BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18891_g1_i2 len=996 path=[1:0-221 223:222-244 246:245-995]

Length=996
                                                                      Score     E

ref|XP_009621275.1|  PREDICTED: uncharacterized protein LOC104112932    106   3e-24   
ref|XP_009758859.1|  PREDICTED: uncharacterized protein LOC104211497  97.4    4e-21   
ref|XP_009596812.1|  PREDICTED: uncharacterized protein LOC104092841  80.1    6e-15   
ref|XP_009776766.1|  PREDICTED: uncharacterized protein LOC104226449  78.6    2e-14   
ref|XP_006338862.1|  PREDICTED: uncharacterized protein LOC102579472  77.8    3e-14   
gb|KDP20373.1|  hypothetical protein JCGZ_05256                       76.6    1e-13   
ref|XP_004240921.1|  PREDICTED: uncharacterized protein LOC101248111  75.9    2e-13   
emb|CDP07659.1|  unnamed protein product                              70.1    4e-11   
gb|ABN08121.1|  hypothetical protein MtrDRAFT_AC155880g21v2           69.3    7e-11   Medicago truncatula
ref|XP_006438993.1|  hypothetical protein CICLE_v10032944mg           69.3    1e-10   
ref|XP_006482795.1|  PREDICTED: uncharacterized protein LOC102620470  68.9    1e-10   
emb|CDP07658.1|  unnamed protein product                              68.2    1e-10   
ref|XP_009144020.1|  PREDICTED: uncharacterized protein LOC103867673  67.4    3e-10   
ref|XP_011009642.1|  PREDICTED: uncharacterized protein LOC105114702  67.0    6e-10   
ref|XP_004488581.1|  PREDICTED: uncharacterized protein LOC101492031  66.6    7e-10   
ref|XP_006410326.1|  hypothetical protein EUTSA_v10017383mg           65.1    2e-09   
ref|XP_006369485.1|  hypothetical protein POPTR_0001s23870g           63.9    9e-09   
emb|CDY60510.1|  BnaC04g54220D                                        62.4    2e-08   
ref|XP_010257591.1|  PREDICTED: uncharacterized protein LOC104597634  62.0    3e-08   
ref|XP_008231406.1|  PREDICTED: uncharacterized protein LOC103330586  60.5    7e-08   
ref|XP_010542777.1|  PREDICTED: protein FAM9A                         60.8    8e-08   
ref|XP_011093963.1|  PREDICTED: uncharacterized protein LOC105173783  60.1    1e-07   
ref|XP_007149120.1|  hypothetical protein PHAVU_005G042700g           59.7    2e-07   
ref|XP_007022893.1|  Uncharacterized protein TCM_026922               59.3    3e-07   
ref|XP_010098647.1|  hypothetical protein L484_002670                 58.5    4e-07   
ref|XP_003595828.1|  hypothetical protein MTR_2g062280                57.8    7e-07   
ref|XP_003545954.1|  PREDICTED: serum response factor homolog A-like  58.5    8e-07   
ref|NP_001236134.1|  uncharacterized protein LOC100306001             57.8    1e-06   
gb|KHN21336.1|  hypothetical protein glysoja_026537                   57.4    2e-06   
ref|XP_010469652.1|  PREDICTED: uncharacterized protein LOC104749673  56.6    2e-06   
gb|KHN49060.1|  hypothetical protein glysoja_031271                   57.0    2e-06   
ref|XP_010510135.1|  PREDICTED: uncharacterized protein LOC104786419  55.8    3e-06   
ref|XP_008461224.1|  PREDICTED: uncharacterized protein LOC103499874  55.1    6e-06   
ref|XP_002862931.1|  hypothetical protein ARALYDRAFT_497238           54.7    8e-06   
ref|XP_002879350.1|  hypothetical protein ARALYDRAFT_902232           54.7    9e-06   
ref|XP_010414063.1|  PREDICTED: uncharacterized protein LOC104700270  53.5    2e-05   
ref|XP_006295508.1|  hypothetical protein CARUB_v10024612mg           53.1    3e-05   
gb|KGN45181.1|  hypothetical protein Csa_7G430160                     49.3    5e-04   



>ref|XP_009621275.1| PREDICTED: uncharacterized protein LOC104112932 [Nicotiana tomentosiformis]
Length=148

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 101/154 (66%), Gaps = 18/154 (12%)
 Frame = -2

Query  806  MGSEFLSRKPHYDITMSKRTRKPTNSNLINIQESA----DHHQSAENCISATVKMNQVVN  639
            M SE   RK  YDI+MSKRTRK    + +NI+E A     H Q   N + +   +N V  
Sbjct  1    MESECFPRKLRYDISMSKRTRK----SPVNIKEEAIKSPQHPQQLINSVESREDVN-VEE  55

Query  638  EGIIQGddddeeskkSLKQLIEGRRRGTSLGEHFTAEEKQLQvavvkaaaAEDGGGSNGV  459
            +G+I  ++++E+ KKSLKQLIEGR  GTSLG HFT EEKQLQ+ V +     +G   NG+
Sbjct  56   KGVISNEEEEEDQKKSLKQLIEGR--GTSLGHHFTEEEKQLQLVVKQP----EGSLMNGL  109

Query  458  KFKHMISRYTKVLSHMMKLRRDASKP-HFRLKVQ  360
            KFK M+SRYTKVLSHM+KL+R   KP  F LK+Q
Sbjct  110  KFKQMVSRYTKVLSHMIKLKR--KKPASFGLKMQ  141



>ref|XP_009758859.1| PREDICTED: uncharacterized protein LOC104211497 [Nicotiana sylvestris]
Length=141

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 95/150 (63%), Gaps = 17/150 (11%)
 Frame = -2

Query  806  MGSEFLSRKPHYDITMSKRTRKPTNSNLINIQESADHHQSAENCISATVKMNQVVN-EGI  630
            M SE   RK  YDI+MSKRTRK   S +I  +E+    +  +  I      N V N E +
Sbjct  1    MESECFPRKLRYDISMSKRTRK---SPVIIKEEAIKSPEHPQQLI------NSVENREDV  51

Query  629  IQGddddeeskkSLKQLIEGRRRGTSLGEHFTAEEKQLQvavvkaaaAEDGGGSNGVKFK  450
            I  ++++E+ KKSLKQLIEGR  GTSLG HFT EEKQLQ+ V +     +G   NG+KFK
Sbjct  52   ISNEEEEEDKKKSLKQLIEGR--GTSLGHHFTEEEKQLQLVVKQ----PEGSLMNGLKFK  105

Query  449  HMISRYTKVLSHMMKLRRDASKPHFRLKVQ  360
             M+SRYTKVLSHM+KL+R     +  LK+Q
Sbjct  106  QMVSRYTKVLSHMIKLKRKKPAAYI-LKMQ  134



>ref|XP_009596812.1| PREDICTED: uncharacterized protein LOC104092841 [Nicotiana tomentosiformis]
Length=136

 Score = 80.1 bits (196),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 90/149 (60%), Gaps = 19/149 (13%)
 Frame = -2

Query  806  MGSEFLSRKPHYDITMSKRTRKPTNSNLINIQESADHHQSAENCISATVKMNQVVNEGII  627
            MGS+   RK HYD++MSKRTRKP N + I    S ++ Q +E  I  +V+  QV +E   
Sbjct  1    MGSKVSPRKLHYDVSMSKRTRKPLNLSAI----SDENPQQSEELI-GSVENKQVPSE---  52

Query  626  QGddddeeskkSLKQLIEGRRRGTSLGEHFTAEEKQLQvavvkaaaAEDGGGSNGVKFKH  447
               ++ +  +KSLKQLIE   R  SL +HF  EEKQLQV V +     +    NG+K K 
Sbjct  53   ---EERKYERKSLKQLIEV--RSISLRQHFIEEEKQLQVMVKQQP---EESIVNGLKLKK  104

Query  446  MISRYTKVLSHMMKLRRDASKPHFRLKVQ  360
            ++  YTKVLSHM+K ++ A    +R+K+Q
Sbjct  105  IMRCYTKVLSHMIKRKKTAG---YRMKMQ  130



>ref|XP_009776766.1| PREDICTED: uncharacterized protein LOC104226449 [Nicotiana sylvestris]
Length=136

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 86/149 (58%), Gaps = 19/149 (13%)
 Frame = -2

Query  806  MGSEFLSRKPHYDITMSKRTRKPTNSNLINIQESADHHQSAENCISATVKMNQVVNEGII  627
            MGS+   RK HYD++MSKRTRKP N N I    S    Q +E  I  +V+  Q  +E   
Sbjct  1    MGSKVSPRKLHYDVSMSKRTRKPLNLNAI----SDKKPQQSEELI-GSVEKKQAPSE---  52

Query  626  QGddddeeskkSLKQLIEGRRRGTSLGEHFTAEEKQLQvavvkaaaAEDGGGSNGVKFKH  447
               ++ +  +KSLKQLIE   R  SL +HF  EEKQLQV V +     +    NG+K K 
Sbjct  53   ---EERKYERKSLKQLIEV--RSISLRQHFIEEEKQLQVMVKQQP---EESMVNGLKLKK  104

Query  446  MISRYTKVLSHMMKLRRDASKPHFRLKVQ  360
            ++  YT VLSHM+K ++ A    +R+K+Q
Sbjct  105  IVRCYTNVLSHMIKRKKTAG---YRMKMQ  130



>ref|XP_006338862.1| PREDICTED: uncharacterized protein LOC102579472 [Solanum tuberosum]
Length=123

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 72/132 (55%), Gaps = 31/132 (23%)
 Frame = -2

Query  791  LSRKPHYDITMSKRTRKPTNSNLINIQESADHHQSAENCISATVKMNQVVNEGIIQGddd  612
              RK  YDI+MSKRTRK      + ++    H +   N                      
Sbjct  7    FPRKLRYDISMSKRTRKTAKEEDVVVESVEYHDEELMN----------------------  44

Query  611  deeskkSLKQLIEGRRRGTSLGEHFTAEEKQLQvavvkaaaAEDGGGSNGVKFKHMISRY  432
            + + KKSLKQLIEGRR  TSLG HFT EE+Q+Q+ V +         +NGVKFK M+SRY
Sbjct  45   NSDEKKSLKQLIEGRR--TSLGHHFTEEERQVQIVVKQ-------AENNGVKFKEMVSRY  95

Query  431  TKVLSHMMKLRR  396
             KVLSHM+KL+R
Sbjct  96   AKVLSHMIKLKR  107



>gb|KDP20373.1| hypothetical protein JCGZ_05256 [Jatropha curcas]
Length=143

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 82/145 (57%), Gaps = 13/145 (9%)
 Frame = -2

Query  806  MGSEFLSRKPHYDITMSKRTRKPTNSNLINIQESADHHQSAENCISATVKMNQVVNEGII  627
            MGSE    K  YDITMSKRTRKP  SN+   Q  AD     E+ + A V  ++   + +I
Sbjct  1    MGSECNPSKHRYDITMSKRTRKPLKSNM--PQAHADLR--GEDNLLAKVDEDRKSLKQLI  56

Query  626  QGddddeeskkSLKQLIEGRRRGTSLGEHFTAEEKQLQvavvkaaaAEDGGGSNGVKFKH  447
             G  ++ E     K+  E R R  SLG+HF+ EEKQLQ         ++  G   VK K 
Sbjct  57   NGIANNVEET---KEDSENRGR-NSLGQHFSEEEKQLQ-----LMRRQNQQGLQAVKLKG  107

Query  446  MISRYTKVLSHMMKLRRDASKPHFR  372
            ++ RY KVLSH++K++RD+++ + R
Sbjct  108  IMGRYVKVLSHLIKVKRDSTRTNIR  132



>ref|XP_004240921.1| PREDICTED: uncharacterized protein LOC101248111 [Solanum lycopersicum]
Length=126

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 77/139 (55%), Gaps = 31/139 (22%)
 Frame = -2

Query  806  MGSEF-LSRKPHYDITMSKRTRK-PTNSNLINIQESADHHQSAENCISATVKMNQVVNEG  633
            MGSE    RK  YDI+MSKRTRK  +N+    + ES ++H+   N               
Sbjct  1    MGSECNFPRKLRYDISMSKRTRKTASNTKEDVVVESVEYHEELINL--------------  46

Query  632  IIQGddddeeskkSLKQLIEGRRRGTSLGEHFTAEEKQLQvavvkaaaAEDGGGSNGVKF  453
                     + KKSLKQLIEGR  GTSLG HF  EE++ +   +    AE+    NGVKF
Sbjct  47   ---------DEKKSLKQLIEGR--GTSLGHHFIEEEEEERQVQIVVKQAEN----NGVKF  91

Query  452  KHMISRYTKVLSHMMKLRR  396
            K M+SRY KVL HM+KL+R
Sbjct  92   KEMVSRYAKVLRHMIKLKR  110



>emb|CDP07659.1| unnamed protein product [Coffea canephora]
Length=145

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 79/144 (55%), Gaps = 22/144 (15%)
 Frame = -2

Query  806  MGSEFLSRKPHYDITMSKRTRKPTNSNLINIQESADHHQSA-------ENCISATVKMNQ  648
            MGSE    K HYD++MSKRTR+      +N+ E  DH Q +       E C +    +  
Sbjct  1    MGSESKPNKFHYDLSMSKRTRRS-----LNLVED-DHDQGSFQAWHGEEEC-ALEFAIGD  53

Query  647  VVNEGIIQGddddeeskkSLKQLIEGRRRGTSLGEHFTAEEKQLQvavvkaaaAEDGGGS  468
                 I   +  + + KKSLKQLI GR    SL +HF+ EE QLQ+ V +     D  G 
Sbjct  54   EEKGSISLSEASENDQKKSLKQLIGGR----SLSQHFSQEEPQLQLVVKQ----HDQEGL  105

Query  467  NGVKFKHMISRYTKVLSHMMKLRR  396
            +G+KF  M+SRY K LSH++KL+R
Sbjct  106  SGLKFTRMVSRYAKALSHLIKLKR  129



>gb|ABN08121.1| hypothetical protein MtrDRAFT_AC155880g21v2 [Medicago truncatula]
 gb|AES66079.2| hypothetical protein MTR_2g062280 [Medicago truncatula]
Length=154

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 78/162 (48%), Gaps = 37/162 (23%)
 Frame = -2

Query  788  SRKPHYDITMSKRTRKPTNSNLINIQESADHHQSAENCISATVKMNQVVNEGIIQGdddd  609
            S K HYDITMS+RTRK    +L N +  +      +  +  T+   +  NE  I      
Sbjct  6    SAKRHYDITMSRRTRK--QQSLANEKPISKVETPKDVSLETTIPEVKEGNENNID-----  58

Query  608  eeskkSLKQLI---------------EGRRRG-TSLGEHFTAEEKQLQvavvkaaaAEDG  477
                KSLKQLI               EG  +G  SLGEHFT EEKQLQ+  +     +  
Sbjct  59   ---HKSLKQLIVGEEKESTKKCSSSDEGESKGRNSLGEHFTEEEKQLQLVRM-----QQK  110

Query  476  GGSNGVKFKHMISRYTKVLSHMMKLRRD------ASKPHFRL  369
                G+KFK ++ RY KVL HMMK +RD        KP F+L
Sbjct  111  DNLQGLKFKKLVRRYAKVLGHMMKSKRDPHLGDAGKKPVFKL  152



>ref|XP_006438993.1| hypothetical protein CICLE_v10032944mg [Citrus clementina]
 gb|ESR52233.1| hypothetical protein CICLE_v10032944mg [Citrus clementina]
Length=161

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 60/163 (37%), Positives = 88/163 (54%), Gaps = 21/163 (13%)
 Frame = -2

Query  806  MGSEFLS---RKPHYDITMSKRTRK-PTNSNLI--------NIQESADHHQSAE-NCISA  666
            MGSE      RK H+DITMSKRTRK P N  L+         +++++D    +E +    
Sbjct  1    MGSESSDPSPRKRHFDITMSKRTRKQPLNFELVEDSYHIPLKVKDASDEQGKSEVDGGHE  60

Query  665  TVKMN-QVVNEGIIQGddddeeskkSLKQLIEGRRRGTSLGEHFTAEEKQLQvavvkaaa  489
             + ++ + + + II G+++  +   +  +   G  R  SLGEHFT EEKQLQ  +V    
Sbjct  61   NINIDHKSLKQLIINGNENLPKVNTATGEESRGGSR-NSLGEHFTEEEKQLQHQLVNKQQ  119

Query  488  AEDGGGSNGVKFKHMISRYTKVLSHMMKLRRDASK---PHFRL  369
                    GVK K M++RY KVLSH++K+RR  S+   P  RL
Sbjct  120  Q---NSMQGVKLKGMVNRYVKVLSHLIKVRRIGSRNKMPPLRL  159



>ref|XP_006482795.1| PREDICTED: uncharacterized protein LOC102620470 [Citrus sinensis]
 gb|KDO46023.1| hypothetical protein CISIN_1g031326mg [Citrus sinensis]
Length=161

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 60/163 (37%), Positives = 87/163 (53%), Gaps = 21/163 (13%)
 Frame = -2

Query  806  MGSEFLS---RKPHYDITMSKRTRK-PTNSNLI--------NIQESADHHQSAE-NCISA  666
            MGSE      RK H+DITMSKRTRK P N  L+         +++++D     E +    
Sbjct  1    MGSESSDPSPRKRHFDITMSKRTRKQPLNFELVEDSYHIPLKVKDASDEQGKGEVDGGHE  60

Query  665  TVKMN-QVVNEGIIQGddddeeskkSLKQLIEGRRRGTSLGEHFTAEEKQLQvavvkaaa  489
             + ++ + + + II G+++  +   +  +   G  R  SLGEHFT EEKQLQ  +V    
Sbjct  61   NINIDHKSLKQLIINGNENLPKVNTATGEESRGGSR-NSLGEHFTEEEKQLQHQLVNKQQ  119

Query  488  AEDGGGSNGVKFKHMISRYTKVLSHMMKLRRDASK---PHFRL  369
                    GVK K M++RY KVLSH++K+RR  S+   P  RL
Sbjct  120  QNS---MQGVKLKGMVNRYVKVLSHLIKVRRIGSRNKMPPLRL  159



>emb|CDP07658.1| unnamed protein product [Coffea canephora]
Length=126

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 75/137 (55%), Gaps = 27/137 (20%)
 Frame = -2

Query  806  MGSEFLSRKPHYDITMSKRTRKPTNSNLINIQESADHHQSAENCISATVKMNQVVNEGII  627
            MGSE    K HYD++MSKRTR+      +N+ E  DH Q +        + ++       
Sbjct  1    MGSESKPNKFHYDLSMSKRTRRS-----LNLVED-DHDQGSFQAWHGEEESSE-------  47

Query  626  QGddddeeskkSLKQLIEGRRRGTSLGEHFTAEEKQLQvavvkaaaAEDGGGSNGVKFKH  447
                   + KKSLKQLI GR    SL +HF+ EE QLQ+ V +     D  G +G+KF  
Sbjct  48   ------NDQKKSLKQLIGGR----SLSQHFSQEEPQLQLVVKQ----HDQEGLSGLKFTR  93

Query  446  MISRYTKVLSHMMKLRR  396
            M+SRY K LSH++KL+R
Sbjct  94   MVSRYAKALSHLIKLKR  110



>ref|XP_009144020.1| PREDICTED: uncharacterized protein LOC103867673 [Brassica rapa]
 emb|CDY42076.1| BnaA05g11100D [Brassica napus]
Length=143

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 81/158 (51%), Gaps = 27/158 (17%)
 Frame = -2

Query  806  MGSEFLSR-KPHYDITMSKRTRKPTNSNLIN-IQESADHHQSAENCISATVKMNQVVNEG  633
            MGSE ++  KP +D++MS+RTRKP +S+L+N +Q      QS++              E 
Sbjct  1    MGSEVVNPIKPRFDLSMSRRTRKPWSSSLVNEMQHQVLSTQSSQQ-------------EK  47

Query  632  IIQGddddeeskkSLKQLIEGRRRGT---------SLGEHFTAEEKQLQvavvkaaaAED  480
             ++ D+D E  +KSL  L+   +            SLG+HF  +E   Q   V       
Sbjct  48   ELEQDEDREIDRKSLNNLMRSEQESNGEANVSNKNSLGQHFGDDEAIKQTMQVVVKKQ--  105

Query  479  GGGSNGVKFKHMISRYTKVLSHMMKLRRDASKPHFRLK  366
             GG NGVKFK M+SRY KVLS +MK +RD      R K
Sbjct  106  -GGENGVKFKGMMSRYVKVLSGLMKAKRDRKTSALRFK  142



>ref|XP_011009642.1| PREDICTED: uncharacterized protein LOC105114702 [Populus euphratica]
Length=181

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 87/187 (47%), Gaps = 49/187 (26%)
 Frame = -2

Query  806  MGSEF--LSRKPHYDITMSKRTRKPTNSNLINIQE--------SADHHQSAENCI-----  672
            MGSE   +  KP YDITMS+RTRKP     IN +E        S +    A++ +     
Sbjct  1    MGSERCDIPCKPRYDITMSRRTRKP----FINFEEANPNPTTVSTEEESDAKDVVVRDKE  56

Query  671  ----SATVKMNQVVNEGIIQ------GddddeeskkSLKQLIEGRRRGT---------SL  549
                 ATV + +     + Q      G  + E +K  L++   G    T         SL
Sbjct  57   TESFPATVDVEEDRKSSLKQLIIDNAGSQESEPTKLVLQETRGGDDENTERKLSGSRNSL  116

Query  548  GEHFTAEEKQLQvavvkaaaAEDGGGSNGVKFKHMISRYTKVLSHMMKLRRDA-------  390
            G+HF  EEKQLQ+  +K A      G  GVK K M+ RY KVLSH+++++RD        
Sbjct  117  GQHFKGEEKQLQLVTMKQAKE----GIEGVKLKGMVGRYVKVLSHLIRIKRDTRMNNGSR  172

Query  389  SKPHFRL  369
             KP  RL
Sbjct  173  KKPLLRL  179



>ref|XP_004488581.1| PREDICTED: uncharacterized protein LOC101492031 [Cicer arietinum]
Length=154

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 75/154 (49%), Gaps = 33/154 (21%)
 Frame = -2

Query  788  SRKPHYDITMSKRTRKPTNSNLINIQESADHHQSAENCISATVKMNQVVNEGIIQGdddd  609
            S K HYDITMS+RTRK    N   I +S           +  V   +  +   ++ ++++
Sbjct  7    SVKRHYDITMSRRTRKQPIPNEKQISKSE---------TTKEVSFEKTTHNHEVKENENN  57

Query  608  eeskkSLKQLIEGRRRGT----------------SLGEHFTAEEKQLQvavvkaaaAEDG  477
                KSLKQLI G  + T                SLGEHFT EEKQL++  +     +  
Sbjct  58   NNDHKSLKQLIVGEEKETKILCNHHDEGESKGRNSLGEHFTEEEKQLKLVRM-----QQK  112

Query  476  GGSNGVKFKHMISRYTKVLSHMMKLRRDASKPHF  375
                G+KFK ++ RY KVL HMMK +RD   PH 
Sbjct  113  DNIQGLKFKKLVRRYAKVLGHMMKAKRD---PHL  143



>ref|XP_006410326.1| hypothetical protein EUTSA_v10017383mg [Eutrema salsugineum]
 gb|ESQ51779.1| hypothetical protein EUTSA_v10017383mg [Eutrema salsugineum]
Length=145

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 78/150 (52%), Gaps = 9/150 (6%)
 Frame = -2

Query  806  MGSEFLS-RKPHYDITMSKRTRKPTNSNLINIQESADH--HQSAENCISATVKMNQVVNE  636
            MGSE ++  K  +DI+MS+RTRKP +S LIN Q+       QS++       + +Q V+ 
Sbjct  1    MGSEVINPIKTRFDISMSRRTRKPWSS-LINEQQEVQDLSTQSSQPEKEQEQEEDQEVDR  59

Query  635  GIIQGddddeeskkSLKQLIEGRRRGTSLGEHFTAEEKQLQvavvkaaaAEDGGGSNGVK  456
              +      E+      Q+       +SLG+HF  ++K ++  +      E  GG NGVK
Sbjct  60   KSLNNLMRCEQETNEEAQV----NNKSSLGQHF-GDDKGIKQTMQLVVKKEKQGGENGVK  114

Query  455  FKHMISRYTKVLSHMMKLRRDASKPHFRLK  366
            FK M+ RY KVLS ++K +RD      R K
Sbjct  115  FKGMMGRYVKVLSGLIKAKRDRKTSVLRFK  144



>ref|XP_006369485.1| hypothetical protein POPTR_0001s23870g [Populus trichocarpa]
 gb|ERP66054.1| hypothetical protein POPTR_0001s23870g [Populus trichocarpa]
Length=181

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 83/169 (49%), Gaps = 34/169 (20%)
 Frame = -2

Query  806  MGSEF--LSRKPHYDITMSKRTRKP--------TNSNLINIQESADH-----HQSAENCI  672
            MGSE   +  KP YDITMS+RTRKP         N   ++ +E  D      H       
Sbjct  1    MGSERCNIPCKPRYDITMSRRTRKPFMNFEEANRNPTTVSTEEERDAKDVAVHDKETESF  60

Query  671  SATVKMNQVVNEGIIQ------GddddeeskkSLKQL-------IEGRRRGT--SLGEHF  537
             AT  + +     + Q      G+ + E +K  L++        IE +  G+  SLG+HF
Sbjct  61   PATDDVEEDRKSSLKQLIIDNAGNQESEPTKLVLQETRGGDDENIERKLSGSRNSLGQHF  120

Query  536  TAEEKQLQvavvkaaaAEDGGGSNGVKFKHMISRYTKVLSHMMKLRRDA  390
              EEKQLQ+  +K A      G  GVK K M+ RY KVLSH+++++RD 
Sbjct  121  KGEEKQLQLVTMKQAKE----GIEGVKLKGMVGRYVKVLSHLIRIKRDT  165



>emb|CDY60510.1| BnaC04g54220D [Brassica napus]
Length=143

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 74/150 (49%), Gaps = 9/150 (6%)
 Frame = -2

Query  806  MGSEFLSR-KPHYDITMSKRTRKPTNSNLINIQESAD-HHQSAENCISATVKMNQVVNEG  633
            MGSE ++  KP +D++MS+RTRKP +S+L++  +  D   QSA+         +  ++  
Sbjct  1    MGSEVINPIKPRFDLSMSRRTRKPWSSSLVSEMQHQDLSTQSAQPDKGKEQDKDLEIDRK  60

Query  632  IIQGddddeeskkSLKQLIEGRRRGTSLGEHFTAEEKQLQvavvkaaaAEDGGGSNGVKF  453
             +      E+       +    +   SLG+HF  +E   Q   +        GG +GVKF
Sbjct  61   SLNNLMRSEQEPNEEANV----KNKNSLGQHFGEDEGTKQTMQLVVKKQ---GGESGVKF  113

Query  452  KHMISRYTKVLSHMMKLRRDASKPHFRLKV  363
            K M+ RY KVLS +MK +RD      R K 
Sbjct  114  KGMMGRYVKVLSGLMKAKRDRKTSALRFKT  143



>ref|XP_010257591.1| PREDICTED: uncharacterized protein LOC104597634 [Nelumbo nucifera]
Length=170

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 86/185 (46%), Gaps = 52/185 (28%)
 Frame = -2

Query  806  MGSEFLSRKPHYDITMSKRTRKPTNSNL-------------------INIQESADHHQSA  684
            MGSE    K HYD++MS+RTRKP    +                   +      ++ +S+
Sbjct  1    MGSECNPSKRHYDLSMSRRTRKPIKLQVSDQPIHPIITAGDDDKKDDVKCSPETENVKSS  60

Query  683  ENCISATVKMNQVVNEGIIQGddddeeskkSLKQLI-----------EGRR--RGTSLGE  543
                + +  + +V  +GI          ++SLK+LI           EG+R   G SLG 
Sbjct  61   PETENPSSGIGEVEEDGI---------DRRSLKELIHEGEEKLGDGEEGKRGRSGKSLGH  111

Query  542  HFTAEEKQLQvavvkaaaAEDGGGSNGVKFKHMISRYTKVLSHMMKLRRDA-----SKPH  378
            HFT +E QLQ+   + A      G  GVK   ++SRY KVLSH++K++RD       KP 
Sbjct  112  HFT-QENQLQLVTKQQAE-----GMEGVKTGGLVSRYIKVLSHLIKVKRDPHLGSRKKPV  165

Query  377  FRLKV  363
             RLK 
Sbjct  166  LRLKT  170



>ref|XP_008231406.1| PREDICTED: uncharacterized protein LOC103330586 [Prunus mume]
Length=140

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 65/147 (44%), Gaps = 31/147 (21%)
 Frame = -2

Query  806  MGSEFLSRKPHYDITMSKRTRK---------PTNSNLINIQESADHHQSAENCISATVKM  654
            MGSE    K  YDI+MSKRTRK         P+ S + +  +  D+ +S +  I    K 
Sbjct  1    MGSECSINKRCYDISMSKRTRKSFHHRDQSCPSKSRVEDGDQDNDNRKSFKQLIDGDEKA  60

Query  653  NQVVNEGIIQGddddeeskkSLKQLIEGRRRGTSLGEHFTAEEKQLQvavvkaaaAEDGG  474
              ++  G                   +G R  +SLG+HFT EE  LQ+   +        
Sbjct  61   KLIIKSG------------------DQGSRARSSLGQHFTDEENHLQLVKKQQKT----A  98

Query  473  GSNGVKFKHMISRYTKVLSHMMKLRRD  393
            G  GVK K ++SR  KV  H++K   D
Sbjct  99   GLQGVKLKKLVSRCAKVFRHLVKAESD  125



>ref|XP_010542777.1| PREDICTED: protein FAM9A [Tarenaya hassleriana]
Length=166

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 85/177 (48%), Gaps = 41/177 (23%)
 Frame = -2

Query  806  MGSEFLSRKPHYDITMSKRTRKPTNSNL------INIQ----ESADHHQSAENCISATVK  657
            MGSE    K  +D++MS+RTRKP N+        I+I     E A HH S +       +
Sbjct  1    MGSELNQAKKRFDLSMSRRTRKPLNNLFKETHQDISIASPPPEEAPHHGSNQEQDREQEQ  60

Query  656  MNQVVNEGIIQGddddeeskkSLKQLIEGRRRG-------------TSLGEHFTAEEKQL  516
              +   E  I          KSL QL+ G   G             +SLGEHF+ EEKQ+
Sbjct  61   ERKQEQEQEID--------HKSLNQLMRGEEEGSQGETGGGGVNGKSSLGEHFSVEEKQV  112

Query  515  QvavvkaaaAEDGGGSNGVKFKHMISRYTKVLSHMMKLRRDA-------SKPHFRLK  366
            ++ +V     ++  G NGVKF+ ++ RY KVLS ++K + D         KP FRLK
Sbjct  113  KMQIVTR---KNNDGENGVKFRGIMGRYAKVLSGLIKAKHDTRRLSASKKKPIFRLK  166



>ref|XP_011093963.1| PREDICTED: uncharacterized protein LOC105173783 [Sesamum indicum]
Length=148

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 80/160 (50%), Gaps = 28/160 (18%)
 Frame = -2

Query  806  MGSEFLSR--KPHYDITMSKRTRKPTNSNL-INIQESADHHQSAENCISATVKMNQVVNE  636
            MGSE  +   KPHY+I+MS+RTR+P  +NL I  QES D  +     I  + K++     
Sbjct  1    MGSEGRTNPTKPHYNISMSRRTRRPIINNLKIEPQESLDELKKDGRLIIRSDKIS-----  55

Query  635  GIIQGddddeeskkSLKQLIEGRRRGTSLGEHFTAE---EKQLQvavvkaaaAEDGGGSN  465
             I Q        K SLKQLIEGR    SL +HF  E   EK + V         D  G  
Sbjct  56   -ITQ-------QKFSLKQLIEGR---CSLAQHFREEEGSEKDMVVRSGDHDHDHDQDGFG  104

Query  464  GVKFKH-MISRYTKVLSHMMKLR-----RDASKPHFRLKV  363
            GVK+K  M+  Y +VL  ++K++     R   KP   LK+
Sbjct  105  GVKWKRSMVGNYGRVLRRLIKVKQESYFRAWWKPALSLKL  144



>ref|XP_007149120.1| hypothetical protein PHAVU_005G042700g [Phaseolus vulgaris]
 gb|ESW21114.1| hypothetical protein PHAVU_005G042700g [Phaseolus vulgaris]
Length=160

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 74/160 (46%), Gaps = 38/160 (24%)
 Frame = -2

Query  773  YDITMSKRTRK---PTNSNLINIQESADHHQSAENCISATVKMNQVVNEGIIQGddddee  603
            YDITMS+RTRK   P   N  +     D     +        + +V   G        E 
Sbjct  12   YDITMSRRTRKHQFPVQGNEKSKSAMGDAAPKDDKLKVQATTIGEVKQGG--------EN  63

Query  602  skkSLKQLIEG-------------RRRGT--SLGEHFTAEEKQ-LQvavvkaaaAEDGGG  471
              KSLKQLI G             R +G+  SLGEHFT EEKQ LQ+  ++         
Sbjct  64   DHKSLKQLIIGDDDKEAMKGNSDERGKGSRNSLGEHFTEEEKQHLQLVRMQQKEN-----  118

Query  470  SNGVKFKHMISRYTKVLSHMMKLRRD------ASKPHFRL  369
              G+KFK ++SRY KVL H++K +RD        KP F+L
Sbjct  119  LQGLKFKKLVSRYAKVLGHLLKAKRDPHLGDAGKKPVFKL  158



>ref|XP_007022893.1| Uncharacterized protein TCM_026922 [Theobroma cacao]
 gb|EOY25515.1| Uncharacterized protein TCM_026922 [Theobroma cacao]
Length=159

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 76/153 (50%), Gaps = 24/153 (16%)
 Frame = -2

Query  806  MGSEFLSRKPHYDITMSKRTRKPTNSNLINIQESADHHQSAENCISATVKM---NQVVNE  636
            MGS     K HYDIT+SKRTRKP     +++QE+      A +     +K+       ++
Sbjct  1    MGSHCNPSKRHYDITLSKRTRKP-----LDLQEANGTSNIASSKWDNPLKIFPRKAADDD  55

Query  635  GIIQGddddeeskkSLKQLIEG-----------RRRG-TSLGEHFTAEEKQLQvavvkaa  492
               + + ++    KSLKQLI G           R  G +SL +HF  EEKQLQ       
Sbjct  56   DDDEDEGEESSDHKSLKQLINGDGGEAKEETSCRSSGRSSLVQHFNQEEKQLQ----LVK  111

Query  491  aAEDGGGSNGVKFKHMISRYTKVLSHMMKLRRD  393
              +  G   G K K M+SRY KVLS ++K +R+
Sbjct  112  KNQQDGVHGGAKLKGMMSRYAKVLSRLVKAKRE  144



>ref|XP_010098647.1| hypothetical protein L484_002670 [Morus notabilis]
 gb|EXB75448.1| hypothetical protein L484_002670 [Morus notabilis]
Length=139

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 67/142 (47%), Gaps = 37/142 (26%)
 Frame = -2

Query  773  YDITMSKRTRKPTNSNLINIQESADHHQSAENCISATVKMNQVVNEGIIQGddddeeskk  594
            YDITMS+RTR+P      N         S  +C    V      N+            +K
Sbjct  8    YDITMSRRTRRPPKVRDAN-------ENSPWDCPPRDVAHESEEND------------RK  48

Query  593  SLKQLIEGRRRG-------------TSLGEHFTAEEKQLQvavvkaaaAEDGGGSNGVKF  453
            SLK+LI+G  +              +SLG+HFT  EKQLQ+  V+   +      +G+K 
Sbjct  49   SLKELIDGDEKTKAVSGGDEGGKGRSSLGQHFTEGEKQLQIVGVQQKES-----LHGLKL  103

Query  452  KHMISRYTKVLSHMMKLRRDAS  387
            K M+SRY KVL ++MK  RD S
Sbjct  104  KKMVSRYAKVLGYLMKKNRDPS  125



>ref|XP_003595828.1| hypothetical protein MTR_2g062280 [Medicago truncatula]
Length=140

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 44/76 (58%), Gaps = 12/76 (16%)
 Frame = -2

Query  575  EGRRRG-TSLGEHFTAEEKQLQvavvkaaaAEDGGGSNGVKFKHMISRYTKVLSHMMKLR  399
            EG  +G  SLGEHFT EEKQLQ+  ++           G+KFK ++ RY KVL HMMK +
Sbjct  68   EGESKGRNSLGEHFTEEEKQLQLVRMQQKD-----NLQGLKFKKLVRRYAKVLGHMMKSK  122

Query  398  RD------ASKPHFRL  369
            RD        KP F+L
Sbjct  123  RDPHLGDAGKKPVFKL  138



>ref|XP_003545954.1| PREDICTED: serum response factor homolog A-like [Glycine max]
Length=195

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 65/194 (34%), Positives = 82/194 (42%), Gaps = 65/194 (34%)
 Frame = -2

Query  782  KPHYDITMSKRTRK------------PTNSN-----LINIQES----ADHHQSAENCISA  666
            K HYDITMS+RTRK            P   N      ++  E+    AD H + E   + 
Sbjct  9    KRHYDITMSRRTRKQQQQQRQQQQQFPVQGNEKTKSTMDDDEATPKDADVHVTVETKATQ  68

Query  665  TVKMNQVVNEGIIQGddddeeskkSLKQLIEGR----------------------RRG--  558
            TV +   V EG        E   KSLKQLI G                        RG  
Sbjct  69   TVSVAGEVKEG-------GESDHKSLKQLIIGDDDHKEAKKGSSNNNSNNNNSDHERGGK  121

Query  557  ----TSLGEHFTAEEKQLQvavvkaaaAEDGGGSNGVKFKHMISRYTKVLSHMMKLRRD-  393
                 SLGEHFT EEKQ  + +V+    +D     G+K K ++ RY KVL H+MK +RD 
Sbjct  122  GGSRNSLGEHFTEEEKQHNLQLVRMQQNKD--NLQGLKLKKLVRRYAKVLGHLMKAKRDP  179

Query  392  ------ASKPHFRL  369
                    KP F+L
Sbjct  180  HLGGDAGKKPVFKL  193



>ref|NP_001236134.1| uncharacterized protein LOC100306001 [Glycine max]
 gb|ACU13962.1| unknown [Glycine max]
Length=195

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 83/189 (44%), Gaps = 55/189 (29%)
 Frame = -2

Query  782  KPHYDITMSKRTRK--------PTNSNLINIQESADHHQSAENC-ISATV-----KMNQV  645
            K HYDITMS+RTRK        P   N     E  D   + ++  +  TV     + N  
Sbjct  9    KRHYDITMSRRTRKQQQQQQQFPVQGNEKTKSEMDDEATTPKDVHVHVTVETKSSQTNVS  68

Query  644  VNEGIIQGddddeeskkSLKQLI-------EGRRRG-----------------------T  555
            + + + +G  + +     LKQLI       E +++G                        
Sbjct  69   IADEVKEGGGESDHKS--LKQLIIGDDDHKEAKKKGNNNNNNNDNNSDDHERGGKGGSRN  126

Query  554  SLGEHFTAEEKQLQvavvkaaaAEDGGGSNGVKFKHMISRYTKVLSHMMKLRRD------  393
            SLGEHFT EEKQ  + +V+    +D     G+KFK ++ RY KVL H+MK +RD      
Sbjct  127  SLGEHFTEEEKQHNLQLVRMQQNKDN--LQGLKFKKLVRRYAKVLGHLMKAKRDPHLGGD  184

Query  392  -ASKPHFRL  369
               KP F+L
Sbjct  185  AGKKPVFKL  193



>gb|KHN21336.1| hypothetical protein glysoja_026537 [Glycine soja]
Length=196

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 83/190 (44%), Gaps = 56/190 (29%)
 Frame = -2

Query  782  KPHYDITMSKRTRK---------PTNSNLINIQESADHHQSAENC-ISATV-----KMNQ  648
            K HYDITMS+RTRK         P   N     E  D   + ++  +  TV     + N 
Sbjct  9    KRHYDITMSRRTRKQQQQQQQQFPVQGNEKTKSEMDDEATTPKDVHVHVTVETKSSQTNV  68

Query  647  VVNEGIIQGddddeeskkSLKQLI-------EGRRRG-----------------------  558
             + + + +G  + +     LKQLI       E +++G                       
Sbjct  69   SIADEVKEGGGESDHKS--LKQLIIGDDDHKEAKKKGNNNNNNNDNNSDDHERGGKGGSR  126

Query  557  TSLGEHFTAEEKQLQvavvkaaaAEDGGGSNGVKFKHMISRYTKVLSHMMKLRRD-----  393
             SLGEHFT EEKQ  + +V+    +D     G+KFK ++ RY KVL H+MK +RD     
Sbjct  127  NSLGEHFTEEEKQHNLQLVRMQQNKDN--LQGLKFKKLVRRYAKVLGHLMKAKRDPHLGG  184

Query  392  --ASKPHFRL  369
                KP F+L
Sbjct  185  DAGKKPVFKL  194



>ref|XP_010469652.1| PREDICTED: uncharacterized protein LOC104749673 [Camelina sativa]
Length=143

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 69/171 (40%), Gaps = 51/171 (30%)
 Frame = -2

Query  806  MGSEFLS-RKPHYDITMSKRTRKPTNSNLIN----------------------IQESADH  696
            MG+E +S  KP +D++MSKRTRKP +S LIN                      I++    
Sbjct  1    MGNEIISPTKPRFDLSMSKRTRKPWSS-LINDMHHLDLSTQSSQPKPDKEQEKIEDKEID  59

Query  695  HQSAENCISATVKMNQVVNEGIIQGddddeeskkSLKQLIEGRRRGTSLGEHFTAEEKQL  516
             QS  N +    K N+  N                            SLG+HF  +E   
Sbjct  60   RQSLNNLMRCEEKSNEETNVN-----------------------NKNSLGQHFGDDEGIK  96

Query  515  QvavvkaaaAEDGGGSNGVKFKHMISRYTKVLSHMMKLRRDASKPHFRLKV  363
            Q   +     + GG    VKFK M+ RY KV S ++K +RD   P  R K 
Sbjct  97   QTMQLVVKKEKLGG----VKFKGMMGRYVKVWSGLIKAKRDRKMPVLRFKT  143



>gb|KHN49060.1| hypothetical protein glysoja_031271 [Glycine soja]
Length=195

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 81/194 (42%), Gaps = 65/194 (34%)
 Frame = -2

Query  782  KPHYDITMSKRTRK------------------PTNSNLIN---IQESADHHQSAENCISA  666
            K HYDITMS+RTRK                   T S + +    ++  D H + E   + 
Sbjct  9    KRHYDITMSRRTRKQQQQQRQQQQQFPVQGNEKTKSTMDDDEATRKDVDVHVTVETKTTQ  68

Query  665  TVKMNQVVNEGIIQGddddeeskkSLKQLIEGR----------------------RRG--  558
            TV +   V EG        E   KSLKQLI G                        RG  
Sbjct  69   TVSIAGEVKEG-------GESDHKSLKQLIIGDDDHKEAKKGSSNNNSNNNNSDHERGGK  121

Query  557  ----TSLGEHFTAEEKQLQvavvkaaaAEDGGGSNGVKFKHMISRYTKVLSHMMKLRRD-  393
                 SLGEHFT EEKQ  + +V+    +D     G+K K ++ RY KVL H+MK +RD 
Sbjct  122  GGSRNSLGEHFTEEEKQHNLQLVRMQQNKDN--LQGLKLKKLVRRYAKVLGHLMKAKRDP  179

Query  392  ------ASKPHFRL  369
                    KP F+L
Sbjct  180  HLGGDAGKKPVFKL  193



>ref|XP_010510135.1| PREDICTED: uncharacterized protein LOC104786419 [Camelina sativa]
 ref|XP_010510136.1| PREDICTED: uncharacterized protein LOC104786419 [Camelina sativa]
Length=143

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 77/155 (50%), Gaps = 19/155 (12%)
 Frame = -2

Query  806  MGSEFLS-RKPHYDITMSKRTRKPTNSNLINIQESADHHQSAENCISATVKMNQVVNEGI  630
            MGSE +S  KP +D++MSKRTRKP +S LIN     D H    +  S+  K ++   +  
Sbjct  1    MGSEVISPTKPRFDLSMSKRTRKPWSS-LIN-----DMHYLDLSTQSSQPKPDK--EQEK  52

Query  629  IQGddddeeskkSLKQLIEGRRRGT------SLGEHFTAEEKQLQvavvkaaaAEDGGGS  468
            I+  + D +S  +L +  E     T      SL +HF  +E   Q   +     + GG  
Sbjct  53   IENKEIDRQSLNNLMRCEEKSNEETNVNNKNSLSQHFGDDEGIKQTMQLVVKKEKLGG--  110

Query  467  NGVKFKHMISRYTKVLSHMMKLRRDASKPHFRLKV  363
              VKFK M+ RY KV S ++K +RD   P  R K 
Sbjct  111  --VKFKGMVGRYVKVWSGLIKAKRDRKTPVLRFKT  143



>ref|XP_008461224.1| PREDICTED: uncharacterized protein LOC103499874 [Cucumis melo]
Length=143

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 69/140 (49%), Gaps = 30/140 (21%)
 Frame = -2

Query  806  MGSEFLSRKPHYDITMSKRTRKPTNSNLINIQESADHHQSAENCISATVKMNQVVNEGII  627
            MGSE +S K HYDI+MSKRTRKP       IQ+   +  S ++ +S       ++++G  
Sbjct  1    MGSESISHKQHYDISMSKRTRKPA-----KIQDELQNFTSKDDGLS-------IIDKG--  46

Query  626  QGddddeeskkSLKQLI-----------EGRRRGTSLGEHFTAEEKQLQvavvkaaaAED  480
                +     KSLKQLI           EG R   SLG+HF+ EE  +    +     +D
Sbjct  47   -DRSESNNDHKSLKQLISGEGKAETRLDEGNRERNSLGQHFSKEE--INNLQIVKKQHQD  103

Query  479  GGGSNGVKFKHMISRYTKVL  420
              G  GVK K ++ ++ + L
Sbjct  104  --GLQGVKLKKVVGKFLRNL  121



>ref|XP_002862931.1| hypothetical protein ARALYDRAFT_497238 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39190.1| hypothetical protein ARALYDRAFT_497238 [Arabidopsis lyrata subsp. 
lyrata]
Length=144

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 72/151 (48%), Gaps = 10/151 (7%)
 Frame = -2

Query  806  MGSEFLS-RKPHYDITMSKRTRKPTNSNLINIQESADHHQSAENCISATVKMNQVVNEGI  630
            MG E ++  KP +D++MSKRTRKP +S LIN  ++  H  S ++      K  + + +  
Sbjct  1    MGGEVINPTKPRFDLSMSKRTRKPWSS-LIN--DTHHHEISTQSSQPKPDKEQEQIEDKE  57

Query  629  IQGddddeeskkSLKQLIEGRRRG--TSLGEHFTAEEKQLQvavvkaaaAEDGGGSNGVK  456
            I     +   +   K   E       +SL +HF  +E   Q   +     + GG    VK
Sbjct  58   IDRKSLNNLMRYEEKPNGEANVNNDKSSLDQHFGDDEGIKQTMQLVVKKEKQGG----VK  113

Query  455  FKHMISRYTKVLSHMMKLRRDASKPHFRLKV  363
            FK M+ RY KV S ++K +RD   P  R K 
Sbjct  114  FKGMMGRYVKVWSGLIKAKRDRKTPVLRFKT  144



>ref|XP_002879350.1| hypothetical protein ARALYDRAFT_902232 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55609.1| hypothetical protein ARALYDRAFT_902232 [Arabidopsis lyrata subsp. 
lyrata]
Length=144

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 72/151 (48%), Gaps = 10/151 (7%)
 Frame = -2

Query  806  MGSEFLS-RKPHYDITMSKRTRKPTNSNLINIQESADHHQSAENCISATVKMNQVVNEGI  630
            MG E ++  KP +D++MSKRTRKP +S LIN  ++  H  S ++      K  + + +  
Sbjct  1    MGGEVINPTKPRFDLSMSKRTRKPWSS-LIN--DTHHHDISTQSSQPKPDKEQEQIEDKE  57

Query  629  IQGddddeeskkSLKQLIEGRRRG--TSLGEHFTAEEKQLQvavvkaaaAEDGGGSNGVK  456
            I     +   +   K   E       +SL +HF  +E   Q   +     + GG    VK
Sbjct  58   IDRKSLNNLMRYEEKPNGEANVNNDKSSLDQHFGDDEGIKQTMQLVVKKEKQGG----VK  113

Query  455  FKHMISRYTKVLSHMMKLRRDASKPHFRLKV  363
            FK M+ RY KV S ++K +RD   P  R K 
Sbjct  114  FKGMMGRYVKVWSGLIKAKRDRKTPVLRFKT  144



>ref|XP_010414063.1| PREDICTED: uncharacterized protein LOC104700270 [Camelina sativa]
Length=143

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 68/171 (40%), Gaps = 51/171 (30%)
 Frame = -2

Query  806  MGSEFLS-RKPHYDITMSKRTRKPTNSNLIN----------------------IQESADH  696
            MGSE +S  KP +D++MSKRTRKP +S LIN                      I++    
Sbjct  1    MGSEVISPTKPRFDLSMSKRTRKPWSS-LINDMHHLDLSTQSSQPKPDKEQEKIEDKEID  59

Query  695  HQSAENCISATVKMNQVVNEGIIQGddddeeskkSLKQLIEGRRRGTSLGEHFTAEEKQL  516
             QS  N +    K N+  N                            SLG+HF  +E   
Sbjct  60   RQSLNNLMRCEEKSNEETNVN-----------------------NKNSLGQHFGDDEGIK  96

Query  515  QvavvkaaaAEDGGGSNGVKFKHMISRYTKVLSHMMKLRRDASKPHFRLKV  363
            Q   +     + GG    +KFK M+ RY KV S ++K +RD   P    K 
Sbjct  97   QTMQLVVKKEKLGG----MKFKGMMGRYVKVWSGLIKAKRDRKTPVLLFKT  143



>ref|XP_006295508.1| hypothetical protein CARUB_v10024612mg [Capsella rubella]
 gb|EOA28406.1| hypothetical protein CARUB_v10024612mg [Capsella rubella]
Length=147

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 79/158 (50%), Gaps = 21/158 (13%)
 Frame = -2

Query  806  MGSEFLS-RKPHYDITMSKRTRKPTNSNLINIQESADHHQSAENCISATVKMNQVVNEGI  630
            MGSE ++  KP +D++MSKRTRKP +S  +N    +D H    +  S+  K +    +  
Sbjct  1    MGSEVINLTKPRFDLSMSKRTRKPWSS--LN----SDMHHQDISTQSSQPKPDDDKEQDE  54

Query  629  IQGddddeeskkSLKQLIE--------GRRRGTSLGEHFTAEEKQLQvavvkaaaAEDGG  474
            I+  + D +S  +L +  E        G  + +SLG+HF  +E   Q   +     + G 
Sbjct  55   IEDKEIDRKSLNNLMRCEEKSNGEANNGNNK-SSLGQHFGDDEGIKQTMQLVVKKEKQG-  112

Query  473  GSNGVKFKHMISRYTKVLSHMMKLRR-DASKPHFRLKV  363
               GVKFK M+ RY KV S ++K +R D   P  R K 
Sbjct  113  ---GVKFKGMMGRYVKVWSGLIKAKRTDRKTPVLRFKT  147



>gb|KGN45181.1| hypothetical protein Csa_7G430160 [Cucumis sativus]
Length=144

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 65/140 (46%), Gaps = 30/140 (21%)
 Frame = -2

Query  806  MGSEFLSRKPHYDITMSKRTRKPTNSNLINIQESADHHQSAENCISATVKMNQVVNEGII  627
            MGSE +S K HYDI+MSKRTRKP       IQ+      + ++ +    K +Q       
Sbjct  1    MGSESISHKQHYDISMSKRTRKPA-----KIQDELQILPTNDDDLIIIGKGDQ-------  48

Query  626  QGddddeeskkSLKQLI-----------EGRRRGTSLGEHFTAEEKQLQvavvkaaaAED  480
                +     KSLKQLI           EG R   SLG+HF+ EE  +    +     +D
Sbjct  49   ---SEINNDHKSLKQLISGEGKAEIRSDEGNRERNSLGQHFSKEE--INNLQIVKKQHQD  103

Query  479  GGGSNGVKFKHMISRYTKVL  420
              G  GVK K ++ ++ + L
Sbjct  104  --GLQGVKLKKVVGKFLRNL  121



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2217996789222