSEKRGGKGG-  64

Query  486  TVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNF  307
               + D + +D   EYLT + GT+G F    +  +RS+ F +N +++GP+G   GT F  
Sbjct  65   --TKFDKVKLDYPHEYLTSVRGTYGSFDVWGHLCVRSLTFESNRKKYGPFGVESGTYFAL  122

Query  306  QAQNGAKIVGFFGRAGFYVDAIGTY  232
               + +KI+GF G+AG+YVDAIG +
Sbjct  123  PKLD-SKIIGFHGKAGWYVDAIGVH  146


 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 68/147 (46%), Gaps = 9/147 (6%)
 Frame = -3

Query  672  TYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltiggggt  493
            TYGP G  GG  +       I QI +       +  +   F      GSK     G    
Sbjct  236  TYGPWGGTGGIMFDDGIYTGIRQINLSRNVGIVSIKVCYDFRGQAVWGSKHGGRGG----  291

Query  492  dtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPF  313
                 + D I  D   E LT ++GT+GP M    NV++S+ F TN+ + GP+G   G  F
Sbjct  292  ----FKHDKIVFDYPSEVLTHVTGTYGPLMYMGPNVIKSLTFHTNLGKHGPFGEEQGPSF  347

Query  312  NFQAQNGAKIVGFFGRAGFYVDAIGTY  232
              +   G K+VGF GR G ++D+IG +
Sbjct  348  AHKIDEG-KVVGFLGREGLFLDSIGVH  373


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 4/85 (5%)
 Frame = -3

Query  480  IRSDTINIDGADEYLTEISGTFGPF--MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNF  307
            + +  I ++  +E LT ISG +GP    DRS NV++S+ F T+  ++GPYG   GT F  
Sbjct  491  VATHRIKLEYPNEMLTCISGYYGPLNNSDRS-NVVKSLCFFTSRGKYGPYGEETGTFFTS  549

Query  306  QAQNGAKIVGFFGRAGFYVDAIGTY  232
             A  G K++G  GR+  Y+DAIG +
Sbjct  550  TATEG-KVLGLHGRSSSYLDAIGVH  573



>gb|AGT16242.1| Jacalin-like lectin domain containing protein [Saccharum hybrid 
cultivar R570]
Length=561

 Score = 68.9 bits (167),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            G  E+L    GT GPF +   +V+ S+   TN R +GP+G   G PF    Q  + IVGF
Sbjct  454  GPSEFLMGAYGTRGPFTNSPADVVTSLTLVTNARSYGPFGHGGGRPFQVPMQGNSSIVGF  513

Query  273  FGRAGFYVDAIGTY  232
            FG AG Y+DAIG Y
Sbjct  514  FGCAGSYIDAIGVY  527



>gb|KCW69706.1| hypothetical protein EUGRSUZ_F03098 [Eucalyptus grandis]
Length=226

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = -3

Query  447  DEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFG  268
            DEYL  +SG   P +     V+RS+ F +N R FGP+G   GTPF+F +    +IVGF G
Sbjct  117  DEYLVSVSGYHCPVVHGGSPVIRSLTFKSNKRTFGPFGMEHGTPFSFPSD--GRIVGFKG  174

Query  267  RAGFYVDAIG  238
            R+G+Y+D+IG
Sbjct  175  RSGWYLDSIG  184



>ref|XP_010477195.1| PREDICTED: jacalin-related lectin 3-like isoform X2 [Camelina 
sativa]
Length=573

 Score = 68.9 bits (167),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 68/147 (46%), Gaps = 9/147 (6%)
 Frame = -3

Query  672  TYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltiggggt  493
            TYGP G  GG  +       I QI +       +  +   F      GSK   T G    
Sbjct  215  TYGPWGGTGGIMFDDGTYTGIRQINLSRSVGVVSMKVCYDFKGQAVWGSKHGGTGG----  270

Query  492  dtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPF  313
                 R D I  D   E LT ++GT+GP +    NV++S+ F TN  + GP+G   G  F
Sbjct  271  ----FRHDKIVFDYPSEVLTHVTGTYGPLVYLGPNVIKSLTFRTNKGKHGPFGEEHGPTF  326

Query  312  NFQAQNGAKIVGFFGRAGFYVDAIGTY  232
              +   G K+VGF GR G ++DAIG +
Sbjct  327  THKIDEG-KVVGFLGREGLFLDAIGVH  352


 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 52/81 (64%), Gaps = 1/81 (1%)
 Frame = -3

Query  474  SDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQN  295
            +D + +D   EYL  ++GT+G F       +RS+   +N R++GP+G   GT F    ++
Sbjct  46   TDNVKLDYPHEYLISVNGTYGSFDAWGNTCVRSLILESNHRKYGPFGCESGTFFAL-PKS  104

Query  294  GAKIVGFFGRAGFYVDAIGTY  232
            G+KI+GF G+AG+Y+DAIG +
Sbjct  105  GSKIIGFHGKAGWYIDAIGVH  125


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 59/105 (56%), Gaps = 6/105 (6%)
 Frame = -3

Query  480  IRSDTINIDGADEYLTEISGTFGPF--MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNF  307
            + +  I ++  +E LT ISG +GP    DRS NV++S+ F T+  ++GPYG   GT F  
Sbjct  470  VATHRIKLEYPNETLTCISGFYGPLNNSDRS-NVVKSLSFFTSRGKYGPYGEECGTFFTS  528

Query  306  QAQNGAKIVGFFGRAGFYVDAIGTYNA*LYGYSAAQCSLGTPLCF  172
               +G K++GF GR G  +DAIG +     G  ++  S  +  CF
Sbjct  529  TTTHG-KVLGFHGRCGCNLDAIGVHMQHWLGNKSSYVSRAS--CF  570



>ref|XP_004960703.1| PREDICTED: agglutinin-like [Setaria italica]
Length=321

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 78/151 (52%), Gaps = 10/151 (7%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            +  GP G NGG  W         ++  ++   G     G+ FS  N++G + T     G 
Sbjct  173  LKIGPCGGNGGVVWDIPGTPSPTRLESITISYGGVID-GIEFSYINQSGQRCTTGRWCGK  231

Query  495  tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYN-VLRSVKFTTNVREFGPYGPNVG-  322
              T   R+  IN+ G  E++ E+SGT G +  R YN ++R++   TNVR +GP+G  +  
Sbjct  232  GGT---RTQLINL-GPSEFVKEVSGTIGAY--RHYNNIIRTLAIVTNVRTYGPFGNQLNG  285

Query  321  -TPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
              PF+   QN + IVGFF R   ++DAIG Y
Sbjct  286  TAPFSIPVQNNSSIVGFFARGQQFLDAIGVY  316



>ref|XP_002461768.1| hypothetical protein SORBIDRAFT_02g007760 [Sorghum bicolor]
 gb|EER98289.1| hypothetical protein SORBIDRAFT_02g007760 [Sorghum bicolor]
Length=361

 Score = 68.6 bits (166),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 50/80 (63%), Gaps = 3/80 (4%)
 Frame = -3

Query  471  DTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNG  292
            +TI +    E +TE+SGT G F D +  V+ S+KF TN++ +GP+G     PF    Q G
Sbjct  225  ETIQL-AESEVVTEVSGTVGNFYDNT--VITSIKFVTNLQTYGPWGDGQDAPFTIPVQPG  281

Query  291  AKIVGFFGRAGFYVDAIGTY  232
            + IVGFF RAG  +DAIG Y
Sbjct  282  SGIVGFFARAGDCLDAIGVY  301



>ref|XP_010459648.1| PREDICTED: jacalin-related lectin 3 isoform X1 [Camelina sativa]
 ref|XP_010459649.1| PREDICTED: jacalin-related lectin 3 isoform X2 [Camelina sativa]
Length=570

 Score = 68.9 bits (167),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -3

Query  471  DTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNG  292
            D + +D   EYL  ++GT+G F       +RS+   +N R++GP+G   GT F    ++G
Sbjct  44   DNVKLDYPHEYLISVNGTYGSFDAWGNTCVRSLTLESNHRKYGPFGCESGTFFAL-PKSG  102

Query  291  AKIVGFFGRAGFYVDAIGTY  232
            +KI+GF G+AG+Y+DAIG +
Sbjct  103  SKIIGFHGKAGWYIDAIGVH  122


 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 68/147 (46%), Gaps = 9/147 (6%)
 Frame = -3

Query  672  TYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltiggggt  493
            TYGP G  GG  +       I QI +       +  +   F      GSK   T G    
Sbjct  212  TYGPWGGTGGIVFDDGIYTGIRQINLSRSVGVVSIKVCYDFKGQAVWGSKHGGTGG----  267

Query  492  dtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPF  313
                 R D I  D   E LT ++GT+GP +    NV++S+ F TN  + GP+G   G  F
Sbjct  268  ----FRHDKIVFDYPSEVLTHVTGTYGPLVYLGPNVIKSLTFRTNKGKHGPFGEEHGPTF  323

Query  312  NFQAQNGAKIVGFFGRAGFYVDAIGTY  232
              +   G K+VGF GR G ++DAIG +
Sbjct  324  THKIDEG-KVVGFLGREGLFLDAIGVH  349



>gb|EAZ25557.1| hypothetical protein OsJ_09383 [Oryza sativa Japonica Group]
Length=126

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = -3

Query  453  GADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGF  274
            G  E++T++ GT GPF   S +V+ S+ FTTN   +GP+G   GT F     +   IVGF
Sbjct  50   GPSEFVTKVYGTIGPFGKFS-SVITSIHFTTNADRYGPFGQGTGTRFEAPMHSDGSIVGF  108

Query  273  FGRAGFYVDAIGTY  232
            FGR   YVDAIG Y
Sbjct  109  FGRTSSYVDAIGFY  122



>emb|CBI19765.3| unnamed protein product [Vitis vinifera]
Length=670

 Score = 68.9 bits (167),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 74/148 (50%), Gaps = 9/148 (6%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I+ GP G   G  W     + + Q+VI      +   I  I    +K GS       GG 
Sbjct  41   ISVGPWGGQDGLRWDDGVYSTVRQLVI-----AHGVGIDSILIEYDKNGSSVWSEKHGGS  95

Query  495  tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTP  316
              T   R++ + +D  DE+LT I G +G  ++R    +RS+   +N R +GP+G   G  
Sbjct  96   GGT---RTNRVKLDSPDEFLTSIHGHYGSLLERGPVFVRSLTLESNKRTYGPFGIEQGIY  152

Query  315  FNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            F+     G KI+GF G++G+Y+DAIG +
Sbjct  153  FSLPT-TGGKIIGFHGKSGWYLDAIGVH  179


 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            R+D I ID   E LT I+G + P M    N+++S+ F T   ++GP+G   GTPF+   +
Sbjct  365  RNDKIVIDYPYEVLTHITGYYAPTMVMGPNIIKSLTFHTTKTKYGPFGEEQGTPFSSNIK  424

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
             G  IVGF GR G ++DAIG +
Sbjct  425  EGV-IVGFHGRTGLFIDAIGVH  445


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 48/79 (61%), Gaps = 2/79 (3%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPF-MDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGA  289
            + ++   E ++ I G +GP  ++  +N ++S+ F T+  ++GP+G  +GT F      G 
Sbjct  573  VKLEYPHEVVSCICGYYGPISINEPWNAIKSLTFYTSRGKYGPFGEEIGTYFTSTRTEG-  631

Query  288  KIVGFFGRAGFYVDAIGTY  232
            K+VGF GR+  Y+DAIG +
Sbjct  632  KVVGFHGRSSLYLDAIGVH  650



>ref|XP_011015046.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Populus 
euphratica]
 ref|XP_011015047.1| PREDICTED: mannose/glucose-specific lectin-like isoform X3 [Populus 
euphratica]
Length=445

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 75/153 (49%), Gaps = 11/153 (7%)
 Frame = -3

Query  690  EISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtlt  511
            +I   I+ GP G  GG  WS+     INQIVI  G          I S + +  +     
Sbjct  297  DIEGTISIGPWGGRGGSPWSYITNRGINQIVIHVGSN--------IKSISFRDTTGLDSA  348

Query  510  iggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGP  331
              GG     +    T+ I+   E+L  ISGT+G F   +   + S+ FTTN   +GP+G 
Sbjct  349  TFGGENPNDIGERKTVLINWPSEHLISISGTYGNF--STLLTITSLSFTTNRATYGPFGT  406

Query  330  NVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
              GTPF+    N   +VGF GRAG Y+DAIG +
Sbjct  407  GSGTPFSIPINNNT-VVGFHGRAGHYLDAIGIF  438


 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 74/148 (50%), Gaps = 11/148 (7%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSKdtltigggg  496
            I+ G  G  GGD +SFR  + I +I++  G          I S + K G+       GG 
Sbjct  156  ISVGQWGGPGGDPFSFRVGSWIKEIIVHEGTN--------IKSLSFKDGNGHEYGKFGGK  207

Query  495  tdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTP  316
                      I IDG  E+LT I+GT+G +      V+ S+ F TN+  +GP+G   GT 
Sbjct  208  NANDTGEERRIEIDGHSEHLTSITGTYGDYAGMV--VITSLAFQTNLTTYGPFGNATGTS  265

Query  315  FNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
            F+   + G+ + GF GR G Y+DAIG +
Sbjct  266  FSIPIE-GSVVTGFHGRGGHYLDAIGIH  292


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 70/152 (46%), Gaps = 17/152 (11%)
 Frame = -3

Query  675  ITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPI----GLIFSSTNKTGSKdtlti  508
            I+ GP G  GGD WS+R    I +IV+   G   +       GL+  +   TG+      
Sbjct  8    ISLGPWGGLGGDRWSYRASGGITEIVLRVEGNIKSISFKDASGLVSGTFGGTGNDPNDRG  67

Query  507  ggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPN  328
                      +   I I    E+L  ISGT G    +   V+ S+ F TN+  +GP+G  
Sbjct  68   ----------KEKKIAIQWPSEHLKSISGTCG--RCKGLLVITSLSFITNLTTYGPFGTA  115

Query  327  VGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTY  232
                F+    + + +VGF GR G+Y+DA+G +
Sbjct  116  ARETFSIPIAD-STVVGFHGRCGYYLDALGIF  146



>ref|XP_010110011.1| hypothetical protein L484_021900 [Morus notabilis]
 gb|EXC25029.1| hypothetical protein L484_021900 [Morus notabilis]
Length=826

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            R D I +D  DE+LT+ISG +G  + R   V++S+ F TN +++GP+G   G PF    +
Sbjct  437  RLDKITLDYPDEFLTQISGYYGSTIFRGPIVVKSLTFYTNKKKYGPFGDEQGIPFTSTQK  496

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
            +G  IVGF GR G+++D IG +
Sbjct  497  DGI-IVGFHGRKGWFLDCIGVH  517


 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 52/83 (63%), Gaps = 1/83 (1%)
 Frame = -3

Query  480  IRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQA  301
            +++D + +D  +EYL  ISG +G   +    V+RS+   +N + +GP+G   GT F+F A
Sbjct  66   VKTDKVKLDYPEEYLISISGYYGEISECGPVVVRSLLLESNKKRYGPFGFQKGTHFSF-A  124

Query  300  QNGAKIVGFFGRAGFYVDAIGTY  232
              G KIVGF GR+G  +D+IG +
Sbjct  125  LTGGKIVGFHGRSGHPLDSIGVH  147


 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 45/79 (57%), Gaps = 2/79 (3%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFGPFMDRSYN-VLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGA  289
            I  +   E LT ISG +G      Y  V++S+ F TN   +GPYG  +GT F   A+   
Sbjct  631  IQFEYPREVLTCISGYYGTIRGDEYKKVVKSLTFHTNRGRYGPYGEEIGTYFT-SAKTEG  689

Query  288  KIVGFFGRAGFYVDAIGTY  232
            KIVGF G++G Y+ AIG +
Sbjct  690  KIVGFHGKSGCYLYAIGVH  708



>gb|AHW81907.1| mannose-binding lectin [Morus alba var. atropurpurea]
Length=161

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 3/78 (4%)
 Frame = -3

Query  465  INIDGADEYLTEISGTFG--PFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNG  292
            I +D  +E+L  +SG  G  P +    +V+RS+ F TN + +GPYG   GTPF+   +NG
Sbjct  80   ITLDFPNEFLVSVSGYTGVLPRLATGKDVIRSLTFKTNKKTYGPYGTEEGTPFSLPIENG  139

Query  291  AKIVGFFGRAGFYVDAIG  238
              IVGF GR+G+ VDAIG
Sbjct  140  L-IVGFKGRSGYVVDAIG  156



>ref|XP_010654564.1| PREDICTED: jacalin-related lectin 19-like [Vitis vinifera]
Length=198

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++  + +   +E L  +SG + P +     V+RS+ F +N R FGP+G   GTPF+  + 
Sbjct  73   KTAEVKLQYPEEILISVSGHYCPVVYGGSPVIRSLTFKSNRRTFGPFGVEEGTPFSL-SM  131

Query  297  NGAKIVGFFGRAGFYVDAIG  238
            +G +IVGF GR+G+Y+DAIG
Sbjct  132  DGGRIVGFQGRSGWYLDAIG  151



>gb|AAM46813.1| hessian fly response gene 1 protein [Triticum aestivum]
Length=345

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 49/82 (60%), Gaps = 3/82 (4%)
 Frame = -3

Query  471  DTINIDGADEYLTEISGTFGPFMDR--SYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            DTI +    E +TE+SGT G F +    YN + S+  TTN R +GP+G    TPF+   Q
Sbjct  258  DTIEL-APSEIVTEVSGTVGIFAEDNVEYNAIASLTITTNHRPYGPFGETQSTPFSVPVQ  316

Query  297  NGAKIVGFFGRAGFYVDAIGTY  232
            +   IVGFF  AG YV+A+G Y
Sbjct  317  DNNNIVGFFACAGKYVEALGVY  338



>ref|XP_008677993.1| PREDICTED: mannose/glucose-specific lectin-like isoform X5 [Zea 
mays]
Length=703

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFGR  265
            E+LT +SG+ G F   + NV+ S+ F TN R +GP+G   GT F+   Q    IVGFFGR
Sbjct  460  EFLTGVSGSIGTFNGHA-NVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGR  518

Query  264  AGFYVDAIGTYNA  226
            +G Y++AIG Y A
Sbjct  519  SGRYLNAIGVYTA  531


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 3/75 (4%)
 Frame = -3

Query  447  DEYLTEISGTFGPFM-DRSY-NVLRSVKFTTNV-REFGPYGPNVGTPFNFQAQNGAKIVG  277
            +E++ E++GTF P   DR+  +V+ S+   T+  +  GP+G  +G  F    Q+ ++IVG
Sbjct  619  EEFIVEVTGTFHPCAWDRTIPSVVSSLTLVTSTGKTHGPFGTQLGAAFQVPVQSDSRIVG  678

Query  276  FFGRAGFYVDAIGTY  232
            FF     Y++AIG Y
Sbjct  679  FFAHGDNYIEAIGAY  693



>emb|CDX82115.1| BnaC02g21750D [Brassica napus]
Length=250

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = -3

Query  477  RSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQ  298
            ++  I +   +EYL  +SG + P +     V+RS+ F +N + +GPYG   GTPF+F   
Sbjct  145  KTTQIKLQYPEEYLIGVSGYYCPVVHSGTPVIRSMTFKSNKQVYGPYGVEQGTPFSFSV-  203

Query  297  NGAKIVGFFGRAGFYVDAIG  238
            NG +IVG  GR+ +Y+D+IG
Sbjct  204  NGGRIVGMNGRSSWYLDSIG  223



>ref|XP_008677995.1| PREDICTED: mannose/glucose-specific lectin-like isoform X7 [Zea 
mays]
Length=680

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = -3

Query  444  EYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFFGR  265
            E+LT +SG+ G F   + NV+ S+ F TN R +GP+G   GT F+   Q    IVGFFGR
Sbjct  437  EFLTGVSGSIGTFNGHA-NVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGR  495

Query  264  AGFYVDAIGTYNA  226
            +G Y++AIG Y A
Sbjct  496  SGRYLNAIGVYTA  508


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 3/75 (4%)
 Frame = -3

Query  447  DEYLTEISGTFGPFM-DRSY-NVLRSVKFTTNV-REFGPYGPNVGTPFNFQAQNGAKIVG  277
            +E++ E++GTF P   DR+  +V+ S+   T+  +  GP+G  +G  F    Q+ ++IVG
Sbjct  596  EEFIVEVTGTFHPCAWDRTIPSVVSSLTLVTSTGKTHGPFGTQLGAAFQVPVQSDSRIVG  655

Query  276  FFGRAGFYVDAIGTY  232
            FF     Y++AIG Y
Sbjct  656  FFAHGDNYIEAIGAY  670



>ref|XP_009614721.1| PREDICTED: jacalin-related lectin 19 [Nicotiana tomentosiformis]
Length=221

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/159 (30%), Positives = 78/159 (49%), Gaps = 9/159 (6%)
 Frame = -3

Query  702  QETMEISTDITYGPLGHNGGDFWSFRPMNKINQIVILSggpgnnnPIGLIFSSTNKTGSK  523
            ++  E+   I  GP G +GG  W       + +I ++     ++  +  ++    K    
Sbjct  9    EQAGELKKRIVVGPWGGHGGSPWDDGGFTGVREITLVYSLCIDSMTV--VYDQNGKPYKA  66

Query  522  dtltiggggtdtTVIRSDTINIDGADEYLTEISGTFGPFMDRSYNVLRSVKFTTNVREFG  343
            +     GG       ++  I +    EYLT +SG + P +     V+RS+ F++N R FG
Sbjct  67   EKHGGVGGS------KTAQIKLQFPGEYLTGVSGYYCPVVYGGSPVIRSLTFSSNRRTFG  120

Query  342  PYGPNVGTPFNFQAQNGAKIVGFFGRAGFYVDAIGTYNA  226
            P+G   GT F+   + G +IVGF GR+G+Y+DAI  Y A
Sbjct  121  PFGVEEGTRFSLPME-GGQIVGFKGRSGWYLDAICCYIA  158



>ref|NP_001068257.2| Os11g0607900 [Oryza sativa Japonica Group]
 dbj|BAF28620.2| Os11g0607900, partial [Oryza sativa Japonica Group]
Length=107

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 41/73 (56%), Gaps = 4/73 (5%)
 Frame = -3

Query  447  DEYLTEISGTFGPFMDRSYNVL-RSVKFTTNVREFGPYGPNVGTPFNFQAQNGAKIVGFF  271
             EYLT ISGT        Y V+  S+   TN R +GPYG   GTPF    Q    IVGFF
Sbjct  23   SEYLTGISGTIA---SSPYGVIITSLTLVTNTRTYGPYGQVGGTPFQIPIQIKGSIVGFF  79

Query  270  GRAGFYVDAIGTY  232
            GR G+YVDA G Y
Sbjct  80   GRVGWYVDAFGIY  92



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1819952291484