BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18884_g2_i1 len=1539 path=[1:0-72 74:73-1458 1460:1459-1482
3588:1483-1538]

Length=1539
                                                                      Score     E

ref|XP_004230936.1|  PREDICTED: UPF0496 protein At4g34320-like          538   0.0      
ref|XP_009605015.1|  PREDICTED: UPF0496 protein At4g34320-like          537   0.0      
emb|CDO97084.1|  unnamed protein product                                537   0.0      
ref|XP_002281050.2|  PREDICTED: UPF0496 protein At4g34320-like is...    540   0.0      Vitis vinifera
ref|XP_009797274.1|  PREDICTED: UPF0496 protein At4g34320-like          536   0.0      
ref|XP_010647846.1|  PREDICTED: UPF0496 protein At4g34320-like is...    535   0.0      
ref|XP_006365509.1|  PREDICTED: UPF0496 protein At4g34320-like          533   0.0      
ref|XP_011088346.1|  PREDICTED: UPF0496 protein At4g34320               530   0.0      
ref|XP_003537895.1|  PREDICTED: UPF0496 protein At4g34320-like          528   0.0      
ref|XP_003541076.1|  PREDICTED: UPF0496 protein At4g34320-like          521   3e-179   
ref|XP_011037574.1|  PREDICTED: UPF0496 protein At4g34320-like          520   4e-179   
gb|KDO51452.1|  hypothetical protein CISIN_1g040233mg                   520   6e-179   
ref|XP_006423198.1|  hypothetical protein CICLE_v10030403mg             518   2e-178   
ref|XP_008365973.1|  PREDICTED: UPF0496 protein At4g34320-like          516   2e-177   
ref|XP_009344780.1|  PREDICTED: UPF0496 protein At4g34320-like          515   4e-177   
ref|XP_004507409.1|  PREDICTED: UPF0496 protein At4g34320-like          512   6e-176   
ref|XP_004289620.1|  PREDICTED: UPF0496 protein At4g34320-like          512   9e-176   
ref|XP_002519094.1|  AT14A, putative                                    512   1e-175   Ricinus communis
ref|XP_002313064.1|  hypothetical protein POPTR_0009s11550g             511   1e-175   Populus trichocarpa [western balsam poplar]
ref|XP_007042727.1|  UPF0496 protein                                    511   2e-175   
ref|XP_008387354.1|  PREDICTED: LOW QUALITY PROTEIN: UPF0496 prot...    510   4e-175   
ref|XP_009334187.1|  PREDICTED: UPF0496 protein At4g34320-like          509   8e-175   
ref|XP_011048925.1|  PREDICTED: UPF0496 protein At4g34320-like          508   2e-174   
gb|KDP46219.1|  hypothetical protein JCGZ_10059                         508   5e-174   
ref|XP_011092769.1|  PREDICTED: UPF0496 protein At4g34320-like          506   9e-174   
ref|XP_007131859.1|  hypothetical protein PHAVU_011G047500g             506   2e-173   
ref|XP_007201071.1|  hypothetical protein PRUPE_ppa007273mg             504   6e-173   
ref|XP_008236784.1|  PREDICTED: UPF0496 protein At4g34320-like          504   8e-173   
gb|KEH30404.1|  UPF0496 plant-like protein                              503   3e-172   
ref|XP_002306083.1|  hypothetical protein POPTR_0004s15800g             501   9e-172   Populus trichocarpa [western balsam poplar]
ref|XP_003529196.1|  PREDICTED: UPF0496 protein At4g34320-like          497   5e-170   
ref|XP_007153142.1|  hypothetical protein PHAVU_003G010400g             491   1e-167   
ref|XP_004148297.1|  PREDICTED: UPF0496 protein At4g34320-like          484   4e-165   
ref|XP_008447055.1|  PREDICTED: UPF0496 protein At4g34320-like          479   5e-163   
ref|XP_010690930.1|  PREDICTED: UPF0496 protein At4g34320-like          476   1e-161   
gb|KHN02045.1|  UPF0496 protein                                         474   2e-161   
ref|XP_008806206.1|  PREDICTED: UPF0496 protein 1-like                  472   2e-160   
gb|EYU37760.1|  hypothetical protein MIMGU_mgv1a008357mg                471   8e-160   
ref|XP_002869155.1|  hypothetical protein ARALYDRAFT_491233             469   4e-159   
ref|NP_195158.1|  uncharacterized protein                               469   4e-159   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006285511.1|  hypothetical protein CARUB_v10006952mg             468   1e-158   
ref|XP_009388042.1|  PREDICTED: UPF0496 protein 1-like                  468   3e-158   
ref|XP_004498189.1|  PREDICTED: UPF0496 protein At4g34320-like          467   4e-158   
ref|XP_010939026.1|  PREDICTED: UPF0496 protein 1-like                  466   9e-158   
ref|XP_010432431.1|  PREDICTED: UPF0496 protein At4g34320               466   1e-157   
ref|XP_010530851.1|  PREDICTED: UPF0496 protein At4g34320-like is...    466   1e-157   
ref|XP_010530852.1|  PREDICTED: UPF0496 protein At4g34320-like is...    466   1e-157   
ref|XP_010447101.1|  PREDICTED: UPF0496 protein At4g34320-like          464   5e-157   
ref|XP_010437629.1|  PREDICTED: UPF0496 protein At4g34320-like is...    464   6e-157   
gb|KEH40778.1|  UPF0496 plant-like protein                              463   1e-156   
gb|EYU41177.1|  hypothetical protein MIMGU_mgv1a008261mg                461   1e-155   
gb|AFK35357.1|  unknown                                                 460   2e-155   
ref|XP_009138282.1|  PREDICTED: UPF0496 protein At4g34320               458   1e-154   
ref|XP_009138287.1|  PREDICTED: UPF0496 protein At4g34320-like          457   2e-154   
emb|CDY46260.1|  BnaC03g66210D                                          456   1e-153   
ref|XP_010028566.1|  PREDICTED: UPF0496 protein At4g34320-like          454   2e-153   
emb|CDX76273.1|  BnaA08g11270D                                          452   3e-152   
ref|XP_010254953.1|  PREDICTED: UPF0496 protein At4g34320-like          451   4e-152   
ref|XP_009108740.1|  PREDICTED: UPF0496 protein At4g34320-like          451   1e-151   
ref|XP_006649570.1|  PREDICTED: UPF0496 protein 1-like                  450   2e-151   
ref|XP_002468329.1|  hypothetical protein SORBIDRAFT_01g043880          450   3e-151   Sorghum bicolor [broomcorn]
ref|XP_003558574.1|  PREDICTED: UPF0496 protein 1                       447   2e-150   
ref|XP_008652317.1|  PREDICTED: UPF0496 protein 1                       447   3e-150   
ref|XP_009386153.1|  PREDICTED: UPF0496 protein 1-like                  447   6e-150   
ref|NP_001049283.1|  Os03g0199100                                       446   7e-150   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001145902.1|  hypothetical protein                               446   9e-150   Zea mays [maize]
ref|XP_004985322.1|  PREDICTED: UPF0496 protein 1-like                  444   2e-149   
dbj|BAJ93975.1|  predicted protein                                      443   1e-148   
ref|XP_010247000.1|  PREDICTED: UPF0496 protein At4g34320-like          437   1e-146   
ref|XP_009408039.1|  PREDICTED: UPF0496 protein 1-like                  435   2e-145   
ref|XP_008459259.1|  PREDICTED: UPF0496 protein At4g34320-like          427   1e-142   
ref|XP_004161622.1|  PREDICTED: UPF0496 protein At4g34320-like          429   1e-142   
gb|KGN61767.1|  hypothetical protein Csa_2G238830                       428   3e-142   
ref|XP_004145340.1|  PREDICTED: UPF0496 protein At4g34320-like          428   4e-142   
ref|XP_010943147.1|  PREDICTED: UPF0496 protein 1-like                  421   6e-140   
gb|KHN25354.1|  UPF0496 protein                                         415   5e-139   
ref|XP_004972533.1|  PREDICTED: UPF0496 protein 1-like                  414   3e-137   
ref|XP_010029837.1|  PREDICTED: UPF0496 protein At2g18630-like          411   2e-136   
ref|XP_009394364.1|  PREDICTED: UPF0496 protein 1-like isoform X2       403   8e-133   
ref|XP_008660446.1|  PREDICTED: UPF0496 protein 1-like                  398   5e-131   
ref|XP_009379180.1|  PREDICTED: UPF0496 protein At2g18630-like          395   3e-130   
gb|KDP31809.1|  hypothetical protein JCGZ_12270                         395   8e-130   
ref|XP_006425739.1|  hypothetical protein CICLE_v10025839mg             393   3e-129   
ref|XP_008775796.1|  PREDICTED: UPF0496 protein 1-like isoform X3       391   3e-128   
ref|XP_008338852.1|  PREDICTED: UPF0496 protein At2g18630-like          390   4e-128   
ref|XP_009374219.1|  PREDICTED: UPF0496 protein At4g34320-like          388   5e-127   
ref|XP_010649192.1|  PREDICTED: UPF0496 protein At4g34320-like          387   8e-127   
ref|XP_008352479.1|  PREDICTED: UPF0496 protein At4g34320-like          384   2e-125   
ref|XP_008775795.1|  PREDICTED: UPF0496 protein 1-like isoform X2       383   6e-125   
ref|XP_008775794.1|  PREDICTED: UPF0496 protein 1-like isoform X1       383   9e-125   
gb|AAL58139.1|AC093093_12  hypothetical protein                         379   2e-123   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006856114.1|  hypothetical protein AMTR_s00059p00142910          375   2e-122   
gb|EPS58393.1|  hypothetical protein M569_16421                         374   8e-122   
ref|XP_007202121.1|  hypothetical protein PRUPE_ppa006925mg             374   1e-121   
gb|EMT23432.1|  hypothetical protein F775_11302                         371   1e-121   
ref|XP_008241622.1|  PREDICTED: UPF0496 protein At2g18630               373   2e-121   
emb|CDY45304.1|  BnaA03g52770D                                          370   3e-121   
ref|XP_011085548.1|  PREDICTED: UPF0496 protein 1-like                  373   7e-121   
ref|XP_010531185.1|  PREDICTED: LOW QUALITY PROTEIN: UPF0496 prot...    368   2e-119   
ref|XP_010432428.1|  PREDICTED: UPF0496 protein At4g34320-like          367   3e-119   
gb|KHG15186.1|  hypothetical protein F383_03556                         369   6e-119   
ref|XP_004300596.1|  PREDICTED: UPF0496 protein At2g18630-like is...    366   1e-118   
gb|EEC66800.1|  hypothetical protein OsI_33205                          362   6e-117   Oryza sativa Indica Group [Indian rice]
ref|NP_195159.1|  uncharacterized protein                               361   6e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002525095.1|  AT14A, putative                                    360   3e-116   Ricinus communis
gb|KHN00564.1|  UPF0496 protein                                         359   5e-116   
ref|XP_010680903.1|  PREDICTED: UPF0496 protein 1-like                  358   2e-115   
ref|XP_009386739.1|  PREDICTED: UPF0496 protein 1-like                  359   2e-115   
ref|XP_003611921.1|  hypothetical protein MTR_5g019430                  357   4e-115   
ref|NP_179453.2|  uncharacterized protein                               357   4e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006296613.1|  hypothetical protein CARUB_v10013876mg             357   5e-115   
gb|AAD08932.1|  At14a, putative                                         357   7e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007047030.1|  Uncharacterized protein TCM_000456                 356   1e-114   
ref|XP_010447098.1|  PREDICTED: UPF0496 protein At4g34320-like          355   2e-114   
ref|XP_006573602.1|  PREDICTED: UPF0496 protein At2g18630-like is...    355   2e-114   
ref|XP_010489568.1|  PREDICTED: UPF0496 protein At2g18630               354   1e-113   
ref|XP_010099360.1|  hypothetical protein L484_009177                   353   1e-113   
gb|EYU44304.1|  hypothetical protein MIMGU_mgv1a007475mg                354   2e-113   
ref|XP_010414492.1|  PREDICTED: UPF0496 protein At2g18630               353   3e-113   
gb|KHN36151.1|  UPF0496 protein                                         352   4e-113   
ref|XP_009406021.1|  PREDICTED: UPF0496 protein 1-like                  352   8e-113   
ref|XP_010467691.1|  PREDICTED: UPF0496 protein At2g18630-like          352   9e-113   
ref|XP_006285951.1|  hypothetical protein CARUB_v10007471mg             349   3e-112   
ref|XP_010437628.1|  PREDICTED: UPF0496 protein At4g34320-like          348   4e-112   
ref|XP_009396891.1|  PREDICTED: UPF0496 protein 1-like isoform X2       347   6e-111   
ref|XP_009396890.1|  PREDICTED: UPF0496 protein 1-like isoform X1       347   6e-111   
ref|XP_006286139.1|  hypothetical protein CARUB_v10007694mg             344   6e-110   
gb|EPS58408.1|  hypothetical protein M569_16405                         344   1e-109   
ref|XP_003537511.1|  PREDICTED: UPF0496 protein At2g18630-like is...    343   1e-109   
ref|XP_002310784.2|  hypothetical protein POPTR_0007s12320g             342   2e-109   Populus trichocarpa [western balsam poplar]
emb|CDY13018.1|  BnaC07g03170D                                          341   1e-108   
ref|XP_002865053.1|  hypothetical protein ARALYDRAFT_496934             340   2e-108   
emb|CDY43904.1|  BnaA07g01810D                                          340   3e-108   
ref|XP_009114701.1|  PREDICTED: UPF0496 protein At2g18630 isoform X1    339   4e-108   
ref|XP_009114703.1|  PREDICTED: UPF0496 protein At2g18630 isoform X2    339   4e-108   
gb|EYU39376.1|  hypothetical protein MIMGU_mgv1a019801mg                340   7e-108   
ref|XP_010558093.1|  PREDICTED: UPF0496 protein At5g66675-like is...    339   5e-107   
ref|XP_010558085.1|  PREDICTED: UPF0496 protein At5g66675-like is...    340   8e-107   
ref|XP_009112552.1|  PREDICTED: UPF0496 protein At2g18630-like          336   1e-106   
ref|NP_850929.1|  uncharacterized protein                               336   1e-106   Arabidopsis thaliana [mouse-ear cress]
gb|KFK28347.1|  hypothetical protein AALP_AA8G504300                    335   2e-106   
ref|XP_010999946.1|  PREDICTED: UPF0496 protein At2g18630-like is...    334   5e-106   
ref|XP_006393860.1|  hypothetical protein EUTSA_v10004318mg             335   6e-106   
ref|XP_006283979.1|  hypothetical protein CARUB_v10005102mg             332   1e-105   
ref|XP_006409128.1|  hypothetical protein EUTSA_v10022714mg             333   1e-105   
sp|Q7XFE1.2|U496E_ORYSJ  RecName: Full=Putative UPF0496 protein 5       334   1e-105   Oryza sativa Japonica Group [Japonica rice]
emb|CDY51496.1|  BnaC09g51110D                                          332   2e-105   
emb|CDY30310.1|  BnaA09g09670D                                          331   4e-105   
ref|XP_006412239.1|  hypothetical protein EUTSA_v100255251mg            327   7e-105   
emb|CDX81379.1|  BnaC09g07900D                                          331   1e-104   
ref|XP_002884146.1|  hypothetical protein ARALYDRAFT_319811             331   1e-104   
ref|XP_003629491.1|  hypothetical protein MTR_8g078100                  329   2e-104   
ref|XP_006280557.1|  hypothetical protein CARUB_v10026498mg             330   3e-104   
ref|XP_007156894.1|  hypothetical protein PHAVU_002G026300g             329   3e-104   
ref|XP_009112322.1|  PREDICTED: UPF0496 protein At5g66675               328   2e-103   
ref|XP_010444753.1|  PREDICTED: UPF0496 protein At5g66675-like          325   3e-102   
ref|XP_010484602.1|  PREDICTED: UPF0496 protein At5g66675               325   3e-102   
ref|XP_011025711.1|  PREDICTED: UPF0496 protein At2g18630               323   4e-102   
ref|XP_010550396.1|  PREDICTED: UPF0496 protein At5g66675-like          323   2e-101   
gb|KHN44506.1|  UPF0496 protein                                         321   2e-101   
gb|AFK35402.1|  unknown                                                 319   6e-101   
ref|XP_006383250.1|  hypothetical protein POPTR_0005s12870g             320   8e-101   
sp|A2Z6C5.1|U496E_ORYSI  RecName: Full=Putative UPF0496 protein 5       320   4e-100   Oryza sativa Indica Group [Indian rice]
ref|XP_010465078.1|  PREDICTED: UPF0496 protein At5g66675-like          318   1e-99    
emb|CDX72478.1|  BnaC07g45000D                                          312   6e-99    
gb|KHG21625.1|  hypothetical protein F383_27631                         314   9e-98    
ref|XP_006361572.1|  PREDICTED: UPF0496 protein 1-like                  311   3e-97    
gb|KCW62869.1|  hypothetical protein EUGRSUZ_G00466                     308   2e-96    
ref|XP_010068116.1|  PREDICTED: UPF0496 protein At4g34320-like          308   2e-96    
ref|XP_010432430.1|  PREDICTED: UPF0496 protein At4g34320-like          306   1e-95    
ref|XP_010042346.1|  PREDICTED: UPF0496 protein At4g34320-like          305   5e-95    
gb|KCW62868.1|  hypothetical protein EUGRSUZ_G00464                     304   8e-95    
ref|XP_010068114.1|  PREDICTED: UPF0496 protein At4g34320-like          304   8e-95    
ref|XP_002869154.1|  hypothetical protein ARALYDRAFT_353391             301   2e-94    
ref|XP_010027373.1|  PREDICTED: UPF0496 protein At4g34320-like          302   4e-94    
gb|KCW62329.1|  hypothetical protein EUGRSUZ_H04971                     301   6e-94    
emb|CDP02406.1|  unnamed protein product                                298   2e-93    
ref|XP_009801742.1|  PREDICTED: UPF0496 protein 1-like                  301   4e-93    
ref|XP_010066381.1|  PREDICTED: UPF0496 protein At4g34320-like          299   6e-93    
ref|XP_004250688.1|  PREDICTED: UPF0496 protein 1-like                  300   1e-92    
ref|XP_010451056.1|  PREDICTED: UPF0496 protein At4g34320-like          295   4e-92    
ref|XP_010680904.1|  PREDICTED: UPF0496 protein 1-like                  296   3e-91    
ref|XP_009586590.1|  PREDICTED: UPF0496 protein 1-like                  296   3e-91    
ref|XP_010042437.1|  PREDICTED: UPF0496 protein At4g34320-like          293   1e-90    
gb|KCW64258.1|  hypothetical protein EUGRSUZ_G01899                     293   2e-90    
ref|XP_010999947.1|  PREDICTED: UPF0496 protein At2g18630-like is...    291   2e-90    
gb|EPS58212.1|  hypothetical protein M569_16603                         291   3e-89    
ref|XP_010447099.1|  PREDICTED: UPF0496 protein At4g34320-like          289   1e-88    
ref|XP_010026158.1|  PREDICTED: UPF0496 protein At2g18630-like          286   1e-87    
ref|XP_010042669.1|  PREDICTED: UPF0496 protein At2g18630-like          285   2e-87    
ref|XP_004301900.1|  PREDICTED: uncharacterized protein LOC101291734    296   4e-86    
ref|XP_010451057.1|  PREDICTED: UPF0496 protein At4g34320-like          281   6e-86    
ref|XP_010451058.1|  PREDICTED: uncharacterized protein LOC104733148    281   3e-83    
ref|XP_010026159.1|  PREDICTED: UPF0496 protein 1-like                  273   8e-83    
ref|XP_008457896.1|  PREDICTED: UPF0496 protein At2g18630-like is...    261   8e-78    
ref|XP_008457897.1|  PREDICTED: UPF0496 protein At2g18630-like is...    259   2e-77    
ref|XP_002983926.1|  hypothetical protein SELMODRAFT_119515             257   1e-76    
gb|KCW58575.1|  hypothetical protein EUGRSUZ_H01233                     258   2e-76    
ref|XP_010068111.1|  PREDICTED: UPF0496 protein At4g34320-like          254   3e-76    
ref|XP_010026389.1|  PREDICTED: UPF0496 protein 1-like                  256   3e-76    
ref|XP_002960085.1|  hypothetical protein SELMODRAFT_74510              255   5e-76    
ref|XP_002984054.1|  hypothetical protein SELMODRAFT_119122             255   9e-76    
ref|XP_002960745.1|  hypothetical protein SELMODRAFT_74185              255   1e-75    
ref|XP_004148443.1|  PREDICTED: UPF0496 protein At2g18630-like          253   3e-75    
ref|XP_002960974.1|  hypothetical protein SELMODRAFT_402496             253   5e-75    
ref|XP_010026393.1|  PREDICTED: UPF0496 protein At4g34320-like          243   3e-70    
ref|XP_010484606.1|  PREDICTED: UPF0496 protein At5g66670-like          233   6e-67    
ref|XP_002525093.1|  AT14A, putative                                    231   7e-67    Ricinus communis
ref|XP_010465105.1|  PREDICTED: UPF0496 protein At5g66670-like          232   8e-67    
ref|XP_010026157.1|  PREDICTED: UPF0496 protein At2g18630-like          231   9e-67    
ref|XP_002865055.1|  hypothetical protein ARALYDRAFT_920059             231   2e-66    
ref|XP_001757691.1|  predicted protein                                  231   2e-66    
ref|XP_010444756.1|  PREDICTED: UPF0496 protein At5g66670-like is...    229   1e-65    
ref|XP_009103499.1|  PREDICTED: UPF0496 protein At5g66670-like          228   1e-65    
ref|XP_010444757.1|  PREDICTED: UPF0496 protein At5g66670-like is...    229   2e-65    
gb|KCW64260.1|  hypothetical protein EUGRSUZ_G019022                    223   2e-65    
gb|ABK28300.1|  unknown                                                 228   3e-65    Arabidopsis thaliana [mouse-ear cress]
ref|NP_201467.1|  uncharacterized protein                               228   3e-65    Arabidopsis thaliana [mouse-ear cress]
ref|NP_201468.1|  uncharacterized protein                               228   3e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010910757.1|  PREDICTED: UPF0496 protein 1-like                  225   3e-64    
gb|KCW59243.1|  hypothetical protein EUGRSUZ_H01920                     220   2e-63    
ref|XP_002865054.1|  hypothetical protein ARALYDRAFT_920058             222   6e-63    
ref|XP_006279638.1|  hypothetical protein CARUB_v10026516mg             222   6e-63    
emb|CDY45250.1|  BnaA07g12400D                                          221   1e-62    
gb|EPS73740.1|  hypothetical protein M569_01016                         214   9e-62    
ref|XP_010070449.1|  PREDICTED: UPF0496 protein At2g18630-like          214   1e-60    
gb|KCW58572.1|  hypothetical protein EUGRSUZ_H01229                     207   3e-58    
emb|CDY69791.1|  BnaCnng65370D                                          209   8e-58    
ref|XP_010041211.1|  PREDICTED: UPF0496 protein At4g34320-like          200   3e-56    
emb|CDY54199.1|  BnaCnng26390D                                          204   3e-56    
ref|XP_010026153.1|  PREDICTED: UPF0496 protein At5g66675-like          201   3e-56    
emb|CBI32550.3|  unnamed protein product                                194   7e-55    
ref|XP_009138584.1|  PREDICTED: UPF0496 protein At4g34320-like          194   1e-54    
ref|XP_010026156.1|  PREDICTED: UPF0496 protein At2g18630-like          193   3e-53    
gb|KCW58574.1|  hypothetical protein EUGRSUZ_H01231                     191   1e-52    
ref|XP_010026391.1|  PREDICTED: UPF0496 protein 1-like                  191   3e-52    
ref|XP_010026392.1|  PREDICTED: uncharacterized protein LOC104416741    198   9e-52    
ref|XP_011025709.1|  PREDICTED: UPF0496 protein At2g18630-like is...    188   1e-50    
ref|XP_010026152.1|  PREDICTED: UPF0496 protein At2g18630-like          184   1e-49    
ref|XP_002984051.1|  hypothetical protein SELMODRAFT_423223             184   3e-48    
gb|KFK28345.1|  hypothetical protein AALP_AA8G504100                    187   5e-48    
gb|ABR25727.1|  unknown                                                 170   1e-46    Oryza sativa Indica Group [Indian rice]
gb|KHN16742.1|  UPF0496 protein                                         166   6e-45    
gb|KCW44471.1|  hypothetical protein EUGRSUZ_L020211                    167   7e-44    
gb|AFK42892.1|  unknown                                                 162   1e-43    
ref|XP_009394362.1|  PREDICTED: long chain base biosynthesis prot...    170   2e-42    
ref|XP_010550397.1|  PREDICTED: UPF0496 protein At5g66675-like          164   2e-42    
gb|KCW64262.1|  hypothetical protein EUGRSUZ_G019032                    156   1e-41    
ref|XP_007199031.1|  hypothetical protein PRUPE_ppa017922mg             160   1e-41    
ref|NP_566836.1|  uncharacterized protein                               155   1e-38    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006662290.1|  PREDICTED: putative UPF0496 protein 5-like         150   1e-37    
gb|AAL16206.1|AF428437_1  AT3g28270/MZF16_5                             150   5e-37    Arabidopsis thaliana [mouse-ear cress]
emb|CDY33577.1|  BnaC06g29750D                                          150   9e-37    
gb|KFK37698.1|  hypothetical protein AALP_AA3G017200                    148   2e-36    
ref|XP_007199414.1|  hypothetical protein PRUPE_ppa026278mg             146   2e-35    
ref|XP_008236802.1|  PREDICTED: UPF0496 protein At4g34320-like          144   9e-35    
ref|XP_008236803.1|  PREDICTED: UPF0496 protein At4g34320-like          142   6e-34    
ref|XP_010430836.1|  PREDICTED: UPF0496 protein At3g28270-like          141   8e-34    
ref|XP_010041287.1|  PREDICTED: UPF0496 protein At4g34320-like          134   4e-33    
ref|XP_009105438.1|  PREDICTED: UPF0496 protein At5g66660-like          138   1e-32    
ref|XP_011025710.1|  PREDICTED: UPF0496 protein At2g18630-like is...    136   1e-32    
emb|CDY33576.1|  BnaC06g29760D                                          136   8e-32    
ref|XP_010068110.1|  PREDICTED: UPF0496 protein At4g34320-like          129   1e-31    
ref|XP_010502825.1|  PREDICTED: UPF0496 protein At3g28270-like          134   4e-31    
ref|XP_008236779.1|  PREDICTED: UPF0496 protein At4g34320-like          132   2e-30    
emb|CDX95979.1|  BnaA07g27520D                                          130   5e-30    
ref|XP_006291279.1|  hypothetical protein CARUB_v10017410mg             130   5e-30    
gb|AAN60266.1|  unknown                                                 127   3e-29    Arabidopsis thaliana [mouse-ear cress]
emb|CDX95978.1|  BnaA07g27530D                                          126   1e-28    
gb|EYU41176.1|  hypothetical protein MIMGU_mgv1a022893mg                119   3e-28    
ref|XP_006291290.1|  hypothetical protein CARUB_v10017426mg             125   3e-28    
ref|XP_010428830.1|  PREDICTED: UPF0496 protein At3g28270-like          122   2e-27    
gb|AAN60297.1|  unknown                                                 120   1e-26    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010026155.1|  PREDICTED: UPF0496 protein At2g18630-like          115   1e-26    
ref|XP_002310783.1|  hypothetical protein POPTR_0007s12310g             116   3e-26    Populus trichocarpa [western balsam poplar]
ref|XP_010534149.1|  PREDICTED: UPF0496 protein At3g57100-like          117   7e-26    
ref|XP_006291317.1|  hypothetical protein CARUB_v10017451mg             118   8e-26    
ref|XP_006412240.1|  hypothetical protein EUTSA_v100255250mg            108   7e-25    
ref|XP_010521290.1|  PREDICTED: UPF0496 protein At3g57100-like          114   2e-24    
gb|EMS58972.1|  hypothetical protein TRIUR3_24193                       107   3e-24    
ref|XP_009105631.1|  PREDICTED: UPF0496 protein At5g66670-like          110   3e-23    
ref|XP_006290444.1|  hypothetical protein CARUB_v10019413mg             110   3e-23    
gb|KCW64263.1|  hypothetical protein EUGRSUZ_G019031                    105   8e-23    
ref|XP_008236810.1|  PREDICTED: UPF0496 protein At4g34320-like          108   1e-22    
ref|NP_189469.1|  AT14A-like protein                                    108   1e-22    
ref|XP_010068633.1|  PREDICTED: UPF0496 protein 1-like                  105   2e-22    
ref|XP_010507095.1|  PREDICTED: UPF0496 protein At3g28270-like          106   4e-22    
ref|XP_006291272.1|  hypothetical protein CARUB_v10017404mg             106   1e-21    
sp|Q6E240.3|U496E_ARATH  RecName: Full=UPF0496 protein At3g28310/...    106   1e-21    
ref|XP_010507094.1|  PREDICTED: UPF0496 protein At3g28270-like          105   1e-21    
dbj|BAD93736.1|  At14a-2 integrin - like protein                        105   1e-21    
ref|XP_010534644.1|  PREDICTED: UPF0496 protein At4g34320-like          104   4e-21    
ref|XP_010502824.1|  PREDICTED: UPF0496 protein At3g28270-like          104   5e-21    
ref|XP_006279201.1|  hypothetical protein CARUB_v10000007mg             102   1e-20    
ref|XP_002878132.1|  hypothetical protein ARALYDRAFT_907169             102   2e-20    
emb|CDY70082.1|  BnaCnng66610D                                        99.4    7e-20    
ref|XP_006291248.1|  hypothetical protein CARUB_v10017379mg           99.8    3e-19    
ref|XP_010534304.1|  PREDICTED: UPF0496 protein At3g57100-like is...  98.2    6e-19    
ref|XP_010534290.1|  PREDICTED: UPF0496 protein At3g57100-like        97.8    7e-19    
emb|CDX91988.1|  BnaC03g32900D                                        96.7    2e-18    
ref|XP_010419440.1|  PREDICTED: UPF0496 protein At3g57100-like        96.7    2e-18    
ref|XP_010514534.1|  PREDICTED: UPF0496 protein At3g28270-like        96.3    4e-18    
ref|XP_010424327.1|  PREDICTED: UPF0496 protein At3g57100-like        95.1    5e-18    
ref|XP_009389878.1|  PREDICTED: UPF0496 protein 1-like                93.6    1e-17    
ref|XP_010502826.1|  PREDICTED: UPF0496 protein At3g28270-like        94.7    1e-17    
emb|CDX74262.1|  BnaA03g27850D                                        93.6    2e-17    
ref|XP_008236809.1|  PREDICTED: UPF0496 protein At4g34320-like        94.0    2e-17    
ref|XP_009134665.1|  PREDICTED: UPF0496 protein At3g57100-like        93.2    2e-17    
gb|KCW59239.1|  hypothetical protein EUGRSUZ_H01914                   88.6    1e-16    
gb|AFW89347.1|  hypothetical protein ZEAMMB73_964178                  85.5    2e-16    
ref|NP_191269.1|  uncharacterized protein                             90.1    3e-16    
ref|XP_003598396.1|  hypothetical protein MTR_3g011140                84.7    7e-16    
ref|XP_010464614.1|  PREDICTED: UPF0496 protein At3g28270-like        89.0    1e-15    
ref|XP_004294817.1|  PREDICTED: UPF0496 protein At4g34320-like        86.7    2e-15    
ref|XP_008236780.1|  PREDICTED: UPF0496 protein At5g66670-like        84.7    2e-14    
ref|XP_010472135.1|  PREDICTED: UPF0496 protein At3g57100-like        84.0    4e-14    
ref|XP_010556076.1|  PREDICTED: UPF0496 protein At4g34320-like        80.9    4e-14    
ref|XP_006279202.1|  hypothetical protein CARUB_v100000060mg          82.8    5e-14    
ref|XP_010532408.1|  PREDICTED: UPF0496 protein At4g34320-like        82.0    5e-14    
emb|CDX76060.1|  BnaA04g03240D                                        82.4    8e-14    
ref|XP_010534656.1|  PREDICTED: UPF0496 protein At3g57100-like        82.0    8e-14    
ref|XP_006393859.1|  hypothetical protein EUTSA_v10005400mg           78.2    2e-13    
ref|XP_009139346.1|  PREDICTED: UPF0496 protein At3g57100-like        80.9    3e-13    
ref|XP_003638222.1|  hypothetical protein MTR_122s0043                75.1    7e-13    
ref|XP_010412426.1|  PREDICTED: UPF0496 protein At3g28270-like        78.2    3e-12    
ref|XP_009387837.1|  PREDICTED: UPF0496 protein At4g34320-like        76.3    6e-12    
ref|XP_010026390.1|  PREDICTED: UPF0496 protein At2g18630-like        74.7    8e-12    
ref|XP_006412002.1|  hypothetical protein EUTSA_v10027573mg           76.3    1e-11    
gb|KCW64261.1|  hypothetical protein EUGRSUZ_G019021                  69.7    7e-11    
ref|XP_011042862.1|  PREDICTED: UPF0496 protein At1g20180-like        72.8    2e-10    
ref|XP_010534657.1|  PREDICTED: UPF0496 protein At3g57100-like        72.0    2e-10    
ref|XP_002302174.2|  hypothetical protein POPTR_0002s06790g           72.0    2e-10    
ref|XP_004978381.1|  PREDICTED: uncharacterized protein LOC101784665  67.4    6e-10    
gb|ACR36054.1|  unknown                                               65.1    2e-09    
ref|XP_001757787.1|  predicted protein                                67.4    8e-09    
gb|KCW59242.1|  hypothetical protein EUGRSUZ_H01918                   61.6    6e-08    
ref|XP_004292001.1|  PREDICTED: UPF0496 protein At4g34320-like        64.7    6e-08    
ref|XP_002960743.1|  hypothetical protein SELMODRAFT_402070           64.3    1e-07    
ref|XP_010502805.1|  PREDICTED: UPF0496 protein At3g28270-like        58.5    1e-07    
ref|XP_002983928.1|  hypothetical protein SELMODRAFT_423232           63.9    1e-07    
ref|XP_009587167.1|  PREDICTED: UPF0496 protein At1g20180-like        63.5    2e-07    
ref|XP_010425577.1|  PREDICTED: UPF0496 protein At3g28270-like        62.4    2e-07    
ref|XP_004291997.1|  PREDICTED: UPF0496 protein At4g34320-like        62.0    6e-07    
ref|XP_008777232.1|  PREDICTED: UPF0496 protein 1-like                61.6    6e-07    
ref|XP_006301821.1|  hypothetical protein CARUB_v10022290mg           60.1    2e-06    
ref|XP_009758515.1|  PREDICTED: UPF0496 protein At1g20180-like is...  60.1    2e-06    
ref|XP_009758514.1|  PREDICTED: UPF0496 protein At1g20180-like is...  60.1    2e-06    
ref|XP_010041657.1|  PREDICTED: UPF0496 protein At4g34320-like        57.4    2e-06    
ref|XP_009595974.1|  PREDICTED: UPF0496 protein At1g20180-like        59.7    2e-06    
ref|XP_008776622.1|  PREDICTED: UPF0496 protein 1-like                58.9    3e-06    
ref|XP_009777697.1|  PREDICTED: UPF0496 protein At1g20180-like        56.6    2e-05    
gb|KDP30764.1|  hypothetical protein JCGZ_15193                       56.2    3e-05    
emb|CDY33572.1|  BnaC06g29800D                                        53.9    7e-05    
ref|XP_004291999.1|  PREDICTED: UPF0496 protein At4g34320-like        54.7    1e-04    
ref|XP_007199021.1|  hypothetical protein PRUPE_ppa017714mg           53.5    3e-04    
gb|KCW55322.1|  hypothetical protein EUGRSUZ_I01245                   51.6    4e-04    



>ref|XP_004230936.1| PREDICTED: UPF0496 protein At4g34320-like [Solanum lycopersicum]
 ref|XP_004230937.1| PREDICTED: UPF0496 protein At4g34320-like [Solanum lycopersicum]
 ref|XP_010315295.1| PREDICTED: UPF0496 protein At4g34320-like [Solanum lycopersicum]
 ref|XP_010315296.1| PREDICTED: UPF0496 protein At4g34320-like [Solanum lycopersicum]
 ref|XP_010315297.1| PREDICTED: UPF0496 protein At4g34320-like [Solanum lycopersicum]
 ref|XP_010315298.1| PREDICTED: UPF0496 protein At4g34320-like [Solanum lycopersicum]
Length=370

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/374 (76%), Positives = 335/374 (90%), Gaps = 7/374 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETS---NDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVG  226
             MGGHMSKK GETS   ++LQ + +L +SYEAAC +D DLQ+FD+ LQART+HVI+TLA G
Sbjct  1     MGGHMSKKPGETSAAIDNLQYKIEL-NSYEAACRIDTDLQSFDTNLQARTSHVINTLADG  59

Query  227   VEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFC  406
             VEVRALSFDSL+EVTGCLL+MN+EVVKVIL+CKKDIW+N ELFELVEEYF+NSLK+LDF 
Sbjct  60    VEVRALSFDSLREVTGCLLEMNQEVVKVILDCKKDIWKNQELFELVEEYFDNSLKTLDFL  119

Query  407   AALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFF  586
             AAL+KCLKRAR+SQLLI +AL++FEEES G++G  N+Y +TLEELK FRA+G+PFTEEFF
Sbjct  120   AALEKCLKRARDSQLLILVALQQFEEES-GVEG--NRYTKTLEELKNFRAAGDPFTEEFF  176

Query  587   QIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaia  766
             QIFQSVY QQ LMLEKLQ +KNKLDK+L+YIHAWRKVS+++F AT AAVLICSVV AAIA
Sbjct  177   QIFQSVYTQQMLMLEKLQLKKNKLDKRLKYIHAWRKVSNIIFVATFAAVLICSVVAAAIA  236

Query  767   spavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKV  946
             +P VA ALAAA +IP+GSMGKWIDSLLKNYEDA+KG KE++++M VGT+ITIKDLD+I+V
Sbjct  237   APPVASALAAAASIPLGSMGKWIDSLLKNYEDAVKGQKELVNTMHVGTFITIKDLDSIRV  296

Query  947   LADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRA  1126
             L DRLE+EIESLL    FAI+E AVKV IEEIRKKLD+FMKNVEDLG+QAD CSRDIRRA
Sbjct  297   LIDRLEIEIESLLKKVEFAIDEDAVKVAIEEIRKKLDVFMKNVEDLGMQADVCSRDIRRA  356

Query  1127  RTVILQRIIKHPNH  1168
             RTVILQRIIK PNH
Sbjct  357   RTVILQRIIKPPNH  370



>ref|XP_009605015.1| PREDICTED: UPF0496 protein At4g34320-like [Nicotiana tomentosiformis]
 ref|XP_009605016.1| PREDICTED: UPF0496 protein At4g34320-like [Nicotiana tomentosiformis]
 ref|XP_009605017.1| PREDICTED: UPF0496 protein At4g34320-like [Nicotiana tomentosiformis]
 ref|XP_009605018.1| PREDICTED: UPF0496 protein At4g34320-like [Nicotiana tomentosiformis]
Length=370

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/374 (77%), Positives = 336/374 (90%), Gaps = 7/374 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETS---NDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVG  226
             MGGH+SKK GETS   ++LQ + +L +SYEAAC  D DLQ+FD+TLQART+HVI+TLA G
Sbjct  1     MGGHLSKKPGETSAAIDNLQYKIEL-NSYEAACRADTDLQSFDTTLQARTSHVINTLADG  59

Query  227   VEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFC  406
             VEVRALSFDSLKEVTGCLL+MN+EVVKVIL+CKKDIW+N ELFELVEEYF+NSLK+LDF 
Sbjct  60    VEVRALSFDSLKEVTGCLLEMNQEVVKVILDCKKDIWKNQELFELVEEYFDNSLKTLDFL  119

Query  407   AALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFF  586
             AAL+KCLKRAR+SQLLI +AL++FEEES G++G  N+Y +TLEELK F+A+G+PFTEEFF
Sbjct  120   AALEKCLKRARDSQLLILVALQQFEEES-GVEG--NRYTKTLEELKNFKAAGDPFTEEFF  176

Query  587   QIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaia  766
             QIFQSVY QQ LMLEKLQ +KNKLDK+L+YIHAWRKVS+++F AT AAVLICSVV AAIA
Sbjct  177   QIFQSVYTQQMLMLEKLQLKKNKLDKRLKYIHAWRKVSNIIFVATFAAVLICSVVAAAIA  236

Query  767   spavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKV  946
             +P VA ALAAAT+IP+GSMGKWIDSLLKNYE+A+KG KE+I++M VGT+ITIKDLD+I+V
Sbjct  237   APPVASALAAATSIPLGSMGKWIDSLLKNYENAVKGQKELINTMHVGTFITIKDLDSIRV  296

Query  947   LADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRA  1126
             L DRLE+EIESLL    FAI+E  VK+GIEEIRKKLD+FMKNVEDLGVQAD CSRDIRRA
Sbjct  297   LIDRLEIEIESLLKKVEFAIDENEVKIGIEEIRKKLDVFMKNVEDLGVQADVCSRDIRRA  356

Query  1127  RTVILQRIIKHPNH  1168
             RTVILQRIIK PNH
Sbjct  357   RTVILQRIIKPPNH  370



>emb|CDO97084.1| unnamed protein product [Coffea canephora]
Length=370

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/374 (76%), Positives = 337/374 (90%), Gaps = 7/374 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETSN---DLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVG  226
             MG HMSKK GE+S+   ++Q  T+L +SYEAAC++D DLQ+FD++L ARTNHVISTLA G
Sbjct  1     MGSHMSKKPGESSSAISNIQFTTEL-NSYEAACKMDEDLQSFDTSLHARTNHVISTLAAG  59

Query  227   VEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFC  406
             VEVRA+SFDSLKEVTGCLLDMN+EVVKVILECK+DIW+N ELFELVEEYFENSLK+LDFC
Sbjct  60    VEVRAVSFDSLKEVTGCLLDMNQEVVKVILECKQDIWKNQELFELVEEYFENSLKTLDFC  119

Query  407   AALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFF  586
             AAL+KCLKRAR+SQLLI +AL++FEEE  G++G  N+Y RTL+ELK F+A+G+PFTEEFF
Sbjct  120   AALEKCLKRARDSQLLIMVALQQFEEED-GVEG--NRYNRTLDELKNFKAAGDPFTEEFF  176

Query  587   QIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaia  766
             +IFQSVY QQ LMLEKLQ RK+KLDKKL+YIHAWRK+SS++F AT AAVLICSVV AA+A
Sbjct  177   EIFQSVYRQQILMLEKLQMRKSKLDKKLKYIHAWRKLSSIIFVATFAAVLICSVVAAAMA  236

Query  767   spavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKV  946
             +P VA ALAAAT+IP+GSMGKWIDSLL++YE+A+KG KEI+SS+ VGTY+TIKDLD I+V
Sbjct  237   APPVAAALAAATSIPLGSMGKWIDSLLQSYENAVKGQKEIMSSIHVGTYVTIKDLDNIRV  296

Query  947   LADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRA  1126
             L DRLE++IESLL    FAI+E AVK+GIEEIRKKLD+FMKNVEDLGVQAD CSRDIRRA
Sbjct  297   LIDRLEIDIESLLANVDFAISEDAVKLGIEEIRKKLDVFMKNVEDLGVQADVCSRDIRRA  356

Query  1127  RTVILQRIIKHPNH  1168
             RTV+LQRIIK+PNH
Sbjct  357   RTVVLQRIIKNPNH  370



>ref|XP_002281050.2| PREDICTED: UPF0496 protein At4g34320-like isoform X1 [Vitis vinifera]
Length=446

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/389 (75%), Positives = 339/389 (87%), Gaps = 9/389 (2%)
 Frame = +2

Query  17    QF*LAFVFGCVKI-MGGHMSKKSGETSNDLQCRTDL-----ISSYEAACELDADLQTFDS  178
             +F L  V  CV+I MGGHMSKKS ETS+ +    +L     +SSYEAAC +D DLQ+FD+
Sbjct  60    EFELGIVRFCVEIIMGGHMSKKSAETSSAITINPNLHYSTELSSYEAACRVDTDLQSFDT  119

Query  179   TLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFE  358
             TLQART+HVI+TLAVGVEVRALSF+SLKEVT CLL+MN+EVVKVILECKKDIW+N ELFE
Sbjct  120   TLQARTSHVINTLAVGVEVRALSFNSLKEVTECLLEMNQEVVKVILECKKDIWKNQELFE  179

Query  359   LVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEE  538
             LVEEYFENSL++LDFC AL+KCLKRAR+SQLLI +AL++FEEE   ++GS  +Y RTLEE
Sbjct  180   LVEEYFENSLQTLDFCTALEKCLKRARDSQLLIVVALQQFEEED-EVEGS--RYLRTLEE  236

Query  539   LKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAA  718
             LK F+A+G+PFTEEFFQIFQSVY QQ LMLEKLQ RK+KLDKKL+YIHAWRKVSS++FAA
Sbjct  237   LKKFKAAGDPFTEEFFQIFQSVYRQQMLMLEKLQLRKSKLDKKLKYIHAWRKVSSMIFAA  296

Query  719   TLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSM  898
             T AAVLICSVV AA+A+P VA ALAAA ++P+G+MGKWIDSLLKNYE+A+KG KE+ISSM
Sbjct  297   TFAAVLICSVVAAAMAAPPVAAALAAAASLPLGTMGKWIDSLLKNYENALKGQKEVISSM  356

Query  899   QVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVE  1078
             QVGTY+ IKDLDTI+VL DRLE+EIESLL TT + I E AVK GIEEI+KKL +FMKNV+
Sbjct  357   QVGTYVAIKDLDTIRVLIDRLEIEIESLLQTTDYVIKEEAVKFGIEEIKKKLGVFMKNVD  416

Query  1079  DLGVQADNCSRDIRRARTVILQRIIKHPN  1165
             DLGVQAD CSRDIRRARTV+LQRIIK PN
Sbjct  417   DLGVQADMCSRDIRRARTVVLQRIIKQPN  445



>ref|XP_009797274.1| PREDICTED: UPF0496 protein At4g34320-like [Nicotiana sylvestris]
 ref|XP_009797275.1| PREDICTED: UPF0496 protein At4g34320-like [Nicotiana sylvestris]
 ref|XP_009797276.1| PREDICTED: UPF0496 protein At4g34320-like [Nicotiana sylvestris]
 ref|XP_009797277.1| PREDICTED: UPF0496 protein At4g34320-like [Nicotiana sylvestris]
Length=370

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/374 (76%), Positives = 336/374 (90%), Gaps = 7/374 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETS---NDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVG  226
             MGGH+SKK GETS   +++Q + +L +SYEAAC  D DLQ+FD+TLQART+HVI+TLA G
Sbjct  1     MGGHLSKKPGETSAAIDNMQYQIEL-NSYEAACRADTDLQSFDTTLQARTSHVINTLADG  59

Query  227   VEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFC  406
             VEVRALSFDSLKEVTGCLL+MN+EVVKVIL+CKKDIW+N ELFELVEEYF+NSLK+LDF 
Sbjct  60    VEVRALSFDSLKEVTGCLLEMNQEVVKVILDCKKDIWKNQELFELVEEYFDNSLKTLDFL  119

Query  407   AALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFF  586
             AAL+KCLKRAR+SQLLI +AL++FEEES G++G  N+Y +TLEELK F+A+G+PFTEEFF
Sbjct  120   AALEKCLKRARDSQLLILVALQQFEEES-GVEG--NRYTKTLEELKNFKAAGDPFTEEFF  176

Query  587   QIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaia  766
             QIFQSVY QQ LMLEKLQ +KNKLDK+L+YIHAWRKVS+++F AT AAVLICSVV AAIA
Sbjct  177   QIFQSVYTQQMLMLEKLQLKKNKLDKRLKYIHAWRKVSNIIFVATFAAVLICSVVAAAIA  236

Query  767   spavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKV  946
             +P VA ALAAAT+IP+GSMGKWIDSLLKNYE+A+KG KE+I++M VGT+ITIKDLD+I+V
Sbjct  237   APPVASALAAATSIPLGSMGKWIDSLLKNYENAVKGQKELINTMHVGTFITIKDLDSIRV  296

Query  947   LADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRA  1126
             L DRLE+EIESLL    FAI+E  VK+GIEEIRKKLD+FMKNVEDLGVQAD CSRDIRRA
Sbjct  297   LIDRLEIEIESLLKKVEFAIDENEVKIGIEEIRKKLDVFMKNVEDLGVQADVCSRDIRRA  356

Query  1127  RTVILQRIIKHPNH  1168
             RTVILQRIIK PNH
Sbjct  357   RTVILQRIIKPPNH  370



>ref|XP_010647846.1| PREDICTED: UPF0496 protein At4g34320-like isoform X2 [Vitis vinifera]
Length=373

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/375 (76%), Positives = 331/375 (88%), Gaps = 8/375 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDL-----ISSYEAACELDADLQTFDSTLQARTNHVISTLA  220
             MGGHMSKKS ETS+ +    +L     +SSYEAAC +D DLQ+FD+TLQART+HVI+TLA
Sbjct  1     MGGHMSKKSAETSSAITINPNLHYSTELSSYEAACRVDTDLQSFDTTLQARTSHVINTLA  60

Query  221   VGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLD  400
             VGVEVRALSF+SLKEVT CLL+MN+EVVKVILECKKDIW+N ELFELVEEYFENSL++LD
Sbjct  61    VGVEVRALSFNSLKEVTECLLEMNQEVVKVILECKKDIWKNQELFELVEEYFENSLQTLD  120

Query  401   FCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEE  580
             FC AL+KCLKRAR+SQLLI +AL++FEEE   ++GS  +Y RTLEELK F+A+G+PFTEE
Sbjct  121   FCTALEKCLKRARDSQLLIVVALQQFEEED-EVEGS--RYLRTLEELKKFKAAGDPFTEE  177

Query  581   FFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaa  760
             FFQIFQSVY QQ LMLEKLQ RK+KLDKKL+YIHAWRKVSS++FAAT AAVLICSVV AA
Sbjct  178   FFQIFQSVYRQQMLMLEKLQLRKSKLDKKLKYIHAWRKVSSMIFAATFAAVLICSVVAAA  237

Query  761   iaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTI  940
             +A+P VA ALAAA ++P+G+MGKWIDSLLKNYE+A+KG KE+ISSMQVGTY+ IKDLDTI
Sbjct  238   MAAPPVAAALAAAASLPLGTMGKWIDSLLKNYENALKGQKEVISSMQVGTYVAIKDLDTI  297

Query  941   KVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIR  1120
             +VL DRLE+EIESLL TT + I E AVK GIEEI+KKL +FMKNV+DLGVQAD CSRDIR
Sbjct  298   RVLIDRLEIEIESLLQTTDYVIKEEAVKFGIEEIKKKLGVFMKNVDDLGVQADMCSRDIR  357

Query  1121  RARTVILQRIIKHPN  1165
             RARTV+LQRIIK PN
Sbjct  358   RARTVVLQRIIKQPN  372



>ref|XP_006365509.1| PREDICTED: UPF0496 protein At4g34320-like [Solanum tuberosum]
Length=370

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/374 (76%), Positives = 335/374 (90%), Gaps = 7/374 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETS---NDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVG  226
             MGGHMSKK GETS   ++LQ + +L +SYEAAC +D DLQ+FD+ LQART+HVI++LA G
Sbjct  1     MGGHMSKKPGETSAAIDNLQYKIEL-NSYEAACRVDTDLQSFDTNLQARTSHVINSLADG  59

Query  227   VEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFC  406
             VEVRALSFDSL+EVTGCLL+MN+EVVKVIL+CKKDIW+N ELFELVEEYF+NSLK+LDF 
Sbjct  60    VEVRALSFDSLREVTGCLLEMNQEVVKVILDCKKDIWKNQELFELVEEYFDNSLKTLDFL  119

Query  407   AALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFF  586
             AAL+KCLKRAR+SQLLI +AL++FEEES G++G  N+Y +TLEELK FRA+G+PFTEEFF
Sbjct  120   AALEKCLKRARDSQLLILVALQQFEEES-GVEG--NRYTKTLEELKNFRAAGDPFTEEFF  176

Query  587   QIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaia  766
             QIFQSVY QQ LMLEKLQ +KNKLDK+L+YIHAWRKVS+++F AT AAVLICSVV AAIA
Sbjct  177   QIFQSVYRQQMLMLEKLQLKKNKLDKRLKYIHAWRKVSNIIFVATFAAVLICSVVAAAIA  236

Query  767   spavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKV  946
             +P VA ALAAA +IP+GSMGKWIDSLLKNYEDA+KG KE+I++M VGT+ITIKDLD+I+V
Sbjct  237   APPVASALAAAASIPLGSMGKWIDSLLKNYEDAVKGQKELINTMHVGTFITIKDLDSIRV  296

Query  947   LADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRA  1126
             L DRLE+EIESLL    FAI+E AVKV IEEIRKKLD+FMKNV+DLGVQAD CSRDIRRA
Sbjct  297   LIDRLEIEIESLLKKVEFAIDEDAVKVAIEEIRKKLDVFMKNVDDLGVQADVCSRDIRRA  356

Query  1127  RTVILQRIIKHPNH  1168
             RTVILQRIIK PN+
Sbjct  357   RTVILQRIIKPPNY  370



>ref|XP_011088346.1| PREDICTED: UPF0496 protein At4g34320 [Sesamum indicum]
 ref|XP_011088347.1| PREDICTED: UPF0496 protein At4g34320 [Sesamum indicum]
 ref|XP_011088348.1| PREDICTED: UPF0496 protein At4g34320 [Sesamum indicum]
Length=382

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/384 (73%), Positives = 332/384 (86%), Gaps = 15/384 (4%)
 Frame = +2

Query  56    MGGHMSKKSGETS-----NDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLA  220
             MG HMSK   ETS     N+LQ  T+L +SYEAAC +D DLQ+FD+TLQ RTN+VI+++A
Sbjct  1     MGSHMSKNPCETSAANAINNLQYTTEL-NSYEAACRVDVDLQSFDTTLQVRTNNVINSIA  59

Query  221   VGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLD  400
              GVEVRALSFDSL+EVT CLL+MN+EVVKVIL+CKKDIW+N ELFELVEEYFENSLK+LD
Sbjct  60    AGVEVRALSFDSLREVTECLLEMNQEVVKVILDCKKDIWKNQELFELVEEYFENSLKTLD  119

Query  401   FCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEE  580
             FCAAL+KCLK AR+ QLLIH+AL++FEEE  G++G+N +Y RTLEELK FR +G+PFTEE
Sbjct  120   FCAALEKCLKSARDRQLLIHVALQQFEEED-GVEGNNGRYLRTLEELKNFRDAGDPFTEE  178

Query  581   FFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvv---  751
             FFQIFQSVY QQ LMLEKLQSRKNKLDKKL+YIHAWRKVSS++FAAT AAVLICSVV   
Sbjct  179   FFQIFQSVYRQQMLMLEKLQSRKNKLDKKLKYIHAWRKVSSIIFAATFAAVLICSVVXXX  238

Query  752   -----taaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYI  916
                   AA+A+P VA ALAAAT+IP+GSMG+WIDSLLKNYE+A+KG KEII+ M VGTY+
Sbjct  239   XVAGGAAALAAPPVAAALAAATSIPLGSMGRWIDSLLKNYENAVKGQKEIINCMNVGTYV  298

Query  917   TIKDLDTIKVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQA  1096
             TIKDLD+I+VL DRLE+EIESL+ +  FAINE AVK+ + EIRKKL +F+KN+E+LG QA
Sbjct  299   TIKDLDSIRVLIDRLEIEIESLMQSADFAINEEAVKLAVAEIRKKLVVFVKNIEELGAQA  358

Query  1097  DNCSRDIRRARTVILQRIIKHPNH  1168
             DNCSRDIRRARTVILQRIIKHPNH
Sbjct  359   DNCSRDIRRARTVILQRIIKHPNH  382



>ref|XP_003537895.1| PREDICTED: UPF0496 protein At4g34320-like [Glycine max]
 gb|KHN14849.1| UPF0496 protein [Glycine soja]
Length=374

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/376 (75%), Positives = 329/376 (88%), Gaps = 7/376 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETSN-----DLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLA  220
             MG HMSKK  ETS+     +L  +T+L SSYEAAC+LD+DLQ+FD+TLQARTN VI+TLA
Sbjct  1     MGSHMSKKIPETSSIGLSTELHYKTEL-SSYEAACKLDSDLQSFDTTLQARTNQVINTLA  59

Query  221   VGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLD  400
             VGVEVRALSFDSLK++T CLL+MN+EVVKVIL+CKKDIW++ ELFELVEEYFENSLK+LD
Sbjct  60    VGVEVRALSFDSLKQITECLLEMNQEVVKVILDCKKDIWKSQELFELVEEYFENSLKTLD  119

Query  401   FCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEE  580
             FC AL+KCLKRAR+SQLLIH+AL++FEEES G  G +N+Y RTL+E K F+A+G+PFTEE
Sbjct  120   FCTALEKCLKRARDSQLLIHVALQQFEEESSG-SGGDNRYPRTLQEFKNFKAAGDPFTEE  178

Query  581   FFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaa  760
             FFQIFQSVY  Q  MLEKLQ RKNKLDKKL+YIH+WRKVSS++F AT AAVLICSVV AA
Sbjct  179   FFQIFQSVYKHQIFMLEKLQLRKNKLDKKLKYIHSWRKVSSMIFVATFAAVLICSVVAAA  238

Query  761   iaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTI  940
             IA+P VA A+AAAT+IPIGSMGKWIDSL +NYE+A+KG KE+ISSMQ GTY+ IKDLD I
Sbjct  239   IAAPPVAAAIAAATSIPIGSMGKWIDSLWRNYENALKGQKEVISSMQAGTYVAIKDLDNI  298

Query  941   KVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIR  1120
             +VL DRLE+EIESLL+   FAI E AVKV IEEI+KKL +FMKNVEDL VQAD CSRDIR
Sbjct  299   RVLIDRLEIEIESLLHNVDFAIEEEAVKVAIEEIKKKLGVFMKNVEDLAVQADMCSRDIR  358

Query  1121  RARTVILQRIIKHPNH  1168
             RARTV+LQRIIKHP++
Sbjct  359   RARTVVLQRIIKHPHN  374



>ref|XP_003541076.1| PREDICTED: UPF0496 protein At4g34320-like [Glycine max]
Length=373

 Score =   521 bits (1341),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 276/376 (73%), Positives = 325/376 (86%), Gaps = 8/376 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDL-----ISSYEAACELDADLQTFDSTLQARTNHVISTLA  220
             MG HMSK+  ETS+ +   T+L     +SSYEAAC+LD+DLQ FD+TLQAR N VI+TLA
Sbjct  1     MGSHMSKRIPETSSSIGLSTELHYKTELSSYEAACKLDSDLQFFDTTLQARANQVINTLA  60

Query  221   VGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLD  400
             VGVEVRALSFDSLK++T CLL+MN+EVVKVIL+CKKDIW++ ELFELVEEYFENSLK+LD
Sbjct  61    VGVEVRALSFDSLKQITECLLEMNQEVVKVILDCKKDIWKSQELFELVEEYFENSLKTLD  120

Query  401   FCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEE  580
             FC  L+KCLKRAR+SQLLIH+A+++FEEESG  D   N+Y RTL+E K F+A+G+PFTEE
Sbjct  121   FCTVLEKCLKRARDSQLLIHVAVQQFEEESGSGD---NRYARTLQEFKNFKAAGDPFTEE  177

Query  581   FFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaa  760
             FFQIFQSVY  Q LMLEKLQ RKNKLDKKL+YIH+WRKVSS++F AT AAVLICSVV AA
Sbjct  178   FFQIFQSVYKHQILMLEKLQLRKNKLDKKLKYIHSWRKVSSMIFVATFAAVLICSVVAAA  237

Query  761   iaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTI  940
             IA+P VA A+AAAT+IPIGSMGKWIDSL +NYE+A+KG KE+ISSMQ GTY+ IKDLD I
Sbjct  238   IAAPPVAAAIAAATSIPIGSMGKWIDSLWRNYENALKGQKEVISSMQAGTYVAIKDLDNI  297

Query  941   KVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIR  1120
             ++L DRLE+EIESLL+   FAI E AVKV IEEI+KKL +FMKNVEDL VQAD CSRDIR
Sbjct  298   RILIDRLEIEIESLLHNVDFAIEEEAVKVAIEEIKKKLGVFMKNVEDLAVQADMCSRDIR  357

Query  1121  RARTVILQRIIKHPNH  1168
             RARTV+LQRIIKHP++
Sbjct  358   RARTVVLQRIIKHPHN  373



>ref|XP_011037574.1| PREDICTED: UPF0496 protein At4g34320-like [Populus euphratica]
 ref|XP_011037575.1| PREDICTED: UPF0496 protein At4g34320-like [Populus euphratica]
Length=374

 Score =   520 bits (1340),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 276/378 (73%), Positives = 321/378 (85%), Gaps = 11/378 (3%)
 Frame = +2

Query  56    MGGHMSKKSGETS-------NDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVIST  214
             MGGH+SK+  E S       N+LQ  T+L SSYEAAC LD DLQ+FD+TLQARTNHVI+ 
Sbjct  1     MGGHVSKRPAEASSSDINLNNNLQYTTEL-SSYEAACRLDKDLQSFDTTLQARTNHVINN  59

Query  215   LAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKS  394
             LAVGVEVRALSFDSLKEVT CLL+MN+EVVKVILECKKDIW+N ELFELVEEYFENSL++
Sbjct  60    LAVGVEVRALSFDSLKEVTECLLEMNQEVVKVILECKKDIWKNQELFELVEEYFENSLQT  119

Query  395   LDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFT  574
             LDFCAAL+KCLKRAR+SQLLI ++LK+FEEES   D    +Y RTLEELK F+A+G+PFT
Sbjct  120   LDFCAALEKCLKRARDSQLLILVSLKQFEEES---DAGGREYVRTLEELKNFKAAGDPFT  176

Query  575   EEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvt  754
             +EFFQIFQSVY QQ +MLEKLQ RKNKLDKKL+ IHAWRKVSS++F A  A VLICSVV 
Sbjct  177   DEFFQIFQSVYRQQIMMLEKLQLRKNKLDKKLKCIHAWRKVSSMIFVAIFATVLICSVVA  236

Query  755   aaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLD  934
             AA+ +P V  A+AAA+ IP+GSMGKWIDSL KNYE+A+KG KE+IS+MQVGTY+ IKDLD
Sbjct  237   AAMTAPPVVAAVAAASTIPLGSMGKWIDSLWKNYENALKGQKEVISTMQVGTYVAIKDLD  296

Query  935   TIKVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRD  1114
              I+VL DRLE+EIE+L+ TT FAI   AVKV IEEI+KKL +FMKNVEDLGV AD+CSRD
Sbjct  297   NIRVLIDRLEIEIEALMRTTDFAIEHGAVKVAIEEIKKKLGVFMKNVEDLGVLADSCSRD  356

Query  1115  IRRARTVILQRIIKHPNH  1168
             I RARTV+LQRIIK PN+
Sbjct  357   IMRARTVVLQRIIKSPNN  374



>gb|KDO51452.1| hypothetical protein CISIN_1g040233mg [Citrus sinensis]
Length=366

 Score =   520 bits (1338),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 276/371 (74%), Positives = 324/371 (87%), Gaps = 5/371 (1%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEV  235
             MGG+MSKK+ ETS+     T  +SSYEAAC LD DLQTFD++LQART+HVI+TLA GVEV
Sbjct  1     MGGNMSKKTSETSSQF---TTELSSYEAACRLDTDLQTFDTSLQARTSHVINTLAAGVEV  57

Query  236   RALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAAL  415
             RALSFDSLKEVT CLL+MN+EVVKVILECKKDIW++ ELFELVEEYFE+SL++LDFC AL
Sbjct  58    RALSFDSLKEVTECLLEMNQEVVKVILECKKDIWKSQELFELVEEYFESSLQTLDFCTAL  117

Query  416   DKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIF  595
             +KCLKRAR+SQLLI +AL++FEEE+    G+ ++Y RTLEELK F+A+G+PFTEEFFQIF
Sbjct  118   EKCLKRARDSQLLILVALQQFEEENDM--GAGHRYVRTLEELKNFKAAGDPFTEEFFQIF  175

Query  596   QSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspa  775
             QSVY QQ  MLEKLQ RKNKLDKKL+YIH+WRKVSS++FAAT A VLICSVV AA+A+P 
Sbjct  176   QSVYKQQISMLEKLQLRKNKLDKKLKYIHSWRKVSSIIFAATFATVLICSVVAAAMAAPP  235

Query  776   vagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLAD  955
             VA ALAAA++IP+GSMGKWIDSL KNYE A+KG KE+ISSMQVGTYI IKDLD I+VL D
Sbjct  236   VAAALAAASSIPLGSMGKWIDSLWKNYEHALKGQKEMISSMQVGTYIAIKDLDNIRVLID  295

Query  956   RLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTV  1135
             RLE+E+E+LL    F I E AVK+G+EEI+KKL +FMKNVEDLGVQAD CSRDIRRARTV
Sbjct  296   RLEIEVEALLQNVDFVIEEEAVKIGVEEIKKKLGVFMKNVEDLGVQADTCSRDIRRARTV  355

Query  1136  ILQRIIKHPNH  1168
             +LQRIIKH N+
Sbjct  356   VLQRIIKHTNN  366



>ref|XP_006423198.1| hypothetical protein CICLE_v10030403mg [Citrus clementina]
 ref|XP_006472632.1| PREDICTED: UPF0496 protein At4g34320-like [Citrus sinensis]
 ref|XP_006487193.1| PREDICTED: UPF0496 protein At4g34320-like [Citrus sinensis]
 gb|ESR36438.1| hypothetical protein CICLE_v10030403mg [Citrus clementina]
Length=366

 Score =   518 bits (1335),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 275/371 (74%), Positives = 324/371 (87%), Gaps = 5/371 (1%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEV  235
             MGG+MSKK+ ETS+     T  +SSYEAAC LD DLQTFD++LQART+H+I+TLA GVEV
Sbjct  1     MGGNMSKKTSETSSQF---TTELSSYEAACRLDTDLQTFDTSLQARTSHMINTLAAGVEV  57

Query  236   RALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAAL  415
             RALSFDSLKEVT CLL+MN+EVVKVILECKKDIW++ ELFELVEEYFE+SL++LDFC AL
Sbjct  58    RALSFDSLKEVTECLLEMNQEVVKVILECKKDIWKSQELFELVEEYFESSLQTLDFCTAL  117

Query  416   DKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIF  595
             +KCLKRAR+SQLLI +AL++FEEE+    G+ ++Y RTLEELK F+A+G+PFTEEFFQIF
Sbjct  118   EKCLKRARDSQLLILVALQQFEEENDM--GAGHRYVRTLEELKNFKAAGDPFTEEFFQIF  175

Query  596   QSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspa  775
             QSVY QQ  MLEKLQ RKNKLDKKL+YIH+WRKVSS++FAAT A VLICSVV AA+A+P 
Sbjct  176   QSVYKQQISMLEKLQLRKNKLDKKLKYIHSWRKVSSIIFAATFATVLICSVVAAAMAAPP  235

Query  776   vagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLAD  955
             VA ALAAA++IP+GSMGKWIDSL KNYE A+KG KE+ISSMQVGTYI IKDLD I+VL D
Sbjct  236   VAAALAAASSIPLGSMGKWIDSLWKNYEHALKGQKEMISSMQVGTYIAIKDLDNIRVLID  295

Query  956   RLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTV  1135
             RLE+E+E+LL    F I E AVK+G+EEI+KKL +FMKNVEDLGVQAD CSRDIRRARTV
Sbjct  296   RLEIEVEALLQNVDFVIEEEAVKIGVEEIKKKLGVFMKNVEDLGVQADTCSRDIRRARTV  355

Query  1136  ILQRIIKHPNH  1168
             +LQRIIKH N+
Sbjct  356   VLQRIIKHTNN  366



>ref|XP_008365973.1| PREDICTED: UPF0496 protein At4g34320-like [Malus domestica]
Length=375

 Score =   516 bits (1329),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 278/380 (73%), Positives = 325/380 (86%), Gaps = 14/380 (4%)
 Frame = +2

Query  56    MGGHMSKKSGETSN-------DLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVIST  214
             MG HMSKKS ETS+       +LQ  TD +SSYEAAC+LDADLQ+FD+ LQ RTNHVIST
Sbjct  1     MGSHMSKKSAETSSSATNLHTNLQYTTDQLSSYEAACKLDADLQSFDTNLQTRTNHVIST  60

Query  215   LAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKS  394
             +A GVEVRALS DSLKEVTGCLL+MN+EVVKVILECKKDIW+N ELFELV+EYFENSL++
Sbjct  61    IAAGVEVRALSLDSLKEVTGCLLEMNQEVVKVILECKKDIWKNQELFELVDEYFENSLQT  120

Query  395   LDFCAALDKCLKRARESQLLIHLALKEFEEES--GGIDGSNNKYERTLEELKGFRASGNP  568
             LDFC AL+KCLKRAR+SQLLI +AL+ FEEE+  GG      +Y RTLEELK F+A G+P
Sbjct  121   LDFCTALEKCLKRARDSQLLILVALQRFEEETEMGG-----GQYTRTLEELKNFKAIGDP  175

Query  569   FTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsv  748
             FTEEFFQIFQS+Y QQ LMLEKLQ RKNKLDKKL+ I+AWRKV+ ++F AT AAVLICSV
Sbjct  176   FTEEFFQIFQSIYKQQILMLEKLQMRKNKLDKKLKCINAWRKVTGMIFVATFAAVLICSV  235

Query  749   vtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKD  928
             V AA+A+P VA ALAAA++IP+GSMG WIDSL KNYE+A++G KE+ISSMQVGTY+ IKD
Sbjct  236   VAAAMAAPPVAAALAAASSIPVGSMGNWIDSLWKNYENALRGQKEVISSMQVGTYVAIKD  295

Query  929   LDTIKVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCS  1108
             LD I+VL DRLE++IESLL+  SFAI+E AVKV IEEI+KKL +FMKNVEDLG +AD CS
Sbjct  296   LDNIRVLIDRLEIDIESLLHNASFAIDEEAVKVAIEEIKKKLGVFMKNVEDLGTEADICS  355

Query  1109  RDIRRARTVILQRIIKHPNH  1168
             RDIRRARTV+LQRIIKH N+
Sbjct  356   RDIRRARTVVLQRIIKHSNN  375



>ref|XP_009344780.1| PREDICTED: UPF0496 protein At4g34320-like [Pyrus x bretschneideri]
Length=375

 Score =   515 bits (1327),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 276/380 (73%), Positives = 320/380 (84%), Gaps = 14/380 (4%)
 Frame = +2

Query  56    MGGHMSKKSGETSN-------DLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVIST  214
             MG HMSKKS ETS+       +LQ  TD +SSYEAAC+LDADLQ+FD  LQ RTNHVIST
Sbjct  1     MGSHMSKKSAETSSSATNLHTNLQYTTDQLSSYEAACKLDADLQSFDMNLQTRTNHVIST  60

Query  215   LAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKS  394
             +A GV+VRALSFDSLKEVTGCLL+MN+EVVKVIL CKKDIW+N ELFELVEEYFENSL++
Sbjct  61    IAAGVQVRALSFDSLKEVTGCLLEMNQEVVKVILGCKKDIWKNQELFELVEEYFENSLQT  120

Query  395   LDFCAALDKCLKRARESQLLIHLALKEFEEES--GGIDGSNNKYERTLEELKGFRASGNP  568
             LDFC AL+KCLKRAR+SQLLI +AL+ FEEE+  GG      +Y RTLEELK F+A G+P
Sbjct  121   LDFCTALEKCLKRARDSQLLILVALQRFEEETEMGG-----GQYTRTLEELKNFKAIGDP  175

Query  569   FTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsv  748
             FTEEFFQIFQS+Y QQ LMLEKLQ RKNKLDKKLR I+AWRKV+ ++F AT AAVLICSV
Sbjct  176   FTEEFFQIFQSIYKQQILMLEKLQMRKNKLDKKLRCINAWRKVTGMIFVATFAAVLICSV  235

Query  749   vtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKD  928
             V   +A+P VA ALAAA++IP+GSMG WIDSL KNYE+ ++G KE+ISSMQVGTY+ IKD
Sbjct  236   VAGGLAAPPVAAALAAASSIPVGSMGNWIDSLWKNYENVLRGQKEVISSMQVGTYVAIKD  295

Query  929   LDTIKVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCS  1108
             LD I+VL DRLE++IESLL+   FAI+E AVKV IEEI+KKL +FMKNVEDLG QAD CS
Sbjct  296   LDNIRVLVDRLEIDIESLLHNAIFAIDEEAVKVAIEEIKKKLGVFMKNVEDLGTQADICS  355

Query  1109  RDIRRARTVILQRIIKHPNH  1168
             RDIRRARTV+LQRIIKH N+
Sbjct  356   RDIRRARTVVLQRIIKHSNN  375



>ref|XP_004507409.1| PREDICTED: UPF0496 protein At4g34320-like [Cicer arietinum]
Length=377

 Score =   512 bits (1319),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 276/379 (73%), Positives = 325/379 (86%), Gaps = 12/379 (3%)
 Frame = +2

Query  56    MGGHMSKKSGETSN---DLQCRTDL-----ISSYEAACELDADLQTFDSTLQARTNHVIS  211
             MG HMSKK  E+S+   +L   T+L     +SSYEAAC+ D DLQTFDSTLQARTN VI+
Sbjct  1     MGSHMSKKIPESSSSAVNLPTTTELHYKTELSSYEAACKQDTDLQTFDSTLQARTNQVIN  60

Query  212   TLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLK  391
             TL  GVEVRALSFDSLK+VTGCLL+MN+EVV+VILECKKDIW++ ELFELVEEYFENSLK
Sbjct  61    TLVEGVEVRALSFDSLKQVTGCLLEMNQEVVRVILECKKDIWKSQELFELVEEYFENSLK  120

Query  392   SLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPF  571
             +LDFC AL+KCLKRAR++QLLI +A+++FEEES   +  +N+Y +TL+ELK F+ +G+PF
Sbjct  121   TLDFCTALEKCLKRARDTQLLILVAIQQFEEES---ESGDNRYSKTLQELKNFKEAGDPF  177

Query  572   TEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvv  751
             TEEFFQIFQSVY QQ LMLEKLQ RKNKLDKKL+YI +WRKVSS++F AT AAVLICSVV
Sbjct  178   TEEFFQIFQSVYKQQILMLEKLQVRKNKLDKKLKYIKSWRKVSSMIFVATFAAVLICSVV  237

Query  752   taaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDL  931
              AAIA+P VA A+AAAT+IPIGSMGKWIDSL KNYE A+KG KE+I+SMQ GTY+ IKDL
Sbjct  238   AAAIAAPPVAAAIAAATSIPIGSMGKWIDSLWKNYEIALKGQKEVIASMQAGTYVAIKDL  297

Query  932   DTIKVLADRLELEIESLLNTTSFAINE-AAVKVGIEEIRKKLDLFMKNVEDLGVQADNCS  1108
             D I+VL DRL++EIESL +T  FAI E  AVK+ IEEI+KKL++FMKNVEDLGVQAD CS
Sbjct  298   DNIRVLVDRLQIEIESLFHTVDFAIEEDQAVKIAIEEIKKKLEVFMKNVEDLGVQADVCS  357

Query  1109  RDIRRARTVILQRIIKHPN  1165
             RDIRRARTV+LQRIIKHPN
Sbjct  358   RDIRRARTVVLQRIIKHPN  376



>ref|XP_004289620.1| PREDICTED: UPF0496 protein At4g34320-like [Fragaria vesca subsp. 
vesca]
Length=375

 Score =   512 bits (1318),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 277/380 (73%), Positives = 325/380 (86%), Gaps = 14/380 (4%)
 Frame = +2

Query  56    MGGHMSKKSG-ETSND------LQCRTDLISSYEAACELDADLQTFDSTLQARTNHVIST  214
             MG HMSKKS  ETS+        Q  TD +SSYEAAC++DADLQ+FD+ LQ RTN VIST
Sbjct  1     MGSHMSKKSNTETSSSAINLTTFQYTTDQLSSYEAACKVDADLQSFDTNLQNRTNQVIST  60

Query  215   LAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKS  394
             LA GVEVRALSFDSLKEVT CLL+MN+EVVKVILECKKDIW+N ELFELVEEYFENSL++
Sbjct  61    LAAGVEVRALSFDSLKEVTECLLEMNQEVVKVILECKKDIWKNQELFELVEEYFENSLQT  120

Query  395   LDFCAALDKCLKRARESQLLIHLALKEFEEES--GGIDGSNNKYERTLEELKGFRASGNP  568
             LDFC AL+KCLKRAR+SQLLI +AL++FEEE+  GG     ++Y RTL ELK F+A+G+P
Sbjct  121   LDFCTALEKCLKRARDSQLLILVALQQFEEETEVGG-----SRYTRTLAELKNFKAAGDP  175

Query  569   FTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsv  748
             FTEEFFQ+FQ+VY QQ LMLEKL  RKNKLDKKL+YI+AWRKVSS++F AT AAVLICSV
Sbjct  176   FTEEFFQMFQTVYRQQLLMLEKLHLRKNKLDKKLKYINAWRKVSSIIFVATFAAVLICSV  235

Query  749   vtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKD  928
             V AA+A+P VA ALAAAT+IPIGSMGKWIDSL KNYE A+KG KE+ISSMQVGTY+ IKD
Sbjct  236   VAAAMAAPPVAAALAAATSIPIGSMGKWIDSLWKNYESAMKGQKEVISSMQVGTYVAIKD  295

Query  929   LDTIKVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCS  1108
             LD+I+VL DRLE+EI+SL++  SFAI + AV++ IEEI+KKL +FMKNVE+LG QAD CS
Sbjct  296   LDSIRVLIDRLEIEIQSLMDNASFAIEQEAVRIAIEEIKKKLGVFMKNVEELGSQADICS  355

Query  1109  RDIRRARTVILQRIIKHPNH  1168
             RDIRRARTV+LQRIIKH N+
Sbjct  356   RDIRRARTVVLQRIIKHSNN  375



>ref|XP_002519094.1| AT14A, putative [Ricinus communis]
 gb|EEF43305.1| AT14A, putative [Ricinus communis]
Length=380

 Score =   512 bits (1318),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 273/378 (72%), Positives = 327/378 (87%), Gaps = 11/378 (3%)
 Frame = +2

Query  56    MGGHMSKKSGETS-------NDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVIST  214
             MGGH+SKK+ E S       N+LQ  T+L SSYEAAC+LD DLQ+FD++LQ RTNHVI+T
Sbjct  1     MGGHVSKKTTEASSSAINIHNNLQYITEL-SSYEAACKLDEDLQSFDTSLQVRTNHVINT  59

Query  215   LAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKS  394
             LAVGVEVR+LSFDSLKEVT CLL+MN+EVVKVILECKKDIW+N ELFELVEEYFENSL++
Sbjct  60    LAVGVEVRSLSFDSLKEVTECLLEMNQEVVKVILECKKDIWKNQELFELVEEYFENSLQT  119

Query  395   LDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFT  574
             LDFC AL+KCLKRAR+SQL I +AL++FEEE+   +   N+Y +TLE LK F+++G+PFT
Sbjct  120   LDFCTALEKCLKRARDSQLFILVALQQFEEEN---EAGGNRYVKTLEGLKNFKSAGDPFT  176

Query  575   EEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvt  754
             EEFFQIFQSVY QQ LMLEKLQ RKNKLDKKL+ +HAWRKVSS++F AT AAVLICSVV 
Sbjct  177   EEFFQIFQSVYRQQMLMLEKLQHRKNKLDKKLKCLHAWRKVSSIIFVATFAAVLICSVVA  236

Query  755   aaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLD  934
             AA+A+P VA ALAAAT+IP+GSMGKWIDSL KNYE+A+KG KE+IS+MQVGTY+ IKDLD
Sbjct  237   AAMAAPPVAAALAAATSIPLGSMGKWIDSLWKNYENALKGEKELISTMQVGTYVAIKDLD  296

Query  935   TIKVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRD  1114
              I+VL +RLE++IE+L++   FAI + AVKV I EIRKKLD+FMK++EDLG QAD CSRD
Sbjct  297   NIRVLINRLEIDIEALMHNAEFAIEQDAVKVAIVEIRKKLDVFMKHIEDLGAQADTCSRD  356

Query  1115  IRRARTVILQRIIKHPNH  1168
             IRRARTV+LQRIIKHPN+
Sbjct  357   IRRARTVVLQRIIKHPNN  374



>ref|XP_002313064.1| hypothetical protein POPTR_0009s11550g [Populus trichocarpa]
 gb|EEE87019.1| hypothetical protein POPTR_0009s11550g [Populus trichocarpa]
Length=374

 Score =   511 bits (1317),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 274/377 (73%), Positives = 324/377 (86%), Gaps = 9/377 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCR------TDLISSYEAACELDADLQTFDSTLQARTNHVISTL  217
             MGGH+SK+  E S+           T  +SSYEAAC LD DLQ+FD+TLQARTNHVI+TL
Sbjct  1     MGGHVSKRPAEASSSSINLNNNLQYTTGLSSYEAACLLDKDLQSFDTTLQARTNHVINTL  60

Query  218   AVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSL  397
             AVGVEVRALSFDSLKEVT CLL+MN+EVVKVILECK+DIW+N ELFELVEEYFENSL++L
Sbjct  61    AVGVEVRALSFDSLKEVTECLLEMNQEVVKVILECKRDIWKNQELFELVEEYFENSLQTL  120

Query  398   DFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTE  577
             DFCAAL+KCLKRAR+SQLLI +AL++FEEES   +   +KY +TLEELK F+A+G+PFTE
Sbjct  121   DFCAALEKCLKRARDSQLLILVALQQFEEES---EAGGSKYVKTLEELKSFKAAGDPFTE  177

Query  578   EFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvta  757
             EFFQIFQSVY QQ  MLEKLQ RKNKLDKKL+ IHAWRKVSS++F AT A VLICSVV A
Sbjct  178   EFFQIFQSVYRQQITMLEKLQLRKNKLDKKLKCIHAWRKVSSIIFVATFATVLICSVVAA  237

Query  758   aiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDT  937
             A+A+P VA ALAAA++IP+GSMGKWIDS+ KNYE+A+KG KE+IS+MQVGTY+ IKDLDT
Sbjct  238   AMAAPPVAAALAAASSIPLGSMGKWIDSMWKNYENALKGQKEVISTMQVGTYVAIKDLDT  297

Query  938   IKVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDI  1117
             I+VL +RLE+EIE+L+ TT FAI   AVK+ IEEI+KKL +FMKNVEDLG+QAD CSRDI
Sbjct  298   IRVLINRLEIEIEALMQTTDFAIEHDAVKLAIEEIKKKLGVFMKNVEDLGLQADTCSRDI  357

Query  1118  RRARTVILQRIIKHPNH  1168
             RRARTV+LQRIIK+P +
Sbjct  358   RRARTVVLQRIIKNPQN  374



>ref|XP_007042727.1| UPF0496 protein [Theobroma cacao]
 gb|EOX98558.1| UPF0496 protein [Theobroma cacao]
Length=373

 Score =   511 bits (1315),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 275/376 (73%), Positives = 323/376 (86%), Gaps = 8/376 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDL-----ISSYEAACELDADLQTFDSTLQARTNHVISTLA  220
             MG H SKK+ ETS+ +    +L     +SSYEAAC+LD DLQTFD+ +QARTN VI+TLA
Sbjct  1     MGNHTSKKTSETSSTINLSGNLPYTTELSSYEAACKLDTDLQTFDTNVQARTNQVINTLA  60

Query  221   VGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLD  400
             VGVEVRALSFDSLKEVT CLL MN+EVVKVILECKKDIW++ ELFELVEEYFENSL++LD
Sbjct  61    VGVEVRALSFDSLKEVTECLLAMNQEVVKVILECKKDIWKSQELFELVEEYFENSLQTLD  120

Query  401   FCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEE  580
             FC+AL+KCLKRAR+SQLLI +AL++FEEES  + GS  +Y RTLEELK F+A+G+PFTEE
Sbjct  121   FCSALEKCLKRARDSQLLILVALQQFEEES-EVGGS--RYVRTLEELKNFKAAGDPFTEE  177

Query  581   FFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaa  760
             FFQIFQSVY QQ  ML+KLQ RKNKLDKKL+Y+HAWRKVSS++F AT A VLICSVV AA
Sbjct  178   FFQIFQSVYRQQIAMLDKLQLRKNKLDKKLKYVHAWRKVSSMIFVATCATVLICSVVAAA  237

Query  761   iaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTI  940
             +A+P VA ALAAAT+IP+GSMGKWIDSL KNYE+A+KG KE+ISSMQ GTY+ IKDLD I
Sbjct  238   MAAPPVAAALAAATSIPLGSMGKWIDSLWKNYENALKGQKEVISSMQAGTYVAIKDLDNI  297

Query  941   KVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIR  1120
             +VL DRLE++IE+LL    FAI E AVK+GI+EI+KKL +FMKNVEDLG QAD CSRDIR
Sbjct  298   RVLIDRLEIDIEALLQNAEFAIEEEAVKIGIDEIKKKLGVFMKNVEDLGQQADICSRDIR  357

Query  1121  RARTVILQRIIKHPNH  1168
             RARTV+LQRIIK PN+
Sbjct  358   RARTVVLQRIIKPPNN  373



>ref|XP_008387354.1| PREDICTED: LOW QUALITY PROTEIN: UPF0496 protein At4g34320-like 
[Malus domestica]
Length=382

 Score =   510 bits (1314),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 279/387 (72%), Positives = 327/387 (84%), Gaps = 14/387 (4%)
 Frame = +2

Query  56    MGGHMSKKSGETS------NDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTL  217
             MG HMSK+S ETS      N+LQ  TD ++SYEAAC+LDADLQ+FD+ L  RTN VI+T+
Sbjct  1     MGSHMSKRSAETSSSAINLNNLQYTTDQLTSYEAACKLDADLQSFDTNLHTRTNQVINTI  60

Query  218   AVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSL  397
             A GVEVRALSFDSLKEVTGCLL+MN+EVVKVILECKKDIW+N ELFELVEEYFENSL++L
Sbjct  61    AAGVEVRALSFDSLKEVTGCLLEMNQEVVKVILECKKDIWKNQELFELVEEYFENSLQTL  120

Query  398   DFCAALDKCLKRARESQLLIHLALKEFEEES--GGIDGSNNKYERTLEELKGFRASGNPF  571
             DFC ALDKCLKRAR+SQLLI +AL++FEEE+  GG     ++Y RTLEELK F+  G+PF
Sbjct  121   DFCTALDKCLKRARDSQLLILVALQQFEEETEMGG-----SRYTRTLEELKNFKTIGDPF  175

Query  572   TEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvv  751
             TEEFFQIFQSVY QQ  MLEKLQ RKNKLDKKL+ I+AWRKV++++F AT AAVLICSVV
Sbjct  176   TEEFFQIFQSVYKQQISMLEKLQLRKNKLDKKLKGINAWRKVTNMIFVATFAAVLICSVV  235

Query  752   taaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDL  931
              AA+A+P VA ALAAA++IPIGSMGKWIDSL KNYE A+ G KE++SSMQVGTY+ IKDL
Sbjct  236   AAAMAAPPVAAALAAASSIPIGSMGKWIDSLWKNYELALXGSKEVLSSMQVGTYVAIKDL  295

Query  932   DTIKVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSR  1111
             D I+VL DRLE++IES+L+  SFAI E AVKV IE+I+KKL +FMKNVEDLG QAD CSR
Sbjct  296   DNIRVLIDRLEIDIESILHNASFAIEEDAVKVAIEDIKKKLGVFMKNVEDLGTQADICSR  355

Query  1112  DIRRARTVILQRIIKHPNH-*GTRMGI  1189
             DIRRARTV+LQRIIKH N+   T +GI
Sbjct  356   DIRRARTVVLQRIIKHSNNXKSTTLGI  382



>ref|XP_009334187.1| PREDICTED: UPF0496 protein At4g34320-like [Pyrus x bretschneideri]
Length=374

 Score =   509 bits (1312),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 277/379 (73%), Positives = 323/379 (85%), Gaps = 13/379 (3%)
 Frame = +2

Query  56    MGGHMSKKSGETS------NDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTL  217
             MG H+SKKS ETS      N+LQ  TD +SSYEAAC+LDADLQ+FD+ L  RTN VI+T+
Sbjct  1     MGSHVSKKSAETSSSAINLNNLQYTTDQLSSYEAACKLDADLQSFDTNLHTRTNLVINTI  60

Query  218   AVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSL  397
             A GVEVRALSFDSLKEVTGCLL+MN+EVVKVILECKKDIW+N ELFELVEEYFENSL++L
Sbjct  61    AAGVEVRALSFDSLKEVTGCLLEMNQEVVKVILECKKDIWKNQELFELVEEYFENSLQTL  120

Query  398   DFCAALDKCLKRARESQLLIHLALKEFEEES--GGIDGSNNKYERTLEELKGFRASGNPF  571
             DFC ALDKCLKRAR+SQLLI +AL++FEEE+  GG     ++Y RTLEELK F+A G+PF
Sbjct  121   DFCTALDKCLKRARDSQLLILVALQQFEEETEMGG-----SRYTRTLEELKNFKAIGDPF  175

Query  572   TEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvv  751
             TEEFFQIFQSVY QQ  MLEKLQ RKNKLDKKL+ I+AWRKV+S++F AT AAVLICSVV
Sbjct  176   TEEFFQIFQSVYKQQIAMLEKLQLRKNKLDKKLKGINAWRKVTSMIFVATFAAVLICSVV  235

Query  752   taaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDL  931
              AA+A+P VA ALAAA++IPIGS GKWIDSL KNYE A++G +E++SSMQVGTY+ IKDL
Sbjct  236   AAAMAAPPVAAALAAASSIPIGSTGKWIDSLWKNYELAVRGQREVLSSMQVGTYVAIKDL  295

Query  932   DTIKVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSR  1111
             D I+VL DRLE++IES+L+  SFAI E AVKV IEEI+KKL +FMKNVEDLG QAD CSR
Sbjct  296   DNIRVLIDRLEIDIESILHNASFAIEEDAVKVAIEEIKKKLGVFMKNVEDLGTQADVCSR  355

Query  1112  DIRRARTVILQRIIKHPNH  1168
             DIRRARTV+LQRIIK  N+
Sbjct  356   DIRRARTVVLQRIIKRSNN  374



>ref|XP_011048925.1| PREDICTED: UPF0496 protein At4g34320-like [Populus euphratica]
Length=374

 Score =   508 bits (1309),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 273/377 (72%), Positives = 323/377 (86%), Gaps = 9/377 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCR------TDLISSYEAACELDADLQTFDSTLQARTNHVISTL  217
             MGGH+SK+  E S+           T  +SSYEAAC LD DLQ+FD+TLQARTNHVI+TL
Sbjct  1     MGGHVSKRPAEASSSSINLNNNLQYTTGLSSYEAACLLDKDLQSFDTTLQARTNHVINTL  60

Query  218   AVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSL  397
             AVGVEVRALSFDSLKEVT CLL+MN+EVVKVILECK+DIW+N ELFELVEEYFENSL++L
Sbjct  61    AVGVEVRALSFDSLKEVTECLLEMNQEVVKVILECKRDIWKNQELFELVEEYFENSLQTL  120

Query  398   DFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTE  577
             DFCAAL+KCLKRAR+SQLLI +AL++FEEES   +   +KY +TLEELK F+A+G+PFTE
Sbjct  121   DFCAALEKCLKRARDSQLLILVALQQFEEES---EAGGSKYVKTLEELKSFKAAGDPFTE  177

Query  578   EFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvta  757
             EFFQIFQSVY QQ  MLEKLQ RKNKLDKKL+ IHAWRKVSS++F AT A VLICSVV A
Sbjct  178   EFFQIFQSVYRQQITMLEKLQLRKNKLDKKLKCIHAWRKVSSIIFVATFATVLICSVVAA  237

Query  758   aiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDT  937
             A+A+P VA ALAAA++IP+GSMGKWIDSL KNYE+A+KG KE+IS+MQVGT++ IKDLDT
Sbjct  238   AMAAPPVAAALAAASSIPLGSMGKWIDSLWKNYENALKGQKEVISTMQVGTFVAIKDLDT  297

Query  938   IKVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDI  1117
             I+VL +RLE+EIE+L+ TT FAI   AVK+ IE+I+KKL +FMKNVEDLG QAD CSRDI
Sbjct  298   IRVLINRLEIEIEALMQTTDFAIEHDAVKLAIEDIKKKLGVFMKNVEDLGAQADTCSRDI  357

Query  1118  RRARTVILQRIIKHPNH  1168
             RRARTV+LQRIIK+P +
Sbjct  358   RRARTVVLQRIIKNPQN  374



>gb|KDP46219.1| hypothetical protein JCGZ_10059 [Jatropha curcas]
Length=380

 Score =   508 bits (1307),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 273/384 (71%), Positives = 326/384 (85%), Gaps = 17/384 (4%)
 Frame = +2

Query  56    MGGHMSKKSG-------------ETSNDLQCRTDLISSYEAACELDADLQTFDSTLQART  196
             MGGH+SKK                 +N+LQ  T+L S YEAAC LD DLQTFD++LQ RT
Sbjct  1     MGGHLSKKLPAEIAASSSSSTIVNLNNNLQYATEL-SFYEAACRLDKDLQTFDTSLQVRT  59

Query  197   NHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYF  376
             N VI+TLAVGVEVRALSFDSLKEVT CLL+MN+EVVKVILECKKDIW+N ELFELVEEYF
Sbjct  60    NQVINTLAVGVEVRALSFDSLKEVTECLLEMNQEVVKVILECKKDIWKNQELFELVEEYF  119

Query  377   ENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRA  556
             ENSL++LDFC AL+KCLKRAR+SQL I +AL++FEEES  ++G  N++ +TLE LK F++
Sbjct  120   ENSLQTLDFCTALEKCLKRARDSQLFILVALQQFEEES--VNGG-NRFGKTLEGLKNFKS  176

Query  557   SGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVL  736
             +G+PFTE+FFQ+FQSVY QQ LMLEKLQSRKNKLDKKL+YIHAWRKVSS++F AT AAVL
Sbjct  177   AGDPFTEDFFQLFQSVYRQQILMLEKLQSRKNKLDKKLKYIHAWRKVSSIIFVATFAAVL  236

Query  737   ICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYI  916
             ICSVV AA+A+P VA ALAAAT+IP+GSMGKWIDSL KNYE+A+KG KE+ S+MQVGTY+
Sbjct  237   ICSVVAAAMAAPPVAAALAAATSIPLGSMGKWIDSLWKNYENALKGQKELTSTMQVGTYV  296

Query  917   TIKDLDTIKVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQA  1096
              IKDLD I++L DRLE++IE L+    FAI E AV++ IEEI+KKL++FMK+VEDLGVQA
Sbjct  297   AIKDLDNIRLLIDRLEIDIEGLMVNAEFAIEEEAVRIAIEEIKKKLEVFMKHVEDLGVQA  356

Query  1097  DNCSRDIRRARTVILQRIIKHPNH  1168
             DNCSRDIRRARTV+LQRIIKHPN+
Sbjct  357   DNCSRDIRRARTVVLQRIIKHPNN  380



>ref|XP_011092769.1| PREDICTED: UPF0496 protein At4g34320-like [Sesamum indicum]
 ref|XP_011092770.1| PREDICTED: UPF0496 protein At4g34320-like [Sesamum indicum]
 ref|XP_011092771.1| PREDICTED: UPF0496 protein At4g34320-like [Sesamum indicum]
 ref|XP_011092772.1| PREDICTED: UPF0496 protein At4g34320-like [Sesamum indicum]
Length=372

 Score =   506 bits (1304),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 285/378 (75%), Positives = 333/378 (88%), Gaps = 13/378 (3%)
 Frame = +2

Query  56    MGGHMSKKSGETS-----NDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLA  220
             MG HMSKK GETS     N+L   T+L + YEAAC LD DLQ+FD+TLQARTN+VI++LA
Sbjct  1     MGSHMSKKPGETSAAASINNLHYTTEL-NYYEAACRLDVDLQSFDTTLQARTNNVINSLA  59

Query  221   VGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLD  400
              GVEV+ALSFDSLKEVT CLL+MN+EVVKVIL+CKKDIW+N ELF+LVE+YFENSLK+LD
Sbjct  60    AGVEVKALSFDSLKEVTECLLEMNQEVVKVILDCKKDIWKNQELFDLVEDYFENSLKTLD  119

Query  401   FCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEE  580
             FCAAL+KCLKRAR+SQLLIH+AL++FEEE G     N KY +TLEELK F+ +G+PFTE+
Sbjct  120   FCAALEKCLKRARDSQLLIHVALQQFEEEDG-----NEKYSKTLEELKSFKDAGDPFTED  174

Query  581   FFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaa  760
             FFQIFQSVY+QQ LMLEKLQ +KNKLDKKLRYIHAWRKVSS++FAAT AAVLICSVV AA
Sbjct  175   FFQIFQSVYMQQMLMLEKLQLKKNKLDKKLRYIHAWRKVSSIIFAATFAAVLICSVVAAA  234

Query  761   iaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTI  940
             +A+P VA ALAAAT+IP+GSMGKWIDSLLKNYE+A+KG KEII+ M VGTY+TIKDLD+I
Sbjct  235   MAAPPVAAALAAATSIPLGSMGKWIDSLLKNYENAVKGQKEIINCMNVGTYVTIKDLDSI  294

Query  941   KVLADRLELEIESLLNTTSFAI--NEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRD  1114
             +VL DRLE+EIESLL    FAI   + AV+VG+EEI+KKLD+FMKN+E+LGVQADNCSRD
Sbjct  295   RVLIDRLEIEIESLLKNAEFAIINGDEAVRVGVEEIKKKLDVFMKNIEELGVQADNCSRD  354

Query  1115  IRRARTVILQRIIKHPNH  1168
             IRRARTVILQRIIKHPNH
Sbjct  355   IRRARTVILQRIIKHPNH  372



>ref|XP_007131859.1| hypothetical protein PHAVU_011G047500g [Phaseolus vulgaris]
 gb|ESW03853.1| hypothetical protein PHAVU_011G047500g [Phaseolus vulgaris]
Length=372

 Score =   506 bits (1302),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 271/376 (72%), Positives = 327/376 (87%), Gaps = 9/376 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETSN-----DLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLA  220
             MG HMSKK  ETS+     +L  +T+L SSYEAAC+LD+DLQ FD+TLQARTN VI+TLA
Sbjct  1     MGSHMSKKVPETSSVGLGTELHYKTEL-SSYEAACKLDSDLQFFDTTLQARTNEVINTLA  59

Query  221   VGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLD  400
              GVEVRALSFDSLK++T CL++MN+EVVKVIL+CKKDIW++ ELFELVEEYFENSL++LD
Sbjct  60    AGVEVRALSFDSLKQITECLMEMNQEVVKVILDCKKDIWKSQELFELVEEYFENSLQTLD  119

Query  401   FCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEE  580
             FC AL+KCLKR+R+SQLLI +AL++FEEES  + G +N+Y RTL+E K F+A+G+PFT+E
Sbjct  120   FCTALEKCLKRSRDSQLLILVALQQFEEES--VLG-DNRYVRTLQEFKNFKAAGDPFTQE  176

Query  581   FFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaa  760
             FFQIFQS Y  Q LM EKLQ RKNKLDKKL+YI +WRKVSS++F AT AAVLICSVV AA
Sbjct  177   FFQIFQSAYKHQILMFEKLQLRKNKLDKKLKYIKSWRKVSSMIFVATFAAVLICSVVAAA  236

Query  761   iaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTI  940
             IA+P +A A+AAAT+IPIGSMGKW+DSL KNYE+A+KG KE+ISSMQ GTY+ IKDLD+I
Sbjct  237   IAAPPIAAAIAAATSIPIGSMGKWMDSLWKNYENALKGQKEVISSMQAGTYVAIKDLDSI  296

Query  941   KVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIR  1120
             +VL DRL++EIESLL+   FAI+E AVKV IEEI+KKL +FMKNVEDLGVQAD CSRDIR
Sbjct  297   RVLIDRLQIEIESLLHNVDFAIDEGAVKVAIEEIKKKLGVFMKNVEDLGVQADMCSRDIR  356

Query  1121  RARTVILQRIIKHPNH  1168
             RARTV+LQRIIKHP++
Sbjct  357   RARTVVLQRIIKHPHN  372



>ref|XP_007201071.1| hypothetical protein PRUPE_ppa007273mg [Prunus persica]
 gb|EMJ02270.1| hypothetical protein PRUPE_ppa007273mg [Prunus persica]
Length=375

 Score =   504 bits (1299),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 278/380 (73%), Positives = 324/380 (85%), Gaps = 14/380 (4%)
 Frame = +2

Query  56    MGGHMSKKSGET-------SNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVIST  214
             MG HMSKKS ET       + +LQ  TD +SSYEAAC++DA+LQ+FD+ LQ RTN VI+T
Sbjct  1     MGSHMSKKSSETSSSAINLNTNLQYTTDQLSSYEAACKVDAELQSFDTNLQTRTNQVINT  60

Query  215   LAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKS  394
             +A GVEVRALSFDSLKE+T CLL+MN+EVVKVILECKKDIW+N ELFELVEEYFENSL++
Sbjct  61    IAAGVEVRALSFDSLKEITECLLEMNQEVVKVILECKKDIWKNQELFELVEEYFENSLQT  120

Query  395   LDFCAALDKCLKRARESQLLIHLALKEFEEES--GGIDGSNNKYERTLEELKGFRASGNP  568
             LDFC AL+KCLKRAR+SQLLI +AL++FEEE+  GG     ++Y RTL ELK F+A G+P
Sbjct  121   LDFCTALEKCLKRARDSQLLILVALQQFEEETEMGG-----SRYTRTLGELKNFKAIGDP  175

Query  569   FTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsv  748
             FTEEFFQIFQSVY QQ  MLEKLQ RKNKLDKKL+YIHAWRKVSS++F AT AAVLICSV
Sbjct  176   FTEEFFQIFQSVYRQQIQMLEKLQLRKNKLDKKLKYIHAWRKVSSIIFVATFAAVLICSV  235

Query  749   vtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKD  928
             V AA+A+P VA ALAAA++IP+GSMGKWIDSL KNYE+A++G KE+ISSMQVGTY+ IKD
Sbjct  236   VAAAMAAPPVAAALAAASSIPVGSMGKWIDSLWKNYENALRGQKEVISSMQVGTYVAIKD  295

Query  929   LDTIKVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCS  1108
             LD I+VL DRLE+EIESLL+  SFAI E AV V IEEI+KKL +FMKNVEDLG QAD CS
Sbjct  296   LDNIRVLIDRLEVEIESLLHNASFAIEEDAVTVAIEEIKKKLGVFMKNVEDLGAQADTCS  355

Query  1109  RDIRRARTVILQRIIKHPNH  1168
             RDIRRARTV+LQRIIKH N+
Sbjct  356   RDIRRARTVVLQRIIKHSNN  375



>ref|XP_008236784.1| PREDICTED: UPF0496 protein At4g34320-like [Prunus mume]
Length=375

 Score =   504 bits (1298),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 276/380 (73%), Positives = 324/380 (85%), Gaps = 14/380 (4%)
 Frame = +2

Query  56    MGGHMSKKSGET-------SNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVIST  214
             MG HMSKKS ET       + +LQ  TD +SSYEAAC++DA+LQ+FD+ +Q RTN VI+T
Sbjct  1     MGSHMSKKSSETSSSAINLNTNLQYTTDQLSSYEAACKVDAELQSFDTNIQTRTNQVINT  60

Query  215   LAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKS  394
             +A GVEVRALSFDSLKE+T CLL+MN+EVVKVILECKKDIW+N ELFELVEEYFENSL++
Sbjct  61    IAAGVEVRALSFDSLKEITECLLEMNQEVVKVILECKKDIWKNQELFELVEEYFENSLQT  120

Query  395   LDFCAALDKCLKRARESQLLIHLALKEFEEES--GGIDGSNNKYERTLEELKGFRASGNP  568
             LDFC AL+KCLKRAR+SQLLI +AL++FEEE+  GG     ++Y RTL+ELK F+A G+P
Sbjct  121   LDFCTALEKCLKRARDSQLLILVALQQFEEETEMGG-----SRYTRTLDELKTFKAIGDP  175

Query  569   FTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsv  748
             FTEEFFQIFQSVY QQ LM EKLQ RKNKLDKK +YIHAWRKVSS++F AT AAVLICSV
Sbjct  176   FTEEFFQIFQSVYRQQILMFEKLQLRKNKLDKKFKYIHAWRKVSSIIFVATFAAVLICSV  235

Query  749   vtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKD  928
             V AA+A+P VA ALAAA++IP+GSMGKWIDSL KNYE+A++G KE+ISSMQVGTY+ IKD
Sbjct  236   VAAAMAAPPVAAALAAASSIPVGSMGKWIDSLWKNYENALRGQKEVISSMQVGTYVAIKD  295

Query  929   LDTIKVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCS  1108
             LD I+VL DRLE+EIESLL+  SFAI E AV V IEEI+KKL +FMKNVEDLG QAD CS
Sbjct  296   LDNIRVLIDRLEVEIESLLHNASFAIEEDAVTVAIEEIKKKLGVFMKNVEDLGAQADTCS  355

Query  1109  RDIRRARTVILQRIIKHPNH  1168
             RDIRRARTV+LQRIIKH N+
Sbjct  356   RDIRRARTVVLQRIIKHSNN  375



>gb|KEH30404.1| UPF0496 plant-like protein [Medicago truncatula]
Length=374

 Score =   503 bits (1295),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 273/377 (72%), Positives = 321/377 (85%), Gaps = 11/377 (3%)
 Frame = +2

Query  56    MGGHMSKKSGETSN-------DLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVIST  214
             MG +MSKK+ ETS+       +L  +T+L SSYEAAC++D DLQTFDSTLQ RTN VI+T
Sbjct  1     MGSNMSKKTQETSSAVNFTTTELHYKTEL-SSYEAACKIDTDLQTFDSTLQTRTNQVINT  59

Query  215   LAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKS  394
             LA GVEVRALSF+SLK+VT CLL+MN+EVVKVIL+CKKDIW + +LFELVEEYFENSL++
Sbjct  60    LASGVEVRALSFESLKQVTECLLEMNQEVVKVILDCKKDIWNSQDLFELVEEYFENSLQT  119

Query  395   LDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFT  574
             LDFC AL+KCLKRAR+SQLLI +A++ FEEES   +  +  Y RTL+ELK F+ +G+PFT
Sbjct  120   LDFCTALEKCLKRARDSQLLILVAIQRFEEES---ESGDKCYARTLQELKNFKTAGDPFT  176

Query  575   EEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvt  754
             EEFFQIFQSVY QQ  MLEKLQ RKNKLDKKL+ IH+WRKVSS++F AT AAVLICSVV 
Sbjct  177   EEFFQIFQSVYKQQTSMLEKLQIRKNKLDKKLKGIHSWRKVSSMIFVATFAAVLICSVVA  236

Query  755   aaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLD  934
             AAIA+P VA ALAAAT+IPIGSMGKWIDSL +NYE A+KG KE+I SMQ GTY+ IKDLD
Sbjct  237   AAIAAPPVAAALAAATSIPIGSMGKWIDSLWRNYEIALKGQKEVIGSMQAGTYVAIKDLD  296

Query  935   TIKVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRD  1114
              I+VL DRLE+E+ESLL+T  FAI E AVK+ IE+I+KKL +FMKNVEDLGVQADNCSRD
Sbjct  297   NIRVLIDRLEIEVESLLHTVDFAIEEEAVKIAIEDIKKKLGVFMKNVEDLGVQADNCSRD  356

Query  1115  IRRARTVILQRIIKHPN  1165
             IRRARTV+LQRIIKHPN
Sbjct  357   IRRARTVVLQRIIKHPN  373



>ref|XP_002306083.1| hypothetical protein POPTR_0004s15800g [Populus trichocarpa]
 gb|EEE86594.1| hypothetical protein POPTR_0004s15800g [Populus trichocarpa]
Length=363

 Score =   501 bits (1290),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 268/378 (71%), Positives = 312/378 (83%), Gaps = 22/378 (6%)
 Frame = +2

Query  56    MGGHMSKKSGETS-------NDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVIST  214
             MGGH+SK+  E S       N+LQ  T+L SSYEAAC LD DLQ+FD+TLQARTNHVI+T
Sbjct  1     MGGHVSKRPAEASSSAINLNNNLQYTTEL-SSYEAACRLDKDLQSFDTTLQARTNHVINT  59

Query  215   LAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKS  394
             LAVG+EVRALSFDSLKEVT CLL+MN+EVVKVILECKKDIW++ ELFELVEEYFENSL++
Sbjct  60    LAVGIEVRALSFDSLKEVTECLLEMNQEVVKVILECKKDIWKDQELFELVEEYFENSLQT  119

Query  395   LDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFT  574
             LDFCAAL+KCLKRAR+SQLLI    +E              Y RTLEELK F+A+G+PFT
Sbjct  120   LDFCAALEKCLKRARDSQLLILAGERE--------------YVRTLEELKNFKAAGDPFT  165

Query  575   EEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvt  754
             +EFFQIFQSVY QQ +MLEKLQ RKNKLDKKL+ IH WRKVSS++F AT A VLICSVV 
Sbjct  166   DEFFQIFQSVYRQQIMMLEKLQLRKNKLDKKLKCIHTWRKVSSMIFVATFATVLICSVVA  225

Query  755   aaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLD  934
             AA+ +P V  A+AAA+ IP+GSMGKWIDSL KNYE+A+KG KE+IS+MQVGTY+ IKDLD
Sbjct  226   AAMTAPPVVAAVAAASTIPLGSMGKWIDSLWKNYENALKGQKEVISTMQVGTYVAIKDLD  285

Query  935   TIKVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRD  1114
              I+VL DRLE+EIE+L+ TT FAI   AVKV IEEI+KKL +FMKNVEDLGV AD CSRD
Sbjct  286   NIRVLIDRLEIEIEALMRTTDFAIEHGAVKVAIEEIKKKLGVFMKNVEDLGVLADTCSRD  345

Query  1115  IRRARTVILQRIIKHPNH  1168
             I RARTV+LQRIIK+PN+
Sbjct  346   IMRARTVVLQRIIKNPNN  363



>ref|XP_003529196.1| PREDICTED: UPF0496 protein At4g34320-like [Glycine max]
Length=371

 Score =   497 bits (1280),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 263/373 (71%), Positives = 320/373 (86%), Gaps = 6/373 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDL---ISSYEAACELDADLQTFDSTLQARTNHVISTLAVG  226
             MGGHMSKK+ ETS+ +    D+   + SYEAAC+LD+DLQ+F++T+QAR N VI+TLAVG
Sbjct  1     MGGHMSKKTPETSSGININADMATELRSYEAACKLDSDLQSFNTTIQARANQVINTLAVG  60

Query  227   VEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFC  406
             VEVR+LSF+SLK+VT CLL+MN+EVVKVIL+CKKDIW+N ELFELVEEYF+NSL++LDFC
Sbjct  61    VEVRSLSFESLKQVTECLLEMNQEVVKVILDCKKDIWKNPELFELVEEYFDNSLQTLDFC  120

Query  407   AALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFF  586
              AL+KCLKRAR++QLLI +AL++FEEE+        +Y RTL+ELK F+A+G+PFTEEFF
Sbjct  121   TALEKCLKRARDNQLLILMALQQFEEETS---LGETRYTRTLQELKNFKAAGDPFTEEFF  177

Query  587   QIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaia  766
             Q++QSVY QQ LMLEKL+ R++KLDKK++ IH WRKVSSV+FAAT+AAVLICSVV AAIA
Sbjct  178   QMYQSVYNQQILMLEKLRVRQSKLDKKVKQIHTWRKVSSVIFAATVAAVLICSVVAAAIA  237

Query  767   spavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKV  946
             +P VA ALAA TAIPIGSMGKWIDSLLKNYE+A+KGHKE+  SMQVG Y+ IKDLD I+V
Sbjct  238   TPHVAAALAAVTAIPIGSMGKWIDSLLKNYENAMKGHKEVAISMQVGAYVAIKDLDNIRV  297

Query  947   LADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRA  1126
             L DRLE+EIESL     FA+ E AVKV IEEI+KKL +FMKNVEDLG+QAD CSRDI RA
Sbjct  298   LIDRLEVEIESLFQNVEFALEEEAVKVAIEEIKKKLGVFMKNVEDLGLQADTCSRDIIRA  357

Query  1127  RTVILQRIIKHPN  1165
             RTV+LQ+IIK P+
Sbjct  358   RTVVLQKIIKLPH  370



>ref|XP_007153142.1| hypothetical protein PHAVU_003G010400g [Phaseolus vulgaris]
 gb|ESW25136.1| hypothetical protein PHAVU_003G010400g [Phaseolus vulgaris]
Length=371

 Score =   491 bits (1264),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 256/374 (68%), Positives = 316/374 (84%), Gaps = 6/374 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDL---ISSYEAACELDADLQTFDSTLQARTNHVISTLAVG  226
             MGGHMSKK+ ETS+ +   TD+   + SYEAA +LD+DLQ+FD+T+QAR N VI TLAVG
Sbjct  1     MGGHMSKKTPETSSGINFNTDMATELRSYEAAYKLDSDLQSFDTTVQARANQVIKTLAVG  60

Query  227   VEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFC  406
             VEVR+LSF+SLK+VT CLL+MN+EVVKVIL  KKDIW+N ELFELVEEY ENSL++LD C
Sbjct  61    VEVRSLSFESLKQVTECLLEMNQEVVKVILSSKKDIWKNQELFELVEEYLENSLQTLDLC  120

Query  407   AALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFF  586
              AL+KCLKRAR+SQLLI  AL++FEEE+   +    +Y RTL+ELK F+ASG+PFTEEFF
Sbjct  121   TALEKCLKRARDSQLLIFAALQQFEEET---ELGEKRYTRTLQELKNFKASGDPFTEEFF  177

Query  587   QIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaia  766
             Q++QSVY QQ LMLEKLQ R++KLDKK++ +H WRKVSS++F AT+AAVLICSVV AAIA
Sbjct  178   QMYQSVYNQQILMLEKLQVRQSKLDKKVKQVHTWRKVSSMIFVATVAAVLICSVVAAAIA  237

Query  767   spavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKV  946
             SP VA  LAA +A+PIGSMGKWID++LK+YE A++GH+E+I SMQVGTY+ IKDLD+I+V
Sbjct  238   SPHVATILAAVSAVPIGSMGKWIDTMLKSYETAVRGHREVIISMQVGTYVAIKDLDSIRV  297

Query  947   LADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRA  1126
             L D++E+EIES+L    FAI +  VKV IEE++KKL +FMKNVEDLGVQAD CSRDI RA
Sbjct  298   LIDKVEIEIESVLQNVEFAIEDDGVKVAIEEMKKKLGVFMKNVEDLGVQADTCSRDIIRA  357

Query  1127  RTVILQRIIKHPNH  1168
             RTV+LQRIIK PN+
Sbjct  358   RTVVLQRIIKLPNN  371



>ref|XP_004148297.1| PREDICTED: UPF0496 protein At4g34320-like [Cucumis sativus]
 ref|XP_004163630.1| PREDICTED: UPF0496 protein At4g34320-like [Cucumis sativus]
 gb|KGN44316.1| hypothetical protein Csa_7G253710 [Cucumis sativus]
Length=372

 Score =   484 bits (1247),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 259/374 (69%), Positives = 309/374 (83%), Gaps = 5/374 (1%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQ---CRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVG  226
             MG H SKKS  +S +L      T  +SSYEAAC+ DADLQ+FDSTLQART+  I+T+AVG
Sbjct  1     MGAHFSKKSSVSSINLSPNLAYTTELSSYEAACKADADLQSFDSTLQARTHQAINTIAVG  60

Query  227   VEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFC  406
             VEVRALSFDSLKE+T CLL+MN+EVVKVIL CKKDIW+N ELFELVEEYFENSL+SLDFC
Sbjct  61    VEVRALSFDSLKEITECLLEMNQEVVKVILSCKKDIWKNQELFELVEEYFENSLQSLDFC  120

Query  407   AALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFF  586
               LDKCLK+AR+S LLI +A++ FEEE   +DG  N Y RTL+ELK F+A+G+PFT EFF
Sbjct  121   TELDKCLKKARDSHLLIVMAIERFEEEVKMVDG--NGYVRTLQELKNFKAAGDPFTNEFF  178

Query  587   QIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaia  766
             QIF +VY  Q  MLEKL  RKNKLDKKL+ +  WRKVSS++F AT A VLICS+V AA+A
Sbjct  179   QIFNAVYRHQIGMLEKLVIRKNKLDKKLKSMSTWRKVSSMIFIATFATVLICSIVAAAMA  238

Query  767   spavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKV  946
             +P VA A+AAA +IP+GS+GKWIDSL KNYE A+KG KE++SSMQVGTY+ IKD+D I+V
Sbjct  239   APPVAAAMAAAASIPVGSVGKWIDSLWKNYEAALKGQKEVVSSMQVGTYLAIKDMDNIRV  298

Query  947   LADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRA  1126
             L D+L +EIESLL    FAI E AVK+G+EE++KKL  FMKNVEDLGVQAD+CSRDIRRA
Sbjct  299   LIDKLTMEIESLLKKADFAIEEEAVKLGVEEMKKKLGQFMKNVEDLGVQADSCSRDIRRA  358

Query  1127  RTVILQRIIKHPNH  1168
             RTV+LQRIIKHPN+
Sbjct  359   RTVVLQRIIKHPNN  372



>ref|XP_008447055.1| PREDICTED: UPF0496 protein At4g34320-like [Cucumis melo]
Length=372

 Score =   479 bits (1234),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 256/374 (68%), Positives = 308/374 (82%), Gaps = 5/374 (1%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCR---TDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVG  226
             MG H+SKKS  +S +L      T  +SSYEAAC+ DADLQ+FDSTLQART+  I+T+AVG
Sbjct  1     MGAHLSKKSSVSSINLSPNLTYTTELSSYEAACKADADLQSFDSTLQARTHQAINTIAVG  60

Query  227   VEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFC  406
             VEVRALSFDSLKE+T CLL+MN+EVVKVIL CKKDIW+N ELFELVEEYFENSL+SLDFC
Sbjct  61    VEVRALSFDSLKEITECLLEMNQEVVKVILSCKKDIWKNQELFELVEEYFENSLQSLDFC  120

Query  407   AALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFF  586
               LDKCLK+AR+S LLI +A++ FEEE   +DG  N Y +TL+ELK F+A+G+PFT+EFF
Sbjct  121   TELDKCLKKARDSHLLIVMAIERFEEEVKMVDG--NGYVKTLQELKNFKAAGDPFTDEFF  178

Query  587   QIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaia  766
             QIF + Y  Q  MLEKL  RKNKLDKKL+ +  WRKVSS++F AT A VLICS+V AA+A
Sbjct  179   QIFNAAYRHQIGMLEKLLIRKNKLDKKLKSMSTWRKVSSMIFIATFATVLICSIVAAAMA  238

Query  767   spavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKV  946
             +P VA A+AAA +IP+GSMGKWIDSL K YE A+KG KE++SSMQVGTY+ IKD+D I+V
Sbjct  239   APPVAAAMAAAASIPVGSMGKWIDSLWKKYEAALKGQKEVVSSMQVGTYLAIKDMDNIRV  298

Query  947   LADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRA  1126
             L D+L +EIESLL    FAI E AV++G+EE++KKL  FMKNVEDLG+QAD CSRDIRRA
Sbjct  299   LIDKLTVEIESLLKKADFAIEEEAVQLGVEEMKKKLAQFMKNVEDLGLQADTCSRDIRRA  358

Query  1127  RTVILQRIIKHPNH  1168
             RTVILQRIIKHPN+
Sbjct  359   RTVILQRIIKHPNN  372



>ref|XP_010690930.1| PREDICTED: UPF0496 protein At4g34320-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010690931.1| PREDICTED: UPF0496 protein At4g34320-like [Beta vulgaris subsp. 
vulgaris]
Length=371

 Score =   476 bits (1224),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 268/375 (71%), Positives = 323/375 (86%), Gaps = 8/375 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETS----NDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAV  223
             MGGHMSKK+ + S    ++LQ  T+L +SYEAAC+ D DLQ+FD+ L ARTNHVI++LA 
Sbjct  1     MGGHMSKKTVDQSSAEMHNLQYTTEL-TSYEAACKTDLDLQSFDTNLHARTNHVINSLAT  59

Query  224   GVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDF  403
             GVEVR+LSF S+KEVT CLL+MN+EVVKVILECK+DIW+  ELFELVEEYFENSL++LDF
Sbjct  60    GVEVRSLSFTSMKEVTECLLEMNQEVVKVILECKQDIWKTPELFELVEEYFENSLQTLDF  119

Query  404   CAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEF  583
             CAAL+KCLKR R+SQLLI +AL++FE+E G       +Y++TLEELK F+A G+PFTEEF
Sbjct  120   CAALEKCLKRVRDSQLLIMVALQQFEDEDG---AEKTRYQKTLEELKHFKAVGDPFTEEF  176

Query  584   FQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaai  763
             FQIFQSVY QQ  MLEKLQ +KNKLDKKL+Y+HAWRKVSS++F AT AAVLICSVV AA+
Sbjct  177   FQIFQSVYKQQLSMLEKLQLKKNKLDKKLKYVHAWRKVSSIIFVATFAAVLICSVVAAAM  236

Query  764   aspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIK  943
             A+P VA A+AAAT+IP+GSMG+WIDSL KNYE A+KG KE+ISSMQVGTYI IKDLD I+
Sbjct  237   AAPPVAAAVAAATSIPVGSMGRWIDSLWKNYETALKGQKEVISSMQVGTYIAIKDLDNIR  296

Query  944   VLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRR  1123
             VL D+L++E+ESLL T  FAI+E AVK+GIEEI+KK+ +F KNVEDLGVQAD CSRDIRR
Sbjct  297   VLIDKLQIELESLLRTADFAISEDAVKLGIEEIKKKMVVFTKNVEDLGVQADMCSRDIRR  356

Query  1124  ARTVILQRIIKHPNH  1168
             ARTV+LQRIIKHPN+
Sbjct  357   ARTVVLQRIIKHPNN  371



>gb|KHN02045.1| UPF0496 protein [Glycine soja]
Length=350

 Score =   474 bits (1221),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 251/348 (72%), Positives = 304/348 (87%), Gaps = 3/348 (1%)
 Frame = +2

Query  122   ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEV  301
             + SYEAAC+LD+DLQ+F++T+QAR N VI+TLAVGVEVR+LSF+SLK+VT CLL+MN+EV
Sbjct  5     LRSYEAACKLDSDLQSFNTTIQARANQVINTLAVGVEVRSLSFESLKQVTECLLEMNQEV  64

Query  302   VKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFE  481
             VKVIL+CKKDIW+N ELFELVEEYF+NSL++LDFC AL+KCLKRAR++QLLI +AL++FE
Sbjct  65    VKVILDCKKDIWKNPELFELVEEYFDNSLQTLDFCTALEKCLKRARDNQLLILMALQQFE  124

Query  482   EESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLD  661
             EE+        +Y RTL+ELK F+A+G+PFTEEFFQ++QSVY QQ LMLEKL+ R++KLD
Sbjct  125   EETS---LGETRYTRTLQELKNFKAAGDPFTEEFFQMYQSVYNQQILMLEKLRVRQSKLD  181

Query  662   KKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDS  841
             KK++ IH WRKVSSV+FAAT+AAVLICSVV AAIA+P VA ALAA TAIPIGSMGKWIDS
Sbjct  182   KKVKQIHTWRKVSSVIFAATVAAVLICSVVAAAIATPHVAAALAAVTAIPIGSMGKWIDS  241

Query  842   LLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINEAAV  1021
             LLKNYE+A+KGHKE+  SMQVG Y+ IKDLD I+VL DRLE+EIESL     FA+ E AV
Sbjct  242   LLKNYENAMKGHKEVAISMQVGAYVAIKDLDNIRVLIDRLEVEIESLFQNVEFALEEEAV  301

Query  1022  KVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
             KV IEEI+KKL +FMKNVEDLG+QAD CSRDI RARTV+LQ+IIK P+
Sbjct  302   KVAIEEIKKKLGVFMKNVEDLGLQADTCSRDIIRARTVVLQKIIKLPH  349



>ref|XP_008806206.1| PREDICTED: UPF0496 protein 1-like [Phoenix dactylifera]
Length=354

 Score =   472 bits (1214),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 251/350 (72%), Positives = 304/350 (87%), Gaps = 2/350 (1%)
 Frame = +2

Query  122   ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEV  301
             ++SYEAAC LD +LQ+FD+TLQ RT+ VISTLAVGVEVR+LSFDSLKEVTGCLL+MN+EV
Sbjct  5     LNSYEAACRLDPELQSFDTTLQQRTSRVISTLAVGVEVRSLSFDSLKEVTGCLLEMNQEV  64

Query  302   VKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEF-  478
             VKVILECKKDIWRN ELF LVEEYFENSL++LDFC AL+KCLK+AR+SQL+IH+AL+ F 
Sbjct  65    VKVILECKKDIWRNPELFGLVEEYFENSLQTLDFCTALEKCLKKARDSQLIIHVALQRFE  124

Query  479   EEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKL  658
             +EE    + S NKY +TLEEL+ F+A+G+PFTEEFF +FQSVY QQ  MLEKLQ RKNKL
Sbjct  125   DEEEVVEEDSRNKYVKTLEELRHFKAAGDPFTEEFFHVFQSVYTQQLSMLEKLQQRKNKL  184

Query  659   DKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWID  838
             DKKL+ I AWRKVSS++F AT A +LICSVV AA+A+P VA ALAAA +IP+GSMGKWID
Sbjct  185   DKKLKSIKAWRKVSSIIFVATFATILICSVVAAAVAAPPVAAALAAAASIPVGSMGKWID  244

Query  839   SLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAI-NEA  1015
             SLLK Y+ A+KG KEI+SSMQVGTYI IKDLD+I+VL DRLE++I++LL+    A+ +E 
Sbjct  245   SLLKGYQQAVKGQKEILSSMQVGTYIMIKDLDSIQVLVDRLEVQIDALLDNAELALRDEE  304

Query  1016  AVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
             AVK GIEEI+K+L++FMK++EDLG QAD CSRDIRRARTV+LQRII+HP 
Sbjct  305   AVKFGIEEIKKRLEVFMKSIEDLGEQADRCSRDIRRARTVVLQRIIRHPK  354



>gb|EYU37760.1| hypothetical protein MIMGU_mgv1a008357mg [Erythranthe guttata]
Length=376

 Score =   471 bits (1213),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 266/377 (71%), Positives = 323/377 (86%), Gaps = 8/377 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETS--ND----LQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTL  217
             MG HMSK SGETS  ND    L   TD + SYEAAC++D DLQ+FD+TLQ RT++VI++L
Sbjct  1     MGSHMSKNSGETSAANDQITPLHYTTDQLHSYEAACKIDTDLQSFDTTLQLRTSNVINSL  60

Query  218   AVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSL  397
             AVGVEVRALSFDSL++VT CLL+MN+EVVKVIL+CKKDIW+N ELFELVE+YFENSLK+L
Sbjct  61    AVGVEVRALSFDSLRQVTECLLEMNQEVVKVILDCKKDIWKNQELFELVEDYFENSLKTL  120

Query  398   DFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTE  577
             DFCAAL+KCLK AR+ QLLIH+AL++FEEE   I+    KY +TL+ELK F+ +G+PFT+
Sbjct  121   DFCAALEKCLKSARDRQLLIHIALQQFEEEDNKIEEGKVKYSKTLKELKNFKDAGDPFTD  180

Query  578   EFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvta  757
             +FF+IFQSVY QQ  MLEKLQ +KNKLDKKL+YIHAWRKVSS++FAAT AAVLICSVV A
Sbjct  181   DFFKIFQSVYSQQISMLEKLQLKKNKLDKKLKYIHAWRKVSSIIFAATFAAVLICSVVAA  240

Query  758   aiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDT  937
             A+A+P VA ALAAA ++P+GSMG+WIDSLLKNYE+A+KG KEII  M VG+Y+TIKDLD 
Sbjct  241   AMAAPPVAAALAAAASVPLGSMGRWIDSLLKNYENAVKGQKEIIGYMSVGSYVTIKDLDN  300

Query  938   IKVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDI  1117
             I+VL DRLE+EIESLL +  FA  E +VKV ++EI+KKL +F+KN+E+LG QAD CSRDI
Sbjct  301   IRVLIDRLEIEIESLLKSADFA--EESVKVAVDEIKKKLAVFVKNIEELGDQADKCSRDI  358

Query  1118  RRARTVILQRIIKHPNH  1168
             RRARTVILQRIIKHPN+
Sbjct  359   RRARTVILQRIIKHPNN  375



>ref|XP_002869155.1| hypothetical protein ARALYDRAFT_491233 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45414.1| hypothetical protein ARALYDRAFT_491233 [Arabidopsis lyrata subsp. 
lyrata]
Length=374

 Score =   469 bits (1208),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 253/374 (68%), Positives = 311/374 (83%), Gaps = 8/374 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEV  235
             MG   SKKS ETS      T  + SYEAAC+ D +LQ+FD+ L+ART+HVISTLA GVEV
Sbjct  1     MGNQTSKKSQETSAKSVHYTTELRSYEAACKADTELQSFDTCLKARTSHVISTLATGVEV  60

Query  236   RALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAAL  415
             RALSFDSLKEVT CLL+MN+EVVKVIL+CKKDIW+N E+FELVE+YFENSLK+LDFCAAL
Sbjct  61    RALSFDSLKEVTQCLLEMNQEVVKVILDCKKDIWKNQEMFELVEDYFENSLKTLDFCAAL  120

Query  416   DKCLKRARESQLLIHLALKEFEEES---GGIDGSNNKYERTLEELKGFRASGNPFTEEFF  586
             +K L+RAR+S LLI +AL++FE+ES   GG     N Y++TLEELK F+ + +PF E+FF
Sbjct  121   EKGLRRARDSHLLILVALQQFEDESLVQGG-----NGYKKTLEELKNFKDAESPFNEDFF  175

Query  587   QIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaia  766
             ++FQSVY QQ LMLEKLQ RKNKLDKKL+ IH WRK+SS++F AT A VLICSVV AA+A
Sbjct  176   KMFQSVYKQQMLMLEKLQLRKNKLDKKLKCIHTWRKLSSIIFVATFATVLICSVVAAAMA  235

Query  767   spavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKV  946
             +P VA ALAAATA+P+GSMGKWIDSL KNYE+A+KG KE+ISSMQ GT++ +KDLD I+V
Sbjct  236   APPVAAALAAATAVPLGSMGKWIDSLWKNYENALKGQKEVISSMQAGTFVAVKDLDNIRV  295

Query  947   LADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRA  1126
             L +RLE+EI  ++ +  FA+   AVK+GI++I+KKL++F KNVE+LG QAD CSRDIRRA
Sbjct  296   LIERLEIEITGMVKSAEFAVEHNAVKIGIDDIKKKLEVFKKNVEELGTQADLCSRDIRRA  355

Query  1127  RTVILQRIIKHPNH  1168
             RTVILQRIIKHPN+
Sbjct  356   RTVILQRIIKHPNN  369



>ref|NP_195158.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9SYZ7.1|U496A_ARATH RecName: Full=UPF0496 protein At4g34320 [Arabidopsis thaliana]
 emb|CAB36709.1| putative protein [Arabidopsis thaliana]
 emb|CAB80149.1| putative protein [Arabidopsis thaliana]
 gb|AEE86359.1| uncharacterized protein AT4G34320 [Arabidopsis thaliana]
Length=374

 Score =   469 bits (1208),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 253/374 (68%), Positives = 310/374 (83%), Gaps = 8/374 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEV  235
             MG   SKKS ETS      T  + SY AAC+ D +LQ+FD+ LQART+HVISTLA GVEV
Sbjct  1     MGNQTSKKSQETSAKSVHYTTELRSYAAACKADTELQSFDTCLQARTSHVISTLATGVEV  60

Query  236   RALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAAL  415
             RALSFDSLKEVT CLL+MN+EVVKVIL+CKKDIW+N E+FELVE+YFENSLK+LDFCAAL
Sbjct  61    RALSFDSLKEVTQCLLEMNQEVVKVILDCKKDIWKNQEMFELVEDYFENSLKTLDFCAAL  120

Query  416   DKCLKRARESQLLIHLALKEFEEES---GGIDGSNNKYERTLEELKGFRASGNPFTEEFF  586
             +K L+RAR+S LLI +AL++FE+ES   GG     N Y++TLEELK F+ + +PF E+FF
Sbjct  121   EKGLRRARDSHLLILVALQQFEDESLVQGG-----NGYKKTLEELKNFKDAESPFNEDFF  175

Query  587   QIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaia  766
             ++FQSVY QQ LMLEKLQ RKNKLDKKL+ IH WRK+SS++F AT A VLICSVV AA+A
Sbjct  176   KMFQSVYKQQMLMLEKLQHRKNKLDKKLKCIHTWRKLSSIIFVATFATVLICSVVAAAMA  235

Query  767   spavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKV  946
             +P VA ALAAATA+P+GSMGKWIDSL KNYE+A+KG KE+ISSMQ GT++ +KDLD I+V
Sbjct  236   APPVAAALAAATAVPLGSMGKWIDSLWKNYENALKGQKEVISSMQAGTFVAVKDLDNIRV  295

Query  947   LADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRA  1126
             L +RLE+EI  ++ +  FA+   AVK+GI++I+KKL++F KNVE+LG QAD CSRDIRRA
Sbjct  296   LIERLEIEITGMVKSAEFAVEHNAVKIGIDDIKKKLEVFKKNVEELGTQADLCSRDIRRA  355

Query  1127  RTVILQRIIKHPNH  1168
             RTVILQRIIKHPN+
Sbjct  356   RTVILQRIIKHPNN  369



>ref|XP_006285511.1| hypothetical protein CARUB_v10006952mg [Capsella rubella]
 gb|EOA18409.1| hypothetical protein CARUB_v10006952mg [Capsella rubella]
Length=376

 Score =   468 bits (1205),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 251/376 (67%), Positives = 312/376 (83%), Gaps = 10/376 (3%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQC--RTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGV  229
             MG   SK+  E+S   +    T  + SYEAAC+ D +LQ+FD+ LQART+HVISTLA GV
Sbjct  1     MGNQTSKRPQESSTSAKSVHYTTELRSYEAACKADTELQSFDTCLQARTSHVISTLATGV  60

Query  230   EVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCA  409
             EVRALSFDSLKEVT CLL+MN+EVVKVIL+CKKDIW+N E+F+LVE+YFENSLK+LDFCA
Sbjct  61    EVRALSFDSLKEVTQCLLEMNQEVVKVILDCKKDIWKNQEMFDLVEDYFENSLKTLDFCA  120

Query  410   ALDKCLKRARESQLLIHLALKEFEEES---GGIDGSNNKYERTLEELKGFRASGNPFTEE  580
             AL+K L+RAR+S LLIH+AL++FE+ES   GG     N Y++TLEELK F+ + +PF E+
Sbjct  121   ALEKGLRRARDSHLLIHVALQQFEDESLVQGG-----NGYKKTLEELKNFKDAESPFNED  175

Query  581   FFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaa  760
             FF++FQSVY QQ LMLEKLQ RKNKLDKKL+ IH WRK+SS++F AT A VLICSVV AA
Sbjct  176   FFKMFQSVYKQQMLMLEKLQLRKNKLDKKLKCIHTWRKLSSIIFVATFATVLICSVVAAA  235

Query  761   iaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTI  940
             +A+P VA ALAAATA+P+GSMGKWIDSL KNYE+A+KG KE+ISSMQ GT++ +KDLD I
Sbjct  236   MAAPPVAAALAAATAVPLGSMGKWIDSLWKNYENALKGQKEVISSMQAGTFVAVKDLDNI  295

Query  941   KVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIR  1120
             +VL +RLE+EI  ++ +  FA+   AVK+GI++I+KKL++F KNVE+LG QAD CSRDIR
Sbjct  296   RVLIERLEIEITGMVKSAEFAVEHNAVKIGIDDIKKKLEVFKKNVEELGTQADLCSRDIR  355

Query  1121  RARTVILQRIIKHPNH  1168
             RARTVILQRIIKHPN+
Sbjct  356   RARTVILQRIIKHPNN  371



>ref|XP_009388042.1| PREDICTED: UPF0496 protein 1-like [Musa acuminata subsp. malaccensis]
Length=389

 Score =   468 bits (1204),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 254/389 (65%), Positives = 320/389 (82%), Gaps = 21/389 (5%)
 Frame = +2

Query  56    MGGHMSKK--------------SGETSNDLQCRTDL-----ISSYEAACELDADLQTFDS  178
             MG H+SK+              S  T+ D   + D+     +SSYEAAC LD +LQTFDS
Sbjct  1     MGAHLSKRPDTPPVLLEDGGDASAATAGDKGVQADIRYVAELSSYEAACRLDPELQTFDS  60

Query  179   TLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFE  358
             TLQ RT+ VIS+LA+GVEVR+LS DSL+E+TGCLL+MN EVVKVILECK+DIW++ ELF+
Sbjct  61    TLQRRTSRVISSLALGVEVRSLSLDSLREITGCLLEMNHEVVKVILECKRDIWKSPELFD  120

Query  359   LVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEE  538
             LVE+YF+NSL++LDFCAAL+KCLK+AR++QL+IH+AL+ F EE    D  N KY RTLEE
Sbjct  121   LVEDYFDNSLQTLDFCAALEKCLKKARDTQLIIHVALQRFAEEEEEED-DNKKYSRTLEE  179

Query  539   LKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAA  718
             L+ F+A+G+PFTEEFF++FQSVY QQ LMLEKLQ RKNKLDKKL+ I AWR +SS++FAA
Sbjct  180   LRLFKAAGDPFTEEFFRVFQSVYRQQLLMLEKLQLRKNKLDKKLKSIKAWRTLSSIIFAA  239

Query  719   TLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSM  898
             T AAV+ICSVV AA+A+P VA ALAAA +IPIGSMGKWIDSLL +Y++A+KG KE++SSM
Sbjct  240   TFAAVIICSVVAAAVAAPPVAAALAAAASIPIGSMGKWIDSLLNDYQNALKGQKEVLSSM  299

Query  899   QVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINE-AAVKVGIEEIRKKLDLFMKNV  1075
             QVGT+I IKD+D+I+VL D+LE+ I SLL+ + FAI +  AVK+GIEEIRKK+++FMK+V
Sbjct  300   QVGTFIAIKDMDSIRVLIDKLEMGITSLLDDSEFAIKDVGAVKLGIEEIRKKMEVFMKSV  359

Query  1076  EDLGVQADNCSRDIRRARTVILQRIIKHP  1162
             EDLG QAD CSRDIRRARTV+LQRII++P
Sbjct  360   EDLGEQADRCSRDIRRARTVVLQRIIRNP  388



>ref|XP_004498189.1| PREDICTED: UPF0496 protein At4g34320-like [Cicer arietinum]
Length=373

 Score =   467 bits (1201),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 255/375 (68%), Positives = 309/375 (82%), Gaps = 8/375 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRT-DL---ISSYEAACELDADLQTFDSTLQARTNHVISTLAV  223
             MGG +SKK+  TS+D+     D+   + SYEAAC+LD+DLQ+F +TLQARTN VI+TLAV
Sbjct  1     MGGCLSKKTDGTSSDINLNAADMATELRSYEAACKLDSDLQSFGTTLQARTNQVINTLAV  60

Query  224   GVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDF  403
             GVEVR+LSFDSLK+VT CLL+MN+EVVKVIL+CKKDIW++ ELFELVEEYF+NSLK+LD 
Sbjct  61    GVEVRSLSFDSLKQVTECLLEMNQEVVKVILDCKKDIWKSQELFELVEEYFDNSLKTLDL  120

Query  404   CAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEF  583
             C AL KCLKRA++SQLLIH AL++FEEE+G      N+Y RTL+ELK F+ +G+PFTEEF
Sbjct  121   CTALQKCLKRAKDSQLLIHAALQKFEEETG---SGENRYTRTLQELKSFKDAGDPFTEEF  177

Query  584   FQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaai  763
              QI+QSVY QQ LM EKLQ RK+K DKKL+ I  WRKVS ++F  T+A+VLICSVV AA+
Sbjct  178   IQIYQSVYNQQILMFEKLQLRKSKFDKKLKQIRTWRKVSFIIFVVTVASVLICSVVAAAV  237

Query  764   aspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIK  943
             ASP VA ALAA TAIPIGSMGKWIDSL+KNYE+ +KGHKE+  SM VG+Y+ IKDLD I+
Sbjct  238   ASPHVAAALAAVTAIPIGSMGKWIDSLMKNYENVLKGHKEVTISMVVGSYVAIKDLDNIR  297

Query  944   VLADRLELEIESLLNTTSFAI-NEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIR  1120
             VL +RLE+EIESL     FAI  E AVKV IEEI+KKL +FMKNV+DLG QAD CSRDI 
Sbjct  298   VLVNRLEVEIESLQENVDFAIEEEEAVKVAIEEIKKKLGVFMKNVKDLGAQADTCSRDII  357

Query  1121  RARTVILQRIIKHPN  1165
             RARTV+LQ+I+K P+
Sbjct  358   RARTVVLQKIVKLPH  372



>ref|XP_010939026.1| PREDICTED: UPF0496 protein 1-like [Elaeis guineensis]
Length=386

 Score =   466 bits (1200),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 254/386 (66%), Positives = 314/386 (81%), Gaps = 16/386 (4%)
 Frame = +2

Query  56    MGGHMSKKSGET---------SNDLQCRTDL-----ISSYEAACELDADLQTFDSTLQAR  193
             MGG +S++ G           +     R  +     +SSYEAAC LD +LQ+FD+T Q R
Sbjct  1     MGGQLSRRPGTPPVVHVDGGATTSAGGRGGMEYLAELSSYEAACRLDPELQSFDTTFQQR  60

Query  194   TNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEY  373
             T+ VISTLA+GVEVR+LSF+SLKEVTGCLL+MN+EVVKVILECKKDIW+N ELF+LVEEY
Sbjct  61    TSRVISTLALGVEVRSLSFNSLKEVTGCLLEMNQEVVKVILECKKDIWKNPELFDLVEEY  120

Query  374   FENSLKSLDFCAALDKCLKRARESQLLIHLALKEF-EEESGGIDGSNNKYERTLEELKGF  550
             FE+SL++LDFC AL+KCLK+AR+SQL+IH+AL+ F EEE    + S  KY +TLEEL+ F
Sbjct  121   FESSLQTLDFCTALEKCLKKARDSQLIIHVALQHFEEEEEVVEEDSKKKYLKTLEELRHF  180

Query  551   RASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAA  730
             +A+G+PFTEEFFQ+FQSVY QQ  M EKLQ RKNK+DKKL+ I AWRKVSS++F AT A 
Sbjct  181   KAAGDPFTEEFFQVFQSVYRQQLSMFEKLQQRKNKVDKKLKSIKAWRKVSSIIFVATFAT  240

Query  731   VLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGT  910
             +LICSVV AA+A+P VA ALAAA +IP+GSMGKWIDSLLK Y+ A+KG KEI+SSMQVGT
Sbjct  241   ILICSVVAAAVAAPPVAAALAAAASIPVGSMGKWIDSLLKGYQQAVKGQKEILSSMQVGT  300

Query  911   YITIKDLDTIKVLADRLELEIESLLNTTSFAI-NEAAVKVGIEEIRKKLDLFMKNVEDLG  1087
             YI IKDLD+I+VL DRLE++I +LL+   FA+ +E AVK GIEEI+KKL++FMK++EDLG
Sbjct  301   YIMIKDLDSIRVLIDRLEIQINALLDNADFALRDEEAVKFGIEEIKKKLEVFMKSIEDLG  360

Query  1088  VQADNCSRDIRRARTVILQRIIKHPN  1165
              QAD CSRDIRRARTV+LQRII+HP 
Sbjct  361   EQADRCSRDIRRARTVVLQRIIRHPK  386



>ref|XP_010432431.1| PREDICTED: UPF0496 protein At4g34320 [Camelina sativa]
Length=374

 Score =   466 bits (1199),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 250/374 (67%), Positives = 309/374 (83%), Gaps = 8/374 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEV  235
             MG   SKK  + S      T  + SYEAAC+ D +LQ+FD+ LQART+HVISTLA GVEV
Sbjct  1     MGNQTSKKPQDASAKSVHYTTELRSYEAACKADTELQSFDTCLQARTSHVISTLATGVEV  60

Query  236   RALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAAL  415
             RALSFDSLKEVT CLL+MN+EVVKVIL+CKKDIW+N E+FELVE+YFENSLK+LDFCAAL
Sbjct  61    RALSFDSLKEVTQCLLEMNQEVVKVILDCKKDIWKNQEMFELVEDYFENSLKTLDFCAAL  120

Query  416   DKCLKRARESQLLIHLALKEFEEES---GGIDGSNNKYERTLEELKGFRASGNPFTEEFF  586
             +K L+RAR+S LLI +AL++FE+ES   GG     N Y++TLEELK F+ + +PF E+FF
Sbjct  121   EKGLRRARDSHLLILVALQQFEDESLVQGG-----NGYKKTLEELKNFKDAESPFNEDFF  175

Query  587   QIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaia  766
             ++FQSVY QQ +MLEKLQ RKNKLDKKL+ IH WRK+SS++F AT A VLICSVV AA+A
Sbjct  176   KMFQSVYKQQMVMLEKLQLRKNKLDKKLKCIHTWRKISSIIFVATFATVLICSVVAAAMA  235

Query  767   spavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKV  946
             +P VA ALAAATA+P+GSMGKWIDSL KNYE+A+KG KE+ISSMQ GT++ +KDLD I+V
Sbjct  236   APPVAAALAAATAVPLGSMGKWIDSLWKNYENALKGQKEVISSMQAGTFVAVKDLDNIRV  295

Query  947   LADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRA  1126
             L +RLE+EI  ++ +  FA+   AVK+GI++I+KKL++F KNVE+LG QAD CSRDIRRA
Sbjct  296   LIERLEIEITGMVKSAEFAVEHNAVKIGIDDIKKKLEVFKKNVEELGTQADLCSRDIRRA  355

Query  1127  RTVILQRIIKHPNH  1168
             RTVILQRIIKHPN+
Sbjct  356   RTVILQRIIKHPNN  369



>ref|XP_010530851.1| PREDICTED: UPF0496 protein At4g34320-like isoform X1 [Tarenaya 
hassleriana]
Length=395

 Score =   466 bits (1200),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 265/390 (68%), Positives = 319/390 (82%), Gaps = 21/390 (5%)
 Frame = +2

Query  35    VFGCVKIMGGHMSKKSGE---------TSNDLQCRTDLISSYEAACELDADLQTFDSTLQ  187
             VFG    MG   SKK             S  L   T+L  SYEAAC+ D +LQ+FD++LQ
Sbjct  8     VFGT---MGNQASKKPPAESSSSSSSAKSTTLHYTTEL-RSYEAACKADLELQSFDTSLQ  63

Query  188   ARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVE  367
             ARTNHVISTLA GVEVRALSFDSLKEVTGCLL+MN+EVV+VILECKKDIW++ ELFELVE
Sbjct  64    ARTNHVISTLATGVEVRALSFDSLKEVTGCLLEMNQEVVRVILECKKDIWKSQELFELVE  123

Query  368   EYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEES---GGIDGSNNKYERTLEE  538
             EYFENSLK+LDFCAAL+K L+RAR+SQLLI LAL++F++ES   GG     N+YE+TLEE
Sbjct  124   EYFENSLKTLDFCAALEKGLRRARDSQLLILLALQQFDDESLIKGG-----NRYEKTLEE  178

Query  539   LKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAA  718
             LK F+ +G+PF E+FF+IFQSVY QQ LMLEKLQ R+NKLDKKL+ IH+WR++SS++F  
Sbjct  179   LKNFKEAGSPFDEDFFRIFQSVYRQQMLMLEKLQLRRNKLDKKLKSIHSWRRLSSMIFVP  238

Query  719   TLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSM  898
             T A VLICSVV AA+A+P VA ALAAAT+IP+GSMGKWIDSL KNYE+A+KG KE+ISSM
Sbjct  239   TFATVLICSVVAAAMAAPPVAAALAAATSIPLGSMGKWIDSLWKNYENALKGQKEVISSM  298

Query  899   QVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVE  1078
             Q GTY+ IKDLD I+VL +RLE+EIE ++ +  FA+ + AV +GIEEIRKKL +FMKNVE
Sbjct  299   QAGTYVAIKDLDNIRVLIERLEIEIEGMVKSAEFAVEKEAVMIGIEEIRKKLGIFMKNVE  358

Query  1079  DLGVQADNCSRDIRRARTVILQRIIKHPNH  1168
             +L +QAD CSRDIRRARTVILQRIIKHPN+
Sbjct  359   ELALQADLCSRDIRRARTVILQRIIKHPNN  388



>ref|XP_010530852.1| PREDICTED: UPF0496 protein At4g34320-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010530853.1| PREDICTED: UPF0496 protein At4g34320-like isoform X2 [Tarenaya 
hassleriana]
Length=384

 Score =   466 bits (1199),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 262/383 (68%), Positives = 316/383 (83%), Gaps = 18/383 (5%)
 Frame = +2

Query  56    MGGHMSKKSGE---------TSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVI  208
             MG   SKK             S  L   T+L  SYEAAC+ D +LQ+FD++LQARTNHVI
Sbjct  1     MGNQASKKPPAESSSSSSSAKSTTLHYTTEL-RSYEAACKADLELQSFDTSLQARTNHVI  59

Query  209   STLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSL  388
             STLA GVEVRALSFDSLKEVTGCLL+MN+EVV+VILECKKDIW++ ELFELVEEYFENSL
Sbjct  60    STLATGVEVRALSFDSLKEVTGCLLEMNQEVVRVILECKKDIWKSQELFELVEEYFENSL  119

Query  389   KSLDFCAALDKCLKRARESQLLIHLALKEFEEES---GGIDGSNNKYERTLEELKGFRAS  559
             K+LDFCAAL+K L+RAR+SQLLI LAL++F++ES   GG     N+YE+TLEELK F+ +
Sbjct  120   KTLDFCAALEKGLRRARDSQLLILLALQQFDDESLIKGG-----NRYEKTLEELKNFKEA  174

Query  560   GNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLI  739
             G+PF E+FF+IFQSVY QQ LMLEKLQ R+NKLDKKL+ IH+WR++SS++F  T A VLI
Sbjct  175   GSPFDEDFFRIFQSVYRQQMLMLEKLQLRRNKLDKKLKSIHSWRRLSSMIFVPTFATVLI  234

Query  740   CsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYIT  919
             CSVV AA+A+P VA ALAAAT+IP+GSMGKWIDSL KNYE+A+KG KE+ISSMQ GTY+ 
Sbjct  235   CSVVAAAMAAPPVAAALAAATSIPLGSMGKWIDSLWKNYENALKGQKEVISSMQAGTYVA  294

Query  920   IKDLDTIKVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQAD  1099
             IKDLD I+VL +RLE+EIE ++ +  FA+ + AV +GIEEIRKKL +FMKNVE+L +QAD
Sbjct  295   IKDLDNIRVLIERLEIEIEGMVKSAEFAVEKEAVMIGIEEIRKKLGIFMKNVEELALQAD  354

Query  1100  NCSRDIRRARTVILQRIIKHPNH  1168
              CSRDIRRARTVILQRIIKHPN+
Sbjct  355   LCSRDIRRARTVILQRIIKHPNN  377



>ref|XP_010447101.1| PREDICTED: UPF0496 protein At4g34320-like [Camelina sativa]
 ref|XP_010447102.1| PREDICTED: UPF0496 protein At4g34320-like [Camelina sativa]
 ref|XP_010447103.1| PREDICTED: UPF0496 protein At4g34320-like [Camelina sativa]
Length=374

 Score =   464 bits (1194),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 249/374 (67%), Positives = 309/374 (83%), Gaps = 8/374 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEV  235
             MG   SKK  ++S      T  + SYEAAC+ D +LQ+FD+ LQART+HVISTLA G EV
Sbjct  1     MGNQTSKKPQDSSAKSVHYTTELRSYEAACKADTELQSFDTCLQARTSHVISTLATGFEV  60

Query  236   RALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAAL  415
             RALSFDSLKEVT CLL+MN+EVVKVIL+CKKDIW+N E+FELVE+YFENSLK+LDFCAAL
Sbjct  61    RALSFDSLKEVTQCLLEMNQEVVKVILDCKKDIWKNQEMFELVEDYFENSLKTLDFCAAL  120

Query  416   DKCLKRARESQLLIHLALKEFEEES---GGIDGSNNKYERTLEELKGFRASGNPFTEEFF  586
             +K L+RAR+S LLI +AL++FE+ES   GG     N Y++TLEELK F+ + +PF E+FF
Sbjct  121   EKGLRRARDSHLLILVALQQFEDESLVQGG-----NGYKKTLEELKNFKDAESPFNEDFF  175

Query  587   QIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaia  766
             ++FQSVY QQ +MLEKLQ RKNKLDKKL+ IH WRK+SS++F AT A VLICSVV AA+A
Sbjct  176   KMFQSVYKQQMVMLEKLQIRKNKLDKKLKCIHTWRKLSSIIFVATFATVLICSVVAAAMA  235

Query  767   spavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKV  946
             +P VA ALAAATA+P+GSMGKWIDSL KNYE+A+KG KE+ISSMQ GT++ +KDLD I+V
Sbjct  236   APPVAAALAAATAVPLGSMGKWIDSLWKNYENALKGQKEVISSMQAGTFVAVKDLDNIRV  295

Query  947   LADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRA  1126
             L +RLE+EI  ++ +  FA+   AVK+GI++I+KKL++F KNVE+LG QAD CSRDIRRA
Sbjct  296   LIERLEIEITGMVKSAEFAVEHNAVKIGIDDIKKKLEVFKKNVEELGTQADLCSRDIRRA  355

Query  1127  RTVILQRIIKHPNH  1168
             RTVILQRIIKHPN+
Sbjct  356   RTVILQRIIKHPNN  369



>ref|XP_010437629.1| PREDICTED: UPF0496 protein At4g34320-like isoform X1 [Camelina 
sativa]
 ref|XP_010437630.1| PREDICTED: UPF0496 protein At4g34320-like isoform X2 [Camelina 
sativa]
 ref|XP_010437631.1| PREDICTED: UPF0496 protein At4g34320-like isoform X2 [Camelina 
sativa]
 ref|XP_010437632.1| PREDICTED: UPF0496 protein At4g34320-like isoform X2 [Camelina 
sativa]
Length=374

 Score =   464 bits (1193),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 249/374 (67%), Positives = 309/374 (83%), Gaps = 8/374 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEV  235
             MG   SKK  + S      T  + SYEAAC+ D +LQ+FD+ LQART+HVISTLA GVEV
Sbjct  1     MGNQTSKKPQDASAKSVHYTTELRSYEAACKADTELQSFDTCLQARTSHVISTLATGVEV  60

Query  236   RALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAAL  415
             RALSFDSLKEVT CLL+MN+EVVKVIL+CKKDIW+N E+FELVE+YFENSLK+LDFCAAL
Sbjct  61    RALSFDSLKEVTQCLLEMNQEVVKVILDCKKDIWKNQEMFELVEDYFENSLKTLDFCAAL  120

Query  416   DKCLKRARESQLLIHLALKEFEEES---GGIDGSNNKYERTLEELKGFRASGNPFTEEFF  586
             +K L+RAR+S LLI +AL++FE+ES   GG     N Y++TLEELK F+ + +PF E+FF
Sbjct  121   EKGLRRARDSHLLILVALQQFEDESLVQGG-----NGYKKTLEELKNFKDAESPFNEDFF  175

Query  587   QIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaia  766
             ++FQSVY QQ +MLEKLQ RKNKLDKKL+ IH WRK+SS++F AT A VLICSVV AA+A
Sbjct  176   KMFQSVYKQQMVMLEKLQLRKNKLDKKLKCIHTWRKLSSIIFVATFATVLICSVVAAAMA  235

Query  767   spavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKV  946
             +P VA ALAAATA+P+GSMGKWIDSL KNYE+A+KG KE+ISSMQ GT++ +KDLD I+V
Sbjct  236   APPVAAALAAATAVPLGSMGKWIDSLWKNYENALKGQKEVISSMQAGTFVAVKDLDNIRV  295

Query  947   LADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRA  1126
             L +RLE+EI  ++ +  FA+   AVK+GI++I+KKL++F KNVE+LG QAD CSRDIRRA
Sbjct  296   LIERLEIEITGMVKSAEFAVEHNAVKIGIDDIKKKLEVFKKNVEELGTQADLCSRDIRRA  355

Query  1127  RTVILQRIIKHPNH  1168
             RTVILQRII+HPN+
Sbjct  356   RTVILQRIIRHPNN  369



>gb|KEH40778.1| UPF0496 plant-like protein [Medicago truncatula]
Length=371

 Score =   463 bits (1191),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 255/374 (68%), Positives = 312/374 (83%), Gaps = 8/374 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDL---ISSYEAACELDADLQTFDSTLQARTNHVISTLAVG  226
             MGG MSK + ET +D+    ++   + SY AAC+ DADLQ+FD+ LQARTN VI++LAVG
Sbjct  1     MGGCMSK-TPETQSDINLNVEMATELRSYAAACKHDADLQSFDNNLQARTNQVINSLAVG  59

Query  227   VEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFC  406
             VEVR+LSFDSLK+VT CLL+MN+EVVKVIL+CKKDIW++ ELFELVEEYF+NSLK+LDFC
Sbjct  60    VEVRSLSFDSLKQVTECLLEMNQEVVKVILDCKKDIWKSQELFELVEEYFDNSLKTLDFC  119

Query  407   AALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFF  586
              AL+KCLKRAR+SQLLI +AL++F+EE+   D   N Y +TL+ELK F+A G+PFTEEFF
Sbjct  120   NALEKCLKRARDSQLLIDVALQKFDEETVSGD---NCYVKTLQELKSFKAVGDPFTEEFF  176

Query  587   QIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaia  766
             QI+QSVY QQ LMLEKL+ RK KLDKKL+ I  WRKVS ++F AT+A+VLICSVV AA+A
Sbjct  177   QIYQSVYNQQVLMLEKLKLRKGKLDKKLKQIRIWRKVSFIIFVATVASVLICSVVAAAVA  236

Query  767   spavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKV  946
             SP VA A+AA TAIPIGSMGKWIDSL+KNYE+A+KGHKE+  SM+VG+Y+ IKDLD I+V
Sbjct  237   SPHVAAAVAAVTAIPIGSMGKWIDSLMKNYENALKGHKEVTISMEVGSYVAIKDLDNIRV  296

Query  947   LADRLELEIESLLNTTSFAI-NEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRR  1123
             L +RLE+EIESL     +AI  E AVKV IEEI+KKL +FMKNVEDLG QAD CSRDI R
Sbjct  297   LVNRLEVEIESLKTNVGYAIEEEGAVKVAIEEIKKKLGVFMKNVEDLGAQADTCSRDIIR  356

Query  1124  ARTVILQRIIKHPN  1165
             ARTV+LQ+I+K P+
Sbjct  357   ARTVVLQKIVKLPH  370



>gb|EYU41177.1| hypothetical protein MIMGU_mgv1a008261mg [Erythranthe guttata]
Length=379

 Score =   461 bits (1185),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 261/378 (69%), Positives = 323/378 (85%), Gaps = 7/378 (2%)
 Frame = +2

Query  56    MGGHMSKKSG-ETS----NDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLA  220
             MG H+SKK G ET+    N+L   +  ++SYEAAC+LD DLQ+FD+TLQ+RT++VI++LA
Sbjct  1     MGSHISKKQGHETTTSSINNLHNISTELNSYEAACKLDIDLQSFDATLQSRTHNVINSLA  60

Query  221   VGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLD  400
             VGVEV+ALSFDSLKEVT CLL+MN+EVVKVIL+CKKDIW+N ELF+LVE+YFENSLK+LD
Sbjct  61    VGVEVKALSFDSLKEVTECLLEMNQEVVKVILDCKKDIWKNQELFDLVEDYFENSLKTLD  120

Query  401   FCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNN-KYERTLEELKGFRASGNPFTE  577
             FC AL+KCLKRAR+SQLLIH+AL++FE+E+    GS+  +Y +TLEEL+ F+  G+PFTE
Sbjct  121   FCTALEKCLKRARDSQLLIHVALQQFEDENRVEGGSSEVRYSKTLEELRNFKDVGDPFTE  180

Query  578   EFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvta  757
             +FF IF+SVY  Q LMLE+LQ +KNKLDKKLR +HAWRKVSSV+FAAT AAVLICSVV A
Sbjct  181   DFFVIFRSVYKNQMLMLERLQKKKNKLDKKLRSLHAWRKVSSVIFAATFAAVLICSVVAA  240

Query  758   aiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDT  937
             A+A+P VA ALAAA +IP+GSMGKWIDSLLKNYE+A+KG KE+++ M VGTY+ IKDLD 
Sbjct  241   AMAAPPVAAALAAAASIPLGSMGKWIDSLLKNYENAVKGQKEMVNYMNVGTYVAIKDLDN  300

Query  938   IKVLADRLELEIESLLNTTSFAIN-EAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRD  1114
             I+V  +RLE++IES+L    FA++ E  VK  +EEIR+KLDLFMKN E+LG QADNCSRD
Sbjct  301   IRVSIERLEIDIESMLKNADFALSGEGDVKACVEEIRRKLDLFMKNSEELGAQADNCSRD  360

Query  1115  IRRARTVILQRIIKHPNH  1168
             IRRARTVILQRIIKHPN+
Sbjct  361   IRRARTVILQRIIKHPNN  378



>gb|AFK35357.1| unknown [Medicago truncatula]
Length=371

 Score =   460 bits (1184),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 254/374 (68%), Positives = 313/374 (84%), Gaps = 8/374 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDL---ISSYEAACELDADLQTFDSTLQARTNHVISTLAVG  226
             MGG MSK + ET +D+    ++   + SY AAC+ DADLQ+FD+ LQARTN VI++LAVG
Sbjct  1     MGGCMSK-TPETQSDINLNVEMATELRSYAAACKHDADLQSFDNNLQARTNQVINSLAVG  59

Query  227   VEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFC  406
             VEVR+LSFDSLK+VT CLL+MN+EVVKVIL+CKKDIW++ ELFELVEEYF+NSLK+LDFC
Sbjct  60    VEVRSLSFDSLKQVTECLLEMNQEVVKVILDCKKDIWKSQELFELVEEYFDNSLKTLDFC  119

Query  407   AALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFF  586
              AL+KCLKRAR+SQLLI +AL++F+ E+  + G +N Y +TL+ELK F+A G+PFTEEFF
Sbjct  120   NALEKCLKRARDSQLLIDVALQKFDGET--VSG-DNCYVKTLQELKSFKAVGDPFTEEFF  176

Query  587   QIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaia  766
             QI+QSVY QQ LMLEKL+ RK KLDKKL+ I  WRKVS ++F AT+A+VLICSVV AA+A
Sbjct  177   QIYQSVYNQQVLMLEKLKLRKGKLDKKLKQIRIWRKVSFIIFVATVASVLICSVVAAAVA  236

Query  767   spavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKV  946
             SP VA A+AA TAIPIGSMGKWIDSL+KNYE+A+KGHKE+  SM+VG+Y+ IKDLD I+V
Sbjct  237   SPHVAAAVAAVTAIPIGSMGKWIDSLMKNYENALKGHKEVTISMEVGSYVAIKDLDNIRV  296

Query  947   LADRLELEIESLLNTTSFAI-NEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRR  1123
             L +RLE+EIESL     +AI  E AVKV IEEI+KKL +FMKNVEDLG QAD CSRDI R
Sbjct  297   LVNRLEVEIESLKTNVGYAIEEEGAVKVAIEEIKKKLGVFMKNVEDLGAQADTCSRDIIR  356

Query  1124  ARTVILQRIIKHPN  1165
             ARTV+LQ+I+K P+
Sbjct  357   ARTVVLQKIVKLPH  370



>ref|XP_009138282.1| PREDICTED: UPF0496 protein At4g34320 [Brassica rapa]
 ref|XP_009138284.1| PREDICTED: UPF0496 protein At4g34320 [Brassica rapa]
Length=378

 Score =   458 bits (1179),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 252/375 (67%), Positives = 311/375 (83%), Gaps = 6/375 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDL----ISSYEAACELDADLQTFDSTLQARTNHVISTLAV  223
             MG   SKKS ETS+     +      + SYEAAC+ D +LQ+FD+ +QART+HVISTLA 
Sbjct  1     MGNQTSKKSHETSSKTTTTSMHYTTELRSYEAACKADTELQSFDTCMQARTSHVISTLAT  60

Query  224   GVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDF  403
             GVEVRALSFDSLKEVT CLL+MN+EVVKVIL+CKKDIW+N ELFELVE+YFENSLK+LDF
Sbjct  61    GVEVRALSFDSLKEVTECLLEMNQEVVKVILDCKKDIWKNQELFELVEDYFENSLKTLDF  120

Query  404   CAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEF  583
             CAAL+K L+ AR+SQLLI +AL++FE+ES  ++G N  YE+TLEELK F+ + +PF E+F
Sbjct  121   CAALEKGLRIARDSQLLILVALQQFEDES-LVEGGNG-YEKTLEELKNFKEAESPFDEDF  178

Query  584   FQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaai  763
             F++FQSVY  Q LMLEKLQ RKNKLDKKL+ IH WRK+SS++F AT A VLICSVV AA+
Sbjct  179   FKMFQSVYKHQMLMLEKLQHRKNKLDKKLKSIHTWRKLSSIIFVATFATVLICSVVAAAM  238

Query  764   aspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIK  943
             A+P VA ALAAATAIP+GSMGKW+DSL KNYE+A+KG KE+ISSMQ GT++ +KDLD I+
Sbjct  239   AAPPVAAALAAATAIPLGSMGKWVDSLWKNYENALKGQKEVISSMQAGTFVAVKDLDNIR  298

Query  944   VLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRR  1123
             +L +RLE+EI+ ++    FA+   AV++GI EI+KKL++F K VE+LGVQAD CSRDIRR
Sbjct  299   ILIERLEIEIKGMVMCAEFAVEHEAVRIGIAEIKKKLEVFKKCVEELGVQADLCSRDIRR  358

Query  1124  ARTVILQRIIKHPNH  1168
             ARTVILQRIIKHPNH
Sbjct  359   ARTVILQRIIKHPNH  373



>ref|XP_009138287.1| PREDICTED: UPF0496 protein At4g34320-like [Brassica rapa]
 ref|XP_009138288.1| PREDICTED: UPF0496 protein At4g34320-like [Brassica rapa]
 ref|XP_009138289.1| PREDICTED: UPF0496 protein At4g34320-like [Brassica rapa]
Length=378

 Score =   457 bits (1177),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 250/375 (67%), Positives = 312/375 (83%), Gaps = 6/375 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDL----ISSYEAACELDADLQTFDSTLQARTNHVISTLAV  223
             MG   SKKS ETS+     +      + SYEAAC+ D +LQ+FD+ +QART+HVISTLA 
Sbjct  1     MGNQTSKKSHETSSKTTTTSMHYTTELRSYEAACKADTELQSFDTCMQARTSHVISTLAT  60

Query  224   GVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDF  403
             GVEVR+LSFDSLKEVT CLL+MN+EVV+VIL+CKKDIW+N ELFELVE+YFENSLK+LDF
Sbjct  61    GVEVRSLSFDSLKEVTECLLEMNQEVVQVILDCKKDIWKNQELFELVEDYFENSLKTLDF  120

Query  404   CAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEF  583
             CAAL+K L++AR+SQLLI +AL++FE+ES  ++G N  YE+TLEELK F+ + +PF E+F
Sbjct  121   CAALEKGLRKARDSQLLILVALQQFEDES-LVEGGNG-YEKTLEELKNFKEAESPFDEDF  178

Query  584   FQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaai  763
             F++FQSVY  Q LMLEKLQ RKNKLDKKL+ IH WRK+SS++F AT A VLICSVV AA+
Sbjct  179   FKMFQSVYKHQMLMLEKLQHRKNKLDKKLKSIHTWRKLSSIIFVATFATVLICSVVAAAM  238

Query  764   aspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIK  943
             A+P VA ALAAATAIP+GSMGKW+DSL KNYE+A+KG KE+ISSMQ GT++ +KDLD I+
Sbjct  239   AAPPVAAALAAATAIPLGSMGKWVDSLWKNYENALKGQKEVISSMQAGTFVAVKDLDNIR  298

Query  944   VLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRR  1123
             +L +RLE+EI+ ++    FA+   AV++GI EI+KKL++F K VE+LGVQAD CSRDIRR
Sbjct  299   ILIERLEIEIKGMVMCAEFAVEHEAVRIGIAEIKKKLEVFKKCVEELGVQADLCSRDIRR  358

Query  1124  ARTVILQRIIKHPNH  1168
             ARTVILQRIIKHPNH
Sbjct  359   ARTVILQRIIKHPNH  373



>emb|CDY46260.1| BnaC03g66210D [Brassica napus]
Length=388

 Score =   456 bits (1173),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 248/383 (65%), Positives = 311/383 (81%), Gaps = 12/383 (3%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDL----ISSYEAACELDADLQTFDSTLQARTNHVISTLAV  223
             MG   SKKS ETS+            + SYEAAC+ D +LQ+FD+ LQART+HVISTLA 
Sbjct  1     MGNQTSKKSQETSSKTTTTNMHYTTELRSYEAACKADTELQSFDTCLQARTSHVISTLAT  60

Query  224   GVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDF  403
             GVEVRALSFDSLKEVT CLL+MN+EVVKVIL+CKKDIW+N E+FELVE+YFENSLK+LDF
Sbjct  61    GVEVRALSFDSLKEVTECLLEMNQEVVKVILDCKKDIWKNQEMFELVEDYFENSLKTLDF  120

Query  404   CAALDKCLKRARESQLLIHLALKEFEEESGGIDGSN--------NKYERTLEELKGFRAS  559
             CAAL+K L++AR+SQLLI +AL++FE+ES      N        N YE+TL+ELK F+ +
Sbjct  121   CAALEKGLRKARDSQLLILVALQQFEDESLLTYDFNIHYYFVGCNGYEKTLDELKNFKDA  180

Query  560   GNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLI  739
              +PF+++FF++FQSVY  Q LMLEKLQ RKNKLDKKL+ IH WRK+ +++F AT A VLI
Sbjct  181   ESPFSKDFFKMFQSVYKHQMLMLEKLQLRKNKLDKKLKCIHTWRKLCNIIFVATFATVLI  240

Query  740   CsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYIT  919
             CSVV AA+A+P VA ALAAATA+P+GSMGKWIDSL KNYE+A+KG +E+ISSMQ GTY+ 
Sbjct  241   CSVVAAAMAAPPVAAALAAATAVPVGSMGKWIDSLWKNYENALKGQREVISSMQAGTYVA  300

Query  920   IKDLDTIKVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQAD  1099
             +KDLD I+VL ++LE++I  ++   SFA+   AVK+GI+EI+KKL++F KNVE+LGVQAD
Sbjct  301   VKDLDNIRVLIEQLEIDIRGMVTCASFAVEHEAVKLGIDEIKKKLEVFKKNVEELGVQAD  360

Query  1100  NCSRDIRRARTVILQRIIKHPNH  1168
              CSRDIRRARTV+LQRIIKHPN+
Sbjct  361   LCSRDIRRARTVVLQRIIKHPNN  383



>ref|XP_010028566.1| PREDICTED: UPF0496 protein At4g34320-like [Eucalyptus grandis]
Length=365

 Score =   454 bits (1169),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 238/352 (68%), Positives = 292/352 (83%), Gaps = 7/352 (2%)
 Frame = +2

Query  122   ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEV  301
             +S+YEAAC  DADL++FDS L+ +T+H I  LA GV VRALSFDSL+EVTGCL++MN+EV
Sbjct  18    LSAYEAACMADADLRSFDSNLRTQTSHAIEALAAGVGVRALSFDSLREVTGCLMEMNQEV  77

Query  302   VKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFE  481
             V+VIL+CK+DIW   ELFELVEEYFENSL++LDF +ALDKCLK AR+SQLLI +AL++FE
Sbjct  78    VRVILDCKQDIWGTQELFELVEEYFENSLQTLDFLSALDKCLKHARDSQLLILIALQQFE  137

Query  482   EE---SGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKN  652
              E   +GG D    +Y RTLEELK F+A+G+PFT+EFF+IFQ+VY     MLEKLQ RK+
Sbjct  138   GEDRRAGGAD----RYARTLEELKNFKAAGDPFTKEFFRIFQAVYRNHVTMLEKLQLRKS  193

Query  653   KLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKW  832
             KLDKKLRY+HAWRKVSS++FAAT A +LICSVV AA+A P VAGALAAA +IP+ S+GKW
Sbjct  194   KLDKKLRYLHAWRKVSSMIFAATFAVILICSVVAAAVAQPHVAGALAAAASIPVCSVGKW  253

Query  833   IDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINE  1012
             IDSLLKNYE+A+KG KE I +MQVGT + I DL+ I+VL DRLE+EI+S+L     A+ E
Sbjct  254   IDSLLKNYENAVKGQKETIVAMQVGTGLVISDLENIRVLVDRLEIEIQSMLQNAELAVEE  313

Query  1013  AAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPNH  1168
               VK+G+EEI+KKL  FMKN++ LGVQADNCSRDIRRARTV+LQRIIK PN 
Sbjct  314   GEVKIGVEEIKKKLSAFMKNIDQLGVQADNCSRDIRRARTVVLQRIIKSPNQ  365



>emb|CDX76273.1| BnaA08g11270D [Brassica napus]
Length=388

 Score =   452 bits (1164),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 247/383 (64%), Positives = 308/383 (80%), Gaps = 12/383 (3%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDL----ISSYEAACELDADLQTFDSTLQARTNHVISTLAV  223
             MG   SKKS ETS             + SYEAAC+ D +LQ+FD+ LQ RT+HVISTLA 
Sbjct  1     MGNQTSKKSQETSFKTTTTNMHYTTELRSYEAACKADTELQSFDTCLQTRTSHVISTLAT  60

Query  224   GVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDF  403
             GVEVRALSFDSLKEVT CLL+MN+EVVKVIL+CKKDIW+N E+FELVE+YFENSLK+LDF
Sbjct  61    GVEVRALSFDSLKEVTECLLEMNQEVVKVILDCKKDIWKNQEMFELVEDYFENSLKTLDF  120

Query  404   CAALDKCLKRARESQLLIHLALKEFEEESGGIDGSN--------NKYERTLEELKGFRAS  559
             CAAL+K L++AR+SQLLI +AL+ FE+ES     +N        N YE+TL+ELK F+ +
Sbjct  121   CAALEKGLRKARDSQLLILVALQHFEDESLVEGNTNLEFVFIGCNGYEKTLDELKNFKDA  180

Query  560   GNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLI  739
              +PF+++FF++FQSVY  Q LMLEKLQ RKNKLDKKL+ IH WRK+ +++F AT A VLI
Sbjct  181   ESPFSKDFFKMFQSVYKHQMLMLEKLQLRKNKLDKKLKCIHTWRKLCNIIFVATFATVLI  240

Query  740   CsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYIT  919
             CSVV AA+A+P VA ALAAATA+P+GSMGKWIDSL KNYE+A+KG +E+ISSMQ GTY+ 
Sbjct  241   CSVVAAAMAAPPVAAALAAATAVPVGSMGKWIDSLWKNYENALKGQREVISSMQAGTYVA  300

Query  920   IKDLDTIKVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQAD  1099
             +KDLD I+VL ++LE+EI  ++   +FA+   AVK+GI+EI+KKL++F KNVE+LG QAD
Sbjct  301   VKDLDNIRVLIEQLEIEIRGMVTCAAFAVEHEAVKLGIDEIKKKLEVFKKNVEELGAQAD  360

Query  1100  NCSRDIRRARTVILQRIIKHPNH  1168
              CSRDIRRARTVILQRIIKHPN+
Sbjct  361   LCSRDIRRARTVILQRIIKHPNN  383



>ref|XP_010254953.1| PREDICTED: UPF0496 protein At4g34320-like [Nelumbo nucifera]
Length=375

 Score =   451 bits (1161),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 261/377 (69%), Positives = 316/377 (84%), Gaps = 8/377 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDL-----ISSYEAACELDADLQTFDSTLQARTNHVISTLA  220
             MGG  SKK+GE    LQ  ++      +SSYEAAC  D ++QTFDSTLQARTN VI+TLA
Sbjct  1     MGGQFSKKTGENPPVLQLNSNFQYTAELSSYEAACRHDPEVQTFDSTLQARTNRVINTLA  60

Query  221   VGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLD  400
              GVEVRALSF+SL+EVTGCLL+MN+EVVK+ILECKKDIW+N ELFELVEEYFENSL++LD
Sbjct  61    HGVEVRALSFNSLREVTGCLLEMNQEVVKIILECKKDIWKNQELFELVEEYFENSLQTLD  120

Query  401   FCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEE  580
             FC A++KCLKRAR+SQL++H+AL++FEEE  G++G   KY +T EELK F+A+G+PFTEE
Sbjct  121   FCTAMEKCLKRARDSQLILHVALQQFEEED-GVEG-QKKYLKTSEELKNFKAAGDPFTEE  178

Query  581   FFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaa  760
             FFQ+F SVY QQ LMLEKL  RK KLDKKL+ + AWRKVSS++FAA  AAVLICSVV AA
Sbjct  179   FFQVFNSVYKQQVLMLEKLMLRKRKLDKKLKSVKAWRKVSSIIFAAAFAAVLICSVVAAA  238

Query  761   iaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTI  940
             +A+P VA ALAAAT+IP+GSMGKW DSL ++YE A+KG KE+I SMQ GTYI IKDLD+I
Sbjct  239   MAAPPVAAALAAATSIPLGSMGKWFDSLWRDYEVALKGQKEVIHSMQAGTYIAIKDLDSI  298

Query  941   KVLADRLELEIESLLNTTSFAINEA-AVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDI  1117
             +VL DRLE+EIESL+    FA+ E  AVK+GI+EI+KKL +FMK++EDLG  AD CSRDI
Sbjct  299   RVLVDRLEIEIESLMQNADFALREEDAVKIGIDEIKKKLGVFMKSIEDLGEHADRCSRDI  358

Query  1118  RRARTVILQRIIKHPNH  1168
             RRARTV+LQRIIKHPN+
Sbjct  359   RRARTVVLQRIIKHPNN  375



>ref|XP_009108740.1| PREDICTED: UPF0496 protein At4g34320-like [Brassica rapa]
 ref|XP_009108741.1| PREDICTED: UPF0496 protein At4g34320-like [Brassica rapa]
Length=378

 Score =   451 bits (1159),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 244/375 (65%), Positives = 308/375 (82%), Gaps = 6/375 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDL----ISSYEAACELDADLQTFDSTLQARTNHVISTLAV  223
             MG   SKKS ETS             + SYEAAC+ D +LQ+FD+ L  RT+HVISTLA 
Sbjct  1     MGNQTSKKSQETSFKTTTTNMHYTTELRSYEAACKADTELQSFDTCLHTRTSHVISTLAT  60

Query  224   GVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDF  403
             GVEVRALSFDSLKEVT CLL+MN+EVVKVIL+CKKDIW+N E+FELVE+YFENSLK+LDF
Sbjct  61    GVEVRALSFDSLKEVTECLLEMNQEVVKVILDCKKDIWKNQEMFELVEDYFENSLKTLDF  120

Query  404   CAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEF  583
             CAAL+K L++AR+SQLLI +AL++FE+ES  ++G N  YE+TL+ELK F+ + +PF+++F
Sbjct  121   CAALEKGLRKARDSQLLILVALQQFEDES-LVEGCNG-YEKTLDELKNFKDAESPFSKDF  178

Query  584   FQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaai  763
             F++FQSVY  Q LMLEKLQ RKNKLDKKL+ IH WRK+ +++F AT A VLICSVV AAI
Sbjct  179   FKMFQSVYKHQMLMLEKLQLRKNKLDKKLKCIHTWRKLCNIIFVATFATVLICSVVAAAI  238

Query  764   aspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIK  943
             A+P VA ALAAATA+P+GSMGKWIDSL KNYE+++KG +E+ISSMQ GTY+ +KDLD I+
Sbjct  239   AAPPVAAALAAATAVPVGSMGKWIDSLWKNYENSLKGQREVISSMQAGTYVAVKDLDNIR  298

Query  944   VLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRR  1123
             VL ++LE++I  ++   +F +   AVK+GI+EI+KKL++F KNVE+LG QAD CSRDIRR
Sbjct  299   VLIEQLEIDISGMVTCAAFTVEHEAVKLGIDEIKKKLEVFKKNVEELGAQADLCSRDIRR  358

Query  1124  ARTVILQRIIKHPNH  1168
             ARTVILQRIIKHPN+
Sbjct  359   ARTVILQRIIKHPNN  373



>ref|XP_006649570.1| PREDICTED: UPF0496 protein 1-like [Oryza brachyantha]
Length=387

 Score =   450 bits (1158),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 238/354 (67%), Positives = 300/354 (85%), Gaps = 8/354 (2%)
 Frame = +2

Query  125   SSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVV  304
             SSYEAAC  D +L+TFD+TLQ RT+  ISTLAVGVEVR+LS +SL+EVTGCLLDMN+EVV
Sbjct  32    SSYEAACRSDPELRTFDTTLQRRTSRAISTLAVGVEVRSLSLESLREVTGCLLDMNQEVV  91

Query  305   KVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEE  484
             +VIL+CKKDIW++ ELF+LVE+YFE+SL +LDFC ALDKCLKRAR+SQLL+H+AL+ F++
Sbjct  92    RVILDCKKDIWKSPELFDLVEDYFESSLHTLDFCTALDKCLKRARDSQLLLHVALQRFDD  151

Query  485   E----SGGID---GSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQS  643
             E    +GG +     + +Y RTL EL+ F+A+G+PFTEEFF  FQ+VY QQ  MLEKLQ 
Sbjct  152   EEDNDAGGQEDDAAPSARYARTLHELRQFKAAGDPFTEEFFSAFQAVYRQQLTMLEKLQQ  211

Query  644   RKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsM  823
             RK++LDKK+R I AWR+VSS++FA T AAVLICSVV AAIA+P VA ALAAA +IP+GSM
Sbjct  212   RKHRLDKKVRAIKAWRRVSSIIFATTFAAVLICSVVAAAIAAPPVAAALAAAASIPVGSM  271

Query  824   GKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFA  1003
             GKWIDSLLK Y+DA++G KE++S+MQVGT+I IKDLD+I+VL +R+ELEI S+++   FA
Sbjct  272   GKWIDSLLKGYQDALRGQKEVVSAMQVGTFIAIKDLDSIRVLINRVELEISSMIDCVEFA  331

Query  1004  -INEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHP  1162
               +E AVK G+EEI+KKL++FMK+VEDLG QAD CSRDIRRARTV+LQRII+ P
Sbjct  332   ERDEEAVKFGVEEIKKKLEVFMKSVEDLGEQADRCSRDIRRARTVVLQRIIRQP  385



>ref|XP_002468329.1| hypothetical protein SORBIDRAFT_01g043880 [Sorghum bicolor]
 gb|EER95327.1| hypothetical protein SORBIDRAFT_01g043880 [Sorghum bicolor]
Length=381

 Score =   450 bits (1157),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 232/348 (67%), Positives = 296/348 (85%), Gaps = 1/348 (0%)
 Frame = +2

Query  125   SSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVV  304
             SSYEAAC  D +L+TFD+TLQ RT+  ISTLAVGVEVR++S DSL+EVTGCLLDMN+EVV
Sbjct  34    SSYEAACRSDPELRTFDTTLQRRTSRAISTLAVGVEVRSMSLDSLREVTGCLLDMNQEVV  93

Query  305   KVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEE  484
             +VIL+CKKDIW++ ELF+LVE+YFE+SL++LDFC ALDKCLKRAR+SQLL+H+AL+ F++
Sbjct  94    RVILDCKKDIWKSAELFDLVEDYFESSLQTLDFCTALDKCLKRARDSQLLLHVALQRFDD  153

Query  485   ESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDK  664
             E       + +Y RTL EL+ F+A+G+PFT+EFF  FQ+VY QQ  MLEKLQ RK++LD+
Sbjct  154   EQNSDAAPSARYARTLHELRQFKAAGDPFTDEFFAAFQAVYRQQLAMLEKLQQRKHRLDR  213

Query  665   KLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSL  844
             K++ I AWR+VSS++FA T AAVLICSVV AAIA+P VA ALAAA A+P+GSMGKWIDSL
Sbjct  214   KIKTIKAWRRVSSIIFATTFAAVLICSVVAAAIAAPPVAAALAAAAAVPLGSMGKWIDSL  273

Query  845   LKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFA-INEAAV  1021
             LK Y+DA++G KE++S+MQVGT+I IKDLD+I+VL +R+E E+ S+++   FA  +E AV
Sbjct  274   LKGYQDALRGQKEVVSTMQVGTFIAIKDLDSIRVLINRVEAEVSSMVDCVEFAERDEEAV  333

Query  1022  KVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
             K G+EEI+KKL+ FMK+VEDLG QAD CSRDIRRARTV+LQRII+ PN
Sbjct  334   KFGVEEIKKKLENFMKSVEDLGEQADRCSRDIRRARTVVLQRIIRQPN  381



>ref|XP_003558574.1| PREDICTED: UPF0496 protein 1 [Brachypodium distachyon]
Length=393

 Score =   447 bits (1151),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 235/361 (65%), Positives = 300/361 (83%), Gaps = 14/361 (4%)
 Frame = +2

Query  122   ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEV  301
             +SSYEAAC  D +++TFDSTLQ RT+  ISTLAVGVEVR++S DSL+EVTGCLLDMN+EV
Sbjct  34    LSSYEAACRYDPEVRTFDSTLQRRTSRAISTLAVGVEVRSMSLDSLREVTGCLLDMNQEV  93

Query  302   VKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFE  481
             V+VIL+CKKDIW++ +LF+LVE+YFE+SL++LDFC ALDKCLKRAR+SQLL+H+AL+ F+
Sbjct  94    VRVILDCKKDIWKSPDLFDLVEDYFESSLQTLDFCTALDKCLKRARDSQLLLHVALQRFD  153

Query  482   EESGGIDGSNN------------KYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALM  625
             +E  G D                +Y RTL EL+ F+A+G+PFT+EFF+ FQ+VY QQ  M
Sbjct  154   DEERG-DAPEGASASAAAAAPSARYARTLHELRQFKAAGDPFTDEFFEAFQAVYRQQLAM  212

Query  626   LEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaata  805
             LEKLQ RK++LDKK++ I AWR+VSS++FA T AAVLICSVV AAIA+P VA ALAAA A
Sbjct  213   LEKLQQRKHRLDKKVKTIKAWRRVSSIIFATTFAAVLICSVVAAAIAAPPVAAALAAAAA  272

Query  806   ipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLL  985
             +P+GSMGKWIDSLLK Y+DA+ G KE++S+MQVGT+I IKDLD+I+VL +R+E+EI S++
Sbjct  273   VPVGSMGKWIDSLLKGYQDALHGQKEVVSAMQVGTFIAIKDLDSIRVLINRVEMEISSMV  332

Query  986   NTTSFA-INEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHP  1162
             +   FA  +E A+K G+EEI+KKL+ FMK+VEDLG QAD CSRDIRRARTV+LQRII+HP
Sbjct  333   DCVEFAERDEEAIKFGVEEIKKKLEAFMKSVEDLGEQADRCSRDIRRARTVVLQRIIRHP  392

Query  1163  N  1165
             N
Sbjct  393   N  393



>ref|XP_008652317.1| PREDICTED: UPF0496 protein 1 [Zea mays]
 ref|XP_008652323.1| PREDICTED: UPF0496 protein 1 [Zea mays]
 tpg|DAA43952.1| TPA: hypothetical protein ZEAMMB73_791340 [Zea mays]
Length=382

 Score =   447 bits (1150),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 236/352 (67%), Positives = 300/352 (85%), Gaps = 4/352 (1%)
 Frame = +2

Query  122   ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEV  301
             +SSYEAAC  D +L+TFD+TLQ RT+  ISTLAVGVEVR++S DSL+EVTGCLLDMN+EV
Sbjct  31    LSSYEAACRSDPELRTFDTTLQRRTSRAISTLAVGVEVRSMSLDSLREVTGCLLDMNQEV  90

Query  302   VKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFE  481
             V+VIL+CKKDIW++ ELF+LVE+YFE+SL++LDFC ALDKCLKRAR+SQLL+H+AL+ F+
Sbjct  91    VRVILDCKKDIWKSPELFDLVEDYFESSLQTLDFCTALDKCLKRARDSQLLLHVALQRFD  150

Query  482   EESGG---IDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKN  652
             +E G        + +Y RTL EL+ F+A+G+PFT+EFF  FQ+VY QQ  MLEKLQ RK+
Sbjct  151   DEEGSDAAAAAPSARYARTLHELRQFKAAGDPFTDEFFAAFQAVYRQQLAMLEKLQQRKH  210

Query  653   KLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKW  832
             +LDKK++ I AWR+VSS++FA T AAVLICSVV AAIA+P VA ALAAA A+P+GSMGKW
Sbjct  211   RLDKKVKTIKAWRRVSSIIFATTFAAVLICSVVAAAIAAPPVAAALAAAAAVPLGSMGKW  270

Query  833   IDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFA-IN  1009
             IDSLLK Y+DA++G KE++S+MQVGT+I IKDLD+I+VL +R+E+EI S+++   FA  +
Sbjct  271   IDSLLKGYQDALRGQKEVVSAMQVGTFIAIKDLDSIRVLINRVEVEISSMVDCVEFAERD  330

Query  1010  EAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
             E AVK G+EEI+KKL+ FMK+VEDLG QAD CSRDIRRARTV+LQRII+HPN
Sbjct  331   EEAVKFGVEEIKKKLENFMKSVEDLGEQADRCSRDIRRARTVVLQRIIRHPN  382



>ref|XP_009386153.1| PREDICTED: UPF0496 protein 1-like [Musa acuminata subsp. malaccensis]
Length=391

 Score =   447 bits (1149),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 243/372 (65%), Positives = 304/372 (82%), Gaps = 5/372 (1%)
 Frame = +2

Query  59    GGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVR  238
             GG     +GE S+        +SSY AAC LD +LQTFD+TLQ RT+  ISTLA+GVEVR
Sbjct  20    GGSSRPAAGEASHANIRYVAELSSYAAACRLDPELQTFDTTLQQRTSRAISTLALGVEVR  79

Query  239   ALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALD  418
             +LS DSL+E+T CLL+MN+EVVKVIL CK+DIW++ ELF+LVE+YFENSL++LDFC AL+
Sbjct  80    SLSLDSLREITSCLLEMNQEVVKVILACKRDIWKSPELFDLVEDYFENSLQTLDFCTALE  139

Query  419   KCLKRARESQLLIHLALKEF---EEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQ  589
             +CLKRAR+SQL+IH+AL+ F   E+E+   D  N KY RTL+EL+ F  +G+PFTEEFF+
Sbjct  140   RCLKRARDSQLIIHVALQRFAEGEDETEAED-CNKKYSRTLDELRLFNTAGDPFTEEFFR  198

Query  590   IFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaias  769
             +FQSVY QQ LMLEKLQ RKNKLDKKL+ I AWRKVSS++FAATLAAVLICSVV AA+++
Sbjct  199   VFQSVYRQQLLMLEKLQLRKNKLDKKLKSIKAWRKVSSIIFAATLAAVLICSVVAAAVSA  258

Query  770   pavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVL  949
             P VA ALAAA +IPIGSM KWIDSLLK+Y ++++G KE++ SMQVGT+I IKDLD+I+V 
Sbjct  259   PPVAAALAAAASIPIGSMAKWIDSLLKDYGNSVQGQKEVVGSMQVGTFIVIKDLDSIRVS  318

Query  950   ADRLELEIESLLNTTSFAINEA-AVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRA  1126
              D+LE+EI SLL+   FAI +  AVK+GIEEI+KKL++F K+VE LG Q D CSRDIRRA
Sbjct  319   IDKLEIEIVSLLDNADFAIKDVEAVKIGIEEIKKKLEVFTKSVEALGEQNDKCSRDIRRA  378

Query  1127  RTVILQRIIKHP  1162
             RTV+LQRII+ P
Sbjct  379   RTVVLQRIIRTP  390



>ref|NP_001049283.1| Os03g0199100 [Oryza sativa Japonica Group]
 sp|Q10QE9.1|U496A_ORYSJ RecName: Full=UPF0496 protein 1 [Oryza sativa Japonica Group]
 sp|A2XDK8.1|U496A_ORYSI RecName: Full=UPF0496 protein 1 [Oryza sativa Indica Group]
 gb|ABF94480.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11197.1| Os03g0199100 [Oryza sativa Japonica Group]
 gb|EAY88918.1| hypothetical protein OsI_10402 [Oryza sativa Indica Group]
 gb|EAZ25943.1| hypothetical protein OsJ_09795 [Oryza sativa Japonica Group]
Length=388

 Score =   446 bits (1148),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 235/354 (66%), Positives = 296/354 (84%), Gaps = 9/354 (3%)
 Frame = +2

Query  131   YEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKV  310
             YEAAC  D +L+TFD+TLQ RT+  ISTLAVGVEVR+LS +SL+EVTGCLLDMN+EVV+V
Sbjct  35    YEAACRSDPELRTFDTTLQRRTSRAISTLAVGVEVRSLSLESLREVTGCLLDMNQEVVRV  94

Query  311   ILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEES  490
             IL+CKKDIW++ ELF+LVE+YFE+SL +LDFC ALDKCLKRAR+SQLL+H+AL+ F++E 
Sbjct  95    ILDCKKDIWKSPELFDLVEDYFESSLHTLDFCTALDKCLKRARDSQLLLHVALQRFDDEE  154

Query  491   GG--------IDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSR  646
                           + +Y RTL EL+ F+A+G+PFTEEFF  FQ+VY QQ  MLEKLQ R
Sbjct  155   DNDAAAAGQEDAAPSARYARTLHELRQFKAAGDPFTEEFFSAFQAVYRQQLTMLEKLQQR  214

Query  647   KNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMG  826
             K++LDKK+R I AWR+VSS++FA T AAVLICSVV AAIA+P VA ALAAA +IP+GSMG
Sbjct  215   KHRLDKKVRAIKAWRRVSSIIFATTFAAVLICSVVAAAIAAPPVAAALAAAASIPVGSMG  274

Query  827   KWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFA-  1003
             KWIDSLLK Y+DA++G KE++S+MQVGT+I IKDLD+I+VL +R+ELEI S+++   FA 
Sbjct  275   KWIDSLLKGYQDALRGQKEVVSAMQVGTFIAIKDLDSIRVLINRVELEISSMIDCVEFAE  334

Query  1004  INEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
              +E AVK G+EEI+KKL++FMK+VEDLG QAD CSRDIRRARTV+LQRII+HP+
Sbjct  335   RDEEAVKFGVEEIKKKLEVFMKSVEDLGEQADRCSRDIRRARTVVLQRIIRHPS  388



>ref|NP_001145902.1| hypothetical protein [Zea mays]
 gb|ACL52818.1| unknown [Zea mays]
 gb|AFW89348.1| hypothetical protein ZEAMMB73_728470 [Zea mays]
Length=372

 Score =   446 bits (1146),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 235/352 (67%), Positives = 297/352 (84%), Gaps = 4/352 (1%)
 Frame = +2

Query  122   ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEV  301
             +SSYEAAC  D +L+TFD+TLQ RT+  ISTLAVGVEVR++S DSL+EVTGCLLDMN+EV
Sbjct  21    LSSYEAACRSDPELRTFDTTLQRRTSRAISTLAVGVEVRSMSLDSLREVTGCLLDMNQEV  80

Query  302   VKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEF-  478
             V+VIL+CKKDIW++ ELF+LVE+YFE+SL++LDFC ALDKCLKRAR+SQLL+H+AL+ F 
Sbjct  81    VRVILDCKKDIWKSPELFDLVEDYFESSLQTLDFCTALDKCLKRARDSQLLLHVALQRFD  140

Query  479   --EEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKN  652
               E+        + +Y RTL EL+ F+ +G+PFT+EFF  FQ+VY QQ  MLEKLQ RK+
Sbjct  141   DEEDIDAAAAAPSARYARTLHELRQFKTAGDPFTDEFFAAFQAVYRQQLAMLEKLQQRKH  200

Query  653   KLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKW  832
             +LDKK++ I AWR+VSS++FA T AAVLICSVV AAIA+P VA ALAAA A+P+GSMGKW
Sbjct  201   RLDKKVKTIKAWRRVSSIIFATTFAAVLICSVVAAAIAAPPVAAALAAAAAVPLGSMGKW  260

Query  833   IDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFA-IN  1009
             IDSLLK Y+DA++G KE++S+MQVGT+I IKDLD+I+VL +R+ELEI S+++   FA  +
Sbjct  261   IDSLLKGYQDALRGQKEVVSTMQVGTFIAIKDLDSIRVLINRVELEISSMVDCVEFAERD  320

Query  1010  EAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
             E AVK G+EEI+KKL+ FMK+VEDLG QAD CSRDIRRARTV+LQRII+HPN
Sbjct  321   EEAVKFGVEEIKKKLENFMKSVEDLGEQADRCSRDIRRARTVVLQRIIRHPN  372



>ref|XP_004985322.1| PREDICTED: UPF0496 protein 1-like [Setaria italica]
Length=379

 Score =   444 bits (1143),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 237/349 (68%), Positives = 298/349 (85%), Gaps = 2/349 (1%)
 Frame = +2

Query  125   SSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVV  304
             SSYEAAC+ D +L+TFD+TLQ RT+  ISTLAVGVEVR+LS DSL+EVTGCLLDMN+EVV
Sbjct  31    SSYEAACQSDPELRTFDTTLQRRTSRAISTLAVGVEVRSLSLDSLREVTGCLLDMNQEVV  90

Query  305   KVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEF-E  481
             +VIL+CKKDIW++ ELF+LVE+YFE+SL +LDFC ALDKCLKRAR+SQLL+H+AL+ F +
Sbjct  91    RVILDCKKDIWKSPELFDLVEDYFESSLHTLDFCTALDKCLKRARDSQLLLHVALQRFDD  150

Query  482   EESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLD  661
             EE       + +Y RTL EL+ F+A+G+PFTEEFF  FQ+VY QQ  MLEKLQ RK++LD
Sbjct  151   EEDAAAAAPSARYARTLHELRQFKAAGDPFTEEFFAAFQAVYRQQLTMLEKLQQRKHRLD  210

Query  662   KKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDS  841
             KK++ I AWR+VSS++FA T AAVLICSVV AAIA+P VA ALAAA A+P+GSMGKWIDS
Sbjct  211   KKIKTIKAWRRVSSIIFATTFAAVLICSVVAAAIAAPPVAAALAAAAAVPLGSMGKWIDS  270

Query  842   LLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFA-INEAA  1018
             LLK Y+DA++G KE++S+MQVGT+I IKDLD+I+VL +R+E+EI S+++   FA  +E A
Sbjct  271   LLKGYQDALRGQKEVVSAMQVGTFIAIKDLDSIRVLINRVEVEISSMIDCVEFAERDEEA  330

Query  1019  VKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
             VK G+EEI+KKL+ FMK+VEDLG QAD CSRDIRRARTV+LQRII++PN
Sbjct  331   VKFGVEEIKKKLENFMKSVEDLGEQADRCSRDIRRARTVVLQRIIRNPN  379



>dbj|BAJ93975.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97187.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=383

 Score =   443 bits (1139),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 241/370 (65%), Positives = 300/370 (81%), Gaps = 4/370 (1%)
 Frame = +2

Query  65    HMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRAL  244
             H    S E         + +SSYEAAC  D +++TFDSTLQ RT+  ISTLAVGVEVR++
Sbjct  15    HRPTTSSEPGLPHAAAAEDLSSYEAACRHDPEVRTFDSTLQRRTSRAISTLAVGVEVRSM  74

Query  245   SFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKC  424
             S DSL+EVTGCLLDMN+EVVKVIL+CKKDIW++ ELF+LVE+YFE+SL +LDFC ALDKC
Sbjct  75    SLDSLREVTGCLLDMNQEVVKVILDCKKDIWKSPELFDLVEDYFESSLHTLDFCTALDKC  134

Query  425   LKRARESQLLIHLALKEFEEESGGID--GSNNKYERTLEELKGFRASGNPFTEEFFQIFQ  598
             LKRAR+SQLL+H+AL+ F++E           +Y RTL EL+ F+A+G+PFT+EFF+ FQ
Sbjct  135   LKRARDSQLLLHVALQRFDDEDDNDGDAAPAARYARTLHELRQFKAAGDPFTDEFFEAFQ  194

Query  599   SVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspav  778
             +VY QQ  MLEKLQ RK++LDKK++ I AWR+VSSV+FA+T AAVLICSVV AAIA+P V
Sbjct  195   AVYRQQLAMLEKLQQRKHRLDKKIKTIKAWRRVSSVIFASTFAAVLICSVVAAAIAAPPV  254

Query  779   agalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADR  958
             A ALAAA AIPIGSMGKWIDSLLK Y+DA++G KE++S+MQVGT+I IKDLD I+VL  R
Sbjct  255   AAALAAAAAIPIGSMGKWIDSLLKGYQDAVRGQKEVVSAMQVGTFIAIKDLDNIRVLISR  314

Query  959   LELEIESLLNTTSFA-INEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTV  1135
             +E+EI S+++   FA  +E AVK G+EEI+KKL+ FMK+VEDLG QAD CSRDIRRARTV
Sbjct  315   VEMEISSMIDCVDFAERDEEAVKFGVEEIKKKLEAFMKSVEDLGEQADRCSRDIRRARTV  374

Query  1136  ILQRIIKHPN  1165
             +LQRII+ PN
Sbjct  375   VLQRIIR-PN  383



>ref|XP_010247000.1| PREDICTED: UPF0496 protein At4g34320-like [Nelumbo nucifera]
Length=375

 Score =   437 bits (1125),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 261/374 (70%), Positives = 311/374 (83%), Gaps = 8/374 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDL-----ISSYEAACELDADLQTFDSTLQARTNHVISTLA  220
             MGG  SKK  E    LQ  T+      +SSYEAAC LD +LQTFDSTLQARTNHVI+TLA
Sbjct  1     MGGQFSKKVVENPPILQLNTNFQYTAELSSYEAACRLDPELQTFDSTLQARTNHVINTLA  60

Query  221   VGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLD  400
              GVEVRALSF SLKEVTGCLLDMN+EVVK+ILECK DIW+N ELFELVEEYFENSL++LD
Sbjct  61    HGVEVRALSFHSLKEVTGCLLDMNQEVVKIILECKTDIWKNQELFELVEEYFENSLQTLD  120

Query  401   FCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEE  580
             FC AL+KCLKRAR+SQL++H+AL++FE+E G  DG   KY RTLEELK F+A+ +PFTEE
Sbjct  121   FCTALEKCLKRARDSQLILHVALQQFEDEDGA-DG-KKKYSRTLEELKNFKAAEDPFTEE  178

Query  581   FFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaa  760
             FFQ+FQSVY QQ LML+KL  RK KLDKKL+ + AWRKVSS++FAA  AAVLICSVV AA
Sbjct  179   FFQVFQSVYKQQVLMLQKLLLRKRKLDKKLKSVKAWRKVSSIIFAAAFAAVLICSVVAAA  238

Query  761   iaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTI  940
             +A+P VA ALAAAT+IP+GSMGKW D L ++YE+A+KG KE+I+SMQ GTYI IKDLD+I
Sbjct  239   MAAPPVAAALAAATSIPLGSMGKWFDPLWRDYENALKGQKEVINSMQAGTYIAIKDLDSI  298

Query  941   KVLADRLELEIESLLNTTSFAINEA-AVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDI  1117
             +VL DRLE+E++SL+    FA+ E  AVK GIEEI+KKL +F+K++EDLG  AD CSRDI
Sbjct  299   RVLVDRLEIEMDSLMQNADFALREEDAVKFGIEEIKKKLGIFVKSIEDLGEHADKCSRDI  358

Query  1118  RRARTVILQRIIKH  1159
             RRARTV+LQRIIK+
Sbjct  359   RRARTVVLQRIIKN  372



>ref|XP_009408039.1| PREDICTED: UPF0496 protein 1-like [Musa acuminata subsp. malaccensis]
Length=387

 Score =   435 bits (1119),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 240/386 (62%), Positives = 306/386 (79%), Gaps = 17/386 (4%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDL------QCRTDL-----ISSYEAACELDADLQTFDSTLQARTNH  202
             MG H SK+    S  L        + D+     +SSYEAAC LD +LQ FDSTLQ  T+ 
Sbjct  1     MGAHHSKRPDTPSVLLDDGGGGGGKADIRYVAELSSYEAACRLDPELQGFDSTLQRCTSR  60

Query  203   VISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFEN  382
             VIS+LA+GVEVR+LS DSL+E+TGCLL+MN+EVVKVILECK DIW+  ELF LVE+YFEN
Sbjct  61    VISSLALGVEVRSLSLDSLREITGCLLEMNQEVVKVILECKSDIWKTPELFGLVEDYFEN  120

Query  383   SLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGI-----DGSNNKYERTLEELKG  547
             SL +LDFCAAL+KCLK+AR+ QL+I +AL+ F EE           +  KY RTLEEL+ 
Sbjct  121   SLHTLDFCAALEKCLKKARDGQLIIQVALQHFAEEEAEPEPEPQKDAKKKYSRTLEELRL  180

Query  548   FRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLA  727
             F+A+G+PFTEEFFQ+FQSV+ QQ LMLEKLQ RKNKLDK+LR I AWR+VSS +FAAT A
Sbjct  181   FKAAGDPFTEEFFQVFQSVHGQQLLMLEKLQQRKNKLDKQLRSIKAWRRVSSTIFAATFA  240

Query  728   AVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVG  907
             AVLICSVV AA+A+P VA ALAAA +IPIGSMGKWIDSLL +Y++A+KG +E++ SMQVG
Sbjct  241   AVLICSVVAAAVAAPPVAAALAAAASIPIGSMGKWIDSLLHDYQNAVKGQREVLRSMQVG  300

Query  908   TYITIKDLDTIKVLADRLELEIESLLNTTSFAINEA-AVKVGIEEIRKKLDLFMKNVEDL  1084
             TY+ IKD+++I+VL D++E+E+ SLL    FA+ +A AV + +EEI+KK+++FM++VE++
Sbjct  301   TYVAIKDMESIRVLIDKVEMEMASLLADAEFAMEDAQAVSIAMEEIKKKVEVFMRSVEEV  360

Query  1085  GVQADNCSRDIRRARTVILQRIIKHP  1162
             G QAD CSRDIRRARTV+LQRII++P
Sbjct  361   GEQADGCSRDIRRARTVVLQRIIRNP  386



>ref|XP_008459259.1| PREDICTED: UPF0496 protein At4g34320-like [Cucumis melo]
Length=367

 Score =   427 bits (1098),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 235/373 (63%), Positives = 306/373 (82%), Gaps = 9/373 (2%)
 Frame = +2

Query  56    MGG-HMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLA--VG  226
             MG  H +K++ E   +LQ     +++YEAAC +D D+++FD TLQAR N V++TLA   G
Sbjct  1     MGNQHTTKRTPE---ELQ---PAVAAYEAACRVDDDVRSFDKTLQARANQVLTTLADDGG  54

Query  227   VEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFC  406
             VEVRALSFDSLK+VT CLL+MN+EVV+VIL+CKKDIW+N ELFELVE+YFENSL++LDFC
Sbjct  55    VEVRALSFDSLKQVTECLLEMNQEVVRVILQCKKDIWKNQELFELVEDYFENSLETLDFC  114

Query  407   AALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFF  586
              AL+ CLKRAR+SQ++I +A+++FEE+        N++++TL EL+ F+ASG+PFT+EFF
Sbjct  115   TALENCLKRARDSQVMILMAVRQFEEDERESQMGPNQFDKTLRELRNFKASGDPFTDEFF  174

Query  587   QIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaia  766
             +IF SVY  Q  MLEKLQ +KNKLDKKL+ I  WRK+S ++FAAT AAVLICSVV   I 
Sbjct  175   RIFHSVYKHQTAMLEKLQQKKNKLDKKLKSISTWRKLSCMIFAATFAAVLICSVVATVIM  234

Query  767   spavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKV  946
             +P VA AL+AA++IP+GSMGKWIDSL K+YE+A+KG KE+I+SMQVGTYI IKD+D I++
Sbjct  235   APPVAAALSAASSIPLGSMGKWIDSLWKSYENAVKGQKEVINSMQVGTYIAIKDMDNIRI  294

Query  947   LADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRA  1126
             L ++LE+EI+ +L    FAI E A+KV +EE++KKL++FMK+VEDLGVQAD CSRDI RA
Sbjct  295   LVEKLEIEIKGMLEKADFAIKEEALKVVVEEMKKKLEVFMKSVEDLGVQADLCSRDITRA  354

Query  1127  RTVILQRIIKHPN  1165
             RTV+LQRIIKHPN
Sbjct  355   RTVVLQRIIKHPN  367



>ref|XP_004161622.1| PREDICTED: UPF0496 protein At4g34320-like [Cucumis sativus]
Length=421

 Score =   429 bits (1103),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 238/386 (62%), Positives = 306/386 (79%), Gaps = 7/386 (2%)
 Frame = +2

Query  11    SLQF*LAFVFGCVKIMGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQA  190
             S+   L F       MG H + K   T+ +LQ     +++YEAAC  D D+++FD TLQA
Sbjct  41    SINLHLPFPLFFAITMGNHHTTK--RTTEELQ---PAVAAYEAACRADDDVRSFDKTLQA  95

Query  191   RTNHVISTLA--VGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELV  364
             R N V++TLA   GVEVRALSFDSLK+VT CLL+MN+EVV+VIL+CKKDIW+N ELFELV
Sbjct  96    RANQVLTTLADDGGVEVRALSFDSLKQVTECLLEMNQEVVRVILQCKKDIWKNQELFELV  155

Query  365   EEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELK  544
             E+YFENSL++LDFC AL+ CLKRAR+SQ++I +A+++FEE+        N++++TL EL+
Sbjct  156   EDYFENSLETLDFCTALENCLKRARDSQVMILMAVRQFEEDERESQMGPNQFDKTLRELR  215

Query  545   GFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATL  724
              F+ASG+PFT+EFF+IF SVY  Q  MLEKLQ +KNKLDKKL+ I  WRK+S +MFAAT 
Sbjct  216   NFKASGDPFTDEFFRIFHSVYKHQTAMLEKLQQKKNKLDKKLKSISTWRKLSCMMFAATF  275

Query  725   AAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQV  904
             AAVLICSVV   I +P VA AL+AA++IP+GSMGKWIDSL K+YE+A+KG KE+I+SMQV
Sbjct  276   AAVLICSVVATVIMAPPVAAALSAASSIPLGSMGKWIDSLWKSYENAVKGQKEVINSMQV  335

Query  905   GTYITIKDLDTIKVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDL  1084
             GTYI IKD+D I++L ++LE+EIE +L    FAI E A+K  +EE++KKL++FMK+VEDL
Sbjct  336   GTYIAIKDMDNIRILVEKLEIEIEGMLEKADFAIKEDALKFVVEEMKKKLEVFMKSVEDL  395

Query  1085  GVQADNCSRDIRRARTVILQRIIKHP  1162
             GVQAD CSRDI RARTV+LQRIIKHP
Sbjct  396   GVQADLCSRDITRARTVVLQRIIKHP  421



>gb|KGN61767.1| hypothetical protein Csa_2G238830 [Cucumis sativus]
Length=420

 Score =   428 bits (1101),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 237/386 (61%), Positives = 306/386 (79%), Gaps = 7/386 (2%)
 Frame = +2

Query  11    SLQF*LAFVFGCVKIMGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQA  190
             S+   L F       MG H + K   T+ +LQ     +++YEAAC  D D+++FD TLQA
Sbjct  40    SINLHLPFPLFFAITMGNHHTTK--RTTEELQ---PAVAAYEAACRADDDVRSFDKTLQA  94

Query  191   RTNHVISTLA--VGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELV  364
             R N V++TLA   GVEVRALSFDSLK+VT CLL+MN+EVV+VIL+CKKDIW+N ELFELV
Sbjct  95    RANQVLTTLADDGGVEVRALSFDSLKQVTECLLEMNQEVVRVILQCKKDIWKNQELFELV  154

Query  365   EEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELK  544
             E+YFENSL++LDFC AL+ CLKRAR+SQ++I +A+++FEE+        N++++TL EL+
Sbjct  155   EDYFENSLETLDFCTALENCLKRARDSQVMILMAVRQFEEDERESQMGPNQFDKTLRELR  214

Query  545   GFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATL  724
              F+ASG+PFT+EFF+IF SVY  Q  MLEKLQ +KNKLDKKL+ I  WRK+S +MFAAT 
Sbjct  215   NFKASGDPFTDEFFRIFHSVYKHQTAMLEKLQQKKNKLDKKLKSISTWRKLSCMMFAATF  274

Query  725   AAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQV  904
             AAVLICSVV   I +P VA AL+AA++IP+GSMGKWIDSL K+YE+A+KG KE+I+SMQV
Sbjct  275   AAVLICSVVATVIMAPPVAAALSAASSIPLGSMGKWIDSLWKSYENAVKGQKEVINSMQV  334

Query  905   GTYITIKDLDTIKVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDL  1084
             GTYI IKD+D I++L ++LE+EIE +L    FAI E A+K  +EE++KKL++FMK+VEDL
Sbjct  335   GTYIAIKDMDNIRILVEKLEIEIEGMLEKADFAIKEDALKFVVEEMKKKLEVFMKSVEDL  394

Query  1085  GVQADNCSRDIRRARTVILQRIIKHP  1162
             GVQAD CSRDI RART++LQRIIKHP
Sbjct  395   GVQADLCSRDITRARTLVLQRIIKHP  420



>ref|XP_004145340.1| PREDICTED: UPF0496 protein At4g34320-like [Cucumis sativus]
 ref|XP_004153334.1| PREDICTED: UPF0496 protein At4g34320-like [Cucumis sativus]
Length=421

 Score =   428 bits (1100),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 237/386 (61%), Positives = 306/386 (79%), Gaps = 7/386 (2%)
 Frame = +2

Query  11    SLQF*LAFVFGCVKIMGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQA  190
             S+   L F       MG H + K   T+ +LQ     +++YEAAC  D D+++FD TLQA
Sbjct  41    SINLHLPFPLFFAITMGNHHTTK--RTTEELQ---PAVAAYEAACRADDDVRSFDKTLQA  95

Query  191   RTNHVISTLA--VGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELV  364
             R N V++TLA   GVEVRALSFDSLK+VT CLL+MN+EVV+VIL+CKKDIW+N ELFELV
Sbjct  96    RANQVLTTLADDGGVEVRALSFDSLKQVTECLLEMNQEVVRVILQCKKDIWKNQELFELV  155

Query  365   EEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELK  544
             E+YFENSL++LDFC AL+ CLKRAR+SQ++I +A+++FEE+        N++++TL EL+
Sbjct  156   EDYFENSLETLDFCTALENCLKRARDSQVMILMAVRQFEEDERESQMGPNQFDKTLRELR  215

Query  545   GFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATL  724
              F+ASG+PFT+EFF+IF SVY  Q  MLEKLQ +KNKLDKKL+ I  WRK+S +MFAAT 
Sbjct  216   NFKASGDPFTDEFFRIFHSVYKHQTAMLEKLQQKKNKLDKKLKSISTWRKLSCMMFAATF  275

Query  725   AAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQV  904
             AAVLICSVV   I +P VA AL+AA++IP+GSMGKWIDSL K+YE+A+KG KE+I+SMQV
Sbjct  276   AAVLICSVVATVIMAPPVAAALSAASSIPLGSMGKWIDSLWKSYENAVKGQKEVINSMQV  335

Query  905   GTYITIKDLDTIKVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDL  1084
             GTYI IKD+D I++L ++LE+EIE +L    FAI E A+K  +EE++KKL++FMK+VEDL
Sbjct  336   GTYIAIKDMDNIRILVEKLEIEIEGMLEKADFAIKEDALKFVVEEMKKKLEVFMKSVEDL  395

Query  1085  GVQADNCSRDIRRARTVILQRIIKHP  1162
             GVQAD CSRDI RART++LQRIIKHP
Sbjct  396   GVQADLCSRDITRARTLVLQRIIKHP  421



>ref|XP_010943147.1| PREDICTED: UPF0496 protein 1-like [Elaeis guineensis]
Length=393

 Score =   421 bits (1082),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 231/351 (66%), Positives = 292/351 (83%), Gaps = 3/351 (1%)
 Frame = +2

Query  122   ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEV  301
             +SSYE AC LD +L++FDSTLQ RT+HVISTLA GVEVR+LSFDSL+ VTGCLL+MN+EV
Sbjct  43    LSSYETACRLDPELRSFDSTLQERTSHVISTLAHGVEVRSLSFDSLRAVTGCLLEMNEEV  102

Query  302   VKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFE  481
             VKVILE K+DIW+N ELF+LVEEYFENSL++LDFC AL+KCL +AR+SQL+IH+AL+ FE
Sbjct  103   VKVILEGKEDIWKNPELFKLVEEYFENSLQTLDFCTALEKCLNKARDSQLIIHVALQRFE  162

Query  482   EESGGIDGSN--NKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNK  655
             EE   +   +   KY RT+EEL+ F+A+G+PFTEEFFQ+FQSV  QQ  MLEK++ RKNK
Sbjct  163   EEEEEVVEEDCKKKYLRTIEELRHFKAAGDPFTEEFFQVFQSVSRQQQSMLEKIKQRKNK  222

Query  656   LDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWI  835
             LDKKL+ I AWRKVSS++F A  A ++ICSVVTA +A+P VA ALAAA +IP+GSMGKWI
Sbjct  223   LDKKLKSIKAWRKVSSIIFMAAFATLIICSVVTAVVAAPHVAAALAAAASIPVGSMGKWI  282

Query  836   DSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAI-NE  1012
             DSL K Y+ A++G KEI+SSMQV TYI IKDLD+I+VL D LE +I  LL+   FA+ +E
Sbjct  283   DSLFKGYQQAVEGQKEILSSMQVRTYIVIKDLDSIRVLVDCLEAQINMLLDNADFALRDE  342

Query  1013  AAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
              AVK GI+EI++KL++F K++EDL  QAD CSRDI +ARTV+LQ+II++PN
Sbjct  343   EAVKFGIQEIKEKLEVFTKSIEDLRQQADRCSRDIGKARTVVLQKIIRYPN  393



>gb|KHN25354.1| UPF0496 protein [Glycine soja]
Length=291

 Score =   415 bits (1067),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 222/294 (76%), Positives = 259/294 (88%), Gaps = 3/294 (1%)
 Frame = +2

Query  287   MNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLA  466
             MN+EVVKVIL+CKKDIW++ ELFELVEEYFENSLK+LDFC  L+KCLKRAR+SQLLIH+A
Sbjct  1     MNQEVVKVILDCKKDIWKSQELFELVEEYFENSLKTLDFCTVLEKCLKRARDSQLLIHVA  60

Query  467   LKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSR  646
             +++FEEESG  D   N+Y RTL+E K F+A+G+PFTEEFFQIFQSVY  Q LMLEKLQ R
Sbjct  61    VQQFEEESGSGD---NRYARTLQEFKNFKAAGDPFTEEFFQIFQSVYKHQILMLEKLQLR  117

Query  647   KNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMG  826
             KNKLDKKL+YIH+WRKVSS++F AT AAVLICSVV AAIA+P VA A+AAAT+IPIGSMG
Sbjct  118   KNKLDKKLKYIHSWRKVSSMIFVATFAAVLICSVVAAAIAAPPVAAAIAAATSIPIGSMG  177

Query  827   KWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAI  1006
             KWIDSL +NYE+A+KG KE+ISSMQ GTY+ IKDLD I++L DRLE+EIESLL+   FAI
Sbjct  178   KWIDSLWRNYENALKGQKEVISSMQAGTYVAIKDLDNIRILIDRLEIEIESLLHNVDFAI  237

Query  1007  NEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPNH  1168
              E AVKV IEEI+KKL +FMKNVEDL VQAD CSRDIRRARTV+LQRIIKHP++
Sbjct  238   EEEAVKVAIEEIKKKLGVFMKNVEDLAVQADMCSRDIRRARTVVLQRIIKHPHN  291



>ref|XP_004972533.1| PREDICTED: UPF0496 protein 1-like [Setaria italica]
Length=378

 Score =   414 bits (1063),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 221/350 (63%), Positives = 287/350 (82%), Gaps = 3/350 (1%)
 Frame = +2

Query  122   ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFD-SLKEVTGCLLDMNKE  298
             +SSYEAAC  D +L+TFD+TLQ  T+  ISTLAVGVEVR+LS + SL+EVT CLLD N+ 
Sbjct  30    LSSYEAACRSDPELRTFDTTLQRCTSRAISTLAVGVEVRSLSLEYSLREVTDCLLDTNQN  89

Query  299   VVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEF  478
              ++VIL+CKKDIW++ ELF+L+EEYFE+S+ +LDFC ALDKCLKRAR+SQLL+H+AL+ F
Sbjct  90    GLRVILDCKKDIWKSPELFDLIEEYFESSVHTLDFCTALDKCLKRARDSQLLLHVALQRF  149

Query  479   EEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKL  658
             ++E       + +Y RTL EL+ F+A+G+PFTEEFF  FQ+VY QQ  ML+KLQ RK++L
Sbjct  150   DDEEYAA-APSARYARTLHELRQFKAAGDPFTEEFFAAFQAVYRQQLTMLKKLQRRKHRL  208

Query  659   DKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWID  838
             DKK++ I  WR+VSS++FA T AAVLICSVV AAIA+  VA ALAAA A+P GSM KWID
Sbjct  209   DKKIKTIKVWRRVSSIIFATTFAAVLICSVVAAAIAALPVAAALAAAAAVPQGSMRKWID  268

Query  839   SLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFA-INEA  1015
             SLLK Y+DA++G +E++S+MQV  +I IKDLD+I+VL +R+E+EI S+++   FA  +E 
Sbjct  269   SLLKGYQDALRGQEEVVSAMQVAKFIGIKDLDSIRVLINRVEVEISSMIDCVEFAERDEE  328

Query  1016  AVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
             AVK G+EEI+KKL+ FMK+VEDLG QAD CSRDIRRARTV+LQRII++PN
Sbjct  329   AVKFGVEEIKKKLENFMKSVEDLGEQADRCSRDIRRARTVVLQRIIRNPN  378



>ref|XP_010029837.1| PREDICTED: UPF0496 protein At2g18630-like [Eucalyptus grandis]
 gb|KCW56806.1| hypothetical protein EUGRSUZ_I02475 [Eucalyptus grandis]
Length=378

 Score =   411 bits (1057),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 235/380 (62%), Positives = 292/380 (77%), Gaps = 12/380 (3%)
 Frame = +2

Query  53    IMGGHMSKKSGETS--------NDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVI  208
             + GG  SKK  + +         + Q   DL +SYE AC  D DLQ FD TL  RTN VI
Sbjct  1     MTGGQSSKKRSDDALPIPLPLNTNAQYMADL-TSYEDACRTDPDLQAFDHTLHERTNRVI  59

Query  209   STLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSL  388
             ++LAVGVEVR+LSF+SL+EVTG LL+MN+EVVKVILECKKDIW N ELF LVE+YFENSL
Sbjct  60    NSLAVGVEVRSLSFESLREVTGSLLEMNQEVVKVILECKKDIWNNQELFALVEDYFENSL  119

Query  389   KSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNP  568
             ++LDFC AL+KCLKRAR+SQLLI  A+++FE+   GI+   NKY +TLEEL+ FRA+G+P
Sbjct  120   QTLDFCTALEKCLKRARDSQLLIQFAIQQFEQVEDGIE--ENKYAKTLEELQKFRAAGDP  177

Query  569   FTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsv  748
             FTEEFF IFQSVY QQ  MLEKLQ RK KLDKKL+    W++VS+++F A   + LI SV
Sbjct  178   FTEEFFVIFQSVYKQQLAMLEKLQVRKKKLDKKLKSTKTWKRVSNMIFVAAFVSALIFSV  237

Query  749   vtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKD  928
             V AA+A+P V  ALA A A+PIGS+GKW DSL KNY+ A+KG +E+ISSMQVGTYITIKD
Sbjct  238   VAAAVAAPPVITALAGAIAVPIGSVGKWCDSLWKNYQSALKGQRELISSMQVGTYITIKD  297

Query  929   LDTIKVLADRLELEIESLLNTTSFAINE-AAVKVGIEEIRKKLDLFMKNVEDLGVQADNC  1105
             +D+IKVL  +L++EIES +    FA +E  AVK+ I EI+K+L +FM+ VEDLG  AD C
Sbjct  298   MDSIKVLVSKLQVEIESFMQNADFASSEDEAVKLAIGEIKKRLAIFMERVEDLGAHADKC  357

Query  1106  SRDIRRARTVILQRIIKHPN  1165
             SR+IRRARTV++QRII+H N
Sbjct  358   SREIRRARTVVVQRIIRHSN  377



>ref|XP_009394364.1| PREDICTED: UPF0496 protein 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394365.1| PREDICTED: UPF0496 protein 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=396

 Score =   403 bits (1036),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 217/351 (62%), Positives = 280/351 (80%), Gaps = 5/351 (1%)
 Frame = +2

Query  122   ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEV  301
             +SSYEAAC LD +LQTFD+TLQ RT+  ISTLA+GVEV ALSFDSL+EV GCLL+MN+EV
Sbjct  48    LSSYEAACRLDPELQTFDATLQQRTSRAISTLALGVEVHALSFDSLREVIGCLLEMNQEV  107

Query  302   VKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEF-  478
             VKVIL+ KKD+W+N ELFELVE+YF+NSL+++DFC AL+ CLK+AR SQL+IH+AL+ F 
Sbjct  108   VKVILDSKKDVWKNPELFELVEDYFDNSLQTIDFCTALENCLKKARNSQLIIHIALQRFA  167

Query  479   -EEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNK  655
              +E+   +DG   KY RTL+EL+ F+ +G+PFT+EFFQ+FQ+VY QQ  MLEKLQ RK K
Sbjct  168   DDEQEVDVDG-RKKYVRTLDELRHFKVAGDPFTQEFFQLFQTVYRQQLSMLEKLQLRKGK  226

Query  656   LDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWI  835
             LDKKL+ +  WRKVSS+MFAA   AV+IC  V AA+ +     A  AA A      GKWI
Sbjct  227   LDKKLKRLKTWRKVSSIMFAAAFTAVIIC-SVVAAVVAAPPVAAALAAAASIPIPAGKWI  285

Query  836   DSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAI-NE  1012
             DSLLK Y+DA++  K I++SM+VGT +T+KDLD I+VL D+LE++I SLL+ + F++ +E
Sbjct  286   DSLLKGYQDALERQKGILNSMRVGTDLTLKDLDIIQVLVDKLEIQIHSLLDASDFSLRDE  345

Query  1013  AAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
              AV+ GIEEIRKKL+ FMK+V+ L  QAD C+RDIRRARTV+LQ+II+HPN
Sbjct  346   DAVRFGIEEIRKKLEEFMKSVDSLDQQADRCNRDIRRARTVVLQKIIRHPN  396



>ref|XP_008660446.1| PREDICTED: UPF0496 protein 1-like [Zea mays]
Length=379

 Score =   398 bits (1022),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 214/367 (58%), Positives = 283/367 (77%), Gaps = 3/367 (1%)
 Frame = +2

Query  74    KKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFD  253
             K+ G +   L    + +S+YEAAC  D +L+TFD+TLQ RT   ISTLAVGVEVR++S D
Sbjct  13    KRPGPSEPALPAAAEELSAYEAACRSDPELRTFDTTLQRRTRRAISTLAVGVEVRSMSLD  72

Query  254   SLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKR  433
             SL+EVTGCLLDMN+EVV+ IL+CK+DIW++ ELF+LV++Y E+SL++LDFC AL+KCLKR
Sbjct  73    SLREVTGCLLDMNQEVVRTILDCKEDIWKSPELFDLVKDYLESSLQTLDFCTALEKCLKR  132

Query  434   ARESQLLIHLALKEFEEES--GGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVY  607
             AR+SQL + +AL+ F++E         + +Y RTL EL+ F+ +GNPFT+EFF  F +VY
Sbjct  133   ARDSQLPLRIALQRFDDEKDSDAAAAPSARYVRTLHELRQFKTAGNPFTDEFFDTFDAVY  192

Query  608   VQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavaga  787
              QQ  ML+KLQ R+++LDKK++ I AWR+VSS++FA T AAVLICS+V A IA+P VA A
Sbjct  193   QQQLDMLKKLQQRQHRLDKKVKTIQAWRRVSSIIFATTFAAVLICSIVAAVIAAPPVAAA  252

Query  788   laaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLEL  967
             LAAA A+P+GSMGKW DSLLK  +DA+   + ++S MQ GT I IKDL+ IKVL  R+E 
Sbjct  253   LAAAAAVPLGSMGKWFDSLLKGCQDAVNRQEGVVSEMQFGTLIAIKDLENIKVLIKRVEE  312

Query  968   EIESLLNTTSFA-INEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQ  1144
             EI S+++   FA  +E AVK G+EEI+KKL+ FMK+VEDLG QAD C+R I RART++L 
Sbjct  313   EISSMIDCVEFAERDEEAVKFGVEEIKKKLESFMKSVEDLGEQADRCTRHIHRARTLVLG  372

Query  1145  RIIKHPN  1165
             RII+HPN
Sbjct  373   RIIRHPN  379



>ref|XP_009379180.1| PREDICTED: UPF0496 protein At2g18630-like [Pyrus x bretschneideri]
Length=371

 Score =   395 bits (1016),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 222/374 (59%), Positives = 291/374 (78%), Gaps = 7/374 (2%)
 Frame = +2

Query  53    IMGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVE  232
             +MGG  S K+ ET+ + Q   DL SSYEAAC+LD  LQ+FD  LQ RT+ VI +L+ G++
Sbjct  1     MMGGK-SSKNLETTTNSQDSADL-SSYEAACKLDPALQSFDVNLQQRTSRVIHSLSAGLD  58

Query  233   VRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAA  412
              R+LS DSLKEVT CLLDMN+EVVKVILECKKDIW++ E+F LVEEYFENSL++LDFC +
Sbjct  59    FRSLSLDSLKEVTDCLLDMNQEVVKVILECKKDIWKSKEMFSLVEEYFENSLQTLDFCTS  118

Query  413   LDKCLKRARESQLLIHLALKEFEEESG-GIDGSNNKYERTLEELKGFRASGNPFTEEFFQ  589
             L++CLKRA  +QL+I  A+++FEEE G G DG  N   RTL+EL+ F+ +G+PFT+EFF 
Sbjct  119   LEQCLKRALNTQLIIQAAVRQFEEEVGAGADG--NGCARTLKELRAFKVAGDPFTDEFFI  176

Query  590   IFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaias  769
             +FQ+VY  QA M EKLQ RK KLDKK + + AWR++S+V+F AT  +VL+ SVV AAIA+
Sbjct  177   LFQAVYKNQASMFEKLQLRKRKLDKKFKSMKAWRRLSNVIFVATFVSVLVFSVVAAAIAA  236

Query  770   pavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVL  949
             P +  ALA A A+PIGS+GKW + L  NYE  +K  +EIISSMQ+GT++T+KDLD+I+VL
Sbjct  237   PPLVTALAGAFAVPIGSVGKWCNMLWNNYERGLKEQREIISSMQIGTFVTMKDLDSIRVL  296

Query  950   ADRLELEIESLLNTTSFAINEA--AVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRR  1123
              D+ E+ IESLL+   FAI E   AVK+ ++EI+KKLD+F++ +++L   AD CSRDIR+
Sbjct  297   VDKFEIGIESLLHNADFAIREEGLAVKLVMDEIKKKLDVFVETIDNLSQHADKCSRDIRK  356

Query  1124  ARTVILQRIIKHPN  1165
             ARTVILQRII HPN
Sbjct  357   ARTVILQRIIGHPN  370



>gb|KDP31809.1| hypothetical protein JCGZ_12270 [Jatropha curcas]
Length=386

 Score =   395 bits (1014),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 222/386 (58%), Positives = 293/386 (76%), Gaps = 17/386 (4%)
 Frame = +2

Query  56    MGGHMSKKSG--------------ETSNDLQCRTDLISSYEAACELDADLQTFDSTLQAR  193
             MGG  SK+ G              + ++D Q    L +SYE AC+LD DLQ+FD+ ++ R
Sbjct  1     MGGQSSKQKGVEPPPPPPPPPPPFQINSDSQYTAGL-NSYEKACKLDPDLQSFDNAVRER  59

Query  194   TNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEY  373
             TN VIS+LA GVEVR+LSFDSL+EVT CLL+MN+EVVKVILECK+DIW+N++LF LVEEY
Sbjct  60    TNQVISSLATGVEVRSLSFDSLREVTNCLLEMNQEVVKVILECKEDIWKNNDLFALVEEY  119

Query  374   FENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGS-NNKYERTLEELKGF  550
             F+NS K+LDFC AL+ CLKRAR SQL+I +AL++FE ES   DG    KY +TLEEL+ F
Sbjct  120   FDNSAKTLDFCTALENCLKRARNSQLIIQVALRQFEGESALQDGVIEKKYAKTLEELRKF  179

Query  551   RASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAA  730
             +  G+PFTEEF+ +FQ+VY QQ  ML+KLQ RK +LDKKL+ +  WR+VS+V+F     +
Sbjct  180   KTVGDPFTEEFYILFQAVYRQQVSMLQKLQLRKRRLDKKLKSMKTWRRVSNVLFVTAFVS  239

Query  731   VLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGT  910
             VL+ SVV AAIA+P V  ALA A A+PIGS+GKW +SL  +Y  A+K  KE++S+MQVGT
Sbjct  240   VLVFSVVAAAIAAPPVVTALAGALAVPIGSVGKWCNSLWNSYMKALKRQKELVSTMQVGT  299

Query  911   YITIKDLDTIKVLADRLELEIESLLNTTSFA-INEAAVKVGIEEIRKKLDLFMKNVEDLG  1087
             +I IKD+D I+VL ++LELEIESLL   + A I E A+K+ I+EI+KKL++FM+ +EDLG
Sbjct  300   FIAIKDMDNIRVLVNKLELEIESLLQNVNIALIEEDALKLVIDEIKKKLEVFMQTIEDLG  359

Query  1088  VQADNCSRDIRRARTVILQRIIKHPN  1165
               A+ CSRDI +ARTV+LQRII++P+
Sbjct  360   EHANKCSRDITQARTVVLQRIIRYPD  385



>ref|XP_006425739.1| hypothetical protein CICLE_v10025839mg [Citrus clementina]
 ref|XP_006425740.1| hypothetical protein CICLE_v10025839mg [Citrus clementina]
 ref|XP_006466717.1| PREDICTED: UPF0496 protein At2g18630-like isoform X1 [Citrus 
sinensis]
 ref|XP_006466718.1| PREDICTED: UPF0496 protein At2g18630-like isoform X2 [Citrus 
sinensis]
 gb|ESR38979.1| hypothetical protein CICLE_v10025839mg [Citrus clementina]
 gb|ESR38980.1| hypothetical protein CICLE_v10025839mg [Citrus clementina]
 gb|KDO79464.1| hypothetical protein CISIN_1g016839mg [Citrus sinensis]
 gb|KDO79465.1| hypothetical protein CISIN_1g016839mg [Citrus sinensis]
Length=381

 Score =   393 bits (1010),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 230/382 (60%), Positives = 290/382 (76%), Gaps = 11/382 (3%)
 Frame = +2

Query  53    IMGGHMSKKSG--------ETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVI  208
             +MGG  SKK G        E   D Q   DL S YEAAC LD DLQ+FD+T+Q RT+ VI
Sbjct  1     MMGGQSSKKKGGDAPSPPLEVITDAQYSADL-SLYEAACRLDPDLQSFDATIQERTSRVI  59

Query  209   STLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSL  388
               L+ GVEV +LSFDSLKEVTG LL+MN+EVVKVILECKKDIW N +LF LVE+YFE S+
Sbjct  60    HKLSAGVEVHSLSFDSLKEVTGSLLEMNQEVVKVILECKKDIWNNQDLFGLVEDYFETSI  119

Query  389   KSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNK-YERTLEELKGFRASGN  565
             K+LDFC  L+ CLKRAR SQL+I LA+K+F+EE    +  + K Y RTL+ELK F+ +G+
Sbjct  120   KTLDFCTVLENCLKRARNSQLIIQLAVKQFDEEVELQEVVDEKRYVRTLDELKKFKDAGD  179

Query  566   PFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICs  745
             PFTEEFF +FQSVY QQ LMLE+LQ RK KLDKKL+ +  WR VS+V+F +T  AVLI S
Sbjct  180   PFTEEFFVLFQSVYKQQVLMLERLQKRKRKLDKKLKSMKTWRMVSNVLFVSTFVAVLIFS  239

Query  746   vvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIK  925
             VV AAIA+P +  ALA A A+PIGS+GKW +SL  +YE A+KG KE++S+MQ+G Y+ I 
Sbjct  240   VVAAAIAAPPLVTALAGALAVPIGSVGKWCNSLWNSYEKALKGQKELMSTMQIGAYVKIM  299

Query  926   DLDTIKVLADRLELEIESLLNTTSFAINEA-AVKVGIEEIRKKLDLFMKNVEDLGVQADN  1102
             D+D I+VL ++LE++IE+LLN   FA+ E   VK+ IEEIRK+L++FM+ +E L   AD 
Sbjct  300   DMDHIRVLVNKLEIQIEALLNNADFALREEDVVKLAIEEIRKRLEVFMETIEVLCDHADK  359

Query  1103  CSRDIRRARTVILQRIIKHPNH  1168
             CSRDIRRARTVILQ+IIK+PN+
Sbjct  360   CSRDIRRARTVILQKIIKYPNN  381



>ref|XP_008775796.1| PREDICTED: UPF0496 protein 1-like isoform X3 [Phoenix dactylifera]
 ref|XP_008775797.1| PREDICTED: UPF0496 protein 1-like isoform X3 [Phoenix dactylifera]
Length=387

 Score =   391 bits (1005),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 231/387 (60%), Positives = 301/387 (78%), Gaps = 17/387 (4%)
 Frame = +2

Query  56    MGGHMSKKS---------GETSNDLQCRTDL-----ISSYEAACELDADLQTFDSTLQAR  193
             MGG +S  +         G TS      + +     +SSYE AC LD +L++FD TLQ R
Sbjct  1     MGGQLSTGTPPVLNVDGGGATSASAGGHSGMEYLAGLSSYETACRLDPELRSFDDTLQER  60

Query  194   TNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEY  373
             T+ VISTLA GVE+R+LSFDSL++VTG LL+MN++VVKVILE K+DIW+N ELF LVEEY
Sbjct  61    TSRVISTLAHGVELRSLSFDSLRQVTGSLLEMNQDVVKVILEGKEDIWKNPELFNLVEEY  120

Query  374   FENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSN--NKYERTLEELKG  547
             FENSL++LDFC AL+KCLK+AR+SQL++H+AL+ FEEE   +   +   KY RTLEEL+ 
Sbjct  121   FENSLQTLDFCTALEKCLKKARDSQLILHVALQHFEEEKEEVVEQDCKKKYLRTLEELRH  180

Query  548   FRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLA  727
             F+A+G+PFTEEFF+ FQSV+ QQ  MLEKL  RKNKL+KKL+ I  WRKVS+++FAAT+A
Sbjct  181   FKAAGDPFTEEFFKEFQSVHRQQLSMLEKLNQRKNKLNKKLKSIKTWRKVSNIIFAATVA  240

Query  728   AVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVG  907
              ++ICSV  AA+A+P VA ALAAA +IP+GSMGKWIDSL K+Y++A+KG K I+SSMQV 
Sbjct  241   TIIICSVAAAAVAAPPVAAALAAAASIPVGSMGKWIDSLFKDYQEALKGQKGILSSMQVR  300

Query  908   TYITIKDLDTIKVLADRLELEIESLLNTTSFAI-NEAAVKVGIEEIRKKLDLFMKNVEDL  1084
             TYI IKDLD+I VL +RLE +I  LL    FA+ +E AVK GI+EI++K+++F K++EDL
Sbjct  301   TYIVIKDLDSIGVLVNRLEDQINVLLENADFALRDEEAVKFGIKEIKEKVEVFTKSIEDL  360

Query  1085  GVQADNCSRDIRRARTVILQRIIKHPN  1165
             G + D CSRDI +ARTV+LQRII++PN
Sbjct  361   GEKTDQCSRDIGKARTVVLQRIIRYPN  387



>ref|XP_008338852.1| PREDICTED: UPF0496 protein At2g18630-like [Malus domestica]
Length=374

 Score =   390 bits (1002),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 222/376 (59%), Positives = 292/376 (78%), Gaps = 8/376 (2%)
 Frame = +2

Query  53    IMGGHMSK--KSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVG  226
             +MGG  SK  ++ ET+   Q   DL SSYEAAC+LD  LQ+FD  LQ RT+ VI +L+ G
Sbjct  1     MMGGKSSKNLENLETTTISQDSADL-SSYEAACKLDPALQSFDVNLQQRTSRVIHSLSAG  59

Query  227   VEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFC  406
             ++ R+LS DSLKEVT CLLDMN+EVVKVILECKKDIW++ E+F LVEEYFENSL++LDFC
Sbjct  60    LDFRSLSLDSLKEVTDCLLDMNQEVVKVILECKKDIWKSKEMFSLVEEYFENSLQTLDFC  119

Query  407   AALDKCLKRARESQLLIHLALKEFEEESG-GIDGSNNKYERTLEELKGFRASGNPFTEEF  583
              +L++CLKRA  +QL+I  A+++FEEE G G DG  N   RTL+EL+ F+A+G+PFT+EF
Sbjct  120   TSLEQCLKRALNTQLIIQAAVRQFEEEVGAGADG--NGCARTLKELRAFKAAGDPFTDEF  177

Query  584   FQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaai  763
             F +FQ+VY  QA M EKLQ RK KLDKK + + AWR++S+V+F AT  +VL+ SVV AAI
Sbjct  178   FILFQAVYKNQASMFEKLQLRKRKLDKKFKSMKAWRRLSNVIFVATFVSVLVFSVVAAAI  237

Query  764   aspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIK  943
             A+P +  ALA A AIPIGS+GKW + L  NYE  +KG +EIISSMQ+ T++T+KDLD+I+
Sbjct  238   AAPPLVTALAGALAIPIGSVGKWCNILWNNYEKGLKGQREIISSMQIRTFVTMKDLDSIR  297

Query  944   VLADRLELEIESLLNTTSFAINE--AAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDI  1117
             VL D+ E+ IESLL+   FAI E  +AVK+ ++EI+KKLD+F++ +++L   AD CSRDI
Sbjct  298   VLVDKFEIGIESLLHNXDFAIREEGSAVKLVMDEIKKKLDVFVETIDNLSQHADKCSRDI  357

Query  1118  RRARTVILQRIIKHPN  1165
             R+ARTVI QRII +PN
Sbjct  358   RKARTVISQRIIGYPN  373



>ref|XP_009374219.1| PREDICTED: UPF0496 protein At4g34320-like [Pyrus x bretschneideri]
Length=390

 Score =   388 bits (997),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 226/393 (58%), Positives = 293/393 (75%), Gaps = 24/393 (6%)
 Frame = +2

Query  53    IMGGHMSKKSG------------------ETSNDLQCRTDLISSYEAACELDADLQTFDS  178
             +MGG  SK  G                  E++ + Q   DL SSYEAAC+LD  LQ+FD 
Sbjct  1     MMGGKFSKNKGVDASGTPSPPPPQPPETLESNTNSQDTADL-SSYEAACKLDPALQSFDV  59

Query  179   TLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFE  358
              LQ RT+ VI + + G+EVR+LS DSLKEVT CLLDMN+EVVK+ILECKKDIW++ E+F 
Sbjct  60    NLQQRTSRVIHSFSDGLEVRSLSLDSLKEVTDCLLDMNQEVVKLILECKKDIWKSKEMFS  119

Query  359   LVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESG-GIDGSNNKYERTLE  535
             LVEEYFENSL++LDFC +L++CLKRA  +QL+I  A+K+FEEE G G DG  N   RTL+
Sbjct  120   LVEEYFENSLQTLDFCTSLEQCLKRALNNQLIIQAAVKQFEEEVGAGADG--NGCARTLK  177

Query  536   ELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFA  715
             EL+ F+A+G+PFT+EFF +FQ+VY  QA M EKLQ RK KLDKKL+ + AWR+VS+V+F 
Sbjct  178   ELRAFKAAGDPFTDEFFILFQAVYKNQASMFEKLQLRKRKLDKKLKSVKAWRRVSNVIFV  237

Query  716   ATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISS  895
             AT  +VL+ SVV AAIA+P +  ALA A A+PIGS+GKW + L  NYE  +KG +EII S
Sbjct  238   ATFISVLVFSVVAAAIAAPPLVTALAGALAVPIGSVGKWCNMLWNNYERGLKGQREIIGS  297

Query  896   MQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINE--AAVKVGIEEIRKKLDLFMK  1069
             MQ+GT++T+KDLD+I+VL D+ E+ IESLL    FAI E   AVK+ I+EI+KKLD+F++
Sbjct  298   MQIGTFVTLKDLDSIRVLVDKFEIGIESLLQNADFAIREEGVAVKLVIDEIKKKLDVFVE  357

Query  1070  NVEDLGVQADNCSRDIRRARTVILQRIIKHPNH  1168
              +++L   AD CSR+IR+ARTVILQRII+HPN 
Sbjct  358   TIDNLSQHADKCSRNIRKARTVILQRIIRHPNQ  390



>ref|XP_010649192.1| PREDICTED: UPF0496 protein At4g34320-like [Vitis vinifera]
 ref|XP_010649193.1| PREDICTED: UPF0496 protein At4g34320-like [Vitis vinifera]
 ref|XP_010649194.1| PREDICTED: UPF0496 protein At4g34320-like [Vitis vinifera]
 ref|XP_010649195.1| PREDICTED: UPF0496 protein At4g34320-like [Vitis vinifera]
 ref|XP_010649196.1| PREDICTED: UPF0496 protein At4g34320-like [Vitis vinifera]
Length=380

 Score =   387 bits (994),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 233/379 (61%), Positives = 294/379 (78%), Gaps = 11/379 (3%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDL---ISSYEAACELDADLQTFDSTLQARTNHVISTLAVG  226
             MGG  SKK  + +  ++  +     +SSYEAAC LD DLQ+FD+ +Q RTN VI+TLAVG
Sbjct  1     MGGIFSKKRDDEAPSVRINSQYAADLSSYEAACRLDPDLQSFDTNIQERTNRVINTLAVG  60

Query  227   VEV----RALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKS  394
             VEV    R+LSFDSL+EVT CLL+MN+EVVKVILECKKDIW+  ELF+LVEEYF+NSL++
Sbjct  61    VEVGVEVRSLSFDSLREVTDCLLEMNQEVVKVILECKKDIWKCKELFDLVEEYFDNSLRT  120

Query  395   LDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDG-SNNKYERTLEELKGFRASGNPF  571
             L+FC  LDKCLKRAR+SQL++ +AL+ FEEE    DG   NK+ +TL+EL+ F+A+G PF
Sbjct  121   LEFCTVLDKCLKRARDSQLIVQVALQRFEEEEK--DGVGENKHLKTLQELRNFKAAGKPF  178

Query  572   TEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvv  751
             +++FF++FQSVY  Q LMLEKL+ RK KLDKKL+ +  WRKVS+++F +   +VLI SVV
Sbjct  179   SDDFFELFQSVYSGQKLMLEKLRQRKRKLDKKLKSLQGWRKVSTIVFVSAFVSVLIFSVV  238

Query  752   taaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDL  931
              AAIA+P V  ALA A A+PIGSMGKW DS+ K YE  +KG +EIISSMQVG+ I IKDL
Sbjct  239   AAAIAAPPVVTALAGALAVPIGSMGKWFDSIWKKYEKELKGRREIISSMQVGSLIAIKDL  298

Query  932   DTIKVLADRLELEIESLLNTTSFAINEA-AVKVGIEEIRKKLDLFMKNVEDLGVQADNCS  1108
             + I+VL ++LE++IESLL    FAI E  AVK+ IEEI+KKL  FM+ +E LG   D CS
Sbjct  299   EDIRVLVEKLEIDIESLLQNADFAIQEEDAVKLVIEEIKKKLHGFMETIEMLGQNTDKCS  358

Query  1109  RDIRRARTVILQRIIKHPN  1165
             RDIRRARTVILQRII+HPN
Sbjct  359   RDIRRARTVILQRIIRHPN  377



>ref|XP_008352479.1| PREDICTED: UPF0496 protein At4g34320-like [Malus domestica]
 ref|XP_008352480.1| PREDICTED: UPF0496 protein At4g34320-like [Malus domestica]
 ref|XP_008361061.1| PREDICTED: UPF0496 protein At4g34320-like [Malus domestica]
 ref|XP_008361063.1| PREDICTED: UPF0496 protein At4g34320-like [Malus domestica]
 ref|XP_008361370.1| PREDICTED: UPF0496 protein At4g34320-like [Malus domestica]
 ref|XP_008361371.1| PREDICTED: UPF0496 protein At4g34320-like [Malus domestica]
Length=390

 Score =   384 bits (986),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 226/393 (58%), Positives = 295/393 (75%), Gaps = 24/393 (6%)
 Frame = +2

Query  53    IMGGHMSKKSG------------------ETSNDLQCRTDLISSYEAACELDADLQTFDS  178
             +MGG  SK  G                  E++ + Q   DL SSYEAAC+LD  LQ+FD 
Sbjct  1     MMGGKFSKNKGVDASGTXSPPPPQPHETLESNTNSQDTADL-SSYEAACKLDPALQSFDV  59

Query  179   TLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFE  358
              LQ RT+ VI + + G+EVR+LS DSLKEVT CLLDMN+EVVK+ILECKKDIW++ E+F 
Sbjct  60    NLQQRTSRVIHSFSDGLEVRSLSLDSLKEVTDCLLDMNQEVVKLILECKKDIWKSKEMFS  119

Query  359   LVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESG-GIDGSNNKYERTLE  535
             LVEEYFENSL++LDFC +L++CLKRA  +QL+I  A+++FEEE G G DG  N   RTL+
Sbjct  120   LVEEYFENSLQTLDFCTSLEQCLKRALNNQLIIQAAVRQFEEEVGAGADG--NGCARTLK  177

Query  536   ELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFA  715
             EL+ F+A+G+PFT+EFF++FQ+VY  QA M EKLQ RK KLDKKL+ + AWR+VS+V+F 
Sbjct  178   ELRAFKAAGDPFTDEFFRLFQTVYKNQASMFEKLQLRKRKLDKKLKSVKAWRRVSNVIFV  237

Query  716   ATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISS  895
             AT  +VL+ SVV AAIA+P +  ALA A A+PIGS+GKW + L  NYE  +KG +EIISS
Sbjct  238   ATFVSVLVFSVVAAAIAAPPLVTALAGALAVPIGSVGKWCNMLWNNYERGLKGQREIISS  297

Query  896   MQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINE--AAVKVGIEEIRKKLDLFMK  1069
             MQ+GT++T+KDLD+I+VL D+ E+ IESLL    FAI E   AVK+ I+EI+KKLD+F++
Sbjct  298   MQIGTFVTLKDLDSIRVLVDKFEIGIESLLQNADFAIREEGVAVKLVIDEIKKKLDVFVE  357

Query  1070  NVEDLGVQADNCSRDIRRARTVILQRIIKHPNH  1168
              +++L   AD CSR+IR+ARTVILQRII+HPN 
Sbjct  358   TIDNLSQHADKCSRNIRKARTVILQRIIRHPNQ  390



>ref|XP_008775795.1| PREDICTED: UPF0496 protein 1-like isoform X2 [Phoenix dactylifera]
Length=407

 Score =   383 bits (984),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 229/384 (60%), Positives = 298/384 (78%), Gaps = 17/384 (4%)
 Frame = +2

Query  56    MGGHMSKKS---------GETSNDLQCRTDL-----ISSYEAACELDADLQTFDSTLQAR  193
             MGG +S  +         G TS      + +     +SSYE AC LD +L++FD TLQ R
Sbjct  1     MGGQLSTGTPPVLNVDGGGATSASAGGHSGMEYLAGLSSYETACRLDPELRSFDDTLQER  60

Query  194   TNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEY  373
             T+ VISTLA GVE+R+LSFDSL++VTG LL+MN++VVKVILE K+DIW+N ELF LVEEY
Sbjct  61    TSRVISTLAHGVELRSLSFDSLRQVTGSLLEMNQDVVKVILEGKEDIWKNPELFNLVEEY  120

Query  374   FENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSN--NKYERTLEELKG  547
             FENSL++LDFC AL+KCLK+AR+SQL++H+AL+ FEEE   +   +   KY RTLEEL+ 
Sbjct  121   FENSLQTLDFCTALEKCLKKARDSQLILHVALQHFEEEKEEVVEQDCKKKYLRTLEELRH  180

Query  548   FRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLA  727
             F+A+G+PFTEEFF+ FQSV+ QQ  MLEKL  RKNKL+KKL+ I  WRKVS+++FAAT+A
Sbjct  181   FKAAGDPFTEEFFKEFQSVHRQQLSMLEKLNQRKNKLNKKLKSIKTWRKVSNIIFAATVA  240

Query  728   AVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVG  907
              ++ICSV  AA+A+P VA ALAAA +IP+GSMGKWIDSL K+Y++A+KG K I+SSMQV 
Sbjct  241   TIIICSVAAAAVAAPPVAAALAAAASIPVGSMGKWIDSLFKDYQEALKGQKGILSSMQVR  300

Query  908   TYITIKDLDTIKVLADRLELEIESLLNTTSFAI-NEAAVKVGIEEIRKKLDLFMKNVEDL  1084
             TYI IKDLD+I VL +RLE +I  LL    FA+ +E AVK GI+EI++K+++F K++EDL
Sbjct  301   TYIVIKDLDSIGVLVNRLEDQINVLLENADFALRDEEAVKFGIKEIKEKVEVFTKSIEDL  360

Query  1085  GVQADNCSRDIRRARTVILQRIIK  1156
             G + D CSRDI +ARTV+LQRII+
Sbjct  361   GEKTDQCSRDIGKARTVVLQRIIR  384



>ref|XP_008775794.1| PREDICTED: UPF0496 protein 1-like isoform X1 [Phoenix dactylifera]
Length=410

 Score =   383 bits (983),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 229/384 (60%), Positives = 298/384 (78%), Gaps = 17/384 (4%)
 Frame = +2

Query  56    MGGHMSKKS---------GETSNDLQCRTDL-----ISSYEAACELDADLQTFDSTLQAR  193
             MGG +S  +         G TS      + +     +SSYE AC LD +L++FD TLQ R
Sbjct  1     MGGQLSTGTPPVLNVDGGGATSASAGGHSGMEYLAGLSSYETACRLDPELRSFDDTLQER  60

Query  194   TNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEY  373
             T+ VISTLA GVE+R+LSFDSL++VTG LL+MN++VVKVILE K+DIW+N ELF LVEEY
Sbjct  61    TSRVISTLAHGVELRSLSFDSLRQVTGSLLEMNQDVVKVILEGKEDIWKNPELFNLVEEY  120

Query  374   FENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSN--NKYERTLEELKG  547
             FENSL++LDFC AL+KCLK+AR+SQL++H+AL+ FEEE   +   +   KY RTLEEL+ 
Sbjct  121   FENSLQTLDFCTALEKCLKKARDSQLILHVALQHFEEEKEEVVEQDCKKKYLRTLEELRH  180

Query  548   FRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLA  727
             F+A+G+PFTEEFF+ FQSV+ QQ  MLEKL  RKNKL+KKL+ I  WRKVS+++FAAT+A
Sbjct  181   FKAAGDPFTEEFFKEFQSVHRQQLSMLEKLNQRKNKLNKKLKSIKTWRKVSNIIFAATVA  240

Query  728   AVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVG  907
              ++ICSV  AA+A+P VA ALAAA +IP+GSMGKWIDSL K+Y++A+KG K I+SSMQV 
Sbjct  241   TIIICSVAAAAVAAPPVAAALAAAASIPVGSMGKWIDSLFKDYQEALKGQKGILSSMQVR  300

Query  908   TYITIKDLDTIKVLADRLELEIESLLNTTSFAI-NEAAVKVGIEEIRKKLDLFMKNVEDL  1084
             TYI IKDLD+I VL +RLE +I  LL    FA+ +E AVK GI+EI++K+++F K++EDL
Sbjct  301   TYIVIKDLDSIGVLVNRLEDQINVLLENADFALRDEEAVKFGIKEIKEKVEVFTKSIEDL  360

Query  1085  GVQADNCSRDIRRARTVILQRIIK  1156
             G + D CSRDI +ARTV+LQRII+
Sbjct  361   GEKTDQCSRDIGKARTVVLQRIIR  384



>gb|AAL58139.1|AC093093_12 hypothetical protein [Oryza sativa Japonica Group]
 gb|EEE50818.1| hypothetical protein OsJ_31216 [Oryza sativa Japonica Group]
Length=378

 Score =   379 bits (972),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 205/347 (59%), Positives = 275/347 (79%), Gaps = 1/347 (0%)
 Frame = +2

Query  128   SYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVK  307
             SYEAAC  D +L TFD+ L+ R +  I+ +A GVEVR+LS  SL+EVTGCLLDMN+EVV+
Sbjct  32    SYEAACSADPELGTFDTALRRRASRAITAVASGVEVRSLSLGSLREVTGCLLDMNQEVVR  91

Query  308   VILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEE  487
             V+L+CK+D+WR+ +LF+LVE+YFE SL +LDF AALDK L RAR+SQL++HLAL+    E
Sbjct  92    VVLDCKRDVWRSPDLFDLVEDYFEGSLHTLDFLAALDKSLHRARDSQLVLHLALQRHHHE  151

Query  488   SGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKK  667
                   ++  Y  TL EL+ F+A+G PFT+EFF  FQ+VY QQ  M+ KL+ RK +LD++
Sbjct  152   PPAAASASELYASTLGELRQFKAAGEPFTDEFFAAFQTVYRQQMSMVGKLRRRKRRLDRR  211

Query  668   LRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLL  847
             LR +  WR+VS ++F  + AA+L+CSVV AAIA+P VA ALAAA ++P+GS GKW+DSLL
Sbjct  212   LRSVRVWRRVSGIVFLTSFAALLVCSVVAAAIAAPPVAAALAAAASMPVGSAGKWMDSLL  271

Query  848   KNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFA-INEAAVK  1024
             K Y+DA+ GHKE++S+MQVGT+I IKDLD+I+VL + LE++I S+ ++  FA  +E AV+
Sbjct  272   KKYQDALHGHKEVVSAMQVGTFIAIKDLDSIRVLVEHLEVQISSMADSVEFAERDEEAVR  331

Query  1025  VGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
              GI+E++KKL+LFMK+V+DLG QAD CSRDIRRARTV+LQRII HPN
Sbjct  332   FGIDEVKKKLELFMKSVDDLGEQADRCSRDIRRARTVVLQRIIHHPN  378



>ref|XP_006856114.1| hypothetical protein AMTR_s00059p00142910 [Amborella trichopoda]
 gb|ERN17581.1| hypothetical protein AMTR_s00059p00142910 [Amborella trichopoda]
Length=369

 Score =   375 bits (964),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 219/376 (58%), Positives = 288/376 (77%), Gaps = 13/376 (3%)
 Frame = +2

Query  56    MGGHMSKKSGETS-----NDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLA  220
             MGG MSK    ++      +LQ  ++L S YE AC+LD +L+ FDS LQA+T   I+ LA
Sbjct  1     MGGKMSKNGNPSAVLQFDGNLQYVSELFS-YEEACKLDPELEFFDSNLQAQTKQAINKLA  59

Query  221   VGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLD  400
             VGVEVR+LS +SLK+V  CLL+MN+EVVKVILE K+DIW++ ELF+LVEEYF NSL+++D
Sbjct  60    VGVEVRSLSVESLKDVISCLLEMNQEVVKVILERKQDIWKSPELFDLVEEYFNNSLQTMD  119

Query  401   FCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEE  580
             FC AL+KCLKRA++ Q++I +AL++F E   G       +++TLEEL+ F+ + +PFTEE
Sbjct  120   FCTALEKCLKRAKDGQMIIQVALQQFAEAGEG------HHQKTLEELRSFKMAASPFTEE  173

Query  581   FFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaa  760
             FF + QSVY QQ  ML+KL ++K+KLDKKL+ I  WR+VSS++FA+  A VLICSVV AA
Sbjct  174   FFTLLQSVYSQQVSMLKKLVAKKSKLDKKLKSIKVWRRVSSIIFASVFATVLICSVVAAA  233

Query  761   iaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTI  940
             +A+P VA ALAAA+AIPIGS GKW+DSL KNYE A+K  KE+I+SM VG Y+ IKDLD I
Sbjct  234   VAAPPVAAALAAASAIPIGSAGKWVDSLWKNYEVALKSQKEVINSMHVGAYVAIKDLDNI  293

Query  941   KVLADRLELEIESLLNTTSFAIN-EAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDI  1117
             +VL DRLE+EI SLL    FA+  + A+K+GIEEI KK ++F K++EDL   A  C RDI
Sbjct  294   RVLVDRLEIEIGSLLQNVDFALQAQDAIKLGIEEITKKFEVFTKSIEDLDDHATRCHRDI  353

Query  1118  RRARTVILQRIIKHPN  1165
             +RARTV+LQ+IIKHP+
Sbjct  354   QRARTVVLQKIIKHPS  369



>gb|EPS58393.1| hypothetical protein M569_16421 [Genlisea aurea]
Length=388

 Score =   374 bits (961),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 196/349 (56%), Positives = 271/349 (78%), Gaps = 3/349 (1%)
 Frame = +2

Query  122   ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEV  301
             +++  +AC LD D    D+TL+AR N  I  LA GVEV ALS +SL++VT CLL+MN+EV
Sbjct  37    LTTLASACRLDVDAHAMDTTLEARANSAIRALAAGVEVHALSMESLRDVTECLLEMNQEV  96

Query  302   VKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFE  481
             VKVIL+CKKD+WRN +LF LVE++F+N+L +LDFC+AL K L RAR++Q+ + +AL+E E
Sbjct  97    VKVILDCKKDVWRNQDLFSLVEDHFDNTLHTLDFCSALQKSLHRARDAQIRLLVALQELE  156

Query  482   EESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLD  661
              E G    + ++  + LEELK F+ +GNPF E+FFQ   SV+  Q LML+KLQ +K KLD
Sbjct  157   GEEGK-PWAKSQCCKALEELKRFKETGNPFGEDFFQCLHSVHQHQMLMLDKLQRKKRKLD  215

Query  662   KKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDS  841
              KL+ I AWR++SS++FA T AA+LICSVV AA++   +A  L+AA +IPIGS+GKWIDS
Sbjct  216   GKLKSIQAWRRISSIIFATTFAALLICSVVAAALSLGPIAAGLSAAASIPIGSIGKWIDS  275

Query  842   LLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLL-NTTSFAINEAA  1018
             LL+  E AI+G KEI++SM+VG+Y+ +KDLD I+V+ D+LE+E+E ++ +   F I EAA
Sbjct  276   LLRKREAAIRGQKEIVNSMKVGSYVAVKDLDGIRVMVDKLEMEMEWMMRDADDFGI-EAA  334

Query  1019  VKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
             V++G++E+++KL  FMK+V+DLG QAD CSRDIRRARTV+LQRIIK P+
Sbjct  335   VRIGVQEMKRKLQGFMKDVDDLGAQADCCSRDIRRARTVVLQRIIKPPS  383



>ref|XP_007202121.1| hypothetical protein PRUPE_ppa006925mg [Prunus persica]
 gb|EMJ03320.1| hypothetical protein PRUPE_ppa006925mg [Prunus persica]
Length=390

 Score =   374 bits (960),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 212/350 (61%), Positives = 282/350 (81%), Gaps = 4/350 (1%)
 Frame = +2

Query  122   ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEV  301
             +SSYEAAC+ D  LQ+FD+TL+ RT+ VI++L+ G+EVR+LS DSLKEVT CLL+MN+EV
Sbjct  42    LSSYEAACKHDPALQSFDATLRQRTSRVITSLSTGLEVRSLSLDSLKEVTDCLLEMNQEV  101

Query  302   VKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFE  481
             VKVILECKKDIW + E+F LVEEYFENSL+++DFC AL++CLKRA  +QL+I  A+++F+
Sbjct  102   VKVILECKKDIWNSKEMFSLVEEYFENSLQTMDFCTALEQCLKRALNNQLIIQAAVRQFQ  161

Query  482   EE-SGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKL  658
             EE   G +G   + ERTL+EL+ F+A+G+PFT+EFF +FQSVY QQA M EKLQ RK KL
Sbjct  162   EEVEAGAEG--KRCERTLQELRAFKAAGDPFTDEFFILFQSVYKQQASMFEKLQLRKRKL  219

Query  659   DKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWID  838
             DKKL+ + AWR+VS+V+F A   +VL+ SVV AAIA+P +  ALA A A+PIGS+GKW +
Sbjct  220   DKKLKSVKAWRRVSNVIFVAGFVSVLVFSVVAAAIAAPPLVTALAGALAVPIGSIGKWCN  279

Query  839   SLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINEA-  1015
              L   YE  +KG +EIISSMQ+GTY+T+KDLD I+VL D+ E++IESLL T  FA+ E  
Sbjct  280   LLWNRYERTLKGQREIISSMQIGTYVTMKDLDNIRVLVDKWEIQIESLLQTAGFALREED  339

Query  1016  AVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
              VK+ I+EI+KKL++F++ +++L   AD CSR+IRRARTVILQRII+HP+
Sbjct  340   TVKLVIDEIKKKLEMFVETIDNLSQHADKCSRNIRRARTVILQRIIRHPD  389



>gb|EMT23432.1| hypothetical protein F775_11302 [Aegilops tauschii]
Length=311

 Score =   371 bits (952),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 206/311 (66%), Positives = 261/311 (84%), Gaps = 3/311 (1%)
 Frame = +2

Query  242   LSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDK  421
             +S  S + VT CLLDMN+EVVKVIL+CKKDIW++ ELF+LVE+YFE+SL +LDFC ALDK
Sbjct  1     MSLVSPRGVTVCLLDMNQEVVKVILDCKKDIWKSPELFDLVEDYFESSLHTLDFCTALDK  60

Query  422   CLKRARESQLLIHLALKEF--EEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIF  595
             CLKRAR+SQLL+H+AL+ F  E+++        +Y RTL EL+ F+A+G+PF++EFF+ F
Sbjct  61    CLKRARDSQLLLHVALQRFDDEDDNDADAAPAARYARTLHELRQFKAAGDPFSDEFFEAF  120

Query  596   QSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspa  775
             Q+VY QQ  MLEKLQ RK++LDKK++ I AWR+VSSV+FA+T AAVLICSVV AAIA+P 
Sbjct  121   QAVYRQQLAMLEKLQQRKHRLDKKIKTIKAWRRVSSVIFASTFAAVLICSVVAAAIAAPP  180

Query  776   vagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLAD  955
             VA ALAAA AIPIGSMGKWIDSLLK Y+DA++G KE++S+MQVGT+I IKDLD I+VL +
Sbjct  181   VAAALAAAAAIPIGSMGKWIDSLLKGYQDAVRGQKEVVSAMQVGTFIAIKDLDNIRVLIN  240

Query  956   RLELEIESLLNTTSFA-INEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRART  1132
             R+E+EI S+++   FA  +E AVK G+EEI+KKL+ FMK+VEDLG QAD CSRDIRRART
Sbjct  241   RVEMEISSMIDCVDFAERDEEAVKFGVEEIKKKLEAFMKSVEDLGEQADRCSRDIRRART  300

Query  1133  VILQRIIKHPN  1165
             V+LQRII+HPN
Sbjct  301   VVLQRIIRHPN  311



>ref|XP_008241622.1| PREDICTED: UPF0496 protein At2g18630 [Prunus mume]
Length=387

 Score =   373 bits (958),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 212/350 (61%), Positives = 281/350 (80%), Gaps = 4/350 (1%)
 Frame = +2

Query  122   ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEV  301
             +SSYEAAC+ D  LQ+FD+TL+ RT+ VI++L+ G+EVR+LS DSLKEVT CLL+MN+EV
Sbjct  39    LSSYEAACKHDPALQSFDATLRQRTSRVITSLSTGLEVRSLSLDSLKEVTDCLLEMNQEV  98

Query  302   VKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFE  481
             VKVILECKKDIW + E+F LVEEYFENSL+++DFC AL++CLKRA  +QL+I  A+++F+
Sbjct  99    VKVILECKKDIWNSKEMFSLVEEYFENSLQTMDFCTALEQCLKRALNNQLIIQAAVRQFQ  158

Query  482   EE-SGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKL  658
             EE   G +G   + ERTL+EL+ F+A+G PFT+EFF +FQSVY QQA M EKLQ RK KL
Sbjct  159   EEVEAGAEG--KRCERTLQELRAFKAAGEPFTDEFFILFQSVYKQQASMFEKLQLRKRKL  216

Query  659   DKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWID  838
             DKKL+ + AWR+VS+V+F A   +VL+ SVV AAIA+P +  ALA A A+PIGS+GKW +
Sbjct  217   DKKLKSVKAWRRVSNVIFVAGFVSVLVFSVVAAAIAAPPLVTALAGALAVPIGSIGKWCN  276

Query  839   SLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINEA-  1015
              L   YE  +KG +EIISSMQ+GTY+T+KDLD I+VL D+ E++IESLL T  FA+ E  
Sbjct  277   LLWNRYERTLKGQREIISSMQIGTYVTMKDLDNIRVLVDKWEIQIESLLQTAGFALREED  336

Query  1016  AVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
              VK+ I+EI+KKL++F++ +++L   AD CSR+IRRARTVILQRII+HP+
Sbjct  337   TVKLVIDEIKKKLEMFVETIDNLSQHADKCSRNIRRARTVILQRIIRHPD  386



>emb|CDY45304.1| BnaA03g52770D [Brassica napus]
Length=325

 Score =   370 bits (951),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 209/313 (67%), Positives = 261/313 (83%), Gaps = 6/313 (2%)
 Frame = +2

Query  56   MGGHMSKKSGETSNDLQCRTDL----ISSYEAACELDADLQTFDSTLQARTNHVISTLAV  223
            MG   SKKS ETS+     +      + SYEAAC+ D +LQ+FD+ +QART+HVISTLA 
Sbjct  1    MGNQTSKKSHETSSKTTTTSMHYTTELRSYEAACKADTELQSFDTCMQARTSHVISTLAT  60

Query  224  GVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDF  403
            GVEVRALSFDSLKEVT CLL+MN+EVVKVIL+CKKDIW+N ELFELVE+YFENSLK+LDF
Sbjct  61   GVEVRALSFDSLKEVTECLLEMNQEVVKVILDCKKDIWKNQELFELVEDYFENSLKTLDF  120

Query  404  CAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEF  583
            CAAL+K L++AR+SQLLI +AL++FE+ES  ++G N  YE+TLEELK F+ + +PF E+F
Sbjct  121  CAALEKGLRKARDSQLLILVALQQFEDES-LVEGGNG-YEKTLEELKNFKEAESPFDEDF  178

Query  584  FQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaai  763
            F++FQSVY  Q LMLEKLQ RKNKLDKKL+ IH WRK+SS++F AT A VLICSVV AA+
Sbjct  179  FKMFQSVYKHQMLMLEKLQHRKNKLDKKLKSIHTWRKLSSIIFVATFATVLICSVVAAAM  238

Query  764  aspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIK  943
            A+P VA ALAAATAIP+GSMGKW+DSL KNYE+A+KG KE+ISSMQ GT++ +KDLD I+
Sbjct  239  AAPPVAAALAAATAIPLGSMGKWVDSLWKNYENALKGQKEVISSMQAGTFVAVKDLDNIR  298

Query  944  VLADRLELEIESL  982
            +L +RLE+EI+ +
Sbjct  299  ILIERLEIEIKGM  311



>ref|XP_011085548.1| PREDICTED: UPF0496 protein 1-like [Sesamum indicum]
Length=409

 Score =   373 bits (957),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 197/351 (56%), Positives = 271/351 (77%), Gaps = 3/351 (1%)
 Frame = +2

Query  122   ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEV  301
             + SYE AC  D DLQTFDSTLQ RT+  I+++AVG+EVR+LS DSL+EVT CLL+MN+EV
Sbjct  49    LRSYEDACRADPDLQTFDSTLQLRTSRAINSIAVGLEVRSLSLDSLREVTECLLEMNQEV  108

Query  302   VKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFE  481
             VK+IL+ KKDIW+N EL +LV++YFENSL +LDFC ALD CLKRA   + +I++AL++F+
Sbjct  109   VKIILQNKKDIWKNQELSDLVDDYFENSLLTLDFCTALDACLKRAGHIESIINVALRKFD  168

Query  482   EE--SGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNK  655
             EE  +   +GS   Y RTLEEL+ FR + +PFT+EFF++F SV+ +Q  MLE+LQ++K K
Sbjct  169   EEHCTFAGEGSAKNYSRTLEELRNFRLAADPFTQEFFRVFSSVHSKQITMLERLQAKKKK  228

Query  656   LDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWI  835
             LDK+L  +  WRKVS+V+F  T A+V ICSVV A + +P V  ALAAA A+P+GSMG+W+
Sbjct  229   LDKQLGKLKVWRKVSNVIFIVTFASVWICSVVAAPVTAPPVVTALAAAAAVPLGSMGRWL  288

Query  836   DSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAIN-E  1012
             +SL KN E  ++G ++IISSMQ+G+Y+ IKDLD+I+VL DR  +E+E+LL    FA   E
Sbjct  289   NSLWKNCERDLRGQRDIISSMQIGSYVVIKDLDSIRVLVDRFRVELEALLANAEFATREE  348

Query  1013  AAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
             AAV + +EEIRKK++ F+K + DL   A+ C+++ R ART+IL+RII HP+
Sbjct  349   AAVVIAVEEIRKKVNEFIKTIHDLSEHANKCTQETRMARTLILRRIINHPS  399



>ref|XP_010531185.1| PREDICTED: LOW QUALITY PROTEIN: UPF0496 protein At2g18630-like 
[Tarenaya hassleriana]
Length=382

 Score =   368 bits (945),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 202/382 (53%), Positives = 266/382 (70%), Gaps = 23/382 (6%)
 Frame = +2

Query  53    IMGGHMSKKSGETSNDLQCR---------TDLISSYEAACELDADLQTFDSTLQARTNHV  205
             +MGG  SKK     +  Q           T+ +SSYE AC  D +LQ+FDS LQ RTN V
Sbjct  1     MMGGKSSKKKNREEDSPQTPVQINIKSEYTEHLSSYETACSQDPELQSFDSALQERTNRV  60

Query  206   ISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENS  385
             I+ LA GVEVR+LSFDSL+EVT CLL+MN++VVKVIL+ K+DIW N ELF LV  YFE+S
Sbjct  61    INKLAAGVEVRSLSFDSLREVTQCLLEMNQDVVKVILQGKEDIWNNQELFSLVNLYFESS  120

Query  386   LKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGN  565
              K++DFC+AL+ CLKRAR SQ++I  A+K+FEEE    DG N KY +TLE+LK F+  G 
Sbjct  121   AKTMDFCSALENCLKRARRSQVIIQFAVKQFEEE----DGENKKYVKTLEDLKRFKEEGQ  176

Query  566   PFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICs  745
             PFTEEFF +F  VY QQ  MLE+L  +K KLDK+L+ I  WR+VS+V+F     +V    
Sbjct  177   PFTEEFFVLFDLVYRQQVSMLEELHKQKRKLDKRLKMIKTWRRVSNVVFVTCFVSVX---  233

Query  746   vvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIK  925
                   A+P V  A+A A A+P+GS+GKW + L K YE  ++G KEII+S+++GTYI +K
Sbjct  234   ------AAPPVVAAIAGALAVPVGSVGKWCNFLWKKYEKVVRGQKEIITSIKIGTYIAVK  287

Query  926   DLDTIKVLADRLELEIESLLNTTSFAIN-EAAVKVGIEEIRKKLDLFMKNVEDLGVQADN  1102
             D++ I+VL  +LE+EIES L    FA+N E  VK+ I+EI+KKLD+F + +E+LG QA  
Sbjct  288   DMENIRVLVHKLEVEIESFLKKAEFAVNEEEVVKLAIDEIKKKLDVFTETIEELGHQASK  347

Query  1103  CSRDIRRARTVILQRIIKHPNH  1168
                D+ +ARTVILQRIIK+P  
Sbjct  348   YCSDVTKARTVILQRIIKYPTR  369



>ref|XP_010432428.1| PREDICTED: UPF0496 protein At4g34320-like [Camelina sativa]
 ref|XP_010432429.1| PREDICTED: UPF0496 protein At4g34320-like [Camelina sativa]
Length=378

 Score =   367 bits (943),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 204/372 (55%), Positives = 262/372 (70%), Gaps = 17/372 (5%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEV  235
             MG   SK S +TS  +  R   + +YEAAC+ D ++Q+FD+ + ART+HVISTLA  VEV
Sbjct  1     MGNRTSKNSMKTSAKVYTRE--LRAYEAACKEDTEIQSFDTRMHARTSHVISTLAKDVEV  58

Query  236   RALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAAL  415
             RALSFDSLKEVT  LL+MN+EVVKVIL+CKKDIW++ E+FELVE+YFE SLK+ +F  AL
Sbjct  59    RALSFDSLKEVTQFLLEMNQEVVKVILDCKKDIWKDKEMFELVEDYFETSLKTHEFYDAL  118

Query  416   DKCLKRARESQLLIHLALKEFEEES---GGIDGSNNKYERTLEELKGFRASGNPFTEEFF  586
                L+R R +  LI   L++FEEES   GG     N Y++TLE+LK F  + NPF + FF
Sbjct  119   ADSLQRVRSNHHLILGVLRQFEEESLVQGG-----NGYKKTLEKLKNFEDAQNPFGQNFF  173

Query  587   QIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaia  766
              +FQSVY QQ LMLEKLQ R+ K DKKL++       SS++F AT A VLIC     A A
Sbjct  174   NMFQSVYTQQMLMLEKLQLRRKKSDKKLKH-----NCSSIVFVATYATVLIC--SVVAAA  226

Query  767   spavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKV  946
               A   A A A  +P+G+MGKWID L KNYE A+KGHK++ISSMQ GTY+ +KDLD I++
Sbjct  227   ISAPPVAPALAVPVPLGTMGKWIDLLWKNYEKALKGHKDVISSMQPGTYVAVKDLDDIRL  286

Query  947   LADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRA  1126
             L   L++EI S+  +  +A+   AV +G+  I+K L++F  N+E+L  Q D CSRDIRRA
Sbjct  287   LIQELDIEIRSIKKSDKYAVELKAVMIGVNAIKKILEVFENNIEELETQVDLCSRDIRRA  346

Query  1127  RTVILQRIIKHP  1162
             RTVILQRII HP
Sbjct  347   RTVILQRIINHP  358



>gb|KHG15186.1| hypothetical protein F383_03556 [Gossypium arboreum]
Length=431

 Score =   369 bits (947),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 214/385 (56%), Positives = 279/385 (72%), Gaps = 4/385 (1%)
 Frame = +2

Query  29    AFVFGCVKIMGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVI  208
              F F   K  GG + + S +  +D    +DL SSYEAAC  D+ LQ FD+TL  RTN VI
Sbjct  42    TFHFKFSKTKGG-VVEVSSQGRSDSGIESDL-SSYEAACRNDSTLQQFDATLHQRTNDVI  99

Query  209   STLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSL  388
              TLA  + V+ALSFDSLKEVTGC+ + N+EVVK+ILEC++DIW N +LF LVEEYF+N+ 
Sbjct  100   GTLAANMGVQALSFDSLKEVTGCVFETNQEVVKIILECQRDIWNNPDLFSLVEEYFDNTK  159

Query  389   KSLDFCAALDKCLKRARESQLLIHLALKEFEEESG-GIDGSNNKYERTLEELKGFRASGN  565
             K+L+FC AL  CLKRAR +QL+I LA+K FEEE G  +     K+ +TLEEL+ F+A+  
Sbjct  160   KTLEFCTALQNCLKRARNNQLIIQLAVKNFEEEVGLQVGDDERKFVKTLEELRKFKAAEE  219

Query  566   PFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICs  745
             PFT+EFF +F SV  QQ LML KL SRK KLDKK+  +  WR+VS+V+F AT  +VLI S
Sbjct  220   PFTKEFFILFDSVRRQQELMLRKLVSRKRKLDKKMESLKTWRRVSNVLFVATFVSVLIFS  279

Query  746   vvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIK  925
             VV AAIA+P V  ALA A A+PIGS+GKW + L K YE+ ++G KE+I  M++G+ ITI 
Sbjct  280   VVAAAIAAPPVVTALAGAMAVPIGSVGKWCNWLWKRYENELQGQKELIIGMEIGSCITIY  339

Query  926   DLDTIKVLADRLELEIESLLNTTSFAINEA-AVKVGIEEIRKKLDLFMKNVEDLGVQADN  1102
             D++ IKVL  RLE+E+ESLL+   FA+ E  AVK+ I EI+ KL+ FMK +E+LG QA+N
Sbjct  340   DMENIKVLISRLEIEMESLLHNADFAVREEDAVKLAINEIKGKLEAFMKTIEELGRQAEN  399

Query  1103  CSRDIRRARTVILQRIIKHPNH*GT  1177
             CSRDIR ARTV+LQ+++K   +  T
Sbjct  400   CSRDIRMARTVVLQKMMKRSGNSST  424



>ref|XP_004300596.1| PREDICTED: UPF0496 protein At2g18630-like isoform 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_004300597.1| PREDICTED: UPF0496 protein At2g18630-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=384

 Score =   366 bits (940),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 214/351 (61%), Positives = 271/351 (77%), Gaps = 4/351 (1%)
 Frame = +2

Query  113   TDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMN  292
             T  +SSYEAAC+LD+ LQ+FD ++Q RT+ V ++L+ GVEVR+LS DSLKEVT CLL+MN
Sbjct  36    TSHLSSYEAACKLDSGLQSFDVSVQQRTSRVFNSLSTGVEVRSLSLDSLKEVTDCLLEMN  95

Query  293   KEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALK  472
              EVVKVILECKKDIW N E+F LVEEYFENSL++LDFC AL++CLKRA  +QL+I  A++
Sbjct  96    HEVVKVILECKKDIWNNQEMFSLVEEYFENSLQTLDFCTALERCLKRAVNNQLIIQAAVR  155

Query  473   EFEEE-SGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRK  649
              FEEE   G DG      RTL+EL+ F+A+G+PFTEEFF +FQ+VY QQA ML+KLQ RK
Sbjct  156   RFEEEVEAGFDGKG--CVRTLQELRAFKAAGDPFTEEFFVLFQAVYNQQASMLQKLQVRK  213

Query  650   NKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGK  829
              KLDKKL+ + AWRKVS+V+F AT  +VLI SVV AAIA+P +  ALA A A+PIGS+GK
Sbjct  214   RKLDKKLKSVKAWRKVSNVIFVATFVSVLIFSVVAAAIAAPPLVTALAGALAVPIGSVGK  273

Query  830   WIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAIN  1009
             W + L   YE A+KG +EIISSMQVG+ IT+ DL+ I+VL  +LE+EIE+LL    FAI 
Sbjct  274   WCNMLWSRYERALKGQREIISSMQVGSMITMTDLNNIRVLVGKLEIEIEALLQNADFAIR  333

Query  1010  EA-AVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKH  1159
             E  AVK+ + EI KKL+ FM+ +E L   AD C  +IR+ARTVIL+RII +
Sbjct  334   EEDAVKIVMIEINKKLETFMETIESLSQNADKCGHNIRKARTVILRRIINN  384



>gb|EEC66800.1| hypothetical protein OsI_33205 [Oryza sativa Indica Group]
Length=383

 Score =   362 bits (928),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 202/349 (58%), Positives = 271/349 (78%), Gaps = 3/349 (1%)
 Frame = +2

Query  128   SYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVK  307
             SYEAAC  D +L TFD+ L+ R +  I+ +A GVEVR+LS  SL+EVTGCLLDMN+EVV+
Sbjct  35    SYEAACSADPELGTFDTALRRRASRAITAVASGVEVRSLSLGSLREVTGCLLDMNQEVVR  94

Query  308   VILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEE  487
             V+L CK+D+WR+ +LF+LVE+YFE SL +LDF AALDK L RAR+SQL++HLA++    E
Sbjct  95    VVLACKRDVWRSPDLFDLVEDYFEGSLHTLDFLAALDKSLHRARDSQLVLHLAVQRHHHE  154

Query  488   SGGIDGSNNK--YERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLD  661
                   ++    Y  TL EL+ F+A+G PFT+EFF  FQ+VY QQ  M+ KL+ RK +LD
Sbjct  155   PPAAAAASASELYASTLGELRQFKAAGEPFTDEFFAAFQTVYRQQMSMVGKLRRRKRRLD  214

Query  662   KKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDS  841
             ++LR +  WR+VS ++F    AA+L+CSVV AAIA+P VA ALA A ++P+GS GKW+DS
Sbjct  215   RRLRSVRVWRRVSGIVFLTAFAALLVCSVVAAAIAAPPVAAALAPAASMPVGSAGKWMDS  274

Query  842   LLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFA-INEAA  1018
             LLK Y+DA+ GHKE++S+MQVGT+I IKDLD+I+VL + LE++I S+ ++  FA  +E A
Sbjct  275   LLKKYQDALHGHKEVVSAMQVGTFIAIKDLDSIRVLVEHLEVQISSMADSVEFAERDEEA  334

Query  1019  VKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
             V+ GI+E++KKL+LFMK+V+DLG QAD CS DIRRARTV+LQRII HPN
Sbjct  335   VRFGIDEVKKKLELFMKSVDDLGEQADRCSHDIRRARTVVLQRIIHHPN  383



>ref|NP_195159.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9SYZ8.1|U496B_ARATH RecName: Full=UPF0496 protein At4g34330 [Arabidopsis thaliana]
 emb|CAB36710.1| putative protein [Arabidopsis thaliana]
 emb|CAB80150.1| putative protein [Arabidopsis thaliana]
 gb|AEE86360.1| uncharacterized protein AT4G34330 [Arabidopsis thaliana]
Length=354

 Score =   361 bits (926),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 199/366 (54%), Positives = 256/366 (70%), Gaps = 18/366 (5%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEV  235
             MG   S+KS E S   +  T  + SYEAAC+ D ++Q+FD+ +QART+HVISTLA GVEV
Sbjct  1     MGNKTSRKSKEKSG--RNYTTELRSYEAACKEDMEIQSFDTRMQARTSHVISTLATGVEV  58

Query  236   RALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAAL  415
             R+LSFDSLK V G LLDMN+EV KVIL+CKKDIW+N E+FE VE YFE SLK+LDF  AL
Sbjct  59    RSLSFDSLKAVIGSLLDMNQEVAKVILDCKKDIWKNQEMFEFVEAYFETSLKTLDFFNAL  118

Query  416   DKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIF  595
              + L+  + + L I             +DG  N Y++TL+ELK F+ +  PF ++FF++F
Sbjct  119   KRGLQGVQINHLFI-------------LDG--NGYKKTLQELKRFKDADRPFDQDFFKMF  163

Query  596   QSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspa  775
             QSVY QQ  ML+KLQ R+NKLDKKL+ I  WRK+SS++F AT A ++IC  V AA  +  
Sbjct  164   QSVYNQQKWMLDKLQRRQNKLDKKLKRIRTWRKLSSIIFMATFATLVIC-SVLAATMAAP  222

Query  776   vagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLAD  955
                A  AA   P+GSMGKWIDSL KNYE+ IKG  E+ SSM VGTY+ ++DL+ IK L  
Sbjct  223   HVAAALAAATPPVGSMGKWIDSLWKNYENEIKGQTEVFSSMYVGTYVAVQDLNNIKDLIK  282

Query  956   RLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTV  1135
             RL+ EI  ++    +A     VK+GI  I+ +L++F KNVE+L +QAD CS DIRRARTV
Sbjct  283   RLDTEIRGMVKNAEYAGELGPVKIGINAIKTQLEVFKKNVEELEIQADMCSTDIRRARTV  342

Query  1136  ILQRII  1153
             ILQRII
Sbjct  343   ILQRII  348



>ref|XP_002525095.1| AT14A, putative [Ricinus communis]
 gb|EEF37222.1| AT14A, putative [Ricinus communis]
Length=390

 Score =   360 bits (924),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 220/391 (56%), Positives = 289/391 (74%), Gaps = 20/391 (5%)
 Frame = +2

Query  53    IMGGHMSKKSG--------------ETSNDLQCRTDLISSYEAACELDADLQTFDSTLQA  190
             +MGG  SKK G              + +++ Q   DL +SYE AC LD DLQ FD+TL  
Sbjct  1     MMGGQFSKKKGVANPTPPPPPPPPLKINSNSQYTADL-TSYEDACMLDPDLQAFDTTLHE  59

Query  191   RTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEE  370
             RTN V+++L+ GVEVR+LSF+SLKEVT CLLDMN++VV VIL+CK+DIW N EL  LV+E
Sbjct  60    RTNRVLNSLSTGVEVRSLSFNSLKEVTNCLLDMNQDVVNVILQCKEDIWDNKELSALVKE  119

Query  371   YFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDG-SNNKYERTLEELKG  547
             YFE+S K+LDFCAAL+ CLKRAR SQL+I +AL+ FEEE    DG    KY +TLEEL+ 
Sbjct  120   YFESSAKTLDFCAALESCLKRARNSQLIIQVALRRFEEEVALHDGVVETKYVKTLEELRN  179

Query  548   FRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLA  727
             F+A+G+PFT+EF+ +FQSVY QQ  ML+KLQ RK KLDKK++ +  WR+VS+V+F +   
Sbjct  180   FKAAGDPFTDEFYILFQSVYRQQVSMLQKLQLRKKKLDKKMKSMKTWRRVSNVLFVSAFV  239

Query  728   AVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVG  907
             +VLI SVV AAIA+P V  ALA A A+PIGS+GKW +SL   Y  A+KG KE++SSMQVG
Sbjct  240   SVLIFSVVAAAIAAPPVVTALAGALAVPIGSVGKWCNSLWNGYMKALKGQKELVSSMQVG  299

Query  908   TYITIKDLDTIKVLADRLELEIESLLNTTSFA-INEAA---VKVGIEEIRKKLDLFMKNV  1075
             T+I I+D+D I++L ++LE EI++LL   + A INE A   VK+ I++I+KKL+ FM+ +
Sbjct  300   TFIVIQDMDNIRILVNKLEAEIDALLQNVNIALINEDAFEIVKIVIDDIKKKLEEFMQTI  359

Query  1076  EDLGVQADNCSRDIRRARTVILQRIIKHPNH  1168
             EDLG  A  CS DI +ARTVILQRII++P+ 
Sbjct  360   EDLGEHASKCSHDITQARTVILQRIIRYPDR  390



>gb|KHN00564.1| UPF0496 protein [Glycine soja]
Length=376

 Score =   359 bits (922),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 213/378 (56%), Positives = 282/378 (75%), Gaps = 10/378 (3%)
 Frame = +2

Query  56    MGGHMSKK-SGETSNDLQCRTDLI-----SSYEAACELDADLQTFDSTLQARTNHVISTL  217
             MGG  SK  S E+   ++  T  +     SSYEAAC  D +LQ+FD ++Q  TN VIS+L
Sbjct  1     MGGQSSKMVSVESPTPIKMGTHSLYAADLSSYEAACVKDPNLQSFDVSIQEHTNRVISSL  60

Query  218   AVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSL  397
             A GVEVR+LSFDSL+E+T  LL+MN+EVVKVIL+CKKDIW N ELF LV +YF+NSL +L
Sbjct  61    AHGVEVRSLSFDSLREMTDSLLEMNQEVVKVILDCKKDIWGNSELFSLVNDYFDNSLHTL  120

Query  398   DFCAALDKCLKRARESQLLIHLALKEFEEE-SGGIDGSNNKYERTLEELKGFRASGNPFT  574
             +FC +L+KCL++ARE+Q+++   +  FEEE   G +G    Y +TL+ELK F+ +G+PFT
Sbjct  121   EFCNSLEKCLRQARENQMIVKSVVTYFEEEVQNGAEGVT--YVKTLQELKKFKDAGDPFT  178

Query  575   EEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvt  754
             EEF+ +FQSVY QQA ML+KLQ RK KLDKKL+ +  WR+VS+ +F A   +VLI SVV 
Sbjct  179   EEFYLLFQSVYTQQASMLQKLQIRKRKLDKKLKSLKTWRRVSNAIFVAAFVSVLIFSVVA  238

Query  755   aaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLD  934
             A+IA+P V  ALAAA A+PIGS+GKW +SL K YE A+KG +E++SSMQ+GTYI++KDLD
Sbjct  239   ASIAAPPVVTALAAALAVPIGSVGKWCNSLFKRYEKALKGQREVVSSMQIGTYISLKDLD  298

Query  935   TIKVLADRLELEIESLLNTTSFAI-NEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSR  1111
              I+VL ++LEL +ESLL    FAI NE  +K  I+EI+KK++ F + +E L   AD CSR
Sbjct  299   NIRVLINKLELVLESLLQNADFAIKNEDVMKFAIDEIKKKIETFSETMESLSAHADKCSR  358

Query  1112  DIRRARTVILQRIIKHPN  1165
              IRRARTV++Q IIK P+
Sbjct  359   QIRRARTVVIQNIIKKPD  376



>ref|XP_010680903.1| PREDICTED: UPF0496 protein 1-like [Beta vulgaris subsp. vulgaris]
Length=387

 Score =   358 bits (919),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 200/356 (56%), Positives = 271/356 (76%), Gaps = 8/356 (2%)
 Frame = +2

Query  122   ISSYEAACELDADLQTFDSTLQARTNHVISTLA-----VGVEVRALSFDSLKEVTGCLLD  286
             +SSY  AC+LD D+Q FDS L  RT H+I++L       G EV ++S DSLK+V GCL+D
Sbjct  30    LSSYLQACQLDPDVQVFDSHLHERTTHIINSLTNNEGDEGFEVHSVSLDSLKQVAGCLID  89

Query  287   MNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLA  466
             MN+EVV+VILECKKD+W N ELF LV++YFE S+++LDF  ALDKCLKR R+ QL+I +A
Sbjct  90    MNQEVVRVILECKKDVWNNQELFGLVQDYFEYSVQTLDFFTALDKCLKRVRDRQLIIQVA  149

Query  467   LKEFEEESGGID--GSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQ  640
             L +FEEE G +      N+Y + L+ELK F+ +G+PFTEEF  +FQSVY QQ +M EKLQ
Sbjct  150   LLQFEEEIGNVGNVSGQNRYGKILKELKNFKEAGDPFTEEFLTMFQSVYKQQVVMFEKLQ  209

Query  641   SRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigs  820
              RK+KLDKKL+ +  +RKVS+++FAAT  AV+ICSVV AAI++P +  A+AAA + P+G 
Sbjct  210   LRKHKLDKKLKSLKIYRKVSNIIFAATFVAVIICSVVAAAISAPPMVSAIAAAASAPMGG  269

Query  821   MGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSF  1000
             +G+W++SL K YE  +K  +E+I+SMQVGTYI IKDLD+I+VL D+L++++ESLL    F
Sbjct  270   IGRWMNSLWKKYESELKTQRELINSMQVGTYIAIKDLDSIRVLVDKLDIQVESLLANAEF  329

Query  1001  AIN-EAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
             A++ E AV   IEEI+KK   F++ +++LG   +  SRD+RRARTVILQRIIKHP+
Sbjct  330   ALSQEGAVVTVIEEIKKKQTEFLEAIDELGEHGNKYSRDVRRARTVILQRIIKHPS  385



>ref|XP_009386739.1| PREDICTED: UPF0496 protein 1-like [Musa acuminata subsp. malaccensis]
Length=414

 Score =   359 bits (921),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 212/376 (56%), Positives = 282/376 (75%), Gaps = 8/376 (2%)
 Frame = +2

Query  59    GGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVR  238
             G   S  +G   + +Q   +L +SYEAAC LD +L++FD+TLQ RT+H ISTLA+GVE+R
Sbjct  39    GSSTSGDTGAGQSGIQYTAEL-TSYEAACRLDPELRSFDATLQQRTSHAISTLALGVELR  97

Query  239   ALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALD  418
              LSFD+L+EVTGCLL+ NKEVVK ILEC+KDIW++ EL  LV++YFE S+++LD+C  L+
Sbjct  98    CLSFDTLREVTGCLLETNKEVVKAILECRKDIWKSPELLSLVDDYFECSIQTLDYCTELE  157

Query  419   KCLKRARESQLLIHLALKEFEEESG------GIDGSNNKYERTLEELKGFRASGNPFTEE  580
             KCLK+AR+S L+I  A++ FEEE          +    +Y  TLE+L+ F+A+G+PFTEE
Sbjct  158   KCLKKARDSHLIIQFAIQRFEEEDKEKNEVVTEEDGKTRYTMTLEKLRHFKAAGSPFTEE  217

Query  581   FFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaa  760
             F ++ +SVY  Q LMLEKL  RK KLD K++ I+ WR+VS++ F A L AV+ICSVV A+
Sbjct  218   FARVLKSVYEHQKLMLEKLLLRKKKLDDKMKSINTWRRVSNITFVAALVAVIICSVVAAS  277

Query  761   iaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTI  940
             IA+P VA ALAAATAIPIGSMGKW++SLLKN ++A     E+++SMQ GT+I +KDLDTI
Sbjct  278   IAAPPVAAALAAATAIPIGSMGKWVNSLLKNCQNAFGRETELLTSMQFGTFIALKDLDTI  337

Query  941   KVLADRLELEIESLLNTTSFAI-NEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDI  1117
             +VL D+LE+   SLL    FA  +E AVK  IEEI+K L++FMKN+EDLGVQ D CSRD 
Sbjct  338   RVLVDKLEIHFNSLLENADFAFRDEEAVKFAIEEIKKNLEVFMKNIEDLGVQVDRCSRDT  397

Query  1118  RRARTVILQRIIKHPN  1165
              +AR V+++ IIKHP 
Sbjct  398   SKARMVVVRTIIKHPG  413



>ref|XP_003611921.1| hypothetical protein MTR_5g019430 [Medicago truncatula]
 gb|AES94879.1| UPF0496 plant-like protein [Medicago truncatula]
Length=380

 Score =   357 bits (916),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 198/350 (57%), Positives = 271/350 (77%), Gaps = 6/350 (2%)
 Frame = +2

Query  122   ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEV  301
             +SSYEAAC  D +LQ+FD+T+Q RTN VI++LA G+EVR++S +SL EVTG LLDMN+EV
Sbjct  31    LSSYEAACVNDPNLQSFDATIQERTNRVINSLAQGIEVRSISLESLGEVTGSLLDMNQEV  90

Query  302   VKVILECKKDIW--RNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKE  475
             VKVILECK+DIW  ++ +LF LVE++FENSL++L+FC AL+KCLKRARE  +++  A+  
Sbjct  91    VKVILECKQDIWNKKDRDLFSLVEDFFENSLQTLEFCNALEKCLKRAREKLVVVKSAMTC  150

Query  476   FEEE-SGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKN  652
             F+EE   G++GS   Y +TL+ LK F+ + +PFTEEF+ +FQSVY QQ+ ML+KL  RK 
Sbjct  151   FDEEVQNGVEGST--YVKTLKGLKDFKETEDPFTEEFYSLFQSVYTQQSSMLKKLLIRKQ  208

Query  653   KLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKW  832
              LDKKL+     ++VSSV+F A   AVLI SVV AAI++P V  ALA A A+PIGS+GKW
Sbjct  209   NLDKKLKSHKTLKRVSSVIFVAAFVAVLIFSVVAAAISAPPVVTALAGALAVPIGSVGKW  268

Query  833   IDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAI-N  1009
              +SL K YE A+KG +E+ISSM VGTYI + D++ I+V  ++LE++IES++ T  FA+ N
Sbjct  269   CNSLFKKYETALKGQREVISSMHVGTYIALVDMNNIRVRINQLEIKIESMVQTADFALGN  328

Query  1010  EAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKH  1159
             E AVK+ I+EI+KK++ F + +E L VQAD CSR  R+ARTV++Q+IIK+
Sbjct  329   EDAVKLAIDEIKKKIETFAEIIESLSVQADQCSRQTRKARTVVVQKIIKY  378



>ref|NP_179453.2| uncharacterized protein [Arabidopsis thaliana]
 sp|Q56XQ0.3|U496I_ARATH RecName: Full=UPF0496 protein At2g18630 [Arabidopsis thaliana]
 dbj|BAD95236.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC06787.1| uncharacterized protein AT2G18630 [Arabidopsis thaliana]
Length=393

 Score =   357 bits (917),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 197/381 (52%), Positives = 272/381 (71%), Gaps = 13/381 (3%)
 Frame = +2

Query  53    IMGGHMSKKS-----GETSNDLQCR-----TDLISSYEAACELDADLQTFDSTLQARTNH  202
             +MGG  SK       G  S  +Q +     T+ +SSYE AC  D  L++FDS L  RTN 
Sbjct  1     MMGGKSSKSKKNVEFGSPSTPVQIKINSEYTEHLSSYERACSEDPKLESFDSALHERTNR  60

Query  203   VISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFEN  382
             VI+ LA GVE+++LSFDSL+EVT CLLDMN++VVKVIL+ K+DIW N +LF LV  YFE+
Sbjct  61    VINKLASGVEIKSLSFDSLREVTQCLLDMNQDVVKVILQDKEDIWNNQDLFSLVNLYFES  120

Query  383   SLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASG  562
             + K++DFC+ L+ CL RAR SQ++I  A+ +FEEE+   D  N KYE+TLEELK F+ +G
Sbjct  121   TAKTMDFCSELENCLNRARRSQVIIQFAVNQFEEENE--DKENRKYEKTLEELKRFKVAG  178

Query  563   NPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLIC  742
              PFT+EFF +F  VY QQ +MLE+L   K KLDK+LR I  WR+VS+++F     +VLI 
Sbjct  179   EPFTKEFFALFDLVYKQQVMMLEELHKLKRKLDKRLRNIKTWRRVSNMVFVTAFVSVLIF  238

Query  743   svvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITI  922
             SVV AA+A+P V  A+A A A+P+GS+GKW ++L   YE  ++G KEII+S+++GTYI++
Sbjct  239   SVVAAAVAAPPVVAAIAGALAVPVGSVGKWCNTLWTKYEKVVRGQKEIITSIRIGTYISV  298

Query  923   KDLDTIKVLADRLELEIESLLNTTSFAIN-EAAVKVGIEEIRKKLDLFMKNVEDLGVQAD  1099
             K++D I +L  ++E+EIESLL    FAI  E  V++ I+EI+KKLD+F + +E+LG  A 
Sbjct  299   KEMDNISILVRKVEVEIESLLKKAEFAITEEKEVRLAIDEIKKKLDVFTETIEELGEHAG  358

Query  1100  NCSRDIRRARTVILQRIIKHP  1162
                 D+ +ARTVILQRII++P
Sbjct  359   KYCSDVTKARTVILQRIIRYP  379



>ref|XP_006296613.1| hypothetical protein CARUB_v10013876mg [Capsella rubella]
 gb|EOA29511.1| hypothetical protein CARUB_v10013876mg [Capsella rubella]
Length=399

 Score =   357 bits (917),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 200/385 (52%), Positives = 272/385 (71%), Gaps = 16/385 (4%)
 Frame = +2

Query  53    IMGGHMSKKS-----GETSNDLQCR-----TDLISSYEAACELDADLQTFDSTLQARTNH  202
             +MGG  SK       G  S  +Q +     T+ +SSYE AC  D  L++FDS L  RTN 
Sbjct  1     MMGGKSSKHKKDVEFGSPSTPVQIKINSEYTEHLSSYERACSEDPKLESFDSALHERTNR  60

Query  203   VISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFEN  382
             VI+ LA GVE+++LSFDSL+EVT CLLDMN++VVKVIL+ K+DIW NH+LF LV  YFE+
Sbjct  61    VINKLASGVEIKSLSFDSLREVTQCLLDMNQDVVKVILQDKEDIWNNHDLFSLVNLYFES  120

Query  383   SLKSLDFCAALDKCLKRARESQLLIHLALKEFEEES----GGIDGSNNKYERTLEELKGF  550
             +LK++DFC+ L+ CL RAR SQ++I  A+K+FEEES     G D  N KYE+TLEELK F
Sbjct  121   TLKTMDFCSELENCLNRARRSQVVIQFAVKQFEEESEIPVNG-DNENRKYEKTLEELKKF  179

Query  551   RASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAA  730
                G PFT+ FF +F  VY +Q LMLE+L   K KLDK+L  I  WR+VS+++F     +
Sbjct  180   TDLGEPFTKRFFALFDLVYKKQVLMLEELHKLKRKLDKRLGNIKTWRRVSNMVFVTAFVS  239

Query  731   VLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGT  910
             VLI SVV AA+A+P V  A+A A A+P+GS+GKW ++L   YE  ++G KEII+S+++GT
Sbjct  240   VLIFSVVAAAVAAPPVVAAIAGALAVPVGSVGKWCNTLWTKYEKVVRGQKEIITSIRIGT  299

Query  911   YITIKDLDTIKVLADRLELEIESLLNTTSFAIN-EAAVKVGIEEIRKKLDLFMKNVEDLG  1087
             YI++K++D I +L  ++E+EIESLL    FA+  E  V++ I+EI+KKLD+F   +E+LG
Sbjct  300   YISVKEMDNISILVRKVEVEIESLLKKAEFAVTEEKVVRIAIDEIKKKLDVFTDTIEELG  359

Query  1088  VQADNCSRDIRRARTVILQRIIKHP  1162
               AD    D+ +ARTVILQRII++P
Sbjct  360   KHADKYCSDVTKARTVILQRIIRYP  384



>gb|AAD08932.1| At14a, putative [Arabidopsis thaliana]
 gb|AAM15135.1| At14a, putative [Arabidopsis thaliana]
Length=392

 Score =   357 bits (915),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 197/380 (52%), Positives = 271/380 (71%), Gaps = 13/380 (3%)
 Frame = +2

Query  56    MGGHMSKKS-----GETSNDLQCR-----TDLISSYEAACELDADLQTFDSTLQARTNHV  205
             MGG  SK       G  S  +Q +     T+ +SSYE AC  D  L++FDS L  RTN V
Sbjct  1     MGGKSSKSKKNVEFGSPSTPVQIKINSEYTEHLSSYERACSEDPKLESFDSALHERTNRV  60

Query  206   ISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENS  385
             I+ LA GVE+++LSFDSL+EVT CLLDMN++VVKVIL+ K+DIW N +LF LV  YFE++
Sbjct  61    INKLASGVEIKSLSFDSLREVTQCLLDMNQDVVKVILQDKEDIWNNQDLFSLVNLYFEST  120

Query  386   LKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGN  565
              K++DFC+ L+ CL RAR SQ++I  A+ +FEEE+   D  N KYE+TLEELK F+ +G 
Sbjct  121   AKTMDFCSELENCLNRARRSQVIIQFAVNQFEEENE--DKENRKYEKTLEELKRFKVAGE  178

Query  566   PFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICs  745
             PFT+EFF +F  VY QQ +MLE+L   K KLDK+LR I  WR+VS+++F     +VLI S
Sbjct  179   PFTKEFFALFDLVYKQQVMMLEELHKLKRKLDKRLRNIKTWRRVSNMVFVTAFVSVLIFS  238

Query  746   vvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIK  925
             VV AA+A+P V  A+A A A+P+GS+GKW ++L   YE  ++G KEII+S+++GTYI++K
Sbjct  239   VVAAAVAAPPVVAAIAGALAVPVGSVGKWCNTLWTKYEKVVRGQKEIITSIRIGTYISVK  298

Query  926   DLDTIKVLADRLELEIESLLNTTSFAIN-EAAVKVGIEEIRKKLDLFMKNVEDLGVQADN  1102
             ++D I +L  ++E+EIESLL    FAI  E  V++ I+EI+KKLD+F + +E+LG  A  
Sbjct  299   EMDNISILVRKVEVEIESLLKKAEFAITEEKEVRLAIDEIKKKLDVFTETIEELGEHAGK  358

Query  1103  CSRDIRRARTVILQRIIKHP  1162
                D+ +ARTVILQRII++P
Sbjct  359   YCSDVTKARTVILQRIIRYP  378



>ref|XP_007047030.1| Uncharacterized protein TCM_000456 [Theobroma cacao]
 gb|EOX91187.1| Uncharacterized protein TCM_000456 [Theobroma cacao]
Length=390

 Score =   356 bits (914),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 207/379 (55%), Positives = 275/379 (73%), Gaps = 12/379 (3%)
 Frame = +2

Query  53    IMGGHMSK-KSGETSNDLQCRTDL-----ISSYEAACELDADLQTFDSTLQARTNHVIST  214
             +MG   SK K G+     Q +TD      +SSYEAAC  D  LQ FD+TL  RTNHVIST
Sbjct  1     MMGCQSSKTKGGDPEPSSQVKTDSKLEADLSSYEAACRHDPALQHFDATLHERTNHVIST  60

Query  215   LAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKS  394
             LA G+ V ++SFDSLKEVTGCLL+ N+EV K+ILE +KDIW N ELF LVEEYF+NS K+
Sbjct  61    LAAGLGVSSISFDSLKEVTGCLLETNQEVAKIILESQKDIWDNPELFSLVEEYFDNSKKT  120

Query  395   LDFCAALDKCLKRARESQLLIHLALKEFEEE---SGGIDGSNNKYERTLEELKGFRASGN  565
             LDFC AL+ CL+RAR +QL+I LA+++FEEE     G DG   K+ +TLEEL+ F+A+  
Sbjct  121   LDFCTALENCLRRARNNQLIIQLAVRKFEEEVELQVGTDG--KKFVKTLEELRKFKAAEE  178

Query  566   PFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICs  745
             PF++EFF +F SV  QQ  ML KL  RK K+DKKL+ +  WR+VS+V+F AT  +VLI S
Sbjct  179   PFSKEFFLLFDSVRRQQESMLGKLLVRKRKIDKKLKSLKTWRRVSNVLFVATFVSVLIFS  238

Query  746   vvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIK  925
             VV AA+A+P V  ALA A A+PIGS+GKW + L K YE+ +KG +E+I+++++G  ITI 
Sbjct  239   VVAAAVAAPPVVTALAGALAVPIGSVGKWCNWLWKRYENELKGQRELITTVELGARITIG  298

Query  926   DLDTIKVLADRLELEIESLLNTTSFAINEA-AVKVGIEEIRKKLDLFMKNVEDLGVQADN  1102
             +LD I++L  RLE+EIESLL+   FA+ E  AVK+  +EI++K + +M+ +E LG QAD 
Sbjct  299   NLDNIRMLVGRLEIEIESLLHYADFALREEDAVKLAFDEIKRKSEEYMEIIEKLGRQADM  358

Query  1103  CSRDIRRARTVILQRIIKH  1159
             CSRDIR+AR V+LQ + + 
Sbjct  359   CSRDIRKARAVVLQTMTRQ  377



>ref|XP_010447098.1| PREDICTED: UPF0496 protein At4g34320-like [Camelina sativa]
Length=361

 Score =   355 bits (910),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 202/374 (54%), Positives = 260/374 (70%), Gaps = 17/374 (5%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEV  235
             MG   SK S +TS     R   + +YEAAC+ D ++Q+FD+ + ART+HVISTLA  VEV
Sbjct  1     MGNRTSKNSMKTSAKAYTRE--LRAYEAACKEDTEIQSFDTRMHARTSHVISTLAKDVEV  58

Query  236   RALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAAL  415
             RALSFDSLKEVT  LL+MN EVVKVIL+CKKDIW++ E+FEL ++YFE SLK+ +F  AL
Sbjct  59    RALSFDSLKEVTQFLLEMNLEVVKVILDCKKDIWKDKEMFELTKDYFETSLKTHEFYDAL  118

Query  416   DKCLKRARESQLLIHLALKEFEEES---GGIDGSNNKYERTLEELKGFRASGNPFTEEFF  586
                L+R R +  LI   L++FEEES   GG     N Y+ TLE+LK F    NPF ++FF
Sbjct  119   ADSLQRVRSNHHLILGVLRQFEEESLVQGG-----NGYKTTLEKLKNFEDVQNPFGQDFF  173

Query  587   QIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaia  766
              +FQSVY +Q LMLEKLQ R+ K DKKL++       SS++F AT A VLIC     A A
Sbjct  174   NMFQSVYTRQMLMLEKLQLRRKKSDKKLKH-----NCSSIIFVATYATVLIC--SVVAAA  226

Query  767   spavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKV  946
               A   A A A  +P+G+MGKWID L KNYE A+KGHK++ISSMQ GTY+ +KDLD I++
Sbjct  227   MSAPPVAPALAAPVPLGTMGKWIDLLWKNYEKALKGHKDVISSMQPGTYVAVKDLDDIRL  286

Query  947   LADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRA  1126
             L   L++EI S+  +  +A+   AV +G+  I+K L++F KN+E+L  Q D CSRDIRRA
Sbjct  287   LIQELDIEIRSIKKSDKYAVELKAVMIGVNAIKKILEVFEKNIEELETQVDLCSRDIRRA  346

Query  1127  RTVILQRIIKHPNH  1168
             RTVILQRII H N+
Sbjct  347   RTVILQRIINHLNN  360



>ref|XP_006573602.1| PREDICTED: UPF0496 protein At2g18630-like isoform X1 [Glycine 
max]
 ref|XP_006573603.1| PREDICTED: UPF0496 protein At2g18630-like isoform X2 [Glycine 
max]
Length=382

 Score =   355 bits (912),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 201/382 (53%), Positives = 279/382 (73%), Gaps = 13/382 (3%)
 Frame = +2

Query  53    IMGGHMSKKSGETSNDLQCRTDL-------ISSYEAACELDADLQTFDSTLQARTNHVIS  211
             +MGG  SK    +      +          ++SYEAAC  D +LQ+ D+T+Q RTN VI+
Sbjct  1     MMGGQSSKIPSNSGVPTPIKMGTHSLYAADLNSYEAACVEDPNLQSLDATIQERTNRVIT  60

Query  212   TLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIW--RNHELFELVEEYFENS  385
             +LA G+EVR++S +SL E+TG LL+MN++V KVILEC++DIW  ++ ELF LVE++FENS
Sbjct  61    SLANGIEVRSISIESLGEMTGSLLEMNQDVAKVILECQQDIWNKKDRELFSLVEDFFENS  120

Query  386   LKSLDFCAALDKCLKRARESQLLIHLALKEFEEE-SGGIDGSNNKYERTLEELKGFRASG  562
             L++L+FC ALDKCL RAR   +++  A+  FEEE   G++GS   Y +TL+ELKGF+ +G
Sbjct  121   LQTLNFCNALDKCLNRARGRHVIVKSAITCFEEEVQNGVEGST--YLKTLQELKGFKEAG  178

Query  563   NPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLIC  742
             +PFTEEF+ +FQSVY QQA ML+KL+ RK KLDKKL+     ++VS+ +F A   +VLI 
Sbjct  179   DPFTEEFYSLFQSVYQQQASMLKKLKIRKQKLDKKLKSFKTLKRVSNAIFVAAFVSVLIF  238

Query  743   svvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITI  922
             SVV AAIA+P V  ALA A A+PIGS+GKW +SL K YE A+KG +E+ISSMQVG+YIT+
Sbjct  239   SVVAAAIAAPPVVTALAGALAVPIGSVGKWCNSLFKRYETALKGQRELISSMQVGSYITL  298

Query  923   KDLDTIKVLADRLELEIESLLNTTSFAI-NEAAVKVGIEEIRKKLDLFMKNVEDLGVQAD  1099
              DL  I++  D+LE++IES+L ++ FA+ NE AVK  I+EI+K +D+F + +E L  QAD
Sbjct  299   VDLKNIRLRIDQLEIKIESMLQSSDFALRNEDAVKFAIDEIKKNIDIFAETIEALSKQAD  358

Query  1100  NCSRDIRRARTVILQRIIKHPN  1165
              CSR IR ARTV++++II + N
Sbjct  359   ECSRQIRMARTVVVKKIINYTN  380



>ref|XP_010489568.1| PREDICTED: UPF0496 protein At2g18630 [Camelina sativa]
Length=399

 Score =   354 bits (908),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 198/385 (51%), Positives = 274/385 (71%), Gaps = 16/385 (4%)
 Frame = +2

Query  53    IMGGHMSKKS-----GETSNDLQCR-----TDLISSYEAACELDADLQTFDSTLQARTNH  202
             +MGG  SK       G  S  +Q +     T+  SSYE AC  D  L++FDS L  RTN 
Sbjct  1     MMGGKGSKSKRDVEFGSPSTPVQIKINSEYTEHFSSYERACSEDPKLESFDSALHERTNR  60

Query  203   VISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFEN  382
             VI+ LA GVE+++LSFDSLKEVT CLLDMN++VVKVIL+ K+DIW N +LF LV  YF++
Sbjct  61    VINKLASGVEIKSLSFDSLKEVTQCLLDMNQDVVKVILQDKEDIWNNQDLFSLVNMYFDS  120

Query  383   SLKSLDFCAALDKCLKRARESQLLIHLALKEFEEES----GGIDGSNNKYERTLEELKGF  550
             +LK++DFC+ L+ CL RAR SQ++I  A+K+FEEE+     G D  N KYE+TLEELK F
Sbjct  121   TLKTMDFCSELENCLNRARRSQVVIQFAVKQFEEEAEIHVNG-DNENKKYEKTLEELKRF  179

Query  551   RASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAA  730
             +  G PFT++FF++F  VY +Q LML++L   K KLD++L  I +WR+VS+++F     +
Sbjct  180   KDLGEPFTKKFFELFDLVYKKQVLMLDELHKLKKKLDRRLGNIKSWRRVSNMVFVTAFVS  239

Query  731   VLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGT  910
             VLI SVV AA+A+P V  A+A A A+P+GS+GKW ++L   YE  +KG KEII+S+++GT
Sbjct  240   VLIFSVVAAAVAAPPVVAAIAGALAVPVGSLGKWCNTLWTKYEKVVKGQKEIITSIRIGT  299

Query  911   YITIKDLDTIKVLADRLELEIESLLNTTSFAIN-EAAVKVGIEEIRKKLDLFMKNVEDLG  1087
             +I++K++D I VL  ++E+EIESLL    FA+  E  VK+ I+EI+KKLD+F   +E+LG
Sbjct  300   FISVKEMDNISVLVRKVEVEIESLLKKAEFAVTEEKVVKIAIDEIKKKLDVFTDTIEELG  359

Query  1088  VQADNCSRDIRRARTVILQRIIKHP  1162
               AD    D+ +ARTVILQRII++P
Sbjct  360   KHADKYCSDVTKARTVILQRIIRYP  384



>ref|XP_010099360.1| hypothetical protein L484_009177 [Morus notabilis]
 gb|EXB77881.1| hypothetical protein L484_009177 [Morus notabilis]
Length=389

 Score =   353 bits (907),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 200/349 (57%), Positives = 266/349 (76%), Gaps = 1/349 (0%)
 Frame = +2

Query  122   ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEV  301
             +SSYEAAC  D  LQTFD+ L  RTN VI TLA GVEVR+LSF+SLKE+T CLL+MN+EV
Sbjct  40    LSSYEAACRSDPTLQTFDAILLERTNRVIGTLATGVEVRSLSFNSLKEITDCLLEMNQEV  99

Query  302   VKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFE  481
             VKVILE KKDIW N ++F LVE+YFENS+ +LDFC AL++CLKRA  +QL++  A+  F+
Sbjct  100   VKVILENKKDIWNNKDMFSLVEQYFENSILTLDFCTALERCLKRATGNQLVVRAAVNRFK  159

Query  482   EESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLD  661
             EE  G + +   +E+TL EL  F+A+G+PFT+EFF +FQSV  QQ +MLEKLQ+RK KLD
Sbjct  160   EELEGSEANGGTFEKTLHELAKFKAAGDPFTDEFFVLFQSVLNQQYVMLEKLQTRKRKLD  219

Query  662   KKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDS  841
             KKL+ +  WRKVS+V+F A   ++LI SVV AAIA+P V  AL  A A+PIGS+GKW +S
Sbjct  220   KKLKSVKTWRKVSNVIFVAAFVSLLIFSVVAAAIAAPPVVTALLGALAVPIGSVGKWCNS  279

Query  842   LLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINE-AA  1018
                 Y + ++G +EIISSMQVGTY+T+KDL++IK L ++LE+E+ESLL+   FA+ E  A
Sbjct  280   FWNRYGNTVRGQREIISSMQVGTYVTLKDLESIKALVNKLEIEVESLLHNAQFALMEDGA  339

Query  1019  VKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
             +K+ +EEI+KKL+ F +  E L  Q + C ++I  AR VI++RIIKHP+
Sbjct  340   LKIVMEEIKKKLEAFTETTESLSRQNEKCVQEITMARKVIIKRIIKHPS  388



>gb|EYU44304.1| hypothetical protein MIMGU_mgv1a007475mg [Erythranthe guttata]
Length=406

 Score =   354 bits (908),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 203/360 (56%), Positives = 272/360 (76%), Gaps = 7/360 (2%)
 Frame = +2

Query  122   ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEV  301
              SSYEAAC  D DL++FDS+LQ RT   I+++AVG+EVR+LS DSL +VT CLL+MN EV
Sbjct  48    FSSYEAACRADPDLRSFDSSLQLRTTRAINSIAVGLEVRSLSLDSLSDVTECLLEMNYEV  107

Query  302   VKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFE  481
             VK+IL+ K D+W+N EL ELV++YFENSL +LDFC ALD CLKRA   + +I++ALK+F 
Sbjct  108   VKIILQNKMDVWKNKELSELVDDYFENSLATLDFCTALDACLKRAGHIESIINVALKKFH  167

Query  482   EE--SGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNK  655
             EE  SGG D     Y RTL+ELK F+ +G+PFT EFF++F SVY +Q  MLEKLQ +K K
Sbjct  168   EEHNSGGGD---KDYSRTLDELKNFQTTGDPFTHEFFKVFNSVYSKQLSMLEKLQVKKRK  224

Query  656   LDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWI  835
             LD+K+  + AWRKVS+V+F    A+VLICSVV AA+++PAV  ALAAA A+P+GSMGKW+
Sbjct  225   LDRKMGKVSAWRKVSNVIFIVAFASVLICSVVAAAVSAPAVVTALAAAAAVPLGSMGKWL  284

Query  836   DSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFA--IN  1009
             +S+ KN E  ++G +EIISSMQ+G+YI IKDLD I+VL D+  +EIE+LL    FA   +
Sbjct  285   NSIWKNCERDLRGQREIISSMQIGSYIVIKDLDNIRVLVDKFRIEIEALLANAEFAGSGD  344

Query  1010  EAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPNH*GTRMGI  1189
             E AV V +EEI+KK+D F+K + DL   A+ C+++ R ART+IL++II HP+     +G+
Sbjct  345   EVAVVVAVEEIKKKVDSFVKTIHDLSKHANKCTQETRMARTLILRKIINHPSGSNQDIGM  404



>ref|XP_010414492.1| PREDICTED: UPF0496 protein At2g18630 [Camelina sativa]
Length=399

 Score =   353 bits (905),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 196/385 (51%), Positives = 275/385 (71%), Gaps = 16/385 (4%)
 Frame = +2

Query  53    IMGGHMSKKS-----GETSNDLQCR-----TDLISSYEAACELDADLQTFDSTLQARTNH  202
             +MGG  SK       G  S  +Q +     T+  SSYE AC  D +L++FDS L  RTN 
Sbjct  1     MMGGKGSKSKKDVEFGSPSTPVQIKINSEYTEHFSSYEKACSEDPNLESFDSALHERTNR  60

Query  203   VISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFEN  382
             VI+ LA GVE+++LSFDSLKEVT CLLDMN++VVKVIL+ K+DIW N +LF LV  YF++
Sbjct  61    VINKLASGVEIKSLSFDSLKEVTQCLLDMNQDVVKVILQDKEDIWNNQDLFSLVNMYFDS  120

Query  383   SLKSLDFCAALDKCLKRARESQLLIHLALKEFEEES----GGIDGSNNKYERTLEELKGF  550
             +LK++DFC+ L+ CL RAR SQ++I  A+K+FEEE+     G D  N KYE+TL+ELK F
Sbjct  121   TLKTMDFCSELENCLNRARRSQVVIQFAVKQFEEEAEIQVNG-DNENRKYEKTLDELKRF  179

Query  551   RASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAA  730
             +  G PFT++FF++F  VY +Q LML++L   K KLD++L  I +WR+VS+++F     +
Sbjct  180   KDLGEPFTKKFFELFDLVYKKQVLMLDELHKLKKKLDRRLGNIKSWRRVSNMVFVTAFVS  239

Query  731   VLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGT  910
             VLI SVV AA+A+P V  A+A A A+P+GS+GKW ++L   YE  +KG KEII+S+++GT
Sbjct  240   VLIFSVVAAAVAAPPVVAAIAGALAVPVGSLGKWCNTLWTKYEKVVKGQKEIITSIRIGT  299

Query  911   YITIKDLDTIKVLADRLELEIESLLNTTSFAINEA-AVKVGIEEIRKKLDLFMKNVEDLG  1087
             +I++K++D I VL  ++E+EIESLL    FA+ E   V++ I+EI+KKLD+F   +E+LG
Sbjct  300   FISVKEMDNISVLVRKVEVEIESLLKKAEFAVTEERVVRIAIDEIKKKLDVFTDTIEELG  359

Query  1088  VQADNCSRDIRRARTVILQRIIKHP  1162
               AD    D+ +ARTVILQRII++P
Sbjct  360   KHADKYCSDVTKARTVILQRIIRYP  384



>gb|KHN36151.1| UPF0496 protein [Glycine soja]
Length=382

 Score =   352 bits (903),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 199/382 (52%), Positives = 277/382 (73%), Gaps = 13/382 (3%)
 Frame = +2

Query  53    IMGGHMSKKSGETSNDLQCRTDL-------ISSYEAACELDADLQTFDSTLQARTNHVIS  211
             +MGG  SK    +      +          ++SYEAAC  D +LQ+ D+T+Q RTN VI+
Sbjct  1     MMGGQSSKIPSNSGVPTPIKMGTHSLYAADLNSYEAACVEDPNLQSLDATIQERTNRVIT  60

Query  212   TLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIW--RNHELFELVEEYFENS  385
             +LA G+EVR++S +SL E+TG LL+MN++V KVILEC++DIW  ++ ELF LVE++FENS
Sbjct  61    SLANGIEVRSISIESLGEMTGSLLEMNQDVAKVILECQQDIWNKKDRELFSLVEDFFENS  120

Query  386   LKSLDFCAALDKCLKRARESQLLIHLALKEFEEE-SGGIDGSNNKYERTLEELKGFRASG  562
             L++L+FC ALDKCL RAR   +++  A+  FEEE   G++GS   Y +TL+ELKGF+ +G
Sbjct  121   LQTLNFCNALDKCLNRARGRHVIVKSAITCFEEEVQNGVEGST--YLKTLQELKGFKEAG  178

Query  563   NPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLIC  742
             +PFTEEF+ +FQSVY QQA ML+KL+ RK KLDKKL+     ++VS+ +  A   +VLI 
Sbjct  179   DPFTEEFYSLFQSVYQQQASMLKKLKIRKQKLDKKLKSFKTLKRVSNAICVAAFVSVLIF  238

Query  743   svvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITI  922
             SVV AAIA+P    ALA A A+PIGS+GKW +SL K YE A+KG +E+ISSMQVG+YIT+
Sbjct  239   SVVAAAIAAPPGVTALAGALAVPIGSVGKWCNSLFKRYETALKGQRELISSMQVGSYITL  298

Query  923   KDLDTIKVLADRLELEIESLLNTTSFAI-NEAAVKVGIEEIRKKLDLFMKNVEDLGVQAD  1099
              DL  I++  D+LE++IES+L ++ FA+ NE AVK  I+EI+K +D+F + +E L  QAD
Sbjct  299   VDLKNIRLRIDQLEIKIESMLQSSDFALRNEDAVKFAIDEIKKNIDIFAETIEALSKQAD  358

Query  1100  NCSRDIRRARTVILQRIIKHPN  1165
              CSR IR ARTV++++II + N
Sbjct  359   ECSRQIRMARTVVVKKIINYTN  380



>ref|XP_009406021.1| PREDICTED: UPF0496 protein 1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009406022.1| PREDICTED: UPF0496 protein 1-like [Musa acuminata subsp. malaccensis]
Length=394

 Score =   352 bits (902),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 216/353 (61%), Positives = 275/353 (78%), Gaps = 6/353 (2%)
 Frame = +2

Query  122   ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEV  301
             +S YEAAC  D DL +FD+TLQ RT+H ISTLA+GVE+R+LSF++L EVTGCLLD NKEV
Sbjct  40    LSYYEAACREDPDLWSFDATLQRRTSHAISTLALGVELRSLSFNTLSEVTGCLLDTNKEV  99

Query  302   VKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFE  481
             V VILE KKDIW+N EL +L  +YFE S+++LD+C  L+KCLKRAR+S L+IH AL+ FE
Sbjct  100   VDVILESKKDIWKNPELLDLANDYFECSIQTLDYCTELEKCLKRARDSHLIIHFALQHFE  159

Query  482   EESGG-----IDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSR  646
              E+       I+    KY  TLE+L+ F+A+GNPFTEEF Q+FQSVY QQ LMLEKL  R
Sbjct  160   NENKDKGEMEIEDGKRKYAMTLEKLRHFKAAGNPFTEEFSQVFQSVYRQQQLMLEKLLLR  219

Query  647   KNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMG  826
             K KLDKKLR I+AWRKVS+++F + LAAV+ICSVV AA+A+P VA ALAAA  IPIGS G
Sbjct  220   KKKLDKKLRSINAWRKVSNIIFVSALAAVVICSVVAAAVAAPPVAAALAAACTIPIGSAG  279

Query  827   KWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAI  1006
             KWI+SLLKNY++A+   ++I+SSMQ GT I +KDLDTI+V+ D LE+   SL     FA+
Sbjct  280   KWINSLLKNYQNALGEERDILSSMQFGTCIALKDLDTIRVMVDNLEIHFNSLSEDADFAL  339

Query  1007  NEA-AVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHP  1162
              +  A+K  I+EI++KL+ F  ++E+LGVQ D CSRDIR+ RTV+LQRI+KHP
Sbjct  340   KDVEAMKFAIKEIKRKLEQFTTSIENLGVQVDRCSRDIRKTRTVVLQRIMKHP  392



>ref|XP_010467691.1| PREDICTED: UPF0496 protein At2g18630-like [Camelina sativa]
Length=399

 Score =   352 bits (902),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 196/385 (51%), Positives = 275/385 (71%), Gaps = 16/385 (4%)
 Frame = +2

Query  53    IMGGHMSKKS-----GETSNDLQCR-----TDLISSYEAACELDADLQTFDSTLQARTNH  202
             +MGG  SK       G  S  +Q +     T+ +SSYE AC  D  L++FDS L  RTN 
Sbjct  1     MMGGKGSKNKKDIEFGSPSTPVQIKMNSEYTEHLSSYERACSEDPKLESFDSALHERTNR  60

Query  203   VISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFEN  382
             VI+ LA GVE+++LSFDSLKEVT CLLDMN++VVKVIL+ K+DIW N +LF LV  YF++
Sbjct  61    VINKLASGVEIKSLSFDSLKEVTQCLLDMNQDVVKVILQDKEDIWNNQDLFSLVNMYFDS  120

Query  383   SLKSLDFCAALDKCLKRARESQLLIHLALKEFEEES----GGIDGSNNKYERTLEELKGF  550
             +LK++DFC+ L+ CL RAR SQ++I  A+K+FEEE+     G D  N KYE+TL+ELK F
Sbjct  121   TLKTMDFCSELEHCLNRARRSQVVIQFAVKQFEEEAEVHVNG-DNENKKYEKTLDELKRF  179

Query  551   RASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAA  730
             +  G PFT++FF++F  VY +Q LML++L   K KLD++L  I +WR+VS+++F     +
Sbjct  180   KDLGEPFTKKFFELFDLVYKKQVLMLDELHKLKKKLDRRLGNIKSWRRVSNMVFVTAFVS  239

Query  731   VLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGT  910
             VLI SVV AA+A+P V  A+A A A+P+GS+GKW ++L   YE  +KG KEII+S+++GT
Sbjct  240   VLIFSVVAAAVAAPPVVAAIAGALAVPVGSLGKWCNTLWTKYEKVVKGQKEIITSIRIGT  299

Query  911   YITIKDLDTIKVLADRLELEIESLLNTTSFAIN-EAAVKVGIEEIRKKLDLFMKNVEDLG  1087
             +I++K++D I VL  ++E+EIESLL    FA+  E  V++ I+EI+KKLD+F   +E+LG
Sbjct  300   FISVKEMDNISVLVRKVEVEIESLLKKAEFAVTEEKVVRIAIDEIKKKLDVFTDTIEELG  359

Query  1088  VQADNCSRDIRRARTVILQRIIKHP  1162
               AD    D+ +ARTVILQRII++P
Sbjct  360   KHADKYCSDVTKARTVILQRIIRYP  384



>ref|XP_006285951.1| hypothetical protein CARUB_v10007471mg [Capsella rubella]
 gb|EOA18849.1| hypothetical protein CARUB_v10007471mg [Capsella rubella]
Length=372

 Score =   349 bits (896),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 192/372 (52%), Positives = 254/372 (68%), Gaps = 10/372 (3%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEV  235
             MG  +  KS ET   +     L  +YEAAC+ D ++Q+FD+ +QA+T+HVI+TLA GVEV
Sbjct  1     MGNMICIKSNETRPKIYTNEQL-RAYEAACKADTEVQSFDTRMQAQTSHVINTLATGVEV  59

Query  236   RALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAAL  415
             RALS D+LK VTG LLDMN++VVKVIL+CK+D+W N E+F+LV EYF  SLK  DFC AL
Sbjct  60    RALSLDTLKVVTGSLLDMNQDVVKVILDCKEDVWENKEMFDLVGEYFNTSLKMQDFCNAL  119

Query  416   DKCLKRARESQLLIHLALKEFEEES---GGIDGSNNKYERTLEELKGFRASGNPFTEEFF  586
             ++ LK  R S LLI  AL++F EES   GG     N Y++TLEEL  F+ +  PF E+F 
Sbjct  120   ERSLKVVRLSHLLIRGALQQFNEESLVQGG-----NGYKKTLEELTKFQNAERPFGEDFL  174

Query  587   QIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaia  766
              +FQ++Y QQ +MLE +Q RKNKLDKKL+ +  WRK+SS++F AT A VLIC  V AA  
Sbjct  175   SMFQNIYKQQIIMLETIQVRKNKLDKKLKRVQTWRKLSSIIFVATYATVLIC-AVVAAAM  233

Query  767   spavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKV  946
                   A     A+P+G+MGKWIDS+ KNYE  +KGHK +I SM+V T + +KDLD I+ 
Sbjct  234   FAPPLAATLVTAAVPMGAMGKWIDSMWKNYEKGLKGHKGVIESMEVSTTVALKDLDDIRS  293

Query  947   LADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRA  1126
             L ++L+ +I+S++     A+   AVKV I  I K L  F K VE+L  + D C+R   RA
Sbjct  294   LIEKLDNDIKSMVKGAEDAVEFGAVKVRIIAIEKILSEFTKKVEELETRVDLCTRHATRA  353

Query  1127  RTVILQRIIKHP  1162
             RTVI+QRII +P
Sbjct  354   RTVIIQRIINYP  365



>ref|XP_010437628.1| PREDICTED: UPF0496 protein At4g34320-like [Camelina sativa]
Length=356

 Score =   348 bits (894),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 204/374 (55%), Positives = 263/374 (70%), Gaps = 26/374 (7%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEV  235
             MG   SK S +TS  +   T+L  +YEAAC  D ++Q+FD+ + ART+H+IS LA  VEV
Sbjct  1     MGNKTSKNSMKTSAKVYA-TEL-RAYEAACRKDKEIQSFDTRMHARTSHLISALATDVEV  58

Query  236   RALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAAL  415
             RALSFDSLKEVT  LL+MN+E+VKVIL+CKKDIW++ E+F+    YFE SLK+ +F  AL
Sbjct  59    RALSFDSLKEVTQFLLEMNQEIVKVILDCKKDIWKDKEMFD----YFETSLKTHEFYDAL  114

Query  416   DKCLKRARESQLLIHLALKEFEEES---GGIDGSNNKYERTLEELKGFRASGNPFTEEFF  586
                +   R +  LI   L++FEEES   GG     N Y++TLE+LK F  + NPF E+FF
Sbjct  115   ADSMHWVRSNHHLILGVLRQFEEESLVQGG-----NGYKKTLEKLKNFTDAQNPFGEDFF  169

Query  587   QIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaia  766
              +FQSVY QQ LMLEKLQ R+NKLD            SS++F AT A VLICSVV AA++
Sbjct  170   NMFQSVYKQQMLMLEKLQLRRNKLDT----------CSSIIFVATYATVLICSVVAAAMS  219

Query  767   spavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKV  946
             +P VA ALAA   +    MGKWID L KNYE A+KGHK++ISSMQ GTY+ +KDLD I++
Sbjct  220   APPVAPALAAPVPLGT--MGKWIDLLWKNYEKALKGHKDVISSMQPGTYVAVKDLDDIRL  277

Query  947   LADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRA  1126
             L   L++EI S+  +  +A+   AV +G+  I+K L++F KN+E+LG QAD CSRDIRRA
Sbjct  278   LIQELDIEIRSINKSDDYAVELKAVMIGVNAIKKILEVFEKNIEELGTQADMCSRDIRRA  337

Query  1127  RTVILQRIIKHPNH  1168
             RTVILQRII HPN+
Sbjct  338   RTVILQRIINHPNN  351



>ref|XP_009396891.1| PREDICTED: UPF0496 protein 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=385

 Score =   347 bits (889),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 199/371 (54%), Positives = 281/371 (76%), Gaps = 4/371 (1%)
 Frame = +2

Query  50    KIMGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGV  229
             K+ GG  ++ S   +  +Q  T  +SSYE AC L  +LQ+FD+T+Q RT+H I TLA GV
Sbjct  6     KVNGGGATRSSAAQTG-IQQYTAELSSYEEACRLYPELQSFDATVQQRTSHAICTLAQGV  64

Query  230   EVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCA  409
             E+ +L+FD+L+E+T  +L+ N+EVV+ +LECKKDIW+N ELF+LV++YF  S+++LD+  
Sbjct  65    EIGSLAFDTLREITDGILETNQEVVRFLLECKKDIWKNPELFDLVDDYFNCSIQTLDYYT  124

Query  410   ALDKCLKRARESQLLIHLALKEF--EEESGGIDGSNNKYERTLEELKGFRASGNPFTEEF  583
              L++CLK+AR+SQL+I  AL+ F  E+E+   +    KY  TL++L+ F+A+GNPFTEEF
Sbjct  125   ELERCLKKARDSQLIIQFALQRFEEEDEAESREDDKTKYIETLKKLRQFKAAGNPFTEEF  184

Query  584   FQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaai  763
              Q+F SVY  Q  MLEKL  RK KLD+KL+ + AWRKVS+++F A LAA +ICS+V AAI
Sbjct  185   SQVFHSVYTMQQSMLEKLLLRKRKLDRKLKSVKAWRKVSNMIFVAALAAFIICSIVAAAI  244

Query  764   aspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIK  943
             A+P VA ALAAA+AIPIGS+GKW+ SLLK ++DA+   KE++S MQ+GT + +KDLDT++
Sbjct  245   AAPPVAAALAAASAIPIGSLGKWVGSLLKRHQDALVEEKELLSWMQIGTCVALKDLDTLR  304

Query  944   VLADRLELEIESLLNTTSFAI-NEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIR  1120
             +L D+LE+   S+L    FA+ +E AVK  +EEI+K+++ FM N+EDLG Q D CSR IR
Sbjct  305   LLVDKLEIHFNSVLENADFALRDEEAVKFAVEEIKKQMEFFMNNIEDLGKQVDQCSRYIR  364

Query  1121  RARTVILQRII  1153
             +ARTV+LQRI+
Sbjct  365   KARTVVLQRIM  375



>ref|XP_009396890.1| PREDICTED: UPF0496 protein 1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=395

 Score =   347 bits (889),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 199/371 (54%), Positives = 281/371 (76%), Gaps = 4/371 (1%)
 Frame = +2

Query  50    KIMGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGV  229
             K+ GG  ++ S   +  +Q  T  +SSYE AC L  +LQ+FD+T+Q RT+H I TLA GV
Sbjct  16    KVNGGGATRSSAAQTG-IQQYTAELSSYEEACRLYPELQSFDATVQQRTSHAICTLAQGV  74

Query  230   EVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCA  409
             E+ +L+FD+L+E+T  +L+ N+EVV+ +LECKKDIW+N ELF+LV++YF  S+++LD+  
Sbjct  75    EIGSLAFDTLREITDGILETNQEVVRFLLECKKDIWKNPELFDLVDDYFNCSIQTLDYYT  134

Query  410   ALDKCLKRARESQLLIHLALKEF--EEESGGIDGSNNKYERTLEELKGFRASGNPFTEEF  583
              L++CLK+AR+SQL+I  AL+ F  E+E+   +    KY  TL++L+ F+A+GNPFTEEF
Sbjct  135   ELERCLKKARDSQLIIQFALQRFEEEDEAESREDDKTKYIETLKKLRQFKAAGNPFTEEF  194

Query  584   FQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaai  763
              Q+F SVY  Q  MLEKL  RK KLD+KL+ + AWRKVS+++F A LAA +ICS+V AAI
Sbjct  195   SQVFHSVYTMQQSMLEKLLLRKRKLDRKLKSVKAWRKVSNMIFVAALAAFIICSIVAAAI  254

Query  764   aspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIK  943
             A+P VA ALAAA+AIPIGS+GKW+ SLLK ++DA+   KE++S MQ+GT + +KDLDT++
Sbjct  255   AAPPVAAALAAASAIPIGSLGKWVGSLLKRHQDALVEEKELLSWMQIGTCVALKDLDTLR  314

Query  944   VLADRLELEIESLLNTTSFAI-NEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIR  1120
             +L D+LE+   S+L    FA+ +E AVK  +EEI+K+++ FM N+EDLG Q D CSR IR
Sbjct  315   LLVDKLEIHFNSVLENADFALRDEEAVKFAVEEIKKQMEFFMNNIEDLGKQVDQCSRYIR  374

Query  1121  RARTVILQRII  1153
             +ARTV+LQRI+
Sbjct  375   KARTVVLQRIM  385



>ref|XP_006286139.1| hypothetical protein CARUB_v10007694mg [Capsella rubella]
 gb|EOA19037.1| hypothetical protein CARUB_v10007694mg [Capsella rubella]
Length=388

 Score =   344 bits (882),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 188/366 (51%), Positives = 256/366 (70%), Gaps = 5/366 (1%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEV  235
             MG   SK S +TS  +  R   + +YEAACE D ++Q+FD  +QART+ VI+TLA GVEV
Sbjct  1     MGNRTSKHS-KTSLRIYARE--LRTYEAACEEDKEIQSFDKRMQARTSDVINTLATGVEV  57

Query  236   RALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAAL  415
             R +S DSLK VT  LLDMN+EVVKV+L+CKKDIW++ E+F+LVE+YFE S+K+ DFC AL
Sbjct  58    RGVSLDSLKVVTESLLDMNQEVVKVMLDCKKDIWKDKEMFKLVEDYFETSMKTHDFCDAL  117

Query  416   DKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIF  595
              K L R R+S  +I  AL++FEEES  + G N  Y++TLE+LK F+ +  PF E+F  +F
Sbjct  118   RKGLHRIRDSYHMIVSALRQFEEES-PVQGGNG-YKKTLEKLKKFKDAERPFGEDFVDMF  175

Query  596   QSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspa  775
             Q  Y QQ LMLEKLQ    KL+KKL+ I  WRK++S++F A  AAV IC +V AA+ +  
Sbjct  176   QIAYKQQMLMLEKLQLHNYKLEKKLKRIRTWRKLTSIIFVAAYAAVFICCIVAAAMTASP  235

Query  776   vagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLAD  955
             +   LAA      G  GKWIDSL K YE+ IKG ++++SSMQ GTY+ +K++D ++ L +
Sbjct  236   LVEVLAATAVPVSGIAGKWIDSLWKKYENEIKGQRDVVSSMQAGTYVAVKEMDIVRFLTE  295

Query  956   RLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTV  1135
             +L+ EI +L+ +  +A+   AVK+ I EI + L +F KN+E+L  QAD C RDI + R V
Sbjct  296   QLDNEIRNLVKSAEYAVEHGAVKIRIHEINEMLLVFKKNIEELETQADLCCRDIIKVREV  355

Query  1136  ILQRII  1153
             ILQRII
Sbjct  356   ILQRII  361



>gb|EPS58408.1| hypothetical protein M569_16405 [Genlisea aurea]
Length=406

 Score =   344 bits (882),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 197/377 (52%), Positives = 270/377 (72%), Gaps = 9/377 (2%)
 Frame = +2

Query  71    SKKSGETSNDLQCRTDL----ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVR  238
             S KSG+T      R +     + SYE AC  D DL+ FDSTLQ RT+  I ++A GVEVR
Sbjct  30    SSKSGKTHGSGAARVNPSDADLRSYEDACRSDPDLEDFDSTLQLRTSRAIHSIAAGVEVR  89

Query  239   ALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALD  418
             +LS DSL+EVT CLL+MN+EVVKVIL+ KKD+W+N EL +LV++YFENSL +LDFCAALD
Sbjct  90    SLSLDSLREVTECLLEMNQEVVKVILKNKKDVWKNVELSDLVDDYFENSLLTLDFCAALD  149

Query  419   KCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQ  598
              CLKRA   + ++++AL  FEEE       NN Y RTL+EL+ FR + +PFT EFF++F 
Sbjct  150   ACLKRAGHIESIVNVALGTFEEERY---AQNNDYSRTLDELRKFREAADPFTAEFFRVFS  206

Query  599   SVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspav  778
             SVY +Q   LEKLQ +K K+D+KL  +  WR+VS+V+F  T A+VLICSVV AA+A+P V
Sbjct  207   SVYSKQVSTLEKLQLKKRKMDEKLGKLKVWRRVSNVIFVVTFASVLICSVVAAAVAAPPV  266

Query  779   agalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADR  958
               ALAAA A+P+GS G+W+ SL KN E  +K  KEI+++MQ+G ++ IKD+D+I+V  DR
Sbjct  267   VTALAAAAAVPLGSTGRWLSSLWKNCERDLKSQKEIVNAMQIGAFVVIKDMDSIRVQVDR  326

Query  959   LELEIESLL--NTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRART  1132
              ++E+E++L     + A  E+A    + E+RKK+D F++ +E+LG  AD C+ + R ART
Sbjct  327   FQIELEAMLGSAGYAAAAEESAAATAVVELRKKVDEFVRIIEELGKYADKCTHETRMART  386

Query  1133  VILQRIIKHPNH*GTRM  1183
             VIL+RII HP H G+ +
Sbjct  387   VILRRIINHPPHRGSTL  403



>ref|XP_003537511.1| PREDICTED: UPF0496 protein At2g18630-like isoform X1 [Glycine 
max]
 ref|XP_006590676.1| PREDICTED: UPF0496 protein At2g18630-like isoform X2 [Glycine 
max]
 gb|KHN42014.1| UPF0496 protein [Glycine soja]
Length=382

 Score =   343 bits (880),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 208/382 (54%), Positives = 281/382 (74%), Gaps = 13/382 (3%)
 Frame = +2

Query  53    IMGGHMSK--KSGETSNDLQCRTDLI-----SSYEAACELDADLQTFDSTLQARTNHVIS  211
             +MGG  SK   S +    ++  T  +     SSYEAAC  D +LQ+ D+T+Q RTN VI+
Sbjct  1     MMGGQSSKIPSSSDVPTPIKMGTHSLYAADLSSYEAACVEDPNLQSLDATIQERTNRVIT  60

Query  212   TLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIW--RNHELFELVEEYFENS  385
             +LA G+EV ++S +SL EVTG LL+MN++V KVILECK+DIW  ++ ELF LVE++FENS
Sbjct  61    SLAQGIEVHSISIESLGEVTGSLLEMNQDVAKVILECKQDIWNKKDRELFSLVEDFFENS  120

Query  386   LKSLDFCAALDKCLKRARESQLLIHLALKEFEEE-SGGIDGSNNKYERTLEELKGFRASG  562
             L++L+FC ALDKCL RARE  +++  A+  FEEE   G++GS   Y +TL+ELKGF+ +G
Sbjct  121   LQTLEFCNALDKCLNRARERHVIVKSAITCFEEEVQNGVEGST--YLKTLQELKGFKEAG  178

Query  563   NPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLIC  742
             +PFTEEF+ +FQSVY QQA ML+KLQ RK KLDKKL+ +   ++VS+ +F A   +VLI 
Sbjct  179   DPFTEEFYSLFQSVYQQQASMLKKLQIRKQKLDKKLKSLKTLKRVSNAIFVAAFVSVLIF  238

Query  743   svvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITI  922
             SVV AAIA+P V  ALA A A+PIGS+GKW +SL K YE A+KG +E+I SMQVGTYIT+
Sbjct  239   SVVAAAIAAPPVVTALAGALAVPIGSVGKWCNSLFKRYETALKGQRELIISMQVGTYITL  298

Query  923   KDLDTIKVLADRLELEIESLLNTTSFAI-NEAAVKVGIEEIRKKLDLFMKNVEDLGVQAD  1099
              DL  I+V  D+LE+ IES+L ++ FA+ NE AVK  I+EI+K +D F + +E L  QAD
Sbjct  299   VDLKHIQVRIDQLEINIESMLQSSDFALRNEDAVKFAIDEIKKNIDTFAETIEALSKQAD  358

Query  1100  NCSRDIRRARTVILQRIIKHPN  1165
              CSR IRRART+++++II + N
Sbjct  359   ECSRQIRRARTMVVKKIINYTN  380



>ref|XP_002310784.2| hypothetical protein POPTR_0007s12320g [Populus trichocarpa]
 gb|EEE91234.2| hypothetical protein POPTR_0007s12320g [Populus trichocarpa]
Length=379

 Score =   342 bits (878),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 203/381 (53%), Positives = 277/381 (73%), Gaps = 11/381 (3%)
 Frame = +2

Query  53    IMGGHMSKKSGETSNDLQCR-------TDLISSYEAACELDADLQTFDSTLQARTNHVIS  211
             +MGG  SK  G  +  L  +       T+ ++SYE AC  D +LQ+FD+ L  RTNHVI+
Sbjct  1     MMGGQSSKTRGSDTPSLPLQANTNSQLTEDLTSYEDACNRDPELQSFDAALHERTNHVIN  60

Query  212   TLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLK  391
             +LA GV +  LS  S KEVT CLL+MN++VVKVILE K+DIW N ELF LVEEYFENS+K
Sbjct  61    SLATGVGI--LSLGSFKEVTNCLLEMNQDVVKVILESKEDIWNNRELFGLVEEYFENSVK  118

Query  392   SLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGS-NNKYERTLEELKGFRASGNP  568
             +++FCAAL+  LKRA+ SQL+I  A+K+FEEE    DG+   K+ +TLE L+ F+A+G+P
Sbjct  119   TMEFCAALESSLKRAQNSQLIIQFAIKQFEEEVEMQDGAVEKKFVKTLEGLQKFKAAGDP  178

Query  569   FTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsv  748
             FT +FF +FQSV  QQ  ML+KLQSRK KLDKK++ +  WR+VS+V+F +   +VLI SV
Sbjct  179   FTPQFFALFQSVSEQQVSMLKKLQSRKKKLDKKMKSMKTWRRVSNVLFVSAFVSVLIISV  238

Query  749   vtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKD  928
             V AAIA+P V  A+A A A+P+GS+GKW + L   YE A+K  KE++ SMQVGT++TI D
Sbjct  239   VAAAIAAPPVLTAVAGAIAVPVGSVGKWCNMLWNRYEKALKEQKELVRSMQVGTFVTIND  298

Query  929   LDTIKVLADRLELEIESLLNTTSFAINEA-AVKVGIEEIRKKLDLFMKNVEDLGVQADNC  1105
             +D+I+VL  +L++ I+SLL+   FAI E  AVK+ I+EI+KK+ +FM+ +EDL   AD C
Sbjct  299   MDSIRVLVIKLQMGIQSLLDNADFAIREEDAVKLVIDEIKKKMAVFMEIIEDLAAHADKC  358

Query  1106  SRDIRRARTVILQRIIKHPNH  1168
             +RDI  ART+IL RI+K+ + 
Sbjct  359   NRDISLARTMILNRILKYADQ  379



>emb|CDY13018.1| BnaC07g03170D [Brassica napus]
Length=392

 Score =   341 bits (874),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 187/367 (51%), Positives = 267/367 (73%), Gaps = 6/367 (2%)
 Frame = +2

Query  83    GETSNDLQCR-----TDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALS  247
             G  S  +Q +     T+ ++SYE AC  D  L++FDS L  RTN VI+ LA GVE+++LS
Sbjct  17    GSPSTPVQIKINSAYTEHLTSYETACSEDPKLESFDSALHERTNRVINKLASGVEIKSLS  76

Query  248   FDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCL  427
             FDSL+EVT CLLDMN++VVKVIL+ K+DIW + +LF LV  YFE++ K++DFC+ L+ CL
Sbjct  77    FDSLREVTQCLLDMNQDVVKVILQDKEDIWNHQDLFGLVNMYFESTAKTMDFCSELEGCL  136

Query  428   KRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVY  607
              RA+ SQ++I  A+K+FEEE    +  + KYE+TLEELK F+ +G+PFT+EFF +F SV+
Sbjct  137   NRAKRSQVIIQFAVKQFEEEDEDEENEDRKYEKTLEELKRFKLAGDPFTKEFFDLFDSVH  196

Query  608   VQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavaga  787
               Q +ML++L   K +LDKKL+ I  WR+VS+++F     +VLI SVV AA+A+P V  A
Sbjct  197   KHQVMMLDELHKLKRRLDKKLKNIKTWRRVSNMVFVTAFVSVLIFSVVAAAVAAPPVVAA  256

Query  788   laaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLEL  967
             +A A A+P+GS+GKW +SL   YE  +KG KEI++S+++GTYI++K++D I VL  R+E+
Sbjct  257   IAGALAVPVGSVGKWCNSLWTKYEKVVKGQKEIVTSVRIGTYISVKEMDNISVLVRRVEV  316

Query  968   EIESLLNTTSFAI-NEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQ  1144
             EIESLL    FA+  E  V++ ++EI+KKLD+F   +E+L   AD   RD+ +ARTVILQ
Sbjct  317   EIESLLKNAEFAVAEENGVRLAMDEIKKKLDVFTDTIEELREHADKYCRDVTKARTVILQ  376

Query  1145  RIIKHPN  1165
             RII++P 
Sbjct  377   RIIRYPT  383



>ref|XP_002865053.1| hypothetical protein ARALYDRAFT_496934 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41312.1| hypothetical protein ARALYDRAFT_496934 [Arabidopsis lyrata subsp. 
lyrata]
Length=402

 Score =   340 bits (873),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 185/377 (49%), Positives = 268/377 (71%), Gaps = 16/377 (4%)
 Frame = +2

Query  104   QCRTDL-------ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLK  262
             Q RTD+       +++Y++AC  D DLQ+FDS+L  RTN VIS+LA G E R+LSFD+L 
Sbjct  18    QIRTDMGSLYSADLTAYKSACREDPDLQSFDSSLHQRTNRVISSLASGAETRSLSFDALI  77

Query  263   EVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARE  442
             EV+GCLL+MN+EVV+ I+E K+D W N +L  LV  YF++S+K+LDFC A+D C+KRAR 
Sbjct  78    EVSGCLLEMNQEVVRFIIESKEDAWDNKDLTCLVNAYFDSSIKTLDFCNAVDNCVKRARI  137

Query  443   SQLLIHLALKEFEEESGGID-----GSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVY  607
              Q+L+  ALK+FE ES G +     G+ NKY +TLEEL  F+AS +PF  +FF +F+SVY
Sbjct  138   GQMLLQFALKQFEMESSGNNKSVEPGTTNKYAKTLEELNKFKASADPFDGDFFMLFESVY  197

Query  608   VQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavaga  787
              QQ ++LE L  +K KLDKKL+ I  W+K+S+V+F     +VLI SVV AA+A+P V  A
Sbjct  198   EQQVMLLEILHKQKRKLDKKLKNIKHWKKISNVVFVTAFVSVLIFSVVAAAVAAPPVVTA  257

Query  788   laaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLEL  967
             +AAA A+P+GS+GKW + L K YE A+KG K+I+ SM++G Y+T+KD+D I+VL D+L++
Sbjct  258   VAAALAVPVGSIGKWCNHLWKKYETAVKGQKDIVLSMRIGAYVTMKDMDNIRVLIDKLKI  317

Query  968   EIESLLNTTSFAIN----EAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTV  1135
             E+ES++    FA+     E AV++ + EI KK D+F + +E++G  A  CS++I  ART+
Sbjct  318   EMESMMQKVDFALKEKEEEVAVRLSMHEISKKFDVFTERIEEVGENATKCSKNITLARTI  377

Query  1136  ILQRIIKHPNH*GTRMG  1186
             +L+ I+  P+   +  G
Sbjct  378   VLRHILSFPSSSDSEQG  394



>emb|CDY43904.1| BnaA07g01810D [Brassica napus]
Length=392

 Score =   340 bits (871),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 187/367 (51%), Positives = 266/367 (72%), Gaps = 6/367 (2%)
 Frame = +2

Query  83    GETSNDLQCR-----TDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALS  247
             G  S  +Q +     T+ ++SYE AC  D  L++FDS+L  RT  VI+ LA GVE+++LS
Sbjct  17    GSPSTPVQIKINSAYTEHLTSYETACSEDPKLESFDSSLHERTTRVINKLASGVEIKSLS  76

Query  248   FDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCL  427
             FDSL+EVT CLLDMN++VVKVIL+ K+DIW N +LF LV  YFE++ K++DFC+ L+ CL
Sbjct  77    FDSLREVTQCLLDMNQDVVKVILQDKEDIWNNQDLFGLVNMYFESTAKTMDFCSELEGCL  136

Query  428   KRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVY  607
              RA+ SQ++I  A+K FEEE    +  + KYE+TLEELK F+ +G+PFT+EFF +F SV+
Sbjct  137   NRAKRSQVIIQFAVKLFEEEEEDGNNEDRKYEKTLEELKRFKLAGDPFTKEFFHLFDSVH  196

Query  608   VQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavaga  787
               Q +ML++L   K +LDKKL+ I  WR+VS+++F     +VLI SVV AA+A+P V  A
Sbjct  197   KHQVMMLDELHKLKRRLDKKLKNIKTWRRVSNMVFVTAFVSVLIFSVVAAAVAAPPVVAA  256

Query  788   laaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLEL  967
             +A A A+P+GS+GKW +SL   YE  +KG KEI++S+++GTYI++K++D I VL  R+E+
Sbjct  257   IAGALAVPVGSVGKWCNSLWTKYEKVVKGQKEIVTSVRIGTYISVKEMDNISVLVRRVEV  316

Query  968   EIESLLNTTSFAI-NEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQ  1144
             EIESLL    FA+  E  V++ ++EI+KKLD+F   +E+L   AD   RD+ +ARTVILQ
Sbjct  317   EIESLLKNAEFAVAEENGVRLAMDEIKKKLDVFTDTIEELREHADKYCRDVTKARTVILQ  376

Query  1145  RIIKHPN  1165
             RII++P 
Sbjct  377   RIIRYPT  383



>ref|XP_009114701.1| PREDICTED: UPF0496 protein At2g18630 isoform X1 [Brassica rapa]
 ref|XP_009114702.1| PREDICTED: UPF0496 protein At2g18630 isoform X1 [Brassica rapa]
Length=397

 Score =   339 bits (870),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 187/367 (51%), Positives = 266/367 (72%), Gaps = 6/367 (2%)
 Frame = +2

Query  83    GETSNDLQCR-----TDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALS  247
             G  S  +Q +     T+ ++SYE AC  D  L++FDS+L  RT  VI+ LA GVE+++LS
Sbjct  17    GSPSTPVQIKINSAYTEHLTSYETACSEDPKLESFDSSLHERTTRVINKLASGVEIKSLS  76

Query  248   FDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCL  427
             FDSL+EVT CLLDMN++VVKVIL+ K+DIW N +LF LV  YFE++ K++DFC+ L+ CL
Sbjct  77    FDSLREVTQCLLDMNQDVVKVILQDKEDIWNNQDLFGLVNLYFESTAKTMDFCSELEGCL  136

Query  428   KRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVY  607
              RA+ SQ++I  A+K FEEE    +  + KYE+TLEELK F+ +G+PFT+EFF +F SV+
Sbjct  137   NRAKRSQVIIQFAVKLFEEEEDDGNNEDRKYEKTLEELKRFKLAGDPFTKEFFHLFDSVH  196

Query  608   VQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavaga  787
               Q +ML++L   K +LDKKL+ I  WR+VS+++F     +VLI SVV AA+A+P V  A
Sbjct  197   KHQVMMLDELHKLKRRLDKKLKNIKTWRRVSNMVFVTAFVSVLIFSVVAAAVAAPPVVAA  256

Query  788   laaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLEL  967
             +A A A+P+GS+GKW +SL   YE  +KG KEI++S+++GTYI++K++D I VL  R+E+
Sbjct  257   IAGALAVPVGSVGKWCNSLWTKYEKVVKGQKEIVTSVRIGTYISVKEMDNISVLVRRVEV  316

Query  968   EIESLLNTTSFAI-NEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQ  1144
             EIESLL    FA+  E  V++ ++EI+KKLD+F   +E+L   AD   RD+ +ARTVILQ
Sbjct  317   EIESLLKNAEFAVAEENGVRLAMDEIKKKLDVFTDTIEELREHADKYCRDVTKARTVILQ  376

Query  1145  RIIKHPN  1165
             RII++P 
Sbjct  377   RIIRYPT  383



>ref|XP_009114703.1| PREDICTED: UPF0496 protein At2g18630 isoform X2 [Brassica rapa]
Length=391

 Score =   339 bits (870),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 187/367 (51%), Positives = 266/367 (72%), Gaps = 6/367 (2%)
 Frame = +2

Query  83    GETSNDLQCR-----TDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALS  247
             G  S  +Q +     T+ ++SYE AC  D  L++FDS+L  RT  VI+ LA GVE+++LS
Sbjct  17    GSPSTPVQIKINSAYTEHLTSYETACSEDPKLESFDSSLHERTTRVINKLASGVEIKSLS  76

Query  248   FDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCL  427
             FDSL+EVT CLLDMN++VVKVIL+ K+DIW N +LF LV  YFE++ K++DFC+ L+ CL
Sbjct  77    FDSLREVTQCLLDMNQDVVKVILQDKEDIWNNQDLFGLVNLYFESTAKTMDFCSELEGCL  136

Query  428   KRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVY  607
              RA+ SQ++I  A+K FEEE    +  + KYE+TLEELK F+ +G+PFT+EFF +F SV+
Sbjct  137   NRAKRSQVIIQFAVKLFEEEEDDGNNEDRKYEKTLEELKRFKLAGDPFTKEFFHLFDSVH  196

Query  608   VQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavaga  787
               Q +ML++L   K +LDKKL+ I  WR+VS+++F     +VLI SVV AA+A+P V  A
Sbjct  197   KHQVMMLDELHKLKRRLDKKLKNIKTWRRVSNMVFVTAFVSVLIFSVVAAAVAAPPVVAA  256

Query  788   laaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLEL  967
             +A A A+P+GS+GKW +SL   YE  +KG KEI++S+++GTYI++K++D I VL  R+E+
Sbjct  257   IAGALAVPVGSVGKWCNSLWTKYEKVVKGQKEIVTSVRIGTYISVKEMDNISVLVRRVEV  316

Query  968   EIESLLNTTSFAI-NEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQ  1144
             EIESLL    FA+  E  V++ ++EI+KKLD+F   +E+L   AD   RD+ +ARTVILQ
Sbjct  317   EIESLLKNAEFAVAEENGVRLAMDEIKKKLDVFTDTIEELREHADKYCRDVTKARTVILQ  376

Query  1145  RIIKHPN  1165
             RII++P 
Sbjct  377   RIIRYPT  383



>gb|EYU39376.1| hypothetical protein MIMGU_mgv1a019801mg [Erythranthe guttata]
Length=418

 Score =   340 bits (871),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 184/364 (51%), Positives = 256/364 (70%), Gaps = 11/364 (3%)
 Frame = +2

Query  122   ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEV  301
             ISSYEAAC  D DL +FD+ +  RT+  I+++A  V+ R+LS DSL++VT  LLD N+EV
Sbjct  49    ISSYEAACRSDPDLSSFDAAIHRRTSAAINSIAATVDARSLSLDSLRQVTETLLDTNQEV  108

Query  302   VKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFE  481
             V++IL+ KKDIW+N EL +LV++YFENSL +LDFC ALD CLKRA   + ++++AL++FE
Sbjct  109   VRIILQNKKDIWKNPELSDLVDDYFENSLLTLDFCTALDACLKRAAHIESVVNIALRKFE  168

Query  482   EESGGIDGSNNKYERTLEELKGFR--ASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNK  655
              E       +N Y  TL EL+ F   A+ +PF EEFF +F SVY +Q +MLE+L+S+K+K
Sbjct  169   HEHHSTATPDNNYSSTLAELRNFNAAAAADPFGEEFFSVFNSVYSKQIVMLERLKSKKSK  228

Query  656   LDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWI  835
             LD KL  + AW+KVS+V+F  T A+VLICSVV AA+++P V  ALAAA A+P+GSMG+WI
Sbjct  229   LDNKLGKLKAWKKVSNVIFVVTFASVLICSVVAAALSAPPVVTALAAAAAVPLGSMGRWI  288

Query  836   DSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINEA  1015
             +SL K YE+ ++G +EII SMQ+GT+I IKDL++I+VL DR  ++IE LL    F  +  
Sbjct  289   NSLWKTYENDLRGQREIIGSMQIGTFIVIKDLESIRVLVDRFRIKIEGLLANADFGTSVE  348

Query  1016  AVK---------VGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPNH  1168
               +           +EEIRK +  F+K + DL   A+ CS + R ART+IL+RII HP +
Sbjct  349   EEEEGGAEVALVAAVEEIRKGVGDFIKTIHDLSEHANKCSHETRMARTLILRRIINHPKN  408

Query  1169  *GTR  1180
                R
Sbjct  409   DSNR  412



>ref|XP_010558093.1| PREDICTED: UPF0496 protein At5g66675-like isoform X2 [Tarenaya 
hassleriana]
Length=478

 Score =   339 bits (870),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 189/398 (47%), Positives = 280/398 (70%), Gaps = 22/398 (6%)
 Frame = +2

Query  38    FGCVKIMGGHMSK------KSGETSNDLQC------RTDL-------ISSYEAACELDAD  160
             FG   +  G +SK      KS  +SN +        RTD+       +SSY++AC  D D
Sbjct  66    FGNCLMFPGFLSKSKTMEDKSIYSSNRINTSPIKPIRTDMGSIYSADLSSYKSACRQDPD  125

Query  161   LQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWR  340
             L++FDS+L  RTN VIS++A   E ++LSFDSL +V+GCLL+MN+EVV+ I+E ++D+W 
Sbjct  126   LRSFDSSLHLRTNRVISSIASRAESQSLSFDSLIDVSGCLLEMNQEVVRFIIESREDVWE  185

Query  341   NHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKY  520
             N EL  LV  YF++++K+LDFC A++ C++RAR SQ++I  A+K+FE ES  +D  NNKY
Sbjct  186   NKELSSLVNAYFDSTIKTLDFCNAVENCVRRARVSQMIIQFAVKQFEMESLDVDRGNNKY  245

Query  521   ERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVS  700
              +TLEEL  F+A+G+PF E+FF +F+SVY QQ L+L++L  +K KLDKK++ I  WRKVS
Sbjct  246   SKTLEELNKFKAAGDPFDEDFFTLFESVYEQQILLLDQLHKQKRKLDKKMKNIKTWRKVS  305

Query  701   SVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHK  880
             +V+F     +VLI SVV AA+A+P V  A+AAA A+PIGS+GKW + L K YE ++KG K
Sbjct  306   NVVFMTAFVSVLIFSVVAAAVAAPPVVTAVAAALAVPIGSVGKWCNYLWKKYESSVKGQK  365

Query  881   EIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINE---AAVKVGIEEIRKK  1051
             +I+ S+++G ++TIKD+D I++  D+L++E+ES+L    FA+ E    AV++ I EI +K
Sbjct  366   DIVLSIKIGAFVTIKDMDNIRIHVDKLKIEMESMLQKVDFALKEEEDVAVRLAIHEIGRK  425

Query  1052  LDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
             LD F + +E++G  A  CS+DI  ART++L+ I+  P+
Sbjct  426   LDAFAEKIEEVGENAARCSKDITLARTIVLRHILSFPS  463



>ref|XP_010558085.1| PREDICTED: UPF0496 protein At5g66675-like isoform X1 [Tarenaya 
hassleriana]
Length=511

 Score =   340 bits (872),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 189/398 (47%), Positives = 280/398 (70%), Gaps = 22/398 (6%)
 Frame = +2

Query  38    FGCVKIMGGHMSK------KSGETSNDLQC------RTDL-------ISSYEAACELDAD  160
             FG   +  G +SK      KS  +SN +        RTD+       +SSY++AC  D D
Sbjct  99    FGNCLMFPGFLSKSKTMEDKSIYSSNRINTSPIKPIRTDMGSIYSADLSSYKSACRQDPD  158

Query  161   LQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWR  340
             L++FDS+L  RTN VIS++A   E ++LSFDSL +V+GCLL+MN+EVV+ I+E ++D+W 
Sbjct  159   LRSFDSSLHLRTNRVISSIASRAESQSLSFDSLIDVSGCLLEMNQEVVRFIIESREDVWE  218

Query  341   NHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKY  520
             N EL  LV  YF++++K+LDFC A++ C++RAR SQ++I  A+K+FE ES  +D  NNKY
Sbjct  219   NKELSSLVNAYFDSTIKTLDFCNAVENCVRRARVSQMIIQFAVKQFEMESLDVDRGNNKY  278

Query  521   ERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVS  700
              +TLEEL  F+A+G+PF E+FF +F+SVY QQ L+L++L  +K KLDKK++ I  WRKVS
Sbjct  279   SKTLEELNKFKAAGDPFDEDFFTLFESVYEQQILLLDQLHKQKRKLDKKMKNIKTWRKVS  338

Query  701   SVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHK  880
             +V+F     +VLI SVV AA+A+P V  A+AAA A+PIGS+GKW + L K YE ++KG K
Sbjct  339   NVVFMTAFVSVLIFSVVAAAVAAPPVVTAVAAALAVPIGSVGKWCNYLWKKYESSVKGQK  398

Query  881   EIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINE---AAVKVGIEEIRKK  1051
             +I+ S+++G ++TIKD+D I++  D+L++E+ES+L    FA+ E    AV++ I EI +K
Sbjct  399   DIVLSIKIGAFVTIKDMDNIRIHVDKLKIEMESMLQKVDFALKEEEDVAVRLAIHEIGRK  458

Query  1052  LDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
             LD F + +E++G  A  CS+DI  ART++L+ I+  P+
Sbjct  459   LDAFAEKIEEVGENAARCSKDITLARTIVLRHILSFPS  496



>ref|XP_009112552.1| PREDICTED: UPF0496 protein At2g18630-like [Brassica rapa]
 ref|XP_009112553.1| PREDICTED: UPF0496 protein At2g18630-like [Brassica rapa]
 ref|XP_009112554.1| PREDICTED: UPF0496 protein At2g18630-like [Brassica rapa]
Length=389

 Score =   336 bits (861),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 186/384 (48%), Positives = 273/384 (71%), Gaps = 22/384 (6%)
 Frame = +2

Query  53    IMGGHMSKKS-----GETSNDLQCR-----TDLISSYEAACELDADLQTFDSTLQARTNH  202
             +MGG+ SKK      G  +  +Q +     T+ ++SYE AC  D  L++FDS+L  RTN 
Sbjct  1     MMGGNPSKKKQNIEYGSPTTPVQMKINSAYTEHLTSYERACTEDPKLESFDSSLHRRTNL  60

Query  203   VISTLAV--GVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYF  376
             VI+ LA   GVE+++LSF+SL+EVT CLLDMN++VVKVIL+ K+DIW N ++F LV  YF
Sbjct  61    VINNLAASSGVEIKSLSFESLREVTQCLLDMNQDVVKVILQDKEDIWSNQDMFSLVNMYF  120

Query  377   ENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRA  556
             +++ K++DFC+ L+ CL RAR SQ++I  A+K+FEEE         +Y++TLEELK F  
Sbjct  121   DSTAKTMDFCSELESCLNRARRSQVIIKFAVKQFEEE---------EYKKTLEELKRFTL  171

Query  557   SGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVL  736
             +G+PF++EFF +F SV+  Q +MLE+L   K +LDKKL+ +  WR+VS+V+F     +VL
Sbjct  172   AGDPFSKEFFALFDSVHRHQVMMLEELHRLKRRLDKKLKSVKTWRRVSNVVFVTAFVSVL  231

Query  737   ICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYI  916
             I SVV AA+A+P V  ALA A A+P+GS+GKW +S    YE  ++G KEI++S+++GTY+
Sbjct  232   IFSVVAAAVAAPPVVAALAGALAVPVGSVGKWCNSFWDKYEKVVRGQKEIVTSIRIGTYV  291

Query  917   TIKDLDTIKVLADRLELEIESLLNTTSFAI-NEAAVKVGIEEIRKKLDLFMKNVEDLGVQ  1093
             +++++D+I VL  R+E+EI SLL    FA+ +E  V++ I+EI+KKLD F + +E+LG  
Sbjct  292   SVREMDSISVLVRRVEVEIGSLLKNAEFAVGDERVVRLAIDEIKKKLDGFTETIEELGKH  351

Query  1094  ADNCSRDIRRARTVILQRIIKHPN  1165
             A     D+ +ARTVILQRII++PN
Sbjct  352   ASKYCSDVTKARTVILQRIIRYPN  375



>ref|NP_850929.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q8GW16.1|U496H_ARATH RecName: Full=UPF0496 protein At5g66675 [Arabidopsis thaliana]
 dbj|BAC43715.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63419.1| At5g66675 [Arabidopsis thaliana]
 gb|AED98250.1| uncharacterized protein AT5G66675 [Arabidopsis thaliana]
Length=412

 Score =   336 bits (862),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 183/378 (48%), Positives = 267/378 (71%), Gaps = 15/378 (4%)
 Frame = +2

Query  77    KSGETSNDLQCRTDL-------ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEV  235
             ++  T    Q RTD+       +++Y +AC  D DLQ+FDS+L  RTN VI++LA G + 
Sbjct  20    RTNNTPLPQQIRTDMGSLYSADLTAYNSACREDPDLQSFDSSLHQRTNRVINSLASGAQT  79

Query  236   RALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAAL  415
             R+LSFD+L EV+GCLL+MN+EVV+ I+E K+D+W N +L  LV  YF++S+K+LDFC A+
Sbjct  80    RSLSFDALIEVSGCLLEMNQEVVRFIIESKEDVWDNKDLTCLVNAYFDSSIKTLDFCNAV  139

Query  416   DKCLKRARESQLLIHLALKEFEEESGG----IDGSNNKYERTLEELKGFRASGNPFTEEF  583
             D C+KRAR  Q+L+  ALK+FE ES G    ++   NKY +TLEEL  F+ASG+PF  +F
Sbjct  140   DNCVKRARIGQMLLQFALKQFEMESSGSNKSVEPGTNKYAKTLEELNKFKASGDPFDGDF  199

Query  584   FQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaai  763
             F + +SVY QQ ++LE L  +K KLDKKL+ I  W+K+S+V+F     +VLI SVV AA+
Sbjct  200   FMLLESVYEQQVMLLEILHKQKRKLDKKLKNIKYWKKISNVVFVTAFVSVLIFSVVAAAV  259

Query  764   aspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIK  943
             A+P V  ALAAA A+PIGS+GKW + L K YE A+KG K+I+ SM++G Y+T+KD+D I+
Sbjct  260   AAPPVVTALAAALAVPIGSIGKWCNHLWKKYETAVKGQKDIVLSMRIGAYVTMKDMDNIR  319

Query  944   VLADRLELEIESLLNTTSFAIN----EAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSR  1111
             V  D+L++E+ES++    FA+     E AV++ + EI KK D+F + +E++G  A  CS+
Sbjct  320   VHVDKLKIEMESMMQKVDFALKEKEEEVAVRLSMHEISKKFDVFTERIEEVGDNATKCSK  379

Query  1112  DIRRARTVILQRIIKHPN  1165
             +I  ART++L+ I+  P+
Sbjct  380   NITLARTIVLRHILSFPS  397



>gb|KFK28347.1| hypothetical protein AALP_AA8G504300 [Arabis alpina]
Length=401

 Score =   335 bits (860),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 178/374 (48%), Positives = 262/374 (70%), Gaps = 13/374 (3%)
 Frame = +2

Query  104   QCRTDL-------ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLK  262
             Q RTD+       +S+Y +AC  D DLQ+FDS+L  RTN VI++LA G E R+LSFD+L 
Sbjct  20    QIRTDMGSLYSADLSAYNSACREDPDLQSFDSSLHNRTNRVINSLASGAETRSLSFDALI  79

Query  263   EVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARE  442
             EV+GCLL+MN+EVV+ I+E ++D+W N +L  LV  YF++S+K+LDFC A+D C+KRAR 
Sbjct  80    EVSGCLLEMNQEVVRFIIESREDVWDNKDLTCLVNAYFDSSIKTLDFCNAVDHCVKRARI  139

Query  443   SQLLIHLALKEFEEESG--GIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQ  616
              Q++I  A+K+FE ES    ++  +NKY +TLEEL  F+ASG+PF  +FF +F+SVY QQ
Sbjct  140   GQMIIQFAVKQFEIESSKKSVEPGSNKYAKTLEELNKFKASGDPFDGDFFMLFESVYEQQ  199

Query  617   ALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaa  796
              ++LE L  +K KLDKKL+ I  W+K+S+V+F     +VLI SVV AA+       A+AA
Sbjct  200   VMLLEILHKQKRKLDKKLKNIKNWKKISNVVFVTAFVSVLIFSVVAAAVXXXXXVTAVAA  259

Query  797   ataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIE  976
             A A+PIGS+GKW + L K YE A+KG K+I+ SM++G Y+T+KD++ I+V  D+L++E+E
Sbjct  260   ALAVPIGSVGKWCNHLWKKYETAVKGQKDIVLSMRIGAYVTMKDMENIRVHVDKLKIEME  319

Query  977   SLLNTTSFAIN----EAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQ  1144
             S++    FA+     E AV++ + EI K+ D+F + +E++G  A  CS+DI  ART++L+
Sbjct  320   SMMQKVDFALKEEEEEVAVRLSMHEISKRFDVFAERIEEVGDNATKCSKDITLARTIVLR  379

Query  1145  RIIKHPNH*GTRMG  1186
              I+  P    +  G
Sbjct  380   HILSFPTSSDSEQG  393



>ref|XP_010999946.1| PREDICTED: UPF0496 protein At2g18630-like isoform X1 [Populus 
euphratica]
Length=381

 Score =   334 bits (856),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 190/371 (51%), Positives = 262/371 (71%), Gaps = 4/371 (1%)
 Frame = +2

Query  50    KIMGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGV  229
             K  GG +     ++SN  Q   D  SSYE AC+LD  LQ+FD+TL  +TNHVI++L+ G 
Sbjct  9     KTRGGDIPPPPVQSSNHSQFAEDF-SSYEDACKLDPCLQSFDATLMEKTNHVINSLSTG-  66

Query  230   EVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCA  409
             ++   S  S K VT CLL+MN++VVK ILE K+DIW N ELF LVEEYFE+S+K++DFC 
Sbjct  67    DIATGSSGSFKVVTNCLLEMNQDVVKFILESKEDIWNNPELFALVEEYFESSIKTMDFCT  126

Query  410   ALDKCLKRARESQLLIHLALKEFEEESGGIDGS-NNKYERTLEELKGFRASGNPFTEEFF  586
              L+ C+  AR SQL I  A+  FE+E G  DG    KY +TLEEL+ F  +G+PFT +FF
Sbjct  127   ELESCVTSARTSQLNIMAAIAHFEKEVGLQDGVIEKKYVKTLEELQNFMVAGDPFTPKFF  186

Query  587   QIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaia  766
              +FQSVY QQ  ML+KLQS K KLDKKL+ +  WR+VS+V+F +    V+I +V  AAIA
Sbjct  187   MLFQSVYEQQVSMLKKLQSHKRKLDKKLKSVKIWRRVSNVLFVSVFVTVMIFAVAAAAIA  246

Query  767   spavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKV  946
             +P V  ALA+A A P+ S+G W + L   YE+A+K  K ++S++QVGT+ITIKD+++I+V
Sbjct  247   APPVVSALASALADPVHSVGTWCNLLWHRYENALKEQKVLVSAIQVGTFITIKDMESIRV  306

Query  947   LADRLELEIESLLNTTSFAIN-EAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRR  1123
             L ++LE+EI+SLL+   FAI  EA VK+ ++E++KK+ +FM+  EDL  QA  C+RDI R
Sbjct  307   LVNKLEIEIKSLLHHADFAIREEAVVKLVMDELKKKMAVFMETFEDLAAQAHRCNRDIIR  366

Query  1124  ARTVILQRIIK  1156
              R +I +RII+
Sbjct  367   GRIMISKRIIE  377



>ref|XP_006393860.1| hypothetical protein EUTSA_v10004318mg [Eutrema salsugineum]
 gb|ESQ31146.1| hypothetical protein EUTSA_v10004318mg [Eutrema salsugineum]
Length=410

 Score =   335 bits (858),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 185/386 (48%), Positives = 270/386 (70%), Gaps = 14/386 (4%)
 Frame = +2

Query  71    SKKSGETSNDLQCRTDL-------ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGV  229
             S+    T    Q RTD+       +S+Y++AC  D DLQ+FDS+L  RTN VI++LA G 
Sbjct  17    SRNRSNTPPLEQIRTDMGSLYSADLSAYKSACREDPDLQSFDSSLHQRTNRVINSLASGA  76

Query  230   EVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCA  409
             E R+LSFD+L EV+GCLL+MN+EVV+ I+E ++D+W N +L  LV  YF++S+K+LDFC 
Sbjct  77    ETRSLSFDALIEVSGCLLEMNQEVVRFIIESREDVWDNKDLTCLVNAYFDSSIKTLDFCN  136

Query  410   ALDKCLKRARESQLLIHLALKEFEEESGG---IDGSNNKYERTLEELKGFRASGNPFTEE  580
             A+D C+KRAR  Q++I  A+K+FE ES     ++   NKY +TL+EL  F+ASG+PF  +
Sbjct  137   AVDHCVKRARIGQMIIQFAVKQFEIESSAKTSVEPGTNKYAKTLQELNKFKASGDPFDAD  196

Query  581   FFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaa  760
             FF +F+SVY QQ L+LE L  +K KLD+KL+ I  W+K+S+V+F     +VLI SVV AA
Sbjct  197   FFLLFESVYEQQVLLLEILHKQKRKLDRKLKNIKHWKKISNVVFVTAFVSVLIFSVVAAA  256

Query  761   iaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTI  940
             IA+P V  A+AAA A+PIGS+GKW + L   YE A+KG K+I+ SM++G Y+T+KD++ I
Sbjct  257   IAAPPVVTAVAAALAVPIGSVGKWCNHLWSKYETAVKGQKDIVLSMRIGAYVTMKDMENI  316

Query  941   KVLADRLELEIESLLNTTSFAIN----EAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCS  1108
             +V  DRL++E+ES+++   FAI     EAAV++ + EI  K D+F + +E++G  A  CS
Sbjct  317   RVHVDRLKIEMESMMHKVDFAIKEEQEEAAVRLSMHEISNKFDVFTERIEEVGENAAKCS  376

Query  1109  RDIRRARTVILQRIIKHPNH*GTRMG  1186
             +DI  ART++L+ I+  P+   +  G
Sbjct  377   KDITLARTIVLRHILSFPSSSDSEQG  402



>ref|XP_006283979.1| hypothetical protein CARUB_v10005102mg [Capsella rubella]
 gb|EOA16877.1| hypothetical protein CARUB_v10005102mg [Capsella rubella]
Length=365

 Score =   332 bits (852),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 188/371 (51%), Positives = 248/371 (67%), Gaps = 11/371 (3%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEV  235
             MG   SK S +T    +     + +Y  AC+ D ++Q+FD+ + ART HVI+TLA GV+ 
Sbjct  1     MGNRTSKNSIKTLA--RTYATELRTYATACKEDTEIQSFDTRVLARTGHVINTLAKGVKD  58

Query  236   RALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAAL  415
             RALSFDSLK     LL+MN+EVVKVIL+CK+DIW N E+FE+VE++F+ SLK+ DFC AL
Sbjct  59    RALSFDSLKVAMESLLEMNQEVVKVILDCKEDIWENKEMFEIVEDFFDTSLKTQDFCNAL  118

Query  416   DKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIF  595
             ++ L+R   S LLI   L + EEES  + G N  Y++TLE+L  F+ + +P  E+F  +F
Sbjct  119   ERGLQRILTSHLLIRGVLPQLEEESQLVQGGNG-YKKTLEKLMKFKDAVSPLGEDFVNLF  177

Query  596   QSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspa  775
             QSVY QQ LML+KLQ RK K      +IH  RK+SS++F AT A VLIC  V  A  S  
Sbjct  178   QSVYKQQMLMLKKLQLRKYK------HIHTLRKLSSIIFVATYATVLIC-SVVVAAMSAP  230

Query  776   vagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLAD  955
                A  + T++ +G MGKWIDSL KNYE A+K HK++ISSMQ GTY  +KDL  I+ L  
Sbjct  231   PVVAALSTTSVTLGIMGKWIDSLWKNYEKALKAHKDVISSMQAGTY-AVKDLYDIRFLIQ  289

Query  956   RLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTV  1135
              L+ EI S+     + +  AAVK+GI  I + L++  KN+E LG+  D CSRDI RARTV
Sbjct  290   ELDTEIRSINKNDDYVVEHAAVKMGINAINRILEVSKKNIEKLGILVDLCSRDITRARTV  349

Query  1136  ILQRIIKHPNH  1168
             ILQRII HPN+
Sbjct  350   ILQRIINHPNN  360



>ref|XP_006409128.1| hypothetical protein EUTSA_v10022714mg [Eutrema salsugineum]
 gb|ESQ50581.1| hypothetical protein EUTSA_v10022714mg [Eutrema salsugineum]
Length=399

 Score =   333 bits (855),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 195/384 (51%), Positives = 277/384 (72%), Gaps = 14/384 (4%)
 Frame = +2

Query  53    IMGGHMSKKS-----GETSNDLQCR-----TDLISSYEAACELDADLQTFDSTLQARTNH  202
             +MGG  SK       G  +  +Q +     T+ +SSYE AC  D  L++FDS L  RTN 
Sbjct  1     MMGGKSSKNRKSDEFGSPTTPVQIKINSAYTEDLSSYERACSEDPKLESFDSALHERTNR  60

Query  203   VISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFEN  382
             VI+ LA GVE+++LSFDSL+EVT CLLDMN++VVKVIL+ K+DIW N +LF LV  YF +
Sbjct  61    VINKLASGVEIKSLSFDSLREVTQCLLDMNQDVVKVILQDKEDIWNNQDLFSLVNMYFAS  120

Query  383   SLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESG-GIDGS--NNKYERTLEELKGFR  553
             + K++DFC+ L+ CL RAR SQ++I  A+K+FEEES   ++G+  N KYE+TLEELK F+
Sbjct  121   TSKTMDFCSELENCLNRARRSQVIIQFAVKQFEEESEIPLNGNNENRKYEKTLEELKRFK  180

Query  554   ASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAV  733
             ++G+PFT+EFF +F  V+  Q LML++L   K KLDKKL+ I  WR+VS+++F     +V
Sbjct  181   SAGDPFTKEFFALFDLVHKHQVLMLDELHKLKRKLDKKLKNIKTWRRVSNMVFVTAFISV  240

Query  734   LICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTY  913
             LI SVV AA+A+P V  A+A A A+P+GS+GKW +SL   YE  ++G KEII+++++GTY
Sbjct  241   LIFSVVAAAVAAPPVVAAIAGALAVPVGSVGKWCNSLWTKYEKVVRGQKEIITTIRIGTY  300

Query  914   ITIKDLDTIKVLADRLELEIESLLNTTSFAINEA-AVKVGIEEIRKKLDLFMKNVEDLGV  1090
             I++K++D I VL  ++E+EIESLL    FA+ E   V++ I+EI+KKLD+F + +E+LG 
Sbjct  301   ISVKEMDNISVLVRKVEVEIESLLKNAEFAVTEENVVRLAIDEIKKKLDVFTETIEELGK  360

Query  1091  QADNCSRDIRRARTVILQRIIKHP  1162
              A+    D+ +ARTVILQRII++P
Sbjct  361   HANKYCSDVTKARTVILQRIIRYP  384



>sp|Q7XFE1.2|U496E_ORYSJ RecName: Full=Putative UPF0496 protein 5 [Oryza sativa Japonica 
Group]
 gb|AAP53285.2| hypothetical protein LOC_Os10g21540 [Oryza sativa Japonica Group]
Length=423

 Score =   334 bits (857),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 186/325 (57%), Positives = 255/325 (78%), Gaps = 1/325 (0%)
 Frame = +2

Query  128   SYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVK  307
             SYEAAC  D +L TFD+ L+ R +  I+ +A GVEVR+LS  SL+EVTGCLLDMN+EVV+
Sbjct  32    SYEAACSADPELGTFDTALRRRASRAITAVASGVEVRSLSLGSLREVTGCLLDMNQEVVR  91

Query  308   VILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEE  487
             V+L+CK+D+WR+ +LF+LVE+YFE SL +LDF AALDK L RAR+SQL++HLAL+    E
Sbjct  92    VVLDCKRDVWRSPDLFDLVEDYFEGSLHTLDFLAALDKSLHRARDSQLVLHLALQRHHHE  151

Query  488   SGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKK  667
                   ++  Y  TL EL+ F+A+G PFT+EFF  FQ+VY QQ  M+ KL+ RK +LD++
Sbjct  152   PPAAASASELYASTLGELRQFKAAGEPFTDEFFAAFQTVYRQQMSMVGKLRRRKRRLDRR  211

Query  668   LRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLL  847
             LR +  WR+VS ++F  + AA+L+CSVV AAIA+P VA ALAAA ++P+GS GKW+DSLL
Sbjct  212   LRSVRVWRRVSGIVFLTSFAALLVCSVVAAAIAAPPVAAALAAAASMPVGSAGKWMDSLL  271

Query  848   KNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFA-INEAAVK  1024
             K Y+DA+ GHKE++S+MQVGT+I IKDLD+I+VL + LE++I S+ ++  FA  +E AV+
Sbjct  272   KKYQDALHGHKEVVSAMQVGTFIAIKDLDSIRVLVEHLEVQISSMADSVEFAERDEEAVR  331

Query  1025  VGIEEIRKKLDLFMKNVEDLGVQAD  1099
              GI+E++KKL+LFMK+V+DLG QAD
Sbjct  332   FGIDEVKKKLELFMKSVDDLGEQAD  356



>emb|CDY51496.1| BnaC09g51110D [Brassica napus]
Length=384

 Score =   332 bits (852),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 183/384 (48%), Positives = 269/384 (70%), Gaps = 22/384 (6%)
 Frame = +2

Query  53    IMGGHMSKKS-----GETSNDLQCR-----TDLISSYEAACELDADLQTFDSTLQARTNH  202
             +MGG+ SKK      G  +  +  +     T+ ++SYE AC  D  L++FDS+L  RTN 
Sbjct  1     MMGGNPSKKKQNIEYGSPTTPVHIKINSAYTEHLTSYERACTEDPKLESFDSSLHQRTNL  60

Query  203   VISTLAV--GVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYF  376
             VI+ LA   GVE+++LSF+SL+EVT CLLDMN++VVKVIL+ + DIW N ++F LV  YF
Sbjct  61    VINKLAASSGVEIKSLSFESLREVTQCLLDMNQDVVKVILQDRDDIWSNQDMFSLVNMYF  120

Query  377   ENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRA  556
             +++ K++DFC+ L+ CL RAR SQ++I  A+K+FEEE          YE+TLEELK F  
Sbjct  121   DSTAKTMDFCSELESCLNRARRSQVIIKFAVKQFEEED---------YEKTLEELKRFTL  171

Query  557   SGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVL  736
             +G+PF++EFF +F SV+  Q +MLE+L   K +LDKKL+ +  WR+VS+V+F     +VL
Sbjct  172   AGDPFSKEFFALFDSVHRHQVMMLEELHRLKRRLDKKLKSVKTWRRVSNVVFVTAFVSVL  231

Query  737   ICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYI  916
             I SVV AA+A+P V  ALA A  +P+GS+GKW +SL + YE  ++G KEI++S+++GTY+
Sbjct  232   IFSVVAAAVAAPPVVAALAGALTVPVGSVGKWCNSLWEKYEKVVRGQKEIVTSIRIGTYV  291

Query  917   TIKDLDTIKVLADRLELEIESLLNTTSFAI-NEAAVKVGIEEIRKKLDLFMKNVEDLGVQ  1093
             +++++D I VL  R+E+E  SLL    FA+ +E  V++ I+EI+KKLD+F + +E+LG  
Sbjct  292   SVREMDNISVLVRRVEVEFGSLLKNAEFAVSDERVVRLAIDEIKKKLDVFTETIEELGKH  351

Query  1094  ADNCSRDIRRARTVILQRIIKHPN  1165
             A     D+ +ARTVILQRII++P 
Sbjct  352   ASKYCSDVTKARTVILQRIIRYPT  375



>emb|CDY30310.1| BnaA09g09670D [Brassica napus]
Length=384

 Score =   331 bits (849),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 184/384 (48%), Positives = 272/384 (71%), Gaps = 22/384 (6%)
 Frame = +2

Query  53    IMGGHMSKKS-----GETSNDLQCR-----TDLISSYEAACELDADLQTFDSTLQARTNH  202
             +MGG+ SKK      G  +  +  +     T+ ++SYE AC  D  L++FDS+L  RT+ 
Sbjct  1     MMGGNPSKKKQNIEYGSPTTPVHIKINSAYTEHLTSYERACTEDPKLESFDSSLHQRTHL  60

Query  203   VISTLAV--GVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYF  376
             VI+ LA   GVE+++LSF+SL+EVT CLLDMN++VVKVIL+ K+DIW N ++F LV  YF
Sbjct  61    VINNLAASSGVEIKSLSFESLREVTQCLLDMNQDVVKVILQDKEDIWSNQDMFSLVNMYF  120

Query  377   ENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRA  556
             +++ K++DFC+ L++CL RAR SQ++I  A+K+FEEE          YE+TLEELK F  
Sbjct  121   DSTAKTMDFCSELERCLNRARRSQVIIKFAVKQFEEED---------YEKTLEELKRFTL  171

Query  557   SGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVL  736
             +G+PF++EFF +F SV+  Q +MLE+L   K +LDKKL+ +  WR+VS+V+F     +VL
Sbjct  172   AGDPFSKEFFALFDSVHRHQVMMLEELHRLKRRLDKKLKSVKTWRRVSNVVFVTAFVSVL  231

Query  737   ICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYI  916
             I SVV AA+A+P V  ALA A A+P+GS+GKW +S  + YE  ++G KEI++S+++GTY+
Sbjct  232   IFSVVAAAVAAPPVVAALAGALAVPVGSVGKWCNSFWEKYEKVVRGQKEIMTSIRIGTYV  291

Query  917   TIKDLDTIKVLADRLELEIESLLNTTSFAI-NEAAVKVGIEEIRKKLDLFMKNVEDLGVQ  1093
             +++++D+I VL  R+E+EI SLL    FA+ +E  V++ I+EI+KKLD F + +E+LG  
Sbjct  292   SVREMDSISVLVRRVEVEIGSLLKNAEFAVGDERVVRLAIDEIKKKLDGFTETIEELGKH  351

Query  1094  ADNCSRDIRRARTVILQRIIKHPN  1165
             A     D+ +ARTVILQRII++P 
Sbjct  352   ASKYCSDVTKARTVILQRIIRYPT  375



>ref|XP_006412239.1| hypothetical protein EUTSA_v100255251mg, partial [Eutrema salsugineum]
 gb|ESQ53692.1| hypothetical protein EUTSA_v100255251mg, partial [Eutrema salsugineum]
Length=269

 Score =   327 bits (837),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 180/266 (68%), Positives = 227/266 (85%), Gaps = 2/266 (1%)
 Frame = +2

Query  371   YFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGF  550
             +FENSLK+LDFCAAL+K L++AR+SQLLI +AL++FE+ES  ++G N  Y++TLEELK F
Sbjct  1     HFENSLKTLDFCAALEKGLRKARDSQLLILVALQQFEDESL-VEGGNG-YKKTLEELKNF  58

Query  551   RASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAA  730
             + + +PF E+FF++FQSVY QQ LMLEKLQ RKNKLDKKL+ IH WRK+SS++F AT A 
Sbjct  59    KEAESPFNEDFFKMFQSVYKQQMLMLEKLQLRKNKLDKKLKCIHTWRKLSSIIFVATFAT  118

Query  731   VLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGT  910
             VLICSVV AA+A+P VA ALAAATA+P+GSMGKWIDSL KNYE+A+KG KE+ISSMQ GT
Sbjct  119   VLICSVVAAAMAAPPVAAALAAATALPLGSMGKWIDSLWKNYENALKGQKEMISSMQAGT  178

Query  911   YITIKDLDTIKVLADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGV  1090
             ++ +KDLDTI+VL +RLE+EI  ++    FA+   AVK+GIEEI+KKL++F +NVE+LG 
Sbjct  179   FVAVKDLDTIRVLIERLEIEITGMVKCAEFAVEHEAVKIGIEEIKKKLEVFKRNVEELGT  238

Query  1091  QADNCSRDIRRARTVILQRIIKHPNH  1168
             QAD CSRDIRRARTVILQRIIKHPN+
Sbjct  239   QADLCSRDIRRARTVILQRIIKHPNN  264



>emb|CDX81379.1| BnaC09g07900D [Brassica napus]
Length=406

 Score =   331 bits (849),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 176/372 (47%), Positives = 266/372 (72%), Gaps = 11/372 (3%)
 Frame = +2

Query  104   QCRTDL-------ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLK  262
             Q RTD+       ++SY++AC+ D DLQ+FDS+L +RTN VI++LA G E R+LSF++L 
Sbjct  33    QIRTDMASIYSSDLTSYKSACKEDPDLQSFDSSLHSRTNRVINSLASGAESRSLSFEALI  92

Query  263   EVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARE  442
             EV+GCLL+MN+EVVK I+E ++D+W N +L  LV  YF++S+K+LDFC A+D C+KRAR 
Sbjct  93    EVSGCLLEMNQEVVKFIIESREDVWDNKDLTSLVNAYFDSSIKTLDFCNAVDHCVKRARI  152

Query  443   SQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQAL  622
              Q++I  A+K+FE ES   +   +KY +TL+EL  F+ASG+PF  +FF +F+SVY QQ +
Sbjct  153   GQMIIQFAVKQFEMESSSPEPGASKYAKTLQELNKFKASGDPFDGDFFMLFESVYEQQVM  212

Query  623   MLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaat  802
             +LE L  +K KLDKKL+ I  W+K+S+V+F     +VLI SVV AAIA+P V  A+AAA 
Sbjct  213   LLETLHKQKRKLDKKLKNIKHWKKISNVVFVTAFVSVLIFSVVAAAIAAPPVVTAVAAAL  272

Query  803   aipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESL  982
             A+P+GS+GKW   L K YE A++  K+++ SM+VG +IT++D++ I+V  D+L++E+E++
Sbjct  273   AVPLGSVGKWCSHLWKKYETAVRRQKDVVLSMKVGAHITMRDMENIRVHVDKLKIEMEAM  332

Query  983   LNTTSFAINEA----AVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRI  1150
             +    FAI E     AV++ ++EI K+ D+F + +E++G  A  CS+DI  ART++L+ I
Sbjct  333   MQRVDFAIEEGEEEVAVRLSMQEISKRFDVFTERIEEVGENAAKCSKDITLARTIVLRHI  392

Query  1151  IKHPNH*GTRMG  1186
             +  P    +  G
Sbjct  393   LSFPTSSDSEQG  404



>ref|XP_002884146.1| hypothetical protein ARALYDRAFT_319811 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60405.1| hypothetical protein ARALYDRAFT_319811 [Arabidopsis lyrata subsp. 
lyrata]
Length=398

 Score =   331 bits (848),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 196/385 (51%), Positives = 274/385 (71%), Gaps = 16/385 (4%)
 Frame = +2

Query  53    IMGGHMSKKS-----GETSNDLQCR-----TDLISSYEAACELDADLQTFDSTLQARTNH  202
             +MGG  SK       G  S  +Q +     ++ +SSYE AC  D  L++FD+ L  RTN 
Sbjct  1     MMGGKSSKNKKNVEFGSPSTPVQIKINSEYSEHLSSYERACSEDPKLESFDAALHERTNR  60

Query  203   VISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFEN  382
             VI+ LA GVE+++LSFDSL+EVT CLLDMN++VVKVIL+ K+DIW N +LF LV  YFE+
Sbjct  61    VINKLASGVEIKSLSFDSLREVTQCLLDMNQDVVKVILQDKEDIWNNQDLFSLVNLYFES  120

Query  383   SLKSLDFCAALDKCLKRARESQLLIHLALKEFEEES----GGIDGSNNKYERTLEELKGF  550
             + K++DFC+ L+ CL RAR SQ++I  A+K+FEEE+     G D  N KYE+TL+ELK F
Sbjct  121   TAKTMDFCSELENCLNRARRSQVIIQFAVKQFEEEAEIPVNG-DKENRKYEKTLKELKRF  179

Query  551   RASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAA  730
             + +G PFT+EFF +F  VY QQ +MLE+L   K KLDKKL+ I  WR+VS+++F     +
Sbjct  180   KVAGEPFTKEFFALFDLVYKQQVMMLEELHKLKKKLDKKLKNIKTWRRVSNMVFVTAFVS  239

Query  731   VLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGT  910
             VLI SVV AA+A+P V  A+A A A+P+GS+GKW ++L   YE  ++G KEII+S+++GT
Sbjct  240   VLIFSVVAAAVAAPPVVAAIAGALAVPVGSVGKWCNTLWTKYEKVVRGQKEIITSIRIGT  299

Query  911   YITIKDLDTIKVLADRLELEIESLLNTTSFAIN-EAAVKVGIEEIRKKLDLFMKNVEDLG  1087
             YI++K++D I +L  ++E+EIESLL    FAI  E  V++ I+EI+KKLD+F + +E+LG
Sbjct  300   YISVKEMDNISILVRKVEVEIESLLKKAEFAITEEKEVRLAIDEIKKKLDVFTETIEELG  359

Query  1088  VQADNCSRDIRRARTVILQRIIKHP  1162
               A     D+ +ARTVILQRII++P
Sbjct  360   EHAGKYCSDVTKARTVILQRIIRYP  384



>ref|XP_003629491.1| hypothetical protein MTR_8g078100 [Medicago truncatula]
 gb|AET03967.1| UPF0496 plant-like protein [Medicago truncatula]
Length=375

 Score =   329 bits (844),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 202/377 (54%), Positives = 283/377 (75%), Gaps = 9/377 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDLI-----SSYEAACELDADLQTFDSTLQARTNHVISTLA  220
             MGG+ SK   + ++  +  T  +     SSYEAAC  D +LQ+FD +++  TN VIS+LA
Sbjct  1     MGGNSSKMMSDANDCTKMGTHSVYAADLSSYEAACVKDPNLQSFDESIKEHTNRVISSLA  60

Query  221   VGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLD  400
              GVEVR+LSF+SL+EVT  LL+MN EVVKVIL+CK+DIW N +LF LV +YF+NSL++L+
Sbjct  61    TGVEVRSLSFNSLREVTDSLLEMNHEVVKVILDCKRDIWGNKDLFALVNDYFDNSLQTLE  120

Query  401   FCAALDKCLKRARESQLLIHLALKEFEEE-SGGIDGSNNKYERTLEELKGFRASGNPFTE  577
             FC +L+KCL+RARE+Q+++   +  FEEE   G++G      +TL+EL+ F+ +G+PFTE
Sbjct  121   FCNSLEKCLRRARENQVMVKSVITYFEEEVQNGLEGGT--CVKTLQELRNFKDAGDPFTE  178

Query  578   EFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvta  757
             EF+ +FQSVY QQA ML+KLQ RK KLDKKL+ + +W++VS+ +F A   +VLI SVV A
Sbjct  179   EFYLLFQSVYTQQATMLKKLQIRKRKLDKKLKSLKSWKRVSNAIFLAAFVSVLIFSVVAA  238

Query  758   aiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDT  937
             +IA+P V  ALAAA  +P+GS+GKW +SL K YE AIKG +E++SSMQ+GTYI++KDLD 
Sbjct  239   SIAAPPVVTALAAALVVPLGSVGKWCNSLFKGYEKAIKGQREVVSSMQLGTYISLKDLDN  298

Query  938   IKVLADRLELEIESLLNTTSFAI-NEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRD  1114
             I+VL ++LEL++ESLL    FA+ NE  +K+ I+EI+K ++ F + +E L   AD CSR 
Sbjct  299   IRVLTNKLELQLESLLQNADFALKNEDVIKLAIDEIKKNIETFSETLETLSANADKCSRQ  358

Query  1115  IRRARTVILQRIIKHPN  1165
             IR+ARTV++Q IIK P+
Sbjct  359   IRKARTVVIQNIIKRPD  375



>ref|XP_006280557.1| hypothetical protein CARUB_v10026498mg [Capsella rubella]
 ref|XP_006280558.1| hypothetical protein CARUB_v10026498mg [Capsella rubella]
 gb|EOA13455.1| hypothetical protein CARUB_v10026498mg [Capsella rubella]
 gb|EOA13456.1| hypothetical protein CARUB_v10026498mg [Capsella rubella]
Length=412

 Score =   330 bits (847),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 180/378 (48%), Positives = 265/378 (70%), Gaps = 15/378 (4%)
 Frame = +2

Query  77    KSGETSNDLQCRTDL-------ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEV  235
             ++  T    Q RTD+       +S+Y++AC  D DLQ+FDS+L  RTN VI++LA G E 
Sbjct  20    RTNNTPPPPQIRTDIGSLYSADLSAYKSACREDPDLQSFDSSLHQRTNRVINSLASGAET  79

Query  236   RALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAAL  415
             R+LSFD+L EV+GCLL+MN EVV+ I+E K+D W N +L  LV  YF++S+K+LDFC A+
Sbjct  80    RSLSFDALIEVSGCLLEMNHEVVRFIIESKEDAWDNKDLTCLVNAYFDSSIKTLDFCNAV  139

Query  416   DKCLKRARESQLLIHLALKEFEEESGG----IDGSNNKYERTLEELKGFRASGNPFTEEF  583
             D  +KRAR  Q+L+  A+K+FE ES G    ++   NKY  TLEEL  F+ASG+PF  +F
Sbjct  140   DNSVKRARVGQMLLQFAIKQFEMESSGNNTSVEPGTNKYANTLEELNKFKASGDPFDGDF  199

Query  584   FQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaai  763
             F +F+SVY QQ ++L+ L  +K KLD+KL+ I  W+K+S+V+F     +VLI SVV AA+
Sbjct  200   FMLFESVYEQQVMLLDILHKQKRKLDRKLKNIKHWKKISNVVFVTAFVSVLIFSVVAAAV  259

Query  764   aspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIK  943
             A+P V  A+AAA A+PIGS+GKW + L K YE A+KG K+I+ SM++G Y+T+KD+D I+
Sbjct  260   AAPPVVTAVAAALAVPIGSIGKWCNHLWKKYETAVKGQKDIVLSMRIGAYVTMKDMDNIR  319

Query  944   VLADRLELEIESLLNTTSFAIN----EAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSR  1111
             +  D+L++E+ES++    FA+     E AV++ + EI KK D+F + +E++G  A  CS+
Sbjct  320   LHIDKLKIEMESMMQRVDFALKEKDEEVAVRLSMHEISKKFDVFTERIEEVGENASKCSK  379

Query  1112  DIRRARTVILQRIIKHPN  1165
             +I  ART++L+ I+  P+
Sbjct  380   NITLARTIVLRHILSFPS  397



>ref|XP_007156894.1| hypothetical protein PHAVU_002G026300g [Phaseolus vulgaris]
 ref|XP_007156895.1| hypothetical protein PHAVU_002G026300g [Phaseolus vulgaris]
 gb|ESW28888.1| hypothetical protein PHAVU_002G026300g [Phaseolus vulgaris]
 gb|ESW28889.1| hypothetical protein PHAVU_002G026300g [Phaseolus vulgaris]
Length=380

 Score =   329 bits (843),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 195/382 (51%), Positives = 274/382 (72%), Gaps = 17/382 (4%)
 Frame = +2

Query  53    IMGGHMSKKSGETSNDLQCRTDL---------ISSYEAACELDADLQTFDSTLQARTNHV  205
             +MGG  SK+   +S+D+     +         +SSYEAAC  D +LQ+ D+T++ RTN V
Sbjct  1     MMGGGTSKRP--SSSDVPTPIKMGTHSLYAADLSSYEAACVEDPNLQSLDATIRERTNRV  58

Query  206   ISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIW--RNHELFELVEEYFE  379
             I++LA G+EVR++S +SL EVTG LL+MN++V KVILECK+DIW  ++ ELF LVE++FE
Sbjct  59    ITSLANGIEVRSISIESLGEVTGSLLEMNQDVAKVILECKQDIWNKKDKELFSLVEDFFE  118

Query  380   NSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEE-SGGIDGSNNKYERTLEELKGFRA  556
             NSL++L FC ALDKCL RARE  +++  A+  FEEE   G++GS   Y +TL+ELK F+ 
Sbjct  119   NSLETLKFCNALDKCLNRARERHVMVKSAITYFEEEVQNGVEGST--YLKTLQELKVFKE  176

Query  557   SGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVL  736
             +G+PFTE+F+ +FQSVY QQA ML+KLQ RK KLDKKL+ +   ++VS+ +F A   +VL
Sbjct  177   AGDPFTEDFYSLFQSVYQQQASMLKKLQIRKQKLDKKLKSLKTLKRVSNAIFVAAFVSVL  236

Query  737   ICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYI  916
             I SVV AAI++P V  AL  A  +P+GS+GKW DSL K YE A+ G + +I +M   +YI
Sbjct  237   IFSVVAAAISAPPVVTALVGALLVPMGSVGKWCDSLFKRYEKALNGQRNLIITMHDASYI  296

Query  917   TIKDLDTIKVLADRLELEIESLLNTTSFAI-NEAAVKVGIEEIRKKLDLFMKNVEDLGVQ  1093
             T+ DL+ I+V  D+LE++IES+L +  FA+ NE  VK  I+EI+K +D F + +E L  Q
Sbjct  297   TLMDLNNIRVRIDQLEIKIESMLQSADFALRNEDGVKFAIDEIKKNIDTFAETIEALSKQ  356

Query  1094  ADNCSRDIRRARTVILQRIIKH  1159
             AD CSR IRRARTV++++II +
Sbjct  357   ADECSRQIRRARTVVVKKIINY  378



>ref|XP_009112322.1| PREDICTED: UPF0496 protein At5g66675 [Brassica rapa]
 ref|XP_009112323.1| PREDICTED: UPF0496 protein At5g66675 [Brassica rapa]
 emb|CDY18618.1| BnaA09g07770D [Brassica napus]
Length=413

 Score =   328 bits (842),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 174/364 (48%), Positives = 262/364 (72%), Gaps = 11/364 (3%)
 Frame = +2

Query  104   QCRTDL-------ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLK  262
             Q RTD+       ++SY +AC+ D DLQ+FDS+L +RTN VI++LA G E R+LSF++L 
Sbjct  34    QIRTDMASIYSSDLTSYNSACKEDPDLQSFDSSLHSRTNRVINSLASGAESRSLSFEALI  93

Query  263   EVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARE  442
             EV+GCLL+MN+EVV+ I+E ++D+W N +L  LV  YF++S+K+LDFC A+D C+KRAR 
Sbjct  94    EVSGCLLEMNQEVVRFIIESREDVWDNKDLTSLVNAYFDSSIKTLDFCNAVDHCVKRARI  153

Query  443   SQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQAL  622
              Q++I  A+K+FE ES   +   + Y +TL+EL  F+ASG+PF  +FF +F+SVY QQ +
Sbjct  154   GQMIIQFAVKQFEMESSSPEPGAHNYAKTLQELNKFKASGDPFDGDFFMLFESVYEQQVM  213

Query  623   MLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaat  802
             +LE L  +K KLDKKL+ I  W+K+S+V+F     +VLI SVV AAIA+P V  A+AAA 
Sbjct  214   LLETLHKQKRKLDKKLKNIKHWKKISNVVFVTAFVSVLIFSVVAAAIAAPPVVTAVAAAL  273

Query  803   aipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESL  982
             A+P+GS+GKW   L K YE A++  K+++ SM+VG +IT+KD++ I+V  D+L++E+E++
Sbjct  274   AVPLGSVGKWCSHLWKKYETAVRREKDVVLSMKVGAHITMKDMENIRVHVDKLKIEMEAM  333

Query  983   LNTTSFAINEA----AVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRI  1150
             +    FAI E     AV++ ++EI K+ D+F + +E++G  A  CS+DI  ART++L+ I
Sbjct  334   MQRVDFAIEEGEEEVAVRLSMQEISKRFDVFTERIEEVGENAAKCSKDITLARTIVLRHI  393

Query  1151  IKHP  1162
             +  P
Sbjct  394   LSFP  397



>ref|XP_010444753.1| PREDICTED: UPF0496 protein At5g66675-like [Camelina sativa]
 ref|XP_010444754.1| PREDICTED: UPF0496 protein At5g66675-like [Camelina sativa]
 ref|XP_010444755.1| PREDICTED: UPF0496 protein At5g66675-like [Camelina sativa]
Length=418

 Score =   325 bits (833),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 187/373 (50%), Positives = 266/373 (71%), Gaps = 19/373 (5%)
 Frame = +2

Query  104   QCRTDL-------ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLK  262
             Q RTD+       +S+Y +AC  D DLQ+FDS+L  RTN VI++LA G E R+LSFD+L 
Sbjct  30    QIRTDIGSLYSADLSAYNSACREDPDLQSFDSSLHQRTNRVINSLASGSETRSLSFDALI  89

Query  263   EVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARE  442
             EV+GCLL+MN+EVV+ I+E K+D W N +L  LV  YF++S+K+LDFC A+D C+KRAR 
Sbjct  90    EVSGCLLEMNQEVVRFIIESKEDAWDNKDLTCLVNAYFDSSIKTLDFCNAVDSCVKRARI  149

Query  443   SQLLIHLALKEFE-EESGGIDGS-------NNKYERTLEELKGFRASGNPFTEEFFQIFQ  598
              Q+L+  ALK+FE EES G + +        NKY +TLEEL  F+ASG+PF  +FF +F+
Sbjct  150   GQMLLQFALKQFEMEESSGTNNNKSAEPRGTNKYAKTLEELNKFKASGDPFDGDFFMLFE  209

Query  599   SVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspav  778
             SVY QQ ++LE L  +K KLDKKL+ I  W+K+S+V+F  T  +VLI SVV AA+A+P V
Sbjct  210   SVYEQQVMLLEVLHKQKRKLDKKLKNIKHWKKISNVVFVTTFVSVLIFSVVAAAVAAPPV  269

Query  779   agalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADR  958
               A+AAA A+PIGS+GKW + L K YE A+KG K+I+ SM++G Y+T+KD+D I+V  D+
Sbjct  270   VTAVAAALAVPIGSIGKWCNHLWKKYETAVKGQKDIVLSMRIGAYVTMKDMDNIRVHVDK  329

Query  959   LELEIESLLNTTSFAIN----EAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRA  1126
             L++E+ES++    FA+     E AV++ + EI KK D+F + +E++G  A  CS+DI  A
Sbjct  330   LKIEMESMMQKVDFALKEKEEEVAVRLSMHEISKKFDVFTERIEEVGENAAKCSKDITLA  389

Query  1127  RTVILQRIIKHPN  1165
             RT++L+ I+  P+
Sbjct  390   RTIVLRHILSFPS  402



>ref|XP_010484602.1| PREDICTED: UPF0496 protein At5g66675 [Camelina sativa]
 ref|XP_010484603.1| PREDICTED: UPF0496 protein At5g66675 [Camelina sativa]
 ref|XP_010484604.1| PREDICTED: UPF0496 protein At5g66675 [Camelina sativa]
 ref|XP_010484605.1| PREDICTED: UPF0496 protein At5g66675 [Camelina sativa]
Length=417

 Score =   325 bits (833),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 187/373 (50%), Positives = 266/373 (71%), Gaps = 19/373 (5%)
 Frame = +2

Query  104   QCRTDL-------ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLK  262
             Q RTD+       +S+Y +AC  D DLQ+FDS+L  RTN VI++LA G E R+LSFD+L 
Sbjct  30    QIRTDIGSLYSADLSAYNSACREDPDLQSFDSSLHQRTNRVINSLASGSETRSLSFDALI  89

Query  263   EVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARE  442
             EV+GCLL+MN+EVV+ I+E K+D W N +L  LV  YF++S+K+LDFC A+D C+KRAR 
Sbjct  90    EVSGCLLEMNQEVVRFIIESKEDAWDNKDLTCLVNAYFDSSIKTLDFCNAVDSCVKRARI  149

Query  443   SQLLIHLALKEFE-EESGGIDGSN-------NKYERTLEELKGFRASGNPFTEEFFQIFQ  598
              Q+L+  ALK+FE EES G + +        NKY +TLEEL  F+ASG+PF  +FF +F+
Sbjct  150   GQMLLQFALKQFEMEESSGTNNNKSAEPRVANKYAKTLEELNKFKASGDPFDGDFFMLFE  209

Query  599   SVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspav  778
             SVY QQ ++LE L  +K KLDKKL+ I  W+K+S+V+F  T  +VLI SVV AA+A+P V
Sbjct  210   SVYEQQVMLLEVLHKQKRKLDKKLKNIKHWKKISNVVFVTTFVSVLIFSVVAAAVAAPPV  269

Query  779   agalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADR  958
               A+AAA A+PIGS+GKW + L K YE A+KG K+I+ SM++G Y+T+KD+D I+V  D+
Sbjct  270   VTAVAAALAVPIGSIGKWCNHLWKKYETAVKGQKDIVLSMRIGAYVTMKDMDNIRVHVDK  329

Query  959   LELEIESLLNTTSFAIN----EAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRA  1126
             L++E+ES++    FA+     E AV++ + EI KK D+F + +E++G  A  CS+DI  A
Sbjct  330   LKIEMESMMQKVDFALKEKEEEVAVRLSMHEISKKFDVFTERIEEVGENAAKCSKDITLA  389

Query  1127  RTVILQRIIKHPN  1165
             RT++L+ I+  P+
Sbjct  390   RTIVLRHILSFPS  402



>ref|XP_011025711.1| PREDICTED: UPF0496 protein At2g18630 [Populus euphratica]
Length=379

 Score =   323 bits (829),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 203/381 (53%), Positives = 274/381 (72%), Gaps = 11/381 (3%)
 Frame = +2

Query  53    IMGGHMSKKSGE--TSNDLQCRTDL-----ISSYEAACELDADLQTFDSTLQARTNHVIS  211
             +MGG  SK       S  LQ  T+      +S YE AC+ D +LQ+FD+ L  RTNHVI+
Sbjct  1     MMGGQSSKTKASDIPSLPLQANTNSQLTEDLSLYEDACKRDPELQSFDAALHERTNHVIN  60

Query  212   TLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLK  391
             +L  GVE+  LS  S KEVT CLL+MN++VVKVILE K+DIW N ELF LVEEYFENS+K
Sbjct  61    SLTTGVEI--LSLGSFKEVTNCLLEMNQDVVKVILESKEDIWNNRELFGLVEEYFENSVK  118

Query  392   SLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGS-NNKYERTLEELKGFRASGNP  568
             +++FCAAL+  LKRA+ SQL+I  A+K+FEEE    DG+   K+ +TLE L+ F+A+G+P
Sbjct  119   TMEFCAALESSLKRAQNSQLIIQFAIKQFEEEVEMQDGAVGKKFVKTLEGLEKFKAAGDP  178

Query  569   FTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsv  748
             FT +FF +F SV  QQ  ML+KLQSRK KLDKK++ +  WR+VS+V+F +   +VLI SV
Sbjct  179   FTPQFFALFHSVSEQQVSMLKKLQSRKKKLDKKMKSMKTWRRVSNVLFVSVFVSVLIISV  238

Query  749   vtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKD  928
             V AA+A+P V  ALA A A+P+GS+GKW + L   YE A+K  KE++ SMQVGT++TI D
Sbjct  239   VAAAVAAPPVLTALAGAMAVPVGSVGKWCNMLWNRYEKALKEQKELVRSMQVGTFVTIND  298

Query  929   LDTIKVLADRLELEIESLLNTTSFAINEA-AVKVGIEEIRKKLDLFMKNVEDLGVQADNC  1105
             + +I+VL  +L++ I+SLL+   FAI E  AVK+ I+EI+KK+ +FM+ VEDL   AD C
Sbjct  299   MASIRVLVIKLQMGIQSLLDNADFAIREEDAVKLVIDEIKKKMAVFMEIVEDLAAHADKC  358

Query  1106  SRDIRRARTVILQRIIKHPNH  1168
             +RDI  ART+IL RI+K+ + 
Sbjct  359   NRDISLARTMILNRILKYADQ  379



>ref|XP_010550396.1| PREDICTED: UPF0496 protein At5g66675-like [Tarenaya hassleriana]
Length=410

 Score =   323 bits (828),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 176/348 (51%), Positives = 256/348 (74%), Gaps = 4/348 (1%)
 Frame = +2

Query  122   ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEV  301
             +S YE+AC  D DL++FDS+L  RTN VIS++A     +  SFDSL EV+GCLL+MN EV
Sbjct  44    LSYYESACREDPDLRSFDSSLHRRTNRVISSIASRAGTQPFSFDSLVEVSGCLLEMNHEV  103

Query  302   VKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFE  481
             V+ I+E ++D+W N +L  LV  YF++++K+LDFC A++ C++RAR SQL+I  A+K++E
Sbjct  104   VRFIVESREDVWDNKDLTSLVNAYFDSTIKTLDFCNAVENCVRRARISQLIIRFAVKQYE  163

Query  482   EESGGID-GSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKL  658
              ES  +D G+NNKY +TLEEL  F+A+ +PF E+FF +F+SVY QQ L+LE+L  +K KL
Sbjct  164   IESQDVDKGNNNKYPKTLEELNKFKAASDPFDEDFFALFESVYEQQVLLLEELHKQKMKL  223

Query  659   DKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWID  838
             DKK++ I  WRKVS+V+F     +VLI S+V AA+A+P V  A+AAA A+PIGS+GK  +
Sbjct  224   DKKMKNIKTWRKVSNVVFMTAFVSVLIFSIVAAAVAAPPVVTAVAAAMAVPIGSVGKLCN  283

Query  839   SLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINE--  1012
              L K Y+ A+KG K I+ SM++G Y+ +KD++ I VL D+L++EIES+L+   FA+ E  
Sbjct  284   YLWKKYDTAVKGQKGIVLSMKIGAYVAMKDMENIGVLVDKLKIEIESMLHKVDFALKEEE  343

Query  1013  -AAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRII  1153
               AV++ I EI +KLD+F + +E++G  A  CS+DI  ARTV+L+ I+
Sbjct  344   DVAVRLAIHEISRKLDVFTEKIEEVGENAAKCSKDITLARTVVLRHIL  391



>gb|KHN44506.1| UPF0496 protein [Glycine soja]
Length=354

 Score =   321 bits (822),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 190/369 (51%), Positives = 253/369 (69%), Gaps = 35/369 (9%)
 Frame = +2

Query  56    MGGHMSKK-SGETSNDLQCRTDLI-----SSYEAACELDADLQTFDSTLQARTNHVISTL  217
             MGG  SK  S E+   ++  T  +     SSYEAAC  D +LQ+FD ++Q  TN VIS+L
Sbjct  1     MGGQSSKMFSVESPTPIKMGTHSLYAADLSSYEAACVKDPNLQSFDVSIQEHTNRVISSL  60

Query  218   AVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSL  397
             A GVEVR+LSFDSL+E+T  LL+MN+EVVKVIL+CKKDIW N ELF LV +YF NSL++L
Sbjct  61    AHGVEVRSLSFDSLREMTDSLLEMNQEVVKVILDCKKDIWGNSELFSLVNDYFNNSLQTL  120

Query  398   DFCAALDKCLKRARESQLLIHLALKEFEEES-GGIDGSNNKYERTLEELKGFRASGNPFT  574
             +FC +L+KCL+RARE+Q+++   +  FEEE   G DG    Y +TL+ELK F+ + +PFT
Sbjct  121   EFCNSLEKCLRRARENQMIVKSVVTYFEEEGQNGADGVT--YVKTLQELKKFKDARDPFT  178

Query  575   EEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvt  754
             EEF+ +FQSVY QQA ML+KLQ RK KLDKKL+ +  WR+VS+ +F A   +VLI SVV 
Sbjct  179   EEFYLLFQSVYAQQASMLQKLQIRKRKLDKKLKSLKTWRRVSNAIFVAAFVSVLIFSVVA  238

Query  755   aaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLD  934
             A+IA+P                           YE A+KG +E+ISSMQ+GT+I++KDLD
Sbjct  239   ASIAAP-------------------------PRYEKALKGQREVISSMQIGTFISLKDLD  273

Query  935   TIKVLADRLELEIESLLNTTSFAI-NEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSR  1111
              I+VL ++LE  +ESLL    FAI NE  +K  I+EI+KK++ F + +E+L   AD C R
Sbjct  274   NIRVLVNKLEGVLESLLQNADFAIKNEDVMKFAIDEIKKKIEAFSETMENLSTHADKCCR  333

Query  1112  DIRRARTVI  1138
              IRRARTV+
Sbjct  334   QIRRARTVV  342



>gb|AFK35402.1| unknown [Lotus japonicus]
Length=352

 Score =   319 bits (818),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 190/345 (55%), Positives = 256/345 (74%), Gaps = 12/345 (3%)
 Frame = +2

Query  56    MGGHMSKKS---GETSNDLQCRT----DLISSYEAACELDADLQTFDSTLQARTNHVIST  214
             MGG  SK S     TS ++   +    DL SSYEA C  D  LQ+FD+T+Q  TN VIS+
Sbjct  1     MGGQSSKMSSVDAPTSINMGTHSLYAADL-SSYEATCVKDPSLQSFDATIQGHTNRVISS  59

Query  215   LAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKS  394
             LA GVEVR+LSFDSL+EVT  LL+MN+EVVKVIL+CKKDIW N ELF LV +YF+NSL++
Sbjct  60    LAHGVEVRSLSFDSLREVTDSLLEMNQEVVKVILDCKKDIWGNKELFALVNDYFDNSLQT  119

Query  395   LDFCAALDKCLKRARESQLLIHLALKEFEEE-SGGIDGSNNKYERTLEELKGFRASGNPF  571
             L+FC +L+KCL+RARE+Q+++   +  F+EE   G++     Y +TL+ELK F+ +G+PF
Sbjct  120   LEFCNSLEKCLRRARENQVIVKSVITYFDEELQNGVEVG--AYVKTLQELKNFKDAGDPF  177

Query  572   TEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvv  751
             TE+F+ +FQS Y QQALML+KLQ RK KLDKK + +  W++VS+ +F A   +VLI SVV
Sbjct  178   TEDFYSLFQSTYTQQALMLQKLQIRKRKLDKKFKSLKTWKRVSNAIFVAAFVSVLIFSVV  237

Query  752   taaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDL  931
              A++A+P V  ALAAA A+PIGS+GKW +SL K Y+ A+   +E+ISSMQVGTYI++KDL
Sbjct  238   AASVAAPPVVTALAAAMAVPIGSVGKWCNSLFKRYKKALMKQREVISSMQVGTYISLKDL  297

Query  932   DTIKVLADRLELEIESLLNTTSFAI-NEAAVKVGIEEIRKKLDLF  1063
             D I+VL D+LEL++ESLL    FA+ NE  +K+ I+EI+K  + F
Sbjct  298   DNIRVLTDKLELQLESLLQNADFALRNEDVIKIAIDEIKKNRNFF  342



>ref|XP_006383250.1| hypothetical protein POPTR_0005s12870g [Populus trichocarpa]
 gb|ERP61047.1| hypothetical protein POPTR_0005s12870g [Populus trichocarpa]
Length=381

 Score =   320 bits (820),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 185/371 (50%), Positives = 257/371 (69%), Gaps = 4/371 (1%)
 Frame = +2

Query  50    KIMGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGV  229
             K  GG +     ++    Q   D  SSYE AC+LD  LQ+FD+TL  +TNHVI++L+ G 
Sbjct  9     KTRGGDIPPPPVQSITHSQFAEDF-SSYEDACKLDPCLQSFDATLMEKTNHVINSLSTG-  66

Query  230   EVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCA  409
             ++   S  S K VT CLL+MN++VVK ILE K+DIW N ELF LV+EYF +S+K++DFC 
Sbjct  67    DIATGSSGSFKAVTNCLLEMNQDVVKFILESKEDIWNNPELFALVDEYFGSSIKTMDFCT  126

Query  410   ALDKCLKRARESQLLIHLALKEFEEESGGIDGS-NNKYERTLEELKGFRASGNPFTEEFF  586
              L+ C+  AR SQL I  A+  FE+E    DG    KY +TLEEL+ F  +G+PFT +FF
Sbjct  127   ELESCVTSARTSQLNIMAAIAHFEKEVELQDGVIEKKYVKTLEELQKFMVAGDPFTPKFF  186

Query  587   QIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaia  766
              + QSVY QQ  ML+KLQS K KLDKKL+ +  WR+VS+V+F +    V+I +V  AAIA
Sbjct  187   MLLQSVYEQQVSMLKKLQSHKRKLDKKLKSVKIWRRVSNVLFVSVFVTVMIFAVAAAAIA  246

Query  767   spavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKV  946
             +P V  ALA+A A P+ S+G W + L   YE+A+K  K +++++QVGT+ITIKD+++I+V
Sbjct  247   APPVVTALASALADPMRSVGTWCNLLWHRYENALKEQKVLVNAIQVGTFITIKDMESIRV  306

Query  947   LADRLELEIESLLNTTSFAINEA-AVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRR  1123
             L ++LE+EI+SLL+   FAI E   VK+ I+E++KK+ +FM+  EDL  QA  C+RDI R
Sbjct  307   LVNKLEIEIKSLLHHADFAIREEDVVKLVIDELKKKMAVFMETFEDLAAQAHRCNRDIIR  366

Query  1124  ARTVILQRIIK  1156
              RT+I QRII+
Sbjct  367   GRTMISQRIIE  377



>sp|A2Z6C5.1|U496E_ORYSI RecName: Full=Putative UPF0496 protein 5 [Oryza sativa Indica 
Group]
Length=428

 Score =   320 bits (820),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 184/327 (56%), Positives = 252/327 (77%), Gaps = 3/327 (1%)
 Frame = +2

Query  128   SYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVK  307
             SYEAAC  D +L TFD+ L+ R +  I+ +A GVEVR+LS  SL+EVTGCLLDMN+EVV+
Sbjct  35    SYEAACSADPELGTFDTALRRRASRAITAVASGVEVRSLSLGSLREVTGCLLDMNQEVVR  94

Query  308   VILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEE  487
             V+L CK+D+WR+ +LF+LVE+YFE SL +LDF AALDK L RAR+SQL++HLA++    E
Sbjct  95    VVLACKRDVWRSPDLFDLVEDYFEGSLHTLDFLAALDKSLHRARDSQLVLHLAVQRHHHE  154

Query  488   SGGIDGSNNK--YERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLD  661
                   ++    Y  TL EL+ F+A+G PFT+EFF  FQ+VY QQ  M+ KL+ RK +LD
Sbjct  155   PPAAAAASASELYASTLGELRQFKAAGEPFTDEFFAAFQTVYRQQMSMVGKLRRRKRRLD  214

Query  662   KKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDS  841
             ++LR +  WR+VS ++F    AA+L+CSVV AAIA+P VA ALA A ++P+GS GKW+DS
Sbjct  215   RRLRSVRVWRRVSGIVFLTAFAALLVCSVVAAAIAAPPVAAALAPAASMPVGSAGKWMDS  274

Query  842   LLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFA-INEAA  1018
             LLK Y+DA+ GHKE++S+MQVGT+I IKDLD+I+VL + LE++I S+ ++  FA  +E A
Sbjct  275   LLKKYQDALHGHKEVVSAMQVGTFIAIKDLDSIRVLVEHLEVQISSMADSVEFAERDEEA  334

Query  1019  VKVGIEEIRKKLDLFMKNVEDLGVQAD  1099
             V+ GI+E++KKL+LFMK+V+DLG QAD
Sbjct  335   VRFGIDEVKKKLELFMKSVDDLGEQAD  361



>ref|XP_010465078.1| PREDICTED: UPF0496 protein At5g66675-like [Camelina sativa]
 ref|XP_010465086.1| PREDICTED: UPF0496 protein At5g66675-like [Camelina sativa]
 ref|XP_010465095.1| PREDICTED: UPF0496 protein At5g66675-like [Camelina sativa]
Length=412

 Score =   318 bits (816),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 184/367 (50%), Positives = 263/367 (72%), Gaps = 13/367 (4%)
 Frame = +2

Query  104   QCRTDL-------ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLK  262
             Q RTD+       +S+Y +AC  D DLQ+FDS+L  RTN VI++LA G E R+LSFD+L 
Sbjct  30    QIRTDIGSLYSADLSAYNSACREDPDLQSFDSSLHQRTNRVINSLASGSETRSLSFDALI  89

Query  263   EVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARE  442
             EV+GCLL+MN+EVV+ I+E K+D W N +L  LV  YF++S+K+LDFC A+D C+KRAR 
Sbjct  90    EVSGCLLEMNQEVVRFIIESKEDAWDNKDLTCLVNAYFDSSIKTLDFCNAVDNCVKRARI  149

Query  443   SQLLIHLALKEF--EEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQ  616
              Q+L+  ALK+F  EE S   + + NKY +TLE L  F+ASG+PF  +FF +F+SVY QQ
Sbjct  150   GQMLLQFALKQFEMEESSATNNNNTNKYAKTLEGLNKFKASGDPFDGDFFMLFESVYEQQ  209

Query  617   ALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaa  796
              ++LE L  +K KLDKKL+ I  W+K+S+V+F  T  +VLI SVV AA+A+P V  A+AA
Sbjct  210   VMLLEVLHKQKRKLDKKLKNIKHWKKISNVVFVTTFVSVLIFSVVAAAVAAPPVVTAVAA  269

Query  797   ataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIE  976
             A A+PIGS+GKW + L K YE A+KG K+I+ SM++G Y+T+KD+D I+V  D+L++E+E
Sbjct  270   ALAVPIGSIGKWCNHLWKKYETAVKGQKDIVLSMRIGAYVTMKDMDNIRVHVDKLKIEME  329

Query  977   SLLNTTSFAIN----EAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQ  1144
             S++    FA+     E AV++ + EI KK D+F + +E++G  A  CS+DI  ART++L+
Sbjct  330   SMMQKVDFALKEKEEEVAVRLSMHEISKKFDVFTERIEEVGENAAKCSKDITLARTIVLR  389

Query  1145  RIIKHPN  1165
              I+  P+
Sbjct  390   HILSFPS  396



>emb|CDX72478.1| BnaC07g45000D [Brassica napus]
Length=289

 Score =   312 bits (799),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 183/270 (68%), Positives = 226/270 (84%), Gaps = 6/270 (2%)
 Frame = +2

Query  56   MGGHMSKKSGETSNDLQCRTDL----ISSYEAACELDADLQTFDSTLQARTNHVISTLAV  223
            MG   SKKS ETS+     +      + SYEAAC+ D +LQ+FD+ +QART+HVISTLA 
Sbjct  1    MGNQTSKKSHETSSKTTTTSMHYTTELRSYEAACKADTELQSFDTCMQARTSHVISTLAT  60

Query  224  GVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDF  403
            GVEVRALSFDSLKEVT CLL+MN+EVVKVIL+CKKDIW+N+ELFELVE+YFENSLK+LDF
Sbjct  61   GVEVRALSFDSLKEVTECLLEMNQEVVKVILDCKKDIWKNNELFELVEDYFENSLKTLDF  120

Query  404  CAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEF  583
            CAAL+K L++AR+SQLLI +AL++FE+ES  ++G N  YE+TLEELK F+ + +PF E+F
Sbjct  121  CAALEKGLRKARDSQLLILVALQQFEDES-LVEGGNG-YEKTLEELKNFKEAESPFDEDF  178

Query  584  FQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaai  763
            F++FQSVY  Q LMLEKLQ RKNKLDKKL+ IH WRK+SS++F AT A VLICSVV AA+
Sbjct  179  FKMFQSVYKHQMLMLEKLQHRKNKLDKKLKSIHTWRKLSSIIFVATFATVLICSVVAAAM  238

Query  764  aspavagalaaataipigsMGKWIDSLLKN  853
            A+P VA ALAAATAIP+GSMGKW+DSLL++
Sbjct  239  AAPPVAAALAAATAIPLGSMGKWVDSLLRS  268



>gb|KHG21625.1| hypothetical protein F383_27631 [Gossypium arboreum]
Length=427

 Score =   314 bits (804),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 202/382 (53%), Positives = 262/382 (69%), Gaps = 6/382 (2%)
 Frame = +2

Query  26    LAFVFGC--VKIMGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTN  199
             L+ + GC   K  GG+    S +   D Q   DL SSYEAAC  D+ LQ FD TLQ  TN
Sbjct  35    LSAMMGCQSSKTKGGNAESIS-QVKPDSQLEADL-SSYEAACRQDSTLQHFDVTLQEHTN  92

Query  200   HVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFE  379
              VI TLAV   V+++SF++L+EVT CLL+ N+ VVKVILEC++DIW N ELF LVEEYFE
Sbjct  93    SVIGTLAVSSGVQSISFNTLQEVTCCLLETNQAVVKVILECQRDIWNNSELFSLVEEYFE  152

Query  380   NSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSN-NKYERTLEELKGFRA  556
             NS K+LDFC  L+ CLKRAR  QL+I LA+K F+EE G   G N  K+ +TLEEL+ F+ 
Sbjct  153   NSKKTLDFCTMLENCLKRARNDQLIIQLAVKYFDEEVGLEVGVNEKKFVKTLEELRRFKV  212

Query  557   SGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVL  736
             +  PF +EFF +   V  QQ  ML KL  RK KLDKKL+ +  WR+VS+V+F AT  +VL
Sbjct  213   ADKPFPKEFFVLLDLVRKQQESMLGKLLVRKRKLDKKLKSLKTWRRVSNVLFVATFVSVL  272

Query  737   ICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYI  916
             I SVV AA+++P V  ALA+A  +PIGS+GKW  SL K YE  +K    + ++M++   I
Sbjct  273   IFSVVAAAVSAPPVVTALASALTVPIGSVGKWCTSLWKRYEKEVKEQMGLTTTMELFARI  332

Query  917   TIKDLDTIKVLADRLELEIESLLNTTSFAINEA-AVKVGIEEIRKKLDLFMKNVEDLGVQ  1093
             TI D+D I+VL   LE++IESLL T +FA+ E  A+K+ ++EI+KKL  FM+ +E LG Q
Sbjct  333   TIYDMDDIRVLVTNLEIKIESLLKTANFALGEEDALKLAMDEIKKKLGEFMEIIEKLGQQ  392

Query  1094  ADNCSRDIRRARTVILQRIIKH  1159
             AD CS DIR AR VIL R++ H
Sbjct  393   ADKCSHDIRMARAVILHRMMTH  414



>ref|XP_006361572.1| PREDICTED: UPF0496 protein 1-like [Solanum tuberosum]
Length=389

 Score =   311 bits (798),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 165/369 (45%), Positives = 260/369 (70%), Gaps = 2/369 (1%)
 Frame = +2

Query  65    HMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRAL  244
             + S+  G    +    +  +SSY++ACE D +L  FDS LQART+  ++++AV  +  +L
Sbjct  10    NQSRPCGPAKPESDVVSPDLSSYQSACEEDPELGRFDSALQARTSLALNSIAVNSDYNSL  69

Query  245   SFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKC  424
             S +SL++ T C LDMN+ VV  ILE KKDIW++ ++F+LV++Y ++S+  ++FC++LD  
Sbjct  70    SLESLRDATLCFLDMNQGVVNFILESKKDIWKDPDIFDLVKDYLDSSIHIMNFCSSLDDS  129

Query  425   LKRARESQLLIHLALKEFEEESGGIDG-SNNKYERTLEELKGFRASGNPFTEEFFQIFQS  601
             L+RAR SQ +I +AL +FE E  G +G S   +  TL++LK F+A+G+PFT +FF  FQ+
Sbjct  130   LERARNSQSIIQVALTKFENEINGNEGDSELLFTETLQQLKSFKAAGDPFTAKFFSSFQA  189

Query  602   VYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspava  781
             VY  Q  +L KL+S+ +KLDKKL  +  W++VS+++FA    + +ICS+V AA+ +P + 
Sbjct  190   VYTHQNALLTKLKSKMSKLDKKLSRVKTWKRVSNIIFATVFVSAIICSIVAAAVTAPPMV  249

Query  782   galaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRL  961
              ALAAA ++P+G++GKWI+S+ K YED +K  +EI++SM+ GT++ I+DL  I+VL D+L
Sbjct  250   TALAAAASVPLGTVGKWINSMWKKYEDELKRDREILTSMEAGTFLVIQDLVNIQVLVDKL  309

Query  962   ELEIESLLNTTSFAINEA-AVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVI  1138
             ++  E LL++ +FAIN A AV   +EE++K ++ F + +E L   A  CS+DIR ARTVI
Sbjct  310   QIIFEGLLHSANFAINGADAVTTAMEEVKKNVNGFSETIEVLSDHAKKCSQDIRMARTVI  369

Query  1139  LQRIIKHPN  1165
             L+RI+  P+
Sbjct  370   LRRIVSQPS  378



>gb|KCW62869.1| hypothetical protein EUGRSUZ_G00466 [Eucalyptus grandis]
Length=350

 Score =   308 bits (789),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 175/346 (51%), Positives = 244/346 (71%), Gaps = 7/346 (2%)
 Frame = +2

Query  137   AACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVIL  316
             AACE D DLQTF++ LQART+ V+STL+ GV+V ALS DSLKE+T CLL+MN+EVVKVIL
Sbjct  4     AACESDPDLQTFNANLQARTDKVLSTLSSGVDVGALSLDSLKEITECLLEMNQEVVKVIL  63

Query  317   ECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGG  496
             + KKDIWRN ELFELV++YF +SL +LDF A+L+ CLK  R++ L I  AL  FEEE G 
Sbjct  64    DSKKDIWRNEELFELVQDYFNDSLPTLDFYASLENCLKHVRDAHLQIFTALHYFEEEDG-  122

Query  497   IDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRY  676
              +G  + Y + LEEL  F+ +G+PFT+EFF++FQ++Y  Q  ML+KL  +K K++KKL+ 
Sbjct  123   -EGCCS-YSKILEELTKFKENGDPFTKEFFELFQTIYKLQKFMLKKLWIKKKKIEKKLKS  180

Query  677   IHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNY  856
             I  WRK+SS++   T AA+LI           +    +A A A  +  +GKWIDSL K+ 
Sbjct  181   IQMWRKISSMIPVVTFAAILI--YSVTTAMVASPPVVVALAAATAMDVIGKWIDSLWKHC  238

Query  857   EDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINEA--AVKVG  1030
             E+A+K  +E+I+SMQ   ++ +KDLD +++  D LE++++SLL    F I     AVK+G
Sbjct  239   EEALKRREEVITSMQASIFVALKDLDKMRITIDPLEVQMKSLLQKADFPIEAGAEAVKLG  298

Query  1031  IEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPNH  1168
             I +I+KKL  FMK+ + LG   D CSR+I+R+R V+LQ+IIK P +
Sbjct  299   IADIKKKLRDFMKDAKGLGKDVDICSRNIQRSRLVVLQKIIKPPTN  344



>ref|XP_010068116.1| PREDICTED: UPF0496 protein At4g34320-like [Eucalyptus grandis]
Length=361

 Score =   308 bits (789),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 175/346 (51%), Positives = 244/346 (71%), Gaps = 7/346 (2%)
 Frame = +2

Query  137   AACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVIL  316
             AACE D DLQTF++ LQART+ V+STL+ GV+V ALS DSLKE+T CLL+MN+EVVKVIL
Sbjct  15    AACESDPDLQTFNANLQARTDKVLSTLSSGVDVGALSLDSLKEITECLLEMNQEVVKVIL  74

Query  317   ECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGG  496
             + KKDIWRN ELFELV++YF +SL +LDF A+L+ CLK  R++ L I  AL  FEEE G 
Sbjct  75    DSKKDIWRNEELFELVQDYFNDSLPTLDFYASLENCLKHVRDAHLQIFTALHYFEEEDG-  133

Query  497   IDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRY  676
              +G  + Y + LEEL  F+ +G+PFT+EFF++FQ++Y  Q  ML+KL  +K K++KKL+ 
Sbjct  134   -EGCCS-YSKILEELTKFKENGDPFTKEFFELFQTIYKLQKFMLKKLWIKKKKIEKKLKS  191

Query  677   IHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNY  856
             I  WRK+SS++   T AA+LI           +    +A A A  +  +GKWIDSL K+ 
Sbjct  192   IQMWRKISSMIPVVTFAAILI--YSVTTAMVASPPVVVALAAATAMDVIGKWIDSLWKHC  249

Query  857   EDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINEA--AVKVG  1030
             E+A+K  +E+I+SMQ   ++ +KDLD +++  D LE++++SLL    F I     AVK+G
Sbjct  250   EEALKRREEVITSMQASIFVALKDLDKMRITIDPLEVQMKSLLQKADFPIEAGAEAVKLG  309

Query  1031  IEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPNH  1168
             I +I+KKL  FMK+ + LG   D CSR+I+R+R V+LQ+IIK P +
Sbjct  310   IADIKKKLRDFMKDAKGLGKDVDICSRNIQRSRLVVLQKIIKPPTN  355



>ref|XP_010432430.1| PREDICTED: UPF0496 protein At4g34320-like [Camelina sativa]
Length=378

 Score =   306 bits (785),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 167/351 (48%), Positives = 243/351 (69%), Gaps = 12/351 (3%)
 Frame = +2

Query  128   SYEAACELDADLQTFDSTLQARTNHVISTLAVGVEV--RALSFDSLKEVTGCLLDMNKEV  301
             +YEAAC+ D ++Q+FD  +  R ++VISTL+ GV+V  RA+SFDSLK VT  LLDMN+EV
Sbjct  34    TYEAACKEDTEIQSFDRRMHTRMSNVISTLSTGVDVEGRAVSFDSLKVVTESLLDMNQEV  93

Query  302   VKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFE  481
             VK +++CK DIW++ E+FEL  ++F+NS K+LDFC AL++ +     +  LI  A+++FE
Sbjct  94    VKAVMDCKNDIWKHKEVFELAVDFFDNSTKTLDFCYALEESMCLVGSNHQLILSAIRQFE  153

Query  482   EE---SGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKN  652
             +E    GG     N Y++TL+ELK F+ +  PF E+FF++FQ VY QQ LMLEKLQ R  
Sbjct  154   DERLVRGG-----NGYKKTLKELKKFKDAKTPFGEDFFKMFQIVYEQQMLMLEKLQIRTK  208

Query  653   KLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKW  832
             +LD KL+ I  WRK+SS++F AT A +LIC  V AA  +     A   +  +P+GSMGKW
Sbjct  209   RLDIKLKRIRTWRKISSIIFVATYATLLIC-SVVAAAIAAPPVAAALVSVIVPMGSMGKW  267

Query  833   IDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAI-N  1009
             + SL K YE A+KG K++  SMQVGT++ +KDLD I++L  +L+ EI+ ++ +   A+ +
Sbjct  268   LHSLWKKYETAVKGQKDVFFSMQVGTFVAVKDLDNIRLLIQQLDNEIKMMVTSAESAVEH  327

Query  1010  EAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHP  1162
                +K+ I EI+K L +F K +E+LG +AD CS+DI +AR V+  +II H 
Sbjct  328   HDTIKIQIHEIKKVLSVFKKKIEELGNRADLCSKDIIKAREVVFHKIINHT  378



>ref|XP_010042346.1| PREDICTED: UPF0496 protein At4g34320-like [Eucalyptus grandis]
Length=361

 Score =   305 bits (780),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 172/346 (50%), Positives = 241/346 (70%), Gaps = 7/346 (2%)
 Frame = +2

Query  137   AACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVIL  316
             AACE + D +TF++ LQARTN V+STLA GV+V+ LS DSLKE++ CLL+MN+EVVKVIL
Sbjct  15    AACESNPDPRTFNANLQARTNQVLSTLASGVDVQTLSLDSLKEISECLLEMNQEVVKVIL  74

Query  317   ECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGG  496
             + KKDIWRN EL +LV++YF +SL +LDFCA+L+ CLK  R++ L I  AL  FEEE   
Sbjct  75    DSKKDIWRNEELLKLVQDYFNDSLPTLDFCASLENCLKHVRDAHLQIFTALHCFEEEDR-  133

Query  497   IDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRY  676
              +G  + Y + LEEL  F+ +G+PFT EFF++FQ++Y  Q  ML+KL  +K K++KKL+ 
Sbjct  134   -EGCCS-YSKILEELTKFKETGDPFTREFFELFQTIYKLQKFMLKKLWIKKKKIEKKLKS  191

Query  677   IHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNY  856
             I  WRK+SS++   T AA+LI           +    +A A A  +  +GKWIDSL KN 
Sbjct  192   IQMWRKISSMIPVVTFAAILI--YSVTTAMVASPPVVVALAAATAMDVIGKWIDSLWKNC  249

Query  857   EDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINEA--AVKVG  1030
             E+A+K  +E+I+SMQ   ++ +KDLD +++  D LE++++SLL    F I     AVK+G
Sbjct  250   EEALKRREEVITSMQASIFVALKDLDKMRITIDPLEVQMKSLLQKADFPIEAGAEAVKLG  309

Query  1031  IEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPNH  1168
             I +I+KKL  FMK+ + LG   D CSR+I+R+R V+LQRIIK P +
Sbjct  310   IADIKKKLRDFMKDAKGLGKDVDICSRNIQRSRLVVLQRIIKPPTN  355



>gb|KCW62868.1| hypothetical protein EUGRSUZ_G00464 [Eucalyptus grandis]
Length=350

 Score =   304 bits (778),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 172/346 (50%), Positives = 242/346 (70%), Gaps = 7/346 (2%)
 Frame = +2

Query  137   AACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVIL  316
             AACE D D  TF++ LQARTN V+STLA GV+V+ LS DSLKE++ CL++MN+EVVKVIL
Sbjct  4     AACESDPDPGTFNANLQARTNQVLSTLASGVDVQTLSLDSLKEISECLVEMNQEVVKVIL  63

Query  317   ECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGG  496
             + KKDIWRN EL +LV++YF +SL +LDFCA+L+ CLK  R++ L I  AL  FEEE G 
Sbjct  64    DSKKDIWRNEELLKLVQDYFNDSLPTLDFCASLENCLKHVRDAHLQIFTALHCFEEEDG-  122

Query  497   IDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRY  676
              +G  + Y + LEEL  F+ +G+PFT EFF++FQ++Y  Q  ML+KL  +K K++KKL+ 
Sbjct  123   -EGCWS-YSKILEELTKFKETGDPFTREFFELFQTIYKLQKSMLKKLWIKKKKIEKKLKS  180

Query  677   IHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNY  856
             I  WRK+SS++  AT AA+LI           +     A A A  + ++GKWIDSL K+ 
Sbjct  181   IQMWRKISSMISVATFAAILI--YSVTTATVASPPVVAALAAATAMDAIGKWIDSLWKHC  238

Query  857   EDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINEA--AVKVG  1030
             E+A+K  +E+I+SMQ G ++ +KDLD +++  D LE++++SLL    F I     AVK+G
Sbjct  239   EEALKRREEVITSMQAGIFVALKDLDKMRITIDPLEVQMKSLLQKADFPIEAGAEAVKLG  298

Query  1031  IEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPNH  1168
             I +I+KKL  FMK+ + LG   D CS +I+R+R V+LQ+IIK P +
Sbjct  299   IADIKKKLRDFMKDAKGLGKDVDMCSCNIQRSRLVVLQKIIKPPTN  344



>ref|XP_010068114.1| PREDICTED: UPF0496 protein At4g34320-like [Eucalyptus grandis]
Length=361

 Score =   304 bits (778),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 172/346 (50%), Positives = 242/346 (70%), Gaps = 7/346 (2%)
 Frame = +2

Query  137   AACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVIL  316
             AACE D D  TF++ LQARTN V+STLA GV+V+ LS DSLKE++ CL++MN+EVVKVIL
Sbjct  15    AACESDPDPGTFNANLQARTNQVLSTLASGVDVQTLSLDSLKEISECLVEMNQEVVKVIL  74

Query  317   ECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGG  496
             + KKDIWRN EL +LV++YF +SL +LDFCA+L+ CLK  R++ L I  AL  FEEE G 
Sbjct  75    DSKKDIWRNEELLKLVQDYFNDSLPTLDFCASLENCLKHVRDAHLQIFTALHCFEEEDG-  133

Query  497   IDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRY  676
              +G  + Y + LEEL  F+ +G+PFT EFF++FQ++Y  Q  ML+KL  +K K++KKL+ 
Sbjct  134   -EGCWS-YSKILEELTKFKETGDPFTREFFELFQTIYKLQKSMLKKLWIKKKKIEKKLKS  191

Query  677   IHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNY  856
             I  WRK+SS++  AT AA+LI           +     A A A  + ++GKWIDSL K+ 
Sbjct  192   IQMWRKISSMISVATFAAILI--YSVTTATVASPPVVAALAAATAMDAIGKWIDSLWKHC  249

Query  857   EDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINEA--AVKVG  1030
             E+A+K  +E+I+SMQ G ++ +KDLD +++  D LE++++SLL    F I     AVK+G
Sbjct  250   EEALKRREEVITSMQAGIFVALKDLDKMRITIDPLEVQMKSLLQKADFPIEAGAEAVKLG  309

Query  1031  IEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPNH  1168
             I +I+KKL  FMK+ + LG   D CS +I+R+R V+LQ+IIK P +
Sbjct  310   IADIKKKLRDFMKDAKGLGKDVDMCSCNIQRSRLVVLQKIIKPPTN  355



>ref|XP_002869154.1| hypothetical protein ARALYDRAFT_353391 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45413.1| hypothetical protein ARALYDRAFT_353391 [Arabidopsis lyrata subsp. 
lyrata]
Length=327

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 181/371 (49%), Positives = 234/371 (63%), Gaps = 51/371 (14%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEV  235
             MG   S+KS ETS   +  T  + SYEAAC+ D ++Q+FD  +QART+HVISTL  GVEV
Sbjct  1     MGNKTSRKSKETS--ARNYTTELRSYEAACKEDMEIQSFDKRMQARTSHVISTLPTGVEV  58

Query  236   RALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAAL  415
             RALSFDSLK VT  LLDMN+EVVKVIL+CKKD+          EE             + 
Sbjct  59    RALSFDSLKVVTESLLDMNQEVVKVILDCKKDM----------EE-------------SR  95

Query  416   DKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIF  595
             +  L+R R S LLI  AL +FEEES  +    N Y++TLEELK F+ +  PF ++F ++F
Sbjct  96    NGGLQRVRVSHLLILGALHQFEEES--LIQYGNGYKKTLEELKRFKDTERPFDQDFIKMF  153

Query  596   QSVYVQQALMLEKLQSRKNKLDKKLR-YIHAWRKVSSVMFAATLAAVLICsvvtaaiasp  772
             QSVY QQ LMLEKLQ  K K  ++ + + H  + +   +         +C          
Sbjct  154   QSVYKQQMLMLEKLQLCKKKARQEAQAHPHMAKSLQHHLHG------YVC----------  197

Query  773   avagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLA  952
                         P+GSMGKWIDSL KNYE+AIKG K +ISSMQ GTY+ +KDLD I+ L 
Sbjct  198   -------HYAMAPLGSMGKWIDSLWKNYENAIKGQKGVISSMQAGTYVAVKDLDNIRDLI  250

Query  953   DRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRART  1132
             +RL+++I  ++    FA+   AVK+GI  I+KKL++F KNVE LG+QAD CSR+I +ART
Sbjct  251   ERLDIKIRGMVKNAEFAVEHDAVKIGINVIKKKLEVFQKNVEALGIQADICSREIIKART  310

Query  1133  VILQRIIKHPN  1165
             VILQRII HPN
Sbjct  311   VILQRIINHPN  321



>ref|XP_010027373.1| PREDICTED: UPF0496 protein At4g34320-like [Eucalyptus grandis]
Length=361

 Score =   302 bits (774),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 171/346 (49%), Positives = 240/346 (69%), Gaps = 7/346 (2%)
 Frame = +2

Query  137   AACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVIL  316
             AACE D D +TF++ LQARTN V+STLA GV+V+ LS DSLKE++ CLL+MN+EVVKVIL
Sbjct  15    AACESDPDPRTFNANLQARTNQVLSTLASGVDVQTLSLDSLKEISECLLEMNQEVVKVIL  74

Query  317   ECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGG  496
             + KKDIWRN EL +LV++YF +SL +LDFCA+L+ CLK  R++ L I  AL  FEEE G 
Sbjct  75    DSKKDIWRNEELLKLVQDYFNDSLPTLDFCASLENCLKHVRDAHLQIFTALHCFEEEDG-  133

Query  497   IDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRY  676
              +G  + Y + LEEL  F+ +G+PFT EFF++FQ++Y  Q  ML+KL  +K K++KKL+ 
Sbjct  134   -EGCCS-YTKILEELTKFKETGDPFTREFFELFQTIYKLQKFMLKKLWIKKKKIEKKLKS  191

Query  677   IHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNY  856
             I  WRK+SS++   T AA++I           +    +A A A  +  +GKWIDSL K+ 
Sbjct  192   IQIWRKISSMIPVVTFAAIII--YSVTTAMVASPPVVVALAAATAMDVIGKWIDSLWKHC  249

Query  857   EDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINEA--AVKVG  1030
             E+A+K  +E+I+SMQ G +  +KDLD +++  D LE++++SL     F I     AVK+G
Sbjct  250   EEALKRREEVITSMQAGIFSALKDLDKMRITIDPLEVQMKSLFKKADFPIEAGAEAVKLG  309

Query  1031  IEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPNH  1168
             I +I+KKL  FMK+ + LG   D CS +I+R+R V+LQRIIK P +
Sbjct  310   IADIKKKLRDFMKDAKGLGKDVDMCSCNIQRSRLVVLQRIIKPPTN  355



>gb|KCW62329.1| hypothetical protein EUGRSUZ_H04971 [Eucalyptus grandis]
Length=350

 Score =   301 bits (772),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 171/346 (49%), Positives = 240/346 (69%), Gaps = 7/346 (2%)
 Frame = +2

Query  137   AACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVIL  316
             AACE D D +TF++ LQARTN V+STLA GV+V+ LS DSLKE++ CLL+MN+EVVKVIL
Sbjct  4     AACESDPDPRTFNANLQARTNQVLSTLASGVDVQTLSLDSLKEISECLLEMNQEVVKVIL  63

Query  317   ECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGG  496
             + KKDIWRN EL +LV++YF +SL +LDFCA+L+ CLK  R++ L I  AL  FEEE G 
Sbjct  64    DSKKDIWRNEELLKLVQDYFNDSLPTLDFCASLENCLKHVRDAHLQIFTALHCFEEEDG-  122

Query  497   IDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRY  676
              +G  + Y + LEEL  F+ +G+PFT EFF++FQ++Y  Q  ML+KL  +K K++KKL+ 
Sbjct  123   -EGCCS-YTKILEELTKFKETGDPFTREFFELFQTIYKLQKFMLKKLWIKKKKIEKKLKS  180

Query  677   IHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNY  856
             I  WRK+SS++   T AA++I           +    +A A A  +  +GKWIDSL K+ 
Sbjct  181   IQIWRKISSMIPVVTFAAIII--YSVTTAMVASPPVVVALAAATAMDVIGKWIDSLWKHC  238

Query  857   EDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINEA--AVKVG  1030
             E+A+K  +E+I+SMQ G +  +KDLD +++  D LE++++SL     F I     AVK+G
Sbjct  239   EEALKRREEVITSMQAGIFSALKDLDKMRITIDPLEVQMKSLFKKADFPIEAGAEAVKLG  298

Query  1031  IEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPNH  1168
             I +I+KKL  FMK+ + LG   D CS +I+R+R V+LQRIIK P +
Sbjct  299   IADIKKKLRDFMKDAKGLGKDVDMCSCNIQRSRLVVLQRIIKPPTN  344



>emb|CDP02406.1| unnamed protein product [Coffea canephora]
Length=311

 Score =   298 bits (764),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 169/299 (57%), Positives = 227/299 (76%), Gaps = 6/299 (2%)
 Frame = +2

Query  287   MNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLA  466
             MN+EVV VIL+CKKDIW++ +L++LV +YFENSL+SLDFC AL+ CLKR+  +Q ++ LA
Sbjct  1     MNQEVVNVILQCKKDIWKDQDLYDLVNDYFENSLQSLDFCTALEACLKRSLHTQSIVLLA  60

Query  467   LKEFEEESGGIDG-----SNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLE  631
             L++FEEE           S N Y +TL+EL  F+A+G+PFT+EFF +FQ VY QQ LMLE
Sbjct  61    LQKFEEEHENAQAHSQEESVNPYPKTLQELSNFKATGDPFTQEFFSLFQDVYKQQVLMLE  120

Query  632   KLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataip  811
             KLQ++K KLDKKL+ +  WRKVS+V+F A   +VLICSVV AA+ +P V  ALAAA A+P
Sbjct  121   KLQAKKRKLDKKLKSMKGWRKVSNVIFIAAFVSVLICSVVAAAVTAPPVVTALAAAAAVP  180

Query  812   igsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNT  991
             +GSMGKW++S+    E  +KG +E+I SMQ+G Y+ IKDLD+I+VL D+L++EIE+LL T
Sbjct  181   LGSMGKWLNSIWSKCERDLKGQREVIFSMQIGNYVVIKDLDSIRVLVDKLQIEIEALLQT  240

Query  992   TSFAINE-AAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
               FA+ E  AV + + EI+KK+  FMK ++DL   AD CSRDIRRAR VIL+RII +P+
Sbjct  241   ADFAMREDEAVVIAVTEIKKKVSGFMKTIQDLNDHADKCSRDIRRARAVILRRIINYPS  299



>ref|XP_009801742.1| PREDICTED: UPF0496 protein 1-like [Nicotiana sylvestris]
Length=400

 Score =   301 bits (771),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 176/370 (48%), Positives = 268/370 (72%), Gaps = 3/370 (1%)
 Frame = +2

Query  86    ETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKE  265
             ETS++     DL SSY++ACE D +LQ FDS LQART+  ++++AV ++ R+LS DSL+E
Sbjct  29    ETSSNSDISPDL-SSYQSACEEDPELQRFDSALQARTSLALNSIAVNMDPRSLSLDSLRE  87

Query  266   VTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARES  445
             VT C LDMN+ VV  ILE KKDIW++ +LF+LV++Y E+S+  ++FC++LD  L+RAR S
Sbjct  88    VTLCFLDMNQGVVNFILESKKDIWKDPDLFDLVKDYLESSIHIMNFCSSLDDSLERARTS  147

Query  446   QLLIHLALKEFEEESGGIDG-SNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQAL  622
             Q +I +AL +FE ES G +G S   +  TLE+LK F+A+G+PFT  FF  F SVY+QQ  
Sbjct  148   QSIILVALTKFENESSGNEGDSKLLFSETLEQLKSFKAAGDPFTARFFSSFHSVYLQQEA  207

Query  623   MLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaat  802
             +L KL+S+KNKLDKKL  +  W++VS+++FA    + +ICS+V AA+ +P +  ALAAA 
Sbjct  208   LLMKLKSKKNKLDKKLSRVKTWKRVSNIIFATVFVSAIICSIVAAAVTAPPIVTALAAAA  267

Query  803   aipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESL  982
             ++P+G++GKWI+S+ K YED +K  +EI++SM+ G+++ I+DL+ I+VLAD+L++ +E L
Sbjct  268   SVPLGTVGKWINSMWKKYEDELKREREILTSMEAGSFVVIQDLEHIRVLADKLQIIVEGL  327

Query  983   LNTTSFAINEA-AVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKH  1159
             L++  FAI    AV   +EE++K ++ F + +E L   A  C++DIR AR VIL++I+  
Sbjct  328   LHSADFAIRGTDAVASAMEEVKKNVNGFSETIEVLSQHAKKCNQDIRMARAVILRKIVSQ  387

Query  1160  PNH*GTRMGI  1189
             P+     +G+
Sbjct  388   PSSSNQGIGM  397



>ref|XP_010066381.1| PREDICTED: UPF0496 protein At4g34320-like [Eucalyptus grandis]
Length=361

 Score =   299 bits (766),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 171/346 (49%), Positives = 240/346 (69%), Gaps = 7/346 (2%)
 Frame = +2

Query  137   AACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVIL  316
             AACE D D +TF++ LQARTN V+ TLA GV+V+ LS DSLKE++ CLL+MN+EVVKVI 
Sbjct  15    AACESDPDPRTFNANLQARTNQVLRTLASGVDVQTLSLDSLKEISECLLEMNQEVVKVIY  74

Query  317   ECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGG  496
             + KKDIWRN EL +LV++YF +SL +LDFCA+L+ CLK  R++ L I  AL  FEEE G 
Sbjct  75    DSKKDIWRNEELLKLVQDYFNDSLPTLDFCASLENCLKHVRDAHLQIFTALHCFEEEDG-  133

Query  497   IDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRY  676
              +G  + Y + LEEL  F+ +G+PFT EFF++FQ++Y  Q  ML+KL  +K K++KKL+ 
Sbjct  134   -EGCCS-YSKILEELTKFKETGDPFTREFFELFQTIYKLQKSMLKKLWIKKKKIEKKLKS  191

Query  677   IHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNY  856
             I  WRK+SS++  AT AA+LI           +     A A A  + ++GKWIDSL +N 
Sbjct  192   IQMWRKISSMIPVATFAAILI--YSVTTATVASAPVVAALAAATAMDAIGKWIDSLWRNC  249

Query  857   EDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINEA--AVKVG  1030
             E+A+K  +E+I+SMQ G ++ +KDLD +++  D LE++I+SLL    F I     AVK+ 
Sbjct  250   EEALKRREEVITSMQAGIFVALKDLDKMRITIDPLEVQIKSLLQKADFPIEAGVEAVKLR  309

Query  1031  IEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPNH  1168
             I +I+KKL  FMK+ + LG   + CS +I+R+R V+LQRIIK P +
Sbjct  310   IADIKKKLRDFMKDAKGLGKDVNMCSCNIQRSRLVVLQRIIKPPTN  355



>ref|XP_004250688.1| PREDICTED: UPF0496 protein 1-like [Solanum lycopersicum]
Length=407

 Score =   300 bits (768),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 159/350 (45%), Positives = 250/350 (71%), Gaps = 2/350 (1%)
 Frame = +2

Query  122   ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEV  301
             +SSYE+ACE D +L  FDS L+ART+  ++++AV  +  +LS +SL++VT C LDMN+ V
Sbjct  26    LSSYESACEEDPELGRFDSALKARTSLALNSIAVNSDYNSLSLESLRDVTLCFLDMNQGV  85

Query  302   VKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFE  481
             V  ILE KKDIW++ ++F+LV++Y ++S+  ++FC++LD  L+RAR SQ +I +AL +FE
Sbjct  86    VNFILESKKDIWKDPDIFDLVKDYLDSSIHIMNFCSSLDDSLERARNSQSIIQVALTKFE  145

Query  482   EESGGIDG-SNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKL  658
              E  G  G S   +  TL++ K F+A+G+PFT +FF  FQ+VY  Q  +L KL+S+ +KL
Sbjct  146   NEINGNQGDSQLLFTETLQQFKSFKAAGDPFTAKFFSSFQAVYTHQNALLTKLKSKMSKL  205

Query  659   DKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWID  838
             DKKL  +  W++VS+++FA    + +ICS+V AA+ +P +  ALAAA ++P+G++GKWI+
Sbjct  206   DKKLNRVKTWKRVSNIIFATVFVSAIICSIVAAAVTAPPMVTALAAAASVPLGTVGKWIN  265

Query  839   SLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINEA-  1015
             S+   YED +K  + I++SM+ GT++ I+DL  I+VL D+L++  E LL++ +FAIN A 
Sbjct  266   SMWNKYEDELKRDRGILNSMEAGTFLVIQDLVNIQVLVDKLQIIFEGLLHSANFAINGAD  325

Query  1016  AVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
             +V   +EE++K ++ F + +E L   A  CS+DI  ARTVIL+RI+  P+
Sbjct  326   SVTSAMEEVKKNVNGFSETIELLSDHAKKCSQDISMARTVILRRIVSQPS  375



>ref|XP_010451056.1| PREDICTED: UPF0496 protein At4g34320-like [Camelina sativa]
Length=317

 Score =   295 bits (756),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 171/314 (54%), Positives = 220/314 (70%), Gaps = 17/314 (5%)
 Frame = +2

Query  56   MGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEV  235
            MG   SK S +TS  +  R   + +YEAAC+ D ++Q+FD+ + ART+HVISTLA  VEV
Sbjct  1    MGNRTSKNSMKTSAKVYTRE--LRAYEAACKEDTEIQSFDTRMHARTSHVISTLAKDVEV  58

Query  236  RALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAAL  415
            RALSFDSLKEVT  LL+MN+EVVKVIL+CKKDIW++ E+FELVE+YFE SLK+ +F  AL
Sbjct  59   RALSFDSLKEVTQFLLEMNQEVVKVILDCKKDIWKDKEMFELVEDYFETSLKTHEFYDAL  118

Query  416  DKCLKRARESQLLIHLALKEFEEES---GGIDGSNNKYERTLEELKGFRASGNPFTEEFF  586
               L+R   +  LI   L++FEEES   GG     N Y++TLE+LK F    NPF ++FF
Sbjct  119  ADSLQRVLSNHHLILGVLRQFEEESLVQGG-----NGYKKTLEKLKNFEDVQNPFGQDFF  173

Query  587  QIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaia  766
             +FQSVY +Q LMLEKLQ R+ K DKKL++       SS++F AT A VLIC     A A
Sbjct  174  NMFQSVYTRQMLMLEKLQLRRKKSDKKLKH-----NCSSIIFVATYATVLIC--SVVAAA  226

Query  767  spavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKV  946
              A   A A A  +P+G+MGKWID L KNYE A+KGHK++ISSMQ GTY+ +KDLD I++
Sbjct  227  MSAPPVAPALAAPVPLGTMGKWIDLLWKNYEKALKGHKDVISSMQPGTYVAVKDLDDIRL  286

Query  947  LADRLELEIESLLN  988
            L   L++EI S+ N
Sbjct  287  LIQELDIEIRSICN  300



>ref|XP_010680904.1| PREDICTED: UPF0496 protein 1-like [Beta vulgaris subsp. vulgaris]
Length=398

 Score =   296 bits (758),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 178/353 (50%), Positives = 254/353 (72%), Gaps = 10/353 (3%)
 Frame = +2

Query  131   YEAACELDADLQTFDSTLQARTNHVISTLA------VGVEVRALSFDSLKEVTGCLLDMN  292
             Y AAC+ D D++ FDS LQ     V++TLA      +  +V +LSFDSL++VTG L+DMN
Sbjct  41    YLAACQNDPDVKIFDSKLQQHAASVMNTLASVDNSGLDQQVCSLSFDSLRQVTGSLMDMN  100

Query  293   KEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALK  472
              E VKVIL+CKKD+W+N EL  LVE+YFE S+++LDF  ALD+CLKRAR+   +I +AL+
Sbjct  101   HEAVKVILDCKKDVWKNKELLSLVEDYFEYSVQTLDFFTALDQCLKRARDRHFIIQVALR  160

Query  473   EFEEE---SGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQS  643
              FEEE   + G+  + +K+  TL+EL+ F+ +G+PF +EF  IFQ+VY QQ  ML +LQ 
Sbjct  161   RFEEEMRDNHGVSNAGDKFSNTLKELRSFKEAGDPFGQEFLTIFQAVYNQQVQMLRRLQL  220

Query  644   RKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsM  823
             RK KLDKKL+ +  +RKV +++F A    V+ICSVV AAIA+P VA ALAAA + PIG M
Sbjct  221   RKRKLDKKLKSVKVYRKVCNIIFGAAFVGVVICSVVAAAIAAPPVAAALAAAVSAPIGGM  280

Query  824   GKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFA  1003
             GKW +SL K YE  +K  +E I  +Q+GT I +KDL+ I+VL ++LE+ I+SLL+   FA
Sbjct  281   GKWFNSLWKKYERELKSEREWIVELQIGTCIAVKDLENIRVLVEKLEIVIDSLLSNADFA  340

Query  1004  INEA-AVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKH  1159
             + EA  + + +++IR KL++FM+ ++ + V +D  SR+IR+ARTVIL RI+++
Sbjct  341   LKEADTLTMVMDDIRNKLNVFMEGIDTITVHSDKYSREIRQARTVILHRIMRN  393



>ref|XP_009586590.1| PREDICTED: UPF0496 protein 1-like [Nicotiana tomentosiformis]
Length=400

 Score =   296 bits (758),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 173/370 (47%), Positives = 267/370 (72%), Gaps = 3/370 (1%)
 Frame = +2

Query  86    ETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKE  265
             ETS++     DL SSY++ACE D +LQ FDS LQART+  ++++AV ++ R+LS DSL+E
Sbjct  29    ETSSNSDVSPDL-SSYQSACEEDPELQRFDSALQARTSLALNSIAVNMDHRSLSLDSLRE  87

Query  266   VTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARES  445
             VT C LDMN+ VV  ILE KKDIW++ +LF+LV++Y E+S+  ++FC++LD  L+RAR S
Sbjct  88    VTLCFLDMNQGVVNFILESKKDIWKDPDLFDLVKDYLESSIHIMNFCSSLDDSLERARTS  147

Query  446   QLLIHLALKEFEEESGGID-GSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQAL  622
             Q +I +AL +FE ES   +  S   +  TLE+LK F+A+G+PFT +FF  F +VY+QQ  
Sbjct  148   QSIILVALTKFENESSANEVDSKLLFSETLEQLKSFKAAGDPFTAKFFSSFHTVYLQQEA  207

Query  623   MLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaat  802
             +L KL+S+K+KLDKKL  +  W++VS+++FA    + +ICS+V AA+ +P +  ALAAA 
Sbjct  208   LLMKLKSKKSKLDKKLSRVKTWKRVSNIIFATVFVSAIICSIVAAAVTAPPIVTALAAAA  267

Query  803   aipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESL  982
             ++P+G++GKWI+S+ K YED +K  +EI++SMQ G+++ I+DL+ I+VLAD+L++ +E L
Sbjct  268   SVPLGTVGKWINSMWKKYEDELKREREILTSMQAGSFVVIQDLEHIRVLADKLQIIVEGL  327

Query  983   LNTTSFAINEA-AVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKH  1159
             L++  FAI    AV   +EE++K ++ F + +E L   A  C++DIR AR VIL++I+  
Sbjct  328   LHSADFAIKGTDAVASAMEEVKKNVNGFSETIEVLSQHAKKCNQDIRMARAVILRKIVSQ  387

Query  1160  PNH*GTRMGI  1189
             P+     +G+
Sbjct  388   PSSSNQGIGM  397



>ref|XP_010042437.1| PREDICTED: UPF0496 protein At4g34320-like [Eucalyptus grandis]
Length=349

 Score =   293 bits (749),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 162/346 (47%), Positives = 229/346 (66%), Gaps = 19/346 (5%)
 Frame = +2

Query  137   AACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVIL  316
             AACE D D +TF++ LQARTN V+STLA GV+V+ LS DSLKE++ CLL+MN+EVVKVIL
Sbjct  15    AACESDPDPRTFNANLQARTNQVLSTLASGVDVQTLSLDSLKEISECLLEMNQEVVKVIL  74

Query  317   ECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGG  496
             + KKDIWRN EL +LV++YF +SL +LDFCA+L+ CLK  R++ L I  AL  FEEE G 
Sbjct  75    DSKKDIWRNEELLKLVQDYFNDSLPTLDFCASLENCLKHVRDAHLQIFTALHCFEEEDG-  133

Query  497   IDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRY  676
              +G  + Y + LEEL  F+ +G+PFT EFF++ +    ++ +  +               
Sbjct  134   -EGCCS-YTKILEELTKFKETGDPFTREFFELKKLWIKKKKIEKKLKS------------  179

Query  677   IHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNY  856
             I  WRK+SS++   T AA+LI           +    +A A A  + ++GKWIDSL KN 
Sbjct  180   IQMWRKISSMIPVVTFAAILI--YSVTTARVASPPVVVALAAATAMDAIGKWIDSLWKNC  237

Query  857   EDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINEA--AVKVG  1030
             E+A+K  +E+I+SMQ G +I +KDLD +++  D LE++++SL     F I     AVK+G
Sbjct  238   EEALKRREEVITSMQAGIFIALKDLDKMRITIDPLEVQMKSLFKKADFPIEAGAEAVKLG  297

Query  1031  IEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPNH  1168
             I +I+KKL  FMK+V+ LG   D CSR+++R+R V+LQRIIK P +
Sbjct  298   IADIKKKLRDFMKDVKGLGKDVDMCSRNLQRSRLVVLQRIIKPPTN  343



>gb|KCW64258.1| hypothetical protein EUGRSUZ_G01899 [Eucalyptus grandis]
Length=389

 Score =   293 bits (751),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 160/328 (49%), Positives = 219/328 (67%), Gaps = 21/328 (6%)
 Frame = +2

Query  173   DSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHEL  352
             D  LQ +TN V+STLA GV+VRALS DSLKE+T CLL+MN+EVVKVIL+ KKDIWRN EL
Sbjct  74    DVNLQVKTNEVLSTLAYGVDVRALSLDSLKEITECLLEMNQEVVKVILDSKKDIWRNEEL  133

Query  353   FELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTL  532
             FELV++YF +SL +LDF A+L+ CLK  R++ L I  AL  FEEE G        Y + L
Sbjct  134   FELVQDYFNDSLHALDFYASLENCLKHVRDAHLQILAALHCFEEEDG---EGRCSYSKIL  190

Query  533   EELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMF  712
             EEL  F+ +G+PFT+EFF+IFQ++Y QQ  ML+ +Q+              WRK+SS++ 
Sbjct  191   EELTKFKEAGDPFTKEFFEIFQTIYKQQKSMLKNIQT--------------WRKISSMIL  236

Query  713   AATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIIS  892
              AT AA+LI           ++      A A  + ++GKWIDSL KNYE+A+K  KE+I+
Sbjct  237   VATFAAILI--YSVMTAMVASLPVMAVPAAATTMDAIGKWIDSLWKNYEEALKRPKEVIT  294

Query  893   SMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINEA--AVKVGIEEIRKKLDLFM  1066
             SMQ   ++ +K LD +++  D L+++++SLL    F I     A+K+GI +I+KKL  FM
Sbjct  295   SMQASIFVALKVLDKMRITIDPLDVQMKSLLQKADFLIEAGAEALKLGIVDIKKKLRDFM  354

Query  1067  KNVEDLGVQADNCSRDIRRARTVILQRI  1150
             K+VE LG   D CSR I+R+R V++QRI
Sbjct  355   KDVEGLGKDVDMCSRIIQRSRLVVVQRI  382



>ref|XP_010999947.1| PREDICTED: UPF0496 protein At2g18630-like isoform X2 [Populus 
euphratica]
Length=337

 Score =   291 bits (746),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 167/322 (52%), Positives = 227/322 (70%), Gaps = 3/322 (1%)
 Frame = +2

Query  50    KIMGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGV  229
             K  GG +     ++SN  Q   D  SSYE AC+LD  LQ+FD+TL  +TNHVI++L+ G 
Sbjct  9     KTRGGDIPPPPVQSSNHSQFAEDF-SSYEDACKLDPCLQSFDATLMEKTNHVINSLSTG-  66

Query  230   EVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCA  409
             ++   S  S K VT CLL+MN++VVK ILE K+DIW N ELF LVEEYFE+S+K++DFC 
Sbjct  67    DIATGSSGSFKVVTNCLLEMNQDVVKFILESKEDIWNNPELFALVEEYFESSIKTMDFCT  126

Query  410   ALDKCLKRARESQLLIHLALKEFEEESGGIDGS-NNKYERTLEELKGFRASGNPFTEEFF  586
              L+ C+  AR SQL I  A+  FE+E G  DG    KY +TLEEL+ F  +G+PFT +FF
Sbjct  127   ELESCVTSARTSQLNIMAAIAHFEKEVGLQDGVIEKKYVKTLEELQNFMVAGDPFTPKFF  186

Query  587   QIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaia  766
              +FQSVY QQ  ML+KLQS K KLDKKL+ +  WR+VS+V+F +    V+I +V  AAIA
Sbjct  187   MLFQSVYEQQVSMLKKLQSHKRKLDKKLKSVKIWRRVSNVLFVSVFVTVMIFAVAAAAIA  246

Query  767   spavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKV  946
             +P V  ALA+A A P+ S+G W + L   YE+A+K  K ++S++QVGT+ITIKD+++I+V
Sbjct  247   APPVVSALASALADPVHSVGTWCNLLWHRYENALKEQKVLVSAIQVGTFITIKDMESIRV  306

Query  947   LADRLELEIESLLNTTSFAINE  1012
             L ++LE+EI+SLL+   FAI E
Sbjct  307   LVNKLEIEIKSLLHHADFAIRE  328



>gb|EPS58212.1| hypothetical protein M569_16603 [Genlisea aurea]
Length=402

 Score =   291 bits (745),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 171/367 (47%), Positives = 248/367 (68%), Gaps = 10/367 (3%)
 Frame = +2

Query  80    SGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSL  259
             SG          DL+  YEAAC  D  L++FDS LQ RT+  I+++AVG++VR+LS +SL
Sbjct  16    SGRPPTAGPSAADLLK-YEAACLADPQLRSFDSALQERTSRAINSIAVGLDVRSLSLESL  74

Query  260   KEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRAR  439
              +VT  L++MN+EVVK+IL+ KKDIW+N  L +LV++YF+ SL++LDFC +LD CLKRA 
Sbjct  75    TQVTESLMEMNQEVVKLILQSKKDIWKNKNLSDLVDDYFDISLRTLDFCTSLDACLKRAA  134

Query  440   ESQLLIHLALKEFEEESGGIDG-----SNNK--YERTLEELKGFRASGNPFTEEFFQIFQ  598
               + +I +AL +F EE   + G     S+ K  Y +TLEEL  F+A G+PF+E+FF++F 
Sbjct  135   RVESIIKVALHKFHEEQHCLQGVRENSSSEKRCYPKTLEELNNFKAVGDPFSEDFFKVFN  194

Query  599   SVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspav  778
             SV   Q  MLE+L+SRK KLD+KL  +  +R++S+++F    A+VL+CSVV AA+ +P V
Sbjct  195   SVCSGQIAMLERLKSRKKKLDRKLASMKTYRRISNIIFITAFASVLVCSVVAAALTAPPV  254

Query  779   agalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADR  958
               ALAAA A+P+GS+G W+ S+   YE  + G  EII+SMQ+GT I IKDLD I+   +R
Sbjct  255   LTALAAAAAVPMGSIGTWLASIWSKYEKDLSGQIEIITSMQIGTRIAIKDLDNIRAQIER  314

Query  959   LELEIESLLNTTSFAINEAAVKV--GIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRART  1132
              ++ I++L  +  FA   A  KV  GI EI K+ + F + + +L   A+ CS+  R AR+
Sbjct  315   FQIRIKALSESADFAAEGAEDKVVAGIGEIEKEAESFFETIHELSKHANKCSQQTRMARS  374

Query  1133  VILQRII  1153
             +IL +II
Sbjct  375   LILGKII  381



>ref|XP_010447099.1| PREDICTED: UPF0496 protein At4g34320-like [Camelina sativa]
Length=385

 Score =   289 bits (739),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 160/349 (46%), Positives = 238/349 (68%), Gaps = 10/349 (3%)
 Frame = +2

Query  128   SYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVK  307
             +YEAACE D ++Q+FD  + AR ++VISTL+  VE  A+SFDSLK VT  LLD+++EV+K
Sbjct  43    TYEAACEEDTEIQSFDRRMHARMSNVISTLSTDVEGGAVSFDSLKVVTESLLDVSQEVMK  102

Query  308   VILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEE  487
              +L+CKKDIW++ E+ EL  ++F+NS K+LDFC AL++ +     +  LI  A+++FEEE
Sbjct  103   FVLDCKKDIWKHKEVLELAVDFFDNSTKTLDFCYALEESVCLVGSNHQLILSAIRQFEEE  162

Query  488   ---SGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKL  658
                 GG     N Y++TL+ELK F+ +  PF ++FF++FQ VY QQ LMLEKLQ R  +L
Sbjct  163   RLVRGG-----NGYKKTLKELKKFKDAETPFGKDFFKMFQIVYEQQMLMLEKLQIRTKRL  217

Query  659   DKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWID  838
             D K + I  WRK++S++F A  A +LIC  V AA  +     A  A+T  P+G+MGKW+ 
Sbjct  218   DNKFKRIRTWRKIASIIFVAIYATLLIC-SVVAAAIAATAVAAALASTIAPMGAMGKWLH  276

Query  839   SLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAI-NEA  1015
             SL K YE+A+KG K++  SMQ GT++ +KDLD I++L  +L+ EI+ ++ +   A+ +  
Sbjct  277   SLWKKYENAVKGQKDVFFSMQEGTFVAVKDLDYIRLLIQQLDKEIKRMVTSAETAVEHHD  336

Query  1016  AVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHP  1162
              +K+ I EI K L +F K +E+LG +AD CS+DI +AR V   +++ H 
Sbjct  337   TIKIQIHEINKVLLVFKKKIEELGNRADLCSKDIIKAREVFFNKVMHHT  385



>ref|XP_010026158.1| PREDICTED: UPF0496 protein At2g18630-like [Eucalyptus grandis]
Length=370

 Score =   286 bits (731),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 173/369 (47%), Positives = 239/369 (65%), Gaps = 4/369 (1%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEV  235
             MGG  SK S    N        ++SYEAAC  D  LQ FD TL  + N VI TLA   E 
Sbjct  1     MGGMFSKDSSSLENRNPGYQSHLTSYEAACRADRSLQDFDKTLHDQANRVIRTLAASAEA  60

Query  236   RALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAAL  415
             ++L+  S+ E T  +L+MN+ +  ++L  ++DIW++ EL +LVE YF N L+ LDF  +L
Sbjct  61    QSLALKSIGEATTGVLEMNRVLANILLASREDIWKDKELSDLVEYYFNNGLQILDFYNSL  120

Query  416   DKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIF  595
             + CL++A +SQL I LAL  FEEE GG +    +Y  TL  L+ FR +G+PFTEEF+++F
Sbjct  121   ENCLRQAHDSQLNIRLALVHFEEE-GGKNVERERYAGTLLALQRFREAGDPFTEEFWKVF  179

Query  596   QSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspa  775
              SV  QQ  ML KL++   KLDKK++    WR+V++ +F     + LI SVV  AIA+P 
Sbjct  180   HSVLKQQKEMLPKLEACVKKLDKKVKSAQTWRRVTNAIFVTAFVSTLILSVVAVAIAAPP  239

Query  776   vagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLAD  955
             V  ALAAA A PIGS+GKW DS  KNY   +KG K +I  M  GT I+I+D  TI+ L  
Sbjct  240   VVTALAAALAAPIGSVGKWCDSWWKNYRRELKGKKVLIDIMYEGTKISIEDFKTIRSLVG  299

Query  956   RLELEIESLLNTTSFAIN---EAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRA  1126
             +LE+EIES++    FA+    E AVK+G+ EI+K+ ++FMK +E+L  QAD  SR+IR A
Sbjct  300   KLEIEIESIVQKADFALGEEQEEAVKLGMLEIKKRAEVFMKTIEELSTQADKSSREIRMA  359

Query  1127  RTVILQRII  1153
             R++ILQ+I+
Sbjct  360   RSMILQKIM  368



>ref|XP_010042669.1| PREDICTED: UPF0496 protein At2g18630-like [Eucalyptus grandis]
Length=373

 Score =   285 bits (729),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 176/369 (48%), Positives = 238/369 (64%), Gaps = 4/369 (1%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEV  235
             MGG  SK S    N        ++SYEAAC  D  LQ FD TL  + + VI TLA   E 
Sbjct  1     MGGMFSKDSSSLENRNPGYQSHLTSYEAACGADRSLQDFDKTLHDQADRVIRTLAASAEA  60

Query  236   RALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAAL  415
             ++L+  S+ E T  +L+MN+ +  ++L  K+DIW++ EL +LVE YF N L+ LDF  +L
Sbjct  61    QSLALKSIGEATTGVLEMNRVLANILLASKEDIWKDKELSDLVEYYFNNGLQILDFYNSL  120

Query  416   DKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIF  595
             + CL++A +SQL I  AL  FEEE GG +    +Y  TL  L+ FR +G+PFTEEF+ +F
Sbjct  121   ENCLRQAHDSQLNIRHALVHFEEE-GGENVERERYVGTLLALQRFREAGDPFTEEFWMVF  179

Query  596   QSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspa  775
              SV  QQ  ML KL++   KLDKK++    WR+V++ +F     + LI SVV  AIA+P 
Sbjct  180   HSVLKQQKEMLPKLEACMKKLDKKVKSAETWRRVTNAIFVTAFVSTLILSVVAVAIAAPP  239

Query  776   vagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLAD  955
             V  ALAAA A PIGS+GKW DS  KNY   +KG K +I  M  GT I+I+DL TI+ L  
Sbjct  240   VVTALAAALAAPIGSVGKWCDSWWKNYRRELKGKKVLIDIMFEGTKISIEDLKTIRSLVG  299

Query  956   RLELEIESLLNTTSFAIN---EAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRA  1126
             +LE+EIES++    FA+    E AVK+G+ EI+K+ ++FMK +EDL  QAD  SR+IR A
Sbjct  300   KLEIEIESIVQKADFALGEEQEEAVKLGMLEIKKRAEVFMKTIEDLSTQADKSSREIRMA  359

Query  1127  RTVILQRII  1153
             RTVILQ+I+
Sbjct  360   RTVILQKIM  368



>ref|XP_004301900.1| PREDICTED: uncharacterized protein LOC101291734 [Fragaria vesca 
subsp. vesca]
Length=969

 Score =   296 bits (759),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 184/355 (52%), Positives = 247/355 (70%), Gaps = 8/355 (2%)
 Frame = +2

Query  113   TDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMN  292
             T L SSYEAAC+LD+ L +FD +LQ RT+ V ++L+   +VR+LS +SLKEV+  LL+ N
Sbjct  616   TALFSSYEAACKLDSGLHSFDLSLQQRTSRVFNSLSTRAKVRSLSLNSLKEVSDWLLETN  675

Query  293   KEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALK  472
             +EVVKVILECKKDIW N E+F LVEEYFENS  +L+FC AL+ CLKR   +QL+I  A+ 
Sbjct  676   QEVVKVILECKKDIWNNQEIFSLVEEYFENSFHTLEFCTALETCLKRVVNNQLIIQAAVS  735

Query  473   EFEEE-SGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRK  649
              FEEE   G++G      + L+EL+ F+A+G+PF EEF  +F++V    A ML+ LQ RK
Sbjct  736   RFEEEVEAGLEGKG--CVKILQELRAFKAAGDPFREEFLSLFRAVLNGHASMLQILQVRK  793

Query  650   NKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGK  829
              +LDKKL+ + AWRKVS+V+  AT  +VLI SVV AAI +P +  +LA A A+ +GS  K
Sbjct  794   KRLDKKLKSVKAWRKVSNVLIVATFVSVLIFSVVAAAITAPPLVTSLARALAVSVGSSEK  853

Query  830   WIDSLLKNYEDAIKGHKEIISSMQVGT---YITIKDLDTIKVLADRLELEIESLLNTTSF  1000
             W   +L +Y   +   +  I+SMQ+GT     T+ DL+ I+VL ++ E EIE+LL T  F
Sbjct  854   WC-KILWSYYHTLNAQRIEINSMQLGTMDCMFTMTDLNNIRVLVEKCESEIEALLQTADF  912

Query  1001  AINEA-AVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHP  1162
              I E  AVK+ + EI KKL++FM+ V+ L   AD C R+IRRARTVILQRII HP
Sbjct  913   GITEENAVKIVMIEINKKLEMFMETVKSLSQNADECGRNIRRARTVILQRIISHP  967



>ref|XP_010451057.1| PREDICTED: UPF0496 protein At4g34320-like [Camelina sativa]
Length=370

 Score =   281 bits (719),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 165/351 (47%), Positives = 239/351 (68%), Gaps = 18/351 (5%)
 Frame = +2

Query  128   SYEAACELDADLQTFDSTLQARTNHVISTLAVGVEV--RALSFDSLKEVTGCLLDMNKEV  301
             +YEAAC+ D ++Q+FD  + AR ++VISTL+ GV+V  RALSFDSLK VT  LLD+N+EV
Sbjct  32    TYEAACKEDTEIQSFDRRMHARMSNVISTLSTGVDVEGRALSFDSLKVVTESLLDINQEV  91

Query  302   VKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFE  481
             VKV++ CK DIW++ E+FEL  ++F+NS K+LDFC AL++ +     +  LI  A+++FE
Sbjct  92    VKVVINCKNDIWKHKEVFELAVDFFDNSTKTLDFCYALEESMCLVGSNHQLILSAIRQFE  151

Query  482   EES---GGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKN  652
             EES   GG     N Y++TL+ELK F+ +  PF E+FF++FQ    QQ LMLEKLQ R  
Sbjct  152   EESLVRGG-----NGYKKTLKELKKFKDAKTPFGEDFFKMFQ--IEQQMLMLEKLQIRSK  204

Query  653   KLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKW  832
             +LD KL+ I  WR+   ++F AT A +LIC  V AA  +     A  A+  +P+G+MGKW
Sbjct  205   RLDIKLKRIRTWRE---IIFVATYATLLIC-SVVAAAIAAPSVAAALASVIVPMGAMGKW  260

Query  833   IDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAI-N  1009
             + SL K YE A+KG K++   MQVGT++ +KDLD I++L  +L+ EI+ ++ +   A+ +
Sbjct  261   LHSLWKKYE-AVKGQKDMFFWMQVGTFVAVKDLDNIRLLIQQLDKEIKRMVTSAESAVEH  319

Query  1010  EAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHP  1162
                VK+ I EI K L +F K +E+LG +AD CS+DI +AR V+  ++I H 
Sbjct  320   HDTVKIQIHEIEKVLLVFKKKIEELGNRADLCSKDIIKAREVVFNKVIHHT  370



>ref|XP_010451058.1| PREDICTED: uncharacterized protein LOC104733148 [Camelina sativa]
Length=587

 Score =   281 bits (718),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 162/288 (56%), Positives = 197/288 (68%), Gaps = 44/288 (15%)
 Frame = +2

Query  146  ELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECK  325
            +L  +LQ+FD+ LQART+HVISTLA GVEVRALSFDSLKEVT CLL+MN+EVVKVIL+CK
Sbjct  309  QLHTELQSFDTCLQARTSHVISTLATGVEVRALSFDSLKEVTQCLLEMNQEVVKVILDCK  368

Query  326  KDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEE------  487
            KDIW+N E+FELVE+YFENSLK+LDFCAAL+K L+RARES LLI +AL++FE+E      
Sbjct  369  KDIWKNQEMFELVEDYFENSLKTLDFCAALEKGLQRARESHLLILVALQQFEDESLVQEF  428

Query  488  ------SGGIDGSN--------------------NKYERTLEELKGFRASGNPFTEEFFQ  589
                  S  +D SN                    N Y++TLE+LK F  + NPF E+FF 
Sbjct  429  YDALADSMHLDRSNHHLILGVLRQFEEESLVQGGNGYKKTLEKLKDFEDAQNPFGEDFFN  488

Query  590  IFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaias  769
            +FQSVY QQ LMLEKLQ R+NK D            SS++F AT A VLIC     A A 
Sbjct  489  MFQSVYKQQMLMLEKLQLRRNKPD----------TCSSIIFVATYATVLIC--SVVAAAM  536

Query  770  pavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTY  913
             A   A   A  +P+G+MGKWID L KNYE A+K HK++I+SMQ GTY
Sbjct  537  SAPHVAPGLAAPVPLGTMGKWIDLLWKNYEKALKEHKDVITSMQPGTY  584


 Score =   235 bits (599),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 143/166 (86%), Gaps = 8/166 (5%)
 Frame = +2

Query  152  DADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKD  331
            D +LQ+FD+ LQART+HVISTLA GVEVRALSFDSLKEVT CLL+MN+EVVKVIL+CKKD
Sbjct  149  DTELQSFDTCLQARTSHVISTLATGVEVRALSFDSLKEVTQCLLEMNQEVVKVILDCKKD  208

Query  332  IWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEES---GGID  502
            IW+N E+FELVE+YFENSLK+LDFCAAL+K L+RARES LLI +AL++FE+ES   GG  
Sbjct  209  IWKNQEMFELVEDYFENSLKTLDFCAALEKGLQRARESHLLILVALQQFEDESLVQGG--  266

Query  503  GSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQ  640
               N Y++TLEELK F+ + +PF E+FF++FQSVY QQ +MLEKLQ
Sbjct  267  ---NGYKKTLEELKNFKDAESPFNEDFFKMFQSVYKQQMVMLEKLQ  309


 Score =   203 bits (517),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = +2

Query  56   MGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEV  235
            MG   SKK  + S      T  + SYEAAC+ D +LQ+FD+ LQART+HVISTLA GVEV
Sbjct  1    MGNQTSKKPQDASAKSVHYTTELRSYEAACKADTELQSFDTCLQARTSHVISTLATGVEV  60

Query  236  RALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAAL  415
            RALSFDSLKEVT CLL+MN+EVVKVIL+CKKDIW+N E+FELVE+YFENSLK+LDFCAAL
Sbjct  61   RALSFDSLKEVTQCLLEMNQEVVKVILDCKKDIWKNQEMFELVEDYFENSLKTLDFCAAL  120

Query  416  DKCLKRARESQLLIHLALKEFEEES  490
            +K L+RARES LLI +AL++FE+ES
Sbjct  121  EKGLQRARESHLLILVALQQFEDES  145



>ref|XP_010026159.1| PREDICTED: UPF0496 protein 1-like [Eucalyptus grandis]
 gb|KCW58576.1| hypothetical protein EUGRSUZ_H01234 [Eucalyptus grandis]
Length=376

 Score =   273 bits (699),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 181/377 (48%), Positives = 247/377 (66%), Gaps = 7/377 (2%)
 Frame = +2

Query  56    MGGHMSKKSGETSN--DLQCR-TDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVG  226
             MGG  SKK  ++S+  D   R    ++SYEAAC  D  LQ FD TL  + + VI TLA  
Sbjct  1     MGGVWSKKEVDSSSMEDSNPRYQSQLNSYEAACRADRSLQDFDRTLHDQADRVIRTLAGS  60

Query  227   VEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFC  406
              E ++L+ +S+ E T  +L+MN+ +  +IL  K+DIW++ EL  LVE YF + L+ LDF 
Sbjct  61    AEAQSLALNSIGETTTGVLEMNRALANIILASKEDIWKDKELSNLVEYYFNHGLRILDFF  120

Query  407   AALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFF  586
              +L+ CL+RAR+SQ  I LAL  FEEE G   G   +Y RTL EL+ FR +G+PFTEEF 
Sbjct  121   NSLENCLRRARDSQSSIRLALVHFEEERGENVG-GERYVRTLLELQRFREAGDPFTEEFS  179

Query  587   QIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaia  766
             ++  SV  QQ  ML KL++ K KLDKK++    WR+V++ +F     + LI SVV  AIA
Sbjct  180   KLLYSVLKQQEEMLVKLEACKKKLDKKVKSAQTWRRVTNAIFMTAFVSTLILSVVAVAIA  239

Query  767   spavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKV  946
             +P V  ALAAA A PIG++GKW DS  KNY   +KG K ++  M  GT I+I+DL TI+ 
Sbjct  240   APPVVIALAAALAAPIGTVGKWCDSWWKNYRRELKGKKLLVDLMNEGTKISIEDLKTIRS  299

Query  947   LADRLELEIESLLNTTSFAIN---EAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDI  1117
             L  +LE+EIES++    FA+    E AVK+G+ EI+K+ ++FMK +EDLG QAD  SR+I
Sbjct  300   LVGKLEIEIESIVQKADFALGEEQEEAVKLGMLEIKKRAEVFMKTIEDLGTQADKSSREI  359

Query  1118  RRARTVILQRIIKHPNH  1168
             R ARTVILQ+I+   + 
Sbjct  360   RMARTVILQKIMGQSSR  376



>ref|XP_008457896.1| PREDICTED: UPF0496 protein At2g18630-like isoform X1 [Cucumis 
melo]
Length=414

 Score =   261 bits (668),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 170/391 (43%), Positives = 256/391 (65%), Gaps = 15/391 (4%)
 Frame = +2

Query  26    LAFVFGCVKIMGGHMSKK---SGETS------NDLQCRTDLISSYEAACELDADLQTFDS  178
             L+F    +++MGG  SK     G+ S      ND      L SSYEA C  + DL++FD 
Sbjct  27    LSFFPFSLEMMGGQSSKSKSGGGDVSLPPLPINDAHYAAAL-SSYEAECANNTDLRSFDV  85

Query  179   TLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFE  358
              +  RTN  +++LA GV V +LS D+L EVT  LL+MN + VK+ILE K+D+W N ELF 
Sbjct  86    QVHERTNRALNSLADGVAVGSLSMDALMEVTDFLLEMNGDAVKIILESKEDVW-NKELFS  144

Query  359   LVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFE-EESGGIDGSNNKYERTLE  535
             LV+ +F+NSLK L+FC AL+  L+R R+SQ +I LA+++FE +E+ G +G   +Y +T E
Sbjct  145   LVDAFFDNSLKVLEFCKALEVSLRRTRDSQFIIKLAVRKFESDENNGDNG--ERYVKTFE  202

Query  536   ELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFA  715
             ELK F+ +G+PF EEF  +F+S+Y +   M +KLQ +K KLDKK   +  W+ VS+V+  
Sbjct  203   ELKKFQEAGDPFGEEFVTLFRSLYKEHLSMFKKLQRQKKKLDKKYTTMKTWKTVSNVILV  262

Query  716   ATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISS  895
                A+VLI SVV AA+++P V  AL AA A+P+G +GKW ++L   Y ++IK  K+++SS
Sbjct  263   TAFASVLIFSVVAAAMSAPPVVIALGAALAVPMGPVGKWCNTLWNRYLNSIKVEKQLLSS  322

Query  896   MQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINE-AAVKVGIEEIRKKLDLFMKN  1072
             M+  ++I +KD + I++L  RL +++ SLL   +  I E  A+++ I+EI+K L+ F + 
Sbjct  323   MEGHSFIILKDFENIRLLVRRLSIQLGSLLQNANLGIREQGAMQLVIDEIKKNLEGFDET  382

Query  1073  VEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
             ++ L V A  CS D+ +AR VILQ+I +  N
Sbjct  383   IDKLSVHATKCSTDVTKAREVILQKIARQSN  413



>ref|XP_008457897.1| PREDICTED: UPF0496 protein At2g18630-like isoform X2 [Cucumis 
melo]
Length=379

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 168/382 (44%), Positives = 251/382 (66%), Gaps = 15/382 (4%)
 Frame = +2

Query  53    IMGGHMSKK---SGETS------NDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHV  205
             +MGG  SK     G+ S      ND      L SSYEA C  + DL++FD  +  RTN  
Sbjct  1     MMGGQSSKSKSGGGDVSLPPLPINDAHYAAAL-SSYEAECANNTDLRSFDVQVHERTNRA  59

Query  206   ISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENS  385
             +++LA GV V +LS D+L EVT  LL+MN + VK+ILE K+D+W N ELF LV+ +F+NS
Sbjct  60    LNSLADGVAVGSLSMDALMEVTDFLLEMNGDAVKIILESKEDVW-NKELFSLVDAFFDNS  118

Query  386   LKSLDFCAALDKCLKRARESQLLIHLALKEFE-EESGGIDGSNNKYERTLEELKGFRASG  562
             LK L+FC AL+  L+R R+SQ +I LA+++FE +E+ G +G   +Y +T EELK F+ +G
Sbjct  119   LKVLEFCKALEVSLRRTRDSQFIIKLAVRKFESDENNGDNGE--RYVKTFEELKKFQEAG  176

Query  563   NPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLIC  742
             +PF EEF  +F+S+Y +   M +KLQ +K KLDKK   +  W+ VS+V+     A+VLI 
Sbjct  177   DPFGEEFVTLFRSLYKEHLSMFKKLQRQKKKLDKKYTTMKTWKTVSNVILVTAFASVLIF  236

Query  743   svvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITI  922
             SVV AA+++P V  AL AA A+P+G +GKW ++L   Y ++IK  K+++SSM+  ++I +
Sbjct  237   SVVAAAMSAPPVVIALGAALAVPMGPVGKWCNTLWNRYLNSIKVEKQLLSSMEGHSFIIL  296

Query  923   KDLDTIKVLADRLELEIESLLNTTSFAINE-AAVKVGIEEIRKKLDLFMKNVEDLGVQAD  1099
             KD + I++L  RL +++ SLL   +  I E  A+++ I+EI+K L+ F + ++ L V A 
Sbjct  297   KDFENIRLLVRRLSIQLGSLLQNANLGIREQGAMQLVIDEIKKNLEGFDETIDKLSVHAT  356

Query  1100  NCSRDIRRARTVILQRIIKHPN  1165
              CS D+ +AR VILQ+I +  N
Sbjct  357   KCSTDVTKAREVILQKIARQSN  378



>ref|XP_002983926.1| hypothetical protein SELMODRAFT_119515 [Selaginella moellendorffii]
 gb|EFJ14938.1| hypothetical protein SELMODRAFT_119515 [Selaginella moellendorffii]
Length=380

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 148/363 (41%), Positives = 241/363 (66%), Gaps = 9/363 (2%)
 Frame = +2

Query  122   ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEV  301
             +S YE  C +D D++ F   L+ RT  V+ ++A GV+ R LSF SLK+VT   L++++EV
Sbjct  20    LSEYERVCAMDPDVRKFGDGLKERTERVLQSMAAGVDERGLSFQSLKDVTTSFLELDQEV  79

Query  302   VKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFE  481
             V VIL  KKD+W +  LFELV++YF+NS+ +LDFC  L+KC+K+ARE+Q+ I +A+    
Sbjct  80    VNVILNYKKDVWASDSLFELVKDYFDNSMATLDFCEELNKCIKQARENQMSIQVAINMMP  139

Query  482   EESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLD  661
              E    D S  + +  L+EL  +  +GNPFT+EF + FQ VY +Q  +  KLQ++K  LD
Sbjct  140   NEG---DPSEEQCQAILKELNQYVDAGNPFTDEFMEKFQIVYQRQMELQRKLQAKKKSLD  196

Query  662   KKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDS  841
             +KLRY+  W KVS++++AAT AA++IC+VV A +  PA+ GA+AA +++P+ ++G+WI S
Sbjct  197   RKLRYVRGWTKVSTIIYAATCAALVICAVVAAVMTVPAIVGAVAAVSSMPLETLGRWIKS  256

Query  842   LLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINEA--  1015
              L  YE  ++  ++++    + T++TIK++DTI+ L + L   +ES+++   F    A  
Sbjct  257   FLTKYEKELQARRDLMREANLKTFVTIKEMDTIRALINSLSNSMESIVHCIQFGQRHADG  316

Query  1016  -AVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPNH*GTRMGI*  1192
               + + +E+++ +   F++++++L    D CSRDIRRAR V+L+RI+K  +    R+G  
Sbjct  317   FGMHLVVEQLKSRQSAFIRDLDELEEHVDRCSRDIRRARLVVLRRIVKKRSG---RIGFQ  373

Query  1193  DCF  1201
              CF
Sbjct  374   LCF  376



>gb|KCW58575.1| hypothetical protein EUGRSUZ_H01233 [Eucalyptus grandis]
Length=410

 Score =   258 bits (658),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 160/346 (46%), Positives = 221/346 (64%), Gaps = 4/346 (1%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEV  235
             MGG  SK S    N        ++SYEAAC  D  LQ FD TL  + N VI TLA   E 
Sbjct  1     MGGMFSKDSSSLENRNPGYQSHLTSYEAACRADRSLQDFDKTLHDQANRVIRTLAASAEA  60

Query  236   RALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAAL  415
             ++L+  S+ E T  +L+MN+ +  ++L  ++DIW++ EL +LVE YF N L+ LDF  +L
Sbjct  61    QSLALKSIGEATTGVLEMNRVLANILLASREDIWKDKELSDLVEYYFNNGLQILDFYNSL  120

Query  416   DKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIF  595
             + CL++A +SQL I LAL  FEEE GG +    +Y  TL  L+ FR +G+PFTEEF+++F
Sbjct  121   ENCLRQAHDSQLNIRLALVHFEEE-GGKNVERERYAGTLLALQRFREAGDPFTEEFWKVF  179

Query  596   QSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspa  775
              SV  QQ  ML KL++   KLDKK++    WR+V++ +F     + LI SVV  AIA+P 
Sbjct  180   HSVLKQQKEMLPKLEACVKKLDKKVKSAQTWRRVTNAIFVTAFVSTLILSVVAVAIAAPP  239

Query  776   vagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLAD  955
             V  ALAAA A PIGS+GKW DS  KNY   +KG K +I  M  GT I+I+D  TI+ L  
Sbjct  240   VVTALAAALAAPIGSVGKWCDSWWKNYRRELKGKKVLIDIMYEGTKISIEDFKTIRSLVG  299

Query  956   RLELEIESLLNTTSFAIN---EAAVKVGIEEIRKKLDLFMKNVEDL  1084
             +LE+EIES++    FA+    E AVK+G+ EI+K+ ++FMK +E+L
Sbjct  300   KLEIEIESIVQKADFALGEEQEEAVKLGMLEIKKRAEVFMKTIEEL  345



>ref|XP_010068111.1| PREDICTED: UPF0496 protein At4g34320-like [Eucalyptus grandis]
Length=314

 Score =   254 bits (649),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 146/312 (47%), Positives = 213/312 (68%), Gaps = 7/312 (2%)
 Frame = +2

Query  239   ALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALD  418
             A++  +  +++ CLL+MN+EVVKVIL+ KKDIWRN EL +LV++YF +SL +LDFCA+L+
Sbjct  2     AMTQIAYTKISECLLEMNQEVVKVILDSKKDIWRNEELLKLVQDYFNDSLPTLDFCASLE  61

Query  419   KCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQ  598
              CLK  R++ L I  AL  FEEE G  +G  + Y + LEEL  F+ +G+PFT EFF++FQ
Sbjct  62    NCLKHVRDAHLQIFTALHCFEEEDG--EGCCS-YTKILEELTKFKETGDPFTREFFELFQ  118

Query  599   SVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspav  778
             ++Y  Q  ML+KL  +K K++KKL+ I  WRK+SS++   T AA+LI           + 
Sbjct  119   TIYKLQKFMLKKLWIKKKKIEKKLKSIQMWRKISSMIPVVTFAAILI--YSVTTATVASP  176

Query  779   agalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADR  958
                 A A A  + ++GKWIDSL +N E+A+K  +E+I+SMQ G ++ +KDLD +++  D 
Sbjct  177   PVVAALAAATAMDAIGKWIDSLWRNCEEALKRREEVITSMQAGIFVALKDLDKMRITIDP  236

Query  959   LELEIESLLNTTSFAINEA--AVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRART  1132
             LE++++SLL    F I     AVK+GI +I+KKL  FMK+ + LG   D CSR+I+R+R 
Sbjct  237   LEVQMKSLLQKADFPIEAGAEAVKLGIADIKKKLRDFMKDAKGLGKDVDMCSRNIQRSRL  296

Query  1133  VILQRIIKHPNH  1168
             V+LQRIIK P +
Sbjct  297   VVLQRIIKPPTN  308



>ref|XP_010026389.1| PREDICTED: UPF0496 protein 1-like [Eucalyptus grandis]
Length=365

 Score =   256 bits (654),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 153/342 (45%), Positives = 209/342 (61%), Gaps = 21/342 (6%)
 Frame = +2

Query  149   LDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKK  328
             +D  LQ  D TL  R +  I TLA+  E ++L+F+SL E+    L+M+ EV K+ILE   
Sbjct  41    VDLSLQDLDKTLPDRADRAIRTLALVAEAQSLTFNSLGEMATGRLEMDHEVAKIILES--  98

Query  329   DIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGS  508
              IW + EL  LV+ YF + L+ LDF  +L  CL+RA +SQ  I LAL  FEE+ G   G 
Sbjct  99    -IWNDEELIHLVDYYFNHCLQILDFYTSLKNCLRRAHDSQSSIRLALVHFEEKRGENVG-  156

Query  509   NNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAW  688
               +Y RTL+EL+ FR +G+PFTEEF ++F SVY QQ  M +KL++ K KLDKK++    W
Sbjct  157   GKRYLRTLQELQRFREAGDPFTEEFSKLFHSVYKQQGEMSQKLEACKMKLDKKVKSAQTW  216

Query  689   RKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAI  868
             R V++ +F     + LI               ++ AA   PIG++GKW DS  KNY   +
Sbjct  217   RWVTNAIFVTVFVSALIL--------------SVVAALRTPIGTVGKWCDSRWKNYRREL  262

Query  869   KGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAIN---EAAVKVGIEE  1039
             KG K +I  M  GT ++I+DL TI+ L   LE+EIES++    F +    E AVK+G+ E
Sbjct  263   KGKKLLIDLMNEGTKMSIEDLKTIRSLVGMLEIEIESIMQKADFTLGEEQEEAVKLGMLE  322

Query  1040  IRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
             IRK+ ++FMK VEDL  QAD  S +I R RTVIL+RII  P 
Sbjct  323   IRKRAEVFMKTVEDLSTQADKSSHEIERTRTVILKRIIGQPT  364



>ref|XP_002960085.1| hypothetical protein SELMODRAFT_74510 [Selaginella moellendorffii]
 gb|EFJ37624.1| hypothetical protein SELMODRAFT_74510 [Selaginella moellendorffii]
Length=370

 Score =   255 bits (652),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 148/372 (40%), Positives = 244/372 (66%), Gaps = 13/372 (3%)
 Frame = +2

Query  56    MGGHMSKK--SGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGV  229
             MG   S+    GE+ + +      +S YE  C +D D++ F   L+ RT  V+ ++A GV
Sbjct  1     MGNQSSRSLSPGESLSSID-----LSEYERVCAMDPDVRKFGDGLKERTERVLQSMAAGV  55

Query  230   EVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCA  409
             + R LSF SLK+VT   L++++EVV VIL  KKD+W +  LFELV++YF+NS+ +LDFC 
Sbjct  56    DERGLSFQSLKDVTTSFLELDQEVVNVILNYKKDVWASDSLFELVKDYFDNSMATLDFCE  115

Query  410   ALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQ  589
              L+KC+K+ARE+Q+ I +A+     E    D +  + +  L+EL  +  +GNPFT+EF +
Sbjct  116   ELNKCIKQARENQMSIQVAINMMPSEG---DPNEEQCQAILKELNQYVDAGNPFTDEFME  172

Query  590   IFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaias  769
              FQ+VY +Q  +  KLQ++K  LD+KLRY+  W KVS++++AAT AA++IC+VV A +  
Sbjct  173   KFQTVYQKQMELQRKLQAKKKSLDRKLRYVRGWTKVSTIIYAATCAALVICAVVAAVMTV  232

Query  770   pavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVL  949
             PA+ GA+AA +++P+ ++G+WI S L  YE  ++  ++++      T++TIK++DTI+ L
Sbjct  233   PAIVGAVAAVSSMPLETLGRWIKSFLTKYEKELQARRDLMREANFKTFVTIKEMDTIRAL  292

Query  950   ADRLELEIESLLNTTSFAINEA---AVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIR  1120
              + L   +ES+++   F    A    + + +E+++ +   F++++++L    D CSRDIR
Sbjct  293   INSLRNSMESIVHCIQFGQRHADGFGMHLVVEQLKSRQSAFIRDLDELEEHVDRCSRDIR  352

Query  1121  RARTVILQRIIK  1156
             RAR V+L+RI+K
Sbjct  353   RARLVVLRRIVK  364



>ref|XP_002984054.1| hypothetical protein SELMODRAFT_119122 [Selaginella moellendorffii]
 gb|EFJ15066.1| hypothetical protein SELMODRAFT_119122 [Selaginella moellendorffii]
Length=370

 Score =   255 bits (651),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 148/372 (40%), Positives = 244/372 (66%), Gaps = 13/372 (3%)
 Frame = +2

Query  56    MGGHMSKK--SGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGV  229
             MG   S+    GE+ + +      +S YE  C +D D++ F   L+ RT  V+ ++A GV
Sbjct  1     MGNQSSRSLSPGESLSSID-----LSEYERVCAMDPDVRKFGDGLKERTERVLQSMAAGV  55

Query  230   EVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCA  409
             + R LSF SLK+VT   L++++EVV VIL  KKD+W +  LFELV++YF+NS+ +LDFC 
Sbjct  56    DERGLSFQSLKDVTTSFLELDQEVVNVILNYKKDVWASDSLFELVKDYFDNSMATLDFCE  115

Query  410   ALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQ  589
              L+KC+K+ARE+Q+ I +A+     E    D +  + +  L+EL  +  +GNPFT+EF +
Sbjct  116   ELNKCIKQARENQMSIQVAINMMPSEG---DPNEEQCQAILKELNQYVDAGNPFTDEFME  172

Query  590   IFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaias  769
              FQ+VY +Q  +  KLQ++K  LD+KLRY+  W KVS++++AAT AA++IC+VV A +  
Sbjct  173   KFQTVYQKQMELQRKLQAKKKSLDRKLRYVRGWTKVSTIIYAATCAALVICAVVAAVMTV  232

Query  770   pavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVL  949
             PA+ GA+AA +++P+ ++G+WI S L  YE  ++  ++++      T++TIK++DTI+ L
Sbjct  233   PAIVGAVAAVSSMPLETLGRWIKSFLTKYEKELQARRDLMREANFKTFVTIKEMDTIRAL  292

Query  950   ADRLELEIESLLNTTSFAINEA---AVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIR  1120
              + L   +ES+++   F    A    + + +E+++ +   F++++++L    D CSRDIR
Sbjct  293   INSLRNSMESIVHCIQFGQRHADGFGMHLVVEQLKSRQSAFIRDLDELEEHVDCCSRDIR  352

Query  1121  RARTVILQRIIK  1156
             RAR V+L+RI+K
Sbjct  353   RARLVVLRRIVK  364



>ref|XP_002960745.1| hypothetical protein SELMODRAFT_74185 [Selaginella moellendorffii]
 gb|EFJ38284.1| hypothetical protein SELMODRAFT_74185 [Selaginella moellendorffii]
Length=380

 Score =   255 bits (651),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 149/372 (40%), Positives = 243/372 (65%), Gaps = 13/372 (3%)
 Frame = +2

Query  56    MGGHMSKK--SGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGV  229
             MG   S+    GE+ + +      +S YE  C  D D++ F   L+ RT  V+ ++A GV
Sbjct  1     MGNQSSRSLSPGESLSSID-----LSEYERVCAKDPDVRKFGDGLKERTERVLQSMAAGV  55

Query  230   EVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCA  409
             + R LSF SLK+VT   L++++EVV VIL  KKD+W +  LFELV++YF+NS+ +LDFC 
Sbjct  56    DERGLSFQSLKDVTTSFLELDQEVVNVILNYKKDVWASDSLFELVKDYFDNSMATLDFCE  115

Query  410   ALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQ  589
              L+KC+K+ARE+Q+ I +A+     E    D S  + +  L+EL  +  +GNPFT+EF +
Sbjct  116   ELNKCIKQARENQMSIQVAINMMPSEG---DPSEEQCQAILKELNQYVDAGNPFTDEFME  172

Query  590   IFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaias  769
              FQ+VY +Q  +  KLQ++K  LD+KLRY+  W KVS++++AAT AA++IC+VV A +  
Sbjct  173   KFQTVYQKQMELQRKLQAKKKSLDRKLRYVRGWTKVSTIIYAATCAALVICAVVAAVMTV  232

Query  770   pavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVL  949
             PA+ GA+AA +++P+ ++G+WI S L  YE  ++  ++++      T++TIK++DTI+ L
Sbjct  233   PAIVGAVAAVSSMPLETLGRWIKSFLTKYEKELQARRDLMREANFKTFVTIKEMDTIRAL  292

Query  950   ADRLELEIESLLNTTSFAINEA---AVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIR  1120
              + L   +ES+++   F    A    + + +E+++ +   F++++++L    D CSRDIR
Sbjct  293   INSLSNSMESIVHCIQFGQRHADGFGMHLVVEQLKSRQSAFIRDLDELEEHVDRCSRDIR  352

Query  1121  RARTVILQRIIK  1156
             RAR V+L+RI+K
Sbjct  353   RARLVVLRRIVK  364



>ref|XP_004148443.1| PREDICTED: UPF0496 protein At2g18630-like [Cucumis sativus]
 ref|XP_004170692.1| PREDICTED: UPF0496 protein At2g18630-like [Cucumis sativus]
 gb|KGN62084.1| hypothetical protein Csa_2G296090 [Cucumis sativus]
Length=378

 Score =   253 bits (647),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 164/381 (43%), Positives = 248/381 (65%), Gaps = 14/381 (4%)
 Frame = +2

Query  53    IMGGHMSKK---SGETS------NDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHV  205
             +MGG  SK     G+ S      ND +    L SSYEA C  + DL++FD  +  RT+  
Sbjct  1     MMGGQSSKSKSGGGDVSFPPLPINDARYAAAL-SSYEAECLENPDLKSFDVQVHERTSRA  59

Query  206   ISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENS  385
             +++LA GV V +LS D+L EVT  LL+MN + VK+IL+ K+D+W N  LF LVE +F+NS
Sbjct  60    LNSLAGGVAVGSLSMDALMEVTDFLLEMNGDAVKIILKSKEDVW-NKGLFSLVEAFFDNS  118

Query  386   LKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGN  565
             LK L+F  AL++ L+R R+SQ +I LA+K+FE +  G +G   +Y +T E+LK F+ +G+
Sbjct  119   LKVLEFSKALEESLRRTRDSQFIIKLAVKKFESDENGDNG--ERYVKTFEDLKKFQEAGD  176

Query  566   PFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICs  745
             PF EEF  +F+S+Y +   M +KLQ +K KLDKK   +  W+ VS+V+     A+VLI S
Sbjct  177   PFGEEFVTLFRSLYKEHLSMFKKLQHQKKKLDKKYSTMETWKTVSNVILVTAFASVLIFS  236

Query  746   vvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIK  925
             VV AA+++P V  AL AA A+P+G +GKW ++L   Y ++IK  K+++SSM+  ++I +K
Sbjct  237   VVAAAMSAPPVVIALGAALAVPMGPVGKWCNTLWNRYLNSIKVEKQLLSSMEGHSFIILK  296

Query  926   DLDTIKVLADRLELEIESLLNTTSFAINE-AAVKVGIEEIRKKLDLFMKNVEDLGVQADN  1102
             D + I++L  RL +++ SLL   +  I E  A+++ I+EI+K L+ F + +E L   A  
Sbjct  297   DFENIRLLVRRLSIQLGSLLQNANLGIREQGAMQLVIDEIKKNLEGFDETIEKLSAHATK  356

Query  1103  CSRDIRRARTVILQRIIKHPN  1165
             CS D+ +AR VILQ+I +  N
Sbjct  357   CSTDVTKAREVILQKIARQSN  377



>ref|XP_002960974.1| hypothetical protein SELMODRAFT_402496 [Selaginella moellendorffii]
 gb|EFJ38513.1| hypothetical protein SELMODRAFT_402496 [Selaginella moellendorffii]
Length=370

 Score =   253 bits (645),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 147/372 (40%), Positives = 242/372 (65%), Gaps = 13/372 (3%)
 Frame = +2

Query  56    MGGHMSKK--SGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGV  229
             MG   S+    GE+ + +      +S YE  C +D D++ F   L+ RT  V+ ++  GV
Sbjct  1     MGNQSSRSLSPGESLSSID-----LSEYERVCAMDPDVRKFGDGLKERTERVLQSMVAGV  55

Query  230   EVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCA  409
             + R LSF SLK+VT   L++++EVV VIL  KKD+W +  LFELV++YF+NS+ +LDFC 
Sbjct  56    DERGLSFQSLKDVTTSFLELDQEVVNVILNYKKDVWASDSLFELVKDYFDNSMATLDFCE  115

Query  410   ALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQ  589
              L+KC+K+ARE+Q+ I +A+     E    D +  + +  L+EL  +  +GNPFT+EF  
Sbjct  116   ELNKCIKQARENQMSIQVAINMMPSEG---DPNEEQCQAILKELNQYVDAGNPFTDEFMD  172

Query  590   IFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaias  769
              FQ+VY +Q  +  KLQ++K  LD+KLRY+  W KVS++++AAT AA++IC+VV A +  
Sbjct  173   KFQTVYQKQMELQRKLQAKKKSLDRKLRYVRGWTKVSTIIYAATCAALVICAVVAAVMTV  232

Query  770   pavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVL  949
             PA+ GA+AA +++P+ ++G+WI S L  YE  ++  ++++      T++TIK++DTI+ L
Sbjct  233   PAIVGAVAAVSSMPLETLGRWIKSFLTKYEKELQARRDLMREANFKTFVTIKEMDTIRAL  292

Query  950   ADRLELEIESLLNTTSFAINEA---AVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIR  1120
              + L   +ES+++   F    A    + + +E+++ +   F++++++L    D CSRDIR
Sbjct  293   INSLRNSMESIVHCIQFGQRHADGFGMHLVVEQLKSRQSAFIRDLDELEEHVDRCSRDIR  352

Query  1121  RARTVILQRIIK  1156
             RAR V+L+RI+K
Sbjct  353   RARLVVLRRIVK  364



>ref|XP_010026393.1| PREDICTED: UPF0496 protein At4g34320-like [Eucalyptus grandis]
Length=457

 Score =   243 bits (620),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 155/344 (45%), Positives = 211/344 (61%), Gaps = 10/344 (3%)
 Frame = +2

Query  146   ELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECK  325
             ++D+ LQ  D TL  R + VI T+A+  E ++L+F SL E+    L+M+ EV K+ILE  
Sbjct  121   KVDSSLQDLDKTL--RADRVIRTIALRAEDQSLTFYSLGEMATDRLEMDHEVAKIILES-  177

Query  326   KDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDG  505
                W + EL  LV+ YF + L+ L F  +L  CL  AR++Q  I LA+  +EEE G   G
Sbjct  178   --TWNDKELIHLVDYYFNHCLRILGFYTSLGTCLGLARDNQSRIQLAIMHYEEERGENVG  235

Query  506   SNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHA  685
                KY +TL++L+  R +G PFT EF  +F SV+ QQA ML+KLQ+R+ KLDK+L+    
Sbjct  236   -GEKYVKTLQDLQRLREAGGPFTYEFSMLFNSVWEQQAEMLQKLQARE-KLDKELKSAQT  293

Query  686   WRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDA  865
             WR+V+  +F     + LI SVV  A A   V  ALAA    PI + GKW DS  K Y   
Sbjct  294   WRRVTIAIFVTVFMSALILSVVAVAKAWKPVVIALAAGLPAPIATAGKWCDSWWKKYRRE  353

Query  866   IKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINEA---AVKVGIE  1036
              KG KE+I  M  GT I+I DL TI++L  +L  EIES+L    F + E    A+K+G+ 
Sbjct  354   RKGKKELIDLMNAGTRISINDLVTIRLLVSKLGTEIESILQNAGFILGEEQEEAMKLGMR  413

Query  1037  EIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPNH  1168
             EI+K+ ++FMK +EDL  QAD  S +I RARTVILQRII  P+ 
Sbjct  414   EIKKRAEVFMKTMEDLSTQADKSSHEIHRARTVILQRIIGQPSR  457



>ref|XP_010484606.1| PREDICTED: UPF0496 protein At5g66670-like [Camelina sativa]
Length=409

 Score =   233 bits (594),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 144/390 (37%), Positives = 243/390 (62%), Gaps = 15/390 (4%)
 Frame = +2

Query  26    LAFVFGCVKIMGGHMSKKSGETSN----DLQCR------TDLISSYEAACELDADLQTFD  175
             +AF     ++M G+ S  SG T+      +Q +      +DL SSY +AC+  + L+TFD
Sbjct  1     MAFCGLHSELMKGNSSSNSGGTNGSSVKPIQTKMRSKYSSDL-SSYTSACKKYSSLKTFD  59

Query  176   STLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELF  355
             S +  RT  V S+L    + ++L+ +S+ EV G LL++N++ V+VI+E K+ + +N +L 
Sbjct  60    SLIHKRTKSVFSSLDAQAKTQSLNLESIMEVYGYLLELNQDTVRVIIESKEAVLKNKDLT  119

Query  356   ELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLE  535
              LV+ YF+++ K+LDFC  + KC+K+A  SQL+I LA+K+FE E+   +G  NKY +TLE
Sbjct  120   ALVDVYFKSTSKTLDFCNTVQKCVKKAEISQLVIRLAVKQFEAETDVGEGKKNKYAKTLE  179

Query  536   ELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFA  715
             EL  F++ G+PF  EF   ++S+Y +Q L+L++L+  K KLDKK R +  WR VS+V+F 
Sbjct  180   ELNKFKSLGDPFDGEFLTQYESIYDEQILLLDELRKLKVKLDKKQRNLKTWRIVSNVVFV  239

Query  716   ATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISS  895
                 A  + SVV AA+ +P V  A+A+    PI  +G W +++ K YE A++  + ++SS
Sbjct  240   TAFVAAFVLSVVAAAMVAPPVLCAVASGLTTPIDIVGMWCNNMWKVYEKAVERQRAVVSS  299

Query  896   MQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAI----NEAAVKVGIEEIRKKLDLF  1063
             ++ GT    + +  IK   ++L   I S+L T  FA+    +E A+ + +++I+KK++ F
Sbjct  300   LERGTQANNELMVNIKFEVEKLSERISSILMTIDFAVEREEDEMAMGLAMQDIKKKVEGF  359

Query  1064  MKNVEDLGVQADNCSRDIRRARTVILQRII  1153
                ++++G +ADNCS+ I   R +++  I+
Sbjct  360   TAKIKEVGERADNCSKLIALGRLIVVGHIL  389



>ref|XP_002525093.1| AT14A, putative [Ricinus communis]
 gb|EEF37220.1| AT14A, putative [Ricinus communis]
Length=348

 Score =   231 bits (588),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 150/206 (73%), Gaps = 16/206 (8%)
 Frame = +2

Query  53   IMGGHMSKKSG--------------ETSNDLQCRTDLISSYEAACELDADLQTFDSTLQA  190
            +MGG  SKK G              + +++ Q   DL +SYE AC LD DLQ FD+TL  
Sbjct  1    MMGGQFSKKKGVANPTPPPPPPPPLKINSNSQYTADL-TSYEDACMLDPDLQAFDTTLHE  59

Query  191  RTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEE  370
            RTN V+++L+ GVEVR+LSF+SLKEVT CLLDMN++VV VIL+CK+DIW N EL  LV+E
Sbjct  60   RTNRVLNSLSTGVEVRSLSFNSLKEVTNCLLDMNQDVVNVILQCKEDIWDNKELSALVKE  119

Query  371  YFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDG-SNNKYERTLEELKG  547
            YFE+S K+LDFCAAL+ CLKRAR SQL+I +AL+ FEEE    DG    KY +TLEEL+ 
Sbjct  120  YFESSAKTLDFCAALESCLKRARNSQLIIQVALRRFEEEVALHDGVVETKYVKTLEELRN  179

Query  548  FRASGNPFTEEFFQIFQSVYVQQALM  625
            F+A+G+PFT+EF+ +FQSVY QQ  M
Sbjct  180  FKAAGDPFTDEFYILFQSVYRQQVSM  205


 Score =   125 bits (314),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 88/118 (75%), Gaps = 4/118 (3%)
 Frame = +2

Query  827   KWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFA-  1003
             KW +SL   Y  A+KG KE++ S+QVGT+I I+D+D I++L ++LE EI++LL   + A 
Sbjct  231   KWCNSLWNGYMKALKGQKELVISLQVGTFIVIQDMDNIRILVNKLEAEIDALLQNVNIAV  290

Query  1004  INEAA---VKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPNH  1168
             INE A   VK+ I++I+KKL+ FM+ +EDLG  A  CS DIR+ARTVILQRII++P+ 
Sbjct  291   INEDAFEIVKIVIDDIKKKLEGFMQTIEDLGEHASKCSHDIRQARTVILQRIIRYPDR  348



>ref|XP_010465105.1| PREDICTED: UPF0496 protein At5g66670-like [Camelina sativa]
Length=405

 Score =   232 bits (592),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 141/389 (36%), Positives = 242/389 (62%), Gaps = 13/389 (3%)
 Frame = +2

Query  26    LAFVFGCVKIMGGHMSKKSGETSN----DLQCR-----TDLISSYEAACELDADLQTFDS  178
             +AF     ++M G+ S  SG T+      +Q +     +  +SSY +AC+  + L++FDS
Sbjct  1     MAFCGLFSELMKGNSSSNSGGTNGSPVKPIQTKMRSKYSSELSSYTSACKKYSSLKSFDS  60

Query  179   TLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFE  358
              +  RT  VIS+L    + ++L+ +S+ EV G LL++N++ V+VI+E K+D+ +N +L  
Sbjct  61    LVHKRTESVISSLDAQAKTQSLNLESIMEVYGYLLELNQDTVRVIIESKEDVLKNKDLKA  120

Query  359   LVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEE  538
             LV+ YF+++ K+LDFC  + KC+K+A  SQL+I LA+K+FE E+   +G   KY +TLEE
Sbjct  121   LVDVYFKSTSKTLDFCNTVQKCVKKAEISQLIIRLAVKQFETETDVGEGKKKKYAKTLEE  180

Query  539   LKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAA  718
             L  F++ G+PF  EF   ++S+Y +Q L+L++L+  K KLDKK R +  WR VS+V+F  
Sbjct  181   LNKFKSLGDPFDGEFVTQYESIYDEQILLLDELRKLKVKLDKKQRNLKTWRIVSNVVFVT  240

Query  719   TLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSM  898
                A  + SVV AA+ +P V  A+A+    PI  +G W +++ K YE A++  + ++SS+
Sbjct  241   AFVAAFVLSVVAAAMVAPPVLSAVASGLTTPIDVVGMWCNNMWKVYEKAVERQRGVVSSL  300

Query  899   QVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAI----NEAAVKVGIEEIRKKLDLFM  1066
             + G     + +  IK   ++L   I S+L T  FA+    +E A+ + +++I+KK++ F 
Sbjct  301   ESGAQANNELMVNIKFEVEKLSERISSILMTIDFAVEREEDEMAMGLAMQDIKKKVEGFT  360

Query  1067  KNVEDLGVQADNCSRDIRRARTVILQRII  1153
               ++++G +ADNCS+ I   R +++  I+
Sbjct  361   AKIKEVGERADNCSKLIALGRLIVVGHIL  389



>ref|XP_010026157.1| PREDICTED: UPF0496 protein At2g18630-like [Eucalyptus grandis]
Length=369

 Score =   231 bits (589),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 147/342 (43%), Positives = 207/342 (61%), Gaps = 10/342 (3%)
 Frame = +2

Query  149   LDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKK  328
             +D  LQ  D TL  R +  I TLA+G E ++L+F+SL E+    L+M+ EV K+ILE   
Sbjct  8     VDPSLQDLDKTLPDRADRAIRTLALGAEAQSLTFNSLGEMATGRLEMDHEVAKIILES--  65

Query  329   DIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGS  508
              IW + EL  LV+ YF +  + LDF  +L  CL+RA +SQ  I LAL   EEE G   G 
Sbjct  66    -IWNDEELIHLVDYYFNHCPQILDFYTSLKNCLRRAHDSQSNIQLALLHVEEERGENVG-  123

Query  509   NNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAW  688
               +Y RTL+EL+  R +G+PFTEEF +++ SV  QQ  M +KL++ K KLDKK++    W
Sbjct  124   GKRYVRTLQELQRLREAGDPFTEEFSELYHSVNEQQGEMSQKLEACKEKLDKKVKSAQTW  183

Query  689   RKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAI  868
             R V++ +      + LI S V  A A   V  A+ AA    IG++GKW DS  KNY   +
Sbjct  184   RWVTNAISVIVFVSTLILSAVAVAKAWLPVVIAITAALPTSIGTVGKWCDSWWKNYRREL  243

Query  869   KGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINE---AAVKVGIEE  1039
             KG K +I  M  GT I+I+DL TI  L D+L++EIES +      + E    AVK G+ E
Sbjct  244   KGKKLLIDLMNKGTKISIEDLKTIWRLVDKLKIEIESSMKKADITLGEEQGEAVKRGMLE  303

Query  1040  IRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
             I+ + ++FMK +EDL  QA+  S++I+RA   +L+RII  P+
Sbjct  304   IKGRAEVFMKIIEDLSTQAEKGSQEIQRA---LLKRIIGQPS  342



>ref|XP_002865055.1| hypothetical protein ARALYDRAFT_920059 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41314.1| hypothetical protein ARALYDRAFT_920059 [Arabidopsis lyrata subsp. 
lyrata]
Length=398

 Score =   231 bits (589),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 145/392 (37%), Positives = 235/392 (60%), Gaps = 18/392 (5%)
 Frame = +2

Query  41    GCVK--IMGGHMSKKSGETSNDLQC-RTDL-------ISSYEAACELDADLQTFDSTLQA  190
             GC+   + G   SK++G  +  ++  RTD+       +SSY +AC  D++L++FDS+L  
Sbjct  5     GCLPELMTGESSSKRNGPNTLPVKAVRTDMRSKYSSDLSSYTSACMKDSNLKSFDSSLHQ  64

Query  191   RTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEE  370
             RTN +I++LA   E ++L+ DSL EV G LL++N+  V+VI+E ++D+W+N +L  LV+ 
Sbjct  65    RTNIIITSLAARAETQSLNLDSLMEVYGFLLELNQNAVRVIIESREDVWKNKDLKSLVDI  124

Query  371   YFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGID-GSNN---KYERTLEE  538
             YF ++ K+LDFC  ++ C+KR   SQL+I  A+K+FE ES   D G NN   KY +TLEE
Sbjct  125   YFRSTSKTLDFCNTVENCVKRTEISQLIIRFAVKQFETESEDTDLGENNKKKKYAKTLEE  184

Query  539   LKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAA  718
             L  F+A G+PF  EF   F SVY QQ L+LE+L+ ++ KLDKK R +   R +S+V FA 
Sbjct  185   LNKFKAMGDPFNGEFVTQFDSVYDQQVLLLEELRKQRKKLDKKQRNVKTLRTLSNVFFAT  244

Query  719   TLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSM  898
                +VL+ SVV   +++P V  A+A+ +  PI   GKW   + K YE A+K  + ++  M
Sbjct  245   AFVSVLVLSVVATTMSAPPVVSAVASGSTAPIEITGKWFSQMWKKYERAVKRQRGLVLLM  304

Query  899   QVGTYITIKDLDTIKVLADRLELEIESLLNT----TSFAINEAAVKVGIEEIRKKLDLFM  1066
             +    +  + +  ++   D L + +  +L T          E A ++ ++ I+K +D F 
Sbjct  305   ESRAQVNNEAMKNVRSEVDELRIRVSLILETVEFAVEREEEEEATRLAMQGIKKHVDGFT  364

Query  1067  KNVEDLGVQADNCSRDIRRARTVILQRIIKHP  1162
             + +E++G  A  C + I   R ++L+ I++ P
Sbjct  365   EKMEEVGENAAKCCKFIALGRLLVLEHILRLP  396



>ref|XP_001757691.1| predicted protein [Physcomitrella patens]
 gb|EDQ77331.1| predicted protein [Physcomitrella patens]
Length=392

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 143/378 (38%), Positives = 223/378 (59%), Gaps = 16/378 (4%)
 Frame = +2

Query  62    GHMSKKSGETSNDLQCRTDLISS-----YEAACELDADLQTFDSTLQARTNHVISTLAVG  226
             G   KKS   ++     TD +       YEAAC+ D D++ FD  L  RT   +S+LA G
Sbjct  10    GKKIKKSVAVTSRTSSSTDPLPQINLEDYEAACKSDPDVKRFDDKLHTRTQEALSSLAEG  69

Query  227   VEV--RALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLD  400
             VE+  + +SF SLK+VT  LL+++ EVV VILE K+D+W N EL +LV EY   SL++LD
Sbjct  70    VEMPGQGVSFKSLKDVTKSLLEVDNEVVHVILEYKEDVWANKELMDLVTEYLNTSLEALD  129

Query  401   FCAALDKCLKRARES-QLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTE  577
             FC  L+KC+++ R++ +L + +A+     E    + + ++ +  L+EL+GF  + NPF+E
Sbjct  130   FCGVLEKCVQQTRDNLELHLQVAINHMPAEG---EPTQDQCDTVLKELQGFVRAANPFSE  186

Query  578   EFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvta  757
             +F + F +VY +   M  KLQ++K KLD K+R +  W KVS+++  AT AAVL+C V+  
Sbjct  187   DFSKQFVTVYQRHLEMQNKLQAKKRKLDSKMRSVRGWMKVSNIILGATCAAVLLCRVIAD  246

Query  758   aiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDT  937
             AIA+P VA  LA  +  P   MG W+  L + YE  I+    II     GT++ I+DL+ 
Sbjct  247   AIAAPKVAVDLAEESRKPGRGMGSWLKPLCRRYEQ-IRAQAAIIEDASKGTFVAIQDLNN  305

Query  938   IKVLADRLELEIESLLNTTSFA----INEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNC  1105
             IK   +RL+ +  ++     F      +  +++V +E IR+K   F+  +EDL    +  
Sbjct  306   IKASVERLKNDTSAITRNIRFGEDRRHDPYSLQVAVEAIRRKQSAFIDQLEDLRETVNQS  365

Query  1106  SRDIRRARTVILQRIIKH  1159
                I +ARTV+L RI+++
Sbjct  366   RGRINKARTVVLVRILEN  383



>ref|XP_010444756.1| PREDICTED: UPF0496 protein At5g66670-like isoform X1 [Camelina 
sativa]
Length=405

 Score =   229 bits (584),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 143/391 (37%), Positives = 240/391 (61%), Gaps = 17/391 (4%)
 Frame = +2

Query  26    LAFVFGCVKIMGGHMSKKSGETSNDLQCR-----------TDLISSYEAACELDADLQTF  172
             +AF     ++M G+ S  SG T N L  +           +DL SSY +AC   + L+TF
Sbjct  1     MAFSGLFSELMKGNSSSNSGGT-NGLPVKPIQTKLRSKYSSDL-SSYTSACTKYSSLKTF  58

Query  173   DSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHEL  352
             DS +  RT  V S+L    + ++L+ +S+ EV G LL++N++ V+VI+E K+ + +N +L
Sbjct  59    DSMIHKRTKSVFSSLDAQAKTQSLNLESIMEVYGYLLELNQDTVRVIIESKEAVLKNKDL  118

Query  353   FELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTL  532
              +LV+ YF+++ K+LDFC  + KC+K+A  SQL+I LA+K+FE E+   +G   KY +TL
Sbjct  119   KDLVDVYFKSTSKTLDFCNTVQKCVKKAEISQLVIRLAVKQFETETDVREGKKKKYAKTL  178

Query  533   EELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMF  712
             EEL  F++ G+PF  EF   ++S+Y +Q L+L++L+  K KLDKK R +  WR VS+V+F
Sbjct  179   EELNKFKSLGDPFDGEFLTQYESIYDEQILLLDELRKLKVKLDKKQRNLKTWRIVSNVVF  238

Query  713   AATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIIS  892
                  A  + SVV AA+ +P V  A+A+    PI  +G W +++ K YE A++  + ++S
Sbjct  239   VTAFVAAFVLSVVAAAMVAPPVLSAVASGLTTPIDVVGMWCNNMWKVYEKAVERQRGVVS  298

Query  893   SMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAI----NEAAVKVGIEEIRKKLDL  1060
             S++ G     + +  IK   ++L   I S+L T  FA+    +E A+ + +++I+KK++ 
Sbjct  299   SLESGAQANNELMVNIKFEVEKLSERISSILMTIDFAVEREEDEMAMGLAMQDIKKKVEG  358

Query  1061  FMKNVEDLGVQADNCSRDIRRARTVILQRII  1153
             F   ++++G +ADNCS+ I   R +++  I+
Sbjct  359   FTAKIKEVGERADNCSKLIALGRLIVVGHIL  389



>ref|XP_009103499.1| PREDICTED: UPF0496 protein At5g66670-like [Brassica rapa]
Length=385

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 139/380 (37%), Positives = 231/380 (61%), Gaps = 13/380 (3%)
 Frame = +2

Query  35    VFGCVKIMGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVIST  214
             +  C+K      +    + S+DL+        Y ++C+ D+DL+TFDS+L  RTN V+  
Sbjct  10    LMNCIKPSSNKNNSPRSKYSSDLKY-------YTSSCQQDSDLKTFDSSLHKRTNSVMKL  62

Query  215   LAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKS  394
             LA   + +++S  SL EV   +LD+N++VVK I+E ++D+  N +L  LV+ YF+N+ K+
Sbjct  63    LADQAKSQSISQGSLMEVYEFMLDLNRDVVKEIIESREDVRNNKDLTSLVDVYFKNTSKT  122

Query  395   LDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFT  574
             LDFC  +  C+K A  S+L+I  A+K+FE ES   D + NKY +TLEEL  F+A G+PF 
Sbjct  123   LDFCNTVQNCVKIAENSRLIIRYAVKQFEAESE--DANKNKYAKTLEELNKFKAVGDPFD  180

Query  575   EEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvt  754
              EF   + SVY +Q L+L++L   + KLDKK R +  WR++S+V+F     +VL+ SV  
Sbjct  181   GEFLTQYDSVYEEQVLLLDELGKLRAKLDKKQRNLKTWRRLSNVVFITAFVSVLLLSVAA  240

Query  755   aaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLD  934
             AA+++P V  A+AA     I  +GKW + + K YE A+K  + ++S+++ G  +     D
Sbjct  241   AALSAPIVLTAVAAGLTPSIEVVGKWSNKMWKKYEKAVKRQRGLVSTVETGVKVNRIATD  300

Query  935   TIKVLADRLELEIESLLNTTSFAI----NEAAVKVGIEEIRKKLDLFMKNVEDLGVQADN  1102
             +IK+  D L + ++ +L T  FA+    +E A ++ ++EI+KK++   + ++++G   D 
Sbjct  301   SIKLEVDNLRIRLKFILETVDFAVERGEDEEATRLAMQEIKKKVEGLTEKIKEVGQHTDR  360

Query  1103  CSRDIRRARTVILQRIIKHP  1162
              S+ I   R ++LQ I+  P
Sbjct  361   FSKVISSERRLVLQHILSLP  380



>ref|XP_010444757.1| PREDICTED: UPF0496 protein At5g66670-like isoform X2 [Camelina 
sativa]
 ref|XP_010444758.1| PREDICTED: UPF0496 protein At5g66670-like isoform X2 [Camelina 
sativa]
Length=395

 Score =   229 bits (583),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 141/381 (37%), Positives = 235/381 (62%), Gaps = 17/381 (4%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCR-----------TDLISSYEAACELDADLQTFDSTLQARTNH  202
             M G+ S  SG T N L  +           +DL SSY +AC   + L+TFDS +  RT  
Sbjct  1     MKGNSSSNSGGT-NGLPVKPIQTKLRSKYSSDL-SSYTSACTKYSSLKTFDSMIHKRTKS  58

Query  203   VISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFEN  382
             V S+L    + ++L+ +S+ EV G LL++N++ V+VI+E K+ + +N +L +LV+ YF++
Sbjct  59    VFSSLDAQAKTQSLNLESIMEVYGYLLELNQDTVRVIIESKEAVLKNKDLKDLVDVYFKS  118

Query  383   SLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASG  562
             + K+LDFC  + KC+K+A  SQL+I LA+K+FE E+   +G   KY +TLEEL  F++ G
Sbjct  119   TSKTLDFCNTVQKCVKKAEISQLVIRLAVKQFETETDVREGKKKKYAKTLEELNKFKSLG  178

Query  563   NPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLIC  742
             +PF  EF   ++S+Y +Q L+L++L+  K KLDKK R +  WR VS+V+F     A  + 
Sbjct  179   DPFDGEFLTQYESIYDEQILLLDELRKLKVKLDKKQRNLKTWRIVSNVVFVTAFVAAFVL  238

Query  743   svvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITI  922
             SVV AA+ +P V  A+A+    PI  +G W +++ K YE A++  + ++SS++ G     
Sbjct  239   SVVAAAMVAPPVLSAVASGLTTPIDVVGMWCNNMWKVYEKAVERQRGVVSSLESGAQANN  298

Query  923   KDLDTIKVLADRLELEIESLLNTTSFAI----NEAAVKVGIEEIRKKLDLFMKNVEDLGV  1090
             + +  IK   ++L   I S+L T  FA+    +E A+ + +++I+KK++ F   ++++G 
Sbjct  299   ELMVNIKFEVEKLSERISSILMTIDFAVEREEDEMAMGLAMQDIKKKVEGFTAKIKEVGE  358

Query  1091  QADNCSRDIRRARTVILQRII  1153
             +ADNCS+ I   R +++  I+
Sbjct  359   RADNCSKLIALGRLIVVGHIL  379



>gb|KCW64260.1| hypothetical protein EUGRSUZ_G019022, partial [Eucalyptus grandis]
Length=253

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 131/255 (51%), Positives = 180/255 (71%), Gaps = 5/255 (2%)
 Frame = +2

Query  137  AACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVIL  316
            AACE D D +TF++ LQARTN V+ TLA GV+V+ LS DSLKE++ CLL+MN+EVVKVI 
Sbjct  4    AACESDPDPRTFNANLQARTNQVLRTLASGVDVQTLSLDSLKEISECLLEMNQEVVKVIY  63

Query  317  ECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGG  496
            + KKDIWRN EL +LV++YF +SL +LDFCA+L+ CLK  R++ L I  AL  FEEE G 
Sbjct  64   DSKKDIWRNEELLKLVQDYFNDSLPTLDFCASLENCLKHVRDAHLQIFTALHCFEEEDG-  122

Query  497  IDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRY  676
             +G  + Y + LEEL  F+ +G+PFT EFF++FQ++Y  Q  ML+KL  +K K++KKL+ 
Sbjct  123  -EGCCS-YSKILEELTKFKETGDPFTREFFELFQTIYKLQKSMLKKLWIKKKKIEKKLKS  180

Query  677  IHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNY  856
            I  WRK+SS++  AT AA+LI           +     A A A  + ++GKWIDSL +N 
Sbjct  181  IQMWRKISSMIPVATFAAILI--YSVTTATVASAPVVAALAAATAMDAIGKWIDSLWRNC  238

Query  857  EDAIKGHKEIISSMQ  901
            E+A+K  +E+I+SMQ
Sbjct  239  EEALKRREEVITSMQ  253



>gb|ABK28300.1| unknown [Arabidopsis thaliana]
Length=399

 Score =   228 bits (581),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 150/393 (38%), Positives = 241/393 (61%), Gaps = 20/393 (5%)
 Frame = +2

Query  41    GCV-KIMGGHMS-KKSGETSNDL-QCRTDL-------ISSYEAACELDADLQTFDSTLQA  190
             GC+ ++M G  S K++G ++  + + RTD+       +SSY +AC+ D++L++FDS+L  
Sbjct  5     GCLSELMNGESSSKRNGPSTLPVKEVRTDMRSKYSSDLSSYTSACKKDSNLKSFDSSLHQ  64

Query  191   RTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEE  370
             RTN +I++LA   E ++L+ DSL EV G LL++N+  V+VI+E ++D+W+N +L  LV+ 
Sbjct  65    RTNIIITSLAARAETQSLNLDSLMEVYGFLLELNQNAVRVIIESREDVWKNKDLKSLVDV  124

Query  371   YFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEES-----GGIDGSNNKYERTLE  535
             YF+++ K+LDFC  ++ C+KR   SQL+I  A+K+FE ES     GG D    KY +TLE
Sbjct  125   YFKSTSKTLDFCNTVENCVKRTEISQLIIRFAVKQFEAESVDTDLGG-DKKKKKYTKTLE  183

Query  536   ELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFA  715
             EL  F+A G+PF  E    F SVY QQ L LE+L+ ++ KLDKK R +   R VS+V FA
Sbjct  184   ELNKFKAMGDPFDGELVTQFDSVYDQQVLFLEELRKQRRKLDKKQRNVKTLRTVSNVFFA  243

Query  716   ATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISS  895
                 +VL+ SVV   +++P V  A+A+ +  PI   GKW   + K YE A+K  + ++ +
Sbjct  244   TAYVSVLVLSVVATTMSAPPVVCAVASGSTAPIEITGKWFSQMWKKYEKAVKRQRGLVLT  303

Query  896   MQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAI----NEAAVKVGIEEIRKKLDLF  1063
             M+    +  + +  I+   D L   + S+L T  FA+     E A+ + ++ I+K +D F
Sbjct  304   MESRVQVNNEAMKNIRSDVDELRSWVSSILETVDFAVEREEEEEAMGLAMQGIKKHVDGF  363

Query  1064  MKNVEDLGVQADNCSRDIRRARTVILQRIIKHP  1162
              + +E++G  A  CS+ I   R ++L+ I+  P
Sbjct  364   TEKMEEVGENAAKCSKFIALGRLLVLEHILGLP  396



>ref|NP_201467.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9LVR4.1|U496F_ARATH RecName: Full=UPF0496 protein At5g66660 [Arabidopsis thaliana]
 dbj|BAA97272.1| At14a protein-like [Arabidopsis thaliana]
 gb|ABE65589.1| hypothetical protein At5g66660 [Arabidopsis thaliana]
 gb|AED98247.1| uncharacterized protein AT5G66660 [Arabidopsis thaliana]
Length=398

 Score =   228 bits (581),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 150/393 (38%), Positives = 241/393 (61%), Gaps = 20/393 (5%)
 Frame = +2

Query  41    GCV-KIMGGHMS-KKSGETSNDL-QCRTDL-------ISSYEAACELDADLQTFDSTLQA  190
             GC+ ++M G  S K++G ++  + + RTD+       +SSY +AC+ D++L++FDS+L  
Sbjct  5     GCLSELMNGESSSKRNGPSTLPVKEVRTDMRSKYSSDLSSYTSACKKDSNLKSFDSSLHQ  64

Query  191   RTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEE  370
             RTN +I++LA   E ++L+ DSL EV G LL++N+  V+VI+E ++D+W+N +L  LV+ 
Sbjct  65    RTNIIITSLAARAETQSLNLDSLMEVYGFLLELNQNAVRVIIESREDVWKNKDLKSLVDV  124

Query  371   YFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEES-----GGIDGSNNKYERTLE  535
             YF+++ K+LDFC  ++ C+KR   SQL+I  A+K+FE ES     GG D    KY +TLE
Sbjct  125   YFKSTSKTLDFCNTVENCVKRTEISQLIIRFAVKQFEAESVDTDLGG-DKKKKKYTKTLE  183

Query  536   ELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFA  715
             EL  F+A G+PF  E    F SVY QQ L LE+L+ ++ KLDKK R +   R VS+V FA
Sbjct  184   ELNKFKAMGDPFDGELVTQFDSVYDQQVLFLEELRKQRRKLDKKQRNVKTLRTVSNVFFA  243

Query  716   ATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISS  895
                 +VL+ SVV   +++P V  A+A+ +  PI   GKW   + K YE A+K  + ++ +
Sbjct  244   TAYVSVLVLSVVATTMSAPPVVCAVASGSTAPIEITGKWFSQMWKKYEKAVKRQRGLVLT  303

Query  896   MQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAI----NEAAVKVGIEEIRKKLDLF  1063
             M+    +  + +  I+   D L   + S+L T  FA+     E A+ + ++ I+K +D F
Sbjct  304   MESRVQVNNEAMKNIRSDVDELRSWVSSILETVDFAVEREEEEEAMGLAMQGIKKHVDGF  363

Query  1064  MKNVEDLGVQADNCSRDIRRARTVILQRIIKHP  1162
              + +E++G  A  CS+ I   R ++L+ I+  P
Sbjct  364   TEKMEEVGENAAKCSKFIALGRLLVLEHILGLP  396



>ref|NP_201468.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001078809.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9LVR3.1|U496G_ARATH RecName: Full=UPF0496 protein At5g66670 [Arabidopsis thaliana]
 dbj|BAA97273.1| At14a protein-like [Arabidopsis thaliana]
 gb|AAZ52793.1| hypothetical protein At5g66670 [Arabidopsis thaliana]
 gb|AAZ52794.1| hypothetical protein At5g66670 [Arabidopsis thaliana]
 gb|ABE97199.1| hypothetical protein At5g66670 [Arabidopsis thaliana]
 gb|AED98248.1| uncharacterized protein AT5G66670 [Arabidopsis thaliana]
 gb|AED98249.1| uncharacterized protein AT5G66670 [Arabidopsis thaliana]
Length=408

 Score =   228 bits (582),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 149/385 (39%), Positives = 239/385 (62%), Gaps = 18/385 (5%)
 Frame = +2

Query  50    KIMGGHMSKKSGETSNDL----------QCRTDLISSYEAACELDADLQTFDSTLQARTN  199
             +++ GH S  +  T+  L          Q  +DL SSY +AC+  + L++FDS L  RTN
Sbjct  9     ELIKGHSSSNNNGTNVSLAKTIQTNIRSQYSSDL-SSYASACKKYSSLKSFDSLLHERTN  67

Query  200   HVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFE  379
              +IS+LA   + R+L+ +SL EV G LL++N++ V+VI+E K+D+ +N++L  LV+ YF+
Sbjct  68    SIISSLAAQAKTRSLNIESLMEVYGYLLELNQDTVRVIIESKEDVLKNNDLKALVDVYFK  127

Query  380   NSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGID---GSNNKYERTLEELKGF  550
             ++ K+LDFC  ++KC+K+A  SQL+I  A+K+FE E+   D       KY +TLEE+  F
Sbjct  128   STSKTLDFCNTVEKCVKKAEISQLIIRFAVKQFETETVDTDLGESKKKKYVKTLEEMNKF  187

Query  551   RASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAA  730
             +A G+PF  EF   ++SVY +Q L+L++L+  K KL KKLR I  WR +S+V+FA     
Sbjct  188   KAMGDPFDGEFVTQYKSVYDEQVLLLDELRKLKVKLGKKLRNIKTWRILSNVVFATAFVT  247

Query  731   VLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGT  910
             V + SVV AA+ +P V  A+A+    PI  +G W + + K YE A+K  + ++ +M++G 
Sbjct  248   VFVLSVVAAAMMAPPVLSAVASGLTTPIEVVGMWCNKMWKEYEKAVKRQRGLVLTMELGV  307

Query  911   YITIKDLDTIKVLADRLELEIESLLNTTSFAI----NEAAVKVGIEEIRKKLDLFMKNVE  1078
                   +  IK   + L + I S+L T +FA+    NE A +  ++EI+KK++ F + +E
Sbjct  308   QANNVTMVNIKFEVENLSIRISSILKTVNFAVDREENEMATRFAMQEIKKKVEGFTEKIE  367

Query  1079  DLGVQADNCSRDIRRARTVILQRII  1153
             ++G +A NCS+ I   R V+L  I+
Sbjct  368   EVGERAANCSKLIALGRLVVLGHIL  392



>ref|XP_010910757.1| PREDICTED: UPF0496 protein 1-like [Elaeis guineensis]
Length=376

 Score =   225 bits (573),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 148/376 (39%), Positives = 231/376 (61%), Gaps = 20/376 (5%)
 Frame = +2

Query  56    MGGHMSKKSG-----ETSNDLQCR--TDLISSYEAACELDADLQTFDSTLQARTNHVIST  214
             MGG +  K       +T ++ + R  ++L + YE AC LD  +QTF+ TLQ RT+ V+S+
Sbjct  1     MGGCLRSKPAVHGMDDTDDNTEQRYISELNAYYEEACRLDPKIQTFNLTLQRRTSRVLSS  60

Query  215   LAV-GVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLK  391
             LA     +R+LSF+SL+E T  LL +N +   V+L+ K DI  N +L   V+E+F+NS++
Sbjct  61    LAGDAAALRSLSFNSLREATDGLLAVNHDAFAVVLDLKDDISSNPDLLFFVKEFFKNSVE  120

Query  392   SLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPF  571
             +L F AAL +CL RA E++ +++ A++ F+           ++ ++LE+L+ FRA G+PF
Sbjct  121   TLKFFAALKQCLHRAHEAESIVNSAIQLFD---------GKEFSKSLEKLRDFRALGDPF  171

Query  572   TEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvv  751
             T  F    +SV   Q   L  L  +K ++DKKL  + AWRKV SV +AAT AAVLICSVV
Sbjct  172   TSSFIDELRSVCEHQRSTLVSLHGKKEEIDKKLGCVKAWRKVWSVAYAATFAAVLICSVV  231

Query  752   taaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDL  931
              AA+A P  A A AAA +  +GS+G W D+L +N E  ++G  E+I  ++  T+  I++L
Sbjct  232   LAAVAVPPAATAAAAAASTAMGSIGAWFDALWENCEGVLEGEVEVIGMVRKETFFAIQEL  291

Query  932   DTIKVLADRLELEIESLLNTTSFAIN---EAAVKVGIEEIRKKLDLFMKNVEDLGVQADN  1102
             D ++V  ++LE  + S+   T F +    E AV+V +E +RKKL  F +++ +L  + D 
Sbjct  292   DGMRVAVEKLEAMVGSMARETEFGMREEEEVAVRVAVEGMRKKLGEFGRSLVELENEVDR  351

Query  1103  CSRDIRRARTVILQRI  1150
             CS ++ +A   +LQ I
Sbjct  352   CSGEVGKASAAVLQTI  367



>gb|KCW59243.1| hypothetical protein EUGRSUZ_H01920 [Eucalyptus grandis]
Length=299

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 138/298 (46%), Positives = 184/298 (62%), Gaps = 8/298 (3%)
 Frame = +2

Query  281   LDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIH  460
             L+M+ EV K+ILE     W + EL  LV+ YF + L+ L F  +L  CL  AR++Q  I 
Sbjct  6     LEMDHEVAKIILES---TWNDKELIHLVDYYFNHCLRILGFYTSLGTCLGLARDNQSRIQ  62

Query  461   LALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQ  640
             LA+  +EEE G   G   KY +TL++L+  R +G PFT EF  +F SV+ QQA ML+KLQ
Sbjct  63    LAIMHYEEERGENVG-GEKYVKTLQDLQRLREAGGPFTYEFSMLFNSVWEQQAEMLQKLQ  121

Query  641   SRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigs  820
             +R+ KLDK+L+    WR+V+  +F     + LI SVV  A A   V  ALAA    PI +
Sbjct  122   ARE-KLDKELKSAQTWRRVTIAIFVTVFMSALILSVVAVAKAWKPVVIALAAGLPAPIAT  180

Query  821   MGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSF  1000
              GKW DS  K Y    KG KE+I  M  GT I+I DL TI++L  +L  EIES+L    F
Sbjct  181   AGKWCDSWWKKYRRERKGKKELIDLMNAGTRISINDLVTIRLLVSKLGTEIESILQNAGF  240

Query  1001  AINEA---AVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
              + E    A+K+G+ EI+K+ ++FMK +EDL  QAD  S +I RARTVILQRII  P+
Sbjct  241   ILGEEQEEAMKLGMREIKKRAEVFMKTMEDLSTQADKSSHEIHRARTVILQRIIGQPS  298



>ref|XP_002865054.1| hypothetical protein ARALYDRAFT_920058 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41313.1| hypothetical protein ARALYDRAFT_920058 [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score =   222 bits (566),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 137/346 (40%), Positives = 220/346 (64%), Gaps = 7/346 (2%)
 Frame = +2

Query  137   AACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVIL  316
             +AC+  + L++FDS+L  RTN +IS+LA   + ++L+ +SL EV G LL++N++ V+VI+
Sbjct  47    SACKKYSSLKSFDSSLHERTNSIISSLAAQAKTQSLNLESLMEVYGYLLELNQDTVRVII  106

Query  317   ECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGG  496
             E K+D+ +N++L  LV+ YF+++ K+LDFC  ++KC+K+A  SQL+I  A+K+FE E+  
Sbjct  107   ESKEDVLKNNDLKALVDVYFKSTSKTLDFCNTVEKCVKKAEISQLIIRFAVKQFETETVD  166

Query  497   ID---GSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKK  667
              D       KY +TLEEL  F+A G+PF  EF   ++SVY QQ L+L++L+  K KL KK
Sbjct  167   TDLGESKKKKYVKTLEELNKFKAMGDPFDGEFVTQYESVYEQQILLLDELRKLKVKLGKK  226

Query  668   LRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLL  847
              R I  WR +S+V+F      V + SVV AA+ +P V  A+A+    PI  +G W + + 
Sbjct  227   QRNIKTWRILSNVVFVTAFVTVFVLSVVAAAMMAPPVLSAVASGLTTPIEVVGTWCNKMW  286

Query  848   KNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAI----NEA  1015
             K YE A+K  + ++ +M++G       +  IK   + L + I S+L T  FA+    NE 
Sbjct  287   KEYEKAVKRQRGLVLTMELGVQANNVTMVNIKFEVENLSIRISSILKTVDFAVEREENEM  346

Query  1016  AVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRII  1153
             A +  ++EI+KK++ F + +E++G +A NCS+ I   R V+L  I+
Sbjct  347   ATRFAMQEIKKKVEGFTEKIEEVGERAANCSKLIALGRLVVLGHIL  392



>ref|XP_006279638.1| hypothetical protein CARUB_v10026516mg [Capsella rubella]
 gb|EOA12536.1| hypothetical protein CARUB_v10026516mg [Capsella rubella]
Length=405

 Score =   222 bits (566),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 129/348 (37%), Positives = 218/348 (63%), Gaps = 4/348 (1%)
 Frame = +2

Query  122   ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEV  301
             +SSY +AC+  + L++FDS L  RT +VIS+L    + R+++ +SL  V G LL++N++ 
Sbjct  42    LSSYTSACKKYSFLKSFDSLLHKRTYNVISSLDTQAKTRSINLESLMGVYGYLLELNQDT  101

Query  302   VKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFE  481
             V+VI++ K  + +N +L  LV+ YF+++ K+LDFC  + KC+K+A  SQL+I  A+K+FE
Sbjct  102   VRVIIQNKDAVLKNKDLKSLVDIYFKSTSKTLDFCNTVQKCVKKAEISQLIIRFAVKQFE  161

Query  482   EESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLD  661
              E+    G  NKY +TLEEL  F++ G+PF  EF   ++S+Y +Q L+L++L+  K KLD
Sbjct  162   TETDLGVGKKNKYAKTLEELNKFKSMGDPFDGEFVTQYESIYDEQILLLDELRKVKEKLD  221

Query  662   KKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDS  841
             KK R +  WR VS+V+F     A  + SV  AA+ +P V  A+A+    PI  +G W ++
Sbjct  222   KKQRNVKTWRIVSNVVFVTAFVAAFVLSVAAAAMVAPPVLSAVASGLTTPIEVVGMWCNN  281

Query  842   LLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAI----N  1009
             + K YE A++  + ++SS++ G       +  IK   D L + I S+L T  F      +
Sbjct  282   MWKKYEKAVERQRGVVSSLERGAQANNVMMVNIKFEVDNLSIRISSILKTVDFVAERKED  341

Query  1010  EAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRII  1153
             E A +V +++I+ +++ F + ++++G +A+NCS+ I   R V++  I+
Sbjct  342   ETATRVAMQDIKNQVEEFTEKIKEVGERANNCSKLIALGRLVVMGHIL  389



>emb|CDY45250.1| BnaA07g12400D [Brassica napus]
Length=386

 Score =   221 bits (562),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 140/383 (37%), Positives = 231/383 (60%), Gaps = 14/383 (4%)
 Frame = +2

Query  35    VFGCVKIMGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVIST  214
             +  C+K      +    + S+DL+        Y ++C+ D+DL+TFDS+L  RTN V+  
Sbjct  10    LMNCIKPSSNKNNSPRSKYSSDLKY-------YTSSCQQDSDLKTFDSSLHKRTNSVMKL  62

Query  215   LAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKS  394
             LA   + +++S  SL EV   +LD+N++VVK I+E ++D+  N +L  LV+ YF+N+ K+
Sbjct  63    LADQAKSQSISQGSLMEVYEFMLDLNRDVVKEIIESREDVRNNKDLTSLVDVYFKNTSKT  122

Query  395   LDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFT  574
             LDFC  +  C+K A  S+L+I  A+K+FE ES   D + NKY +TLEEL  F+A G+PF 
Sbjct  123   LDFCNTVQNCVKIAENSRLIIRYAVKQFEAESE--DANKNKYAKTLEELNKFKAVGDPFD  180

Query  575   EEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvt  754
              EF   + SVY +Q L+L++L   + KLDKK R +  WR++S+V+F     +VL+ SV  
Sbjct  181   GEFLTQYDSVYEEQVLLLDELGKLRAKLDKKQRNLKTWRRLSNVVFITAFVSVLLLSVAA  240

Query  755   aaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLD  934
             AA+++P V  A+AA     I  +GKW + + K YE A+K  + ++S+++ G  +     D
Sbjct  241   AALSAPIVLTAVAAGLTPSIEVVGKWSNKMWKKYEKAVKRQRGLVSTVETGVKVNRIATD  300

Query  935   TIKVLADRLELEIESLLNTTSFAI----NEAAVKVGIEEIRKKLDLFMKNV-EDLGVQAD  1099
             +IK+  + L + ++ +L T  FA+    +E A ++ ++EI+KK++   + + E++G  A 
Sbjct  301   SIKLEVENLRIRLKFILETVDFAVERGEDEEATRLAMQEIKKKVEGLTEKIKEEVGQHAA  360

Query  1100  NCSRDIRRARTVILQRIIKHPNH  1168
              CS  I   R V L+ I   P++
Sbjct  361   MCSGLIALGRLVFLKHIRSLPSN  383



>gb|EPS73740.1| hypothetical protein M569_01016, partial [Genlisea aurea]
Length=240

 Score =   214 bits (544),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 148/210 (70%), Gaps = 5/210 (2%)
 Frame = +2

Query  122  ISSYEAACELDADLQTFDSTLQARTNHVISTLAVGV---EVRALSFDSLKEVTGCLLDMN  292
            +S YE+AC  D  L++FDS L+ R    I ++AVG    +VR L  +SL +VT CL++MN
Sbjct  18   LSRYESACLADPRLRSFDSGLRERAGRAIDSIAVGSGGDDVRCLPLESLSQVTECLMEMN  77

Query  293  KEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALK  472
            +EVVK+IL+ ++ IW+N EL +LV++YF+ SL++LDFC AL+ CL+RA   + +I++AL 
Sbjct  78   QEVVKIILQSRRGIWKNKELSDLVDDYFDTSLRTLDFCTALESCLRRAAHIESIINVALH  137

Query  473  EFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKN  652
            +F EES G +G   KY  TL ELK FR +G+PF  +FF++F SV   Q  MLE+L SRK 
Sbjct  138  KFREESSGENG--GKYAGTLAELKKFRTAGDPFAGDFFKVFNSVSSGQISMLERLNSRKR  195

Query  653  KLDKKLRYIHAWRKVSSVMFAATLAAVLIC  742
            KLDKKL  +  +R++SSV+F    AAVL+C
Sbjct  196  KLDKKLANLKTYRRISSVIFITAFAAVLVC  225



>ref|XP_010070449.1| PREDICTED: UPF0496 protein At2g18630-like [Eucalyptus grandis]
Length=350

 Score =   214 bits (546),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 141/348 (41%), Positives = 207/348 (59%), Gaps = 12/348 (3%)
 Frame = +2

Query  131   YEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKV  310
             Y+    ++  LQ  D  L+ R + VI TLA+G E R L+F+SL E+    L+M+ E   +
Sbjct  3     YQLKLRVEPSLQDLDKILRDRADRVIRTLALGAEARFLTFNSLGEMATAHLEMDHEAAMI  62

Query  311   ILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEES  490
             IL   K+IW + EL  LV+ YF + L+ LDF  +L  CL RA +SQ  + LAL +FEEE 
Sbjct  63    IL---KNIWNDRELIHLVDYYFNHCLQILDFYTSLKNCLSRAHDSQSSVQLALVQFEEER  119

Query  491   GGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKL  670
                D    +Y +TL+EL+ FR +G+PFTEEF  +F S+Y QQ  ML+KL++ K KL+   
Sbjct  120   AE-DVGGKRYVKTLQELQRFREAGDPFTEEFSTLFHSMYKQQEEMLQKLEACKKKLEACK  178

Query  671   RYI-------HAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGK  829
             + +         WR V+  +F     +  I SVV    A   V   LAAA + PI + GK
Sbjct  179   KKLDKKVKSAQTWRWVTIAIFVTVFVSTFILSVVKVDKAWRHVVVTLAAALSGPIVTFGK  238

Query  830   WIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAIN  1009
             W DS  K ++   +G K +I  M VGT I+I+DL TI+ L  ++E EI S+L     A+ 
Sbjct  239   WCDSWWKTHQRKREGKKNLIDLMNVGTRISIEDLKTIRSLVSKVETEIASILQNADLALG  298

Query  1010  EAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRII  1153
             E AV++GI EI+K +++ +K ++DL ++A   SR+I+ AR VI +RI+
Sbjct  299   EEAVELGILEIKKMVEV-VKTIKDLSIRATKSSREIQTARRVISKRIM  345



>gb|KCW58572.1| hypothetical protein EUGRSUZ_H01229 [Eucalyptus grandis]
Length=322

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 139/341 (41%), Positives = 203/341 (60%), Gaps = 26/341 (8%)
 Frame = +2

Query  143   CELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILEC  322
             C +D  LQ  D TL+ R   VI TL +G E ++ +F+ L E+    L+MN E VK+ILE 
Sbjct  5     CRVDPSLQDLDKTLRDRAARVIRTLELGAEAQSPTFNPLGEMATGRLEMNPEAVKIILES  64

Query  323   KKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGID  502
             K +   + EL  LV  YF + L+ LDF  +L KCL++A ++Q  I  A+  FEEE G   
Sbjct  65    KMN---DKELVHLVLYYFNHCLQILDFYTSLRKCLRQACDNQFWIRHAIMHFEEERGENV  121

Query  503   GSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIH  682
             G   KY +TL+ L+ F+ + NPFT+E+ ++F+SVY Q+  ML+K                
Sbjct  122   G-REKYVKTLQGLQKFKEADNPFTDEYSKLFKSVYKQKEEMLQK----------------  164

Query  683   AWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYED  862
                +V++ +F     + L  SV+  AIA+P V  AL  A   PIG++GKW DS  KN+  
Sbjct  165   ---RVTNAIFVTAFVSTLNFSVIAVAIAAPPVVIALPTALVAPIGTVGKWCDSRWKNFRG  221

Query  863   AIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAIN---EAAVKVGI  1033
              +KG KE+I  M  GT I+I DL TI++L  +L+ EIE +L+   FA+    E AVK+G+
Sbjct  222   ELKGKKELIDLMNAGTRISINDLVTIRLLESKLKTEIELILHNADFALGEEEEEAVKLGM  281

Query  1034  EEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIK  1156
              EI+K +++ MK +EDL +QA+  S +I+ A  VI QRII+
Sbjct  282   LEIKKMVEVVMKTIEDLSIQANKSSHEIQTAWKVIWQRIIR  322



>emb|CDY69791.1| BnaCnng65370D [Brassica napus]
Length=420

 Score =   209 bits (531),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 135/348 (39%), Positives = 214/348 (61%), Gaps = 12/348 (3%)
 Frame = +2

Query  152   DADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKD  331
             D++L++FDS+L  RTN V+ +LA   E +++S  SL EV G LLD+N++VV +I+E ++D
Sbjct  52    DSNLKSFDSSLHQRTNIVMRSLA---ESQSISQGSLMEVYGYLLDLNRDVVSLIIESRED  108

Query  332   IWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGID---  502
             +  N  L  LV+ YF+N+ K+LDFC  +  C+K+A  S+L+I  A+K FE ES GI    
Sbjct  109   VINNKYLSSLVDVYFKNTSKTLDFCNTVQNCVKKAEISKLIIRYAVKLFEAESVGIGENN  168

Query  503   ---GSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLR  673
                 + NKY +TL EL  F+A G+PF  EF   ++SVY QQ L+LE+L++ K KLDKK R
Sbjct  169   NNNNNKNKYAKTLAELNKFKAMGDPFEGEFETQYESVYEQQVLLLEELRNLKAKLDKKQR  228

Query  674   YIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKN  853
              +  WRK+S+V+FA    ++L+ SVV AA+ +P V   +A+    PI  +GKW + +   
Sbjct  229   NLEIWRKLSNVVFATAFVSILVLSVVAAAVVAPQVLIQVASGLTTPIEVVGKWCNEMWNK  288

Query  854   YEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNT---TSFAINEAAVK  1024
             YE A+K   E++S ++ G  +     + I+   ++L ++I  +LNT         E + +
Sbjct  289   YEKAVKIQIELVSKVEAGAKVNNVATENIRFEVEQLRIKILFILNTIEIGVEEEEEVSTR  348

Query  1025  VGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPNH  1168
             + ++EI KK+D     +E++G  A  CS+ I   R ++LQ I+  P +
Sbjct  349   LAMQEIMKKVDGLTDKIEEVGESAAKCSKLIGYGRFLVLQHILGLPTN  396



>ref|XP_010041211.1| PREDICTED: UPF0496 protein At4g34320-like [Eucalyptus grandis]
 gb|KCW44538.1| hypothetical protein EUGRSUZ_L01953 [Eucalyptus grandis]
Length=266

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 124/259 (48%), Positives = 173/259 (67%), Gaps = 6/259 (2%)
 Frame = +2

Query  347   ELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYER  526
             ELF+LV + F N L  L FCA L+ CLK A  +QLLI  AL  FEEE    D    +Y  
Sbjct  12    ELFKLVRDDFPNGLHILYFCATLENCLKYAHNAQLLIFNALHCFEEEDRNGDS---RYSN  68

Query  527   TLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSV  706
             TLE+L+ FR +G+P TE FF+IFQ ++ Q+  M EKLQ +K ++D KL+ I  W KVS++
Sbjct  69    TLEKLRNFRKTGDPLTE-FFKIFQIIHKQKKSMFEKLQIKKKEIDTKLKNIQTWAKVSNM  127

Query  707   MFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEI  886
             +   T  A+LI SV+TAA+ +  +A AL AA A P+  +GKWIDSL KNYE  +   +E+
Sbjct  128   ILVTTFEAILIYSVMTAAVFALPIATALVAAAAFPMDLVGKWIDSLWKNYEKRLMEQREV  187

Query  887   ISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINEA--AVKVGIEEIRKKLDL  1060
             I+SMQ  T++ + DLDT+++L D LE++I+SLL+   F I E   A+K+ I +I+KK+  
Sbjct  188   ITSMQASTFVALMDLDTLRILIDHLEVQIKSLLHKADFVIEEGAEALKLEIADIKKKMRH  247

Query  1061  FMKNVEDLGVQADNCSRDI  1117
             FMK+VE+L  QAD C R +
Sbjct  248   FMKDVEELEKQADMCFRGL  266



>emb|CDY54199.1| BnaCnng26390D [Brassica napus]
Length=397

 Score =   204 bits (518),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 137/368 (37%), Positives = 226/368 (61%), Gaps = 19/368 (5%)
 Frame = +2

Query  110   RTDLISSYEA-------ACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSL--K  262
             RTD+ S Y +       AC+ D+DL+TFDS+L  RTN V+  LA   + +++S  SL   
Sbjct  27    RTDMSSKYSSDLKYYTSACQQDSDLKTFDSSLHKRTNSVMKLLADQAKSQSISQGSLIVM  86

Query  263   EVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARE  442
             EV   +LD+N++VVK I+E ++D+  N +L  LV+ YF+N+ K+LDFC  +  C+K A  
Sbjct  87    EVYEFMLDLNRDVVKEIIESREDVRNNKDLTSLVDVYFKNTSKTLDFCNTVQNCVKIAEN  146

Query  443   SQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQAL  622
             S+L+I  A+K+FE ES   D   NKY +TLEEL  F+A G+PF  E    ++SV  +Q L
Sbjct  147   SRLIIRYAVKQFEAESE--DAKRNKYAKTLEELNKFKAVGDPFDGELLTQYESVCEEQDL  204

Query  623   MLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaat  802
             +LE+L   + KLDKK R +  WR++S+V+F     +VL+ SV  AA+++P V  A+AA  
Sbjct  205   LLEELGKLRAKLDKKQRNLKTWRRLSNVVFITAFVSVLLLSVAAAALSAPIVLTAVAAGL  264

Query  803   aipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESL  982
                I  +GKW + + K YE A++G +E++S+++ G  +     D+I++  + L ++++ +
Sbjct  265   TPSIEVVGKWSNEMWKKYEKAVRGQRELVSTVETGAKVNRIATDSIRLEVENLRIKLKFI  324

Query  983   LNTTSFAI--------NEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVI  1138
             L T  FA+        +E A ++ ++EI+KK++   + ++++G   D  S+ I   R ++
Sbjct  325   LETVDFAVEREGGGEEDEEATRLAMQEIKKKVEGLTEKIKEVGQHTDRFSKVISSERRLV  384

Query  1139  LQRIIKHP  1162
             LQ I+  P
Sbjct  385   LQHILSLP  392



>ref|XP_010026153.1| PREDICTED: UPF0496 protein At5g66675-like [Eucalyptus grandis]
 gb|KCW58573.1| hypothetical protein EUGRSUZ_H01230 [Eucalyptus grandis]
Length=300

 Score =   201 bits (511),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 139/295 (47%), Positives = 192/295 (65%), Gaps = 9/295 (3%)
 Frame = +2

Query  281   LDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLD-FCAALDKCLKRARESQLLI  457
             L+MN E+ KVILE    I+ + E  +LV+ +F + L+ LD F  ALD CL+RAR++Q  I
Sbjct  6     LEMNLEIAKVILES---IYDDKEPSDLVDYHFNHYLQILDDFYTALDNCLRRARDNQSWI  62

Query  458   HLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKL  637
              LA+  FEEE     G   KY +TL+EL+ FR +G PFT+EF  +F SV  QQ  ML+KL
Sbjct  63    QLAIIHFEEERRENVGGE-KYAKTLQELQRFREAGGPFTDEFSMLFNSVCEQQKEMLQKL  121

Query  638   QSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipig  817
             Q+R+ KLDKK++    WR+V + +F     + LI SVV    A+      LAAA A PIG
Sbjct  122   QARE-KLDKKVKSAQVWRRVINFIFVTAFMSALIFSVVAVGKAARPAVSTLAAALATPIG  180

Query  818   sMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTS  997
             ++GKW +S  + Y   +KG KE++  M  GT I   DL+TI++LA +L+ EIES+L   +
Sbjct  181   TVGKWCNSWCEKYRKKLKGKKELVDLMNAGTRILNNDLETIRLLASKLKTEIESILQNAN  240

Query  998   FAIN---EAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRII  1153
             FA+    E AVK+G+ EIRK+ D+FMK +EDL  QAD  SR+I+ ART+IL RI+
Sbjct  241   FALGEEQEEAVKLGMLEIRKRADVFMKTMEDLSTQADKSSREIQMARTLILLRIM  295



>emb|CBI32550.3| unnamed protein product [Vitis vinifera]
Length=198

 Score =   194 bits (493),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +2

Query  821   MGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSF  1000
             MGKWIDSLLKNYE+A+KG KE+ISSMQVGTY+ IKDLDTI+VL DRLE+EIESLL TT +
Sbjct  83    MGKWIDSLLKNYENALKGQKEVISSMQVGTYVAIKDLDTIRVLIDRLEIEIESLLQTTDY  142

Query  1001  AINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
              I E AVK GIEEI+KKL +FMKNV+DLGVQAD CSRDIRRARTV+LQRIIK PN
Sbjct  143   VIKEEAVKFGIEEIKKKLGVFMKNVDDLGVQADMCSRDIRRARTVVLQRIIKQPN  197


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 5/62 (8%)
 Frame = +2

Query  56   MGGHMSKKSGETSNDLQCRTDL-----ISSYEAACELDADLQTFDSTLQARTNHVISTLA  220
            MGGHMSKKS ETS+ +    +L     +SSYEAAC +D DLQ+FD+TLQART+HVI+TLA
Sbjct  1    MGGHMSKKSAETSSAITINPNLHYSTELSSYEAACRVDTDLQSFDTTLQARTSHVINTLA  60

Query  221  VG  226
            VG
Sbjct  61   VG  62



>ref|XP_009138584.1| PREDICTED: UPF0496 protein At4g34320-like [Brassica rapa]
Length=212

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 158/201 (79%), Gaps = 12/201 (6%)
 Frame = +2

Query  392  SLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPF  571
            +LDFCAAL+K L+ AR+SQLLI ++L++FE+ES  ++G N  YE+TLEELK F+ + +PF
Sbjct  15   TLDFCAALEKGLRIARDSQLLILVSLQQFEDESL-VEGGNG-YEKTLEELKNFKEAESPF  72

Query  572  TEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvv  751
             E+FF+          +MLEKLQ RKNKLDKKL+ IH WRK+SS++F AT A VLICSVV
Sbjct  73   DEDFFK----------MMLEKLQHRKNKLDKKLKSIHTWRKLSSIIFVATFATVLICSVV  122

Query  752  taaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDL  931
             A +A+P VA ALAAATAIP+GSMGKW+DSL KNYE+A+KG KE+ISSMQ GTY+ +KDL
Sbjct  123  AAGMAAPPVAAALAAATAIPLGSMGKWVDSLWKNYENALKGQKEVISSMQAGTYVAVKDL  182

Query  932  DTIKVLADRLELEIESLLNTT  994
            D I+VL +RLE++     +TT
Sbjct  183  DNIRVLIERLEIKKGKDCDTT  203



>ref|XP_010026156.1| PREDICTED: UPF0496 protein At2g18630-like [Eucalyptus grandis]
Length=294

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 135/298 (45%), Positives = 183/298 (61%), Gaps = 13/298 (4%)
 Frame = +2

Query  281   LDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIH  460
             L+M+ EV K+ILE    IW + EL  LV+ YF + L+ L F  +L  CL RAR++Q  I 
Sbjct  6     LEMDHEVAKIILES---IWNDEELIHLVDYYFNHCLQILGFYTSLGTCLGRARDNQSQIQ  62

Query  461   LALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQ  640
             LA+  FEEE     G       TL+EL+ FR +G+PFT+EF  +F SV  QQA ML+KLQ
Sbjct  63    LAIMHFEEERAENVGG------TLQELQRFREAGDPFTDEFSMLFNSVCEQQAEMLQKLQ  116

Query  641   SRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigs  820
             +R+ KLDK+L+    WR+V+  +F     + LI SVV  A A   V  ALAAA   PI +
Sbjct  117   ARE-KLDKELKSAQTWRRVTIAIFVTAFVSALIFSVVAVAKAWKPVVIALAAALPAPIVT  175

Query  821   MGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSF  1000
              GKW +S  + Y   +KG KE+I  M  GT I I DL TI++L  +LE EIES++    F
Sbjct  176   AGKWRNSWCEKYRKKLKGKKELIDLMNAGTRILINDLVTIRLLVSKLETEIESIMQIADF  235

Query  1001  AIN---EAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
             A+    E AV+ G+ +I+K+ D+FMK +EDL  Q D  SR+I+ ART+IL RI+    
Sbjct  236   ALGEEQEEAVRRGMLQIKKRADVFMKTMEDLSTQDDKSSREIQMARTLILLRIMGQSG  293



>gb|KCW58574.1| hypothetical protein EUGRSUZ_H01231 [Eucalyptus grandis]
Length=287

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 134/296 (45%), Positives = 181/296 (61%), Gaps = 13/296 (4%)
 Frame = +2

Query  287   MNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLA  466
             M+ EV K+ILE    IW + EL  LV+ YF + L+ L F  +L  CL RAR++Q  I LA
Sbjct  1     MDHEVAKIILE---SIWNDEELIHLVDYYFNHCLQILGFYTSLGTCLGRARDNQSQIQLA  57

Query  467   LKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSR  646
             +  FEEE     G       TL+EL+ FR +G+PFT+EF  +F SV  QQA ML+KLQ+R
Sbjct  58    IMHFEEERAENVGG------TLQELQRFREAGDPFTDEFSMLFNSVCEQQAEMLQKLQAR  111

Query  647   KNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMG  826
             + KLDK+L+    WR+V+  +F     + LI SVV  A A   V  ALAAA   PI + G
Sbjct  112   E-KLDKELKSAQTWRRVTIAIFVTAFVSALIFSVVAVAKAWKPVVIALAAALPAPIVTAG  170

Query  827   KWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAI  1006
             KW +S  + Y   +KG KE+I  M  GT I I DL TI++L  +LE EIES++    FA+
Sbjct  171   KWRNSWCEKYRKKLKGKKELIDLMNAGTRILINDLVTIRLLVSKLETEIESIMQIADFAL  230

Query  1007  N---EAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
                 E AV+ G+ +I+K+ D+FMK +EDL  Q D  SR+I+ ART+IL RI+    
Sbjct  231   GEEQEEAVRRGMLQIKKRADVFMKTMEDLSTQDDKSSREIQMARTLILLRIMGQSG  286



>ref|XP_010026391.1| PREDICTED: UPF0496 protein 1-like [Eucalyptus grandis]
 gb|KCW59241.1| hypothetical protein EUGRSUZ_H01916 [Eucalyptus grandis]
Length=300

 Score =   191 bits (484),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 129/294 (44%), Positives = 186/294 (63%), Gaps = 7/294 (2%)
 Frame = +2

Query  281   LDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIH  460
             L+M+ E  K+IL   K IW + EL  LV+ YF + L+ LDF  +L  CL RAR+SQ  +H
Sbjct  6     LEMDHEAAKIIL---KYIWNDRELIHLVDYYFNHCLQILDFYTSLKNCLSRARDSQSSVH  62

Query  461   LALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQ  640
             LAL  FEEE     G   +Y RTL+EL+ FR +G+PFTEEF ++F+S+  QQ  ML+KL+
Sbjct  63    LALVHFEEERAENVG-GRRYVRTLQELQRFREAGDPFTEEFSKLFRSMCKQQEEMLQKLE  121

Query  641   SRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigs  820
             + K KLDKK++    WR V+  +F     +  I SVV    A   V   LAAA + PI +
Sbjct  122   ACKKKLDKKVKSAQTWRWVTITIFVIVFVSTFILSVVKVDKAWRHVVVTLAAALSGPIVT  181

Query  821   MGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSF  1000
             +GKW DS  K ++   +G K +I  M VGT I+I+DL TI+ L  ++E EI S+L    F
Sbjct  182   VGKWCDSWWKTHQRKREGKKNLIDLMNVGTRISIEDLKTIRSLVSKVETEIASILQNADF  241

Query  1001  AI---NEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRII  1153
             A+    E AV++GI EI+K +++ +K ++DL ++A+  SR+I+ AR VI +RI+
Sbjct  242   ALREEQEEAVELGILEIKKMVEVVVKTIKDLSIRANKSSREIQTARRVISKRIM  295



>ref|XP_010026392.1| PREDICTED: uncharacterized protein LOC104416741 [Eucalyptus grandis]
Length=711

 Score =   198 bits (503),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 140/344 (41%), Positives = 191/344 (56%), Gaps = 39/344 (11%)
 Frame = +2

Query  146   ELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECK  325
             ++D  LQ  D TL  R +  I TLA+G E ++L+F+SL E+    L+M+ EV ++ILE  
Sbjct  332   KVDLSLQDLDKTLPDRADRAIRTLALGAEAQSLTFNSLGEMATGRLEMDHEVAEIILE--  389

Query  326   KDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDG  505
               IW + EL  LV+ YF + L+ LDF    D+                  F EE G   G
Sbjct  390   -SIWNDEELIHLVDYYFNHCLQILDFYTRGDR------------------FPEERGKNVG  430

Query  506   SNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHA  685
                +Y RTL+EL+ FR  G+PFTEEF ++F SVY QQ  M +KL++ K KLDKK++    
Sbjct  431   -GKRYVRTLQELQRFREVGDPFTEEFSKLFHSVYKQQGEMSQKLEACKKKLDKKVKICTN  489

Query  686   WRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDA  865
                         L   LI               ++ AA    IG++GKW DS  KNY   
Sbjct  490   LEMGDQCHICYRLRVRLI--------------LSVVAALRTSIGTVGKWCDSWWKNYRRE  535

Query  866   IKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAIN---EAAVKVGIE  1036
             +KG K +I  M  GT  +I+DL TI  L  +LE+EIES++    F +    E AVK+G+ 
Sbjct  536   LKGKKLLIDLMNEGTKSSIEDLKTIWSLLGKLEVEIESIMQKADFTLGEEQEEAVKLGML  595

Query  1037  EIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPNH  1168
             EIRK+ ++FMK +EDL  QAD  S +I+RARTVIL RII  P+H
Sbjct  596   EIRKRAEVFMKTIEDLSTQADKSSHEIQRARTVILIRIIGQPSH  639


 Score =   123 bits (308),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 117/347 (34%), Positives = 176/347 (51%), Gaps = 42/347 (12%)
 Frame = +2

Query  110   RTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDM  289
             R+DL +SYEAA  +D  LQ F+ TL  + + VI TLA G + ++L+ ++L E        
Sbjct  9     RSDL-TSYEAADGVDTSLQDFEKTLHDQADRVIGTLAAGAKAQSLTINNLTE--------  59

Query  290   NKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLAL  469
                                         FE   + L+F  +L +C+  A E+ L I  AL
Sbjct  60    ----------------------------FEQGKQRLEFYTSLKQCVSGAHENYLSIEHAL  91

Query  470   KEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRK  649
             + FEEE G       KY +T +EL+ F+ + + F  E  + F  VY QQ  + ++LQ+  
Sbjct  92    RHFEEEGGENV-GGEKYVKTRQELQKFKNASDLFMNELSKPFNLVYNQQKKLCKELQAFA  150

Query  650   NKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGK  829
              KLDKKL+    W++V++ +F     A LI SVV  AI +     ALAA  A PIG++GK
Sbjct  151   KKLDKKLKSTKVWKRVTNAIFLTAFVATLIFSVVAVAINASPFVTALAAGLAAPIGTVGK  210

Query  830   WIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAIN  1009
               D+  KN    ++  KE+I  M + T I+I +L  I  L ++L+       N T     
Sbjct  211   SCDTWWKNCHAKLEKKKELIDMMNMRTLISIVELKRIWSLLNQLKTNA----NFTLGEEQ  266

Query  1010  EAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRI  1150
             E AVK  + EI+KKL+ F+  +E+L  +A+   R I  A  +I QR+
Sbjct  267   EEAVKPVMLEIQKKLEEFVATIENLSTEANESRRHIELAMNMISQRL  313



>ref|XP_011025709.1| PREDICTED: UPF0496 protein At2g18630-like isoform X1 [Populus 
euphratica]
Length=357

 Score =   188 bits (477),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 145/374 (39%), Positives = 209/374 (56%), Gaps = 23/374 (6%)
 Frame = +2

Query  56    MGGHMSKKSGETSNDLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAV-GVE  232
             MGG  SK S   ++D     D IS YE A + D  L++FD+ +   T  V ++L     +
Sbjct  1     MGGQSSKTS---NDDFGFAKDFIS-YEDASKKDPRLRSFDAKVLEGTKIVGNSLVTCNSD  56

Query  233   VRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAA  412
             VR+L  D LK++   L D+N++VV   LE K+DIW   ELF LV+EYF+ S K +DFC  
Sbjct  57    VRSL--DLLKDLIKFLFDLNRDVVTFFLESKEDIWNKPELFSLVQEYFDGSNKYMDFCTE  114

Query  413   LDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASGNPFTEEFFQI  592
             L +C+ RAR+SQ  I  A+  FE++          Y +TLEEL+ F  +GNPFT EFF +
Sbjct  115   LQRCVLRARDSQKHIQAAVTHFEKDI---------YAKTLEELQKFVEAGNPFTPEFFDL  165

Query  593   FQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiasp  772
             FQSV  QQ  +LEK++S K KLDKKL+ +  WR V+ V+F +    ++I +VV  A ++ 
Sbjct  166   FQSVREQQQSLLEKIRSHKRKLDKKLKKVTIWRAVTYVLFVSLSVFMMISNVVAVAFSAS  225

Query  773   avagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLA  952
              V  AL  A    +  M    D     Y+ A+K  +E +  +   T+  I  +  +K LA
Sbjct  226   PVVTALVTALGGAVKGMESCCD-FWNLYQKALKVEREFVEKIDRATFTRITAMTNVKALA  284

Query  953   DRLELEIESLLNTTSFAIN--EAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRA  1126
             +RL +EIE LL   +   N  E  VK+ ++EI+K++ LF    E L VQA      I + 
Sbjct  285   ERLTVEIEPLLKKAAGLANREEDFVKLKMDEIKKEMALFKDTCEQLYVQAHKYHSHIIQG  344

Query  1127  RTVILQRIIKHPNH  1168
             R  IL++I    NH
Sbjct  345   RNQILEKI----NH  354



>ref|XP_010026152.1| PREDICTED: UPF0496 protein At2g18630-like [Eucalyptus grandis]
Length=303

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 128/341 (38%), Positives = 183/341 (54%), Gaps = 45/341 (13%)
 Frame = +2

Query  143   CELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILEC  322
             C +D  LQ  D TL+ R   VI TL +G E ++ +F+ L E+    L+MN E VK+ILE 
Sbjct  5     CRVDPSLQDLDKTLRDRAARVIRTLELGAEAQSPTFNPLGEMATGRLEMNPEAVKIILES  64

Query  323   KKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGID  502
             K +   + EL  LV  YF + L+ LDF  +L KCL++A ++Q  I  A+  FEEE G   
Sbjct  65    KMN---DKELVHLVLYYFNHCLQILDFYTSLRKCLRQACDNQFWIRHAIMHFEEERGENV  121

Query  503   GSNNKYERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIH  682
             G   KY +TL+ L+ F+ + NPFT+E         V  A+ +    S  N          
Sbjct  122   G-REKYVKTLQGLQKFKEADNPFTDE---------VTNAIFVTAFVSTLN----------  161

Query  683   AWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYED  862
                  S +  A     V+I                L  A   PIG++GKW DS  KN+  
Sbjct  162   ----FSVIAVAIAAPPVVIA---------------LPTALVAPIGTVGKWCDSRWKNFRG  202

Query  863   AIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAIN---EAAVKVGI  1033
              +KG KE+I  M  GT I+I DL TI++L  +L+ EIE +L+   FA+    E AVK+G+
Sbjct  203   ELKGKKELIDLMNAGTRISINDLVTIRLLESKLKTEIELILHNADFALGEEEEEAVKLGM  262

Query  1034  EEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIK  1156
              EI+K +++ MK +EDL +QA+  S +I+ A  VI QRII+
Sbjct  263   LEIKKMVEVVMKTIEDLSIQANKSSHEIQTAWKVIWQRIIR  303



>ref|XP_002984051.1| hypothetical protein SELMODRAFT_423223 [Selaginella moellendorffii]
 gb|EFJ15063.1| hypothetical protein SELMODRAFT_423223 [Selaginella moellendorffii]
Length=462

 Score =   184 bits (467),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 130/185 (70%), Gaps = 3/185 (2%)
 Frame = +2

Query  188  ARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVE  367
             RT  V+ ++  GV+ R LSF SLK+VT   L++++EVV VIL  KKD+W +  LFELV+
Sbjct  2    GRTERVLQSMVAGVDERGLSFQSLKDVTTSFLELDQEVVNVILNYKKDVWASDSLFELVK  61

Query  368  EYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKG  547
            +YF+NS+ +LDFC  L+KC+K+ARE+Q+ I +A+     E    D +  + +  L+EL  
Sbjct  62   DYFDNSMATLDFCEELNKCIKQARENQMSIQVAINMMPSEG---DPNEEQCQAILKELNQ  118

Query  548  FRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLA  727
            +  +GNPFT+EF + FQ+VY +Q  +  KLQ++K  LD+KLRY+  W KVS++++AAT A
Sbjct  119  YVDAGNPFTDEFMEKFQTVYQKQMELQRKLQAKKKSLDRKLRYVRGWTKVSTIIYAATCA  178

Query  728  AVLIC  742
            A++IC
Sbjct  179  ALVIC  183



>gb|KFK28345.1| hypothetical protein AALP_AA8G504100, partial [Arabis alpina]
Length=835

 Score =   187 bits (476),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 125/321 (39%), Positives = 206/321 (64%), Gaps = 4/321 (1%)
 Frame = +2

Query  203   VISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFEN  382
             V+++LA   + ++LS DSL EV G LL+++++ V VI+E ++D+W+N +L  LV+ YF++
Sbjct  515   VLNSLASRADAQSLSVDSLMEVYGFLLELSQDAVSVIIESREDVWKNKDLRSLVDVYFKS  574

Query  383   SLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESGGIDGSNNKYERTLEELKGFRASG  562
             + K+LDFC  ++ C+K+   SQL+I  A+K+FE E    +   NKY +TLEEL  F+A G
Sbjct  575   TSKTLDFCNTVENCVKKTEISQLIIRFAVKQFEAEDLEGNKKKNKYAKTLEELNKFKAMG  634

Query  563   NPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLIC  742
             +PF  EF   ++SVY +Q L+LE+L+  K KLDKK R +  WR +S+V+FA    +VL+ 
Sbjct  635   DPFDGEFVTPYESVYEEQVLLLEELRKLKVKLDKKQRNVKTWRILSNVVFATAFVSVLVL  694

Query  743   svvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITI  922
             SVV AA+++P V  A+AA +  PI  +GKW + + K YE A+K  + ++ S+++G  +  
Sbjct  695   SVVAAAMSAPPVISAVAAGSTAPIEVVGKWFNDMWKEYEKAVKRQRGLVLSIEIGAKVNN  754

Query  923   KDLDTIKVLADRLELEIESLLNT----TSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGV  1090
                + I+V  D+L ++I  +L T          E A ++ ++EI+KK+D F + +E++G 
Sbjct  755   VVTENIRVEVDKLRIKILWILETVEFAVEREEEEVATRLAMQEIKKKVDGFTEKIEEVGE  814

Query  1091  QADNCSRDIRRARTVILQRII  1153
              A  CS+ I   R ++L  I+
Sbjct  815   NAAKCSKFIALGRLLVLGHIL  835



>gb|ABR25727.1| unknown [Oryza sativa Indica Group]
Length=145

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 102/116 (88%), Gaps = 1/116 (1%)
 Frame = +2

Query  821   MGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSF  1000
             MGKWIDSLLK Y+DA++G KE++S+MQVGT+I IKDLD+I+VL +R+ELEI S+++   F
Sbjct  30    MGKWIDSLLKGYQDALRGQKEVVSAMQVGTFIAIKDLDSIRVLINRVELEISSMIDCVEF  89

Query  1001  A-INEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
             A  +E AVK G+EEI+KKL++FMK+VEDLG QAD CSRDIRRARTV+LQRII+HP+
Sbjct  90    AERDEEAVKFGVEEIKKKLEVFMKSVEDLGEQADRCSRDIRRARTVVLQRIIRHPS  145



>gb|KHN16742.1| UPF0496 protein [Glycine soja]
Length=161

 Score =   166 bits (420),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 130/158 (82%), Gaps = 1/158 (1%)
 Frame = +2

Query  590   IFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaias  769
             ++QSVY QQ LM EKL+ R++KLDKK++ I++WRKVSS++F AT+AAVLICSVV AAIA+
Sbjct  1     MYQSVYNQQLLMFEKLRVRQSKLDKKVKRIYSWRKVSSMIFVATVAAVLICSVVAAAIAT  60

Query  770   pavagalaaataipigsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVL  949
             P VA ALAA TA PIGSMGKWIDSLL NYE+A+K  KE+  SMQVGTY+ IKD++ I VL
Sbjct  61    PDVAAALAAVTATPIGSMGKWIDSLLNNYENAMKEPKEVTFSMQVGTYVAIKDMENIWVL  120

Query  950   ADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLF  1063
              DRLE+EIESLL+   FAI E AVKV IEEI+KKL  F
Sbjct  121   VDRLEVEIESLLHNVEFAIEE-AVKVAIEEIQKKLGSF  157



>gb|KCW44471.1| hypothetical protein EUGRSUZ_L020211, partial [Eucalyptus grandis]
Length=266

 Score =   167 bits (422),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 96/219 (44%), Positives = 143/219 (65%), Gaps = 4/219 (2%)
 Frame = +2

Query  518   YERTLEELKGFRASGNPFTEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKV  697
             Y + LEEL  F+ +G+PFT EFF++FQ++Y  Q  ML+KL  +  K++KKL+ I  WRK+
Sbjct  44    YSKILEELTKFKETGDPFTREFFELFQTIYKLQKSMLKKLWIKMKKIEKKLKSIQMWRKI  103

Query  698   SSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSLLKNYEDAIKGH  877
             SS++  AT AA+LI           +     A A A  + ++GKWIDSL +N E+A+K  
Sbjct  104   SSMIPVATFAAILI--YSVTTATVASPPVVAALAAATAMDAIGKWIDSLWRNCEEALKRR  161

Query  878   KEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAINEA--AVKVGIEEIRKK  1051
             +E+I+SMQ   ++ +KDLD +++  D LE +++SLL    F I     AVK+GI +I+KK
Sbjct  162   EEVITSMQASIFVALKDLDKMRITIDPLEEQMKSLLQKADFPIEAGAEAVKLGIADIKKK  221

Query  1052  LDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPNH  1168
             L  FMK+V+ LG   D CS +++R+R V+LQRIIK P +
Sbjct  222   LRDFMKDVKGLGKDVDMCSCNVQRSRLVVLQRIIKPPTN  260



>gb|AFK42892.1| unknown [Medicago truncatula]
Length=154

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 112/149 (75%), Gaps = 5/149 (3%)
 Frame = +2

Query  56   MGGHMSKKSGETSNDLQCRTDLI-----SSYEAACELDADLQTFDSTLQARTNHVISTLA  220
            MGG+ SK   + ++  +  T  +     SSYEAAC  D +LQ+FD +++  TN VIS+LA
Sbjct  1    MGGNSSKMMSDANDCTKMGTHSVYAADLSSYEAACVKDPNLQSFDESIKEHTNRVISSLA  60

Query  221  VGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLD  400
             GVEVR+LSF+SL+EVT  LL+MN EVVKVIL+CK+DIW N +LF LV +YF+NSL++L+
Sbjct  61   TGVEVRSLSFNSLREVTDSLLEMNHEVVKVILDCKRDIWGNKDLFALVNDYFDNSLQTLE  120

Query  401  FCAALDKCLKRARESQLLIHLALKEFEEE  487
            FC +L+KCL+RARE+Q+++   +  FEEE
Sbjct  121  FCNSLEKCLRRARENQVMVKSVITYFEEE  149



>ref|XP_009394362.1| PREDICTED: long chain base biosynthesis protein 2d-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=651

 Score =   170 bits (430),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 136/168 (81%), Gaps = 2/168 (1%)
 Frame = +2

Query  665   KLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaataipigsMGKWIDSL  844
             KL+ +  WRKVSS+MFAA   AV+ICSVV A +A+P VA ALAAA +IPI   GKWIDSL
Sbjct  485   KLKRLKTWRKVSSIMFAAAFTAVIICSVVAAVVAAPPVAAALAAAASIPIP-AGKWIDSL  543

Query  845   LKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLELEIESLLNTTSFAI-NEAAV  1021
             LK Y+DA++  K I++SM+VGT +T+KDLD I+VL D+LE++I SLL+ + F++ +E AV
Sbjct  544   LKGYQDALERQKGILNSMRVGTDLTLKDLDIIQVLVDKLEIQIHSLLDASDFSLRDEDAV  603

Query  1022  KVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQRIIKHPN  1165
             + GIEEIRKKL+ FMK+V+ L  QAD C+RDIRRARTV+LQ+II+HPN
Sbjct  604   RFGIEEIRKKLEEFMKSVDSLDQQADRCNRDIRRARTVVLQKIIRHPN  651



>ref|XP_010550397.1| PREDICTED: UPF0496 protein At5g66675-like [Tarenaya hassleriana]
Length=322

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 107/310 (35%), Positives = 176/310 (57%), Gaps = 11/310 (4%)
 Frame = +2

Query  236   RALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAAL  415
             R+LSFDSL++VTG +L++N EVVK+ILE K++ +++     L++ Y + SL++LD C+ L
Sbjct  5     RSLSFDSLRQVTGSMLELNNEVVKIILEVKQEEFKSESFMPLMKAYMDASLRNLDLCSTL  64

Query  416   DKCLKRARESQLLIHLALKEFEEESGGIDGSNNK--YERTLEELKGFRASGNPFTEEFFQ  589
             ++C+K AR+ Q  IHL L+E  E     DG  NK    R  EEL   R   NPF +    
Sbjct  65    ERCIKYARDGQFTIHLHLREAVE-----DGDQNKILMTRAKEELTKLRTEDNPFPQHVSD  119

Query  590   IFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaias  769
             +F + + +   ++ +  ++   +D+KL+ I  W K+S+V+FA    +VL+ + V+ A+  
Sbjct  120   MFDATHHRLESLIVESNNQTRGIDRKLKRIETWSKLSTVLFAIGYFSVLVLTGVSLAVNV  179

Query  770   pavagalaaataipigsMGKWIDSLLKNYEDAIKGHKE-IISSMQVGTYITIKDLDTIKV  946
             P+    LA+A    IGSMGKW +   K  E  I+  +E ++ S++ G Y+ ++D+D +K+
Sbjct  180   PSPVEILASALLATIGSMGKWTNYYCKQEEKRIRRVRESLVVSVRTGAYVMLRDMDNVKI  239

Query  947   LADRLELEIESLLNTTSFAINEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRA  1126
             + ++   E+E LL      + E      +    +    F    E+L       S D RRA
Sbjct  240   IVEKWRAEMEILLKKAEAVLREEEEMGEMMREWET---FQGMTEELDRNVSKVSEDTRRA  296

Query  1127  RTVILQRIIK  1156
             RTV LQRI++
Sbjct  297   RTVSLQRILQ  306



>gb|KCW64262.1| hypothetical protein EUGRSUZ_G019032, partial [Eucalyptus grandis]
Length=123

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +2

Query  137  AACELDADLQTFDSTLQARTNHVISTLAVGVEVRALSFDSLKEVTGCLLDMNKEVVKVIL  316
            AACE D D +TF++ LQARTN V+ TLA GV+V+ LS DSLKE++ CLL+MN+EVVKVIL
Sbjct  4    AACESDPDPRTFNANLQARTNQVLRTLASGVDVQTLSLDSLKEISECLLEMNQEVVKVIL  63

Query  317  ECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLIHLALKEFEEESG  493
            + KKDIWRN ELF+LV++YF +SL +LDFCA+L+ CLK  R++ L I  AL  FEEE G
Sbjct  64   DSKKDIWRNEELFKLVQDYFNDSLPTLDFCASLENCLKHVRDAHLQIFTALHCFEEEDG  122



>ref|XP_007199031.1| hypothetical protein PRUPE_ppa017922mg [Prunus persica]
 gb|EMJ00230.1| hypothetical protein PRUPE_ppa017922mg [Prunus persica]
Length=243

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 135/237 (57%), Gaps = 69/237 (29%)
 Frame = +2

Query  56   MGGHMSKKSGETSN------DLQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTL  217
            M GHMSKKS ETS+      +L+  TD + S EAA ++D+ L +FD      TNH     
Sbjct  1    MEGHMSKKSPETSSAINLGTNLKDITDQLGSGEAAFKIDSGLHSFD------TNH-----  49

Query  218  AVGVEVRALSFDSLKEVTGCLLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSL  397
                     S+                       C++        F+L         ++L
Sbjct  50   --------HSY-----------------------CRR--------FKLPH------FRTL  64

Query  398  DFCAALDKCLKRARESQLLIHLALKEFEEES--GGIDGSNNKYERTLEELKGFRASGNPF  571
            D C AL+KCLKRAR SQ  I ++L++F EE+  GG     N+Y RTLEEL  F+  G+PF
Sbjct  65   DSCTALEKCLKRARASQSFILVSLQQFVEETEIGG-----NRYSRTLEELNKFKEIGDPF  119

Query  572  TEEFFQIFQSVYVQQALMLEKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLIC  742
            T+E+FQIFQSVY+QQ LMLEKL+  KNKLDKKL+ IHAWRKVS+++F A +AAV IC
Sbjct  120  TKEYFQIFQSVYMQQTLMLEKLKLPKNKLDKKLKSIHAWRKVSTMIFVAIIAAVWIC  176


 Score = 62.8 bits (151),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  1022  KVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTVILQ  1144
             K  +EEI+KKL + MKNVEDLG QAD CS DIRRARTV LQ
Sbjct  203   KYALEEIKKKLVVDMKNVEDLGAQADTCSGDIRRARTVFLQ  243



>ref|NP_566836.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_850644.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9LHD9.1|U496C_ARATH RecName: Full=UPF0496 protein At3g28270 [Arabidopsis thaliana]
 dbj|BAB02617.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL32818.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM91188.1| unknown protein [Arabidopsis thaliana]
 gb|AEE77425.1| uncharacterized protein AT3G28270 [Arabidopsis thaliana]
 gb|AEE77426.1| uncharacterized protein AT3G28270 [Arabidopsis thaliana]
Length=374

 Score =   155 bits (392),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 118/365 (32%), Positives = 200/365 (55%), Gaps = 16/365 (4%)
 Frame = +2

Query  101   LQCRTDLISSYEAACELDADLQTFDSTLQARTNHVISTLAVGVEVRALS-FDSLKEVTGC  277
             L+C  D++S+Y++ACE    L++FD++LQ RTN +I +L V  +  + S  D+  E++  
Sbjct  9     LKCSEDMMSAYKSACEEHPKLKSFDASLQQRTNKMIDSLTVEDKNGSSSPHDAHMELSKH  68

Query  278   LLDMNKEVVKVILECKKDIWRNHELFELVEEYFENSLKSLDFCAALDKCLKRARESQLLI  457
             L+++ + V   I E + D+W N  L  LV  YFEN+ K+L+    ++ C++ A   QLLI
Sbjct  69    LVEVTQGVADFITEIEDDVWDNQALKYLVLAYFENTKKTLEIFKTIENCVENAEMGQLLI  128

Query  458   HLALKEFEEESGGID--GSNNKYERTLEELKGFRASGNPFTEEFFQI-FQSVYVQQALML  628
               AL EFE+ES   D  G   KYE+TLE+LK F+  G+PF  +     F+ +  QQ  +L
Sbjct  129   REALAEFEKESAEKDVGGKKKKYEKTLEDLKSFKEMGDPFDGKVLTTQFERIKKQQESLL  188

Query  629   EKLQSRKNKLDKKLRYIHAWRKVSSVMFAATLAAVLICsvvtaaiaspavagalaaatai  808
             E++   + K+  ++  +     +++V+F A  A V + S+   A    A AG  A A  +
Sbjct  189   EEVSETRKKIQDEISNLEKKTLITNVVFGAAFAIVAVASIALIATGVGAAAGFGALAAPL  248

Query  809   pi-------gsMGKWIDSLLKNYEDAIKGHKEIISSMQVGTYITIKDLDTIKVLADRLEL  967
                       ++ K  D+L K  E  +K  +EI  S++ G     +  +T+ +L D LE 
Sbjct  249   LAAGWAGVYTTLDKKKDALNKQLE-GLKKVEEIEESVEKGIKTNEEATETVSILVDGLED  307

Query  968   EIESLLNTTSFAI----NEAAVKVGIEEIRKKLDLFMKNVEDLGVQADNCSRDIRRARTV  1135
              I+++L     AI    NEAA ++ + +I KK++   K + ++G   ++ S+ I +AR  
Sbjct  308   RIKNMLKLVDNAIDHEDNEAATRIVLTQISKKVEKLTKKITEVGESVEDHSKLIAKARLQ  367

Query  1136  ILQRI  1150
             +LQ+I
Sbjct  368   VLQKI  372



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4247309536456