BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18895_g1_i1 len=999 path=[3849:0-178 1213:179-216 4268:217-998]

Length=999
                                                                      Score     E

gb|AFU07481.1|  phosphate transporter                                   388   1e-127   
emb|CDO99227.1|  unnamed protein product                                377   3e-125   
gb|ABS12068.1|  high affinity phosphate transporter                     379   2e-124   Petunia x hybrida [garden petunia]
gb|ACB37438.1|  phosphate transporter 1                                 370   2e-124   Petunia x hybrida [garden petunia]
ref|XP_002524622.1|  inorganic phosphate transporter, putative          375   1e-122   Ricinus communis
dbj|BAA20522.1|  phosphate transporter                                  375   2e-122   Catharanthus roseus [chatas]
gb|ADL27918.1|  phosphate transporter 1                                 374   3e-122   
gb|KDP26541.1|  hypothetical protein JCGZ_17699                         374   4e-122   
gb|ABK63963.1|  PT3                                                     373   4e-122   Solanum melongena [aubergine]
ref|XP_011091219.1|  PREDICTED: inorganic phosphate transporter 1...    373   6e-122   
emb|CAC87043.1|  transmembrane protein                                  372   1e-121   Solanum tuberosum [potatoes]
gb|AAV97729.1|  phosphate transporter 3                                 372   2e-121   Solanum lycopersicum
ref|XP_004247729.1|  PREDICTED: inorganic phosphate transporter 1...    372   2e-121   
gb|ACB37440.1|  phosphate transporter 3                                 372   2e-121   Petunia x hybrida [garden petunia]
ref|XP_006354489.1|  PREDICTED: inorganic phosphate transporter 1...    372   2e-121   
ref|XP_009623393.1|  PREDICTED: inorganic phosphate transporter 1...    371   4e-121   
ref|XP_010519113.1|  PREDICTED: probable inorganic phosphate tran...    371   4e-121   
gb|AIY53213.1|  phosphate transporter                                   371   5e-121   
ref|XP_010111916.1|  putative inorganic phosphate transporter 1-7       370   7e-121   
gb|EYU18330.1|  hypothetical protein MIMGU_mgv1a004164mg                370   1e-120   
gb|ABK63964.2|  PT3                                                     370   1e-120   Nicotiana tabacum [American tobacco]
ref|XP_011073524.1|  PREDICTED: inorganic phosphate transporter 1...    370   1e-120   
gb|ABK63959.1|  PT1                                                     370   1e-120   Solanum melongena [aubergine]
ref|XP_009765235.1|  PREDICTED: probable inorganic phosphate tran...    369   2e-120   
ref|XP_006354490.1|  PREDICTED: inorganic phosphate transporter 1...    369   2e-120   
gb|AIU41748.1|  phosphorus transporter PT3                              369   2e-120   
ref|XP_010262309.1|  PREDICTED: inorganic phosphate transporter 1...    369   4e-120   
dbj|BAE98881.1|  phosphate transporter                                  365   4e-120   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001275200.1|  inorganic phosphate transporter                    369   4e-120   
gb|AAZ23928.1|  At3g54700                                               365   5e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010274782.1|  PREDICTED: inorganic phosphate transporter 1...    368   7e-120   
emb|CAA67395.1|  inorganic phosphate transporter 1                      367   1e-119   Solanum tuberosum [potatoes]
gb|AAB82146.1|  inorganic phosphate transporter                         367   2e-119   Solanum lycopersicum
ref|NP_001234361.1|  uncharacterized protein LOC544136                  367   2e-119   
ref|XP_009622805.1|  PREDICTED: inorganic phosphate transporter 1...    366   3e-119   
ref|XP_004289933.1|  PREDICTED: probable inorganic phosphate tran...    366   3e-119   
gb|ABK63962.1|  PT3                                                     366   3e-119   Capsicum frutescens [bird pepper]
ref|XP_009141774.1|  PREDICTED: inorganic phosphate transporter 1-4     366   4e-119   
ref|XP_006411118.1|  hypothetical protein EUTSA_v10016497mg             365   5e-119   
ref|XP_002306845.1|  phosphate transporter 1 family protein             365   6e-119   Populus trichocarpa [western balsam poplar]
gb|AIY53214.1|  phosphate transporter                                   365   6e-119   
ref|XP_010104731.1|  putative inorganic phosphate transporter 1-7       365   9e-119   
ref|XP_009354937.1|  PREDICTED: inorganic phosphate transporter 1-4     365   9e-119   
ref|XP_002285153.1|  PREDICTED: inorganic phosphate transporter 1...    365   1e-118   Vitis vinifera
ref|XP_007050310.1|  Phosphate transporter 1,4                          365   1e-118   
ref|XP_010555844.1|  PREDICTED: inorganic phosphate transporter 1...    364   2e-118   
ref|XP_002877995.1|  inorganic phosphate transporter 1-7 /Pi cotr...    364   2e-118   
ref|XP_009143350.1|  PREDICTED: inorganic phosphate transporter 1...    364   2e-118   
ref|NP_191030.3|  phosphate transporter 1;7                             364   2e-118   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181428.1|  inorganic phosphate transporter 1-4                   364   2e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009143351.1|  PREDICTED: inorganic phosphate transporter 1...    363   3e-118   
emb|CDX76138.1|  BnaA04g04020D                                          363   3e-118   
ref|XP_009369491.1|  PREDICTED: probable inorganic phosphate tran...    363   3e-118   
ref|XP_002524621.1|  inorganic phosphate transporter, putative          363   3e-118   Ricinus communis
gb|AIU41746.1|  phosphorus transporter PT1                              363   3e-118   
ref|XP_009139223.1|  PREDICTED: probable inorganic phosphate tran...    363   4e-118   
ref|XP_010516009.1|  PREDICTED: probable inorganic phosphate tran...    363   4e-118   
ref|XP_010039303.1|  PREDICTED: inorganic phosphate transporter 1...    363   4e-118   
ref|XP_010427180.1|  PREDICTED: probable inorganic phosphate tran...    363   4e-118   
gb|EPS70986.1|  phosphate transporter                                   362   5e-118   
ref|XP_011025992.1|  PREDICTED: inorganic phosphate transporter 1...    363   6e-118   
gb|AFK82642.1|  phosphate transporter                                   357   7e-118   
gb|AFY06658.1|  phosphate transporter                                   363   7e-118   
ref|XP_010509096.1|  PREDICTED: inorganic phosphate transporter 1...    362   7e-118   
ref|XP_010517220.1|  PREDICTED: inorganic phosphate transporter 1...    362   8e-118   
gb|ACJ83774.1|  unknown                                                 354   9e-118   Medicago truncatula
ref|XP_010553420.1|  PREDICTED: inorganic phosphate transporter 1-4     362   1e-117   
emb|CAN76105.1|  hypothetical protein VITISV_020362                     362   1e-117   Vitis vinifera
ref|XP_010517219.1|  PREDICTED: inorganic phosphate transporter 1...    362   1e-117   
emb|CDY13225.1|  BnaC04g26100D                                          361   1e-117   
ref|XP_009143348.1|  PREDICTED: inorganic phosphate transporter 1...    362   1e-117   
ref|XP_010504284.1|  PREDICTED: probable inorganic phosphate tran...    362   1e-117   
ref|XP_006292723.1|  hypothetical protein CARUB_v10018969mg             362   2e-117   
ref|XP_002879774.1|  hypothetical protein ARALYDRAFT_482913             362   2e-117   
gb|ABK63958.1|  PT1                                                     362   2e-117   Capsicum frutescens [bird pepper]
ref|XP_008372094.1|  PREDICTED: inorganic phosphate transporter 1-4     362   2e-117   
gb|AAF74025.1|AF156696_1  inorganic phosphate transporter               361   2e-117   Nicotiana tabacum [American tobacco]
ref|XP_006293978.1|  hypothetical protein CARUB_v10022969mg             361   2e-117   
ref|XP_009765236.1|  PREDICTED: inorganic phosphate transporter 1...    361   2e-117   
ref|XP_006403546.1|  hypothetical protein EUTSA_v10010274mg             361   4e-117   
emb|CAC28219.1|  phosphate transporter                                  361   4e-117   Sesbania rostrata
ref|XP_004296364.1|  PREDICTED: probable inorganic phosphate tran...    361   4e-117   
emb|CDX91503.1|  BnaC04g06470D                                          360   4e-117   
ref|XP_008235689.1|  PREDICTED: inorganic phosphate transporter 1-4     361   4e-117   
gb|EPS70401.1|  inorganic phosphate transporter                         360   5e-117   
gb|AFK45744.1|  unknown                                                 350   5e-117   
ref|XP_008349062.1|  PREDICTED: inorganic phosphate transporter 1-4     360   7e-117   
gb|AFU50504.1|  phosphate transporter 5                                 360   8e-117   
ref|XP_011091218.1|  PREDICTED: inorganic phosphate transporter 1...    359   1e-116   
gb|KHN00295.1|  Putative inorganic phosphate transporter 1-7            359   1e-116   
ref|XP_010037981.1|  PREDICTED: inorganic phosphate transporter 1...    360   1e-116   
ref|NP_001241164.1|  probable inorganic phosphate transporter 1-7...    359   1e-116   
gb|KEH42530.1|  high affinity inorganic phosphate transporter           359   1e-116   
dbj|BAB21545.1|  phosphate transporter                                  359   1e-116   Nicotiana tabacum [American tobacco]
ref|XP_007199786.1|  hypothetical protein PRUPE_ppa003959mg             359   2e-116   
gb|AGH28094.1|  phosphate transporter 1                                 358   3e-116   
gb|ACY74618.1|  phosphate transporter1-7                                358   4e-116   
gb|KHN02509.1|  Putative inorganic phosphate transporter 1-7            358   4e-116   
ref|XP_002285145.1|  PREDICTED: inorganic phosphate transporter 1...    358   6e-116   Vitis vinifera
ref|NP_001254802.1|  probable inorganic phosphate transporter 1-7...    358   6e-116   
emb|CAC28218.1|  phosphate transporter                                  357   7e-116   Sesbania rostrata
gb|ACY74613.1|  phosphate transporter1-2                                357   7e-116   
ref|XP_003521286.1|  PREDICTED: probable inorganic phosphate tran...    357   8e-116   
dbj|BAE93351.1|  phosphate transporter                                  357   9e-116   Lotus japonicus
emb|CDX73457.1|  BnaC08g25460D                                          357   1e-115   
ref|XP_009116146.1|  PREDICTED: probable inorganic phosphate tran...    357   1e-115   
ref|XP_003535748.1|  PREDICTED: inorganic phosphate transporter 1-4     357   1e-115   
gb|ACY74614.1|  phosphate transporter1-3                                357   1e-115   
ref|XP_003537012.1|  PREDICTED: inorganic phosphate transporter 1-4     356   1e-115   
gb|AGX93242.1|  inorganic phosphate transporter 5 like-protein          357   1e-115   
gb|AAN59904.1|  phosphate transporter                                   345   2e-115   Medicago sativa [alfalfa]
ref|XP_008364261.1|  PREDICTED: inorganic phosphate transporter 1-4     356   3e-115   
ref|XP_008381907.1|  PREDICTED: inorganic phosphate transporter 1...    356   3e-115   
ref|XP_002862760.1|  hypothetical protein ARALYDRAFT_497304             354   3e-115   
ref|XP_002531532.1|  inorganic phosphate transporter, putative          355   5e-115   Ricinus communis
ref|XP_007145846.1|  hypothetical protein PHAVU_007G2732000g            355   6e-115   
ref|XP_004495103.1|  PREDICTED: probable inorganic phosphate tran...    355   8e-115   
ref|XP_009132907.1|  PREDICTED: probable inorganic phosphate tran...    355   9e-115   
gb|ACD14299.1|  phosphate transporter 1                                 354   1e-114   
ref|XP_003590758.1|  Inorganic phosphate transporter 1-4                354   1e-114   
ref|XP_007162540.1|  hypothetical protein PHAVU_001G160600g             354   1e-114   
ref|XP_002862761.1|  predicted protein                                  346   1e-114   
gb|ACY74615.1|  phosphate transporter1-4                                353   2e-114   
gb|AAK38196.1|AF305623_1  phosphate transporter 1                       354   2e-114   Lupinus albus
dbj|BAE93352.1|  phosphate transporter                                  354   2e-114   Lotus japonicus
ref|XP_002865427.1|  hypothetical protein ARALYDRAFT_494662             349   2e-114   
ref|XP_004493772.1|  PREDICTED: inorganic phosphate transporter 1...    353   3e-114   
ref|XP_010274777.1|  PREDICTED: inorganic phosphate transporter 1...    353   3e-114   
ref|XP_004497842.1|  PREDICTED: probable inorganic phosphate tran...    354   3e-114   
ref|XP_010274776.1|  PREDICTED: inorganic phosphate transporter 1...    354   3e-114   
ref|XP_011025988.1|  PREDICTED: inorganic phosphate transporter 1...    353   3e-114   
gb|KEH23921.1|  high affinity inorganic phosphate transporter           353   4e-114   
ref|XP_002306844.2|  phosphate transporter 1 family protein             353   4e-114   Populus trichocarpa [western balsam poplar]
ref|XP_007144085.1|  hypothetical protein PHAVU_007G127400g             353   4e-114   
ref|XP_006378341.1|  hypothetical protein POPTR_0010s08240g             353   5e-114   
gb|AFK47605.1|  unknown                                                 353   6e-114   
ref|NP_180842.1|  putative inorganic phosphate transporter 1-5          352   8e-114   Arabidopsis thaliana [mouse-ear cress]
emb|CDX79505.1|  BnaC03g18410D                                          353   8e-114   
ref|XP_002315705.1|  phosphate transporter 2 family protein             352   1e-113   Populus trichocarpa [western balsam poplar]
ref|XP_006378342.1|  phosphate transporter 2 family protein             352   1e-113   
gb|AAK01938.1|  phosphate transporter 1                                 352   1e-113   Lupinus albus
ref|XP_009616492.1|  PREDICTED: inorganic phosphate transporter 1...    351   2e-113   
ref|XP_007222371.1|  hypothetical protein PRUPE_ppa004004mg             351   2e-113   
ref|XP_010494321.1|  PREDICTED: probable inorganic phosphate tran...    350   3e-113   
ref|XP_002279070.1|  PREDICTED: probable inorganic phosphate tran...    350   3e-113   Vitis vinifera
ref|XP_002881246.1|  hypothetical protein ARALYDRAFT_482224             351   3e-113   
ref|XP_002281264.1|  PREDICTED: probable inorganic phosphate tran...    350   4e-113   Vitis vinifera
gb|EYU46460.1|  hypothetical protein MIMGU_mgv1a025868mg                350   4e-113   
ref|XP_004495320.1|  PREDICTED: probable inorganic phosphate tran...    350   5e-113   
gb|EYU17912.1|  hypothetical protein MIMGU_mgv1a004397mg                350   6e-113   
ref|XP_009378993.1|  PREDICTED: probable inorganic phosphate tran...    350   6e-113   
ref|XP_011030507.1|  PREDICTED: probable inorganic phosphate tran...    350   6e-113   
ref|XP_008224362.1|  PREDICTED: probable inorganic phosphate tran...    350   6e-113   
ref|XP_010442030.1|  PREDICTED: probable inorganic phosphate tran...    349   7e-113   
ref|XP_008375348.1|  PREDICTED: probable inorganic phosphate tran...    349   8e-113   
ref|XP_008231651.1|  PREDICTED: LOW QUALITY PROTEIN: probable ino...    349   9e-113   
ref|XP_007035101.1|  Phosphate transporter 1,7 isoform 1                349   1e-112   
ref|XP_010556904.1|  PREDICTED: probable inorganic phosphate tran...    349   1e-112   
ref|XP_006296200.1|  hypothetical protein CARUB_v10025365mg             349   1e-112   
ref|XP_007219001.1|  hypothetical protein PRUPE_ppa004176mg             349   1e-112   
ref|XP_010442029.1|  PREDICTED: probable inorganic phosphate tran...    348   1e-112   
ref|XP_009765017.1|  PREDICTED: inorganic phosphate transporter 1...    349   1e-112   
ref|XP_002862864.1|  hypothetical protein ARALYDRAFT_920199             347   1e-112   
ref|XP_009612775.1|  PREDICTED: probable inorganic phosphate tran...    348   2e-112   
ref|XP_010556901.1|  PREDICTED: probable inorganic phosphate tran...    348   2e-112   
gb|KDP40326.1|  hypothetical protein JCGZ_02324                         348   2e-112   
ref|XP_010442028.1|  PREDICTED: probable inorganic phosphate tran...    348   2e-112   
gb|AAQ67368.1|  high-affinity phosphate transporter                     343   2e-112   Medicago sativa [alfalfa]
ref|XP_010442027.1|  PREDICTED: probable inorganic phosphate tran...    348   2e-112   
ref|XP_010494314.1|  PREDICTED: probable inorganic phosphate tran...    348   2e-112   
ref|XP_010484866.1|  PREDICTED: inorganic phosphate transporter 1...    350   3e-112   
dbj|BAB21563.1|  phosphate transporter                                  348   3e-112   Nicotiana tabacum [American tobacco]
gb|KDO57607.1|  hypothetical protein CISIN_1g0100763mg                  347   3e-112   
ref|XP_003590039.1|  Inorganic phosphate transporter 1-1                348   3e-112   
gb|AFU50501.1|  phosphate transporter 2                                 348   3e-112   
gb|AFY06657.1|  phosphate transporter                                   347   4e-112   
ref|XP_007199605.1|  hypothetical protein PRUPE_ppa024435mg             347   4e-112   
gb|ABK63961.1|  PT2                                                     347   4e-112   Solanum melongena [aubergine]
ref|XP_009626859.1|  PREDICTED: probable inorganic phosphate tran...    347   4e-112   
ref|XP_009133318.1|  PREDICTED: inorganic phosphate transporter 1-4     348   4e-112   
ref|XP_008235688.1|  PREDICTED: inorganic phosphate transporter 1...    347   4e-112   
ref|XP_006420214.1|  hypothetical protein CICLE_v10004694mg             347   5e-112   
ref|XP_006410416.1|  hypothetical protein EUTSA_v10016483mg             347   6e-112   
ref|XP_009372790.1|  PREDICTED: LOW QUALITY PROTEIN: probable ino...    347   7e-112   
ref|XP_002865428.1|  hypothetical protein ARALYDRAFT_331059             347   7e-112   
ref|XP_011083022.1|  PREDICTED: inorganic phosphate transporter 1-4     347   7e-112   
ref|XP_006281683.1|  hypothetical protein CARUB_v10027822mg             347   9e-112   
emb|CDY60902.1|  BnaCnng37050D                                          348   1e-111   
ref|XP_010442032.1|  PREDICTED: probable inorganic phosphate tran...    347   1e-111   
ref|NP_199151.1|  phosphate transporter Pht1;2                          346   1e-111   Arabidopsis thaliana [mouse-ear cress]
gb|EPS62255.1|  hypothetical protein M569_12534                         346   1e-111   
ref|NP_001234043.1|  inorganic phosphate transporter                    346   1e-111   
ref|NP_199150.1|  putative inorganic phosphate transporter 1-3          346   2e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003590043.1|  Inorganic phosphate transporter 1-1                346   2e-111   
gb|AAB69122.1|  putative proton/phosphate cotransporter                 346   2e-111   Arabidopsis thaliana [mouse-ear cress]
gb|AIU41747.1|  phosphorus transporter PT2                              346   2e-111   
gb|AIY53215.1|  phosphate transporter                                   346   2e-111   
ref|XP_002863661.1|  hypothetical protein ARALYDRAFT_494664             346   2e-111   
dbj|BAB21562.1|  phosphate transporter                                  345   2e-111   Nicotiana tabacum [American tobacco]
ref|XP_009101789.1|  PREDICTED: probable inorganic phosphate tran...    345   3e-111   
ref|XP_009765015.1|  PREDICTED: probable inorganic phosphate tran...    345   3e-111   
ref|XP_006356062.1|  PREDICTED: probable inorganic phosphate tran...    345   3e-111   
ref|XP_006489740.1|  PREDICTED: probable inorganic phosphate tran...    345   3e-111   
gb|AAL49927.1|  putative phosphate transporter protein                  345   4e-111   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199149.1|  inorganic phosphate transporter 1-1                   345   4e-111   Arabidopsis thaliana [mouse-ear cress]
gb|ABK63960.1|  PT2                                                     345   4e-111   Capsicum frutescens [bird pepper]
ref|XP_003590037.1|  Inorganic phosphate transporter 1-1                345   4e-111   
ref|XP_010442026.1|  PREDICTED: probable inorganic phosphate tran...    345   5e-111   
ref|XP_002300153.2|  inorganic phosphate transporter family protein     345   5e-111   Populus trichocarpa [western balsam poplar]
ref|XP_009113997.1|  PREDICTED: probable inorganic phosphate tran...    344   6e-111   
emb|CDY22352.1|  BnaA06g36740D                                          345   6e-111   
ref|XP_006282074.1|  hypothetical protein CARUB_v10028320mg             344   6e-111   
emb|CAA68945.1|  phosphate transporter                                  344   6e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002518044.1|  inorganic phosphate transporter, putative          345   7e-111   Ricinus communis
ref|XP_006282331.1|  hypothetical protein CARUB_v10028623mg             345   8e-111   
ref|XP_010494317.1|  PREDICTED: probable inorganic phosphate tran...    344   9e-111   
emb|CDO99226.1|  unnamed protein product                                344   9e-111   
ref|XP_009123889.1|  PREDICTED: probable inorganic phosphate tran...    344   1e-110   
ref|XP_009101790.1|  PREDICTED: probable inorganic phosphate tran...    344   1e-110   
emb|CAA67396.1|  inorganic phosphate transporter 2                      344   1e-110   Solanum tuberosum [potatoes]
emb|CDP10457.1|  unnamed protein product                                336   1e-110   
gb|ABP52096.1|  phosphate transporter                                   344   1e-110   Phaseolus vulgaris [French bean]
ref|XP_006443849.1|  hypothetical protein CICLE_v100196272mg            344   2e-110   
gb|AHL69789.1|  phosphate transporter                                   343   2e-110   
ref|XP_008356174.1|  PREDICTED: uncharacterized protein LOC103419864    356   2e-110   
gb|AAB81346.1|  phosphate transporter                                   343   2e-110   Medicago truncatula
ref|XP_010494318.1|  PREDICTED: probable inorganic phosphate tran...    342   3e-110   
emb|CAA68946.1|  phosphate transporter                                  343   3e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006356063.1|  PREDICTED: probable inorganic phosphate tran...    343   3e-110   
ref|XP_006356064.1|  PREDICTED: probable inorganic phosphate tran...    342   3e-110   
ref|XP_011028798.1|  PREDICTED: inorganic phosphate transporter 1-4     342   4e-110   
ref|XP_011045612.1|  PREDICTED: probable inorganic phosphate tran...    343   4e-110   
gb|AFD10412.1|  phosphate transporter protein                           341   5e-110   
ref|XP_011073523.1|  PREDICTED: probable inorganic phosphate tran...    342   5e-110   
ref|XP_009397891.1|  PREDICTED: probable inorganic phosphate tran...    342   8e-110   
ref|XP_009773764.1|  PREDICTED: inorganic phosphate transporter 1...    342   8e-110   
ref|XP_009361891.1|  PREDICTED: probable inorganic phosphate tran...    341   9e-110   
ref|XP_006403254.1|  hypothetical protein EUTSA_v10003183mg             341   1e-109   
gb|AGK29560.1|  phosphate transporter 1                                 341   1e-109   
gb|ADA83723.1|  PT1                                                     342   1e-109   Manihot esculenta [manioc]
ref|XP_008438529.1|  PREDICTED: probable inorganic phosphate tran...    341   2e-109   
ref|XP_004157696.1|  PREDICTED: probable inorganic phosphate tran...    337   2e-109   
ref|NP_001240239.1|  probable inorganic phosphate transporter 1-7...    341   2e-109   
ref|XP_010494316.1|  PREDICTED: probable inorganic phosphate tran...    340   2e-109   
ref|XP_010442031.1|  PREDICTED: probable inorganic phosphate tran...    340   2e-109   
gb|KFK32097.1|  hypothetical protein AALP_AA6G198600                    331   2e-109   
ref|XP_006282173.1|  hypothetical protein CARUB_v10028434mg             340   3e-109   
ref|XP_009123893.1|  PREDICTED: probable inorganic phosphate tran...    340   3e-109   
gb|AEA76640.1|  phosphate transporter                                   340   3e-109   
ref|NP_001240032.1|  probable inorganic phosphate transporter 1-7...    340   3e-109   
ref|XP_009624037.1|  PREDICTED: probable inorganic phosphate tran...    340   6e-109   
ref|XP_002302047.1|  phosphate transporter 1 family protein             339   6e-109   Populus trichocarpa [western balsam poplar]
ref|XP_010556903.1|  PREDICTED: probable inorganic phosphate tran...    339   8e-109   
ref|XP_006827470.1|  hypothetical protein AMTR_s00009p00128300          339   1e-108   
gb|KCW60352.1|  hypothetical protein EUGRSUZ_H03069                     335   1e-108   
ref|XP_006403248.1|  hypothetical protein EUTSA_v10003184mg             338   1e-108   
gb|KFK31723.1|  hypothetical protein AALP_AA6G150600                    338   2e-108   
gb|KFK31722.1|  hypothetical protein AALP_AA6G150500                    338   2e-108   
ref|XP_007144903.1|  hypothetical protein PHAVU_007G1932000g            337   2e-108   
ref|XP_006403250.1|  hypothetical protein EUTSA_v10003336mg             337   2e-108   
ref|XP_006403253.1|  hypothetical protein EUTSA_v10003187mg             338   2e-108   
gb|EYU18338.1|  hypothetical protein MIMGU_mgv1a017891mg                338   2e-108   
ref|XP_011080302.1|  PREDICTED: inorganic phosphate transporter 1...    337   3e-108   
ref|XP_009397534.1|  PREDICTED: probable inorganic phosphate tran...    338   3e-108   
ref|XP_004134411.1|  PREDICTED: probable inorganic phosphate tran...    337   4e-108   
ref|XP_010484867.1|  PREDICTED: probable inorganic phosphate tran...    341   6e-108   
ref|XP_010556902.1|  PREDICTED: probable inorganic phosphate tran...    336   7e-108   
ref|XP_009101973.1|  PREDICTED: probable inorganic phosphate tran...    336   1e-107   
ref|XP_007034263.1|  Phosphate transporter 1,5                          336   2e-107   
ref|XP_010023955.1|  PREDICTED: inorganic phosphate transporter 1...    335   2e-107   
gb|EYU18333.1|  hypothetical protein MIMGU_mgv1a023891mg                335   3e-107   
ref|XP_010023959.1|  PREDICTED: probable inorganic phosphate tran...    335   4e-107   
gb|EYU18331.1|  hypothetical protein MIMGU_mgv1a026453mg                335   4e-107   
gb|EYU18332.1|  hypothetical protein MIMGU_mgv1a023630mg                335   5e-107   
ref|XP_009123897.1|  PREDICTED: probable inorganic phosphate tran...    335   5e-107   
ref|XP_009123895.1|  PREDICTED: probable inorganic phosphate tran...    335   5e-107   
ref|XP_009114028.1|  PREDICTED: probable inorganic phosphate tran...    334   8e-107   
ref|XP_008447657.1|  PREDICTED: inorganic phosphate transporter 1-4     334   1e-106   
emb|CAA74607.1|  phosphate transporter                                  333   2e-106   Solanum lycopersicum
emb|CDY14883.1|  BnaA02g22250D                                          333   2e-106   
gb|EYU18336.1|  hypothetical protein MIMGU_mgv1a020260mg                332   3e-106   
ref|XP_010326448.1|  PREDICTED: inorganic phosphate transporter 1...    330   3e-106   
ref|XP_011030504.1|  PREDICTED: inorganic phosphate transporter 1...    332   4e-106   
gb|AIU41751.1|  phosphorus transporter PT7                              332   7e-106   
ref|XP_008787383.1|  PREDICTED: inorganic phosphate transporter 1...    332   1e-105   
ref|XP_009143349.1|  PREDICTED: inorganic phosphate transporter 1...    331   1e-105   
gb|EYU18335.1|  hypothetical protein MIMGU_mgv1a019231mg                331   1e-105   
ref|XP_010940611.1|  PREDICTED: inorganic phosphate transporter 1...    331   1e-105   
ref|XP_010935743.1|  PREDICTED: inorganic phosphate transporter 1...    331   1e-105   
gb|AGB58340.1|  putative high affinity phosphate transporter            322   2e-105   
dbj|BAE79506.1|  phosphate transporter                                  330   2e-105   
ref|XP_010918806.1|  PREDICTED: probable inorganic phosphate tran...    330   2e-105   
gb|EYU18334.1|  hypothetical protein MIMGU_mgv1a018422mg                330   3e-105   
ref|XP_003601529.1|  Inorganic phosphate transporter 1-4                330   3e-105   
emb|CDY62546.1|  BnaC03g72240D                                          330   3e-105   
ref|XP_011069904.1|  PREDICTED: inorganic phosphate transporter 1...    329   4e-105   
ref|XP_009400918.1|  PREDICTED: probable inorganic phosphate tran...    330   5e-105   
ref|XP_004247235.1|  PREDICTED: inorganic phosphate transporter 1...    330   5e-105   
ref|XP_008363272.1|  PREDICTED: LOW QUALITY PROTEIN: probable ino...    329   5e-105   
ref|XP_002531531.1|  inorganic phosphate transporter, putative          329   6e-105   
ref|XP_010262308.1|  PREDICTED: inorganic phosphate transporter 1...    329   6e-105   
ref|XP_008806911.1|  PREDICTED: probable inorganic phosphate tran...    329   1e-104   
gb|AIY53218.1|  phosphate transporter                                   328   1e-104   
ref|XP_006358452.1|  PREDICTED: probable inorganic phosphate tran...    327   2e-104   
ref|XP_006351654.1|  PREDICTED: probable inorganic phosphate tran...    328   2e-104   
ref|XP_006351655.1|  PREDICTED: probable inorganic phosphate tran...    328   2e-104   
ref|XP_006827471.1|  hypothetical protein AMTR_s00009p00128360          319   2e-104   
ref|XP_010091373.1|  putative inorganic phosphate transporter 1-7       328   2e-104   
ref|XP_009390806.1|  PREDICTED: probable inorganic phosphate tran...    336   2e-104   
ref|XP_010671039.1|  PREDICTED: probable inorganic phosphate tran...    327   3e-104   
dbj|BAE93353.1|  phosphate transporter                                  328   3e-104   
gb|AFS33110.1|  phosphate transporter                                   327   4e-104   
ref|XP_010069133.1|  PREDICTED: probable inorganic phosphate tran...    327   4e-104   
ref|XP_009393958.1|  PREDICTED: inorganic phosphate transporter 1...    328   4e-104   
ref|XP_010069131.1|  PREDICTED: inorganic phosphate transporter 1...    326   7e-104   
emb|CBI37109.3|  unnamed protein product                                320   7e-104   
gb|KEH23920.1|  high affinity inorganic phosphate transporter           327   7e-104   
gb|EPS68481.1|  phospate transpoter                                     326   8e-104   
ref|XP_009763060.1|  PREDICTED: probable inorganic phosphate tran...    328   1e-103   
ref|XP_007019007.1|  Phosphate transporter 1,7                          326   1e-103   
gb|ACG38622.1|  inorganic phosphate transporter 1-4                     325   1e-103   
gb|ACF84347.1|  unknown                                                 326   1e-103   
ref|XP_002464558.1|  hypothetical protein SORBIDRAFT_01g020570          326   1e-103   
gb|AAY42386.1|  inorganic phosphate transporter 2                       326   1e-103   
tpg|DAA48552.1|  TPA: inorganic phosphate transporter 3                 326   1e-103   
ref|XP_008218677.1|  PREDICTED: inorganic phosphate transporter 1...    326   2e-103   
ref|NP_001266355.1|  inorganic phosphate transporter 1-4                326   2e-103   
gb|AAY42388.1|  inorganic phosphate transporter 4                       325   2e-103   
gb|AHL44891.1|  phosphate transporter 1                                 325   2e-103   
ref|XP_010918832.1|  PREDICTED: probable inorganic phosphate tran...    325   2e-103   
ref|NP_001105816.1|  phosphate transporter protein2                     325   2e-103   
ref|XP_008806921.1|  PREDICTED: LOW QUALITY PROTEIN: probable ino...    325   2e-103   
ref|XP_004240760.1|  PREDICTED: inorganic phosphate transporter 1...    324   5e-103   
gb|AIY53212.1|  phosphate transporter                                   323   6e-103   
ref|NP_001105269.1|  phosphate transporter protein1                     324   6e-103   
ref|XP_009384029.1|  PREDICTED: probable inorganic phosphate tran...    323   1e-102   
ref|XP_009141547.1|  PREDICTED: inorganic phosphate transporter 1...    322   1e-102   
ref|XP_009394788.1|  PREDICTED: probable inorganic phosphate tran...    323   1e-102   
ref|XP_007222591.1|  hypothetical protein PRUPE_ppa004157mg             323   2e-102   
ref|XP_004975146.1|  PREDICTED: probable inorganic phosphate tran...    323   2e-102   
emb|CDY07686.1|  BnaA03g18250D                                          323   2e-102   
ref|XP_004147179.1|  PREDICTED: probable inorganic phosphate tran...    323   2e-102   
ref|NP_001105817.1|  inorganic phosphate transporter 3                  323   3e-102   
ref|XP_010671042.1|  PREDICTED: probable inorganic phosphate tran...    322   3e-102   
gb|AHL44892.1|  phosphate transporter 1                                 322   3e-102   
ref|XP_009141540.1|  PREDICTED: inorganic phosphate transporter 1...    322   3e-102   
ref|XP_004502147.1|  PREDICTED: probable inorganic phosphate tran...    322   4e-102   
ref|XP_010068884.1|  PREDICTED: inorganic phosphate transporter 1...    322   5e-102   
ref|XP_004983000.1|  PREDICTED: probable inorganic phosphate tran...    322   6e-102   
gb|AAK38197.1|AF305624_1  phosphate transporter 2                       322   6e-102   
ref|XP_004134065.1|  PREDICTED: probable inorganic phosphate tran...    321   7e-102   
ref|XP_010023953.1|  PREDICTED: inorganic phosphate transporter 1...    321   8e-102   
ref|XP_010104732.1|  putative inorganic phosphate transporter 1-7       321   9e-102   
ref|XP_010679248.1|  PREDICTED: inorganic phosphate transporter 1...    320   1e-101   
ref|XP_004292211.1|  PREDICTED: inorganic phosphate transporter 1...    320   1e-101   
ref|XP_008445681.1|  PREDICTED: probable inorganic phosphate tran...    320   2e-101   
ref|XP_006661801.1|  PREDICTED: probable inorganic phosphate tran...    320   2e-101   
gb|EMT10759.1|  Putative inorganic phosphate transporter 1-8            317   3e-101   
ref|XP_004297820.1|  PREDICTED: probable inorganic phosphate tran...    319   3e-101   
ref|NP_001240957.1|  inorganic phosphate transporter 1-4-like           320   3e-101   
ref|XP_007224099.1|  hypothetical protein PRUPE_ppa015601mg             320   3e-101   
ref|XP_006378340.1|  phosphate transporter 2 family protein             319   4e-101   
gb|KEH42529.1|  high affinity inorganic phosphate transporter           319   6e-101   
ref|XP_008224361.1|  PREDICTED: inorganic phosphate transporter 1...    318   7e-101   
dbj|BAE94383.1|  putative phosphate transporter                         318   9e-101   
ref|XP_010671044.1|  PREDICTED: probable inorganic phosphate tran...    318   9e-101   
ref|XP_008784752.1|  PREDICTED: probable inorganic phosphate tran...    318   9e-101   
ref|XP_010671214.1|  PREDICTED: probable inorganic phosphate tran...    318   9e-101   
ref|XP_010671211.1|  PREDICTED: probable inorganic phosphate tran...    318   1e-100   
ref|XP_010671210.1|  PREDICTED: probable inorganic phosphate tran...    318   1e-100   
ref|XP_010671040.1|  PREDICTED: probable inorganic phosphate tran...    318   1e-100   
ref|XP_002445668.1|  hypothetical protein SORBIDRAFT_07g023780          318   1e-100   
ref|XP_010671046.1|  PREDICTED: probable inorganic phosphate tran...    318   1e-100   
ref|XP_010023958.1|  PREDICTED: inorganic phosphate transporter 1...    318   1e-100   
ref|XP_002447525.1|  hypothetical protein SORBIDRAFT_06g002800          317   2e-100   
ref|XP_010671037.1|  PREDICTED: probable inorganic phosphate tran...    317   2e-100   
ref|XP_008438528.1|  PREDICTED: inorganic phosphate transporter 1-4     317   3e-100   
ref|XP_004974252.1|  PREDICTED: inorganic phosphate transporter 1...    317   3e-100   
ref|XP_006662397.1|  PREDICTED: probable inorganic phosphate tran...    317   4e-100   
ref|XP_009400917.1|  PREDICTED: probable inorganic phosphate tran...    317   4e-100   
ref|XP_004966411.1|  PREDICTED: inorganic phosphate transporter 1...    317   4e-100   
gb|EYU18337.1|  hypothetical protein MIMGU_mgv1a021490mg                316   5e-100   
emb|CDY18359.1|  BnaA04g22280D                                          316   5e-100   
ref|NP_001239971.1|  inorganic phosphate transporter 1-4-like           316   6e-100   
gb|ACP19339.1|  phosphate transporter 6                                 315   7e-100   
ref|XP_004160594.1|  PREDICTED: LOW QUALITY PROTEIN: probable ino...    322   7e-100   
ref|XP_003573982.1|  PREDICTED: probable inorganic phosphate tran...    316   8e-100   
ref|NP_001064708.1|  Os10g0444700                                       316   8e-100   
gb|AES61010.2|  high affinity inorganic phosphate transporter           315   8e-100   
gb|KDP40327.1|  hypothetical protein JCGZ_02325                         315   1e-99    
ref|NP_001132684.1|  uncharacterized protein LOC100194162               315   1e-99    
gb|AAO72437.1|  phosphate transporter HvPT4                             316   1e-99    
emb|CDX93291.1|  BnaC04g46050D                                          315   1e-99    
ref|XP_004140975.1|  PREDICTED: probable inorganic phosphate tran...    315   2e-99    
tpg|DAA38519.1|  TPA: phosphate transport protein                       315   2e-99    
ref|XP_003590759.1|  Inorganic phosphate transporter                    315   2e-99    
ref|XP_004495322.1|  PREDICTED: inorganic phosphate transporter 1...    315   3e-99    
emb|CDX74877.1|  BnaA05g06230D                                          314   3e-99    
ref|XP_004985678.1|  PREDICTED: inorganic phosphate transporter 1...    314   3e-99    
ref|XP_009367292.1|  PREDICTED: probable inorganic phosphate tran...    314   3e-99    
ref|XP_002465845.1|  hypothetical protein SORBIDRAFT_01g046890          313   5e-99    
gb|AFU50502.1|  phosphate transporter 3                                 313   6e-99    
emb|CDX74875.1|  BnaA05g06210D                                          314   8e-99    
ref|XP_009362144.1|  PREDICTED: inorganic phosphate transporter 1...    312   2e-98    
dbj|BAE94384.1|  putative phosphate transporter                         313   2e-98    
gb|AFU50505.1|  phosphate transporter 6                                 310   2e-98    
ref|XP_010069135.1|  PREDICTED: inorganic phosphate transporter 1...    312   2e-98    
ref|XP_004986548.1|  PREDICTED: probable inorganic phosphate tran...    315   2e-98    
ref|XP_006489739.1|  PREDICTED: inorganic phosphate transporter 1...    311   3e-98    
ref|XP_010904589.1|  PREDICTED: probable inorganic phosphate tran...    312   4e-98    
ref|XP_008341124.1|  PREDICTED: probable inorganic phosphate tran...    307   4e-98    
ref|XP_010671043.1|  PREDICTED: probable inorganic phosphate tran...    311   4e-98    
gb|AFY06659.1|  phosphate transporter                                   311   4e-98    
ref|XP_003558115.1|  PREDICTED: probable inorganic phosphate tran...    312   4e-98    
gb|EAY78699.1|  hypothetical protein OsI_33801                          311   4e-98    
sp|Q7XDZ7.1|PHT13_ORYSJ  RecName: Full=Probable inorganic phospha...    311   4e-98    
ref|XP_009340884.1|  PREDICTED: probable inorganic phosphate tran...    311   5e-98    
emb|CAH65887.1|  OSIGBa0148J22.6                                        311   6e-98    
ref|XP_010676812.1|  PREDICTED: probable inorganic phosphate tran...    311   9e-98    
gb|EAZ08036.1|  hypothetical protein OsI_30301                          310   1e-97    
ref|XP_008388250.1|  PREDICTED: probable inorganic phosphate tran...    310   1e-97    
ref|XP_006420216.1|  hypothetical protein CICLE_v10007177mg             310   2e-97    
gb|EMS63568.1|  putative inorganic phosphate transporter 1-7            301   3e-97    
ref|XP_010068475.1|  PREDICTED: inorganic phosphate transporter 1...    309   3e-97    
gb|AFH74431.1|  phosphate transporter                                   309   3e-97    
emb|CAS02288.1|  phosphate transporter                                  309   4e-97    
gb|AAN37901.1|  phosphate transporter 6                                 309   4e-97    
ref|XP_002465905.1|  hypothetical protein SORBIDRAFT_01g047910          309   4e-97    
ref|XP_002513783.1|  inorganic phosphate transporter, putative          309   4e-97    
ref|XP_004985679.1|  PREDICTED: probable inorganic phosphate tran...    309   5e-97    
gb|AAN39044.1|  putative phosphate transporter OsPT3                    308   5e-97    
dbj|BAE92291.1|  putative phosphate transporter                         309   5e-97    
ref|XP_002467158.1|  hypothetical protein SORBIDRAFT_01g020580          308   6e-97    
ref|NP_001062527.1|  Os08g0564000                                       308   8e-97    
ref|NP_001048979.1|  Os03g0150800                                       308   1e-96    
gb|AAN39046.1|  putative phosphate transporter OsPT5                    308   1e-96    
ref|XP_008341123.1|  PREDICTED: probable inorganic phosphate tran...    307   1e-96    
ref|NP_001183901.1|  hypothetical protein                               307   1e-96    
ref|NP_001052193.1|  Os04g0185600                                       308   1e-96    
ref|XP_009339617.1|  PREDICTED: probable inorganic phosphate tran...    306   2e-96    
ref|XP_004292684.1|  PREDICTED: probable inorganic phosphate tran...    307   2e-96    
ref|XP_007226742.1|  hypothetical protein PRUPE_ppa019091mg             307   2e-96    
ref|XP_007035106.1|  Phosphate transporter 1,7 isoform 1                306   3e-96    
ref|XP_006649357.1|  PREDICTED: probable inorganic phosphate tran...    306   3e-96    
ref|XP_006652111.1|  PREDICTED: LOW QUALITY PROTEIN: probable ino...    307   3e-96    
ref|XP_010556965.1|  PREDICTED: probable inorganic phosphate tran...    301   5e-96    
ref|XP_009378992.1|  PREDICTED: probable inorganic phosphate tran...    306   5e-96    
emb|CDX96883.1|  BnaC02g30210D                                          296   5e-96    
ref|XP_008391197.1|  PREDICTED: probable inorganic phosphate tran...    306   6e-96    
ref|XP_002468495.1|  hypothetical protein SORBIDRAFT_01g046900          306   6e-96    
gb|AAU84427.1|  phosphate transporter 2                                 306   7e-96    
ref|XP_008391217.1|  PREDICTED: probable inorganic phosphate tran...    305   7e-96    
gb|EAY88450.1|  hypothetical protein OsI_09915                          305   9e-96    
sp|Q01MW8.2|PHT14_ORYSI  RecName: Full=Probable inorganic phospha...    306   1e-95    
ref|NP_001048893.1|  Os03g0136400                                       305   1e-95    
ref|NP_001052194.1|  Os04g0186400                                       305   1e-95    
emb|CAH65897.1|  OSIGBa0132G14.5                                        305   1e-95    
gb|AAU84430.1|  phosphate transporter 7                                 305   1e-95    
ref|XP_008219764.1|  PREDICTED: inorganic phosphate transporter 1...    305   1e-95    
gb|AAU84429.1|  phosphate transporter 5                                 305   2e-95    
ref|XP_010671038.1|  PREDICTED: probable inorganic phosphate tran...    305   2e-95    
gb|AAM49810.1|  putative high-affinity phosphate transporter HAPT       305   2e-95    
ref|XP_002962968.1|  hypothetical protein SELMODRAFT_78488              305   2e-95    
emb|CDX91502.1|  BnaC04g06480D                                          303   3e-95    
gb|AGB58341.1|  putative high affinity phosphate transporter            295   4e-95    
gb|EMT16232.1|  Putative inorganic phosphate transporter 1-7            301   4e-95    
gb|EPS68479.1|  hypothetical protein M569_06287                         303   5e-95    
ref|NP_001151202.1|  inorganic phosphate transporter 1-7                304   5e-95    
ref|XP_003573220.1|  PREDICTED: inorganic phosphate transporter 1...    304   5e-95    
ref|XP_002992796.1|  hypothetical protein SELMODRAFT_135913             304   5e-95    
gb|EMT11043.1|  Putative inorganic phosphate transporter 1-12           301   6e-95    
gb|EYU33252.1|  hypothetical protein MIMGU_mgv1a021667mg                303   7e-95    
ref|XP_010676165.1|  PREDICTED: probable inorganic phosphate tran...    311   8e-95    
emb|CAN65533.1|  hypothetical protein VITISV_038520                     302   1e-94    
gb|EYU19352.1|  hypothetical protein MIMGU_mgv1a024469mg                303   1e-94    
ref|XP_009354938.1|  PREDICTED: inorganic phosphate transporter 1...    302   2e-94    
ref|XP_008356137.1|  PREDICTED: inorganic phosphate transporter 1...    302   2e-94    
ref|XP_010230270.1|  PREDICTED: LOW QUALITY PROTEIN: probable ino...    302   3e-94    
gb|ACR36485.1|  unknown                                                 303   3e-94    
gb|AAO72435.1|  phosphate transporter HvPT5                             301   3e-94    
gb|AAL11542.1|AF416722_1  phosphate transporter                         301   8e-94    
gb|EMT15139.1|  Inorganic phosphate transporter 1-2                     293   8e-94    
ref|XP_003558800.1|  PREDICTED: inorganic phosphate transporter 1-2     300   2e-93    
ref|XP_006383468.1|  hypothetical protein POPTR_0005s15860g             300   2e-93    
gb|AAK25766.2|  phosphate transporter                                   300   2e-93    
ref|XP_010689230.1|  PREDICTED: probable inorganic phosphate tran...    300   2e-93    
gb|EMT15138.1|  Inorganic phosphate transporter 1-2                     293   2e-93    
gb|KCW57376.1|  hypothetical protein EUGRSUZ_H00162                     298   5e-93    
gb|AAO72436.1|  phosphate transporter HvPT7                             298   5e-93    
gb|AFY06662.1|  phosphate transporter                                   292   5e-93    
ref|XP_010069130.1|  PREDICTED: inorganic phosphate transporter 1...    298   6e-93    
ref|XP_006423221.1|  hypothetical protein CICLE_v10029826mg             292   6e-93    
gb|EMS48797.1|  Inorganic phosphate transporter 1-2                     297   7e-93    
ref|XP_008382868.1|  PREDICTED: inorganic phosphate transporter 1...    287   8e-93    
ref|XP_010023957.1|  PREDICTED: probable inorganic phosphate tran...    297   2e-92    
ref|XP_010229243.1|  PREDICTED: LOW QUALITY PROTEIN: probable ino...    297   2e-92    
ref|XP_002962571.1|  hypothetical protein SELMODRAFT_78514              297   2e-92    
ref|XP_002992783.1|  hypothetical protein SELMODRAFT_448898             297   2e-92    
ref|XP_002977245.1|  hypothetical protein SELMODRAFT_106380             296   2e-92    
ref|XP_002965398.1|  hypothetical protein SELMODRAFT_83417              296   2e-92    



>gb|AFU07481.1| phosphate transporter [Camellia oleifera]
Length=541

 Score =   388 bits (997),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 208/249 (84%), Positives = 224/249 (90%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIAFYSQ LFQKDIF AIGWIP+ +TMNA+EEVFRI+RAQTLIA+
Sbjct  294  HGLHLLGTTTTWFLLDIAFYSQNLFQKDIFSAIGWIPDAKTMNAIEEVFRISRAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALIDK GRF IQLMGFFFMTVFM+ALAIPY+HWTHKENRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVALIDKIGRFTIQLMGFFFMTVFMYALAIPYNHWTHKENRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GKAGAIVGAFGFLYAAQN DP KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKAGAIVGAFGFLYAAQNQDPTKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
             GYPPGIGVRN+L+VLG +NFLGMVFT LVPESKGKSL E   +   E+    TEMR Q 
Sbjct  474  KGYPPGIGVRNALMVLGGVNFLGMVFTFLVPESKGKSL-EEMSQENEEDEDGSTEMRQQT  532

Query  722  GHEIRTVPV  748
             H+IRTVPV
Sbjct  533  SHDIRTVPV  541



>emb|CDO99227.1| unnamed protein product [Coffea canephora]
Length=415

 Score =   377 bits (969),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 205/248 (83%), Positives = 225/248 (91%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIAFYSQ LFQKDIF AIGWIP  +TM+A+EEV+RIARAQTLIA+
Sbjct  168  HGLHLLGTTTTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMSAIEEVYRIARAQTLIAL  227

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALIDK GRFAIQLMGFFFMTVFMFALA+PY+HWTH++NRIGFV MYSLT
Sbjct  228  CSTVPGYWFTVALIDKIGRFAIQLMGFFFMTVFMFALALPYNHWTHRDNRIGFVIMYSLT  287

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+TDP KTD
Sbjct  288  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSTDPKKTD  347

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYPPGIGV+NSL+VLGC+N LGM+FT LVPESKGKSLEE+S E + E  +     R QG
Sbjct  348  AGYPPGIGVKNSLIVLGCVNALGMMFTFLVPESKGKSLEEISGEIDEENETATDT-RLQG  406

Query  722  GHEIRTVP  745
              + RTVP
Sbjct  407  ASDNRTVP  414



>gb|ABS12068.1| high affinity phosphate transporter [Petunia x hybrida]
Length=534

 Score =   379 bits (974),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 209/249 (84%), Positives = 219/249 (88%), Gaps = 5/249 (2%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT STWFLLDIAFYSQ LFQKDIF AIGWIP  ETMNA+EEV+RIARAQTLIA+
Sbjct  291  HGLHLLGTASTWFLLDIAFYSQNLFQKDIFSAIGWIPPAETMNALEEVYRIARAQTLIAL  350

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA IDK GRFAIQLMGFFFMTVFMFALAIPY HWTHK+NRIGFV MYSLT
Sbjct  351  CSTVPGYWFTVAFIDKIGRFAIQLMGFFFMTVFMFALAIPYTHWTHKDNRIGFVIMYSLT  410

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGA+VGAFGFLYAAQ+TDP KTD
Sbjct  411  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAMVGAFGFLYAAQSTDPKKTD  470

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYP GIGVRNSL+VLGC+NFLGM+FTLLVPESKGKSL E        E    TEMR  G
Sbjct  471  AGYPAGIGVRNSLIVLGCVNFLGMLFTLLVPESKGKSL-EEMSRENEGEDENGTEMRASG  529

Query  722  GHEIRTVPV  748
                RTVPV
Sbjct  530  ----RTVPV  534



>gb|ACB37438.1| phosphate transporter 1 [Petunia x hybrida]
Length=273

 Score =   370 bits (949),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 193/214 (90%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT STWFLLDIAFYSQ LFQKDIF AIGWIP  ETMNA+EEV+RIARAQTLIA+
Sbjct  60   HGLHLLGTASTWFLLDIAFYSQNLFQKDIFSAIGWIPPAETMNALEEVYRIARAQTLIAL  119

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA IDK GRFAIQLMGFFFMTVFMFALAIPY HWTHK+NRIGFV MYSLT
Sbjct  120  CSTVPGYWFTVAFIDKIGRFAIQLMGFFFMTVFMFALAIPYTHWTHKDNRIGFVIMYSLT  179

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGA+VGAFGFLYAAQ+TDP KTD
Sbjct  180  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAMVGAFGFLYAAQSTDPKKTD  239

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESK  643
            AGYP GIGVRNSL+VLGC+NFLGM+FTLLVPESK
Sbjct  240  AGYPAGIGVRNSLIVLGCVNFLGMLFTLLVPESK  273



>ref|XP_002524622.1| inorganic phosphate transporter, putative [Ricinus communis]
 gb|EEF37830.1| inorganic phosphate transporter, putative [Ricinus communis]
Length=536

 Score =   375 bits (962),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 202/249 (81%), Positives = 215/249 (86%), Gaps = 5/249 (2%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEV+RIARAQTLIA+
Sbjct  293  HGLHLLGTTTTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKTMNAIEEVYRIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALIDK GRFAIQLMGFFFMTVFMFALAIPYDHWTHK+NRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVALIDKIGRFAIQLMGFFFMTVFMFALAIPYDHWTHKDNRIGFVVMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GK GA+VGAFGFLY AQN D AK D
Sbjct  413  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKLGAMVGAFGFLYLAQNKDKAKAD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYP GIGVRNSL+VLG INFLG++FT LVPESKGKSL     E    E   + E   Q 
Sbjct  473  AGYPAGIGVRNSLIVLGVINFLGIMFTFLVPESKGKSL-----EEMSGEHEEDNENEEQS  527

Query  722  GHEIRTVPV  748
             H  RTVPV
Sbjct  528  SHNNRTVPV  536



>dbj|BAA20522.1| phosphate transporter [Catharanthus roseus]
Length=542

 Score =   375 bits (962),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 203/249 (82%), Positives = 222/249 (89%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT +TWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEVFRIARAQTLIA+
Sbjct  294  HGLHLLGTATTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNAIEEVFRIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTV LID+ GRF IQ MGFFFMTVFMFALAIPY+HWTHK+NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVFLIDRIGRFIIQWMGFFFMTVFMFALAIPYNHWTHKDNRIGFVIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAI+GAFGFLYAAQ +DP+KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIIGAFGFLYAAQPSDPSKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
             GYPPGIGV+N+L+VLGC+NFLGMVFT LVPE+KGKSL E   +   EE    TE+R Q 
Sbjct  474  KGYPPGIGVKNALIVLGCVNFLGMVFTFLVPEAKGKSL-EEVSKENEEEVENGTELRQQS  532

Query  722  GHEIRTVPV  748
            GH+ RTVPV
Sbjct  533  GHDTRTVPV  541



>gb|ADL27918.1| phosphate transporter 1 [Hevea brasiliensis]
Length=536

 Score =   374 bits (960),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 194/218 (89%), Positives = 204/218 (94%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEVFRIARAQTLIA+
Sbjct  293  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKTMNAIEEVFRIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA IDK GRFAIQLMGFFFMTVFMFALAIPY+HWTH++NRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVAFIDKMGRFAIQLMGFFFMTVFMFALAIPYNHWTHRDNRIGFVVMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GK GAIVGAFGFLY AQN D AK D
Sbjct  413  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKLGAIVGAFGFLYLAQNKDKAKAD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGVRNSL+VLG +NFLGMVFTLLVPESKGKSL
Sbjct  473  AGYPAGIGVRNSLIVLGVVNFLGMVFTLLVPESKGKSL  510



>gb|KDP26541.1| hypothetical protein JCGZ_17699 [Jatropha curcas]
Length=540

 Score =   374 bits (959),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 194/218 (89%), Positives = 204/218 (94%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEV+RIARAQTLIA+
Sbjct  293  HGLHLLGTTTTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKTMNAIEEVYRIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALIDK GRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVALIDKIGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVVMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GK GAIVGAFGFLY AQN D AK D
Sbjct  413  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKLGAIVGAFGFLYLAQNKDKAKAD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+NSL+VLG INFLGM+FT LVPESKGKSL
Sbjct  473  AGYPAGIGVKNSLIVLGVINFLGMLFTFLVPESKGKSL  510



>gb|ABK63963.1| PT3 [Solanum melongena]
Length=532

 Score =   373 bits (958),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 194/218 (89%), Positives = 208/218 (95%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF  IGWIP+PETMNA++EVF+IARAQTLIA+
Sbjct  291  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSKIGWIPHPETMNALDEVFKIARAQTLIAL  350

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA IDK GRFAIQLMGFFFMTVFMFALAIPY+HWT KENRIGFV MYSLT
Sbjct  351  CSTVPGYWFTVAFIDKMGRFAIQLMGFFFMTVFMFALAIPYNHWTKKENRIGFVIMYSLT  410

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+TDP+K D
Sbjct  411  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSTDPSKVD  470

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGY PGIGV+N+L+VLGC+N LGM+FTLLVPESKGKSL
Sbjct  471  AGYRPGIGVKNALIVLGCVNLLGMLFTLLVPESKGKSL  508



>ref|XP_011091219.1| PREDICTED: inorganic phosphate transporter 1-4-like [Sesamum 
indicum]
Length=542

 Score =   373 bits (958),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 207/249 (83%), Positives = 223/249 (90%), Gaps = 0/249 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEVFRIARAQTLIA+
Sbjct  294  HGLHLLGTTTTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKTMNALEEVFRIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTV  ID+ GRFAIQLMGFFFMTVFMFALAIPY HWTH+ENRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVLFIDRIGRFAIQLMGFFFMTVFMFALAIPYTHWTHRENRIGFVIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ  DP+K D
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQPKDPSKRD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYP GIG++NSL+VLGCIN LGM FTLLVPESKGKSLEE+S ENE E+ +   EMR   
Sbjct  474  AGYPAGIGIKNSLIVLGCINALGMFFTLLVPESKGKSLEELSAENENEDENGTVEMRPTA  533

Query  722  GHEIRTVPV  748
             ++ RTVPV
Sbjct  534  ANDFRTVPV  542



>emb|CAC87043.1| transmembrane protein [Solanum tuberosum]
Length=535

 Score =   372 bits (956),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 192/218 (88%), Positives = 208/218 (95%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF  IGWIP+PETMNA++EVF+IA+AQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSKIGWIPHPETMNALDEVFKIAKAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID+ GRFAIQLMGFFFMTVFMFALAIPY+HWT KENR GFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDRMGRFAIQLMGFFFMTVFMFALAIPYNHWTKKENRFGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+TDP+K D
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSTDPSKVD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+N+L+VLGC+NFLGM+FTLLVPESKGKSL
Sbjct  474  AGYPTGIGVKNALIVLGCVNFLGMLFTLLVPESKGKSL  511



>gb|AAV97729.1| phosphate transporter 3 [Solanum lycopersicum]
Length=532

 Score =   372 bits (954),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 191/218 (88%), Positives = 208/218 (95%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF  IGWIP+PETMNA++EVF+IA+AQTLIA+
Sbjct  291  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSKIGWIPHPETMNALDEVFKIAKAQTLIAL  350

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID+ GRFAIQLMGFFFMTVFMFALAIPY+HWT KENRIGFV MYSLT
Sbjct  351  CSTVPGYWFTVAFIDRMGRFAIQLMGFFFMTVFMFALAIPYNHWTKKENRIGFVIMYSLT  410

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+TDP+K D
Sbjct  411  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSTDPSKVD  470

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYP GIGV+N+L+VLGC+NFLGM+FTLLVPESKG+SL
Sbjct  471  TGYPTGIGVKNALIVLGCVNFLGMLFTLLVPESKGRSL  508



>ref|XP_004247729.1| PREDICTED: inorganic phosphate transporter 1-4-like [Solanum 
lycopersicum]
Length=534

 Score =   372 bits (954),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 191/218 (88%), Positives = 208/218 (95%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF  IGWIP+PETMNA++EVF+IA+AQTLIA+
Sbjct  291  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSKIGWIPHPETMNALDEVFKIAKAQTLIAL  350

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID+ GRFAIQLMGFFFMTVFMFALAIPY+HWT KENRIGFV MYSLT
Sbjct  351  CSTVPGYWFTVAFIDRMGRFAIQLMGFFFMTVFMFALAIPYNHWTKKENRIGFVIMYSLT  410

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+TDP+K D
Sbjct  411  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSTDPSKVD  470

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYP GIGV+N+L+VLGC+NFLGM+FTLLVPESKG+SL
Sbjct  471  TGYPTGIGVKNALIVLGCVNFLGMLFTLLVPESKGRSL  508



>gb|ACB37440.1| phosphate transporter 3 [Petunia x hybrida]
Length=538

 Score =   372 bits (955),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 195/218 (89%), Positives = 205/218 (94%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF  IGWIP PETMNA++EVFRIARAQTLIA+
Sbjct  293  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSKIGWIPPPETMNALDEVFRIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA IDK GRFAIQLMG FFMTVFMFALAIPYDHWT KENRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVAFIDKMGRFAIQLMGSFFMTVFMFALAIPYDHWTKKENRIGFVIMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+TDP K D
Sbjct  413  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSTDPKKVD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+N+L+VLGC+NFLGM+ TLLVPESKGKSL
Sbjct  473  AGYPTGIGVKNALIVLGCVNFLGMLSTLLVPESKGKSL  510



>ref|XP_006354489.1| PREDICTED: inorganic phosphate transporter 1-4-like [Solanum 
tuberosum]
Length=535

 Score =   372 bits (954),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 192/218 (88%), Positives = 207/218 (95%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF  IGWIP+PETMNA++EVF+IA+AQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSKIGWIPHPETMNALDEVFKIAKAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID+ GRFAIQLMGFFFMTVFMFALAIPY+HWT KENR GFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDRMGRFAIQLMGFFFMTVFMFALAIPYNHWTKKENRFGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+TDP K D
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSTDPTKVD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+N+L+VLGC+NFLGM+FTLLVPESKGKSL
Sbjct  474  AGYPTGIGVKNALIVLGCVNFLGMLFTLLVPESKGKSL  511



>ref|XP_009623393.1| PREDICTED: inorganic phosphate transporter 1-4-like [Nicotiana 
tomentosiformis]
Length=535

 Score =   371 bits (952),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 193/218 (89%), Positives = 206/218 (94%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF  IGWIP+PETMNA++EVF+IARAQTLIA+
Sbjct  290  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSKIGWIPHPETMNALDEVFKIARAQTLIAL  349

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA IDK GRFAIQLMGFFFMTVFMFALAIPY+HWT KENRIGFV MYSLT
Sbjct  350  CSTVPGYWFTVAFIDKMGRFAIQLMGFFFMTVFMFALAIPYNHWTQKENRIGFVIMYSLT  409

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+TDP K D
Sbjct  410  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSTDPLKVD  469

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+N+L+VLGC+N LGM+FT LVPESKGKSL
Sbjct  470  AGYPTGIGVKNALIVLGCVNLLGMLFTFLVPESKGKSL  507



>ref|XP_010519113.1| PREDICTED: probable inorganic phosphate transporter 1-7 [Tarenaya 
hassleriana]
Length=536

 Score =   371 bits (952),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 193/218 (89%), Positives = 204/218 (94%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EVFRIARAQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNAIQEVFRIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTV LID  GRFAIQLMGFFFMTVFMFALAIPYDHWTHK+NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVGLIDIIGRFAIQLMGFFFMTVFMFALAIPYDHWTHKDNRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GK GAIVGAFGFLY AQ+ D AKT+
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKLGAIVGAFGFLYLAQSPDKAKTE  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGVRNSL+VLG +NFLGMVFT LVPESKGKSL
Sbjct  474  AGYPPGIGVRNSLIVLGVVNFLGMVFTFLVPESKGKSL  511



>gb|AIY53213.1| phosphate transporter [Manihot esculenta]
Length=536

 Score =   371 bits (952),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 204/249 (82%), Positives = 219/249 (88%), Gaps = 5/249 (2%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEV++IARAQTLIA+
Sbjct  293  HGLHLLGTTTTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKTMNALEEVYKIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID+ GRFAIQLMGFFFMTVFMFALAIPY+HWTHKENRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVAFIDRMGRFAIQLMGFFFMTVFMFALAIPYNHWTHKENRIGFVAMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GK GAIVGAFGFLY AQN D AK D
Sbjct  413  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKLGAIVGAFGFLYLAQNKDKAKAD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYP GIGVRNSLLVLG INFLGM+FT LVPESKGKSLEE+S ENE ++         Q 
Sbjct  473  AGYPAGIGVRNSLLVLGVINFLGMIFTFLVPESKGKSLEELSGENEEDDQP-----EEQS  527

Query  722  GHEIRTVPV  748
             +  RTVPV
Sbjct  528  SYNDRTVPV  536



>ref|XP_010111916.1| putative inorganic phosphate transporter 1-7 [Morus notabilis]
 gb|EXC31950.1| putative inorganic phosphate transporter 1-7 [Morus notabilis]
Length=541

 Score =   370 bits (951),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 199/249 (80%), Positives = 217/249 (87%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP+ +TMNA+EEV+RIARAQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPSSKTMNALEEVYRIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTV  IDK GRFAIQLMGFFFMTVFMFALAIPYDHWTH+++R GFV MYSLT
Sbjct  354  CSTVPGYWFTVFFIDKIGRFAIQLMGFFFMTVFMFALAIPYDHWTHRDHRFGFVAMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GK GA+VGAFGFLY AQN D AKTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKLGAMVGAFGFLYLAQNKDKAKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYP GIGVRNSLLVLG +NFLGM+FT LVPESKG+SL E       +E + E E+  Q 
Sbjct  474  AGYPAGIGVRNSLLVLGVVNFLGMIFTFLVPESKGRSL-EEMSGENEDENAEEVELEQQS  532

Query  722  GHEIRTVPV  748
            G+  R VPV
Sbjct  533  GYNNRKVPV  541



>gb|EYU18330.1| hypothetical protein MIMGU_mgv1a004164mg [Erythranthe guttata]
Length=541

 Score =   370 bits (950),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 207/250 (83%), Positives = 224/250 (90%), Gaps = 4/250 (2%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF  IGWIP P+TMNA+EEV++IARAQTLIA+
Sbjct  295  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFTGIGWIPAPKTMNALEEVYKIARAQTLIAL  354

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTV  IDK GRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFV MYSLT
Sbjct  355  CSTVPGYWFTVFFIDKIGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVIMYSLT  414

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGA++GAFGFLYA+Q TDP K D
Sbjct  415  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAMIGAFGFLYASQPTDPTKRD  474

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsve-teMRTQ  718
            AGYP GIG+RNSL+VLGCIN LG+VFT LVPES G+SLEEMS+ENE ++      EMR  
Sbjct  475  AGYPAGIGIRNSLIVLGCINALGVVFTFLVPESNGRSLEEMSKENEDDDDDSNGVEMR--  532

Query  719  GGHEIRTVPV  748
             G+E RTVPV
Sbjct  533  -GNEFRTVPV  541



>gb|ABK63964.2| PT3 [Nicotiana tabacum]
Length=535

 Score =   370 bits (949),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 192/218 (88%), Positives = 206/218 (94%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF  IGWIP+PETMNA++EVF+IA+AQTLIA+
Sbjct  290  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSKIGWIPHPETMNALDEVFKIAKAQTLIAL  349

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA IDK GRFAIQLMGFFFMTVFMFALAIPY+HWT KENRIGFV MYSLT
Sbjct  350  CSTVPGYWFTVAFIDKMGRFAIQLMGFFFMTVFMFALAIPYNHWTQKENRIGFVIMYSLT  409

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+TDP K D
Sbjct  410  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSTDPLKVD  469

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+N+L+VLGC+N LGM+FT LVPESKGKSL
Sbjct  470  AGYPTGIGVKNALIVLGCVNLLGMLFTFLVPESKGKSL  507



>ref|XP_011073524.1| PREDICTED: inorganic phosphate transporter 1-4-like [Sesamum 
indicum]
Length=540

 Score =   370 bits (949),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 209/249 (84%), Positives = 227/249 (91%), Gaps = 2/249 (1%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEV+RI+RAQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKTMNALEEVYRISRAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTV  ID+ GRFAIQLMGFFFMTVFMFALAIPY HWTHK+NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVFFIDRIGRFAIQLMGFFFMTVFMFALAIPYTHWTHKDNRIGFVIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GKAGAIVGAFGFLYAAQ+ DP+K D
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKAGAIVGAFGFLYAAQSKDPSKRD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYP GIGV+NSL+VLGC+N LGM+FT LVPESKGKSLEEMS+E E E GSVET  R  G
Sbjct  474  AGYPAGIGVKNSLIVLGCVNALGMLFTFLVPESKGKSLEEMSKEGEDESGSVET--RQPG  531

Query  722  GHEIRTVPV  748
             ++IRTVPV
Sbjct  532  VNDIRTVPV  540



>gb|ABK63959.1| PT1 [Solanum melongena]
Length=540

 Score =   370 bits (949),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 209/249 (84%), Positives = 225/249 (90%), Gaps = 3/249 (1%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEV++IARAQTLIA+
Sbjct  295  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNALEEVYKIARAQTLIAL  354

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID+ GRF IQLMGFFFMTVFMFALAIPY HWT K++RIGFV MYSLT
Sbjct  355  CSTVPGYWFTVAFIDRLGRFKIQLMGFFFMTVFMFALAIPYHHWTLKDHRIGFVVMYSLT  414

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGA+VGAFGFLYAAQ+TDP KTD
Sbjct  415  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAMVGAFGFLYAAQSTDPKKTD  474

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYPPGIGVRNSL+VLG +NFLGM+FT LVPESKGKSLE++SRENEGEE     EMR   
Sbjct  475  AGYPPGIGVRNSLIVLGVVNFLGMMFTFLVPESKGKSLEDLSRENEGEEEENGAEMRAAS  534

Query  722  GHEIRTVPV  748
            G   RTVPV
Sbjct  535  G---RTVPV  540



>ref|XP_009765235.1| PREDICTED: probable inorganic phosphate transporter 1-2 [Nicotiana 
sylvestris]
Length=536

 Score =   369 bits (948),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 192/218 (88%), Positives = 206/218 (94%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF  IGWIP+PETMNA++EVF+IA+AQTLIA+
Sbjct  291  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSKIGWIPHPETMNALDEVFKIAKAQTLIAL  350

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA IDK GRFAIQLMGFFFMTVFMFALAIPY+HWT KENRIGFV MYSLT
Sbjct  351  CSTVPGYWFTVAFIDKMGRFAIQLMGFFFMTVFMFALAIPYNHWTQKENRIGFVIMYSLT  410

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+TDP K D
Sbjct  411  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSTDPLKVD  470

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+N+L+VLGC+N LGM+FT LVPESKGKSL
Sbjct  471  AGYPTGIGVKNALIVLGCVNLLGMLFTFLVPESKGKSL  508



>ref|XP_006354490.1| PREDICTED: inorganic phosphate transporter 1-4-like [Solanum 
tuberosum]
Length=538

 Score =   369 bits (948),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 210/249 (84%), Positives = 224/249 (90%), Gaps = 4/249 (2%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT STWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEV++IARAQTLIA+
Sbjct  294  HGLHLLGTASTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNALEEVYKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID+ GRFAIQLMGFFFMTVFMFALA+PY HWT K+NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDRIGRFAIQLMGFFFMTVFMFALALPYHHWTLKDNRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGA+VGAFGFLYAAQ TDP KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAMVGAFGFLYAAQPTDPKKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYP GIGVRNSL+VLGC+NFLGM+FT LVPESKGKSLEEMSRENEGEE +V     T G
Sbjct  474  AGYPAGIGVRNSLIVLGCVNFLGMLFTFLVPESKGKSLEEMSRENEGEEETVAEMRATSG  533

Query  722  GHEIRTVPV  748
                RTVPV
Sbjct  534  ----RTVPV  538



>gb|AIU41748.1| phosphorus transporter PT3 [Lycium barbarum]
Length=539

 Score =   369 bits (947),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 192/218 (88%), Positives = 205/218 (94%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF  IGWIP+PETMNA++EVF+IARAQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSKIGWIPHPETMNALDEVFKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            C TVPGYWFTVA IDK GRFAIQLMGFFFMTVFMFALAIPY+HWT KENRIGFV MYSLT
Sbjct  354  CGTVPGYWFTVAFIDKIGRFAIQLMGFFFMTVFMFALAIPYNHWTKKENRIGFVIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+T+P K D
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSTNPLKVD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYP GIGV+N+LLVLGC+N LGM+FTLLVPESKGKSL
Sbjct  474  VGYPTGIGVKNTLLVLGCVNLLGMLFTLLVPESKGKSL  511



>ref|XP_010262309.1| PREDICTED: inorganic phosphate transporter 1-4-like [Nelumbo 
nucifera]
 ref|XP_010262310.1| PREDICTED: inorganic phosphate transporter 1-4-like [Nelumbo 
nucifera]
Length=541

 Score =   369 bits (946),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 209/249 (84%), Positives = 220/249 (88%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  ETMNA+EEV+RIARAQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPAAETMNAIEEVYRIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID+ GRFAIQ MGFFFMTVFMFALAIPY HW  KENRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDRMGRFAIQFMGFFFMTVFMFALAIPYHHWALKENRIGFVIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GKAGAIVGAFGFLYAAQ TD  KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKAGAIVGAFGFLYAAQPTDKTKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYPPGIGVR SL++LG INF GMVFTLLVPESKGKSLEEMS ENE E  +V    + Q 
Sbjct  474  AGYPPGIGVRYSLVMLGVINFFGMVFTLLVPESKGKSLEEMSGENEEENENVTELEQ-QA  532

Query  722  GHEIRTVPV  748
            G+  RTVPV
Sbjct  533  GYNNRTVPV  541



>dbj|BAE98881.1| phosphate transporter [Arabidopsis thaliana]
Length=432

 Score =   365 bits (936),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  ++MNA++EVF+IARAQTLIA+
Sbjct  192  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQSMNAIQEVFKIARAQTLIAL  251

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPY+HWTHKENRIGFV MYSLT
Sbjct  252  CSTVPGYWFTVAFIDVIGRFAIQMMGFFFMTVFMFALAIPYNHWTHKENRIGFVIMYSLT  311

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GA+VGAFGFLY AQN D  KTD
Sbjct  312  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQNPDKDKTD  371

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGVRNSL+VLG +NFLG++FT LVPESKGKSL
Sbjct  372  AGYPPGIGVRNSLIVLGVVNFLGILFTFLVPESKGKSL  409



>ref|NP_001275200.1| inorganic phosphate transporter [Solanum tuberosum]
 gb|AAD38859.1|AF156695_1 inorganic phosphate transporter [Solanum tuberosum]
Length=540

 Score =   369 bits (946),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 191/218 (88%), Positives = 204/218 (94%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT STWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEV++IARAQTLIA+
Sbjct  294  HGLHLLGTASTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNALEEVYKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID+ GRFAIQLMGFFFMTVFMFALA+PY HWT K+NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDRIGRFAIQLMGFFFMTVFMFALALPYHHWTLKDNRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGA+VGAFGFLYAAQ TDP KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAMVGAFGFLYAAQPTDPKKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGVRNSL+VLGC+NFLGM+FT LVPES GKSL
Sbjct  474  AGYPPGIGVRNSLIVLGCVNFLGMLFTFLVPESNGKSL  511



>gb|AAZ23928.1| At3g54700 [Arabidopsis thaliana]
Length=433

 Score =   365 bits (936),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EVF+IARAQTLIA+
Sbjct  188  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNAIQEVFKIARAQTLIAL  247

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPYDHWTHKENRIGFV MYSLT
Sbjct  248  CSTVPGYWFTVAFIDVIGRFAIQMMGFFFMTVFMFALAIPYDHWTHKENRIGFVAMYSLT  307

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GA+VGAFGFLY AQ+ D  KT+
Sbjct  308  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQSPDKTKTE  367

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYPPGIGV+NSL+VLG +N LGMVFTLLVPESKGKSL
Sbjct  368  HGYPPGIGVKNSLIVLGVVNLLGMVFTLLVPESKGKSL  405



>ref|XP_010274782.1| PREDICTED: inorganic phosphate transporter 1-4-like [Nelumbo 
nucifera]
Length=536

 Score =   368 bits (944),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 192/218 (88%), Positives = 204/218 (94%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEVF+IARAQTLIA+
Sbjct  291  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKTMNAIEEVFKIARAQTLIAL  350

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALID  GRFAIQLMGFFFMTVFMFALA PYDHWT K+NRIGFV MYSLT
Sbjct  351  CSTVPGYWFTVALIDYMGRFAIQLMGFFFMTVFMFALAFPYDHWTKKDNRIGFVIMYSLT  410

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAA+GKAGAIVGAFGFLYAAQN D  KTD
Sbjct  411  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAASGKAGAIVGAFGFLYAAQNKDKTKTD  470

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INFLGM+FTLLVPE KGKSL
Sbjct  471  AGYPPGIGVKNSLIMLGVINFLGMIFTLLVPEGKGKSL  508



>emb|CAA67395.1| inorganic phosphate transporter 1 [Solanum tuberosum]
Length=540

 Score =   367 bits (943),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 191/218 (88%), Positives = 204/218 (94%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT STWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEV++IARAQTLIA+
Sbjct  294  HGLHLLGTASTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNALEEVYKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID+ GRFAIQLMGFFFMTVFMFALA+PY HWT K+NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDRIGRFAIQLMGFFFMTVFMFALALPYHHWTLKDNRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGA+VGAFGFLYAAQ TDP KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAMVGAFGFLYAAQPTDPKKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGVRNSL+VLGC+NFLGM+FT LVPESKGKSL
Sbjct  474  AGYPAGIGVRNSLIVLGCVNFLGMLFTFLVPESKGKSL  511



>gb|AAB82146.1| inorganic phosphate transporter [Solanum lycopersicum]
Length=538

 Score =   367 bits (941),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 208/249 (84%), Positives = 223/249 (90%), Gaps = 4/249 (2%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT STWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEV++IARAQTLIA+
Sbjct  294  HGLHLLGTASTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNALEEVYKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA IDK GRFAIQLMGFFFMTVFMFALAIPY HWT K++RIGFV MYS T
Sbjct  354  CSTVPGYWFTVAFIDKIGRFAIQLMGFFFMTVFMFALAIPYHHWTLKDHRIGFVVMYSFT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGA+VGAFGFLYAAQ TDP KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAMVGAFGFLYAAQPTDPTKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYPPGIGVRNSL+VLGC+NFLGM+FT LVPES GKSLE++SRENEGEE +V     T G
Sbjct  474  AGYPPGIGVRNSLIVLGCVNFLGMLFTFLVPESNGKSLEDLSRENEGEEETVAEIRATSG  533

Query  722  GHEIRTVPV  748
                RTVPV
Sbjct  534  ----RTVPV  538



>ref|NP_001234361.1| uncharacterized protein LOC544136 [Solanum lycopersicum]
 emb|CAA76075.1| putative phosphate transporter [Solanum lycopersicum]
Length=538

 Score =   367 bits (941),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 208/249 (84%), Positives = 223/249 (90%), Gaps = 4/249 (2%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT STWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEV++IARAQTLIA+
Sbjct  294  HGLHLLGTASTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNALEEVYKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA IDK GRFAIQLMGFFFMTVFMFALAIPY HWT K++RIGFV MYS T
Sbjct  354  CSTVPGYWFTVAFIDKIGRFAIQLMGFFFMTVFMFALAIPYHHWTLKDHRIGFVVMYSFT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGA+VGAFGFLYAAQ TDP KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAMVGAFGFLYAAQPTDPTKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYPPGIGVRNSL+VLGC+NFLGM+FT LVPES GKSLE++SRENEGEE +V     T G
Sbjct  474  AGYPPGIGVRNSLIVLGCVNFLGMLFTFLVPESNGKSLEDLSRENEGEEETVAEIRATSG  533

Query  722  GHEIRTVPV  748
                RTVPV
Sbjct  534  ----RTVPV  538



>ref|XP_009622805.1| PREDICTED: inorganic phosphate transporter 1-4-like [Nicotiana 
tomentosiformis]
 dbj|BAA86070.1| Phospate transpoter [Nicotiana tabacum]
Length=536

 Score =   366 bits (940),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 192/218 (88%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT STWFLLDIAFYSQ LFQKDIF AIGWIP  ETMNA+EEV+RIARAQTLIA+
Sbjct  293  HGLHLLGTASTWFLLDIAFYSQNLFQKDIFSAIGWIPPAETMNALEEVYRIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTV  ID+ GRFAIQLMGFFFMTVFMFALAIPY HWT K+NRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVFFIDRIGRFAIQLMGFFFMTVFMFALAIPYHHWTLKDNRIGFVIMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGA++GAFGFLYAAQ TDP K D
Sbjct  413  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAMIGAFGFLYAAQPTDPKKVD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGVRNSL+VLGC+NFLGMVFT LVPESKGKSL
Sbjct  473  AGYPAGIGVRNSLIVLGCVNFLGMVFTFLVPESKGKSL  510



>ref|XP_004289933.1| PREDICTED: probable inorganic phosphate transporter 1-7-like 
[Fragaria vesca subsp. vesca]
Length=538

 Score =   366 bits (940),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 200/249 (80%), Positives = 218/249 (88%), Gaps = 0/249 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  ++MNA+EEV++IARAQTLIA+
Sbjct  290  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPAAKSMNAIEEVYKIARAQTLIAM  349

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALID+ GRFAIQ+MGFFFMTVFMFALAIPYDHWTHK+NRIGFV MYSLT
Sbjct  350  CSTVPGYWFTVALIDRIGRFAIQMMGFFFMTVFMFALAIPYDHWTHKDNRIGFVVMYSLT  409

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GAI+GAFGFLY AQN D  KTD
Sbjct  410  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAIIGAFGFLYLAQNQDKTKTD  469

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYP GIGV+NSL+VLG +NFLG++FT LVPES GKSLEEMS ENE E  S     +  G
Sbjct  470  AGYPAGIGVKNSLIVLGVVNFLGILFTFLVPESNGKSLEEMSGENEEEPESAVELEQQSG  529

Query  722  GHEIRTVPV  748
                RTVPV
Sbjct  530  YGNSRTVPV  538



>gb|ABK63962.1| PT3 [Capsicum frutescens]
Length=536

 Score =   366 bits (939),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 190/218 (87%), Positives = 205/218 (94%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF  IGWIP+PETM+A++EVF+IARAQTLIA+
Sbjct  291  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSKIGWIPHPETMSALDEVFKIARAQTLIAL  350

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA IDK GRF IQLMGFFFMTVFMFALAIPY+HWT KENRIGFV MYSLT
Sbjct  351  CSTVPGYWFTVAFIDKMGRFVIQLMGFFFMTVFMFALAIPYNHWTKKENRIGFVIMYSLT  410

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+TD +K D
Sbjct  411  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSTDSSKVD  470

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+N+L+VLGC+N LGM+FT LVPESKGKSL
Sbjct  471  AGYPTGIGVKNALIVLGCVNLLGMLFTFLVPESKGKSL  508



>ref|XP_009141774.1| PREDICTED: inorganic phosphate transporter 1-4 [Brassica rapa]
Length=534

 Score =   366 bits (939),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 189/218 (87%), Positives = 203/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EVF+IARAQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNAIQEVFKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFALAIPY+HWTHKENRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDVIGRFAIQLMGFFFMTVFMFALAIPYNHWTHKENRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GA+VGAFGFLY AQ+ D AKTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQSPDKAKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGVRNSL+VLG +NFLG++FT LVPESKGKSL
Sbjct  474  AGYPPGIGVRNSLIVLGVVNFLGILFTFLVPESKGKSL  511



>ref|XP_006411118.1| hypothetical protein EUTSA_v10016497mg [Eutrema salsugineum]
 gb|ESQ52571.1| hypothetical protein EUTSA_v10016497mg [Eutrema salsugineum]
Length=534

 Score =   365 bits (938),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 189/218 (87%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EVF+IARAQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNAIQEVFKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFALAIPY+HWTHKENRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDVIGRFAIQLMGFFFMTVFMFALAIPYNHWTHKENRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GA+VGAFGFLY AQ+ D  KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQSPDKTKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGVRNSL+VLG +NFLG+VFT LVPESKGKSL
Sbjct  474  AGYPPGIGVRNSLIVLGVVNFLGIVFTFLVPESKGKSL  511



>ref|XP_002306845.1| phosphate transporter 1 family protein [Populus trichocarpa]
 gb|EEE93841.1| phosphate transporter 1 family protein [Populus trichocarpa]
Length=539

 Score =   365 bits (938),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 188/218 (86%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EV+RIARAQTLIA+
Sbjct  293  HGLHLLGTTTTWFLLDIAFYSQNLFQKDIFSAIGWIPKAQTMNAIDEVYRIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID+ GRFAIQLMGFFFMTVFMFALAIPY+HWTHK+NRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVAFIDRIGRFAIQLMGFFFMTVFMFALAIPYNHWTHKDNRIGFVVMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GK GAIVGAFGFLY AQ+ D AK D
Sbjct  413  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKLGAIVGAFGFLYLAQDQDKAKAD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+NSLLVLG +NF GMVFT LVPESKGKSL
Sbjct  473  AGYPAGIGVKNSLLVLGVVNFFGMVFTFLVPESKGKSL  510



>gb|AIY53214.1| phosphate transporter [Manihot esculenta]
Length=536

 Score =   365 bits (938),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 189/218 (87%), Positives = 200/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEV+RIARAQTLIA+
Sbjct  293  HGLHLLGTTTTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKTMNAIEEVYRIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA IDK GRFAIQLMGFFFMTVFMFALAIPY+HW H ENRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVAFIDKMGRFAIQLMGFFFMTVFMFALAIPYNHWRHSENRIGFVVMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GK GA+VGAFGFLY AQN D  K D
Sbjct  413  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKLGAMVGAFGFLYLAQNKDKGKAD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGVRNSL+VLG INFLGM+FT LVPESKGKSL
Sbjct  473  AGYPAGIGVRNSLIVLGVINFLGMMFTFLVPESKGKSL  510



>ref|XP_010104731.1| putative inorganic phosphate transporter 1-7 [Morus notabilis]
 gb|EXC01781.1| putative inorganic phosphate transporter 1-7 [Morus notabilis]
Length=537

 Score =   365 bits (937),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 190/218 (87%), Positives = 205/218 (94%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL+GTT+TWFLLDIAFYSQ LFQKDIF AIGWIP   TMNA++EV++IARAQTLIA+
Sbjct  294  HGLHLVGTTTTWFLLDIAFYSQNLFQKDIFTAIGWIPAANTMNAIQEVYKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALID  GRFAIQLMGFFFMTVFMFALAIPY+HWT KENRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVALIDYMGRFAIQLMGFFFMTVFMFALAIPYNHWTQKENRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+TD  KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSTDKTKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIG++NSL++LG INF GM+FTLLVPESKGKSL
Sbjct  474  AGYPPGIGIKNSLIMLGVINFFGMLFTLLVPESKGKSL  511



>ref|XP_009354937.1| PREDICTED: inorganic phosphate transporter 1-4 [Pyrus x bretschneideri]
Length=538

 Score =   365 bits (937),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 202/249 (81%), Positives = 220/249 (88%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEV+RIARAQTLIA+
Sbjct  290  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKTMNAIEEVYRIARAQTLIAL  349

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID+ GRFAIQLMGFFFMTVFMFALAIPYDHWTHK+NRIGFV +YSLT
Sbjct  350  CSTVPGYWFTVAFIDRIGRFAIQLMGFFFMTVFMFALAIPYDHWTHKDNRIGFVVIYSLT  409

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GAIVGAFGFLY AQN D  KTD
Sbjct  410  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAIVGAFGFLYLAQNKDKNKTD  469

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYPPGIGV+NSL+VLG +NFLG++FT LVPES G+SLEEMS ENE E  +   E+  Q 
Sbjct  470  AGYPPGIGVKNSLIVLGVVNFLGILFTFLVPESNGRSLEEMSGENEEESETGAVELE-QS  528

Query  722  GHEIRTVPV  748
             +  RTVPV
Sbjct  529  SYNNRTVPV  537



>ref|XP_002285153.1| PREDICTED: inorganic phosphate transporter 1-4-like [Vitis vinifera]
Length=536

 Score =   365 bits (936),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 191/218 (88%), Positives = 205/218 (94%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TM+A+EEV++IARAQTLIA+
Sbjct  293  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPAAKTMSALEEVYKIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALIDK GRFAIQLMGFFFMTVFMFALAIPY+HWTHKENRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVALIDKMGRFAIQLMGFFFMTVFMFALAIPYNHWTHKENRIGFVVMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ D +K D
Sbjct  413  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSQDKSKVD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYP GIGV+NSL+VLG +NFLGM+FT LVPESKGKSL
Sbjct  473  KGYPTGIGVKNSLIVLGVVNFLGMLFTFLVPESKGKSL  510



>ref|XP_007050310.1| Phosphate transporter 1,4 [Theobroma cacao]
 gb|EOX94467.1| Phosphate transporter 1,4 [Theobroma cacao]
Length=539

 Score =   365 bits (936),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 205/249 (82%), Positives = 218/249 (88%), Gaps = 3/249 (1%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HG HLLGTT+TWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EVFRIARAQTLIA+
Sbjct  293  HGFHLLGTTTTWFLLDIAFYSQNLFQKDIFSAIGWIPAAKTMNALDEVFRIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA IDK GRF+IQLMGFFFMTVFMFALAIPYDHWTHK+NRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVAFIDKIGRFSIQLMGFFFMTVFMFALAIPYDHWTHKDNRIGFVVMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GK GAIVGAFGFLY AQN D AK D
Sbjct  413  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKLGAIVGAFGFLYLAQNKDKAKAD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYP GIGV+NSLLVLG IN LG +FT LVPESKGKSLEEMS ENE     VE E+ +  
Sbjct  473  AGYPAGIGVKNSLLVLGAINALGFLFTFLVPESKGKSLEEMSGENEDNGAEVEAELSS--  530

Query  722  GHEIRTVPV  748
             H  RTVPV
Sbjct  531  -HNHRTVPV  538



>ref|XP_010555844.1| PREDICTED: inorganic phosphate transporter 1-4-like [Tarenaya 
hassleriana]
Length=532

 Score =   364 bits (934),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 202/249 (81%), Positives = 214/249 (86%), Gaps = 11/249 (4%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT STWFLLDIAFYSQ LFQKDIF AIGWIP   TMNA++EVFRIARAQTLIA+
Sbjct  294  HGLHLLGTASTWFLLDIAFYSQNLFQKDIFSAIGWIPPSPTMNAIQEVFRIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFALAIPY+HWTHK+NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDIIGRFAIQLMGFFFMTVFMFALAIPYNHWTHKDNRIGFVIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAAAGK GA+VGAFGFLY AQ+ D  KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAAAGKLGAMVGAFGFLYLAQSPDKTKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYPPGIGVRNSLL+LG +NFLGM+FT LVPESKGKSLEEMSREN              G
Sbjct  474  AGYPPGIGVRNSLLLLGVVNFLGMIFTFLVPESKGKSLEEMSREN-----------DESG  522

Query  722  GHEIRTVPV  748
            G   +TVPV
Sbjct  523  GSNTKTVPV  531



>ref|XP_002877995.1| inorganic phosphate transporter 1-7 /Pi cotransporter [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH54254.1| inorganic phosphate transporter 1-7 /Pi cotransporter [Arabidopsis 
lyrata subsp. lyrata]
Length=533

 Score =   364 bits (934),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EVF+IARAQTLIA+
Sbjct  290  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNAIQEVFKIARAQTLIAL  349

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPYDHWTHKENRIGFV MYSLT
Sbjct  350  CSTVPGYWFTVAFIDVIGRFAIQMMGFFFMTVFMFALAIPYDHWTHKENRIGFVAMYSLT  409

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GA+VGAFGFLY AQ+ D  KT+
Sbjct  410  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQSPDKTKTE  469

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYPPGIGV+NSL+VLG +N LGMVFTLLVPESKGKSL
Sbjct  470  HGYPPGIGVKNSLIVLGVVNLLGMVFTLLVPESKGKSL  507



>ref|XP_009143350.1| PREDICTED: inorganic phosphate transporter 1-4-like [Brassica 
rapa]
Length=534

 Score =   364 bits (934),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 188/218 (86%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EVF+IARAQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNAIQEVFKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPY+HWTHKENRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDVIGRFAIQMMGFFFMTVFMFALAIPYNHWTHKENRIGFVIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GA+VGAFGFLY AQ+ D  KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQSPDKNKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGVRNSLLVLG +NFLG++FT LVPESKGKSL
Sbjct  474  AGYPPGIGVRNSLLVLGVVNFLGILFTFLVPESKGKSL  511



>ref|NP_191030.3| phosphate transporter 1;7 [Arabidopsis thaliana]
 sp|Q494P0.2|PHT17_ARATH RecName: Full=Probable inorganic phosphate transporter 1-7; Short=AtPht1;7; 
AltName: Full=H(+)/Pi cotransporter [Arabidopsis 
thaliana]
 emb|CAB77590.1| phosphate transport protein [Arabidopsis thaliana]
 gb|AEE79268.1| phosphate transporter 1;7 [Arabidopsis thaliana]
Length=535

 Score =   364 bits (934),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EVF+IARAQTLIA+
Sbjct  290  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNAIQEVFKIARAQTLIAL  349

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPYDHWTHKENRIGFV MYSLT
Sbjct  350  CSTVPGYWFTVAFIDVIGRFAIQMMGFFFMTVFMFALAIPYDHWTHKENRIGFVAMYSLT  409

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GA+VGAFGFLY AQ+ D  KT+
Sbjct  410  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQSPDKTKTE  469

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYPPGIGV+NSL+VLG +N LGMVFTLLVPESKGKSL
Sbjct  470  HGYPPGIGVKNSLIVLGVVNLLGMVFTLLVPESKGKSL  507



>ref|NP_181428.1| inorganic phosphate transporter 1-4 [Arabidopsis thaliana]
 sp|Q96303.1|PHT14_ARATH RecName: Full=Inorganic phosphate transporter 1-4; Short=AtPht1;4; 
AltName: Full=H(+)/Pi cotransporter [Arabidopsis thaliana]
 gb|AAB17266.1| phosphate transporter [Arabidopsis thaliana]
 gb|AAB88291.1| phosphate transporter [Arabidopsis thaliana]
 dbj|BAA34398.1| Phosphate Transporter 4 [Arabidopsis thaliana]
 gb|AAC79607.1| phosphate transporter (AtPT2) [Arabidopsis thaliana]
 gb|AEC09615.1| inorganic phosphate transporter 1-4 [Arabidopsis thaliana]
Length=534

 Score =   364 bits (934),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  ++MNA++EVF+IARAQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQSMNAIQEVFKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPY+HWTHKENRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDVIGRFAIQMMGFFFMTVFMFALAIPYNHWTHKENRIGFVIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GA+VGAFGFLY AQN D  KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQNPDKDKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGVRNSL+VLG +NFLG++FT LVPESKGKSL
Sbjct  474  AGYPPGIGVRNSLIVLGVVNFLGILFTFLVPESKGKSL  511



>ref|XP_009143351.1| PREDICTED: inorganic phosphate transporter 1-4-like [Brassica 
rapa]
Length=534

 Score =   363 bits (933),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 188/218 (86%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EVF+IARAQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNAIQEVFKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPY+HWTHKENRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDVIGRFAIQMMGFFFMTVFMFALAIPYNHWTHKENRIGFVIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GA+VGAFGFLY AQ+ D  KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQSPDKNKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGVRNSLLVLG +NFLG++FT LVPESKGKSL
Sbjct  474  AGYPPGIGVRNSLLVLGVVNFLGILFTFLVPESKGKSL  511



>emb|CDX76138.1| BnaA04g04020D [Brassica napus]
Length=537

 Score =   363 bits (933),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EVF+IARAQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNAIQEVFKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPYDHWTHK+NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDIIGRFAIQMMGFFFMTVFMFALAIPYDHWTHKDNRIGFVAMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GA+VGAFGFLY AQ+ D  KT+
Sbjct  414  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQSPDKNKTE  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYPPGIGV+NSL+VLG +NFLGMVFTLLVPESKGKSL
Sbjct  474  HGYPPGIGVKNSLIVLGVVNFLGMVFTLLVPESKGKSL  511



>ref|XP_009369491.1| PREDICTED: probable inorganic phosphate transporter 1-7 [Pyrus 
x bretschneideri]
Length=538

 Score =   363 bits (933),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 203/249 (82%), Positives = 221/249 (89%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEV+RIARAQTLIA+
Sbjct  290  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKTMNAIEEVYRIARAQTLIAL  349

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALID+ GRFAIQLMGFFFMTVFMFALAIPYDHWTHK+NRIGFV +YSLT
Sbjct  350  CSTVPGYWFTVALIDRIGRFAIQLMGFFFMTVFMFALAIPYDHWTHKDNRIGFVAIYSLT  409

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GAIVGAFGFLY AQN D AK D
Sbjct  410  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAIVGAFGFLYLAQNQDKAKAD  469

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYP GIGV+NSL+VLG +NFLG++FT LVPES G+SLEEMS ENE E  SV  E+    
Sbjct  470  AGYPAGIGVKNSLIVLGVVNFLGILFTFLVPESNGRSLEEMSGENEEESESVAVELE-HS  528

Query  722  GHEIRTVPV  748
            G+  RT+PV
Sbjct  529  GYNNRTLPV  537



>ref|XP_002524621.1| inorganic phosphate transporter, putative [Ricinus communis]
 gb|EEF37829.1| inorganic phosphate transporter, putative [Ricinus communis]
Length=524

 Score =   363 bits (932),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 184/218 (84%), Positives = 203/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP+ ++MNA++EVFRIARAQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPSAKSMNAIQEVFRIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALIDK GRFAIQ+MGFFFMTVFMFALAIPY+HWTHKENRIGFV MYS T
Sbjct  354  CSTVPGYWFTVALIDKMGRFAIQMMGFFFMTVFMFALAIPYNHWTHKENRIGFVVMYSFT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPN+TTF+VPAEIFPARLRSTCHG+SAA+GK GA+VGAFGFLY AQN D +K D
Sbjct  414  FFFANFGPNSTTFIVPAEIFPARLRSTCHGISAASGKLGAMVGAFGFLYLAQNQDKSKAD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+NSL++LG +N LGM+FT LVPESKGKSL
Sbjct  474  AGYPAGIGVKNSLILLGIVNLLGMLFTFLVPESKGKSL  511



>gb|AIU41746.1| phosphorus transporter PT1 [Lycium barbarum]
Length=539

 Score =   363 bits (933),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 207/249 (83%), Positives = 221/249 (89%), Gaps = 3/249 (1%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT STWFLLDIAFYSQ L QKDIF AIGWIP  +TMNA+EEV+RIARAQT+IA+
Sbjct  294  HGLHLLGTASTWFLLDIAFYSQNLSQKDIFSAIGWIPPAQTMNALEEVYRIARAQTIIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTV  ID+ GRFAIQLMGFFFMTVFMFALAIPY HWT K+NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVVFIDRIGRFAIQLMGFFFMTVFMFALAIPYHHWTLKDNRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARL+STCHG+SAAAGKA A+VGAFGFLYAAQ  DP KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLKSTCHGISAAAGKARAMVGAFGFLYAAQPQDPKKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYP GIGVRNSL++LGC+NFLGM+FT LVPES GKSLEEMSRENEGEE S  TEMR   
Sbjct  474  AGYPAGIGVRNSLIILGCVNFLGMIFTFLVPESNGKSLEEMSRENEGEEESAGTEMRGAS  533

Query  722  GHEIRTVPV  748
            G   RTVPV
Sbjct  534  G---RTVPV  539



>ref|XP_009139223.1| PREDICTED: probable inorganic phosphate transporter 1-7 [Brassica 
rapa]
Length=537

 Score =   363 bits (933),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EVF+IARAQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNAIQEVFKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPYDHWTHK+NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDIIGRFAIQMMGFFFMTVFMFALAIPYDHWTHKDNRIGFVAMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GA+VGAFGFLY AQ+ D  KT+
Sbjct  414  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQSPDKNKTE  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYPPGIGV+NSL+VLG +NFLGMVFTLLVPESKGKSL
Sbjct  474  HGYPPGIGVKNSLIVLGVVNFLGMVFTLLVPESKGKSL  511



>ref|XP_010516009.1| PREDICTED: probable inorganic phosphate transporter 1-7 [Camelina 
sativa]
Length=535

 Score =   363 bits (932),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EVF+IARAQTLIA+
Sbjct  290  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNAIQEVFKIARAQTLIAL  349

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMT+FMFALAIPYDHWTHKENRIGFV MYSLT
Sbjct  350  CSTVPGYWFTVAFIDVIGRFAIQMMGFFFMTIFMFALAIPYDHWTHKENRIGFVAMYSLT  409

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GA+VGAFGFLY AQ+ D  KT+
Sbjct  410  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQSPDKNKTE  469

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYPPGIGV+NSL+VLG +N LGMVFTLLVPESKGKSL
Sbjct  470  HGYPPGIGVKNSLIVLGVVNLLGMVFTLLVPESKGKSL  507



>ref|XP_010039303.1| PREDICTED: inorganic phosphate transporter 1-4 isoform X1 [Eucalyptus 
grandis]
 gb|KCW84743.1| hypothetical protein EUGRSUZ_B01557 [Eucalyptus grandis]
Length=528

 Score =   363 bits (931),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 189/218 (87%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEVF IARAQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPGAKTMNAIEEVFWIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALID+ GRFAIQLMGF FMT+FMFALAIPYDHWTHKENRIGFV +YSLT
Sbjct  354  CSTVPGYWFTVALIDRMGRFAIQLMGFAFMTIFMFALAIPYDHWTHKENRIGFVVVYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGK GAIVGAFGFLY AQN D  K D
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKLGAIVGAFGFLYLAQNQDKTKVD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGVRNSL++LG +NFLG++FT LVPESKGKSL
Sbjct  474  AGYPAGIGVRNSLILLGVVNFLGLLFTFLVPESKGKSL  511



>ref|XP_010427180.1| PREDICTED: probable inorganic phosphate transporter 1-7 [Camelina 
sativa]
Length=535

 Score =   363 bits (932),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EVF+IARAQTLIA+
Sbjct  290  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNAIQEVFKIARAQTLIAL  349

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPYDHWTHKENRIGFV MYSLT
Sbjct  350  CSTVPGYWFTVAFIDVIGRFAIQMMGFFFMTVFMFALAIPYDHWTHKENRIGFVVMYSLT  409

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GA+VGAFGFLY AQ+ D  KT+
Sbjct  410  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQSPDKNKTE  469

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYPPGIGV+NSL+VLG +N LGMVFTLLVPESKGKSL
Sbjct  470  HGYPPGIGVKNSLIVLGVVNLLGMVFTLLVPESKGKSL  507



>gb|EPS70986.1| phosphate transporter, partial [Genlisea aurea]
Length=518

 Score =   362 bits (930),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 189/218 (87%), Positives = 203/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIAFYSQ LFQKDIF +IGWIP  +TMNA++EVFRIARAQTLIA+
Sbjct  294  HGLHLLGTTTTWFLLDIAFYSQNLFQKDIFSSIGWIPPAKTMNALDEVFRIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID+ GRFAIQLMGFFFMTVFMFALAIPYDHWTHK+NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDRIGRFAIQLMGFFFMTVFMFALAIPYDHWTHKDNRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ  DP K D
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQPKDPTKRD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+ SL++LGC+N LGM+FT LVPESKGKSL
Sbjct  474  AGYPAGIGVKYSLILLGCVNALGMIFTFLVPESKGKSL  511



>ref|XP_011025992.1| PREDICTED: inorganic phosphate transporter 1-4-like [Populus 
euphratica]
Length=539

 Score =   363 bits (931),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EV+RIARAQTLIA+
Sbjct  293  HGLHLLGTTTTWFLLDIAFYSQNLFQKDIFSAIGWIPKAQTMNAIDEVYRIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID+ GRFAIQLMGFFFMTVFMFALAIPY+HWTHK+N+IGFV +YSLT
Sbjct  353  CSTVPGYWFTVAFIDRIGRFAIQLMGFFFMTVFMFALAIPYNHWTHKDNQIGFVIIYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GK GAIVGAFGFLY AQN D AK D
Sbjct  413  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKLGAIVGAFGFLYLAQNQDKAKAD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+NSLLVLG +NF GMVFT LVPESKGKSL
Sbjct  473  AGYPAGIGVKNSLLVLGVVNFFGMVFTFLVPESKGKSL  510



>gb|AFK82642.1| phosphate transporter, partial [Helianthus annuus]
Length=368

 Score =   357 bits (916),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 193/249 (78%), Positives = 212/249 (85%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EVF+I+RAQTLIA+
Sbjct  121  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKTMNAIQEVFKISRAQTLIAL  180

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTV  ID+ GRFAIQLMGFFFMTVFMFALAIPY HWT +ENRIGFV MY+ T
Sbjct  181  CSTVPGYWFTVFFIDRIGRFAIQLMGFFFMTVFMFALAIPYHHWTQRENRIGFVVMYAFT  240

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GKAGAI+GAFGFLYAAQN D  KTD
Sbjct  241  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKAGAIIGAFGFLYAAQNQDKTKTD  300

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
             GYPPGIGV+NSL+VLG +NFLG++FT LVPES GKSL E       +E     +M T  
Sbjct  301  KGYPPGIGVKNSLIVLGVVNFLGILFTFLVPESNGKSL-EEMSRENEDEDEEGIDMETVR  359

Query  722  GHEIRTVPV  748
              E RTVPV
Sbjct  360  TSENRTVPV  368



>gb|AFY06658.1| phosphate transporter [Citrus trifoliata]
Length=540

 Score =   363 bits (931),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 199/249 (80%), Positives = 216/249 (87%), Gaps = 2/249 (1%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF A+GWIP  +TMNA+ EV++IARAQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAVGWIPPAKTMNAIHEVYKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA IDK GRFAIQ+MGFFFMTVFMFALAIPYDHWTHK NR+GFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDKIGRFAIQMMGFFFMTVFMFALAIPYDHWTHKSNRLGFVIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GK GAIVGAFGFLY AQN D  KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKLGAIVGAFGFLYLAQNKDKTKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYPPGIGV+NSL+VLG +N LG++FT LVPESKGKSLEEMS EN+ E        R   
Sbjct  474  AGYPPGIGVKNSLIVLGFVNLLGLLFTFLVPESKGKSLEEMSGENQDEGAQDME--RNPS  531

Query  722  GHEIRTVPV  748
             +  RTVPV
Sbjct  532  SNNSRTVPV  540



>ref|XP_010509096.1| PREDICTED: inorganic phosphate transporter 1-4-like [Camelina 
sativa]
Length=534

 Score =   362 bits (930),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  ++MNA++EVF+IARAQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQSMNAIQEVFKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPY+HWTHKENRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDVIGRFAIQMMGFFFMTVFMFALAIPYNHWTHKENRIGFVIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GA+VGAFGFLY AQ+ D  KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQSPDKEKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGVRNSL+VLG +NFLG++FT LVPESKGKSL
Sbjct  474  AGYPPGIGVRNSLIVLGVVNFLGILFTFLVPESKGKSL  511



>ref|XP_010517220.1| PREDICTED: inorganic phosphate transporter 1-4 isoform X2 [Camelina 
sativa]
 ref|XP_010517221.1| PREDICTED: inorganic phosphate transporter 1-4 isoform X2 [Camelina 
sativa]
Length=534

 Score =   362 bits (930),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  ++MNA++EVF+IARAQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQSMNAIQEVFKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPY+HWTHKENRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDVIGRFAIQMMGFFFMTVFMFALAIPYNHWTHKENRIGFVIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GA+VGAFGFLY AQ+ D  KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQSPDKEKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGVRNSL+VLG +NFLG++FT LVPESKGKSL
Sbjct  474  AGYPPGIGVRNSLIVLGVVNFLGILFTFLVPESKGKSL  511



>gb|ACJ83774.1| unknown [Medicago truncatula]
Length=298

 Score =   354 bits (908),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIAFYSQ LFQKDIF AIGWIP  + MNA+ E++RIARAQTLIA+
Sbjct  61   HGLHLLGTTTTWFLLDIAFYSQNLFQKDIFTAIGWIPPAKEMNAINELYRIARAQTLIAL  120

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFALAIPYDHWT KENRIGFV MYSLT
Sbjct  121  CSTVPGYWFTVAFIDYMGRFAIQLMGFFFMTVFMFALAIPYDHWTKKENRIGFVVMYSLT  180

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ DP KTD
Sbjct  181  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDPTKTD  240

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYP GIG++NSL+VLG +NF GMVFT LVPE  GKSL
Sbjct  241  HGYPTGIGIKNSLIVLGVVNFFGMVFTFLVPEPNGKSL  278



>ref|XP_010553420.1| PREDICTED: inorganic phosphate transporter 1-4 [Tarenaya hassleriana]
Length=534

 Score =   362 bits (929),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 188/218 (86%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EVFRIARAQTLIA+
Sbjct  294  HGLHLLGTTTTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNAIQEVFRIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTV  ID  GRFAIQLMGFFFMTVFMFALAIPY+HWTHK+NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVGFIDIIGRFAIQLMGFFFMTVFMFALAIPYNHWTHKDNRIGFVIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GAIVGAFGFLY AQN D  KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAIVGAFGFLYLAQNPDKTKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGVRNSL+VLG +NFLG++FT LVPESKGKSL
Sbjct  474  AGYPPGIGVRNSLIVLGVVNFLGILFTFLVPESKGKSL  511



>emb|CAN76105.1| hypothetical protein VITISV_020362 [Vitis vinifera]
Length=536

 Score =   362 bits (930),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 190/218 (87%), Positives = 204/218 (94%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TM+A+EEV++IARAQTLIA+
Sbjct  293  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPAAKTMSALEEVYKIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALIDK GRFAIQLMGFFFMTVFMFALAIPY+HWTHKENRIGFV  YSLT
Sbjct  353  CSTVPGYWFTVALIDKMGRFAIQLMGFFFMTVFMFALAIPYNHWTHKENRIGFVVXYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ D +K D
Sbjct  413  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSQDKSKVD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYP GIGV+NSL+VLG +NFLGM+FT LVPESKGKSL
Sbjct  473  KGYPTGIGVKNSLIVLGVVNFLGMLFTFLVPESKGKSL  510



>ref|XP_010517219.1| PREDICTED: inorganic phosphate transporter 1-4 isoform X1 [Camelina 
sativa]
Length=541

 Score =   362 bits (929),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  ++MNA++EVF+IARAQTLIA+
Sbjct  301  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQSMNAIQEVFKIARAQTLIAL  360

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPY+HWTHKENRIGFV MYSLT
Sbjct  361  CSTVPGYWFTVAFIDVIGRFAIQMMGFFFMTVFMFALAIPYNHWTHKENRIGFVIMYSLT  420

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GA+VGAFGFLY AQ+ D  KTD
Sbjct  421  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQSPDKEKTD  480

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGVRNSL+VLG +NFLG++FT LVPESKGKSL
Sbjct  481  AGYPPGIGVRNSLIVLGVVNFLGILFTFLVPESKGKSL  518



>emb|CDY13225.1| BnaC04g26100D [Brassica napus]
Length=515

 Score =   361 bits (927),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EVF+IARAQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNAIQEVFKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPYDHWTHK+NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDIIGRFAIQMMGFFFMTVFMFALAIPYDHWTHKDNRIGFVAMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GA+VGAFGFLY AQ+ D  KT+
Sbjct  414  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQSPDKNKTE  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYPPGIGV+NSL+VLG +N LGMVFTLLVPESKGKSL
Sbjct  474  HGYPPGIGVKNSLIVLGVVNLLGMVFTLLVPESKGKSL  511



>ref|XP_009143348.1| PREDICTED: inorganic phosphate transporter 1-4-like isoform X1 
[Brassica rapa]
 emb|CDX74874.1| BnaA05g06200D [Brassica napus]
Length=533

 Score =   362 bits (929),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 189/218 (87%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNAV+EVF+IARAQTLIA+
Sbjct  293  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNAVQEVFKIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTV  ID  GRFAIQLMGFFFMTVFMFALAIPY+HWTHK+NRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVVFIDVIGRFAIQLMGFFFMTVFMFALAIPYNHWTHKDNRIGFVIMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GA+VGAFGFLY AQ+ D  KTD
Sbjct  413  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQSPDKNKTD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGVRNSLLVLG INFLG++FT LVPESKGKSL
Sbjct  473  AGYPPGIGVRNSLLVLGVINFLGILFTFLVPESKGKSL  510



>ref|XP_010504284.1| PREDICTED: probable inorganic phosphate transporter 1-7 [Camelina 
sativa]
Length=535

 Score =   362 bits (929),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 200/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EVF+IARAQTLIA+
Sbjct  290  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNAIQEVFKIARAQTLIAL  349

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPYDHWTHKENRIGFV MYSLT
Sbjct  350  CSTVPGYWFTVAFIDVIGRFAIQMMGFFFMTVFMFALAIPYDHWTHKENRIGFVAMYSLT  409

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GA+VGAFGFLY AQ+ D  KT+
Sbjct  410  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQSPDKNKTE  469

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYPPGIGV+NSL+VLG +N LGM FTLLVPESKGKSL
Sbjct  470  HGYPPGIGVKNSLIVLGVVNLLGMAFTLLVPESKGKSL  507



>ref|XP_006292723.1| hypothetical protein CARUB_v10018969mg [Capsella rubella]
 gb|EOA25621.1| hypothetical protein CARUB_v10018969mg [Capsella rubella]
Length=536

 Score =   362 bits (928),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EVF+IARAQTLIA+
Sbjct  290  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNAIQEVFKIARAQTLIAM  349

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPYDHWTHK+NRIGFV MYSLT
Sbjct  350  CSTVPGYWFTVAFIDVIGRFAIQMMGFFFMTVFMFALAIPYDHWTHKDNRIGFVAMYSLT  409

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GA+VGAFGFLY AQ+ D  KT+
Sbjct  410  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQSPDKNKTE  469

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYPPGIGV+NSL+VLG +N LGMVFTLLVPESKGKSL
Sbjct  470  HGYPPGIGVKNSLIVLGVVNLLGMVFTLLVPESKGKSL  507



>ref|XP_002879774.1| hypothetical protein ARALYDRAFT_482913 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56033.1| hypothetical protein ARALYDRAFT_482913 [Arabidopsis lyrata subsp. 
lyrata]
Length=534

 Score =   362 bits (928),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  ++MNA++EVF+IARAQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKSMNAIQEVFKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPY+HWTHKENRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDVIGRFAIQMMGFFFMTVFMFALAIPYNHWTHKENRIGFVIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GA+VGAFGFLY AQ+ D  KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQSPDKNKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGVRNSL+VLG +NFLG++FT LVPESKGKSL
Sbjct  474  AGYPPGIGVRNSLIVLGVVNFLGILFTFLVPESKGKSL  511



>gb|ABK63958.1| PT1 [Capsicum frutescens]
Length=539

 Score =   362 bits (928),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 204/249 (82%), Positives = 223/249 (90%), Gaps = 4/249 (2%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP+ +TMNA++EV+RIARAQTLIA+
Sbjct  295  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPSAQTMNALDEVYRIARAQTLIAL  354

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID+ GRFAIQLMGFFFMTVFMFALAIPY+HWTHK++RIGFV MYSLT
Sbjct  355  CSTVPGYWFTVAFIDRIGRFAIQLMGFFFMTVFMFALAIPYNHWTHKDHRIGFVVMYSLT  414

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ TDP K +
Sbjct  415  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQPTDPKKAE  474

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYP GIGV+NSL+VLG +NFLGM+FT  VPES GKSLE++SRENEGEE +      T G
Sbjct  475  AGYPAGIGVKNSLIVLGVVNFLGMLFTFCVPESNGKSLEDLSRENEGEEENGAEMRATSG  534

Query  722  GHEIRTVPV  748
                RTVPV
Sbjct  535  ----RTVPV  539



>ref|XP_008372094.1| PREDICTED: inorganic phosphate transporter 1-4 [Malus domestica]
Length=538

 Score =   362 bits (928),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 201/249 (81%), Positives = 217/249 (87%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  ETMNA+EEV+RIARAQTLIA+
Sbjct  290  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAETMNAIEEVYRIARAQTLIAL  349

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID+ GRFAIQLMGFFFMTVFMFALAIPY HWTHK+NRIGFV +Y LT
Sbjct  350  CSTVPGYWFTVAFIDRIGRFAIQLMGFFFMTVFMFALAIPYXHWTHKDNRIGFVVIYXLT  409

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GAIVG FGFLY AQN D  KTD
Sbjct  410  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAIVGVFGFLYLAQNKDKNKTD  469

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYPPGIGV+NSLLVLG +NFLG++FT LVPES G+SLEEMS ENE E  +   E+  Q 
Sbjct  470  AGYPPGIGVKNSLLVLGVVNFLGILFTFLVPESNGRSLEEMSGENEEESETGTVELE-QS  528

Query  722  GHEIRTVPV  748
             +  RTVPV
Sbjct  529  NYNNRTVPV  537



>gb|AAF74025.1|AF156696_1 inorganic phosphate transporter [Nicotiana tabacum]
Length=537

 Score =   361 bits (927),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 190/218 (87%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT STWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEV++IARAQTLIA+
Sbjct  294  HGLHLLGTASTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNALEEVYKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTV  IDK GRFAIQLMGFFFMTVFMFALAIPY HWT K+NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVFFIDKIGRFAIQLMGFFFMTVFMFALAIPYHHWTLKDNRIGFVIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGA++GAFGFLYAAQ TD  K D
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAMIGAFGFLYAAQPTDRKKAD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGVRNSL+VLGC+NFLGMVFT LVPESKGKSL
Sbjct  474  AGYPAGIGVRNSLIVLGCVNFLGMVFTFLVPESKGKSL  511



>ref|XP_006293978.1| hypothetical protein CARUB_v10022969mg [Capsella rubella]
 gb|EOA26876.1| hypothetical protein CARUB_v10022969mg [Capsella rubella]
Length=534

 Score =   361 bits (927),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  ++MNA++EVF+IARAQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKSMNAIQEVFKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPY+HWTHKENRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDVVGRFAIQMMGFFFMTVFMFALAIPYNHWTHKENRIGFVIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GA+VGAFGFLY AQ+ D  KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQSPDKDKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGVRNSL+VLG +NFLG++FT LVPESKGKSL
Sbjct  474  AGYPPGIGVRNSLIVLGVVNFLGILFTFLVPESKGKSL  511



>ref|XP_009765236.1| PREDICTED: inorganic phosphate transporter 1-4-like [Nicotiana 
sylvestris]
Length=537

 Score =   361 bits (927),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 190/218 (87%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT STWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEV++IARAQTLIA+
Sbjct  294  HGLHLLGTASTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNALEEVYKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTV  IDK GRFAIQLMGFFFMTVFMFALAIPY HWT K+NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVFFIDKIGRFAIQLMGFFFMTVFMFALAIPYHHWTLKDNRIGFVIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGA++GAFGFLYAAQ TD  K D
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAMIGAFGFLYAAQPTDRKKAD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGVRNSL+VLGC+NFLGMVFT LVPESKGKSL
Sbjct  474  AGYPAGIGVRNSLIVLGCVNFLGMVFTFLVPESKGKSL  511



>ref|XP_006403546.1| hypothetical protein EUTSA_v10010274mg [Eutrema salsugineum]
 gb|ESQ44999.1| hypothetical protein EUTSA_v10010274mg [Eutrema salsugineum]
Length=537

 Score =   361 bits (926),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 200/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EVF+IARAQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNAIQEVFKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPYDHWTHKENRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDVIGRFAIQMMGFFFMTVFMFALAIPYDHWTHKENRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GA+VGAFGFLY AQ+ D  KT+
Sbjct  414  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQSPDKTKTE  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYPPGIGV+NSL+VLG +N LGM FTLLVPESKGKSL
Sbjct  474  HGYPPGIGVKNSLIVLGVVNLLGMFFTLLVPESKGKSL  511



>emb|CAC28219.1| phosphate transporter [Sesbania rostrata]
Length=540

 Score =   361 bits (926),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 190/218 (87%), Positives = 203/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL+GTT+TWFLLDIAFYSQ LFQKDIF AIGWIP  + MNA+ EV+RIARAQTLIA+
Sbjct  297  HGLHLVGTTTTWFLLDIAFYSQNLFQKDIFTAIGWIPPAKEMNAIHEVYRIARAQTLIAL  356

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFALAIPY HWT KENRIGFV MYSLT
Sbjct  357  CSTVPGYWFTVAFIDYMGRFAIQLMGFFFMTVFMFALAIPYHHWTLKENRIGFVVMYSLT  416

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+TDPAKTD
Sbjct  417  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSTDPAKTD  476

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+NSL++LG INF G++FTLLVPESKGKSL
Sbjct  477  AGYPTGIGVKNSLIMLGVINFFGIIFTLLVPESKGKSL  514



>ref|XP_004296364.1| PREDICTED: probable inorganic phosphate transporter 1-7-like 
[Fragaria vesca subsp. vesca]
Length=540

 Score =   361 bits (926),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 192/218 (88%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HG HLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP+ E MNA+ EV+RIARAQTLIA+
Sbjct  294  HGWHLLGTTSTWFLLDIAFYSQNLFQKDIFTAIGWIPSAEKMNAIHEVYRIARAQTLIAM  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALID  GRFAIQLMGFFFMTVFMFALAIPY HWT K NRIGFV +YSLT
Sbjct  354  CSTVPGYWFTVALIDHMGRFAIQLMGFFFMTVFMFALAIPYHHWTLKPNRIGFVVIYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQN DP KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQNKDPKKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+NSL++LG INFLGMVFT LVPESKGKSL
Sbjct  474  AGYPAGIGVKNSLIMLGVINFLGMVFTFLVPESKGKSL  511



>emb|CDX91503.1| BnaC04g06470D [Brassica napus]
Length=533

 Score =   360 bits (925),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 189/218 (87%), Positives = 200/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNAV+EVF+IARAQTLIA+
Sbjct  293  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPVQTMNAVQEVFKIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTV  ID  GRFAIQLMGFFFMTVFMFALAIPY HWTHK+NRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVVFIDVIGRFAIQLMGFFFMTVFMFALAIPYTHWTHKDNRIGFVIMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GA+VGAFGFLY AQ+ D  KTD
Sbjct  413  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQSPDKNKTD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGVRNSLLVLG INFLG++FT LVPESKGKSL
Sbjct  473  AGYPPGIGVRNSLLVLGVINFLGILFTFLVPESKGKSL  510



>ref|XP_008235689.1| PREDICTED: inorganic phosphate transporter 1-4 [Prunus mume]
Length=538

 Score =   361 bits (926),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 200/249 (80%), Positives = 219/249 (88%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEVFRIARAQTLIA+
Sbjct  290  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKTMNAIEEVFRIARAQTLIAL  349

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTV  ID+ GRFAIQLMGFFFMTVFMFALAIPYDHWTHK+NRIGFV +YSLT
Sbjct  350  CSTVPGYWFTVLFIDRIGRFAIQLMGFFFMTVFMFALAIPYDHWTHKDNRIGFVVIYSLT  409

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GAI+GAFGFLY AQN D +K D
Sbjct  410  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAIIGAFGFLYLAQNKDKSKVD  469

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYP GIGV+NSL+VLG INFLG++FT LVPES GKSLEEMS ENE E  +   E+   G
Sbjct  470  AGYPAGIGVKNSLIVLGVINFLGILFTFLVPESNGKSLEEMSGENENENETGAVELEPSG  529

Query  722  GHEIRTVPV  748
             ++ RTVP+
Sbjct  530  LNK-RTVPL  537



>gb|EPS70401.1| inorganic phosphate transporter, partial [Genlisea aurea]
Length=528

 Score =   360 bits (924),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 205/218 (94%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL+GTT+TWFLLDIAFYSQ LFQKDIF AIGWIP P+TMNA++EV++I+RAQTLIA+
Sbjct  299  HGLHLVGTTTTWFLLDIAFYSQNLFQKDIFSAIGWIPPPQTMNALQEVYKISRAQTLIAL  358

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTV  ID+ GRFAIQLMGFFFMTVFMFA+AIPYDHWT K+NRIGFV +YSLT
Sbjct  359  CSTVPGYWFTVFFIDRIGRFAIQLMGFFFMTVFMFAIAIPYDHWTRKDNRIGFVVIYSLT  418

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GKAGAIVGAFGFLYAAQ  DPAK D
Sbjct  419  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKAGAIVGAFGFLYAAQPKDPAKRD  478

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGVR SL++LGC+NFLGM+FTLLVPESKGKSL
Sbjct  479  AGYPAGIGVRYSLIMLGCVNFLGMLFTLLVPESKGKSL  516



>gb|AFK45744.1| unknown [Lotus japonicus]
Length=241

 Score =   350 bits (898),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 199/216 (92%), Gaps = 0/216 (0%)
 Frame = +2

Query  8    LHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAVCS  187
            +HLLGTT+TWFLLDIAFYSQ LFQKDIF AIGWIP  + MNA+ EV++IARAQTLIA+CS
Sbjct  1    MHLLGTTTTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKEMNAIHEVYKIARAQTLIALCS  60

Query  188  TVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLTFF  367
            TVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFALA+PYDHWT K+NR GFV MY+LTFF
Sbjct  61   TVPGYWFTVAFIDYMGRFAIQLMGFFFMTVFMFALALPYDHWTKKDNRFGFVAMYALTFF  120

Query  368  FANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTDAG  547
            FANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYA+Q+ DPAKTD G
Sbjct  121  FANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYASQSKDPAKTDPG  180

Query  548  YPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            YP GIGVRNSL++LG INFLGMVFT LVPESKGKSL
Sbjct  181  YPTGIGVRNSLIMLGVINFLGMVFTFLVPESKGKSL  216



>ref|XP_008349062.1| PREDICTED: inorganic phosphate transporter 1-4 [Malus domestica]
Length=538

 Score =   360 bits (924),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 200/249 (80%), Positives = 217/249 (87%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEV+RIARAQTLIA+
Sbjct  290  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKTMNAIEEVYRIARAQTLIAL  349

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID+ GRFAIQLMGFFFMTVFMFALAIPY HWTHK+NRIGFV +Y LT
Sbjct  350  CSTVPGYWFTVAXIDRIGRFAIQLMGFFFMTVFMFALAIPYXHWTHKDNRIGFVVIYXLT  409

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GAIVG FGFLY AQN D  KTD
Sbjct  410  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAIVGXFGFLYLAQNKDKNKTD  469

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYPPGIGV+NSLLVLG +NFLG++FT LVPES G+SLEEMS ENE E  +   E+  Q 
Sbjct  470  AGYPPGIGVKNSLLVLGVVNFLGILFTFLVPESNGRSLEEMSGENEEESETGTVELE-QS  528

Query  722  GHEIRTVPV  748
             +  RTVPV
Sbjct  529  NYNNRTVPV  537



>gb|AFU50504.1| phosphate transporter 5 [Astragalus sinicus]
Length=539

 Score =   360 bits (924),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 199/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP+ ETMNA+EEV+RIARAQTLIA+
Sbjct  291  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPHAETMNALEEVYRIARAQTLIAL  350

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID+ GRFAIQLMGFFFMTVFMFALAIPYDHWTHK+NRIGFV +YSLT
Sbjct  351  CSTVPGYWFTVAFIDRIGRFAIQLMGFFFMTVFMFALAIPYDHWTHKDNRIGFVVLYSLT  410

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA GK GAIVGAFGFLY AQN D +K D
Sbjct  411  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAACGKLGAIVGAFGFLYLAQNKDKSKAD  470

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+NSLLVLG +N LG  FT LVPE+ GKSL
Sbjct  471  AGYPAGIGVKNSLLVLGVVNILGFFFTFLVPEANGKSL  508



>ref|XP_011091218.1| PREDICTED: inorganic phosphate transporter 1-4-like [Sesamum 
indicum]
Length=526

 Score =   359 bits (922),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL GTTSTWFLLDIAFYSQ LFQKD+F AIGWIP P+TMNA+ EV+RIA+AQTLIA+
Sbjct  294  HGLHLFGTTSTWFLLDIAFYSQNLFQKDVFTAIGWIPPPKTMNAIHEVYRIAKAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+AIPY HWT KENRIGFV MY+LT
Sbjct  354  CSTVPGYWFTVAFIDIMGRFAIQLMGFFFMTVFMFAVAIPYHHWTLKENRIGFVVMYALT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGA+GFLYAAQN D AKTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAYGFLYAAQNKDKAKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL+VLGCIN LGM+ T  VPE+KGKSL
Sbjct  474  AGYPPGIGVKNSLIVLGCINALGMLCTFAVPEAKGKSL  511



>gb|KHN00295.1| Putative inorganic phosphate transporter 1-7 [Glycine soja]
Length=533

 Score =   359 bits (922),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 204/218 (94%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIAFYSQ LFQKDIF AIGWIP  + MNA+ EV++IARAQTLIA+
Sbjct  293  HGLHLLGTTTTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKEMNAIHEVYKIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALID  GRFAIQLMGFFFMTVFMFALAIPY HW+ KENRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVALIDYMGRFAIQLMGFFFMTVFMFALAIPYHHWSEKENRIGFVVMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ DP+KTD
Sbjct  413  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDPSKTD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIG++NSL++LG INF+GM+FTLLVPE+KGKSL
Sbjct  473  AGYPTGIGIKNSLIMLGVINFIGMLFTLLVPEAKGKSL  510



>ref|XP_010037981.1| PREDICTED: inorganic phosphate transporter 1-4-like [Eucalyptus 
grandis]
 gb|KCW49774.1| hypothetical protein EUGRSUZ_K03265 [Eucalyptus grandis]
Length=548

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 197/249 (79%), Positives = 217/249 (87%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF A+GW+P  +TMNA+EEVFRIARAQTLIA+
Sbjct  300  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAVGWLPPAKTMNAIEEVFRIARAQTLIAL  359

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID+ GRFAIQLMGFFFMTVFMFALAIPYDHWTH  N +GFV +YSLT
Sbjct  360  CSTVPGYWFTVAFIDRMGRFAIQLMGFFFMTVFMFALAIPYDHWTHPGNHVGFVVIYSLT  419

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GAIVGAFGFLY AQN D AK D
Sbjct  420  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAIVGAFGFLYLAQNQDKAKAD  479

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYP GIGVRNSL+VLG +NFLG++FT LVPESKGKSLE+MS E E E+ + +   + Q 
Sbjct  480  AGYPAGIGVRNSLIVLGVVNFLGLLFTFLVPESKGKSLEQMSGEIEDEDEAKQASEQQQ-  538

Query  722  GHEIRTVPV  748
             +  RTVPV
Sbjct  539  AYSSRTVPV  547



>ref|NP_001241164.1| probable inorganic phosphate transporter 1-7-like [Glycine max]
 ref|XP_006574391.1| PREDICTED: probable inorganic phosphate transporter 1-7-like 
isoform X1 [Glycine max]
 ref|XP_006574392.1| PREDICTED: probable inorganic phosphate transporter 1-7-like 
isoform X2 [Glycine max]
 gb|ACP19343.1| phosphate transporter 1 [Glycine max]
 gb|ACY74625.1| phosphate transporter1-14 [Glycine max]
 gb|KHN00258.1| Putative inorganic phosphate transporter 1-7 [Glycine soja]
Length=533

 Score =   359 bits (922),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 204/218 (94%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIAFYSQ LFQKDIF AIGWIP  + MNA+ EV++IARAQTLIA+
Sbjct  293  HGLHLLGTTTTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKEMNAIHEVYKIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALID  GRFAIQL+GFFFMTVFMFALAIPYDHW+ KENRIGFV MYS T
Sbjct  353  CSTVPGYWFTVALIDYMGRFAIQLLGFFFMTVFMFALAIPYDHWSEKENRIGFVVMYSFT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPN+TTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ DP+KTD
Sbjct  413  FFFANFGPNSTTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDPSKTD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIG++NSL++LG INF+GM+FTLLVPESKGKSL
Sbjct  473  AGYPTGIGIKNSLIMLGVINFIGMLFTLLVPESKGKSL  510



>gb|KEH42530.1| high affinity inorganic phosphate transporter [Medicago truncatula]
Length=524

 Score =   359 bits (921),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT STWFLLDIAFYSQ LFQKDIF AIGWIP+ +TMNA+EEV++IARAQTLIA+
Sbjct  291  HGLHLLGTASTWFLLDIAFYSQNLFQKDIFSAIGWIPSAKTMNALEEVYKIARAQTLIAL  350

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID+ GRF IQLMGFFFMTVFMFALAIPYDHWTHKENRIGFV +YSLT
Sbjct  351  CSTVPGYWFTVAFIDRIGRFTIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVVLYSLT  410

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+S+A GK GA+VGAFGFLY AQN DP K D
Sbjct  411  FFFANFGPNATTFVVPAEIFPARFRSTCHGISSATGKLGAMVGAFGFLYLAQNQDPKKAD  470

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGVRNSL++LG +N LG  FT LVPE+KGKSL
Sbjct  471  AGYPAGIGVRNSLILLGVVNILGFCFTFLVPETKGKSL  508



>dbj|BAB21545.1| phosphate transporter [Nicotiana tabacum]
Length=537

 Score =   359 bits (922),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 189/218 (87%), Positives = 200/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT STWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEV++IARAQTLIA+
Sbjct  294  HGLHLLGTASTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNALEEVYKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTV  IDK GRFA QLMGFFFMTVFMFALAIPY HWT K+NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVFFIDKIGRFAFQLMGFFFMTVFMFALAIPYHHWTLKDNRIGFVIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGA++GAFGFLYAAQ TD  K D
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAMIGAFGFLYAAQPTDRKKAD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGVRNSL+VLGC+NFLGMVFT LVPESKGKSL
Sbjct  474  AGYPAGIGVRNSLIVLGCVNFLGMVFTFLVPESKGKSL  511



>ref|XP_007199786.1| hypothetical protein PRUPE_ppa003959mg [Prunus persica]
 gb|EMJ00985.1| hypothetical protein PRUPE_ppa003959mg [Prunus persica]
Length=538

 Score =   359 bits (921),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 200/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EV+RIARAQTLIA+
Sbjct  290  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKTMNAIQEVYRIARAQTLIAL  349

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTV  ID+ GRFAIQLMGFFFMTVFMFALAIPYDHWTHK+NRIGFV +YSLT
Sbjct  350  CSTVPGYWFTVLFIDRIGRFAIQLMGFFFMTVFMFALAIPYDHWTHKDNRIGFVVIYSLT  409

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GAIVGAFGFLY AQN D +K D
Sbjct  410  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAIVGAFGFLYLAQNKDKSKAD  469

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+NSLLVLG INFLG++FT LVPES GKSL
Sbjct  470  AGYPAGIGVKNSLLVLGVINFLGILFTFLVPESNGKSL  507



>gb|AGH28094.1| phosphate transporter 1 [Stylosanthes guianensis]
Length=538

 Score =   358 bits (919),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 185/218 (85%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIAFYSQ LFQKDIF AIGWIP  + MNA+ EV+RIARAQTLIA+
Sbjct  295  HGLHLLGTTTTWFLLDIAFYSQNLFQKDIFTAIGWIPPSQNMNAIHEVYRIARAQTLIAL  354

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGF FMT+FMFALAIPYDHWT KENRIGFV MYSLT
Sbjct  355  CSTVPGYWFTVAFIDHMGRFAIQLMGFIFMTIFMFALAIPYDHWTKKENRIGFVVMYSLT  414

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFF+NFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYA+Q+ DP KTD
Sbjct  415  FFFSNFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYASQSKDPKKTD  474

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYP GIGV+NSL++LG +NFLG++FTLLVPESKGKSL
Sbjct  475  KGYPTGIGVKNSLIMLGVVNFLGIIFTLLVPESKGKSL  512



>gb|ACY74618.1| phosphate transporter1-7 [Glycine max]
Length=539

 Score =   358 bits (919),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 196/248 (79%), Positives = 216/248 (87%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT STWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNAVEEV+RIARAQTLIA+
Sbjct  290  HGLHLLGTASTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKTMNAVEEVYRIARAQTLIAL  349

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALIDK GRFAIQLMGFFFMTVFMFALAIPYDHWTHK+NRIGFV +YSLT
Sbjct  350  CSTVPGYWFTVALIDKIGRFAIQLMGFFFMTVFMFALAIPYDHWTHKDNRIGFVVIYSLT  409

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+S+A+GK GAIVGAFGFLY AQN D +K D
Sbjct  410  FFFANFGPNATTFVVPAEIFPARFRSTCHGISSASGKLGAIVGAFGFLYLAQNKDKSKAD  469

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYP GIGV+N+L+VLG +N LG  FT LVPE+ GKSLEEMS EN+ + G+ E   ++  
Sbjct  470  AGYPAGIGVKNALIVLGVVNILGFFFTFLVPEANGKSLEEMSGENDEDVGTQEESEQSHS  529

Query  722  GHEIRTVP  745
             +  RTVP
Sbjct  530  QNNNRTVP  537



>gb|KHN02509.1| Putative inorganic phosphate transporter 1-7 [Glycine soja]
Length=539

 Score =   358 bits (919),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 196/248 (79%), Positives = 216/248 (87%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT STWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNAVEEV+RIARAQTLIA+
Sbjct  290  HGLHLLGTASTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKTMNAVEEVYRIARAQTLIAL  349

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALIDK GRFAIQLMGFFFMTVFMFALAIPYDHWTHK+NRIGFV +YSLT
Sbjct  350  CSTVPGYWFTVALIDKIGRFAIQLMGFFFMTVFMFALAIPYDHWTHKDNRIGFVVIYSLT  409

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+S+A+GK GAIVGAFGFLY AQN D +K D
Sbjct  410  FFFANFGPNATTFVVPAEIFPARFRSTCHGISSASGKLGAIVGAFGFLYLAQNKDKSKAD  469

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYP GIGV+N+L+VLG +N LG  FT LVPE+ GKSLEEMS EN+ + G+ E   ++  
Sbjct  470  AGYPAGIGVKNALIVLGVVNILGFFFTFLVPEANGKSLEEMSGENDEDVGTQEESEQSHS  529

Query  722  GHEIRTVP  745
             +  RTVP
Sbjct  530  QNNNRTVP  537



>ref|XP_002285145.1| PREDICTED: inorganic phosphate transporter 1-4-like [Vitis vinifera]
 ref|XP_010650085.1| PREDICTED: inorganic phosphate transporter 1-4-like [Vitis vinifera]
 ref|XP_010650086.1| PREDICTED: inorganic phosphate transporter 1-4-like [Vitis vinifera]
Length=538

 Score =   358 bits (918),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL+GTT+TWFLLDIAFYSQ LFQKDIF AIGWIP  ETMNAV+EV+RIA+AQTLIA+
Sbjct  294  HGLHLIGTTTTWFLLDIAFYSQNLFQKDIFSAIGWIPKAETMNAVQEVYRIAKAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALID  GRFAIQLMGFFFMTVFMFALAIPY HWT K NRIGFV +YS T
Sbjct  354  CSTVPGYWFTVALIDYMGRFAIQLMGFFFMTVFMFALAIPYHHWTLKPNRIGFVVIYSFT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GKAGAI+GAFGFLYAAQN D  KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKAGAIIGAFGFLYAAQNQDKTKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL+VLG +NFLGM+FT LVPE KGKSL
Sbjct  474  AGYPPGIGVKNSLIVLGVVNFLGMLFTFLVPEPKGKSL  511



>ref|NP_001254802.1| probable inorganic phosphate transporter 1-7-like [Glycine max]
 ref|XP_006603729.1| PREDICTED: probable inorganic phosphate transporter 1-7-like 
isoform X1 [Glycine max]
 gb|AFL02621.1| soybean phosphate transporter protein 11 [Glycine max]
Length=539

 Score =   358 bits (918),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 195/248 (79%), Positives = 216/248 (87%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT STWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEV+RIARAQTLIA+
Sbjct  290  HGLHLLGTASTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKTMNAIEEVYRIARAQTLIAL  349

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALIDK GRFAIQLMGFFFMTVFMFALAIPYDHWTHK+NRIGFV +YSLT
Sbjct  350  CSTVPGYWFTVALIDKIGRFAIQLMGFFFMTVFMFALAIPYDHWTHKDNRIGFVVIYSLT  409

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+S+A+GK GAIVGAFGFLY AQN D +K D
Sbjct  410  FFFANFGPNATTFVVPAEIFPARFRSTCHGISSASGKLGAIVGAFGFLYLAQNKDKSKAD  469

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYP GIGV+N+L+VLG +N LG  FT LVPE+ GKSLEEMS EN+ + G+ E   ++  
Sbjct  470  AGYPAGIGVKNALIVLGVVNILGFFFTFLVPEANGKSLEEMSGENDEDVGTQEESEQSHS  529

Query  722  GHEIRTVP  745
             +  RTVP
Sbjct  530  QNNNRTVP  537



>emb|CAC28218.1| phosphate transporter [Sesbania rostrata]
Length=536

 Score =   357 bits (917),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL+GTT+TWFLLDIAFYSQ LFQKDIF AIGWIP  + MNA+ EV++IARAQTLIA+
Sbjct  294  HGLHLVGTTTTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKEMNAIHEVYKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFALAIPYDHWT KENRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDYMGRFAIQLMGFFFMTVFMFALAIPYDHWTKKENRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ DP KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDPTKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYP GIG++NSL++LG INF GM+FTLLVPESKGKSL
Sbjct  474  KGYPTGIGIKNSLIMLGVINFAGMLFTLLVPESKGKSL  511



>gb|ACY74613.1| phosphate transporter1-2 [Glycine max]
Length=539

 Score =   357 bits (917),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 195/248 (79%), Positives = 216/248 (87%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT STWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEV+RIARAQTLIA+
Sbjct  290  HGLHLLGTASTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKTMNAIEEVYRIARAQTLIAL  349

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALIDK GRFAIQLMGFFFMTVFMFALAIPYDHWTHK+NRIGFV +YSLT
Sbjct  350  CSTVPGYWFTVALIDKIGRFAIQLMGFFFMTVFMFALAIPYDHWTHKDNRIGFVVIYSLT  409

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+S+A+GK GAIVGAFGFLY AQN D +K D
Sbjct  410  FFFANFGPNATTFVVPAEIFPARFRSTCHGISSASGKLGAIVGAFGFLYLAQNKDKSKAD  469

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYP GIGV+N+L+VLG +N LG  FT LVPE+ GKSLEEMS EN+ + G+ E   ++  
Sbjct  470  AGYPAGIGVKNALIVLGVVNILGFFFTFLVPEANGKSLEEMSGENDEDVGTQEESEQSHS  529

Query  722  GHEIRTVP  745
             +  RTVP
Sbjct  530  HNNNRTVP  537



>ref|XP_003521286.1| PREDICTED: probable inorganic phosphate transporter 1-7 [Glycine 
max]
 gb|ACP19342.1| phosphate transporter 2 [Glycine max]
 gb|KHN10736.1| Putative inorganic phosphate transporter 1-7 [Glycine soja]
Length=539

 Score =   357 bits (917),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 195/248 (79%), Positives = 216/248 (87%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT STWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEV+RIARAQTLIA+
Sbjct  290  HGLHLLGTASTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKTMNAIEEVYRIARAQTLIAL  349

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALIDK GRFAIQLMGFFFMTVFMFALAIPYDHWTHK+NRIGFV +YSLT
Sbjct  350  CSTVPGYWFTVALIDKIGRFAIQLMGFFFMTVFMFALAIPYDHWTHKDNRIGFVVIYSLT  409

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+S+A+GK GAIVGAFGFLY AQN D +K D
Sbjct  410  FFFANFGPNATTFVVPAEIFPARFRSTCHGISSASGKLGAIVGAFGFLYLAQNKDKSKAD  469

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYP GIGV+N+L+VLG +N LG  FT LVPE+ GKSLEEMS EN+ + G+ E   ++  
Sbjct  470  AGYPAGIGVKNALIVLGVVNILGFFFTFLVPEANGKSLEEMSGENDEDVGTQEESEQSHS  529

Query  722  GHEIRTVP  745
             +  RTVP
Sbjct  530  HNNNRTVP  537



>dbj|BAE93351.1| phosphate transporter [Lotus japonicus]
 dbj|BAE93354.1| phosphate transporter [Lotus japonicus]
Length=538

 Score =   357 bits (917),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HG+HLLGTT+TWFLLDIAFYSQ LFQKDIF AIGWIP  + MNA+ EV++IARAQTLIA+
Sbjct  296  HGMHLLGTTTTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKEMNAIHEVYKIARAQTLIAL  355

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFALA+PYDHWT K+NR GFV MY+LT
Sbjct  356  CSTVPGYWFTVAFIDYMGRFAIQLMGFFFMTVFMFALALPYDHWTKKDNRFGFVAMYALT  415

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYA+Q+ DPAKTD
Sbjct  416  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYASQSKDPAKTD  475

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYP GIGVRNSL++LG INFLGMVFT LVPESKGKSL
Sbjct  476  PGYPTGIGVRNSLIMLGVINFLGMVFTFLVPESKGKSL  513



>emb|CDX73457.1| BnaC08g25460D [Brassica napus]
Length=531

 Score =   357 bits (916),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 185/218 (85%), Positives = 199/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT+STWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+ EVF IARAQTLIA+
Sbjct  294  HGLHLLGTSSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNAIREVFMIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPYDHWTHKENRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDIMGRFAIQMMGFFFMTVFMFALAIPYDHWTHKENRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GA+VGAFGFLY AQ+ D  KT+
Sbjct  414  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQSPDKNKTE  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYPPGIGV+NSL+VLG +N LGMVFTLLVPESKG+SL
Sbjct  474  HGYPPGIGVKNSLIVLGVVNLLGMVFTLLVPESKGRSL  511



>ref|XP_009116146.1| PREDICTED: probable inorganic phosphate transporter 1-7 [Brassica 
rapa]
 emb|CDX78256.1| BnaA09g34510D [Brassica napus]
Length=531

 Score =   357 bits (916),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 185/218 (85%), Positives = 199/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT+STWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+ EVF IARAQTLIA+
Sbjct  294  HGLHLLGTSSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNAIREVFMIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPYDHWTHKENRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDIMGRFAIQMMGFFFMTVFMFALAIPYDHWTHKENRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GA+VGAFGFLY AQ+ D  KT+
Sbjct  414  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQSPDKNKTE  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYPPGIGV+NSL+VLG +N LGMVFTLLVPESKG+SL
Sbjct  474  HGYPPGIGVKNSLIVLGVVNLLGMVFTLLVPESKGRSL  511



>ref|XP_003535748.1| PREDICTED: inorganic phosphate transporter 1-4 [Glycine max]
 gb|AFL02620.1| soybean phosphate transporter protein 4 [Glycine max]
Length=533

 Score =   357 bits (916),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 185/218 (85%), Positives = 203/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIAFYSQ LFQKDIF AIGWIP  + MNA+ EV++IARAQTLIA+
Sbjct  293  HGLHLLGTTTTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKEMNAIHEVYKIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALID  GRFAIQLMGFFFMTVFMFALAIPY HW+ K+NRIGFV MYS T
Sbjct  353  CSTVPGYWFTVALIDYMGRFAIQLMGFFFMTVFMFALAIPYHHWSEKDNRIGFVVMYSFT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ DP+KTD
Sbjct  413  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDPSKTD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIG++NSL++LG INF+GM+FTLLVPE+KGKSL
Sbjct  473  AGYPTGIGIKNSLIMLGVINFIGMLFTLLVPEAKGKSL  510



>gb|ACY74614.1| phosphate transporter1-3 [Glycine max]
Length=533

 Score =   357 bits (915),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 185/218 (85%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIAFYSQ LFQKDIF AIGWIP  + MNA+ EV++IARAQTLIA+
Sbjct  293  HGLHLLGTTTTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKEMNAIHEVYKIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALID  GRFAIQLMGFFFMTVFMFALAIPY HW+ K+NRIGFV MYS T
Sbjct  353  CSTVPGYWFTVALIDYMGRFAIQLMGFFFMTVFMFALAIPYHHWSEKDNRIGFVVMYSFT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG SAAAGKAGAIVGAFGFLYAAQ+ DP+KTD
Sbjct  413  FFFANFGPNATTFVVPAEIFPARLRSTCHGTSAAAGKAGAIVGAFGFLYAAQSKDPSKTD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIG++NSL++LG INF+GM+FTLLVPE+KGKSL
Sbjct  473  AGYPTGIGIKNSLIMLGVINFIGMLFTLLVPEAKGKSL  510



>ref|XP_003537012.1| PREDICTED: inorganic phosphate transporter 1-4 [Glycine max]
 gb|ACP19340.1| phosphate transporter 5 [Glycine max]
 gb|KHN03879.1| Inorganic phosphate transporter 1-4 [Glycine soja]
Length=521

 Score =   356 bits (914),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 184/218 (84%), Positives = 199/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEVF IARAQTLIA+
Sbjct  291  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKTMNALEEVFFIARAQTLIAL  350

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID+ GRFAIQLMGFFFMT+FMFALAIPYDHWT +ENRIGFV +YSLT
Sbjct  351  CSTVPGYWFTVAFIDRIGRFAIQLMGFFFMTIFMFALAIPYDHWTLRENRIGFVVIYSLT  410

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+S+A+GK GA+VGAFGFLY AQN DP+K D
Sbjct  411  FFFANFGPNATTFVVPAEIFPARFRSTCHGISSASGKLGAMVGAFGFLYLAQNQDPSKAD  470

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGVRNSLLVLG IN LG +FT LVPE+KG+SL
Sbjct  471  AGYPAGIGVRNSLLVLGVINILGFMFTFLVPEAKGRSL  508



>gb|AGX93242.1| inorganic phosphate transporter 5 like-protein [Trifolium repens]
Length=534

 Score =   357 bits (915),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 193/249 (78%), Positives = 208/249 (84%), Gaps = 3/249 (1%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HG+HLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  + MNA+ E++RIARAQTLIA+
Sbjct  289  HGMHLLGTTSTWFLLDIAFYSQNLFQKDIFTAIGWIPPAKEMNAIHELYRIARAQTLIAM  348

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFALAIPYDHWT KENRIGFV MYSLT
Sbjct  349  CSTVPGYWFTVAFIDYMGRFAIQLMGFFFMTVFMFALAIPYDHWTKKENRIGFVVMYSLT  408

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ DP KTD
Sbjct  409  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDPTKTD  468

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYP GIG++NSL++LG +NF GMVFT LVPE  GKSL      +   E      +   G
Sbjct  469  AGYPTGIGIKNSLIMLGVVNFFGMVFTFLVPEPNGKSL---EEMSGENEEDDAEAIEMAG  525

Query  722  GHEIRTVPV  748
                RTVPV
Sbjct  526  SGTARTVPV  534



>gb|AAN59904.1| phosphate transporter [Medicago sativa]
Length=222

 Score =   345 bits (885),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL L GT STWFLLDIAFYSQ LFQKDIF AIGWIP  + MNA+ EV++IARAQTLIA+
Sbjct  1    HGLALFGTCSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKEMNAIHEVYKIARAQTLIAL  60

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPYDHW+ K+NRIGFV MYSLT
Sbjct  61   CSTVPGYWFTVAFIDYMGRFAIQMMGFFFMTVFMFALAIPYDHWSKKDNRIGFVVMYSLT  120

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ DP KTD
Sbjct  121  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDPTKTD  180

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYP GIG++NSL++LG INF+GM+ TLLVPESKGKSL
Sbjct  181  KGYPTGIGIKNSLIMLGVINFVGMLCTLLVPESKGKSL  218



>ref|XP_008364261.1| PREDICTED: inorganic phosphate transporter 1-4 [Malus domestica]
Length=538

 Score =   356 bits (914),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 199/249 (80%), Positives = 215/249 (86%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  ETMNA+EEV+RIARAQTLIA+
Sbjct  290  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAETMNAIEEVYRIARAQTLIAL  349

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            C TVPGYWFTVA ID+ GRFAIQLMGFFFMTVFMFALAIPY HWTHK+NRIGFV +Y LT
Sbjct  350  CXTVPGYWFTVAFIDRIGRFAIQLMGFFFMTVFMFALAIPYXHWTHKDNRIGFVVIYXLT  409

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GAIVG FGFLY AQN D  KTD
Sbjct  410  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAIVGXFGFLYLAQNKDKNKTD  469

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGY PGIGV+NSLLVLG +NFLG++FT LVPES G+SLEEMS ENE E  +   E+  Q 
Sbjct  470  AGYXPGIGVKNSLLVLGVVNFLGILFTFLVPESNGRSLEEMSGENEEESETGTVELE-QS  528

Query  722  GHEIRTVPV  748
             +  RTVPV
Sbjct  529  XYNNRTVPV  537



>ref|XP_008381907.1| PREDICTED: inorganic phosphate transporter 1-4-like [Malus domestica]
Length=537

 Score =   356 bits (913),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 188/218 (86%), Positives = 199/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  E+MNA+ EV+RIARAQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAESMNAIHEVYRIARAQTLIAM  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFALAIPY HWT K N IGFV +YS T
Sbjct  354  CSTVPGYWFTVAFIDYMGRFAIQLMGFFFMTVFMFALAIPYHHWTLKXNXIGFVVIYSFT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ +P KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQDKNPTKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INF GMVFT LVPESKGKSL
Sbjct  474  AGYPPGIGVKNSLIMLGVINFFGMVFTFLVPESKGKSL  511



>ref|XP_002862760.1| hypothetical protein ARALYDRAFT_497304 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39018.1| hypothetical protein ARALYDRAFT_497304 [Arabidopsis lyrata subsp. 
lyrata]
Length=490

 Score =   354 bits (909),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP P TMNA  EVFRIARAQTLIA+
Sbjct  254  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKPATMNATHEVFRIARAQTLIAL  313

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFF MTVFMFA+A PY+HWT  ENRIGFV MY+LT
Sbjct  314  CSTVPGYWFTVAFIDIIGRFAIQLMGFFMMTVFMFAIAFPYNHWTKPENRIGFVVMYALT  373

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ D AK D
Sbjct  374  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSQDKAKVD  433

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL+VLG +NF+GM+FT LVPE KGKSL
Sbjct  434  AGYPPGIGVKNSLIVLGVLNFIGMLFTFLVPEPKGKSL  471



>ref|XP_002531532.1| inorganic phosphate transporter, putative [Ricinus communis]
 gb|EEF30851.1| inorganic phosphate transporter, putative [Ricinus communis]
Length=536

 Score =   355 bits (912),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 198/249 (80%), Positives = 213/249 (86%), Gaps = 6/249 (2%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL+GTT+TWFLLDIAFYSQ LFQKDIF AI WIP    MNA+ EVFRIARAQTLIA+
Sbjct  294  HGLHLVGTTTTWFLLDIAFYSQNLFQKDIFTAINWIPKAAEMNALYEVFRIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTV LID  GRFAIQLMGFFFMTVFMFALAIPYDHWT K NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVFLIDYMGRFAIQLMGFFFMTVFMFALAIPYDHWTLKPNRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ D  KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSQDKTKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYPPGIGV+NSL+ LG INF+GM+FTLLVPESKG+SLEE++ EN+            Q 
Sbjct  474  AGYPPGIGVKNSLIALGVINFIGMLFTLLVPESKGRSLEELTGENDESGE------EMQA  527

Query  722  GHEIRTVPV  748
               +RTVPV
Sbjct  528  AASVRTVPV  536



>ref|XP_007145846.1| hypothetical protein PHAVU_007G2732000g [Phaseolus vulgaris]
 gb|ESW17840.1| hypothetical protein PHAVU_007G2732000g [Phaseolus vulgaris]
Length=531

 Score =   355 bits (911),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL+GTT+TWFLLDIAFYSQ LFQKDIF AIGWIP  + MNA+ EV++IARAQTLIA+
Sbjct  293  HGLHLVGTTTTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQEMNAIHEVYKIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTV LID  GRFAIQLMGFFFMTVFMFALAIPYDHWT K NRIGFV +YSLT
Sbjct  353  CSTVPGYWFTVFLIDHMGRFAIQLMGFFFMTVFMFALAIPYDHWTKKANRIGFVVIYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPN+TTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ DP+KTD
Sbjct  413  FFFANFGPNSTTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDPSKTD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIG++NSL++LG INF GMVFTLLVPESKGKSL
Sbjct  473  AGYPTGIGIKNSLIMLGVINFFGMVFTLLVPESKGKSL  510



>ref|XP_004495103.1| PREDICTED: probable inorganic phosphate transporter 1-7-like 
[Cicer arietinum]
Length=534

 Score =   355 bits (910),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLD+AFYSQ LFQKDIF AIGWIP  +TMNA+EEV+RIARAQTLIA+
Sbjct  290  HGLHLLGTTSTWFLLDVAFYSQNLFQKDIFSAIGWIPAAKTMNALEEVYRIARAQTLIAL  349

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID+ GRF IQLMGFFFMTVFMFALAIPYD+WT KENRIGFV +YSLT
Sbjct  350  CSTVPGYWFTVAFIDRIGRFTIQLMGFFFMTVFMFALAIPYDYWTLKENRIGFVVLYSLT  409

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+S+AAGK GA+VGAFGFLY AQN DP+K D
Sbjct  410  FFFANFGPNATTFVVPAEIFPARFRSTCHGISSAAGKLGAMVGAFGFLYLAQNQDPSKAD  469

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGVRNSL+VLG +N LG  FT LVPE+ GKSL
Sbjct  470  AGYPPGIGVRNSLIVLGFVNILGFCFTFLVPEANGKSL  507



>ref|XP_009132907.1| PREDICTED: probable inorganic phosphate transporter 1-5 [Brassica 
rapa]
 ref|XP_009132909.1| PREDICTED: probable inorganic phosphate transporter 1-5 [Brassica 
rapa]
 ref|XP_009132910.1| PREDICTED: probable inorganic phosphate transporter 1-5 [Brassica 
rapa]
Length=545

 Score =   355 bits (911),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL+GTT+TWFLLDIA+YS  LFQKDI+ AIGWIP  ETMNA+ EV+ ++RAQTLIA+
Sbjct  294  HGLHLVGTTTTWFLLDIAYYSSNLFQKDIYSAIGWIPAAETMNAIHEVYTVSRAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            C TVPGYWFTVALID  GRF IQLMGF FMTVFMFALAIPYDHW H++NRIGF+ MYSLT
Sbjct  354  CGTVPGYWFTVALIDYLGRFFIQLMGFIFMTVFMFALAIPYDHWRHRDNRIGFLIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
             FFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GKAGAIVGAFGFLYAAQ+TDP KTD
Sbjct  414  MFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKAGAIVGAFGFLYAAQSTDPKKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGVRNSLL+LG +NFLG+VFTLLVPESKGKSL
Sbjct  474  AGYPPGIGVRNSLLMLGGVNFLGIVFTLLVPESKGKSL  511



>gb|ACD14299.1| phosphate transporter 1 [Glycine max]
Length=533

 Score =   354 bits (909),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 184/218 (84%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIAFYSQ LFQKDIF AIGWIP  + MNA+ EV++IARAQTLIA+
Sbjct  293  HGLHLLGTTTTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKEMNAIHEVYKIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALID  GRFAIQLMGFFFMTVFMFALAIPY HW+ K+NRIGFV MYS T
Sbjct  353  CSTVPGYWFTVALIDYMGRFAIQLMGFFFMTVFMFALAIPYHHWSEKDNRIGFVVMYSFT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEI PARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ DP+KTD
Sbjct  413  FFFANFGPNATTFVVPAEILPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDPSKTD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIG++NSL++LG INF+GM+FTLLVPE+KGKSL
Sbjct  473  AGYPTGIGIKNSLIMLGVINFIGMLFTLLVPEAKGKSL  510



>ref|XP_003590758.1| Inorganic phosphate transporter 1-4 [Medicago truncatula]
 gb|ABM69111.1| phosphate transporter 5 [Medicago truncatula]
 gb|ACD45087.1| phosphate transporter 5 [Medicago truncatula]
 gb|AES61009.1| high affinity inorganic phosphate transporter [Medicago truncatula]
Length=538

 Score =   354 bits (909),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIAFYSQ LFQKDIF AIGWIP  + MNA+ E++RIARAQTLIA+
Sbjct  294  HGLHLLGTTTTWFLLDIAFYSQNLFQKDIFTAIGWIPPAKEMNAINELYRIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFALAIPYDHWT KENRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDYMGRFAIQLMGFFFMTVFMFALAIPYDHWTKKENRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ DP KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDPTKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYP GIG++NSL+VLG +NF GMVFT LVPE  GKSL
Sbjct  474  HGYPTGIGIKNSLIVLGVVNFFGMVFTFLVPEPNGKSL  511



>ref|XP_007162540.1| hypothetical protein PHAVU_001G160600g [Phaseolus vulgaris]
 gb|ESW34534.1| hypothetical protein PHAVU_001G160600g [Phaseolus vulgaris]
Length=541

 Score =   354 bits (909),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 199/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT+STWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEV++IARAQTLIA+
Sbjct  290  HGLHLLGTSSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKTMNAIEEVYKIARAQTLIAL  349

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA IDK GRFAIQLMGFFFMTVFMFALAIPYDHWTH++NRIGFV MYSLT
Sbjct  350  CSTVPGYWFTVAFIDKIGRFAIQLMGFFFMTVFMFALAIPYDHWTHRDNRIGFVVMYSLT  409

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+S+A+GK GAIVG+FGFLY AQN D +K D
Sbjct  410  FFFANFGPNATTFVVPAEIFPARFRSTCHGISSASGKLGAIVGSFGFLYLAQNKDKSKAD  469

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+N+L+VLG +N LG  FT LVPE+KG+SL
Sbjct  470  AGYPAGIGVKNALIVLGVVNILGFFFTFLVPEAKGRSL  507



>ref|XP_002862761.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39019.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=298

 Score =   346 bits (887),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNA+ EVF+IA+AQTLIA+
Sbjct  70   HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAATMNAIHEVFKIAKAQTLIAL  129

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+A PY+HW   +NRIGFV MYSLT
Sbjct  130  CSTVPGYWFTVAFIDIIGRFAIQLMGFFFMTVFMFAIAFPYNHWILPDNRIGFVIMYSLT  189

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAA GKAGAIVGAFGFLYAAQ  D  KTD
Sbjct  190  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAATGKAGAIVGAFGFLYAAQPQDKTKTD  249

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INF+GM+FT LVPE KGKSL
Sbjct  250  AGYPPGIGVKNSLIMLGVINFVGMLFTFLVPEPKGKSL  287



>gb|ACY74615.1| phosphate transporter1-4 [Glycine max]
Length=521

 Score =   353 bits (907),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEVF IARAQTLIA+
Sbjct  291  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKTMNALEEVFFIARAQTLIAL  350

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID+ GRFAIQLMGFFFMT+FMFALAIPYDHWT +ENRIGFV +YSLT
Sbjct  351  CSTVPGYWFTVAFIDRIGRFAIQLMGFFFMTIFMFALAIPYDHWTLRENRIGFVVIYSLT  410

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+S+A+GK GA+VGAFGFLY AQN DP+K  
Sbjct  411  FFFANFGPNATTFVVPAEIFPARFRSTCHGISSASGKLGAMVGAFGFLYLAQNQDPSKAG  470

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGVRNSLLVLG IN LG +FT LVPE+KG+SL
Sbjct  471  AGYPAGIGVRNSLLVLGVINILGFMFTFLVPEAKGRSL  508



>gb|AAK38196.1|AF305623_1 phosphate transporter 1 [Lupinus albus]
Length=540

 Score =   354 bits (909),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT STWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EV+RIARAQTLIA+
Sbjct  291  HGLHLLGTASTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKTMNALDEVYRIARAQTLIAL  350

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALID+ GRFAIQLMGFFFMTVFMFALAIPYDHWTHK+NRIGFV +YSLT
Sbjct  351  CSTVPGYWFTVALIDRIGRFAIQLMGFFFMTVFMFALAIPYDHWTHKDNRIGFVVIYSLT  410

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+S+A+GK GAIVGAFGFLY AQN D +KTD
Sbjct  411  FFFANFGPNATTFVVPAEIFPARFRSTCHGISSASGKLGAIVGAFGFLYLAQNKDKSKTD  470

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+NSL+VLG +N LG  FT LVPE  GKSL
Sbjct  471  AGYPAGIGVKNSLIVLGVVNILGFCFTFLVPEPNGKSL  508



>dbj|BAE93352.1| phosphate transporter [Lotus japonicus]
 dbj|BAE93355.1| phosphate transporter [Lotus japonicus]
Length=539

 Score =   354 bits (908),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 185/218 (85%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT STWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEV+RIARAQTLIA+
Sbjct  290  HGLHLLGTASTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKTMNALEEVYRIARAQTLIAL  349

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALID+ GRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFV +YSLT
Sbjct  350  CSTVPGYWFTVALIDRIGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVVIYSLT  409

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+S+AAGK GAIVGAFGFLY AQN D +K D
Sbjct  410  FFFANFGPNATTFVVPAEIFPARFRSTCHGISSAAGKLGAIVGAFGFLYLAQNKDKSKAD  469

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+NSLL+LG +N LG   T LVPE+KGKSL
Sbjct  470  AGYPAGIGVKNSLLLLGVVNILGFFCTFLVPEAKGKSL  507



>ref|XP_002865427.1| hypothetical protein ARALYDRAFT_494662 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41686.1| hypothetical protein ARALYDRAFT_494662 [Arabidopsis lyrata subsp. 
lyrata]
Length=395

 Score =   349 bits (895),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP P TMNA  EVFRIARAQTLIA+
Sbjct  167  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKPATMNASHEVFRIARAQTLIAL  226

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFF MTVFMFA+A PY+HWT  ENRIGFV MY+LT
Sbjct  227  CSTVPGYWFTVAFIDIIGRFAIQLMGFFMMTVFMFAIAFPYNHWTKPENRIGFVVMYALT  286

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ D AK D
Sbjct  287  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSQDKAKVD  346

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL+VLG +NF+GM+FT LVPE KGKSL
Sbjct  347  AGYPPGIGVKNSLIVLGVLNFIGMLFTFLVPEPKGKSL  384



>ref|XP_004493772.1| PREDICTED: inorganic phosphate transporter 1-4-like [Cicer arietinum]
Length=537

 Score =   353 bits (907),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT STWFLLDIAFYSQ LFQKDIF A+GWIP  +TMNA+EEV+RIARAQTLIA+
Sbjct  289  HGLHLLGTASTWFLLDIAFYSQNLFQKDIFSAVGWIPPAQTMNALEEVYRIARAQTLIAL  348

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALID+ GRFAIQLMGFFFMTVFMFALAIPY+HWTHK+NRIGFV +YSLT
Sbjct  349  CSTVPGYWFTVALIDRIGRFAIQLMGFFFMTVFMFALAIPYEHWTHKDNRIGFVALYSLT  408

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+S+AAGK GAIVGAFGFLY AQN D +K D
Sbjct  409  FFFANFGPNATTFVVPAEIFPARFRSTCHGISSAAGKLGAIVGAFGFLYLAQNKDKSKAD  468

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+NSLL+LG +N LG  FT LVPE+ GKSL
Sbjct  469  AGYPAGIGVKNSLLLLGVVNILGFCFTFLVPEANGKSL  506



>ref|XP_010274777.1| PREDICTED: inorganic phosphate transporter 1-4-like isoform X2 
[Nelumbo nucifera]
 ref|XP_010274778.1| PREDICTED: inorganic phosphate transporter 1-4-like isoform X2 
[Nelumbo nucifera]
 ref|XP_010274779.1| PREDICTED: inorganic phosphate transporter 1-4-like isoform X2 
[Nelumbo nucifera]
 ref|XP_010274780.1| PREDICTED: inorganic phosphate transporter 1-4-like isoform X2 
[Nelumbo nucifera]
 ref|XP_010274781.1| PREDICTED: inorganic phosphate transporter 1-4-like isoform X2 
[Nelumbo nucifera]
Length=543

 Score =   353 bits (907),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 184/218 (84%), Positives = 200/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT TWFLLDIAFYS  LFQKDIF A+GWIP  +TM+A+EEV++IARAQTLIA+
Sbjct  294  HGLHLLGTTMTWFLLDIAFYSSNLFQKDIFSAVGWIPPAKTMSALEEVYKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA IDK GRF IQLMGFFFMTVFMFALAIPY HWT K+NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDKIGRFKIQLMGFFFMTVFMFALAIPYHHWTLKDNRIGFVIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFF+NFGPNATTFVVPAEIFPARLRSTCHG+SAA+GKAGA+VGAFGFLYAAQ  D  KTD
Sbjct  414  FFFSNFGPNATTFVVPAEIFPARLRSTCHGISAASGKAGAMVGAFGFLYAAQPQDKTKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIG+RN+L++LG INF GMVFTLLVPESKGKSL
Sbjct  474  AGYPPGIGIRNALIMLGAINFFGMVFTLLVPESKGKSL  511



>ref|XP_004497842.1| PREDICTED: probable inorganic phosphate transporter 1-7-like 
[Cicer arietinum]
Length=555

 Score =   354 bits (908),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 185/218 (85%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL+GTT+TWFLLDIAFYSQ LFQKDIF AIGWIP    MNAV EV++IARAQTLIA+
Sbjct  294  HGLHLIGTTTTWFLLDIAFYSQNLFQKDIFSAIGWIPPAVEMNAVHEVYKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFALAIPYDHW+ K+NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDYMGRFAIQLMGFFFMTVFMFALAIPYDHWSKKDNRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAI+GAFGFLYAAQ+ DP+KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIIGAFGFLYAAQSKDPSKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYP GIG++NSL++LG INF GM+FTLLVPESKGKSL
Sbjct  474  KGYPAGIGIKNSLIMLGVINFAGMIFTLLVPESKGKSL  511



>ref|XP_010274776.1| PREDICTED: inorganic phosphate transporter 1-4-like isoform X1 
[Nelumbo nucifera]
Length=570

 Score =   354 bits (909),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 184/218 (84%), Positives = 200/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT TWFLLDIAFYS  LFQKDIF A+GWIP  +TM+A+EEV++IARAQTLIA+
Sbjct  321  HGLHLLGTTMTWFLLDIAFYSSNLFQKDIFSAVGWIPPAKTMSALEEVYKIARAQTLIAL  380

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA IDK GRF IQLMGFFFMTVFMFALAIPY HWT K+NRIGFV MYSLT
Sbjct  381  CSTVPGYWFTVAFIDKIGRFKIQLMGFFFMTVFMFALAIPYHHWTLKDNRIGFVIMYSLT  440

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFF+NFGPNATTFVVPAEIFPARLRSTCHG+SAA+GKAGA+VGAFGFLYAAQ  D  KTD
Sbjct  441  FFFSNFGPNATTFVVPAEIFPARLRSTCHGISAASGKAGAMVGAFGFLYAAQPQDKTKTD  500

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIG+RN+L++LG INF GMVFTLLVPESKGKSL
Sbjct  501  AGYPPGIGIRNALIMLGAINFFGMVFTLLVPESKGKSL  538



>ref|XP_011025988.1| PREDICTED: inorganic phosphate transporter 1-4-like [Populus 
euphratica]
 ref|XP_011025989.1| PREDICTED: inorganic phosphate transporter 1-4-like [Populus 
euphratica]
 ref|XP_011025990.1| PREDICTED: inorganic phosphate transporter 1-4-like [Populus 
euphratica]
Length=539

 Score =   353 bits (906),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 200/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EV+RIARAQTLIA+
Sbjct  293  HGLHLLGTTTTWFLLDIAFYSQNLFQKDIFSAIGWIPKAQTMNAIDEVYRIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID+ GRFAIQLMGFFFMTVFMFALAIPY+HWTHK+N+IGFV +YSLT
Sbjct  353  CSTVPGYWFTVAFIDRIGRFAIQLMGFFFMTVFMFALAIPYNHWTHKDNQIGFVIIYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GK GAIVGAFGFLY AQ+    KTD
Sbjct  413  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKLGAIVGAFGFLYLAQSQSKDKTD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+NSLLVLG +NF G++FT LVPES GKSL
Sbjct  473  AGYPTGIGVKNSLLVLGVVNFFGILFTFLVPESNGKSL  510



>gb|KEH23921.1| high affinity inorganic phosphate transporter [Medicago truncatula]
Length=536

 Score =   353 bits (906),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 199/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+EEV++IARAQTLIA+
Sbjct  289  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNALEEVYKIARAQTLIAL  348

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALID+ GRF IQLMGFFFMTVFMFALAIPYDHWTHK++RIGFV +YSLT
Sbjct  349  CSTVPGYWFTVALIDRIGRFKIQLMGFFFMTVFMFALAIPYDHWTHKDHRIGFVVLYSLT  408

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+S+A+GK GA+VGAFGFLY AQN D +K D
Sbjct  409  FFFANFGPNATTFVVPAEIFPARFRSTCHGISSASGKLGAMVGAFGFLYLAQNKDKSKAD  468

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+NSLL+LG +N LG +FT LVPE+ GKSL
Sbjct  469  AGYPAGIGVKNSLLLLGVVNILGFLFTFLVPEANGKSL  506



>ref|XP_002306844.2| phosphate transporter 1 family protein [Populus trichocarpa]
 gb|EEE93840.2| phosphate transporter 1 family protein [Populus trichocarpa]
Length=539

 Score =   353 bits (906),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 200/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EV+RIARAQTLIA+
Sbjct  293  HGLHLLGTTTTWFLLDIAFYSQNLFQKDIFSAIGWIPKAKTMNAIDEVYRIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID+ GRFAIQLMGFFFMTVFMFALAIPY+HWTHK+NRIGFV +YSLT
Sbjct  353  CSTVPGYWFTVAFIDRIGRFAIQLMGFFFMTVFMFALAIPYNHWTHKDNRIGFVIIYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GK GAIVGAFGFLY +Q+    KTD
Sbjct  413  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKLGAIVGAFGFLYLSQSPHKDKTD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+NSLLVLG +NF G+VFT LVPES GKSL
Sbjct  473  AGYPTGIGVKNSLLVLGVVNFFGIVFTFLVPESNGKSL  510



>ref|XP_007144085.1| hypothetical protein PHAVU_007G127400g [Phaseolus vulgaris]
 gb|ESW16079.1| hypothetical protein PHAVU_007G127400g [Phaseolus vulgaris]
Length=536

 Score =   353 bits (905),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL+GTT TWFLLDIAFYSQ LFQKDIF AIGWIP  + MNA+ EV+RIARAQTLIA+
Sbjct  294  HGLHLVGTTVTWFLLDIAFYSQNLFQKDIFSAIGWIPPSQEMNAIHEVYRIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTV  ID  GRFAIQLMGFFFMTVFMFALAIPY+HWT KENRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVFFIDYMGRFAIQLMGFFFMTVFMFALAIPYNHWTKKENRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFF+NFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+TDP K D
Sbjct  414  FFFSNFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSTDPKKVD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYP GIGV+NSL+VLG +NF GMVFT LVPESKGKSL
Sbjct  474  QGYPTGIGVKNSLIVLGVVNFFGMVFTFLVPESKGKSL  511



>ref|XP_006378341.1| hypothetical protein POPTR_0010s08240g [Populus trichocarpa]
 gb|ERP56138.1| hypothetical protein POPTR_0010s08240g [Populus trichocarpa]
Length=536

 Score =   353 bits (905),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AI WIP   TMNA++EVFRIA+AQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAINWIPPAATMNAIDEVFRIAKAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALID  GRF IQ+MGFFFMT+FMFA+AIPY HWT K NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVALIDHLGRFFIQMMGFFFMTIFMFAIAIPYHHWTLKPNRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAI+GAFGFLYAAQ+TDP KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIIGAFGFLYAAQSTDPKKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGVR SL+VLG +NF+GM+FTLLVPE+KGKSL
Sbjct  474  AGYPPGIGVRWSLIVLGIVNFVGMLFTLLVPEAKGKSL  511



>gb|AFK47605.1| unknown [Medicago truncatula]
Length=538

 Score =   353 bits (905),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 185/218 (85%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIAFYSQ LFQKDIF AIGWIP  + MNA+ E++RIARAQTLIA+
Sbjct  294  HGLHLLGTTTTWFLLDIAFYSQNLFQKDIFTAIGWIPPAKEMNAINELYRIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFALAIPYDHWT KENRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDYMGRFAIQLMGFFFMTVFMFALAIPYDHWTKKENRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFAN GPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ DP KTD
Sbjct  414  FFFANLGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDPTKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYP GIG++NSL+VLG +NF GMVFT LVPE  GKSL
Sbjct  474  HGYPTGIGIKNSLIVLGVVNFFGMVFTFLVPEPNGKSL  511



>ref|NP_180842.1| putative inorganic phosphate transporter 1-5 [Arabidopsis thaliana]
 sp|Q8GYF4.2|PHT15_ARATH RecName: Full=Probable inorganic phosphate transporter 1-5; Short=AtPht1;5; 
AltName: Full=H(+)/Pi cotransporter [Arabidopsis 
thaliana]
 gb|AAB91982.1| putative phosphate transporter [Arabidopsis thaliana]
 dbj|BAA24280.1| inorganic phosphate transporter [Arabidopsis thaliana]
 gb|AAM14902.1| putative phosphate transporter [Arabidopsis thaliana]
 gb|AEC08747.1| putative inorganic phosphate transporter 1-5 [Arabidopsis thaliana]
Length=542

 Score =   352 bits (904),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 199/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIA+YS  LFQKDI+ AIGWIP  ETMNA+ EVF +++AQTLIA+
Sbjct  295  HGLHLLGTTTTWFLLDIAYYSSNLFQKDIYTAIGWIPAAETMNAIHEVFTVSKAQTLIAL  354

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            C TVPGYWFTVA ID  GRF IQLMGF FMT+FMFALAIPYDHW H+ENRIGF+ MYSLT
Sbjct  355  CGTVPGYWFTVAFIDILGRFFIQLMGFIFMTIFMFALAIPYDHWRHRENRIGFLIMYSLT  414

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
             FFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GKAGAIVGAFGFLYAAQ++D  KTD
Sbjct  415  MFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKAGAIVGAFGFLYAAQSSDSEKTD  474

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGVRNSLL+L C+NFLG+VFTLLVPESKGKSL
Sbjct  475  AGYPPGIGVRNSLLMLACVNFLGIVFTLLVPESKGKSL  512



>emb|CDX79505.1| BnaC03g18410D [Brassica napus]
Length=546

 Score =   353 bits (905),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 200/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL+GT +TWFLLDIA+YS  LFQKDI+ AIGWIP  ETMNA+ EV+ ++RAQTLIA+
Sbjct  294  HGLHLVGTATTWFLLDIAYYSSNLFQKDIYSAIGWIPAAETMNAIHEVYTVSRAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            C TVPGYWFTVALID  GRF IQLMGF FMTVFMFALAIPYDHW H++NRIGF+ MYSLT
Sbjct  354  CGTVPGYWFTVALIDYLGRFFIQLMGFIFMTVFMFALAIPYDHWKHRDNRIGFLIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
             FFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GKAGAIVGAFGFLYAAQ+TDP KTD
Sbjct  414  MFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKAGAIVGAFGFLYAAQSTDPKKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGVRNSLL+LG +NFLG+VFTLLVPESKGKSL
Sbjct  474  AGYPPGIGVRNSLLMLGGVNFLGIVFTLLVPESKGKSL  511



>ref|XP_002315705.1| phosphate transporter 2 family protein [Populus trichocarpa]
 gb|EEF01876.1| phosphate transporter 2 family protein [Populus trichocarpa]
Length=536

 Score =   352 bits (903),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 188/218 (86%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AI WIP   TMNA+ EVF+IA+AQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAINWIPPAATMNAIHEVFQIAKAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALID  GRF IQ+MGFFFMTVFMFA+AIPY HWT K NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVALIDHLGRFFIQMMGFFFMTVFMFAIAIPYHHWTLKPNRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAI+GAFGFLYAAQNTDP KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIIGAFGFLYAAQNTDPKKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+ SL+VLG INF+GM+FTLLVPES+GKSL
Sbjct  474  AGYPPGIGVKWSLIVLGVINFIGMLFTLLVPESRGKSL  511



>ref|XP_006378342.1| phosphate transporter 2 family protein [Populus trichocarpa]
 gb|ERP56139.1| phosphate transporter 2 family protein [Populus trichocarpa]
Length=536

 Score =   352 bits (902),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 188/218 (86%), Positives = 200/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AI WIP   TMNA+EEVFRIA+AQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAINWIPPAATMNAIEEVFRIAKAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALID  GRF IQ+MGFFFMTVFMFA+AIPY HWT K NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVALIDHLGRFFIQMMGFFFMTVFMFAIAIPYHHWTLKPNRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAI+GAFGFLYAAQ+TD  KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIIGAFGFLYAAQSTDRTKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            A YPPGIGVR SL+VLG +NFLGM+FTLLVPE+KGKSL
Sbjct  474  ADYPPGIGVRRSLIVLGIVNFLGMLFTLLVPEAKGKSL  511



>gb|AAK01938.1| phosphate transporter 1 [Lupinus albus]
Length=543

 Score =   352 bits (903),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT  TWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EV+RIARAQTLIA+
Sbjct  291  HGLHLLGTAGTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKTMNALDEVYRIARAQTLIAL  350

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALID+ GRFAIQLMGFFFMTVFMFALAIPYDHWTHK+NRIGFV +YSLT
Sbjct  351  CSTVPGYWFTVALIDRIGRFAIQLMGFFFMTVFMFALAIPYDHWTHKDNRIGFVVIYSLT  410

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+S+A+GK GAIVGAFGFLY AQN D +KTD
Sbjct  411  FFFANFGPNATTFVVPAEIFPARFRSTCHGISSASGKLGAIVGAFGFLYLAQNKDKSKTD  470

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+NSL+VLG +N LG  FT LVPE  GKSL
Sbjct  471  AGYPAGIGVKNSLIVLGVVNILGFCFTFLVPEPNGKSL  508



>ref|XP_009616492.1| PREDICTED: inorganic phosphate transporter 1-4-like [Nicotiana 
tomentosiformis]
Length=529

 Score =   351 bits (901),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 194/218 (89%), Positives = 205/218 (94%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP PETMNA+EEV++IARAQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPPETMNAMEEVYKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTV  IDK GRFAIQLMGFFFMT FMFALAIPY+HWTHK+NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVVFIDKIGRFAIQLMGFFFMTAFMFALAIPYNHWTHKDNRIGFVIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGA+VGAFGFLYAAQ+ DP KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAMVGAFGFLYAAQSNDPKKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGVR SL+VLG INF GM+FTLLVPESKGKSL
Sbjct  474  AGYPPGIGVRKSLIVLGFINFFGMLFTLLVPESKGKSL  511



>ref|XP_007222371.1| hypothetical protein PRUPE_ppa004004mg [Prunus persica]
 gb|EMJ23570.1| hypothetical protein PRUPE_ppa004004mg [Prunus persica]
Length=536

 Score =   351 bits (901),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 186/217 (86%), Positives = 197/217 (91%), Gaps = 0/217 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  E+MNA+ EV+RIARAQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAESMNAIHEVYRIARAQTLIAM  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTV  ID  GRF IQLMGFFFMTVFMFALAIPY HWT + NRI FV +YS T
Sbjct  354  CSTVPGYWFTVFFIDYLGRFTIQLMGFFFMTVFMFALAIPYHHWTLRPNRIAFVVIYSFT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ DP KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDPTKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKS  652
            AGYPPGIGV+NSL++LG INF GMVFTLLVPESKGKS
Sbjct  474  AGYPPGIGVKNSLIMLGVINFFGMVFTLLVPESKGKS  510



>ref|XP_010494321.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Camelina 
sativa]
Length=517

 Score =   350 bits (899),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 185/218 (85%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL LLG TSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNAV EVF+IARAQTLIA+
Sbjct  289  HGLPLLGCTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAGTMNAVHEVFKIARAQTLIAL  348

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+A PY+HW   +NRIGFV MYSLT
Sbjct  349  CSTVPGYWFTVAFIDIMGRFAIQLMGFFFMTVFMFAIAFPYNHWIKPDNRIGFVIMYSLT  408

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAA GKAGAIVGAFGFLYAAQ+ DPAKTD
Sbjct  409  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAATGKAGAIVGAFGFLYAAQSQDPAKTD  468

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL+VLG INF+GM+FT LVPE KGKSL
Sbjct  469  AGYPPGIGVKNSLIVLGVINFIGMLFTFLVPEPKGKSL  506



>ref|XP_002279070.1| PREDICTED: probable inorganic phosphate transporter 1-7 [Vitis 
vinifera]
Length=525

 Score =   350 bits (898),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HG+HL GT STWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EV++IA+AQTLIA+
Sbjct  290  HGVHLFGTASTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKTMNAIDEVYKIAKAQTLIAL  349

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID+ GRFAIQLMGFFFMTVFMFALA+PYDHWT K+NRIGFV MYSLT
Sbjct  350  CSTVPGYWFTVAFIDRMGRFAIQLMGFFFMTVFMFALALPYDHWTRKDNRIGFVVMYSLT  409

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GKAGAIVGAFGFLY AQ+ D AK D
Sbjct  410  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKAGAIVGAFGFLYLAQSKDKAKAD  469

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+N+LLVLG IN LG +FT +VPESKGKSL
Sbjct  470  AGYPAGIGVKNALLVLGGINLLGFIFTFMVPESKGKSL  507



>ref|XP_002881246.1| hypothetical protein ARALYDRAFT_482224 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57505.1| hypothetical protein ARALYDRAFT_482224 [Arabidopsis lyrata subsp. 
lyrata]
Length=543

 Score =   351 bits (900),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIA+YS  LFQKDI+ AIGWIP  ETMNA+ EVF +++AQTLIA+
Sbjct  296  HGLHLLGTTTTWFLLDIAYYSSNLFQKDIYTAIGWIPAAETMNAIHEVFTVSKAQTLIAL  355

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            C TVPGYWFTVA ID  GRF IQLMGF FM +FMFALAIPYDHW H+ENRIGF+ MYSLT
Sbjct  356  CGTVPGYWFTVAFIDILGRFFIQLMGFIFMMIFMFALAIPYDHWRHRENRIGFLIMYSLT  415

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
             FFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GKAGAIVGAFGFLYAAQ++D  KTD
Sbjct  416  MFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKAGAIVGAFGFLYAAQSSDSEKTD  475

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGVRNSLL+LGC+NF G+VFTLLVPESKGKSL
Sbjct  476  AGYPPGIGVRNSLLMLGCVNFFGIVFTLLVPESKGKSL  513



>ref|XP_002281264.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Vitis 
vinifera]
Length=537

 Score =   350 bits (899),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 185/218 (85%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  ETMNA+ EVFRIA+AQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAETMNAIHEVFRIAKAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYW TV  ID  GRFAIQLMGFFFMTVFMFALAIPY HWT   NRIGFV MYSLT
Sbjct  354  CSTVPGYWCTVIFIDYMGRFAIQLMGFFFMTVFMFALAIPYHHWTLAPNRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GKAGAI+GAFGFLYA+Q+ D  +TD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKAGAIIGAFGFLYASQSQDKTQTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIG+RNSL+VLG INFLGM+FT LVPE KGKSL
Sbjct  474  AGYPPGIGMRNSLIVLGVINFLGMLFTFLVPEPKGKSL  511



>gb|EYU46460.1| hypothetical protein MIMGU_mgv1a025868mg [Erythranthe guttata]
Length=537

 Score =   350 bits (899),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EV+ IARAQTLIA+
Sbjct  297  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFTAIGWIPPAKTMNAIQEVYTIARAQTLIAL  356

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALID  GRFAIQL+GFFFMTVFMFALA PY HWT  ENRIGFV MYSLT
Sbjct  357  CSTVPGYWFTVALIDVIGRFAIQLIGFFFMTVFMFALAFPYHHWTKPENRIGFVVMYSLT  416

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GK GA++GAFGFLY AQN DP K D
Sbjct  417  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKMGAMIGAFGFLYLAQNQDPTKAD  476

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+NSL+VLG +N LG++FT LVPESKGKSL
Sbjct  477  AGYPAGIGVQNSLIVLGVVNLLGLMFTFLVPESKGKSL  514



>ref|XP_004495320.1| PREDICTED: probable inorganic phosphate transporter 1-5-like 
[Cicer arietinum]
Length=537

 Score =   350 bits (898),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 199/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIAFYSQ LFQKDIF AIGWIP+ + MNA+ E++RIARAQTLIA+
Sbjct  294  HGLHLLGTTTTWFLLDIAFYSQNLFQKDIFTAIGWIPHAKEMNAIHELYRIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFALAIPYDHW  KENRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDYMGRFAIQLMGFFFMTVFMFALAIPYDHWKKKENRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+    +TD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKHKNETD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYP GIGV+NSL++LG +NFLG+VFT LVPE+KGKSL
Sbjct  474  EGYPTGIGVKNSLIMLGVVNFLGIVFTFLVPEAKGKSL  511



>gb|EYU17912.1| hypothetical protein MIMGU_mgv1a004397mg [Erythranthe guttata]
Length=529

 Score =   350 bits (897),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT STWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA++EV+ IARAQTLIA+
Sbjct  298  HGLHLLGTASTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKTMNAIQEVYTIARAQTLIAL  357

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALID  GRFAIQ+MGFFFMTVFMFALAIPY HWT+ ENRIGFV MYSLT
Sbjct  358  CSTVPGYWFTVALIDVIGRFAIQIMGFFFMTVFMFALAIPYHHWTNPENRIGFVVMYSLT  417

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GK GA+VGAFGFLY AQN DP KTD
Sbjct  418  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKLGAMVGAFGFLYLAQNKDPKKTD  477

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+NSL+VLG +N  G++FT LVPE+KGKSL
Sbjct  478  AGYPAGIGVKNSLIVLGFVNLAGLLFTFLVPEAKGKSL  515



>ref|XP_009378993.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Pyrus 
x bretschneideri]
Length=535

 Score =   350 bits (898),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  + MNA+ EV+ IARAQTLIA+
Sbjct  292  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPRADRMNAIHEVYIIARAQTLIAM  351

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFALAIPY HWT K N IGFV +YSLT
Sbjct  352  CSTVPGYWFTVAFIDYMGRFAIQLMGFFFMTVFMFALAIPYHHWTLKANNIGFVVIYSLT  411

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ +PAKTD
Sbjct  412  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQDKNPAKTD  471

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++L  IN  GMVFTLLVPESKGKSL
Sbjct  472  AGYPPGIGVKNSLIMLCVINVFGMVFTLLVPESKGKSL  509



>ref|XP_011030507.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Populus 
euphratica]
Length=536

 Score =   350 bits (898),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 200/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AI WIP   TMNA+ EVF+IA+AQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAINWIPPAATMNAIHEVFQIAKAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRF IQ+MGFFFMTVFMFA+AIPY HWT K NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDHLGRFFIQMMGFFFMTVFMFAIAIPYHHWTLKPNRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAAAGKAGAI+GAFGFLYAAQNTDP KTD
Sbjct  414  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAAAGKAGAIIGAFGFLYAAQNTDPKKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+ SL+VLG INF+GM+FTLLVPES+GKSL
Sbjct  474  AGYPPGIGVKWSLIVLGVINFIGMLFTLLVPESRGKSL  511



>ref|XP_008224362.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Prunus 
mume]
Length=537

 Score =   350 bits (898),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 185/217 (85%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  E+MNA+ EV+RIARAQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAESMNAINEVYRIARAQTLIAM  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTV  ID  GRFAIQLMGFFFMTVFMFALAIPY HWT K NRI FV MYS T
Sbjct  354  CSTVPGYWFTVFFIDYLGRFAIQLMGFFFMTVFMFALAIPYHHWTLKPNRIAFVVMYSFT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAI+GA GFLYAAQ+ DP KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIIGALGFLYAAQSKDPTKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKS  652
            AGYP GIGV+NSL++LG INF GM+FTLLVPESKGKS
Sbjct  474  AGYPTGIGVKNSLIMLGVINFFGMLFTLLVPESKGKS  510



>ref|XP_010442030.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Camelina 
sativa]
 ref|XP_010481869.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Camelina 
sativa]
 ref|XP_010494320.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Camelina 
sativa]
Length=517

 Score =   349 bits (896),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 184/218 (84%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL LLG TSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNAV EVF+IARAQTLIA+
Sbjct  289  HGLPLLGCTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAGTMNAVHEVFKIARAQTLIAL  348

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+A PY+HW   +NRIGFV MYSLT
Sbjct  349  CSTVPGYWFTVAFIDIMGRFAIQLMGFFFMTVFMFAIAFPYNHWIKPDNRIGFVIMYSLT  408

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAA GKAGAIVGAFGFLYAAQ+ DPAKTD
Sbjct  409  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAATGKAGAIVGAFGFLYAAQSQDPAKTD  468

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INF+GM+FT LVPE KGKSL
Sbjct  469  AGYPPGIGVKNSLIMLGVINFIGMLFTFLVPEPKGKSL  506



>ref|XP_008375348.1| PREDICTED: probable inorganic phosphate transporter 1-5 [Malus 
domestica]
Length=519

 Score =   349 bits (895),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFL DIA+YSQ LFQKD+F AIGW+P  ETMNA+EE++RI+RAQTLIA+
Sbjct  293  HGLHLLGTTTTWFLFDIAYYSQNLFQKDVFSAIGWLPAAETMNAIEELYRISRAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CS VPGYWFTVA ID+ GRF IQLMGFFFMTVFMFALAIPY HWT K NRIGFV +YSLT
Sbjct  353  CSLVPGYWFTVAFIDRIGRFPIQLMGFFFMTVFMFALAIPYHHWTLKPNRIGFVVLYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFF+NFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+T+PA+TD
Sbjct  413  FFFSNFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSTNPAETD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIG++NSL++LG INF GM+FTLLVPE+ GKSL
Sbjct  473  AGYPPGIGMKNSLIMLGVINFFGMLFTLLVPEANGKSL  510



>ref|XP_008231651.1| PREDICTED: LOW QUALITY PROTEIN: probable inorganic phosphate 
transporter 1-5 [Prunus mume]
Length=524

 Score =   349 bits (896),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIA+YSQ LFQKDIF AIGWIP  ETMNA+EE++ IARAQTLIA+
Sbjct  298  HGLHLLGTTTTWFLLDIAYYSQNLFQKDIFSAIGWIPAAETMNAIEELYTIARAQTLIAL  357

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CS VPGYWFTVA ID+ GRF IQLMGFFFMTVFMFALAIPY HWT K NRIGFV +YSLT
Sbjct  358  CSLVPGYWFTVAFIDRIGRFPIQLMGFFFMTVFMFALAIPYHHWTLKPNRIGFVVLYSLT  417

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFF+NFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVG FGFLYAAQ+T+P+KTD
Sbjct  418  FFFSNFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGGFGFLYAAQSTNPSKTD  477

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYPPGIG++NSL++LG INF GM+FTLL+PESKGK+L
Sbjct  478  PGYPPGIGMKNSLIMLGTINFFGMLFTLLLPESKGKAL  515



>ref|XP_007035101.1| Phosphate transporter 1,7 isoform 1 [Theobroma cacao]
 ref|XP_007035102.1| Phosphate transporter 1,7 isoform 1 [Theobroma cacao]
 ref|XP_007035103.1| Phosphate transporter 1,7 isoform 1 [Theobroma cacao]
 ref|XP_007035104.1| Phosphate transporter 1,7 isoform 1 [Theobroma cacao]
 ref|XP_007035105.1| Phosphate transporter 1,7 isoform 1 [Theobroma cacao]
 gb|EOY06027.1| Phosphate transporter 1,7 isoform 1 [Theobroma cacao]
 gb|EOY06028.1| Phosphate transporter 1,7 isoform 1 [Theobroma cacao]
 gb|EOY06029.1| Phosphate transporter 1,7 isoform 1 [Theobroma cacao]
 gb|EOY06030.1| Phosphate transporter 1,7 isoform 1 [Theobroma cacao]
 gb|EOY06031.1| Phosphate transporter 1,7 isoform 1 [Theobroma cacao]
Length=537

 Score =   349 bits (896),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 200/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF  IGWIP   +MNA+ EV++IA+AQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSGIGWIPPAASMNAIHEVYKIAKAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
             STVPGYWFTVALID  GRFAIQLMGFFFMTVFMFALAIPY HWT K NRIGFV +YSLT
Sbjct  354  FSTVPGYWFTVALIDIIGRFAIQLMGFFFMTVFMFALAIPYHHWTLKPNRIGFVIIYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPN+TTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+TDP KTD
Sbjct  414  FFFANFGPNSTTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSTDPTKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIG+R SL+VLG INFLGM+FTLLVPESKGKSL
Sbjct  474  AGYPTGIGIRYSLIVLGVINFLGMLFTLLVPESKGKSL  511



>ref|XP_010556904.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Tarenaya 
hassleriana]
Length=526

 Score =   349 bits (895),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 195/218 (89%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNA+ EVF+I RAQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAATMNAIHEVFKIGRAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+A PY+HWT  +NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDIMGRFAIQLMGFFFMTVFMFAIAFPYNHWTKPDNRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPN+TTF+VPAEIFPARLRSTCHG+SAA+GKAGAI+GAFGFLYAAQ  D  K D
Sbjct  414  FFFANFGPNSTTFIVPAEIFPARLRSTCHGISAASGKAGAIIGAFGFLYAAQPKDKTKVD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GY PGIGV+NSL+ LGC+NF GMVFTLLVPESKGKSL
Sbjct  474  HGYSPGIGVKNSLIALGCVNFAGMVFTLLVPESKGKSL  511



>ref|XP_006296200.1| hypothetical protein CARUB_v10025365mg [Capsella rubella]
 gb|EOA29098.1| hypothetical protein CARUB_v10025365mg [Capsella rubella]
Length=541

 Score =   349 bits (896),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 194/249 (78%), Positives = 214/249 (86%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIA+YS  LFQKDI+ AIGWIP  ETMNA+ EVF +++AQTLIA+
Sbjct  294  HGLHLLGTTTTWFLLDIAYYSSNLFQKDIYTAIGWIPAAETMNAIHEVFTVSKAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            C TVPGYWFTVA ID  GRF IQLMGF FMT+FMFALAIPYDHW H+ENRIGF+ MYSLT
Sbjct  354  CGTVPGYWFTVAFIDTLGRFFIQLMGFIFMTIFMFALAIPYDHWKHRENRIGFLVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
             FFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ++D  KTD
Sbjct  414  MFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSSDSEKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYPPGIGVRNSLL+LG +NF G+VFT LVPESKGKSLEE+SRE+E + G       T  
Sbjct  474  AGYPPGIGVRNSLLMLGSVNFFGVVFTFLVPESKGKSLEEISREDEEQSGGDAAAEMTT-  532

Query  722  GHEIRTVPV  748
             H  RTVPV
Sbjct  533  PHSGRTVPV  541



>ref|XP_007219001.1| hypothetical protein PRUPE_ppa004176mg [Prunus persica]
 gb|EMJ20200.1| hypothetical protein PRUPE_ppa004176mg [Prunus persica]
Length=525

 Score =   349 bits (895),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 200/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIA+YSQ LFQKDIF AIGWIP  ETMNA+EE++ IARAQTLIA+
Sbjct  299  HGLHLLGTTTTWFLLDIAYYSQNLFQKDIFSAIGWIPAAETMNAIEELYTIARAQTLIAL  358

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CS VPGYWFTVA ID  GRF IQLMGFFFMTVFMFALAIPY HWT K NRIGFV +YSLT
Sbjct  359  CSLVPGYWFTVAFIDHIGRFPIQLMGFFFMTVFMFALAIPYHHWTLKPNRIGFVVLYSLT  418

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFF+NFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVG FGFLYAAQ+T+PAKTD
Sbjct  419  FFFSNFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGGFGFLYAAQSTNPAKTD  478

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYPPGIG++NSL++LG INF GM+FTLL+PESKGK+L
Sbjct  479  PGYPPGIGMKNSLIMLGTINFFGMLFTLLLPESKGKTL  516



>ref|XP_010442029.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Camelina 
sativa]
Length=517

 Score =   348 bits (894),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL LLG TSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNA+ EVF+IARAQTLIA+
Sbjct  289  HGLPLLGCTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAGTMNAIHEVFKIARAQTLIAL  348

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+A PY+HW   +NRIGFV MYSLT
Sbjct  349  CSTVPGYWFTVAFIDIMGRFAIQLMGFFFMTVFMFAIAFPYNHWIKPDNRIGFVIMYSLT  408

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAA GKAGAIVGAFGFLYAAQ+ DPAKTD
Sbjct  409  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAATGKAGAIVGAFGFLYAAQSQDPAKTD  468

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INF+GM+FT LVPE KGKSL
Sbjct  469  AGYPPGIGVKNSLIMLGVINFIGMLFTFLVPEPKGKSL  506



>ref|XP_009765017.1| PREDICTED: inorganic phosphate transporter 1-4-like [Nicotiana 
sylvestris]
Length=529

 Score =   349 bits (895),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 192/218 (88%), Positives = 203/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIAFYSQ LFQKDIF AIGWIP PETMNA+EEV++IARAQTLIA+
Sbjct  294  HGLHLLGTTTTWFLLDIAFYSQNLFQKDIFSAIGWIPPPETMNAMEEVYKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTV  IDK GRFAIQLMGFFFMT FMFALAIPYDHWTHK+NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVVFIDKIGRFAIQLMGFFFMTAFMFALAIPYDHWTHKDNRIGFVIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGA+VGAFGFLYAAQ+ DP K D
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAMVGAFGFLYAAQSNDPKKAD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGVR SL+VLG INF GM+ TLLVPESKGKSL
Sbjct  474  AGYPPGIGVRKSLIVLGFINFFGMLLTLLVPESKGKSL  511



>ref|XP_002862864.1| hypothetical protein ARALYDRAFT_920199 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39122.1| hypothetical protein ARALYDRAFT_920199 [Arabidopsis lyrata subsp. 
lyrata]
Length=474

 Score =   347 bits (890),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNA+ EVF+IA+AQTLIA+
Sbjct  246  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAATMNAIHEVFKIAKAQTLIAL  305

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+A PY+HW   +NRIGFV MYSLT
Sbjct  306  CSTVPGYWFTVAFIDIIGRFAIQLMGFFFMTVFMFAIAFPYNHWILPDNRIGFVVMYSLT  365

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAA GKAGAIVGAFGFLYAAQ  D  KTD
Sbjct  366  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAATGKAGAIVGAFGFLYAAQPQDKTKTD  425

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INF+GM+FT LVPE KGKSL
Sbjct  426  AGYPPGIGVKNSLIMLGVINFVGMLFTFLVPEPKGKSL  463



>ref|XP_009612775.1| PREDICTED: probable inorganic phosphate transporter 1-7 [Nicotiana 
tomentosiformis]
 ref|XP_009612776.1| PREDICTED: probable inorganic phosphate transporter 1-7 [Nicotiana 
tomentosiformis]
Length=523

 Score =   348 bits (893),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL GTTSTWFLLDIAFYSQ LFQKD+F AIGWIP  +TMNAVEEV +IARAQTLIA+
Sbjct  295  HGLHLFGTTSTWFLLDIAFYSQNLFQKDVFSAIGWIPAAKTMNAVEEVCKIARAQTLIAL  354

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
             STVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+AIPYDHWT K+N IGFV MY+LT
Sbjct  355  LSTVPGYWFTVAFIDIVGRFAIQLMGFFFMTVFMFAIAIPYDHWTKKDNHIGFVAMYALT  414

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGA+GFLYAAQ+ DP KTD
Sbjct  415  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAYGFLYAAQSKDPTKTD  474

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIG++NSL+ LG IN LGMV T  VPESKGKSL
Sbjct  475  AGYPAGIGIKNSLIALGAINALGMVCTFCVPESKGKSL  512



>ref|XP_010556901.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Tarenaya 
hassleriana]
Length=526

 Score =   348 bits (894),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 195/218 (89%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNA+ EVF+I RAQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAATMNAIHEVFKIGRAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+A PY+HWT  +NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDIMGRFAIQLMGFFFMTVFMFAIAFPYNHWTKPDNRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPN+TTF+VPAEIFPARLRSTCHG+SAA+GKAGAI+GAFGFLYAAQ  D  K D
Sbjct  414  FFFANFGPNSTTFIVPAEIFPARLRSTCHGISAASGKAGAIIGAFGFLYAAQPKDKTKVD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GY PGIGV+NSL+ LGC+NF GMVFTLLVPESKGKSL
Sbjct  474  HGYSPGIGVKNSLIALGCVNFAGMVFTLLVPESKGKSL  511



>gb|KDP40326.1| hypothetical protein JCGZ_02324 [Jatropha curcas]
Length=536

 Score =   348 bits (894),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HG HL+GTT+TWFLLDIAFYSQ LFQKDIF AI WIP  + MNA+ EVFRIARAQTLIA+
Sbjct  294  HGRHLVGTTTTWFLLDIAFYSQNLFQKDIFTAINWIPKAQKMNAIHEVFRIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTV LID  GRFAIQLMGFFFMTVFMFA+AIPY HWT + NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVFLIDYMGRFAIQLMGFFFMTVFMFAIAIPYHHWTLEPNRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ TD  KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQPTDKTKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL+ LG INF GM+FTLLVPESKGKSL
Sbjct  474  AGYPPGIGVKNSLIALGVINFFGMLFTLLVPESKGKSL  511



>ref|XP_010442028.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Camelina 
sativa]
Length=517

 Score =   348 bits (893),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL LLG TSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNA+ EVF+IARAQTLIA+
Sbjct  289  HGLPLLGCTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAGTMNAIHEVFKIARAQTLIAL  348

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+A PY+HW   +NRIGFV MYSLT
Sbjct  349  CSTVPGYWFTVAFIDIMGRFAIQLMGFFFMTVFMFAIAFPYNHWIKPDNRIGFVIMYSLT  408

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAA GKAGAIVGAFGFLYAAQ+ DP KTD
Sbjct  409  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAATGKAGAIVGAFGFLYAAQSQDPTKTD  468

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL+VLG INF+GM+FT LVPE KGKSL
Sbjct  469  AGYPPGIGVKNSLIVLGVINFIGMLFTFLVPEPKGKSL  506



>gb|AAQ67368.1| high-affinity phosphate transporter [Medicago sativa]
Length=361

 Score =   343 bits (879),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HG  L GT STWFLLDIAFYSQ LFQKDIF AIGWIP  + MNA+ EV++IARAQTLIA+
Sbjct  122  HGWALFGTCSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKEMNAIHEVYKIARAQTLIAL  181

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFM ALAIPYDHW+ +ENRIGFV MYSLT
Sbjct  182  CSTVPGYWFTVAFIDHMGRFAIQMMGFFFMTVFMLALAIPYDHWSKEENRIGFVVMYSLT  241

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ DP KTD
Sbjct  242  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDPTKTD  301

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYP GIG++NSL++LG INF+GM+ TLLVPESKGKSL
Sbjct  302  KGYPTGIGIKNSLIMLGVINFVGMLCTLLVPESKGKSL  339



>ref|XP_010442027.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Camelina 
sativa]
Length=517

 Score =   348 bits (892),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL LLG TSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNA+ EVF+IARAQTLIA+
Sbjct  289  HGLPLLGCTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAGTMNAIHEVFKIARAQTLIAL  348

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+A PY+HW   +NRIGFV MYSLT
Sbjct  349  CSTVPGYWFTVAFIDIMGRFAIQLMGFFFMTVFMFAIAFPYNHWIKPDNRIGFVIMYSLT  408

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAA GKAGAIVGAFGFLYAAQ+ DP KTD
Sbjct  409  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAATGKAGAIVGAFGFLYAAQSQDPTKTD  468

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL+VLG INF+GM+FT LVPE KGKSL
Sbjct  469  AGYPPGIGVKNSLIVLGVINFIGMLFTFLVPEPKGKSL  506



>ref|XP_010494314.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Camelina 
sativa]
Length=524

 Score =   348 bits (893),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL LLG TSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNAV EVF+IARAQTLIA+
Sbjct  293  HGLPLLGCTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKADTMNAVHEVFKIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFF MTVFMFA+A PY+HW   +NRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVAFIDIMGRFAIQLMGFFMMTVFMFAIAFPYNHWIKPDNRIGFVIMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAA GKAGAIVGAFGFLYAAQ+ DPAKTD
Sbjct  413  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAATGKAGAIVGAFGFLYAAQSQDPAKTD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INF+GM+FT LVPE KGKSL
Sbjct  473  AGYPPGIGVKNSLIMLGVINFVGMLFTFLVPEPKGKSL  510



>ref|XP_010484866.1| PREDICTED: inorganic phosphate transporter 1-1-like [Camelina 
sativa]
Length=576

 Score =   350 bits (897),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 184/218 (84%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL LLG TSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNAV EVF+IARAQTLIA+
Sbjct  348  HGLPLLGCTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAGTMNAVHEVFKIARAQTLIAL  407

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+A PY+HW   +NRIGFV MYSLT
Sbjct  408  CSTVPGYWFTVAFIDIMGRFAIQLMGFFFMTVFMFAIAFPYNHWIKPDNRIGFVIMYSLT  467

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAA GKAGAIVGAFGFLYAAQ+ DPAKTD
Sbjct  468  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAATGKAGAIVGAFGFLYAAQSQDPAKTD  527

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INF+GM+FT LVPE KGKSL
Sbjct  528  AGYPPGIGVKNSLIMLGVINFIGMLFTFLVPEPKGKSL  565



>dbj|BAB21563.1| phosphate transporter [Nicotiana tabacum]
Length=523

 Score =   348 bits (892),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL GTTSTWFLLDIAFYSQ LFQKD+F AIGWIP  +TMNAV+EV++IARAQTLIA+
Sbjct  295  HGLHLFGTTSTWFLLDIAFYSQNLFQKDVFSAIGWIPPAKTMNAVQEVYKIARAQTLIAL  354

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
             STVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+AIPYDHWT K+N IGFV MY+LT
Sbjct  355  LSTVPGYWFTVAFIDIVGRFAIQLMGFFFMTVFMFAIAIPYDHWTKKDNHIGFVAMYALT  414

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGA+GFLYAAQ+ DP KTD
Sbjct  415  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAYGFLYAAQSKDPTKTD  474

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIG++NSL+ LG IN LGMV T  VPESKGKSL
Sbjct  475  AGYPAGIGIKNSLIALGAINALGMVCTFCVPESKGKSL  512



>gb|KDO57607.1| hypothetical protein CISIN_1g0100763mg, partial [Citrus sinensis]
 gb|KDO57608.1| hypothetical protein CISIN_1g0100763mg, partial [Citrus sinensis]
Length=515

 Score =   347 bits (891),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL GTTSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNA+ EV++IARAQTLIA+
Sbjct  294  HGLHLFGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAATMNAIHEVYKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPY HWT K NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDYMGRFAIQMMGFFFMTVFMFALAIPYHHWTLKPNRIGFVIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ DP K D
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDPTKRD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+NSL++LG +NF+GM+ TL VPESKG+SL
Sbjct  474  AGYPAGIGVKNSLIMLGVVNFVGMICTLCVPESKGRSL  511



>ref|XP_003590039.1| Inorganic phosphate transporter 1-1 [Medicago truncatula]
 gb|AES60290.1| high affinity inorganic phosphate transporter [Medicago truncatula]
Length=537

 Score =   348 bits (893),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL L GT STWFLLDIAFYSQ LFQKDIF AIGWIP  + MNA+ EV++IARAQTLIA+
Sbjct  294  HGLALFGTCSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKEMNAIHEVYKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPYDHW+ +ENRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDHMGRFAIQMMGFFFMTVFMFALAIPYDHWSKEENRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ DP KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDPTKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYP GIG++NSL++LG INF+GM+ TLLVPESKGKSL
Sbjct  474  KGYPTGIGIKNSLIMLGVINFVGMLCTLLVPESKGKSL  511



>gb|AFU50501.1| phosphate transporter 2 [Astragalus sinicus]
Length=538

 Score =   348 bits (893),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 203/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL+GTT+TWFLLDIAFYSQ LFQKDIF AIGWIP+ + M+A+ E++++ARAQTLIA+
Sbjct  295  HGLHLVGTTTTWFLLDIAFYSQNLFQKDIFAAIGWIPHAKEMSAIHELYKVARAQTLIAL  354

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
             STVPGYWFTVALID  GRFAIQLMGFFFMTVFMFALAIPYDHWT K+N+IGF+ MYSLT
Sbjct  355  FSTVPGYWFTVALIDYMGRFAIQLMGFFFMTVFMFALAIPYDHWTKKDNKIGFLVMYSLT  414

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYA+Q+ DP KTD
Sbjct  415  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYASQSKDPTKTD  474

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYP GIGV+NSL++LG +NFLG++FTLLVPESKGKSL
Sbjct  475  QGYPTGIGVKNSLIMLGVVNFLGIIFTLLVPESKGKSL  512



>gb|AFY06657.1| phosphate transporter [Citrus trifoliata]
Length=518

 Score =   347 bits (891),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL GTTSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNA+ EV++IARAQTLIA+
Sbjct  294  HGLHLFGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAATMNAIHEVYKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPY HWT K NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDYMGRFAIQMMGFFFMTVFMFALAIPYHHWTLKPNRIGFVIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ DP K D
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDPTKRD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+NSL++LG +NF+GM+ TL VPESKG+SL
Sbjct  474  AGYPAGIGVKNSLIMLGVVNFVGMICTLCVPESKGRSL  511



>ref|XP_007199605.1| hypothetical protein PRUPE_ppa024435mg [Prunus persica]
 gb|EMJ00804.1| hypothetical protein PRUPE_ppa024435mg [Prunus persica]
Length=519

 Score =   347 bits (891),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 199/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP+ +TMNAV EV+RIARAQTLIA+
Sbjct  290  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPSAKTMNAVSEVYRIARAQTLIAL  349

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALIDK GRFAIQLMGFFFMTVFMFALA PY++WTHK++ IGFV +YSLT
Sbjct  350  CSTVPGYWFTVALIDKIGRFAIQLMGFFFMTVFMFALAFPYNYWTHKDHLIGFVVLYSLT  409

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGK GA+VGAFGFLY AQ  D  K +
Sbjct  410  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKLGAMVGAFGFLYLAQPQDKTKAE  469

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AG+P GIGV+NSL+VLG +NFLG++FT  VPESKGKSL
Sbjct  470  AGFPAGIGVKNSLIVLGVVNFLGLLFTFFVPESKGKSL  507



>gb|ABK63961.1| PT2 [Solanum melongena]
Length=525

 Score =   347 bits (891),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL GT STWFLLDIAFYSQ LFQKD+F A+GWIP   TMNAV+EV++IARAQTLIA+
Sbjct  296  HGLHLFGTCSTWFLLDIAFYSQNLFQKDVFSAVGWIPKAPTMNAVQEVYKIARAQTLIAL  355

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+AIPY HWT +ENRIGFV MYSLT
Sbjct  356  CSTVPGYWFTVAFIDIIGRFAIQLMGFFFMTVFMFAIAIPYHHWTLEENRIGFVVMYSLT  415

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGA+GFLYAAQ+ DP KTD
Sbjct  416  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAYGFLYAAQSKDPTKTD  475

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIG++NSL+VLGCIN LG++ T  VPE KGKSL
Sbjct  476  AGYPAGIGIKNSLIVLGCINALGLLCTFCVPEPKGKSL  513



>ref|XP_009626859.1| PREDICTED: probable inorganic phosphate transporter 1-7 [Nicotiana 
tomentosiformis]
Length=525

 Score =   347 bits (891),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL GTTSTWFLLDIAFYSQ LFQKD+F AIGWIP  +TMNAV+EV++IARAQTLIA+
Sbjct  296  HGLHLFGTTSTWFLLDIAFYSQNLFQKDVFSAIGWIPPAKTMNAVQEVYKIARAQTLIAL  355

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
             STVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+AIPYDHWT K+N IGFV MY+LT
Sbjct  356  LSTVPGYWFTVAFIDIVGRFAIQLMGFFFMTVFMFAIAIPYDHWTKKDNHIGFVAMYALT  415

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGA+GFLYAAQ+ DP KTD
Sbjct  416  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAYGFLYAAQSKDPTKTD  475

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIG++NSL+ LG IN LGMV T  VPESKGKSL
Sbjct  476  AGYPAGIGIKNSLIALGAINALGMVCTFCVPESKGKSL  513



>ref|XP_009133318.1| PREDICTED: inorganic phosphate transporter 1-4 [Brassica rapa]
Length=535

 Score =   348 bits (892),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT STWFLLDIAFYS  LFQKDIF AIGWIP  +TM+A++EVF+IARAQTLIA+
Sbjct  294  HGLHLLGTASTWFLLDIAFYSSNLFQKDIFSAIGWIPPAQTMSAIQEVFKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CST+PGYWFTVA ID  GRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFV MYSLT
Sbjct  354  CSTMPGYWFTVAFIDVIGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPN TTFVVPAEIFPAR RSTCHG+SAA+GK GAIVGAFGFLY AQ+ D  KT 
Sbjct  414  FFFANFGPNVTTFVVPAEIFPARFRSTCHGISAASGKLGAIVGAFGFLYLAQSPDKNKTS  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG ++FLG++FT LVPE+KGKSL
Sbjct  474  AGYPPGIGVKNSLIMLGVVSFLGILFTFLVPEAKGKSL  511



>ref|XP_008235688.1| PREDICTED: inorganic phosphate transporter 1-4-like [Prunus mume]
Length=519

 Score =   347 bits (891),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 199/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP+ +TMNAV EV+RIARAQTLIA+
Sbjct  290  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPSAKTMNAVSEVYRIARAQTLIAL  349

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALIDK GRFAIQLMGFFFMTVFMFALA PY++WTHK++ IGFV +YSLT
Sbjct  350  CSTVPGYWFTVALIDKIGRFAIQLMGFFFMTVFMFALAFPYNYWTHKDHLIGFVVLYSLT  409

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGK GA+VGAFGFLY AQ  D  K +
Sbjct  410  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKLGAMVGAFGFLYLAQPQDKTKAE  469

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AG+P GIGV+NSL+VLG +NFLG++FT  VPESKGKSL
Sbjct  470  AGFPAGIGVKNSLIVLGVVNFLGLLFTFFVPESKGKSL  507



>ref|XP_006420214.1| hypothetical protein CICLE_v10004694mg [Citrus clementina]
 ref|XP_006420215.1| hypothetical protein CICLE_v10004694mg [Citrus clementina]
 gb|ESR33454.1| hypothetical protein CICLE_v10004694mg [Citrus clementina]
 gb|ESR33455.1| hypothetical protein CICLE_v10004694mg [Citrus clementina]
Length=537

 Score =   347 bits (891),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL GTTSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNA+ EV++IARAQTLIA+
Sbjct  294  HGLHLFGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAATMNAIHEVYKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPY HWT K NRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDYIGRFAIQMMGFFFMTVFMFALAIPYHHWTLKPNRIGFVIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ DP K D
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDPTKRD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+NSL++LG +NF+GM+ TL VPESKG+SL
Sbjct  474  AGYPAGIGVKNSLIMLGVVNFVGMICTLCVPESKGRSL  511



>ref|XP_006410416.1| hypothetical protein EUTSA_v10016483mg [Eutrema salsugineum]
 gb|ESQ51869.1| hypothetical protein EUTSA_v10016483mg [Eutrema salsugineum]
Length=543

 Score =   347 bits (891),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 179/218 (82%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL+GTT+TWFLLDIA+YS  LFQKDI+ AIGWIP  ETMNA+ E+F ++RAQTLIA+
Sbjct  297  HGLHLIGTTTTWFLLDIAYYSSNLFQKDIYSAIGWIPAAETMNAIHELFTVSRAQTLIAL  356

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            C TVPGYWFTVA ID  GRF IQLMGF FMTVFM ALAIPYDHW  ++NRIGF+ MYSLT
Sbjct  357  CGTVPGYWFTVAFIDYLGRFFIQLMGFIFMTVFMLALAIPYDHWRRRDNRIGFLVMYSLT  416

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
             FFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GKAGAIVGAFGFLYAAQ++DP KTD
Sbjct  417  MFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKAGAIVGAFGFLYAAQSSDPEKTD  476

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGVRNSLL+LG +NFLG+VFTLLVPESKGKSL
Sbjct  477  AGYPPGIGVRNSLLMLGGVNFLGIVFTLLVPESKGKSL  514



>ref|XP_009372790.1| PREDICTED: LOW QUALITY PROTEIN: probable inorganic phosphate 
transporter 1-5 [Pyrus x bretschneideri]
Length=518

 Score =   347 bits (889),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 199/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIA+YSQ LF KDIF AIGWIP  ETMN +EE++ IARAQTLIA+
Sbjct  292  HGLHLLGTTTTWFLLDIAYYSQNLFXKDIFSAIGWIPAAETMNGIEELYTIARAQTLIAL  351

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CS VPGYWFTVA ID+ GRFAIQLMGFFFMTVFMFALAIPY HWT K NRIGFV +YSLT
Sbjct  352  CSLVPGYWFTVAFIDRIGRFAIQLMGFFFMTVFMFALAIPYHHWTLKPNRIGFVVLYSLT  411

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFF+NFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVG FGFLYAAQ+T+PAKT+
Sbjct  412  FFFSNFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGGFGFLYAAQSTNPAKTE  471

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIG++NSL++L  INF GM+FTLLVPE KGKSL
Sbjct  472  AGYPPGIGMKNSLIMLATINFFGMLFTLLVPEPKGKSL  509



>ref|XP_002865428.1| hypothetical protein ARALYDRAFT_331059 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41687.1| hypothetical protein ARALYDRAFT_331059 [Arabidopsis lyrata subsp. 
lyrata]
Length=517

 Score =   347 bits (889),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNA+ EVF+IA+AQTLIA+
Sbjct  289  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAATMNAIHEVFKIAKAQTLIAL  348

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+A PY+HW   +NRIGFV MYSLT
Sbjct  349  CSTVPGYWFTVAFIDIIGRFAIQLMGFFFMTVFMFAIAFPYNHWILPDNRIGFVIMYSLT  408

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAA GKAGAIVGAFGFLYAAQ  D  KTD
Sbjct  409  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAATGKAGAIVGAFGFLYAAQPQDKTKTD  468

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INF+GM+FT LVPE KGKSL
Sbjct  469  AGYPPGIGVKNSLIMLGVINFVGMLFTFLVPEPKGKSL  506



>ref|XP_011083022.1| PREDICTED: inorganic phosphate transporter 1-4 [Sesamum indicum]
Length=524

 Score =   347 bits (890),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIA+YSQ LFQKDIF AIGWIP  +TMNA++EVF IARAQTLIA+
Sbjct  293  HGLHLLGTTSTWFLLDIAYYSQNLFQKDIFSAIGWIPAAKTMNAIQEVFTIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALID  GRFAIQL+GFFFMTVFMFALA PY HWT  +NRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVALIDVLGRFAIQLIGFFFMTVFMFALAFPYHHWTKPDNRIGFVVMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGK GAI+GAFGFLY AQN D  K D
Sbjct  413  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKLGAIIGAFGFLYLAQNQDKKKAD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+NSL+VLG IN LG++FT LVPE+KGKSL
Sbjct  473  AGYPAGIGVKNSLIVLGVINLLGLLFTFLVPEAKGKSL  510



>ref|XP_006281683.1| hypothetical protein CARUB_v10027822mg [Capsella rubella]
 gb|EOA14581.1| hypothetical protein CARUB_v10027822mg [Capsella rubella]
Length=524

 Score =   347 bits (889),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 195/218 (89%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL LLG TSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+ EVF+I RAQTLIA+
Sbjct  293  HGLPLLGCTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKADTMNAIHEVFKIGRAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFF MTVFMFA+A PYDHW   +NRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVAFIDIMGRFAIQLMGFFMMTVFMFAIAFPYDHWIKPDNRIGFVIMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAA GKAGAIVGAFGFLYAAQ+ DP KTD
Sbjct  413  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAATGKAGAIVGAFGFLYAAQSQDPKKTD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INF+GM+FT LVPE KGKSL
Sbjct  473  AGYPPGIGVKNSLIMLGVINFVGMLFTFLVPEPKGKSL  510



>emb|CDY60902.1| BnaCnng37050D [Brassica napus]
Length=581

 Score =   348 bits (893),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNA+ EV++I RAQTLIA+
Sbjct  295  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPGAATMNAIHEVYKIGRAQTLIAL  354

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+A PYDHW   +NRIGFV +YSLT
Sbjct  355  CSTVPGYWFTVAFIDIMGRFAIQLMGFFFMTVFMFAIAFPYDHWIKPDNRIGFVIIYSLT  414

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ D  KTD
Sbjct  415  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDKTKTD  474

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG +NF+GM+ T LVPESKGKSL
Sbjct  475  AGYPPGIGVKNSLIMLGVVNFVGMLMTFLVPESKGKSL  512



>ref|XP_010442032.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Camelina 
sativa]
 ref|XP_010481871.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Camelina 
sativa]
Length=524

 Score =   347 bits (889),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL LLG TSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+ EVF+I RAQTLIA+
Sbjct  293  HGLPLLGCTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKADTMNAIHEVFKIGRAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+A PY+HW   +NRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVAFIDIMGRFAIQLMGFFFMTVFMFAIAFPYNHWIKPDNRIGFVIMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAA GKAGAIVGAFGFLYAAQ+ DP KTD
Sbjct  413  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAATGKAGAIVGAFGFLYAAQSQDPKKTD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INF+GM+FT LVPE KGKSL
Sbjct  473  AGYPPGIGVKNSLIMLGVINFVGMLFTFLVPEPKGKSL  510



>ref|NP_199151.1| phosphate transporter Pht1;2 [Arabidopsis thaliana]
 ref|NP_001190462.1| phosphate transporter Pht1;2 [Arabidopsis thaliana]
 sp|Q96243.2|PHT12_ARATH RecName: Full=Probable inorganic phosphate transporter 1-2; Short=AtPht1;2; 
AltName: Full=H(+)/Pi cotransporter [Arabidopsis 
thaliana]
 dbj|BAA24282.1| inorganic phosphate transporter [Arabidopsis thaliana]
 dbj|BAA97416.1| inorganic phosphate transporter [Arabidopsis thaliana]
 gb|AED94950.1| phosphate transporter Pht1;2 [Arabidopsis thaliana]
 gb|AED94951.1| phosphate transporter Pht1;2 [Arabidopsis thaliana]
Length=524

 Score =   346 bits (888),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 194/218 (89%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNA  EVFRIARAQTLIA+
Sbjct  293  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAATMNATHEVFRIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRF IQL GFF MTVFMFA+A PY+HW   ENRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVAFIDTIGRFKIQLNGFFMMTVFMFAIAFPYNHWIKPENRIGFVVMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAAAGKAGAI+GAFGFLYAAQN D AK D
Sbjct  413  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAAAGKAGAIIGAFGFLYAAQNQDKAKVD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL+VLG +NF+GM+FT LVPE KGKSL
Sbjct  473  AGYPPGIGVKNSLIVLGVLNFIGMLFTFLVPEPKGKSL  510



>gb|EPS62255.1| hypothetical protein M569_12534, partial [Genlisea aurea]
Length=529

 Score =   346 bits (888),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 179/218 (82%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HG HLLGT +TW LLDIAFYSQ LFQKDIF A+GWIP  +TMNA++EV+ IARAQTLIA+
Sbjct  298  HGFHLLGTATTWLLLDIAFYSQNLFQKDIFSAVGWIPPAKTMNAIQEVYTIARAQTLIAL  357

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALID  GRFAIQLMGFFFMTVFMFALA+PY+HWT ++NRIGFV +YSLT
Sbjct  358  CSTVPGYWFTVALIDVVGRFAIQLMGFFFMTVFMFALALPYNHWTKRDNRIGFVVIYSLT  417

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGK GAI+GAFGFLY AQ+ DP KTD
Sbjct  418  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKLGAIIGAFGFLYLAQSPDPKKTD  477

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL+ LG IN LGM FT LVPE KGKSL
Sbjct  478  AGYPPGIGVKNSLIALGVINLLGMAFTFLVPEPKGKSL  515



>ref|NP_001234043.1| inorganic phosphate transporter [Solanum lycopersicum]
 ref|XP_004234039.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Solanum 
lycopersicum]
 gb|AAB82147.1| inorganic phosphate transporter [Solanum lycopersicum]
Length=528

 Score =   346 bits (888),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL GT STWFLLDIAFYSQ LFQKD+F A+GWIP   TMNAV+EV++IARAQTLIA+
Sbjct  299  HGLHLFGTCSTWFLLDIAFYSQNLFQKDVFSAVGWIPKAPTMNAVQEVYKIARAQTLIAL  358

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+AIPY HWT + NRIGF+ MYSLT
Sbjct  359  CSTVPGYWFTVAFIDIIGRFAIQLMGFFFMTVFMFAIAIPYHHWTLEANRIGFIVMYSLT  418

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGA+GFLYAAQ+ DP KTD
Sbjct  419  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAYGFLYAAQSKDPNKTD  478

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIG++NSL+VLGCIN LGM+ T  VPE KGKSL
Sbjct  479  AGYPAGIGIKNSLIVLGCINALGMLCTFCVPEPKGKSL  516



>ref|NP_199150.1| putative inorganic phosphate transporter 1-3 [Arabidopsis thaliana]
 sp|O48639.1|PHT13_ARATH RecName: Full=Probable inorganic phosphate transporter 1-3; Short=AtPht1;3; 
AltName: Full=H(+)/Pi cotransporter [Arabidopsis 
thaliana]
 dbj|BAA24281.1| inorganic phosphate transporter [Arabidopsis thaliana]
 dbj|BAA97415.1| inorganic phosphate transporter [Arabidopsis thaliana]
 gb|AED94949.1| putative inorganic phosphate transporter 1-3 [Arabidopsis thaliana]
Length=521

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 195/218 (89%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNA+ EVF+IARAQTLIA+
Sbjct  293  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAATMNAIHEVFKIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFF MTVFMFA+A PY+HW   +NRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVAFIDIIGRFAIQLMGFFMMTVFMFAIAFPYNHWILPDNRIGFVVMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAA GKAGAIVGAFGFLYAAQ  D  KTD
Sbjct  413  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAATGKAGAIVGAFGFLYAAQPQDKTKTD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INF+GM+FT LVPE KGKSL
Sbjct  473  AGYPPGIGVKNSLIMLGVINFVGMLFTFLVPEPKGKSL  510



>ref|XP_003590043.1| Inorganic phosphate transporter 1-1 [Medicago truncatula]
 gb|AAB81347.1| phosphate transporter [Medicago truncatula]
 gb|AES60294.1| high affinity inorganic phosphate transporter [Medicago truncatula]
Length=533

 Score =   346 bits (888),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL L GT STWFLLDIAFYSQ LFQKDIF AIGWIP  + MNA+ EV++IARAQTLIA+
Sbjct  294  HGLALFGTCSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKEMNAIHEVYKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPYDHW+ +ENRIGFV +YSLT
Sbjct  354  CSTVPGYWFTVAFIDHMGRFAIQMMGFFFMTVFMFALAIPYDHWSKEENRIGFVVIYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ DP KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDPTKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYP GIG++NSL++LG INF+GM+ TLLVPESKGKSL
Sbjct  474  KGYPTGIGIKNSLIMLGVINFVGMLCTLLVPESKGKSL  511



>gb|AAB69122.1| putative proton/phosphate cotransporter [Arabidopsis thaliana]
Length=521

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 195/218 (89%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNA+ EVF+IARAQTLIA+
Sbjct  293  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAATMNAIHEVFKIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFF MTVFMFA+A PY+HW   +NRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVAFIDIIGRFAIQLMGFFMMTVFMFAIAFPYNHWILPDNRIGFVVMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAA GKAGAIVGAFGFLYAAQ  D  KTD
Sbjct  413  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAATGKAGAIVGAFGFLYAAQPQDKTKTD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INF+GM+FT LVPE KGKSL
Sbjct  473  AGYPPGIGVKNSLIMLGVINFVGMLFTFLVPEPKGKSL  510



>gb|AIU41747.1| phosphorus transporter PT2 [Lycium barbarum]
Length=529

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 179/218 (82%), Positives = 195/218 (89%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HG+HL GT STWFLLDIAFYSQ LFQKD+F AIGWIP   TMNAV+EV++I+RAQTLIA+
Sbjct  297  HGMHLFGTCSTWFLLDIAFYSQNLFQKDVFSAIGWIPPAATMNAVQEVYKISRAQTLIAL  356

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQL+GFFFMTVFMFA+A+PY HWT KEN IGFV MYSLT
Sbjct  357  CSTVPGYWFTVAFIDIIGRFAIQLIGFFFMTVFMFAIALPYHHWTLKENHIGFVVMYSLT  416

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVG +GFLYAAQN DP KTD
Sbjct  417  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGVYGFLYAAQNKDPTKTD  476

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIG++NSL+VLGCIN LGM+ T  VPE KGKSL
Sbjct  477  AGYPAGIGIKNSLIVLGCINALGMICTFCVPEPKGKSL  514



>gb|AIY53215.1| phosphate transporter [Manihot esculenta]
Length=534

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 199/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HG+HLLGTT  WFLLDIA+YS  LFQKDIF AIGWIP  +TMNA+ EV+ IARAQTLIA+
Sbjct  294  HGVHLLGTTVCWFLLDIAYYSSNLFQKDIFSAIGWIPPAQTMNAIHEVYVIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            C TVPGYWFTVALID+ GRF IQ+MGFFFMTVFMFALAIPY HWT ++NRIGF+ MYSLT
Sbjct  354  CGTVPGYWFTVALIDRIGRFFIQVMGFFFMTVFMFALAIPYHHWTLRDNRIGFLIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA GKAGAIVG+FGFLYAAQ+TDPAKTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAACGKAGAIVGSFGFLYAAQSTDPAKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+NSL+VLG INF G++FTLLVPESKGKSL
Sbjct  474  AGYPTGIGVKNSLIVLGVINFFGILFTLLVPESKGKSL  511



>ref|XP_002863661.1| hypothetical protein ARALYDRAFT_494664 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39920.1| hypothetical protein ARALYDRAFT_494664 [Arabidopsis lyrata subsp. 
lyrata]
Length=540

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP P TMNA  EVFRIARAQTLIA+
Sbjct  304  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKPATMNATHEVFRIARAQTLIAL  363

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ MGFF MTVFMFA+A PY+HWT  ENRIGFV MY+LT
Sbjct  364  CSTVPGYWFTVAFIDIIGRFAIQPMGFFMMTVFMFAIAFPYNHWTKPENRIGFVVMYALT  423

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARL STCHG+SAAAGKAGAI+GAFGFLYAAQ+ D AK D
Sbjct  424  FFFANFGPNATTFIVPAEIFPARLWSTCHGISAAAGKAGAIIGAFGFLYAAQSQDKAKVD  483

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL+VLG +NF+GM+FT LVPE KGKSL
Sbjct  484  AGYPPGIGVKNSLIVLGVLNFIGMLFTFLVPEPKGKSL  521



>dbj|BAB21562.1| phosphate transporter [Nicotiana tabacum]
Length=523

 Score =   345 bits (886),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL GT STWFLLDIAFYSQ LFQKD+F A+GWIP  +TMNAV+EV++IARAQTLIA+
Sbjct  295  HGLHLFGTCSTWFLLDIAFYSQNLFQKDVFSAVGWIPAAKTMNAVQEVYKIARAQTLIAL  354

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
             STVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+AIPY+HWT K+N IGFV MY+LT
Sbjct  355  LSTVPGYWFTVAFIDIVGRFAIQLMGFFFMTVFMFAIAIPYEHWTKKDNHIGFVAMYALT  414

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGA+GFLYAAQ+ DP KTD
Sbjct  415  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAYGFLYAAQSKDPTKTD  474

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIG++NSLL LG IN LGMV T  VPESKGKSL
Sbjct  475  AGYPAGIGIKNSLLALGAINALGMVCTFCVPESKGKSL  512



>ref|XP_009101789.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Brassica 
rapa]
Length=526

 Score =   345 bits (886),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL LLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNA+ EV++I RAQTLIA+
Sbjct  295  HGLPLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPGAATMNAIHEVYKIGRAQTLIAL  354

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+A PYDHW   +NRIGFV +YSLT
Sbjct  355  CSTVPGYWFTVAFIDIMGRFAIQLMGFFFMTVFMFAIAFPYDHWIKPDNRIGFVIIYSLT  414

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ D  KTD
Sbjct  415  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDKTKTD  474

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INF+GM+ T LVPESKGKSL
Sbjct  475  AGYPPGIGVKNSLIMLGVINFVGMLMTFLVPESKGKSL  512



>ref|XP_009765015.1| PREDICTED: probable inorganic phosphate transporter 1-7 [Nicotiana 
sylvestris]
Length=525

 Score =   345 bits (886),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL GT STWFLLDIAFYSQ LFQKD+F A+GWIP  +TMNAV+EV++IARAQTLIA+
Sbjct  296  HGLHLFGTCSTWFLLDIAFYSQNLFQKDVFSAVGWIPAAKTMNAVQEVYKIARAQTLIAL  355

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
             STVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+AIPY+HWT K+N IGFV MY+LT
Sbjct  356  LSTVPGYWFTVAFIDIVGRFAIQLMGFFFMTVFMFAIAIPYEHWTKKDNHIGFVAMYALT  415

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGA+GFLYAAQ+ DP KTD
Sbjct  416  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAYGFLYAAQSKDPTKTD  475

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIG++NSLL LG IN LGMV T  VPESKGKSL
Sbjct  476  AGYPAGIGIKNSLLALGAINALGMVCTFCVPESKGKSL  513



>ref|XP_006356062.1| PREDICTED: probable inorganic phosphate transporter 1-3-like 
[Solanum tuberosum]
Length=526

 Score =   345 bits (886),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL GT STWFLLDIAFYSQ LFQKD+F A+GWIP   TMNAV+EV++IARAQTLIA+
Sbjct  296  HGLHLFGTCSTWFLLDIAFYSQNLFQKDVFSAVGWIPKAPTMNAVQEVYKIARAQTLIAL  355

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+AIPY HWT + NRIGF+ MYSLT
Sbjct  356  CSTVPGYWFTVAFIDIIGRFAIQLMGFFFMTVFMFAIAIPYHHWTLEANRIGFIVMYSLT  415

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGA+GFLYAAQ+ DP KTD
Sbjct  416  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAYGFLYAAQSKDPMKTD  475

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIG++NSL+VLG IN LGMV T  VPESKGKSL
Sbjct  476  AGYPAGIGIKNSLIVLGFINALGMVCTFCVPESKGKSL  513



>ref|XP_006489740.1| PREDICTED: probable inorganic phosphate transporter 1-7-like 
isoform X1 [Citrus sinensis]
 ref|XP_006489741.1| PREDICTED: probable inorganic phosphate transporter 1-7-like 
isoform X2 [Citrus sinensis]
Length=537

 Score =   345 bits (886),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL GTTSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNA+ EV++IARAQTLIA+
Sbjct  294  HGLHLFGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAATMNAIHEVYKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPY HWT K NRIGFV +YSLT
Sbjct  354  CSTVPGYWFTVAFIDYMGRFAIQMMGFFFMTVFMFALAIPYHHWTLKPNRIGFVIIYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ DP K D
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDPTKRD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+NSL++LG +NF+GM+ TL VPESKG+SL
Sbjct  474  AGYPAGIGVKNSLIMLGVVNFVGMICTLCVPESKGRSL  511



>gb|AAL49927.1| putative phosphate transporter protein [Arabidopsis thaliana]
Length=524

 Score =   345 bits (885),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 194/218 (89%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNA  EVFRIARAQTLIA+
Sbjct  293  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAATMNATHEVFRIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRF IQL GFF MTVFMFA+A PY+HW   ENRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVAFIDTIGRFKIQLNGFFMMTVFMFAIAFPYNHWIKPENRIGFVVMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ D AK D
Sbjct  413  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSQDKAKVD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG +NF+GM+FT LVPE KGKSL
Sbjct  473  AGYPPGIGVKNSLIMLGVLNFIGMLFTFLVPEPKGKSL  510



>ref|NP_199149.1| inorganic phosphate transporter 1-1 [Arabidopsis thaliana]
 sp|Q8VYM2.2|PHT11_ARATH RecName: Full=Inorganic phosphate transporter 1-1; Short=AtPht1;1; 
AltName: Full=H(+)/Pi cotransporter [Arabidopsis thaliana]
 gb|AAB17265.1| phosphate transporter [Arabidopsis thaliana]
 dbj|BAA21503.1| inorganic phosphate transporter [Arabidopsis thaliana]
 dbj|BAA21504.1| inorganic phosphate transporter [Arabidopsis thaliana]
 dbj|BAA97414.1| phosphate transporter [Arabidopsis thaliana]
 gb|AED94948.1| inorganic phosphate transporter 1-1 [Arabidopsis thaliana]
Length=524

 Score =   345 bits (885),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 194/218 (89%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNA  EVFRIARAQTLIA+
Sbjct  293  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAATMNATHEVFRIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRF IQL GFF MTVFMFA+A PY+HW   ENRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVAFIDTIGRFKIQLNGFFMMTVFMFAIAFPYNHWIKPENRIGFVVMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ D AK D
Sbjct  413  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSQDKAKVD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG +NF+GM+FT LVPE KGKSL
Sbjct  473  AGYPPGIGVKNSLIMLGVLNFIGMLFTFLVPEPKGKSL  510



>gb|ABK63960.1| PT2 [Capsicum frutescens]
Length=526

 Score =   345 bits (885),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 179/218 (82%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HG+HL GT STWFLLDIAFYSQ LFQ+D+F AIGWIP   TMNAV+EV++I+RAQTLIA+
Sbjct  297  HGVHLFGTCSTWFLLDIAFYSQNLFQRDVFSAIGWIPPAATMNAVQEVYKISRAQTLIAL  356

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYW TVALID  GRF+IQL+GFFFMTVFMFA+AIPY HWT K+NRIGFV MYSLT
Sbjct  357  CSTVPGYWVTVALIDIIGRFSIQLIGFFFMTVFMFAIAIPYHHWTLKDNRIGFVIMYSLT  416

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGA+GFLYAAQN DP KTD
Sbjct  417  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAYGFLYAAQNKDPKKTD  476

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIG++NSL+VLGCIN LGM+ T  VPE KGKSL
Sbjct  477  AGYPTGIGIKNSLIVLGCINALGMICTFCVPEPKGKSL  514



>ref|XP_003590037.1| Inorganic phosphate transporter 1-1 [Medicago truncatula]
 gb|ABM69110.1| phosphate transporter 3 [Medicago truncatula]
 gb|AES60288.1| high affinity inorganic phosphate transporter [Medicago truncatula]
Length=533

 Score =   345 bits (885),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HG  L GT STWFLLDIAFYSQ LFQKDIF AIGWIP  + MNA+ EV++IARAQTLIA+
Sbjct  294  HGWALFGTCSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKEMNAIHEVYKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMFALAIPYDHW+ +ENRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDHMGRFAIQMMGFFFMTVFMFALAIPYDHWSKEENRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ DP KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDPTKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYP GIG++NSL++LG INF+GM+ TLLVPESKGKSL
Sbjct  474  KGYPTGIGIKNSLIMLGVINFVGMLCTLLVPESKGKSL  511



>ref|XP_010442026.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Camelina 
sativa]
Length=535

 Score =   345 bits (885),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL LLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNA+ EV++I RAQTLIA+
Sbjct  295  HGLPLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAATMNAIHEVYKIGRAQTLIAL  354

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+A PYDHW   +NRIGFV +YSLT
Sbjct  355  CSTVPGYWFTVAFIDTMGRFAIQLMGFFFMTVFMFAIAFPYDHWIKPDNRIGFVIIYSLT  414

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ D  KTD
Sbjct  415  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDKTKTD  474

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INF+GM+ T LVPESKGKSL
Sbjct  475  AGYPPGIGVKNSLIMLGVINFVGMIMTFLVPESKGKSL  512



>ref|XP_002300153.2| inorganic phosphate transporter family protein [Populus trichocarpa]
 gb|EEE84958.2| inorganic phosphate transporter family protein [Populus trichocarpa]
Length=535

 Score =   345 bits (885),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT+  WFLLDI +YS  LFQKDIF +IGWIP  +TMNA+ EV+ +ARAQTLIA+
Sbjct  291  HGLHLLGTSVCWFLLDIGYYSSNLFQKDIFSSIGWIPPAKTMNAIHEVYLVARAQTLIAL  350

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            C TVPGYWFTVALID  GRFAIQLMGFFFMTVFMFALAIPY HWT K NRIGF+ MYSLT
Sbjct  351  CGTVPGYWFTVALIDYIGRFAIQLMGFFFMTVFMFALAIPYHHWTKKSNRIGFLVMYSLT  410

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+TDP +TD
Sbjct  411  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSTDPTQTD  470

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL+VLG +NF G++FTLLVPE+KGKSL
Sbjct  471  AGYPPGIGVKNSLIVLGGVNFFGVLFTLLVPEAKGKSL  508



>ref|XP_009113997.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Brassica 
rapa]
 ref|XP_009113998.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Brassica 
rapa]
Length=521

 Score =   344 bits (883),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 193/218 (89%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL LLG TSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNAV EVF+IARAQTLIA+
Sbjct  293  HGLPLLGCTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKASTMNAVHEVFKIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFF MTVFMFA+A PYDHW   +NRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVAFIDIMGRFAIQLMGFFMMTVFMFAIAFPYDHWIKPDNRIGFVAMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAA GKAGAIVGAFGFLYAAQ  D  KTD
Sbjct  413  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAATGKAGAIVGAFGFLYAAQPQDKTKTD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INF+GM+FT LVPE KGKSL
Sbjct  473  AGYPPGIGVKNSLIMLGVINFVGMLFTFLVPEPKGKSL  510



>emb|CDY22352.1| BnaA06g36740D [Brassica napus]
Length=535

 Score =   345 bits (884),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL LLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNA+ EV++I RAQTLIA+
Sbjct  295  HGLPLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPAAATMNAIHEVYKIGRAQTLIAL  354

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+A PYDHW   +NRIGFV +YSLT
Sbjct  355  CSTVPGYWFTVAFIDIMGRFAIQLMGFFFMTVFMFAIAFPYDHWIKPDNRIGFVIIYSLT  414

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ D  KTD
Sbjct  415  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDKTKTD  474

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INF+GM+ T LVPESKGKSL
Sbjct  475  AGYPPGIGVKNSLIMLGVINFVGMLMTFLVPESKGKSL  512



>ref|XP_006282074.1| hypothetical protein CARUB_v10028320mg [Capsella rubella]
 gb|EOA14972.1| hypothetical protein CARUB_v10028320mg [Capsella rubella]
Length=517

 Score =   344 bits (883),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 195/218 (89%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL LLG TSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNA+ EVF+I RAQTLIA+
Sbjct  289  HGLPLLGCTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKADTMNAIHEVFKIGRAQTLIAL  348

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFF MTVFMFA+A PY+HW   +NRIGFV MYSLT
Sbjct  349  CSTVPGYWFTVAFIDIMGRFAIQLMGFFMMTVFMFAIAFPYNHWIKPDNRIGFVIMYSLT  408

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAA GKAGAIVGAFGFLYAAQ+ DP KTD
Sbjct  409  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAATGKAGAIVGAFGFLYAAQSQDPTKTD  468

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INF+GM+FT LVPE KGKSL
Sbjct  469  AGYPPGIGVKNSLIMLGVINFVGMLFTFLVPEPKGKSL  506



>emb|CAA68945.1| phosphate transporter [Arabidopsis thaliana]
Length=524

 Score =   344 bits (883),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 193/218 (89%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNA  EVFRIARAQTLIA+
Sbjct  293  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAATMNATHEVFRIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRF IQL GFF MTVFMFA+A PY+HW   ENRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVAFIDTIGRFKIQLNGFFMMTVFMFAIAFPYNHWIKPENRIGFVVMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFAN GPNATTF+VPAEIFPARLRSTCHG+SAAAGKAGAI+GAFGFLYAAQN D AK D
Sbjct  413  FFFANLGPNATTFIVPAEIFPARLRSTCHGISAAAGKAGAIIGAFGFLYAAQNQDKAKVD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL+VLG +NF+GM+FT LVPE KGKSL
Sbjct  473  AGYPPGIGVKNSLIVLGVLNFIGMLFTFLVPEPKGKSL  510



>ref|XP_002518044.1| inorganic phosphate transporter, putative [Ricinus communis]
 gb|EEF44177.1| inorganic phosphate transporter, putative [Ricinus communis]
Length=534

 Score =   345 bits (884),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT  WFLLDIA+YS  LFQKDIF AIGWIP  +TMNA+ EVF IARAQTLIA+
Sbjct  294  HGLHLLGTTVCWFLLDIAYYSSNLFQKDIFSAIGWIPPAQTMNAIHEVFVIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            C TVPGYWFTVA ID+ GRF IQLMGFFFMTVFMFALAIPY HWT K+NRIGF+ MYSLT
Sbjct  354  CGTVPGYWFTVAFIDRIGRFIIQLMGFFFMTVFMFALAIPYHHWTLKDNRIGFLIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA GKAGAIVG+FGFLYAAQ+TDP KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAACGKAGAIVGSFGFLYAAQSTDPTKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIG++NSL+ LG INF G++FTLLVPESKGKSL
Sbjct  474  AGYPTGIGMKNSLIALGVINFFGILFTLLVPESKGKSL  511



>ref|XP_006282331.1| hypothetical protein CARUB_v10028623mg [Capsella rubella]
 gb|EOA15229.1| hypothetical protein CARUB_v10028623mg [Capsella rubella]
Length=535

 Score =   345 bits (884),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL LLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNA+ EV++I RAQTLIA+
Sbjct  295  HGLPLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPRAATMNAIHEVYKIGRAQTLIAL  354

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+A PY+HW   +NRIGFV +YSLT
Sbjct  355  CSTVPGYWFTVAFIDIMGRFAIQLMGFFFMTVFMFAIAFPYEHWIKPDNRIGFVIIYSLT  414

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ D  KTD
Sbjct  415  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDKTKTD  474

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INF+GM+ T LVPESKGKSL
Sbjct  475  AGYPPGIGVKNSLIMLGVINFVGMIMTFLVPESKGKSL  512



>ref|XP_010494317.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Camelina 
sativa]
Length=517

 Score =   344 bits (882),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 195/218 (89%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL LLG TSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNA+ EVF+IARAQTLIA+
Sbjct  289  HGLPLLGCTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAGTMNAIHEVFKIARAQTLIAL  348

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+A PY+HW   +NRIGFV MYSLT
Sbjct  349  CSTVPGYWFTVAFIDIMGRFAIQLMGFFFMTVFMFAIAFPYNHWIKPDNRIGFVIMYSLT  408

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAA GKAGAIVGAFGFLYAAQ+ D  KTD
Sbjct  409  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAATGKAGAIVGAFGFLYAAQSQDATKTD  468

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INF+GM+FT LVPE KGKSL
Sbjct  469  AGYPPGIGVKNSLIMLGVINFIGMLFTFLVPEPKGKSL  506



>emb|CDO99226.1| unnamed protein product [Coffea canephora]
Length=538

 Score =   344 bits (883),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKD+   IGWIP   TM+A EE+F+IARAQTLIA+
Sbjct  295  HGLHLLGTTSTWFLLDIAFYSQNLFQKDVLTGIGWIPPAATMSAGEELFKIARAQTLIAL  354

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALID  GRFAIQLMGFFFMTVFMFALAIPY+HWT K +RIGFV MYSLT
Sbjct  355  CSTVPGYWFTVALIDVIGRFAIQLMGFFFMTVFMFALAIPYNHWTKKAHRIGFVVMYSLT  414

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFF+NFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYA+Q+ DP KTD
Sbjct  415  FFFSNFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYASQSKDPNKTD  474

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYP GIG++NSL+VL C+N LGM+FT LVPE KGKSL
Sbjct  475  PGYPTGIGMKNSLIVLACVNALGMLFTFLVPEPKGKSL  512



>ref|XP_009123889.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Brassica 
rapa]
Length=521

 Score =   344 bits (882),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 193/218 (89%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL LLG TSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNAV EVF+IARAQTLIA+
Sbjct  293  HGLPLLGCTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKASTMNAVHEVFKIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFF MTVFMFA+A PYDHW   +NRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVAFIDIIGRFAIQLMGFFMMTVFMFAIAFPYDHWIKPDNRIGFVVMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAA GKAGAIVGAFGFLYAAQ  D  KTD
Sbjct  413  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAATGKAGAIVGAFGFLYAAQPQDKTKTD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INF+GM+FT LVPE KGKSL
Sbjct  473  AGYPPGIGVKNSLIMLGVINFVGMLFTFLVPEPKGKSL  510



>ref|XP_009101790.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Brassica 
rapa]
 ref|XP_009101791.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Brassica 
rapa]
Length=522

 Score =   344 bits (882),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 193/218 (89%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL LLG TSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNAV EVF+IARAQTLIA+
Sbjct  293  HGLPLLGCTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKASTMNAVHEVFKIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFF MTVFMFA+A PYDHW   +NRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVAFIDIMGRFAIQLMGFFMMTVFMFAIAFPYDHWIKPDNRIGFVVMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAA GKAGAIVGAFGFLYAAQ  D  KTD
Sbjct  413  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAATGKAGAIVGAFGFLYAAQPQDKTKTD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INF+GM+FT LVPE KGKSL
Sbjct  473  AGYPPGIGVKNSLIMLGVINFVGMLFTFLVPEPKGKSL  510



>emb|CAA67396.1| inorganic phosphate transporter 2 [Solanum tuberosum]
Length=527

 Score =   344 bits (882),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL GT STWFLLDIAFYSQ LFQKD+F A+GWIP   TMNAV+E+++IARAQTLIA+
Sbjct  297  HGLHLFGTCSTWFLLDIAFYSQNLFQKDVFSAVGWIPKAPTMNAVQELYKIARAQTLIAL  356

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+AIPY HWT + NRIGF+ MYSLT
Sbjct  357  CSTVPGYWFTVAFIDIIGRFAIQLMGFFFMTVFMFAIAIPYHHWTLEANRIGFIVMYSLT  416

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGA+GFLYAAQ+ DP KTD
Sbjct  417  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAYGFLYAAQSKDPMKTD  476

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIG++NSL+VLG IN LGMV T  VPESKGKSL
Sbjct  477  AGYPAGIGIKNSLIVLGFINALGMVCTFCVPESKGKSL  514



>emb|CDP10457.1| unnamed protein product [Coffea canephora]
Length=305

 Score =   336 bits (862),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 176/218 (81%), Positives = 193/218 (89%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  +TMN++ EVF IA+AQTLIA+
Sbjct  59   HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPAAKTMNSINEVFTIAKAQTLIAL  118

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVALID+ GRFAIQL+GF  MT FMFALA PYDHWT   + I FV MYSLT
Sbjct  119  CSTVPGYWFTVALIDRMGRFAIQLVGFTMMTAFMFALAFPYDHWTQPGHHIPFVVMYSLT  178

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GA+VGAFGFLY AQ+ D AKTD
Sbjct  179  FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQSPDKAKTD  238

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGY PGIGV+NSL+VLG +NFLG++FT LVPESKGKSL
Sbjct  239  AGYQPGIGVKNSLIVLGAVNFLGLLFTFLVPESKGKSL  276



>gb|ABP52096.1| phosphate transporter [Phaseolus vulgaris]
Length=531

 Score =   344 bits (882),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL+GTT+TWFLLD AFYSQ LFQKDIF AIGWIP  + MNA+ EV++IARAQTLIA+
Sbjct  293  HGLHLVGTTTTWFLLDKAFYSQNLFQKDIFSAIGWIPPAQEMNAIHEVYKIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTV LID  GRFAIQLMGFFFMTVFMFALAIPYDHWT K NRIGFV +YSLT
Sbjct  353  CSTVPGYWFTVFLIDHMGRFAIQLMGFFFMTVFMFALAIPYDHWTKKANRIGFVVIYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFAN GPN+TT VVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ DP+KTD
Sbjct  413  FFFANSGPNSTTLVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDPSKTD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGY  GIG++NSL++LG IN  GMVFTLLVPESKGKSL
Sbjct  473  AGYSTGIGIKNSLIMLGVINLFGMVFTLLVPESKGKSL  510



>ref|XP_006443849.1| hypothetical protein CICLE_v100196272mg [Citrus clementina]
 ref|XP_006479549.1| PREDICTED: inorganic phosphate transporter 1-4-like [Citrus sinensis]
 gb|ESR57089.1| hypothetical protein CICLE_v100196272mg [Citrus clementina]
 gb|KDO60512.1| hypothetical protein CISIN_1g046667mg [Citrus sinensis]
Length=540

 Score =   344 bits (882),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 197/249 (79%), Positives = 218/249 (88%), Gaps = 2/249 (1%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF A+GWIP+ +TMNA++EV++IARAQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAVGWIPSAKTMNAIQEVYKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA IDK GRFAIQ+MGFFFMTVFMFALAIPYDHWTHK NR+GFV +YSLT
Sbjct  354  CSTVPGYWFTVAFIDKIGRFAIQMMGFFFMTVFMFALAIPYDHWTHKSNRLGFVIIYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GK GAIVGAFGFLY AQ+ D  KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKLGAIVGAFGFLYLAQSKDKTKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
            AGYPPGIGV+NSL+VLG +N LG++FT LVPESKGKSLEEMS EN+ E        R   
Sbjct  474  AGYPPGIGVKNSLIVLGVVNLLGLLFTFLVPESKGKSLEEMSGENQDEGAQDME--RDPS  531

Query  722  GHEIRTVPV  748
             +  RTVPV
Sbjct  532  SNNSRTVPV  540



>gb|AHL69789.1| phosphate transporter [Vernicia fordii]
Length=533

 Score =   343 bits (881),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT  WFLLDIA+YS  LFQKDIF AIGWIP  ETMNA+ EVF IA+AQTLIA+
Sbjct  294  HGLHLLGTTVCWFLLDIAYYSSNLFQKDIFSAIGWIPPAETMNAIHEVFVIAKAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            C TVPGYWFTVA ID+ GRF IQLMGFFFMTVFMFALAIPY HWT K+NRIGF+ MYSLT
Sbjct  354  CGTVPGYWFTVAFIDRIGRFIIQLMGFFFMTVFMFALAIPYHHWTLKDNRIGFLIMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA GKAGAIVGAFGFLYAAQ+TDPAKTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAACGKAGAIVGAFGFLYAAQSTDPAKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+NSL+VLG  +F G++ TLLVPESKGKSL
Sbjct  474  AGYPTGIGVKNSLIVLGVTSFFGILLTLLVPESKGKSL  511



>ref|XP_008356174.1| PREDICTED: uncharacterized protein LOC103419864 [Malus domestica]
Length=1016

 Score =   356 bits (913),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 199/249 (80%), Positives = 215/249 (86%), Gaps = 1/249 (0%)
 Frame = +2

Query  2     HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
             HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP  ETMNA+EEV+RIARAQTLIA+
Sbjct  768   HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAETMNAIEEVYRIARAQTLIAL  827

Query  182   CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
             C TVPGYWFTVA ID+ GRFAIQLMGFFFMTVFMFALAIPY HWTHK+NRIGFV +Y LT
Sbjct  828   CXTVPGYWFTVAFIDRIGRFAIQLMGFFFMTVFMFALAIPYXHWTHKDNRIGFVVIYXLT  887

Query  362   FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
             FFFANFGPNATTFVVPAEIFPAR RSTCHG+SAA+GK GAIVG FGFLY AQN D  KTD
Sbjct  888   FFFANFGPNATTFVVPAEIFPARFRSTCHGISAASGKLGAIVGXFGFLYLAQNKDKNKTD  947

Query  542   AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSLeemsrenegeegsveteMRTQG  721
             AGY PGIGV+NSLLVLG +NFLG++FT LVPES G+SLEEMS ENE E  +   E+  Q 
Sbjct  948   AGYXPGIGVKNSLLVLGVVNFLGILFTFLVPESNGRSLEEMSGENEEESETGTVELE-QS  1006

Query  722   GHEIRTVPV  748
              +  RTVPV
Sbjct  1007  XYNNRTVPV  1015



>gb|AAB81346.1| phosphate transporter [Medicago truncatula]
Length=537

 Score =   343 bits (881),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 179/218 (82%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL L GT STWFLLDIAFYSQ LFQKDIF AIGWIP  + MNA+ EV++IARAQTLIA+
Sbjct  294  HGLALFGTCSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKEMNAIHEVYKIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQ+MGFFFMTVFMF LAIPYDHW+ +ENRIGFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDHMGRFAIQMMGFFFMTVFMFGLAIPYDHWSKEENRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFF+NFGPNA TFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ DP KTD
Sbjct  414  FFFSNFGPNAATFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDPTKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYP GIG++NSL++LG INF+GM+ TLLVPESKGKSL
Sbjct  474  KGYPTGIGIKNSLIMLGVINFVGMLCTLLVPESKGKSL  511



>ref|XP_010494318.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Camelina 
sativa]
 ref|XP_010494319.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Camelina 
sativa]
Length=517

 Score =   342 bits (878),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 195/218 (89%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL LLG TSTWFLLDIAFYSQ LFQKDIF +IGWIP   TMNA+ EVF+IARAQTLIA+
Sbjct  289  HGLPLLGCTSTWFLLDIAFYSQNLFQKDIFSSIGWIPKAGTMNAIHEVFKIARAQTLIAL  348

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+A PY+HW   +NRIGFV MYSLT
Sbjct  349  CSTVPGYWFTVAFIDIMGRFAIQLMGFFFMTVFMFAIAFPYNHWIKPDNRIGFVIMYSLT  408

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAA GKAGAIVGAFGFLYAAQ+ D  KTD
Sbjct  409  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAATGKAGAIVGAFGFLYAAQSQDATKTD  468

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INF+GM+FT LVPE KGKSL
Sbjct  469  AGYPPGIGVKNSLIMLGVINFIGMLFTFLVPEPKGKSL  506



>emb|CAA68946.1| phosphate transporter [Arabidopsis thaliana]
Length=524

 Score =   343 bits (879),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 193/218 (89%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNA  EVFRIARAQTLIA+
Sbjct  293  HGLHLLGTTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAATMNATHEVFRIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRF IQL GFF MTVFMFA+A PY+HW   ENRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVAFIDTIGRFKIQLNGFFMMTVFMFAIAFPYNHWIKPENRIGFVVMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ D  K D
Sbjct  413  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSQDKPKVD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG +NF+GM+FT LVPE KGKSL
Sbjct  473  AGYPPGIGVKNSLIMLGVLNFIGMLFTFLVPEPKGKSL  510



>ref|XP_006356063.1| PREDICTED: probable inorganic phosphate transporter 1-3-like 
[Solanum tuberosum]
Length=525

 Score =   343 bits (879),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 194/218 (89%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL GT STWFLLDIAFYSQ LFQKD+F A+GWIP   TMNAV+EV++IARAQTLIA+
Sbjct  296  HGLHLFGTCSTWFLLDIAFYSQNLFQKDVFSAVGWIPKAPTMNAVQEVYKIARAQTLIAL  355

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+AIPY HWT   NRIGF+ MYS T
Sbjct  356  CSTVPGYWFTVAFIDIIGRFAIQLMGFFFMTVFMFAIAIPYHHWTLDANRIGFIVMYSFT  415

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGA+GFLYAAQ+ DP KTD
Sbjct  416  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAYGFLYAAQSKDPTKTD  475

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIG++NSL+VLG IN LGMV T  VPESKGKSL
Sbjct  476  AGYPTGIGIKNSLIVLGFINALGMVCTFCVPESKGKSL  513



>ref|XP_006356064.1| PREDICTED: probable inorganic phosphate transporter 1-3-like 
[Solanum tuberosum]
Length=525

 Score =   342 bits (878),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 194/218 (89%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL GT STWFLLDIAFYSQ LFQKD+F A+GWIP   TMNAV+EV++IARAQTLIA+
Sbjct  296  HGLHLFGTCSTWFLLDIAFYSQNLFQKDVFSAVGWIPKAPTMNAVQEVYKIARAQTLIAL  355

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+AIPY HWT   NRIGF+ MYS T
Sbjct  356  CSTVPGYWFTVAFIDIIGRFAIQLMGFFFMTVFMFAIAIPYHHWTLDANRIGFIVMYSFT  415

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGA+GFLYAAQ+ DP KTD
Sbjct  416  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAYGFLYAAQSKDPTKTD  475

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIG++NSL+VLG IN LGMV T  VPESKGKSL
Sbjct  476  AGYPTGIGIKNSLIVLGFINALGMVCTFCVPESKGKSL  513



>ref|XP_011028798.1| PREDICTED: inorganic phosphate transporter 1-4 [Populus euphratica]
Length=523

 Score =   342 bits (878),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGT STWFLLDIAFYSQ LFQKDIF AIGWIP  +TMNAV+EV+RIARAQTLIA+
Sbjct  294  HGLHLLGTASTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKTMNAVQEVYRIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA IDK GRFAIQLMGFFFMTVFMFA+AIPY HWTH ENRIGFV MYS T
Sbjct  354  CSTVPGYWFTVAFIDKIGRFAIQLMGFFFMTVFMFAIAIPYKHWTHSENRIGFVVMYSFT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GK GAIVGAFGFLY AQN D AK D
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKLGAIVGAFGFLYLAQNQDKAKAD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGVRNSL+VLG +N LG++FT LVPESKGKSL
Sbjct  474  AGYPAGIGVRNSLIVLGVVNLLGLLFTFLVPESKGKSL  511



>ref|XP_011045612.1| PREDICTED: probable inorganic phosphate transporter 1-5 [Populus 
euphratica]
 ref|XP_011045613.1| PREDICTED: probable inorganic phosphate transporter 1-5 [Populus 
euphratica]
 ref|XP_011045614.1| PREDICTED: probable inorganic phosphate transporter 1-5 [Populus 
euphratica]
Length=535

 Score =   343 bits (879),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 179/218 (82%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL+GT+  WFLLDI +YS  LFQKDIF +IGWIP  +TMNA+ EV+ IARAQTLIA+
Sbjct  291  HGLHLVGTSVCWFLLDIGYYSSNLFQKDIFSSIGWIPPAKTMNAIHEVYLIARAQTLIAL  350

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            C TVPGYWFTVALID  GRFAIQLMGFFFMTVFMFALAIPY HWT K NRIGF+ MYSLT
Sbjct  351  CGTVPGYWFTVALIDYIGRFAIQLMGFFFMTVFMFALAIPYHHWTKKSNRIGFLIMYSLT  410

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+TDP +TD
Sbjct  411  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSTDPTQTD  470

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+ SL+VLG +NF G++FTLLVPE+KGKSL
Sbjct  471  AGYPPGIGVKKSLIVLGGVNFFGVLFTLLVPEAKGKSL  508



>gb|AFD10412.1| phosphate transporter protein, partial [Pisum sativum]
Length=478

 Score =   341 bits (874),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 180/213 (85%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL+GT STWFLLDIAFYSQ LFQKDIF AIGWIP    M+A+ EV++IARAQTLIA+
Sbjct  266  HGLHLIGTCSTWFLLDIAFYSQNLFQKDIFSAIGWIPPATEMSAIHEVYKIARAQTLIAL  325

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
             STVPGYWFTVALID  GRFAIQLMGFFFMTVFMFALAIPYDHW+HKENRIGFV MYSLT
Sbjct  326  FSTVPGYWFTVALIDYMGRFAIQLMGFFFMTVFMFALAIPYDHWSHKENRIGFVVMYSLT  385

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ DPAKT+
Sbjct  386  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDPAKTE  445

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPES  640
             GYP GIG++NSL++LG INF+GM+ TLLVPES
Sbjct  446  KGYPTGIGIKNSLIMLGVINFVGMLCTLLVPES  478



>ref|XP_011073523.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Sesamum 
indicum]
Length=538

 Score =   342 bits (878),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+TWFLLDIAFYS  LFQKDIF AIGWIP  + MNAV EVFR+A+AQTLIA+
Sbjct  294  HGLHLLGTTTTWFLLDIAFYSNNLFQKDIFSAIGWIPPAKEMNAVHEVFRVAKAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
             +TVPGYWFTV LID  GRFAIQLMGFFFMTVFMFALAIPYDHWT K+NRIGFV MYSLT
Sbjct  354  FATVPGYWFTVLLIDVIGRFAIQLMGFFFMTVFMFALAIPYDHWTIKKNRIGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ  DP+K D
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQPKDPSKRD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+ SL+VLGC+N LG++FT LVPE KGKSL
Sbjct  474  AGYPAGIGVKYSLVVLGCVNALGLLFTFLVPEPKGKSL  511



>ref|XP_009397891.1| PREDICTED: probable inorganic phosphate transporter 1-8 [Musa 
acuminata subsp. malaccensis]
Length=536

 Score =   342 bits (877),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 178/218 (82%), Positives = 194/218 (89%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HG+HL+GTT+TWFLLDIAFYSQ LFQKDIF +IGW+P+ +TMNA+EEVFRIARAQTLIA+
Sbjct  294  HGIHLVGTTTTWFLLDIAFYSQNLFQKDIFTSIGWLPDAKTMNAIEEVFRIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            C TVPGYWFTVALID  GRFAIQLMGFFFMTVFM  LAIPY HWT K N IGFV MY LT
Sbjct  354  CGTVPGYWFTVALIDTMGRFAIQLMGFFFMTVFMLGLAIPYHHWTTKGNHIGFVIMYGLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPN+TTF+VPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+ DPAK D
Sbjct  414  FFFANFGPNSTTFIVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSKDPAKRD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYP GIGVRN+L VL   N LG++FT LVPESKGKSL
Sbjct  474  KGYPAGIGVRNALFVLAASNLLGLIFTFLVPESKGKSL  511



>ref|XP_009773764.1| PREDICTED: inorganic phosphate transporter 1-4-like [Nicotiana 
sylvestris]
Length=542

 Score =   342 bits (877),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 194/218 (89%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIA+YSQ LFQKDIF AIGWIP  +TMNAVEEV++IARAQTLIA+
Sbjct  296  HGLHLLGTTSTWFLLDIAYYSQNLFQKDIFSAIGWIPAAKTMNAVEEVYKIARAQTLIAL  355

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTV LID+ GRF IQL+GF  MTVFMFALAIPY+HWTH  N IGFV +YSLT
Sbjct  356  CSTVPGYWFTVFLIDRIGRFTIQLLGFAMMTVFMFALAIPYNHWTHPGNHIGFVVLYSLT  415

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA+GK GA+VGAFGFLY AQ  D  K D
Sbjct  416  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAASGKLGAMVGAFGFLYLAQPQDKTKAD  475

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGVRNSL+VLG INFLG +FT LVPESKGKSL
Sbjct  476  AGYPAGIGVRNSLIVLGVINFLGTLFTFLVPESKGKSL  513



>ref|XP_009361891.1| PREDICTED: probable inorganic phosphate transporter 1-5 [Pyrus 
x bretschneideri]
Length=519

 Score =   341 bits (875),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 179/218 (82%), Positives = 200/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTT+T FL DIA+YSQ LFQKDIF AIGW+P  ETMNA+EE+++IARAQTLIA+
Sbjct  293  HGLHLLGTTTTRFLFDIAYYSQNLFQKDIFSAIGWLPAAETMNAIEELYKIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CS VPGYWFTVA ID+ GRF IQLMGFFFMTVFMFALAIPY HWT K NRIGFV +YSLT
Sbjct  353  CSLVPGYWFTVAFIDRIGRFPIQLMGFFFMTVFMFALAIPYHHWTLKPNRIGFVVLYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFF+NFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAI+GAFGFLYAAQ+T+PA+TD
Sbjct  413  FFFSNFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIIGAFGFLYAAQSTNPAETD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIG++NSL++LG INF GM+FTLLVPE  GKSL
Sbjct  473  AGYPPGIGMKNSLILLGVINFFGMLFTLLVPEPNGKSL  510



>ref|XP_006403254.1| hypothetical protein EUTSA_v10003183mg [Eutrema salsugineum]
 ref|XP_006403255.1| hypothetical protein EUTSA_v10003183mg [Eutrema salsugineum]
 gb|ESQ44707.1| hypothetical protein EUTSA_v10003183mg [Eutrema salsugineum]
 gb|ESQ44708.1| hypothetical protein EUTSA_v10003183mg [Eutrema salsugineum]
Length=521

 Score =   341 bits (875),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 193/218 (89%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL LLG TSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMNA+ EVF+IARAQTLIA+
Sbjct  293  HGLPLLGCTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKASTMNAIHEVFKIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFF MTVFMFA+A PY+HW   +NRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVAFIDIMGRFAIQLMGFFMMTVFMFAIAFPYNHWIKPDNRIGFVVMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAA GKAGAIVGAFGFLYAAQ  D  KTD
Sbjct  413  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAATGKAGAIVGAFGFLYAAQPQDKTKTD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INF+GM+FT LVPE KGKSL
Sbjct  473  AGYPPGIGVKNSLIMLGVINFIGMLFTFLVPEPKGKSL  510



>gb|AGK29560.1| phosphate transporter 1 [Chrysanthemum x morifolium]
Length=532

 Score =   341 bits (875),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 194/218 (89%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHLLGTTSTWFLLDIAFYSQ LFQKD+F AIGWIP    M+A  EV+++A+AQTLIA+
Sbjct  294  HGLHLLGTTSTWFLLDIAFYSQNLFQKDVFTAIGWIPAAAKMSATGEVYKVAKAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFALAIPY HWT  ENR+GFV MYSLT
Sbjct  354  CSTVPGYWFTVAFIDIIGRFAIQLMGFFFMTVFMFALAIPYHHWTLHENRLGFVVMYSLT  413

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGA+GFLYA+Q+TDP KTD
Sbjct  414  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAYGFLYASQSTDPHKTD  473

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYP GIG+R SL+VLG INFLGM FT LVPE  GKSL
Sbjct  474  KGYPTGIGIRYSLVVLGIINFLGMAFTFLVPEPNGKSL  511



>gb|ADA83723.1| PT1 [Manihot esculenta]
Length=566

 Score =   342 bits (878),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 179/218 (82%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HG+HLLGTT  WFLLDIA+YS  LFQKDIF AIGWIP  +TMNA+ EV+ IARAQTLIA+
Sbjct  293  HGVHLLGTTVCWFLLDIAYYSSNLFQKDIFSAIGWIPPAQTMNAIHEVYVIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            C TVPGYWFTVALID+ GRF IQ+MGFFFMTVFMFALAIPY HWT ++NRIGF+ MYSLT
Sbjct  353  CGTVPGYWFTVALIDRIGRFFIQVMGFFFMTVFMFALAIPYHHWTLRDNRIGFLIMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTFVVPAEIFPARLRSTCHG+SAA GKAGAIVG+FGFLY AQ+TDPAK D
Sbjct  413  FFFANFGPNATTFVVPAEIFPARLRSTCHGISAACGKAGAIVGSFGFLYTAQSTDPAKAD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYP GIGV+NSL+VLG INF G++FTLLVPESKGKSL
Sbjct  473  AGYPTGIGVKNSLIVLGVINFFGILFTLLVPESKGKSL  510



>ref|XP_008438529.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Cucumis 
melo]
 ref|XP_008438530.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Cucumis 
melo]
Length=530

 Score =   341 bits (874),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 179/218 (82%), Positives = 195/218 (89%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL+GTTSTWFLLDIAFYSQ LFQKDIF AIGW+P  +TM+A+EE FRIARAQTLIA+
Sbjct  293  HGLHLIGTTSTWFLLDIAFYSQNLFQKDIFTAIGWLPPAKTMSALEECFRIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            C TVPGYWFTVALID  GRF IQL+GF  MT+FMFA+A PY+HW  KENRIGF+ MYSLT
Sbjct  353  CGTVPGYWFTVALIDIIGRFTIQLIGFIMMTIFMFAIAFPYNHWILKENRIGFLVMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPN+TTF+VPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQN D  KTD
Sbjct  413  FFFANFGPNSTTFIVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQNPDRTKTD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYPPGIGV+NSL+ LGCINFLG V TLLVPE KGKSL
Sbjct  473  PGYPPGIGVKNSLIALGCINFLGSVLTLLVPEPKGKSL  510



>ref|XP_004157696.1| PREDICTED: probable inorganic phosphate transporter 1-3-like 
[Cucumis sativus]
Length=405

 Score =   337 bits (863),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 176/218 (81%), Positives = 195/218 (89%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL+GTT+TWFLLDIAFYSQ LFQKDIF AIGW+P  +TM+A+EE FRIARAQTLIA+
Sbjct  168  HGLHLVGTTTTWFLLDIAFYSQNLFQKDIFTAIGWLPPAKTMSALEECFRIARAQTLIAL  227

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            C TVPGYWFTVALID  GRF IQL+GF  MT+FMFA+A PY+HW  KENRIGF+ MYSLT
Sbjct  228  CGTVPGYWFTVALIDIIGRFTIQLIGFIMMTIFMFAIAFPYNHWILKENRIGFLVMYSLT  287

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPN+TTF+VPAEIFPARLRSTCHG+SAAAGKAGAI+GAFGFLYAAQN D  KTD
Sbjct  288  FFFANFGPNSTTFIVPAEIFPARLRSTCHGISAAAGKAGAIIGAFGFLYAAQNPDRTKTD  347

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYPPGIGV+NSL+ LGCINF+G V TLLVPE KGKSL
Sbjct  348  PGYPPGIGVKNSLIALGCINFVGSVLTLLVPEPKGKSL  385



>ref|NP_001240239.1| probable inorganic phosphate transporter 1-7-like [Glycine max]
 ref|XP_006605350.1| PREDICTED: probable inorganic phosphate transporter 1-7-like 
isoform X1 [Glycine max]
 gb|ACN80147.1| phosphate transporter 13 [Glycine max]
 gb|ACY74616.1| phosphate transporter1-5 [Glycine max]
 gb|AEA76641.1| phosphate transporter [Glycine max]
 gb|KHN13164.1| Putative inorganic phosphate transporter 1-7 [Glycine soja]
Length=536

 Score =   341 bits (874),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 196/218 (90%), Gaps = 1/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL+GTT TWFLLDIAFYSQ LFQKDIF AIGWIP  + MNA+ EV+RIARAQTLIA+
Sbjct  294  HGLHLVGTTVTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQDMNAIHEVYRIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFALAIPY+HW +  N IGFV MYS T
Sbjct  354  CSTVPGYWFTVAFIDIMGRFAIQLMGFFFMTVFMFALAIPYNHWKN-HNNIGFVVMYSFT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFF+NFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+T+P K D
Sbjct  413  FFFSNFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSTNPDKVD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYP GIGV+NSL+VLG INF GMVFTLLVPESKGKSL
Sbjct  473  HGYPTGIGVKNSLIVLGVINFFGMVFTLLVPESKGKSL  510



>ref|XP_010494316.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Camelina 
sativa]
Length=517

 Score =   340 bits (873),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 179/218 (82%), Positives = 193/218 (89%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL LLG TSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMN + EVF+IARAQTLIA+
Sbjct  289  HGLPLLGCTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAATMNGIHEVFKIARAQTLIAL  348

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+A PY+HW   +NRIGFV MYSLT
Sbjct  349  CSTVPGYWFTVAFIDIMGRFAIQLMGFFFMTVFMFAIAFPYNHWIKPDNRIGFVVMYSLT  408

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAA GKAGAIVGAFGFLYAAQ  D +K D
Sbjct  409  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAATGKAGAIVGAFGFLYAAQPQDKSKVD  468

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INF+GM+FT LVPE KGKSL
Sbjct  469  AGYPPGIGVKNSLIMLGVINFIGMLFTFLVPEPKGKSL  506



>ref|XP_010442031.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Camelina 
sativa]
Length=517

 Score =   340 bits (872),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 179/218 (82%), Positives = 193/218 (89%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL LLG TSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMN + EVF+IARAQTLIA+
Sbjct  289  HGLPLLGCTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAATMNGIHEVFKIARAQTLIAL  348

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFA+A PY+HW   +NRIGFV MYSLT
Sbjct  349  CSTVPGYWFTVAFIDIMGRFAIQLMGFFFMTVFMFAIAFPYNHWIKPDNRIGFVVMYSLT  408

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAA GKAGAIVGAFGFLYAAQ  D +K D
Sbjct  409  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAATGKAGAIVGAFGFLYAAQPQDKSKVD  468

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INF+GM+FT LVPE KGKSL
Sbjct  469  AGYPPGIGVKNSLIMLGVINFIGMLFTFLVPEPKGKSL  506



>gb|KFK32097.1| hypothetical protein AALP_AA6G198600, partial [Arabis alpina]
Length=259

 Score =   331 bits (849),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 177/218 (81%), Positives = 190/218 (87%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL LLG TSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMN + EVF IARAQTLIA+
Sbjct  37   HGLPLLGCTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAATMNGIHEVFMIARAQTLIAL  96

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA I+  GRF IQLMGFF MTVFMFA+A PY+HW   +NRIGFV MYSLT
Sbjct  97   CSTVPGYWFTVAFIEIMGRFWIQLMGFFMMTVFMFAIAFPYNHWIKPDNRIGFVVMYSLT  156

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAA GKAGAIVGAFGFLYAAQ  D  KTD
Sbjct  157  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAATGKAGAIVGAFGFLYAAQPQDKTKTD  216

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INF+GM+FT LVPE KGKSL
Sbjct  217  AGYPPGIGVKNSLIMLGVINFIGMLFTFLVPEPKGKSL  254



>ref|XP_006282173.1| hypothetical protein CARUB_v10028434mg [Capsella rubella]
 gb|EOA15071.1| hypothetical protein CARUB_v10028434mg [Capsella rubella]
Length=517

 Score =   340 bits (872),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 179/218 (82%), Positives = 192/218 (88%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL LLG TSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMN + EVF+IARAQTLIA+
Sbjct  289  HGLPLLGCTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAATMNGIHEVFKIARAQTLIAL  348

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFF MTVFMFA+A PYDHW   +NRIGFV MYSLT
Sbjct  349  CSTVPGYWFTVAFIDIMGRFAIQLMGFFMMTVFMFAIAFPYDHWIKPDNRIGFVVMYSLT  408

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAA GKAGAIVGAFGFLYAAQ  D +K D
Sbjct  409  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAATGKAGAIVGAFGFLYAAQPQDKSKVD  468

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INF+GM+FT LVPE KGKSL
Sbjct  469  AGYPPGIGVKNSLIMLGVINFVGMLFTFLVPEPKGKSL  506



>ref|XP_009123893.1| PREDICTED: probable inorganic phosphate transporter 1-3 [Brassica 
rapa]
Length=521

 Score =   340 bits (872),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 191/218 (88%), Gaps = 0/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGL LLG TSTWFLLDIAFYSQ LFQKDIF AIGWIP   TMN + EVF IARAQTLIA+
Sbjct  293  HGLPLLGCTSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAATMNGIHEVFMIARAQTLIAL  352

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFF MTVFMFA+A PYDHW   +NRIGFV MYSLT
Sbjct  353  CSTVPGYWFTVAFIDIMGRFAIQLMGFFMMTVFMFAIAFPYDHWIKPDNRIGFVVMYSLT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFFANFGPNATTF+VPAEIFPARLRSTCHG+SAA GKAGAIVGAFGFLYAAQ  D  KTD
Sbjct  413  FFFANFGPNATTFIVPAEIFPARLRSTCHGISAATGKAGAIVGAFGFLYAAQPQDKTKTD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
            AGYPPGIGV+NSL++LG INF+GM+FT LVPE KGKSL
Sbjct  473  AGYPPGIGVKNSLIMLGVINFVGMLFTFLVPEPKGKSL  510



>gb|AEA76640.1| phosphate transporter [Glycine max]
Length=536

 Score =   340 bits (873),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 196/218 (90%), Gaps = 1/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL+GTT TWFLLDIAFYSQ LFQKDIF AIGWIP  + MNA+ EV+RIARAQTLIA+
Sbjct  294  HGLHLVGTTVTWFLLDIAFYSQNLFQKDIFTAIGWIPPAQDMNAIHEVYRIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFALAIPY+HW +  N IGFV MYS T
Sbjct  354  CSTVPGYWFTVAFIDIIGRFAIQLMGFFFMTVFMFALAIPYNHWKN-HNNIGFVVMYSFT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFF+NFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+T+P K D
Sbjct  413  FFFSNFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSTNPNKVD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYP GIGV+NSL+VLG INF GMVFTLLVPESKGKSL
Sbjct  473  HGYPTGIGVKNSLIVLGVINFFGMVFTLLVPESKGKSL  510



>ref|NP_001240032.1| probable inorganic phosphate transporter 1-7-like [Glycine max]
 ref|XP_006588470.1| PREDICTED: probable inorganic phosphate transporter 1-7-like 
isoform X1 [Glycine max]
 gb|ACP19341.1| phosphate transporter 7 [Glycine max]
 gb|ACY74612.1| phosphate transporter1-1 [Glycine max]
 gb|KHN01065.1| Putative inorganic phosphate transporter 1-7 [Glycine soja]
Length=536

 Score =   340 bits (873),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 196/218 (90%), Gaps = 1/218 (0%)
 Frame = +2

Query  2    HGLHLLGTTSTWFLLDIAFYSQQLFQKDIFRAIGWIPNPETMNAVEEVFRIARAQTLIAV  181
            HGLHL+GTT TWFLLDIAFYSQ LFQKDIF AIGWIP  + MNA+ EV+RIARAQTLIA+
Sbjct  294  HGLHLVGTTVTWFLLDIAFYSQNLFQKDIFTAIGWIPPAQDMNAIHEVYRIARAQTLIAL  353

Query  182  CSTVPGYWFTVALIDKTGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVKMYSLT  361
            CSTVPGYWFTVA ID  GRFAIQLMGFFFMTVFMFALAIPY+HW +  N IGFV MYS T
Sbjct  354  CSTVPGYWFTVAFIDIIGRFAIQLMGFFFMTVFMFALAIPYNHWKN-HNNIGFVVMYSFT  412

Query  362  FFFANFGPNATTFVVPAEIFPARLRSTCHgmsaaagkagaivgafgFLYAAQNTDPAKTD  541
            FFF+NFGPNATTFVVPAEIFPARLRSTCHG+SAAAGKAGAIVGAFGFLYAAQ+T+P K D
Sbjct  413  FFFSNFGPNATTFVVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSTNPNKVD  472

Query  542  AGYPPGIGVRNSLLVLGCINFLGMVFTLLVPESKGKSL  655
             GYP GIGV+NSL+VLG INF GMVFTLLVPESKGKSL
Sbjct  473  HGYPTGIGVKNSLIVLGVINFFGMVFTLLVPESKGKSL  510



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2230116990256