BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18848_g1_i3 len=1712 path=[1737:0-671 2408:672-848 2585:849-1711]

Length=1712
                                                                      Score     E

ref|XP_011077850.1|  PREDICTED: uncharacterized protein LOC105161748    541   0.0      
ref|XP_011004091.1|  PREDICTED: uncharacterized protein LOC105110684    525   2e-178   
ref|XP_002322819.2|  hypothetical protein POPTR_0016s07860g             523   1e-177   Populus trichocarpa [western balsam poplar]
ref|XP_002276376.1|  PREDICTED: uncharacterized protein LOC100263016    513   6e-174   Vitis vinifera
ref|XP_009791810.1|  PREDICTED: uncharacterized protein LOC104238976    499   2e-168   
ref|XP_007204849.1|  hypothetical protein PRUPE_ppa026421mg             492   8e-166   
emb|CDP15441.1|  unnamed protein product                                489   3e-164   
ref|XP_007203877.1|  hypothetical protein PRUPE_ppa005088mg             488   3e-164   
ref|XP_006341098.1|  PREDICTED: uncharacterized protein LOC102599218    486   2e-163   
ref|XP_011004215.1|  PREDICTED: uncharacterized protein LOC105110757    486   5e-163   
ref|XP_008243529.1|  PREDICTED: uncharacterized protein LOC103341759    484   1e-162   
ref|XP_008387022.1|  PREDICTED: uncharacterized protein LOC103449476    484   1e-162   
ref|XP_006430163.1|  hypothetical protein CICLE_v10011692mg             483   2e-162   
ref|XP_009342998.1|  PREDICTED: uncharacterized protein LOC103934957    482   1e-161   
ref|XP_006481870.1|  PREDICTED: uncharacterized protein LOC102629589    481   1e-161   
ref|XP_007027793.1|  Uncharacterized protein TCM_022632                 482   1e-161   
ref|XP_010271628.1|  PREDICTED: uncharacterized protein LOC104607648    481   2e-161   
ref|XP_009336971.1|  PREDICTED: uncharacterized protein LOC103929486    481   3e-161   
gb|EYU38652.1|  hypothetical protein MIMGU_mgv1a005747mg                479   8e-161   
ref|XP_004303543.1|  PREDICTED: uncharacterized protein LOC101300265    477   9e-160   
ref|XP_008243528.1|  PREDICTED: uncharacterized protein LOC103341758    476   4e-159   
ref|XP_008387017.1|  PREDICTED: uncharacterized protein LOC103449472    475   5e-159   
ref|XP_004494048.1|  PREDICTED: uncharacterized protein LOC101495207    474   6e-159   
ref|XP_007204331.1|  hypothetical protein PRUPE_ppa005248mg             474   8e-159   
ref|XP_004246498.1|  PREDICTED: uncharacterized protein LOC101249753    473   3e-158   
ref|XP_006430164.1|  hypothetical protein CICLE_v10011692mg             472   4e-158   
ref|XP_010245495.1|  PREDICTED: uncharacterized protein LOC104589...    472   5e-158   
ref|XP_008243526.1|  PREDICTED: uncharacterized protein LOC103341757    472   7e-158   
ref|XP_002308465.2|  hypothetical protein POPTR_0006s22750g             472   9e-158   Populus trichocarpa [western balsam poplar]
ref|XP_006481747.1|  PREDICTED: uncharacterized protein LOC102616...    471   3e-157   
ref|XP_004494047.1|  PREDICTED: uncharacterized protein LOC101494882    467   6e-156   
ref|XP_003537075.2|  PREDICTED: uncharacterized protein LOC100791257    468   6e-156   
ref|XP_009627514.1|  PREDICTED: uncharacterized protein LOC104118047    467   8e-156   
ref|XP_004494204.1|  PREDICTED: uncharacterized protein LOC101488848    466   1e-155   
ref|XP_006430166.1|  hypothetical protein CICLE_v10011628mg             466   1e-155   
ref|XP_009336970.1|  PREDICTED: uncharacterized protein LOC103929485    465   6e-155   
ref|XP_009342999.1|  PREDICTED: uncharacterized protein LOC103934958    464   2e-154   
ref|XP_010059639.1|  PREDICTED: uncharacterized protein LOC104447615    462   1e-153   
ref|XP_011077851.1|  PREDICTED: uncharacterized protein LOC105161749    461   1e-153   
ref|XP_003625849.1|  hypothetical protein MTR_7g104960                  458   2e-152   
ref|XP_002276400.1|  PREDICTED: uncharacterized protein LOC100257880    458   2e-152   Vitis vinifera
emb|CAN71367.1|  hypothetical protein VITISV_014691                     456   7e-152   Vitis vinifera
ref|XP_010245489.1|  PREDICTED: uncharacterized protein LOC104589...    457   2e-151   
emb|CBI30315.3|  unnamed protein product                                453   7e-151   
ref|XP_010271627.1|  PREDICTED: uncharacterized protein LOC104607647    454   9e-151   
ref|XP_010683704.1|  PREDICTED: uncharacterized protein LOC104898342    449   4e-149   
ref|XP_007027791.1|  GATA zinc finger domain-containing protein C...    449   1e-148   
gb|KHN42802.1|  hypothetical protein glysoja_036976                     447   2e-148   
gb|KHN42803.1|  hypothetical protein glysoja_036977                     446   6e-148   
ref|XP_007145292.1|  hypothetical protein PHAVU_007G226800g             446   2e-147   
ref|XP_003518211.1|  PREDICTED: uncharacterized protein LOC100781279    442   1e-146   
ref|XP_002530334.1|  conserved hypothetical protein                     443   1e-146   Ricinus communis
gb|KEH42006.1|  condensation domain protein                             442   3e-146   
gb|KDP37320.1|  hypothetical protein JCGZ_06774                         442   4e-146   
ref|XP_008442856.1|  PREDICTED: uncharacterized protein LOC103486624    441   6e-146   
ref|XP_010093750.1|  hypothetical protein L484_019153                   439   2e-145   
emb|CCH47179.1|  hypothetical protein                                   437   2e-144   
ref|XP_007027792.1|  GATA zinc finger domain-containing protein C...    436   1e-143   
ref|XP_004164824.1|  PREDICTED: uncharacterized LOC101208663            435   2e-143   
gb|KDP37316.1|  hypothetical protein JCGZ_06770                         435   2e-143   
ref|XP_004149220.1|  PREDICTED: uncharacterized protein LOC101208663    434   3e-143   
ref|XP_010520704.1|  PREDICTED: uncharacterized protein LOC104799759    432   5e-142   
ref|XP_006291061.1|  hypothetical protein CARUB_v10017176mg             431   5e-142   
gb|KFK34513.1|  hypothetical protein AALP_AA5G155100                    431   6e-142   
emb|CDX73618.1|  BnaC08g23850D                                          431   7e-142   
ref|XP_008442855.1|  PREDICTED: uncharacterized protein LOC103486623    431   7e-142   
gb|EPS70664.1|  hypothetical protein M569_04096                         429   3e-141   
ref|XP_010515732.1|  PREDICTED: uncharacterized protein LOC104791518    429   4e-141   
ref|XP_009115959.1|  PREDICTED: uncharacterized protein LOC103841192    427   2e-140   
ref|XP_004149221.1|  PREDICTED: uncharacterized protein LOC101208906    429   4e-140   
ref|XP_004164825.1|  PREDICTED: uncharacterized LOC101208906            428   5e-140   
ref|XP_006403785.1|  hypothetical protein EUTSA_v10010329mg             426   8e-140   
ref|XP_002876159.1|  hypothetical protein ARALYDRAFT_906638             425   2e-139   
emb|CDX78109.1|  BnaA09g33040D                                          422   2e-138   
ref|XP_010426882.1|  PREDICTED: uncharacterized protein LOC104711812    422   4e-138   
ref|XP_007145293.1|  hypothetical protein PHAVU_007G226900g             420   2e-137   
ref|XP_009383682.1|  PREDICTED: uncharacterized protein LOC103971395    412   1e-134   
ref|XP_010504007.1|  PREDICTED: uncharacterized protein LOC104781109    412   3e-134   
ref|XP_009393392.1|  PREDICTED: uncharacterized protein LOC103979089    409   1e-133   
emb|CAB89222.1|  putative protein                                       408   7e-133   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566970.1|  uncharacterized protein                               408   1e-132   Arabidopsis thaliana [mouse-ear cress]
gb|AAK59422.1|  unknown protein                                         407   1e-132   Arabidopsis thaliana [mouse-ear cress]
gb|EPS67523.1|  hypothetical protein M569_07254                         405   1e-131   
ref|XP_011004708.1|  PREDICTED: uncharacterized protein LOC105111136    397   1e-129   
ref|XP_006851439.1|  hypothetical protein AMTR_s00040p00100620          398   8e-129   
emb|CBI30316.3|  unnamed protein product                                392   5e-128   
gb|KHN46024.1|  hypothetical protein glysoja_040942                     388   2e-126   
emb|CDP15443.1|  unnamed protein product                                384   3e-124   
ref|XP_008806095.1|  PREDICTED: uncharacterized protein LOC103718873    376   1e-120   
gb|KDO70474.1|  hypothetical protein CISIN_1g0479151mg                  367   2e-118   
gb|EYU38650.1|  hypothetical protein MIMGU_mgv1a011240mg                357   1e-115   
dbj|BAJ94035.1|  predicted protein                                      354   9e-112   
gb|ACN31186.1|  unknown                                                 350   2e-110   Zea mays [maize]
ref|NP_001151279.1|  transposon protein Mutator sub-class               347   4e-109   Zea mays [maize]
gb|KHN46023.1|  hypothetical protein glysoja_040941                     335   5e-107   
ref|XP_003567292.1|  PREDICTED: uncharacterized protein LOC100834188    338   1e-105   
gb|AFW84477.1|  transposon protein Mutator sub-class                    332   1e-103   
ref|XP_002458807.1|  hypothetical protein SORBIDRAFT_03g040670          330   1e-102   Sorghum bicolor [broomcorn]
gb|EEC71848.1|  hypothetical protein OsI_04522                          326   5e-101   Oryza sativa Indica Group [Indian rice]
ref|NP_001044878.1|  Os01g0861900                                       325   1e-100   Oryza sativa Japonica Group [Japonica rice]
gb|KHG10988.1|  Serpentine receptor class alpha-12                      320   2e-100   
ref|XP_006481748.1|  PREDICTED: uncharacterized protein LOC102616...    304   2e-93    
emb|CAN71366.1|  hypothetical protein VITISV_014690                     298   5e-93    Vitis vinifera
gb|KDO70471.1|  hypothetical protein CISIN_1g0117482mg                  278   4e-86    
gb|EMS46893.1|  hypothetical protein TRIUR3_22779                       279   5e-85    
ref|XP_010943826.1|  PREDICTED: uncharacterized protein LOC105061470    281   2e-84    
gb|EMT25090.1|  hypothetical protein F775_29349                         273   8e-84    
ref|XP_002983162.1|  hypothetical protein SELMODRAFT_179994             278   4e-83    
ref|XP_002965922.1|  hypothetical protein SELMODRAFT_407067             277   1e-82    
ref|XP_001783329.1|  predicted protein                                  278   3e-82    
ref|XP_006645061.1|  PREDICTED: uncharacterized protein LOC102701397    271   4e-82    
gb|EMS47722.1|  hypothetical protein TRIUR3_22027                       267   3e-80    
gb|EPS70645.1|  hypothetical protein M569_04115                         254   5e-77    
ref|XP_002308464.2|  hypothetical protein POPTR_0006s22730g             237   5e-71    Populus trichocarpa [western balsam poplar]
gb|KHG06935.1|  pab-dependent poly (a)-specific ribonuclease subu...    238   4e-69    
ref|XP_006588846.1|  PREDICTED: uncharacterized protein LOC100782381    218   1e-63    
ref|XP_011016010.1|  PREDICTED: uncharacterized protein LOC105119559    218   2e-62    
ref|XP_001758098.1|  predicted protein                                  211   1e-57    
ref|XP_001781819.1|  predicted protein                                  202   1e-54    
gb|EAZ14233.1|  hypothetical protein OsJ_04157                          206   4e-54    Oryza sativa Japonica Group [Japonica rice]
gb|KDO70472.1|  hypothetical protein CISIN_1g0117481mg                  194   1e-53    
ref|XP_009343013.1|  PREDICTED: uncharacterized protein LOC103934971    191   2e-52    
gb|EPS73214.1|  hypothetical protein M569_01543                         172   1e-45    
dbj|BAK04361.1|  predicted protein                                      160   3e-40    
ref|XP_002994738.1|  hypothetical protein SELMODRAFT_432639             152   7e-37    
gb|ABK25083.1|  unknown                                                 137   7e-34    Picea sitchensis
ref|NP_001235706.1|  uncharacterized protein LOC100527924               128   2e-30    
ref|XP_001785784.1|  predicted protein                                  132   5e-30    
gb|AEX12714.1|  hypothetical protein 2_6438_02                          119   2e-28    
ref|XP_001764918.1|  predicted protein                                  111   1e-22    
ref|XP_001787135.1|  predicted protein                                61.2    1e-07    
ref|XP_001752297.1|  predicted protein                                60.8    1e-06    
emb|CDY68762.1|  BnaAnng28290D                                        50.8    2e-04    
ref|XP_010263434.1|  PREDICTED: ankyrin repeat-containing protein...  53.5    2e-04    



>ref|XP_011077850.1| PREDICTED: uncharacterized protein LOC105161748 [Sesamum indicum]
Length=474

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/476 (62%), Positives = 361/476 (76%), Gaps = 17/476 (4%)
 Frame = -3

Query  1626  GADENN-----KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNA  1462
             GA+ N+     K R +G TE  WCRAVS GTGITVLA  ++   +    L   L K+ N+
Sbjct  3     GANRNSEPLVPKARALGNTEQNWCRAVSSGTGITVLALQMARPPSQASTLHKILQKLQNS  62

Query  1461  HPILRSKLRYNAATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHII  1282
             HP+LRSKL  N   K  SF  S TP + +   DA STL +L   + + +  +SP+  H+I
Sbjct  63    HPLLRSKLCNNPTNKTLSFHTSTTPQVHLKFHDAKSTLHLLHVLSANHNSDISPA--HVI  120

Query  1281  LEHELSNNAAWRNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllge  1102
             LEHEL N+ +W +P +FP +G +V+FASLYA+ +    V+ LRFHT++CDRTT VSLL E
Sbjct  121   LEHEL-NSQSWSDPNTFPCNGINVMFASLYAVSDTKS-VVVLRFHTSICDRTTAVSLLRE  178

Query  1101  lmelmreg----tLKGIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNL  934
             LMEL+ E       KGIKNEGEG  GIE++VPS  +KK +WAHG+DMLGYSVNSFRLTNL
Sbjct  179   LMELVEETEGGRASKGIKNEGEGEMGIESMVPSGIAKKTIWAHGMDMLGYSVNSFRLTNL  238

Query  933   KFNDVKGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSR-SQWDHH  757
             KF + K PR S VV+LQ+N HHTS+ILAGC+S GIKLCG L AA L+AAHSS+ S  D+ 
Sbjct  239   KFKNSKSPRFSEVVRLQMNKHHTSQILAGCESRGIKLCGALAAAALLAAHSSKFSPSDN-  297

Query  756   QQQKKKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFEN  577
              + KKKYGVVTLTDCRS+L PPLS+HHYGFYHSAILN+HTVKG E LWD+AK  Y  F +
Sbjct  298   -KLKKKYGVVTLTDCRSMLQPPLSNHHYGFYHSAILNIHTVKGTETLWDLAKNCYMDFAH  356

Query  576   SKKTNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVE  397
              KK NK FSDMADLNFLM KAI+NP LT SSSLR++++TVFE+PV+ D S  IQ+++GVE
Sbjct  357   YKKMNKQFSDMADLNFLMSKAIENPSLTPSSSLRTSLLTVFEDPVLDD-SNRIQQKIGVE  415

Query  396   DYVGCSSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDA  229
             DYVGC+SVHGVGPS+AIFDTV DGKLDCACVYPSPLHSREQM+EL+D +KRILIDA
Sbjct  416   DYVGCASVHGVGPSVAIFDTVRDGKLDCACVYPSPLHSREQMNELIDNVKRILIDA  471



>ref|XP_011004091.1| PREDICTED: uncharacterized protein LOC105110684 [Populus euphratica]
Length=475

 Score =   525 bits (1352),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 274/471 (58%), Positives = 343/471 (73%), Gaps = 17/471 (4%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R VGGTEH WCRAV GGTGI VLA L S K     +L NALHK+ N+HPILRS+L   
Sbjct  15    KARAVGGTEHSWCRAVPGGTGIAVLAILTS-KLPRNSVLENALHKLQNSHPILRSRLHSG  73

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
             + T  FSF  S TP I++  F+  ST +IL +    +    S SP H++LEHEL+ N+ W
Sbjct  74    SNTNTFSFITSPTPFIKLKAFNLSSTFKILEN--PLNPKNQSLSPLHLVLEHELNQNS-W  130

Query  1248  RNPASFPPSG---ADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmreg  1078
              N    P S     D+ FA+ YALP     V+ LR H + CDRTT VSLL EL+ L+ E 
Sbjct  131   YNHNKAPSSINEIQDMFFATTYALPN-AKWVLVLRLHASACDRTTAVSLLQELVVLVSEE  189

Query  1077  t----LKGIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGP  910
                   K I NEGE +  IE++VP++K+KK LW  GIDMLGYSVNS RLTNLKF D + P
Sbjct  190   ERGALQKEIANEGEVTSRIEDLVPNKKAKKGLWERGIDMLGYSVNSLRLTNLKFKDSRSP  249

Query  909   RHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGV  730
             R S VV+LQ+N   T  I+AGCKS GIKLCG L +AGL+AAH S+S+ D    +++KY V
Sbjct  250   RSSQVVRLQMNQKDTETIIAGCKSRGIKLCGALASAGLIAAHKSKSRVD----KQRKYAV  305

Query  729   VTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFS  550
             VTLTDCRS+LDP LS+HH+GFYHSAILN H +KGGE+LW++A+++Y+AF + K  N+HFS
Sbjct  306   VTLTDCRSVLDPTLSNHHFGFYHSAILNAHMMKGGEKLWELAQKTYAAFASYKNCNRHFS  365

Query  549   DMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVH  370
             DMADLNFLMCKAIDNPGLT SSSLR+A+++VFEE VV D +A +Q+E+GVEDY+GC+S H
Sbjct  366   DMADLNFLMCKAIDNPGLTPSSSLRTALVSVFEESVVDDRAA-LQKEVGVEDYMGCASAH  424

Query  369   GVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDATKFI  217
             G+GPSIAIFDT+ DG+LDC CVYPSPLHSREQM E +D MK +L++    +
Sbjct  425   GIGPSIAIFDTIRDGRLDCVCVYPSPLHSREQMQEFIDCMKSVLVEGCNHV  475



>ref|XP_002322819.2| hypothetical protein POPTR_0016s07860g [Populus trichocarpa]
 gb|EEF04580.2| hypothetical protein POPTR_0016s07860g [Populus trichocarpa]
Length=475

 Score =   523 bits (1346),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 271/471 (58%), Positives = 340/471 (72%), Gaps = 17/471 (4%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R VGGTEH WCRAV GGTGI VLA L S K      L NALHK+ N+HPILRS+L   
Sbjct  15    KGRAVGGTEHSWCRAVPGGTGIAVLAILTS-KLPRNSGLENALHKLQNSHPILRSRLHSG  73

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
             + T  FSF  S TP I++  F+  ST +IL +         S SP H++LEHEL+ N+ W
Sbjct  74    SNTNTFSFITSPTPFIKLKAFNLSSTFKILEN--PLKPKNQSLSPLHLVLEHELNQNS-W  130

Query  1248  RN---PASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllge----lmel  1090
              N     SF     D+ FA+ YALP E   V+ LR H + CDRTT VSLL E    + E 
Sbjct  131   YNHNKAPSFINDIQDMFFATTYALPNEKW-VLVLRLHASACDRTTAVSLLQELVVLVSEE  189

Query  1089  mregtLKGIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGP  910
              +    K I NE E +  IE++VP++K+KK LW  GIDMLGYSVNS RLTNLKF D K P
Sbjct  190   EKGALQKEIANEEEVTSSIEDLVPNKKAKKGLWERGIDMLGYSVNSLRLTNLKFKDSKSP  249

Query  909   RHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGV  730
             R S VV+LQ+N   T +I+AGC+S GIKLCG L +AGL+AAH S+S+ D    +++KY V
Sbjct  250   RSSQVVRLQMNQKDTEKIIAGCRSRGIKLCGALASAGLIAAHKSKSRVD----KQRKYAV  305

Query  729   VTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFS  550
             VTLTDCRS+LDP LS+HH+GFYHSAILN H +KGGE+LW++A+++Y+AF + K  N+HFS
Sbjct  306   VTLTDCRSVLDPTLSNHHFGFYHSAILNAHVMKGGEKLWELAQKTYAAFASYKNCNRHFS  365

Query  549   DMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVH  370
             DMADLNFLMCKAIDNPGLT SSSLR+A+++VFE+ VV D +A +Q+E+GVEDY+GC+S H
Sbjct  366   DMADLNFLMCKAIDNPGLTPSSSLRTALVSVFEDSVVDDHAA-LQKEVGVEDYMGCASAH  424

Query  369   GVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDATKFI  217
             G+GPSIAIFDT+ DG+LDC CVYPSPLHSREQM E +D MK +L++    +
Sbjct  425   GIGPSIAIFDTIRDGRLDCVCVYPSPLHSREQMQEFIDSMKSVLVEGCNHV  475



>ref|XP_002276376.1| PREDICTED: uncharacterized protein LOC100263016 [Vitis vinifera]
 ref|XP_010654102.1| PREDICTED: uncharacterized protein LOC100263016 [Vitis vinifera]
Length=477

 Score =   513 bits (1322),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 272/466 (58%), Positives = 339/466 (73%), Gaps = 18/466 (4%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNAA  1423
             R VGGTE+ WCRAV GGTG+  +A L+S K  +  LL++ALH + N H +L SKL Y   
Sbjct  13    RAVGGTENSWCRAVLGGTGVVTVALLLS-KPPEASLLQSALHTLQNRHALLGSKLHYGTT  71

Query  1422  TKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAWRN  1243
             T  FSF  S  P +Q+  F+  ST  +L+S   S +       FH+ILEHEL+ N  W N
Sbjct  72    TNTFSFITSPIPPLQVKSFNLSSTCHLLQSLVSSPNTHSVSP-FHLILEHELNQNP-WCN  129

Query  1242  PASFPPS---GADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtL  1072
               S  PS   G DV FAS+Y LP+    V+ LR HTAVCDRTT VSLL EL+ ++RE   
Sbjct  130   LKS--PSYDDGTDVFFASIYTLPD-AKWVVVLRLHTAVCDRTTAVSLLRELIGVVREKEG  186

Query  1071  KG----IKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRH  904
              G    ++++GE S GIE+ +PS K+KK LW  G+DML YSVNS +LTNLKF D K PR 
Sbjct  187   GGREEKMRDDGEVSLGIEDFIPSGKAKKALWVRGVDMLSYSVNSLQLTNLKFKDAKSPRS  246

Query  903   SLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVT  724
             S VV+LQLN   T  +LAGC + GIKLCG L AA L+A HSS+   DHH   K+KY VVT
Sbjct  247   SEVVRLQLNQDDTESLLAGCSAKGIKLCGALVAAALIAGHSSKRPADHH---KEKYAVVT  303

Query  723   LTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDM  544
             LTDCR ILDPPLS+HH+GFYHSA+LN  ++KGGE+LW++A+RSY AF NSK  NKHFSDM
Sbjct  304   LTDCRPILDPPLSTHHFGFYHSAVLNTLSMKGGEKLWELARRSYMAFANSKNCNKHFSDM  363

Query  543   ADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQREL-GVEDYVGCSSVHG  367
             ADLNFLM KAI+NPGLT++SSLR++ +TVFE+PV ++ + +I RE+ G+EDY+GC+SVHG
Sbjct  364   ADLNFLMRKAIENPGLTSASSLRTSFLTVFEDPV-FETNDEIYREIVGLEDYIGCASVHG  422

Query  366   VGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDA  229
             +GPSIAIFDT+  G LDCACVYPSPLHSREQM EL+  MKR+L+DA
Sbjct  423   IGPSIAIFDTIRGGMLDCACVYPSPLHSREQMEELLHNMKRLLVDA  468



>ref|XP_009791810.1| PREDICTED: uncharacterized protein LOC104238976 [Nicotiana sylvestris]
Length=480

 Score =   499 bits (1286),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 269/470 (57%), Positives = 337/470 (72%), Gaps = 22/470 (5%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNAA  1423
             R  G TEH WC+AV  GTGITVLA L+S K+ D  +L+NALHK+ N++PIL+SKL Y   
Sbjct  19    RPAGNTEHSWCKAVPSGTGITVLALLLS-KSPDISVLQNALHKLQNSNPILKSKLHYEPT  77

Query  1422  TKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAWRN  1243
             T ++S+ I +T  +QI PFD  ST QIL+     + +  S S FH+ILEHE++NN+ W N
Sbjct  78    TNSYSYIIPSTSHLQIQPFDLSSTAQILQQ--LKNPNHTSISDFHLILEHEINNNS-WAN  134

Query  1242  PA-SFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLKG  1066
              A S   S +DVLF S+Y L +E   V  LR HT+ CDR   ++LL +L+ELM     KG
Sbjct  135   VATSSDHSDSDVLFVSIYRLSDEKWAV-TLRIHTSTCDRAAALALLRKLLELMSSKKGKG  193

Query  1065  I-KNEG-----------EGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFND  922
             + +NEG           E   GIE  +P+ K+ K  WA GIDM+GY +N+ R  NL F D
Sbjct  194   MNENEGGRAELELGEKMEVGLGIEEYIPAGKANKPFWARGIDMVGYGLNALRFANLNFID  253

Query  921   VKGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKK  742
              +  R S VVKLQLN   T RIL GCK+ GIKLCGVL AAGL+AAHSS+   D  + Q +
Sbjct  254   SESTRGSQVVKLQLNKEDTDRILDGCKTRGIKLCGVLAAAGLIAAHSSK---DLPEDQWE  310

Query  741   KYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTN  562
             KY VVTL +CRSILDP LS    GFYHSAILNMH VKGGE LW++A RSY++F N+K  N
Sbjct  311   KYAVVTLINCRSILDPVLSPDFPGFYHSAILNMHDVKGGEDLWELAMRSYTSFINAKNNN  370

Query  561   KHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGC  382
             KHFSDM DLNFLMCKAIDNPGLT +SSLRS++I+VFE+PV+ D S+ + +E+G+ED++GC
Sbjct  371   KHFSDMGDLNFLMCKAIDNPGLTPASSLRSSLISVFEDPVI-DNSSTVHQEIGLEDFIGC  429

Query  381   SSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILID  232
             +SVHGVGPSIAIFDT+ DG+LDCACVYP PLH+REQM E + EMKRIL+D
Sbjct  430   ASVHGVGPSIAIFDTIRDGQLDCACVYPFPLHTREQMQEFIGEMKRILVD  479



>ref|XP_007204849.1| hypothetical protein PRUPE_ppa026421mg [Prunus persica]
 gb|EMJ06048.1| hypothetical protein PRUPE_ppa026421mg [Prunus persica]
Length=468

 Score =   492 bits (1267),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 270/465 (58%), Positives = 327/465 (70%), Gaps = 18/465 (4%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R VGGTE  WCRAV GGTGITVLA   S K  D   L+ AL K+ N+HPIL S+L  N
Sbjct  5     KGRPVGGTETSWCRAVPGGTGITVLALHAS-KPPDVLNLQTALLKVQNSHPILNSRLHTN  63

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
               T   SF  S TP +QI  F   STL+IL +   S     S SPFH+ILEHEL+ N  W
Sbjct  64    PKTNTLSFVPSPTPYVQIKSFSLSSTLEILET-LYSPISNSSVSPFHLILEHELNQNP-W  121

Query  1248  RNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLK  1069
             +   +   +  D+ FAS+YALP     V+ALR H + CDRT+ VSLL E++ LM  G   
Sbjct  122   QLKNTTCTTDQDMFFASIYALPS-AMWVVALRLHVSACDRTSAVSLLREVVGLMGGGDEG  180

Query  1068  G-----IKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRH  904
             G     I+NEGE + GIE+++PS K KK +W  G+DML YSVNS RLTNLKF D K  R 
Sbjct  181   GEVNMEIRNEGEVNLGIEDLIPSGKGKKAMWVRGMDMLSYSVNSLRLTNLKFTDNKSARV  240

Query  903   SLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVT  724
             S VV+LQ+N   T R+L GCK+ GIKLC  L AAGLMA    R       + +KKYGVVT
Sbjct  241   SQVVRLQMNEDDTQRVLNGCKTRGIKLCAALVAAGLMAVDKYR------LENQKKYGVVT  294

Query  723   LTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDM  544
             LTDCRS L P LS  H+GFYHSAILN HT KGGE LW++A ++Y AF +SK+ NKHFSDM
Sbjct  295   LTDCRSNLHPALSHKHFGFYHSAILNTHTTKGGETLWELANKTYKAFVSSKRNNKHFSDM  354

Query  543   ADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRE--LGVEDYVGCSSVH  370
             ADLNFLMCKAIDNP LT+SSSLR++ ++VFE+PV+ D S D QRE  LG+E+Y+GC+SVH
Sbjct  355   ADLNFLMCKAIDNPTLTSSSSLRASFMSVFEDPVIDD-SNDKQRELGLGLEEYMGCASVH  413

Query  369   GVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILI  235
             G+GPSIAIFDT+ DG+LDC CVYP+PLHSREQM  LVD+MK +L+
Sbjct  414   GIGPSIAIFDTIRDGRLDCVCVYPAPLHSREQMQGLVDDMKAMLV  458



>emb|CDP15441.1| unnamed protein product [Coffea canephora]
Length=483

 Score =   489 bits (1258),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 259/471 (55%), Positives = 339/471 (72%), Gaps = 13/471 (3%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R  GGTE  WC+AV GGTGITVLA L+S KA D   L+  L  + N HPIL+SKL Y+
Sbjct  18    KSRPAGGTEQSWCKAVPGGTGITVLALLLS-KAPDVPFLQTTLRNLQNTHPILKSKLHYD  76

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
             + +  +S+ I ATP +QI PFD  S  +ILR    S+    S + FH+ILEHEL N   W
Sbjct  77    STSTTYSYIIPATPQLQIQPFDLASASEILRGLIRSNSTTFSTTDFHLILEHEL-NRIVW  135

Query  1248  RNP-ASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtL  1072
              NP  S      D+ FAS+Y L  +   V+ALR HT+VCDRTT VSLL EL++LM     
Sbjct  136   PNPDPSSEADDVDLFFASVYTL-SDAKWVVALRLHTSVCDRTTAVSLLRELLKLMSADNG  194

Query  1071  KGIKNE-----GEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPR  907
             +G + E      E   GIE+ VPS K  K  WA G+DMLGYS+NSFRL+NL F D   PR
Sbjct  195   EGTQKEIDEELLEVRLGIEDYVPSGKGNKPFWARGVDMLGYSLNSFRLSNLTFQDTGLPR  254

Query  906   HSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVV  727
              S V++LQ+N   T ++++GC++  IKLCG+L +A L+AAHS++   D H +   KY VV
Sbjct  255   SSQVIRLQINADVTQKLISGCQARNIKLCGLLASAALIAAHSAKCFPDDHWE---KYAVV  311

Query  726   TLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSD  547
             TL DCRS+LDP L ++ +GFYHSAILN H +KGGE LW++A+R+++++ N+K  NKHFSD
Sbjct  312   TLIDCRSLLDPVLENNDHGFYHSAILNSHDIKGGENLWELAERTHASYNNAKNNNKHFSD  371

Query  546   MADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHG  367
             M+D+NFLMCKA++NPGLT SSSLR+A+I+VFE+PV+ D S  + + +G+EDYVGC+S HG
Sbjct  372   MSDVNFLMCKAMENPGLTPSSSLRTALISVFEDPVI-DHSNQLHQRVGLEDYVGCASSHG  430

Query  366   VGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDATKFID  214
             VGPSIA+FDT+ DG+LDCACVYPSPLHSR+QMHEL+ EM+RIL++A+  ID
Sbjct  431   VGPSIALFDTIRDGQLDCACVYPSPLHSRDQMHELIGEMRRILVEASNEID  481



>ref|XP_007203877.1| hypothetical protein PRUPE_ppa005088mg [Prunus persica]
 gb|EMJ05076.1| hypothetical protein PRUPE_ppa005088mg [Prunus persica]
Length=477

 Score =   488 bits (1257),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 263/469 (56%), Positives = 333/469 (71%), Gaps = 16/469 (3%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R VGGTE+ WC+AV  GTGITVLA L+S K  +  +L+ ALH +  +HP+LRSK  ++
Sbjct  18    KTRPVGGTEYSWCKAVPSGTGITVLALLLS-KPPNFSILQTALHNLQYSHPVLRSKHLFD  76

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
               T  FSF    TP +QI PFD PST  IL++++  +        FH+ILEHEL+ N  W
Sbjct  77    PTTNTFSFLTPPTPHLQIQPFDLPSTALILQNQSQPNIPA-----FHLILEHELNINT-W  130

Query  1248  RNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLK  1069
             RNP     +  DVLFAS+Y +  E    +ALR HT+ CDR   V+LL  L+  M+     
Sbjct  131   RNPNPSSDADTDVLFASVYTI-SESRWALALRVHTSACDRAAAVALLRALLGEMKSTGRG  189

Query  1068  G----IKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHS  901
             G    +K  GE S GIE+++P+ K+ K  WA G+DMLGYS+NS RL+NL F D    R S
Sbjct  190   GAERELKGNGEVSLGIEDLIPNGKANKPFWARGVDMLGYSLNSLRLSNLDFKDASSARRS  249

Query  900   LVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTL  721
              VVKLQLN H   R+LAGCKS  IKL G L AAGL+A H+S+   DH   Q +KY VVTL
Sbjct  250   RVVKLQLNPHDCQRLLAGCKSREIKLSGALAAAGLIAVHASKHLPDH---QWEKYAVVTL  306

Query  720   TDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMA  541
              DCRSIL+PPLSS++ GFYHSAI+N H + GG  LW++AKR + AF N+K +NKHF+DM+
Sbjct  307   LDCRSILEPPLSSNNLGFYHSAIMNTHDINGGNTLWELAKRCHIAFANAKNSNKHFTDMS  366

Query  540   DLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVG  361
             DLNFLMCKAI+NPGLT SSS+R+A I+VFE+PV+ D S+++ +ELGVEDY GC+SVHGVG
Sbjct  367   DLNFLMCKAIENPGLTPSSSMRTAFISVFEDPVIDD-SSEVHQELGVEDYEGCASVHGVG  425

Query  360   PSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDATKFID  214
             PSIAIFDT+ DG L+CACVYPSPLHSREQM +L+D MKRIL+D    +D
Sbjct  426   PSIAIFDTIRDGALNCACVYPSPLHSREQMQDLMDRMKRILVDGCDDVD  474



>ref|XP_006341098.1| PREDICTED: uncharacterized protein LOC102599218 [Solanum tuberosum]
Length=470

 Score =   486 bits (1252),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 261/463 (56%), Positives = 339/463 (73%), Gaps = 13/463 (3%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R+ G TEH WC+AV GGTGITVLA L+S K  D  LL+NALHK+ N++PIL+S+L Y 
Sbjct  16    KIRLAGSTEHSWCKAVPGGTGITVLALLLS-KPPDISLLQNALHKLQNSNPILKSQLHYE  74

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
             ++T ++S+ I +T  +QI PFD  ST+QILR       D+ S S FH+ILEHE++ N+ W
Sbjct  75    SSTNSYSYIIPSTSHLQIQPFDLSSTVQILRR--LKTSDLTSVSDFHLILEHEINQNS-W  131

Query  1248  RNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLK  1069
              N  +   S  D+ FAS+Y L  E   V+ALR HT+ CDR   ++LL +L+EL+     +
Sbjct  132   INTGTSSDSDTDIFFASIYQLENEKS-VVALRIHTSACDRAAALALLKKLLELVSGEDGE  190

Query  1068  GIKNE----GEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHS  901
             G + E     E   GIE  +P+ K+ K  WA GIDM+GY +NS R +NLKF D +  R S
Sbjct  191   GTELELLKKMEVGLGIEEYIPAGKASKPFWARGIDMVGYGLNSLRFSNLKFMDSESTRGS  250

Query  900   LVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTL  721
              VVKLQLN   T RIL GCK+  IKLCG+L AAGL+AAHSS+     ++ Q +KY +VTL
Sbjct  251   QVVKLQLNKEETDRILDGCKTRDIKLCGLLAAAGLIAAHSSKGL---NENQWEKYAIVTL  307

Query  720   TDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMA  541
              +CRSILDP LS    GFYHSAILN H VKGG+ LW++AKRSY++F N+K  NKHF+DM 
Sbjct  308   INCRSILDPVLSPDFPGFYHSAILNTHDVKGGDDLWELAKRSYTSFINAKNNNKHFTDMG  367

Query  540   DLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVG  361
             DLNFLMC+AIDNPGLT SSSLR+++I+VFE+PV+ D S+ + +E+G+ED++GC+SVHGVG
Sbjct  368   DLNFLMCRAIDNPGLTPSSSLRTSLISVFEDPVI-DTSSTVHQEIGLEDFIGCASVHGVG  426

Query  360   PSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILID  232
             PSIAIFDT+ DG+LDCACVYP PLH+REQM EL+ EMK+IL+D
Sbjct  427   PSIAIFDTIRDGQLDCACVYPFPLHTREQMQELIGEMKKILVD  469



>ref|XP_011004215.1| PREDICTED: uncharacterized protein LOC105110757 [Populus euphratica]
Length=478

 Score =   486 bits (1250),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 259/466 (56%), Positives = 325/466 (70%), Gaps = 20/466 (4%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R VG TE+ WCR+V  GTGITVLA L+S K  +  LL+  L K+ N+ P+LR+KLR+N
Sbjct  19    KARPVGATEYSWCRSVPLGTGITVLALLLS-KQPNIHLLQATLDKLQNSRPLLRTKLRFN  77

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNA--  1255
             + T +FSF     P +QI PFD  ST  I+ +         +  P+HIILEHEL+ N+  
Sbjct  78    STTNSFSFITPPAPHVQIQPFDLSSTADIISN------GDQNIDPYHIILEHELNKNSWS  131

Query  1254  AWRNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregt  1075
             A+ + +S   +  +V F SLY L  E   V+  R HT+ CDR   V LL EL+ LM    
Sbjct  132   AYLDQSS--DAETNVFFISLYTL-SENRWVVVFRLHTSTCDRAAAVGLLRELLALMGGEN  188

Query  1074  LKGI----KNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPR  907
               GI    +NE E S GIE+ +P  K  K  WA G+DMLGYS+NSFR++NL F D   PR
Sbjct  189   QGGIAKEYENEVEVSLGIEDYIPRGKGNKPFWARGVDMLGYSLNSFRISNLDFVDAGSPR  248

Query  906   HSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVV  727
              S VV+LQ+N   T ++L GC S GIKL G L+AAGL+AA S++   DH   Q +KY VV
Sbjct  249   GSQVVRLQMNSDDTQKLLDGCMSRGIKLSGALSAAGLIAAQSTKDLPDH---QMEKYAVV  305

Query  726   TLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSD  547
             TL DCRSILDP LSS H GFYHSAILN H V GG  LWD+AKR Y A+ N+K  NKHF+D
Sbjct  306   TLIDCRSILDPVLSSDHIGFYHSAILNTHDVSGGVMLWDLAKRCYVAYTNAKNNNKHFTD  365

Query  546   MADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHG  367
             M DLNFLMCKAI+NPGLT SSS+R+A I+VFE+PV+ D + ++  ++GVEDYVGCSSVHG
Sbjct  366   MGDLNFLMCKAIENPGLTPSSSMRTAFISVFEDPVIDDTN-EMHGKVGVEDYVGCSSVHG  424

Query  366   VGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDA  229
             VGPS+AIFDT+ DG+LDCACVYPSPLHSR+QM +L+D+MKRIL+D 
Sbjct  425   VGPSVAIFDTIRDGRLDCACVYPSPLHSRDQMQKLIDDMKRILVDG  470



>ref|XP_008243529.1| PREDICTED: uncharacterized protein LOC103341759 [Prunus mume]
Length=464

 Score =   484 bits (1246),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 265/469 (57%), Positives = 335/469 (71%), Gaps = 16/469 (3%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R VGGTE+ WC+AV  GTGITVLA L+S K  +  +L+ ALH I N+HP+LRSK  ++
Sbjct  5     KTRPVGGTEYSWCKAVPSGTGITVLALLLS-KPPNFSILQTALHNIQNSHPVLRSKHLFD  63

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
               T  FSF    TP +QI  FD PST+ IL+++   +        FH+ILEHEL+ N  W
Sbjct  64    PTTNTFSFLTPPTPHLQIQRFDLPSTVLILQNQNQPNIPA-----FHLILEHELNINT-W  117

Query  1248  RNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmreg---  1078
             RNP     + ADVLFAS+Y +  E    +ALR HT+ CDR   V+LL  L+  M+     
Sbjct  118   RNPNPSSDADADVLFASVYTI-SESRWALALRVHTSACDRAAAVALLRALLAEMKSTGGG  176

Query  1077  -tLKGIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHS  901
                + +K  GE S GIE+++P+ K+ K  WA G+DMLGYS+NS RL+NL F D    R S
Sbjct  177   EAERELKGNGEISLGIEDLIPNGKANKPFWARGVDMLGYSLNSLRLSNLDFKDASSARRS  236

Query  900   LVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTL  721
              VVKLQLN H   R+LAGCKS  IKL G L AAGL+AAH+S+   DH   Q +KY VVTL
Sbjct  237   QVVKLQLNPHDCQRLLAGCKSREIKLSGALAAAGLIAAHASKHLSDH---QWEKYAVVTL  293

Query  720   TDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMA  541
              DCRSIL+PPLSS++ GFYHSAI+N H + GG  LW++AKR Y AF N+K +NKHF+DM+
Sbjct  294   LDCRSILEPPLSSNNLGFYHSAIMNTHDINGGNTLWELAKRCYIAFANAKNSNKHFTDMS  353

Query  540   DLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVG  361
             DLNFLMCKAI+NPGLT SSSLR+A I+VFE+ V+ D S+++ +ELGVEDY GC+SVHGVG
Sbjct  354   DLNFLMCKAIENPGLTPSSSLRTAFISVFEDSVIDD-SSEVHQELGVEDYEGCASVHGVG  412

Query  360   PSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDATKFID  214
             PSIAIFDT+ DG L+CACVYPSPLHSREQM +L+D MKRIL++A   ++
Sbjct  413   PSIAIFDTIRDGALNCACVYPSPLHSREQMQDLMDRMKRILVEACDDVE  461



>ref|XP_008387022.1| PREDICTED: uncharacterized protein LOC103449476 [Malus domestica]
Length=473

 Score =   484 bits (1246),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 255/477 (53%), Positives = 322/477 (68%), Gaps = 26/477 (5%)
 Frame = -3

Query  1617  ENNKERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKL  1438
             E  K R VG  E+ WCRAV GGTGITVL F +S KA D    + ALHK+ NAHPIL S+L
Sbjct  3     EQPKGRAVGAMENSWCRAVPGGTGITVLGFDIS-KAPDMVKYQTALHKLQNAHPILNSRL  61

Query  1437  RYNAATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNN  1258
               N     FSF  S TP +QI   D  STL+IL   T S+    S SPFH+ILEHEL+ N
Sbjct  62    HTNTKANTFSFVTSPTPFVQIKTLDLSSTLEILE--TLSNPSNSSVSPFHLILEHELNQN  119

Query  1257  AAWRNPASF----PPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTT-----------  1123
               W    S     PP+  D+ F ++Y LP+    V  +RFH A CD TT           
Sbjct  120   T-WTKTTSSSSSSPPNDHDMFFGTIYTLPD-AKWVAVMRFHVAACDHTTAETMLRELLGF  177

Query  1122  VVSllgelmelmregtLKGIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRL  943
             ++S          +G +K   N+GE +FGIE++VP+  +KK  W+ G DM+ YS+N+ RL
Sbjct  178   LMSADDGDDGGEGKGIVKETGNKGEANFGIEDLVPARVAKKPFWSRGGDMISYSLNTVRL  237

Query  942   TNLKFNDVKGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWD  763
             ++LKF D K  R S VV+ Q+N   T RIL GCK+  IKLCG L AAGL+AA        
Sbjct  238   SSLKFKDYKSVRSSQVVRFQMNQDETKRILTGCKAREIKLCGALVAAGLIAADKCSKP--  295

Query  762   HHQQQKKKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAF  583
                 QKKKYGV+TL DCRS LDP LS HH+G YHS I  +HT+KGGE LW++AK++Y+AF
Sbjct  296   ---NQKKKYGVLTLIDCRSDLDPALSIHHFGNYHSVIPLVHTIKGGENLWELAKKTYTAF  352

Query  582   ENSKKTNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELG  403
              NSKK +KHF+D+A L+F+MCKAIDNP LT SSSLR++ +TVFE+ ++ D + DIQRELG
Sbjct  353   ANSKKNDKHFTDLATLSFVMCKAIDNPALTPSSSLRTSFMTVFEDTIIDDYN-DIQRELG  411

Query  402   VEDYVGCSSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILID  232
             V+DY+GCSSVHG+GPSIA+FDT+ +G+LDC CVYP+PLHSREQM ELVD MK+IL+D
Sbjct  412   VDDYIGCSSVHGIGPSIAVFDTIRNGRLDCVCVYPTPLHSREQMLELVDNMKKILVD  468



>ref|XP_006430163.1| hypothetical protein CICLE_v10011692mg [Citrus clementina]
 gb|ESR43403.1| hypothetical protein CICLE_v10011692mg [Citrus clementina]
Length=456

 Score =   483 bits (1243),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 257/456 (56%), Positives = 327/456 (72%), Gaps = 19/456 (4%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNAA  1423
             R+  GTE+ WCRAV GGTGI VLA L S K  +T  L++AL+K+ + HPILRS+L  N +
Sbjct  16    RIASGTEYSWCRAVPGGTGIAVLAILTS-KVPETSGLQDALNKLQSYHPILRSRLHTNPS  74

Query  1422  TKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAWRN  1243
                FSF  S T  IQ+  F+  ST +IL S      +  S +P  +ILEHEL+ NA W N
Sbjct  75    KNTFSFVTSPTTFIQVKSFNLSSTSKILES-----SERFSIAPLQLILEHELNENA-WCN  128

Query  1242  PASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLKGI  1063
                   S  D+L+AS YALP+    V+ALR H A CDRTT VSLL EL+ ++     +  
Sbjct  129   LKC--TSTTDMLYASSYALPD-AKWVVALRLHVAACDRTTAVSLLKELLLVLVSDDDQEQ  185

Query  1062  KNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLVVKLQ  883
             +  GE +  IE ++P  K+KK LWA G DML YSVNS + TNLKF D K PR S VV+LQ
Sbjct  186   EGRGEVNLAIEALIPKGKAKKALWARGRDMLTYSVNSLKSTNLKFIDAKSPRSSQVVRLQ  245

Query  882   LNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTDCRSI  703
             LN   T RIL  CKS GIKLCG+L AAGL+AAH+S +Q        +KY V TLTDCRSI
Sbjct  246   LNKDDTERILLTCKSRGIKLCGMLAAAGLIAAHNSDNQ--------RKYAVATLTDCRSI  297

Query  702   LDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADLNFLM  523
             L+PPLS+H +GFYHSAI+N H +K GE+L D+AK+ Y+AF NSK  N+HFSDMADLNFLM
Sbjct  298   LEPPLSNHRFGFYHSAIMNTHLIKRGEKLGDLAKKIYTAFANSKHCNRHFSDMADLNFLM  357

Query  522   CKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPSIAIF  343
             CKAI+NP LT +SSLRS+ ++VFE+  V+D S ++Q+++G+EDY+GC+SVHG+GPSIA+F
Sbjct  358   CKAIENPSLTPASSLRSSFMSVFEDS-VFDSSNEMQQQVGLEDYMGCASVHGIGPSIALF  416

Query  342   DTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILI  235
             DT+ DG+LDC CVYPSPLHSREQM ELV++MK +L+
Sbjct  417   DTIRDGRLDCVCVYPSPLHSREQMQELVEKMKSVLV  452



>ref|XP_009342998.1| PREDICTED: uncharacterized protein LOC103934957 [Pyrus x bretschneideri]
Length=473

 Score =   482 bits (1240),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 254/477 (53%), Positives = 321/477 (67%), Gaps = 26/477 (5%)
 Frame = -3

Query  1617  ENNKERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKL  1438
             E  K R VG  E+ WCRAV GGTGITVL F +S KA D    + ALHK+ NAHPIL S+L
Sbjct  3     EQPKGRAVGAMENSWCRAVPGGTGITVLGFDIS-KAPDMVKYQTALHKLQNAHPILNSRL  61

Query  1437  RYNAATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNN  1258
               N     FSF  S TP +QI   D  STL+IL   T S+    S SPFH+ILE+EL+ N
Sbjct  62    HTNTKANTFSFVTSPTPFVQIKTLDLSSTLEILE--TLSNPSNSSVSPFHLILEYELNQN  119

Query  1257  AAWRNPASF----PPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTT-----------  1123
               W    S     PP+  D+ F ++Y LP+    V  +RFH A CD TT           
Sbjct  120   T-WTKTTSSSSSSPPNDHDMFFGTIYTLPD-AKWVAVMRFHVAACDHTTAETMLRELLGF  177

Query  1122  VVSllgelmelmregtLKGIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRL  943
             + S          +G +K   N+GE +FGIE++VP+  +KK  W+ G DM+ YS+N+ RL
Sbjct  178   LTSADDGDDGGEGKGIVKETGNKGEANFGIEDLVPARVAKKPFWSRGGDMISYSLNTVRL  237

Query  942   TNLKFNDVKGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWD  763
             ++LKF D K  R S VV+ Q+N   T RIL GCK+  IKLCG L AAGL+AA        
Sbjct  238   SSLKFKDYKSVRSSQVVRFQMNQDETKRILTGCKAREIKLCGALVAAGLIAADKCSKP--  295

Query  762   HHQQQKKKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAF  583
                 QKKKYGV+TL DCRS LDP LS HH+G YHS I  +HT+KGGE LW++AK++Y+AF
Sbjct  296   ---NQKKKYGVLTLIDCRSDLDPALSIHHFGNYHSIIPLVHTIKGGENLWELAKKTYTAF  352

Query  582   ENSKKTNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELG  403
              NSKK +KHF+D+A L+F+MCKAIDNP LT SSSLR++ +TVFE+ ++ D + DIQRELG
Sbjct  353   ANSKKNDKHFTDLATLSFVMCKAIDNPALTPSSSLRTSFMTVFEDTIIDDYN-DIQRELG  411

Query  402   VEDYVGCSSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILID  232
             V+DY+GCSSVHG+GPSIA+FDT+ +G+LDC CVYP+PLHSREQM ELVD MK+IL+D
Sbjct  412   VDDYIGCSSVHGIGPSIAVFDTIRNGRLDCVCVYPTPLHSREQMLELVDNMKKILVD  468



>ref|XP_006481870.1| PREDICTED: uncharacterized protein LOC102629589 [Citrus sinensis]
Length=449

 Score =   481 bits (1238),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 256/456 (56%), Positives = 327/456 (72%), Gaps = 19/456 (4%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNAA  1423
             R+  GTE+ WCRAV GGTGI VLA L S K  +T  L++AL+K+ + HPILRS+L  N +
Sbjct  9     RIASGTEYSWCRAVPGGTGIAVLAILTS-KVPETSGLQDALNKLQSYHPILRSRLHTNPS  67

Query  1422  TKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAWRN  1243
                FSF  S T  IQ+  F+  ST +IL S      +  S +P  +ILEHEL+ NA W N
Sbjct  68    KNTFSFVTSPTTFIQVKSFNLSSTSKILES-----SERFSIAPLQLILEHELNENA-WCN  121

Query  1242  PASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLKGI  1063
                   S  D+L+AS YALP+    V+ALR H A CDRTT VSLL EL+ ++     +  
Sbjct  122   LKC--TSTTDMLYASSYALPD-AKWVVALRLHVAACDRTTAVSLLKELLLVLVSDDDQEP  178

Query  1062  KNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLVVKLQ  883
             +  GE +  IE ++P  K+KK LWA G DML YSVNS + TNLKF D K PR S VV+LQ
Sbjct  179   EGRGEVNLAIEALIPKGKAKKALWARGRDMLTYSVNSLKSTNLKFIDAKSPRSSQVVRLQ  238

Query  882   LNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTDCRSI  703
             LN   T RIL  CKS GIKLCG+L AAGL+AAH+S +Q        +KY V TLTDCRSI
Sbjct  239   LNKDDTERILLTCKSRGIKLCGMLAAAGLIAAHNSDNQ--------RKYAVATLTDCRSI  290

Query  702   LDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADLNFLM  523
             ++PPLS+H +GFYHSAI+N H +K GE+L D+AK+ Y+AF NSK  N+HFSDMADLNFLM
Sbjct  291   IEPPLSNHRFGFYHSAIMNTHLIKSGEKLGDLAKKIYTAFVNSKHCNRHFSDMADLNFLM  350

Query  522   CKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPSIAIF  343
             CKAI+NP LT +SSLRS+ ++VFE+  V+D S ++Q+++G+EDY+GC+SVHG+GPSIA+F
Sbjct  351   CKAIENPSLTPASSLRSSFMSVFEDS-VFDSSNEMQQQVGLEDYMGCASVHGIGPSIALF  409

Query  342   DTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILI  235
             DT+ DG+LDC CVYPSPLHSREQM ELV++MK +L+
Sbjct  410   DTIRDGRLDCVCVYPSPLHSREQMQELVEKMKSVLV  445



>ref|XP_007027793.1| Uncharacterized protein TCM_022632 [Theobroma cacao]
 gb|EOY08295.1| Uncharacterized protein TCM_022632 [Theobroma cacao]
Length=485

 Score =   482 bits (1241),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 273/474 (58%), Positives = 338/474 (71%), Gaps = 21/474 (4%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R VGGTEH WCRAV GGTGI VLA L S K  D   LRNALHK+ N+HPILRS+L Y+
Sbjct  14    KGRAVGGTEHSWCRAVLGGTGIAVLAVLTS-KHPDVSRLRNALHKLQNSHPILRSRLHYD  72

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
              +   FSF  S +P +Q+   +  +T  IL +    + +  + SP  +ILEHEL+ NA W
Sbjct  73    PSASTFSFVTSPSPFVQVKSINHFTTCSILEN--LYNQENQNISPLQLILEHELNQNA-W  129

Query  1248  RNPASFP--PS---GADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllg-------  1105
              +    P  PS     DV FAS+YALP     V+ LR H + CDRTT VSLL        
Sbjct  130   TSTCHHPNNPSFCTKNDVFFASIYALPG-ARWVLVLRLHASACDRTTAVSLLRELLTLMG  188

Query  1104  elmelmregtLKGIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFN  925
                E       K + N+GE S  IE+++P  K+KK LWA G+DMLGYSVNS RLTNLKF 
Sbjct  189   TEEEETGSQGQKEMMNKGEVSLAIEDLIPKGKAKKTLWARGVDMLGYSVNSLRLTNLKFK  248

Query  924   DVKGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQK  745
             D K PR S VV+L ++   T RILAGCK+ GIKLCG L AAGL+AAH+S  + DH   Q+
Sbjct  249   DAKSPRSSQVVRLLISPDDTERILAGCKARGIKLCGALGAAGLIAAHTSNCRSDH---QR  305

Query  744   KKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKT  565
             KKYG+VTLTDCRSIL+PPLS+HH+GFYHSAILN H +KG E+LW++AK+ Y+AF N K  
Sbjct  306   KKYGIVTLTDCRSILEPPLSNHHFGFYHSAILNTHVIKGVEKLWELAKKMYTAFTNYKSC  365

Query  564   NKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVG  385
             N+HFSDMADLNFLM +A++NPGLT+SSSLR+++I+VFE+ VV D S D Q+++G+EDY+G
Sbjct  366   NRHFSDMADLNFLMGRAMENPGLTSSSSLRTSLISVFEDTVV-DESNDQQKQVGLEDYMG  424

Query  384   CSSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDATK  223
             C S HG+ PSIAIFDT+ DG+LDC C+YPSPLHSREQM ELVD MK IL+DA K
Sbjct  425   CGSAHGIAPSIAIFDTIRDGQLDCVCIYPSPLHSREQMQELVDNMKCILVDAGK  478



>ref|XP_010271628.1| PREDICTED: uncharacterized protein LOC104607648 [Nelumbo nucifera]
Length=463

 Score =   481 bits (1238),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 261/460 (57%), Positives = 321/460 (70%), Gaps = 21/460 (5%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNAA  1423
             R VGGTE+ WCRAV GGTGITVL+ L+S K  D   L+NALHK+ N+HPI RSKL ++  
Sbjct  20    RSVGGTEYSWCRAVPGGTGITVLSLLLS-KLPDISALQNALHKLQNSHPIFRSKLTHDPT  78

Query  1422  TKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAWRN  1243
             T  FSFAIS  P +QI  FD P T  +L++             FH +LEHEL  N  W +
Sbjct  79    TNTFSFAISPIPSLQIESFDVPFTSHLLQNNPLISP-------FHCVLEHELKRNP-W-S  129

Query  1242  PASFPPSGADV--LFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLK  1069
             P   PP   D   +FASLY+L  +   V+ALRFHTAVCDRT+  +       +   G  K
Sbjct  130   PKHEPPIHPDTETVFASLYSL-SDTKWVLALRFHTAVCDRTS--AEFVLREMVRLVGDEK  186

Query  1068  GIKN--EGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLV  895
             GIK   +GE   GIE ++PS K+ K  WA GID+LGYS+NSFR  NL+F D   PR S V
Sbjct  187   GIKTGKKGEVGLGIEELIPSGKANKPFWARGIDLLGYSLNSFRFANLEFLDTISPRSSEV  246

Query  894   VKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTD  715
             V+LQ+N   T+R++  CK  GIKL G L AAGL+AAHSS+   +HH +   KY VVTL D
Sbjct  247   VRLQMNSDDTTRLITACKERGIKLSGALAAAGLIAAHSSKDLLNHHPE---KYAVVTLID  303

Query  714   CRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADL  535
             CRS+LDP L S H GFYHSAILN H +KGGE LW++AKR Y +  NS   NKHFSDM DL
Sbjct  304   CRSLLDPVLHSCHLGFYHSAILNTHDIKGGEDLWELAKRCYMSLSNSMDCNKHFSDMGDL  363

Query  534   NFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPS  355
             N+LMCKAIDNPG T SSSLR+  I+VFE P++ D++ D+ +E+G+EDY+GCSSVH VGPS
Sbjct  364   NYLMCKAIDNPGFTPSSSLRTCFISVFENPLIDDLN-DLCQEVGLEDYMGCSSVHSVGPS  422

Query  354   IAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILI  235
             IAIFDT+ +G+LDCACVYPSPLHSREQM +L+D MKRIL+
Sbjct  423   IAIFDTIRNGQLDCACVYPSPLHSREQMQKLIDNMKRILV  462



>ref|XP_009336971.1| PREDICTED: uncharacterized protein LOC103929486 [Pyrus x bretschneideri]
Length=473

 Score =   481 bits (1238),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 254/477 (53%), Positives = 321/477 (67%), Gaps = 26/477 (5%)
 Frame = -3

Query  1617  ENNKERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKL  1438
             E  K R VG  E+ WCRAV GGTGITVL F +S KA D    + ALHK+ NAHPIL S+L
Sbjct  3     EQPKGRAVGAMENSWCRAVPGGTGITVLGFDIS-KAPDMVKYQTALHKLQNAHPILNSRL  61

Query  1437  RYNAATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNN  1258
               N     FSF  S TP +QI   D  STL+IL   T S+    S SPFH+ILE+EL+ N
Sbjct  62    HTNTKANTFSFVTSPTPFVQIKTLDLSSTLEILE--TLSNPSNSSVSPFHLILEYELNQN  119

Query  1257  AAWRNPASF----PPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTT-----------  1123
               W    S     PP+  D+ F ++Y LP+    V  +RFH A CD TT           
Sbjct  120   T-WAKTTSSSSSSPPNDHDMFFGTIYTLPD-AKWVAVMRFHVAACDHTTAETMLRELLGF  177

Query  1122  VVSllgelmelmregtLKGIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRL  943
             + S          +G +K   N+GE +FGIE++VP+  +KK  W+ G DM+ YS+N+ RL
Sbjct  178   LTSADDGDDGGEGKGIVKETGNKGEANFGIEDLVPARVAKKPFWSRGGDMISYSLNTVRL  237

Query  942   TNLKFNDVKGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWD  763
             ++LKF D K  R S VV+ Q+N   T RIL GCK+  IKLCG L AAGL+AA        
Sbjct  238   SSLKFKDYKSVRLSQVVRFQMNQDETKRILTGCKAREIKLCGALVAAGLIAADKCSKP--  295

Query  762   HHQQQKKKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAF  583
                 QKKKYGV+TL DCRS LDP LS HH+G YHS I  +HT+KGGE LW++AK++Y+AF
Sbjct  296   ---NQKKKYGVLTLIDCRSDLDPALSIHHFGNYHSIIPLVHTIKGGENLWELAKKTYTAF  352

Query  582   ENSKKTNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELG  403
              NSKK +KHF+D+A L+F+MCKAIDNP LT SSSLR++ +TVFE+ ++ D + DIQRELG
Sbjct  353   ANSKKNDKHFTDLATLSFVMCKAIDNPALTPSSSLRTSFMTVFEDTIIDDYN-DIQRELG  411

Query  402   VEDYVGCSSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILID  232
             V+DY+GCSSVHG+GPSIA+FDT+ +G+LDC CVYP+PLHSREQM ELVD MK+IL+D
Sbjct  412   VDDYIGCSSVHGIGPSIAVFDTIRNGRLDCVCVYPTPLHSREQMLELVDNMKKILVD  468



>gb|EYU38652.1| hypothetical protein MIMGU_mgv1a005747mg [Erythranthe guttata]
Length=472

 Score =   479 bits (1234),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 269/485 (55%), Positives = 336/485 (69%), Gaps = 35/485 (7%)
 Frame = -3

Query  1623  ADENNKE-----RVVGGTEHGWCRAVSGGTGITVLAFL----VSPKAADTCLLRNALHKI  1471
             A  NNK      R +G TE  WCRAVS GTGITVLA      +SP+ +D   L   L ++
Sbjct  3     AGTNNKSETMAPRALGNTEQNWCRAVSSGTGITVLALQMAKSLSPENSD---LDKILDRV  59

Query  1470  LNAHPILRSKLRYNAATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPF  1291
               +HP+LRSKL YN  TK+FSF     P I +   DAP  +          +     SP 
Sbjct  60    QKSHPLLRSKLHYNPTTKSFSFLAPTAPKIHLEFHDAPPLI---------TNHSPDLSPL  110

Query  1290  HIILEHELSNNAAWRNPASFPPSGADVLFASLYALPEEGGHVMA-------LRFHTAVCD  1132
             H +LEHE+ N+  W  P+SFP  GA+V+ A++Y  P       A       LRFHT+VCD
Sbjct  111   HSVLEHEM-NSTNWSEPSSFPTDGAEVILATVYKAPPSDDVAAAAAKSVVVLRFHTSVCD  169

Query  1131  RTTVVS---llgelmelmregtLKGIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYS  961
             RTT V+    L EL+       ++G   +GEG  GIEN++P   +KK +W HG DMLGYS
Sbjct  170   RTTAVALLRELMELVAEETTVVVEGGGGDGEGKTGIENMIPIGMAKKTIWGHGRDMLGYS  229

Query  960   VNSFRLTNLKFNDVKGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHS  781
             V+S RLTNL FN+ K PR S +V+LQ+  HHT+ +LAGCK  GIKLCG L+AA L+AAHS
Sbjct  230   VSSLRLTNLTFNNSKRPRVSQLVRLQITKHHTALLLAGCKFRGIKLCGALSAAALIAAHS  289

Query  780   SRSQWDHHQQQKKKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAK  601
             ++   DH  + KKKYGVVTL DCRS+L+PPLS HH+GFYHSAILN HTV G E  WD+AK
Sbjct  290   TKLTSDH--KLKKKYGVVTLIDCRSLLEPPLSVHHFGFYHSAILNTHTVNGTENFWDLAK  347

Query  600   RSYSAFENSKKTNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISAD  421
               Y+AF + K++NKHFSDMADLNFLM KA++NP LT SSSLR++++TVFEEPV+ D S +
Sbjct  348   ACYTAFASYKQSNKHFSDMADLNFLMSKAMENPSLTPSSSLRTSLVTVFEEPVI-DNSGE  406

Query  420   IQRELGVEDYVGCSSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRI  241
             I++++GVEDYVGC+S HGVGPSIA+FDTV DG+LDCACVYPSPLHSREQM++LVD MKRI
Sbjct  407   IRKKIGVEDYVGCASTHGVGPSIAMFDTVRDGELDCACVYPSPLHSREQMNDLVDRMKRI  466

Query  240   LIDAT  226
             LID T
Sbjct  467   LIDGT  471



>ref|XP_004303543.1| PREDICTED: uncharacterized protein LOC101300265 [Fragaria vesca 
subsp. vesca]
Length=471

 Score =   477 bits (1227),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 257/463 (56%), Positives = 330/463 (71%), Gaps = 21/463 (5%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNAA  1423
             R VGGTE+ WC+AV  GTGITVLA L++ K  +  LL+NALH + N+HPILRS L +++A
Sbjct  18    RPVGGTEYSWCKAVPVGTGITVLALLLT-KPPNIPLLQNALHNLQNSHPILRSNLHFDSA  76

Query  1422  TKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAWRN  1243
             T +FSF    +P +QI PFD PST  ILR  +           FH ILEHEL+ N  WRN
Sbjct  77    TNSFSFLTPPSPHLQIQPFDLPSTASILRPSSAVSP-------FHQILEHELNLNT-WRN  128

Query  1242  PASFPPSG---ADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgel--melmreg  1078
             P   PPS     DV FAS Y L  E    + LR HT+ CDR   V+LL EL        G
Sbjct  129   P--HPPSADADTDVFFASTYGL-SESRWALVLRLHTSACDRAAAVALLKELLGSVGGGGG  185

Query  1077  tLKGIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSL  898
             T   IK +GE    +E+++P+ K+ K  WA G+DMLGYS+NS RL+NL+F DV   + + 
Sbjct  186   TEMEIKGKGEVLSALEDLIPNGKASKPFWARGVDMLGYSLNSLRLSNLEFKDVSLEKTTQ  245

Query  897   VVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLT  718
             +VKL++N  HT ++LAGCKS GIKLCGVL AAGL+AAH+S+   DH   Q +KY VVTL 
Sbjct  246   MVKLRINPEHTDKLLAGCKSKGIKLCGVLAAAGLIAAHASKHLPDH---QWEKYAVVTLL  302

Query  717   DCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMAD  538
             DCR +LDPPLS++  GFYHSAI+N H + G   LW++AKR Y+AF ++K +NKHFSDM+D
Sbjct  303   DCRPLLDPPLSANDLGFYHSAIVNSHDINGENTLWELAKRCYTAFADAKNSNKHFSDMSD  362

Query  537   LNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGP  358
             LNFLMCKAI+NPGLT SSS+R+A  +VFE+ +V D S+++ +ELG+EDY GC+SVHGVGP
Sbjct  363   LNFLMCKAIENPGLTPSSSMRTAFFSVFED-LVIDDSSEVYQELGLEDYEGCASVHGVGP  421

Query  357   SIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDA  229
             SIAIFD++ DG L+C+CVYPSPLHSREQM +L+D M+ IL+D 
Sbjct  422   SIAIFDSIRDGGLNCSCVYPSPLHSREQMQDLMDHMRSILVDG  464



>ref|XP_008243528.1| PREDICTED: uncharacterized protein LOC103341758 [Prunus mume]
Length=472

 Score =   476 bits (1224),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 253/473 (53%), Positives = 324/473 (68%), Gaps = 26/473 (5%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNAA  1423
             R VG  E+ WCRAV GGTGITVL F +S +A D    + ALHK+ NAHPIL S+L  N  
Sbjct  8     RAVGAMENSWCRAVPGGTGITVLGFDIS-RAPDMLKYQTALHKLQNAHPILNSRLHTNTK  66

Query  1422  TKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAWRN  1243
                FSF  S TP +QI  FD  ST++IL   T S+    S SPFH+ILEHEL+ N   + 
Sbjct  67    MNTFSFVTSPTPFVQIKTFDLSSTMEILE--TLSNPSNNSVSPFHLILEHELNKNTWTKT  124

Query  1242  PASFPP--------SGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelm  1087
               +           +  D+ F ++Y LP     V  +R H + CD TT  ++L EL+  +
Sbjct  125   TTTTSSSSSSSASTNDQDMFFGTIYTLPN-AKWVAVMRLHVSACDHTTAETMLRELLGYL  183

Query  1086  regtLKG--------IKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLK  931
               GT  G        I ++GE + GIE++VPS  +KK  WA G+DML YS+NS RLTNLK
Sbjct  184   IGGTNDGEGRGIEKEIGSKGEVNSGIEDLVPSRIAKKPFWARGVDMLSYSLNSLRLTNLK  243

Query  930   FNDVKGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQ  751
             F D K  R S VV+ Q+N   T RIL GCK+ GIKLCG L AAGLMAA        HHQ 
Sbjct  244   FKDTKSARSSQVVRFQMNQEETQRILDGCKAKGIKLCGALVAAGLMAADKCSK---HHQ-  299

Query  750   QKKKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSK  571
              KKKYG++TL DCRS  DP LS HH+G YHS I ++HT+KGGE LW++AK++Y+AF +SK
Sbjct  300   -KKKYGILTLIDCRSNFDPALSIHHFGNYHSVIPHIHTIKGGENLWELAKKTYTAFASSK  358

Query  570   KTNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDY  391
              ++KHF+D+A L+F+MCKAI+NP LT SSSLRS+ +TVFE+ ++ D + D+QRELGV+DY
Sbjct  359   NSDKHFTDLAALSFVMCKAIENPALTPSSSLRSSFMTVFEDTIIDDYN-DMQRELGVDDY  417

Query  390   VGCSSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILID  232
             +GC+SVHG+GPSIAIFDT+ +G+LDC CVYPSPLH+REQM ELVD MK+IL+D
Sbjct  418   IGCASVHGIGPSIAIFDTIRNGRLDCVCVYPSPLHAREQMQELVDNMKKILVD  470



>ref|XP_008387017.1| PREDICTED: uncharacterized protein LOC103449472 [Malus domestica]
Length=477

 Score =   475 bits (1223),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 257/470 (55%), Positives = 333/470 (71%), Gaps = 18/470 (4%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R VGGTEH WC+AV  GTGITVLA L++ +  +   L+ ALH + N+HPILRSK  ++
Sbjct  18    KTRXVGGTEHSWCKAVPCGTGITVLALLLT-RPPNFSNLQTALHNLQNSHPILRSKHHFD  76

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
              AT  +SF    TP +QI PFD PST  IL+       +  + +P H ILEHE++ N  W
Sbjct  77    PATGTYSFLTLPTPHLQIQPFDLPSTAPILQ------INPDNIAPLHQILEHEMNLNP-W  129

Query  1248  RNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLK  1069
             +N      S  DV++AS YA+  E   V+ LR HT+ CDR   V++L EL+  ++     
Sbjct  130   QNLDPSVESDTDVIYASTYAI-SESRWVLVLRLHTSACDRAAAVAVLKELLGELKSTGGG  188

Query  1068  G----IKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHS  901
             G    +K +GE S GIE+++P+ K+ K  WA G+DM+GYS+NS RL+NL+F D    R S
Sbjct  189   GAERELKGDGEVSLGIEDLIPNGKANKPFWARGVDMMGYSLNSLRLSNLEFQDASSERRS  248

Query  900   LVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTL  721
              VVKLQL+   T R+LAGCKS  IKLCG L AAG++AA +S+   DH   Q +KYGVVTL
Sbjct  249   QVVKLQLSPEDTHRLLAGCKSRDIKLCGALAAAGMIAARASKQLPDH---QWEKYGVVTL  305

Query  720   TDCRSILDPPLSSHHYGFYHSAILNMHTVKG-GERLWDMAKRSYSAFENSKKTNKHFSDM  544
              DCR ILDPPLS +H GFYHSAI+N H + G G  LWD+AKR Y++F ++K +NKHF+DM
Sbjct  306   LDCRPILDPPLSINHLGFYHSAIMNTHDINGEGNTLWDLAKRCYTSFASAKNSNKHFTDM  365

Query  543   ADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGV  364
             ADLNFLMCKAI+NPGLT SSS+R+A I+VFE+ V+ D S++I +ELGVEDY GC+S HGV
Sbjct  366   ADLNFLMCKAIENPGLTPSSSMRTAFISVFEDTVI-DESSEINKELGVEDYEGCASAHGV  424

Query  363   GPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDATKFID  214
             GPSIAIFDT+ DG L+CACVYPSPLHSREQM +L+D MK IL++  K ++
Sbjct  425   GPSIAIFDTIRDGCLNCACVYPSPLHSREQMQDLMDRMKSILVNGCKDVE  474



>ref|XP_004494048.1| PREDICTED: uncharacterized protein LOC101495207 [Cicer arietinum]
Length=454

 Score =   474 bits (1220),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 266/474 (56%), Positives = 328/474 (69%), Gaps = 30/474 (6%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R VG TE  WCRAV GGTGI V+A  +S K  +T  L+ A+HK+ N HPILRS L   
Sbjct  5     KGRTVGATECTWCRAVRGGTGIAVVALRIS-KPPNTSHLQTAIHKLQNYHPILRSTL-LQ  62

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
              A   FSF  S TP +++T  D  +   ++          +S SP   ILEHEL+N++AW
Sbjct  63    HANNNFSFLTSPTPFLELTSHDLTNQNDVVN---------ISLSPLQQILEHELNNDSAW  113

Query  1248  RNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLK  1069
             R+         D+ F ++YA+P +   V+ALR H A CDRTT V LL EL+E++ E    
Sbjct  114   RDTTR---DSNDMFFGTVYAMPNDT-WVVALRLHVAACDRTTAVLLLRELLEILEEQEEI  169

Query  1068  GIKN------EGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPR  907
               KN      + E S  IE++VP EK+KK L A G D+L YS+NSFRLTNLKF D K  R
Sbjct  170   KNKNNFDENNKKEISLAIEDIVPGEKTKKALLARGFDVLSYSLNSFRLTNLKFCDAKTTR  229

Query  906   HSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVV  727
              S VV+LQLN   T  +LAGC   GIKLCGV++AAGLMAAHSS+       +  KKYG+V
Sbjct  230   LSQVVRLQLNQDDTKGVLAGCAWNGIKLCGVVSAAGLMAAHSSK-------RGSKKYGIV  282

Query  726   TLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSD  547
             TLTDCRS L   LS + +GFYHSAILN   +KGGE+LWD+AKR+YSAF NSKK+NKHFSD
Sbjct  283   TLTDCRSTLQSHLSDN-FGFYHSAILNSQEIKGGEKLWDLAKRTYSAFANSKKSNKHFSD  341

Query  546   MADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHG  367
             MADLNFLMCKAI+NPGLT SSSLR+A+++VFE+ VV D S   Q+++GVEDY+GC+S+HG
Sbjct  342   MADLNFLMCKAIENPGLTPSSSLRTAILSVFEDTVV-DNSGKKQKDVGVEDYMGCASIHG  400

Query  366   VGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDATKFIDDLN  205
             VGPSIAIFDT+ DG LDC CVYPSPLHSREQM E+  ++K ILIDA K   D N
Sbjct  401   VGPSIAIFDTIRDGSLDCVCVYPSPLHSREQMQEVFGKVKDILIDAAKSYKDSN  454



>ref|XP_007204331.1| hypothetical protein PRUPE_ppa005248mg [Prunus persica]
 gb|EMJ05530.1| hypothetical protein PRUPE_ppa005248mg [Prunus persica]
Length=470

 Score =   474 bits (1221),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 255/471 (54%), Positives = 323/471 (69%), Gaps = 24/471 (5%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNAA  1423
             R VG  E+ WCRAV GGTGITVL F +S  A D    + ALHK+ NAHPIL S+L  N  
Sbjct  8     RAVGAMENSWCRAVPGGTGITVLGFDISC-APDMLKYQTALHKLQNAHPILNSRLHTNTK  66

Query  1422  TKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAWRN  1243
             T  FSF  S TP +QI  FD  STL+IL   T S+    S SPFH+ILEHEL+ N   + 
Sbjct  67    TNTFSFVTSPTPFVQIKTFDLSSTLEILE--TLSNPSNNSVSPFHLILEHELNKNTWTKT  124

Query  1242  PASFPP------SGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmre  1081
               +         +  D+ F ++Y LP     V  +R H + CD TT  ++L EL+  +  
Sbjct  125   TTTTSSSSSASTNDQDMFFGTIYTLPN-AKWVAVMRLHVSACDHTTAETMLRELLGYLIG  183

Query  1080  gtLKG--------IKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFN  925
             GT  G        I ++GE + GIE++VPS  +KK  WA G+DML YS+NS RLTNLKF 
Sbjct  184   GTDDGEGRGIEKEIGSKGEVNSGIEDLVPSRIAKKPFWARGVDMLSYSLNSLRLTNLKFK  243

Query  924   DVKGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQK  745
             D K  R S VV+ ++N   T RIL GCK+ GIKLCG L AAGLMAA        HHQ  K
Sbjct  244   DTKSARSSQVVRFRMNQEETQRILDGCKAKGIKLCGALVAAGLMAADKCSK---HHQ--K  298

Query  744   KKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKT  565
             KKYGV+TL DCRS  DP LS HH+G YHS I ++HT+KGGE LW++AK++Y+AF +SK  
Sbjct  299   KKYGVLTLIDCRSNFDPALSIHHFGNYHSVIPHIHTIKGGENLWELAKKTYTAFASSKDN  358

Query  564   NKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVG  385
             +KHF+D+A L+F+MCKAI+NP LT SSSLRS+ +TVFE+ ++ D + D+QRELGV+DY+G
Sbjct  359   DKHFTDLAALSFVMCKAIENPALTPSSSLRSSFMTVFEDTIIDDYN-DMQRELGVDDYIG  417

Query  384   CSSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILID  232
             C+SVHG+GPSIAIFDT+ +G+LDC CVYPSPLH+REQM ELVD MK+IL+D
Sbjct  418   CASVHGIGPSIAIFDTIRNGRLDCVCVYPSPLHTREQMQELVDNMKKILVD  468



>ref|XP_004246498.1| PREDICTED: uncharacterized protein LOC101249753 [Solanum lycopersicum]
Length=472

 Score =   473 bits (1218),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 257/465 (55%), Positives = 331/465 (71%), Gaps = 15/465 (3%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R  G TEH WC+AV GGTGITVLA L+S K  D  LL+NALHK+ N++PIL+S+L Y 
Sbjct  16    KSRPAGSTEHSWCKAVPGGTGITVLALLLS-KPPDISLLQNALHKLQNSNPILKSQLHYE  74

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
             ++T ++S+ I +T  +QI PFD  ST+QILR       D+ S S FH+ILEHE+++N+ W
Sbjct  75    SSTNSYSYIIPSTSHLQIQPFDLSSTVQILRR--LKTSDLTSVSDFHLILEHEINHNS-W  131

Query  1248  RNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLK  1069
              N  +   S  D+ FAS+Y L  E   V ALR HT+VCDR   +++L +L++L+      
Sbjct  132   MNTGTSSDSDTDIFFASIYQLENEKS-VFALRIHTSVCDRAAALAVLKKLLKLVSCEKED  190

Query  1068  G------IKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPR  907
                    I  + E   GIE  +P  K+ K  WA GIDM+GY +NS R  NLKF D +  R
Sbjct  191   EEGTELEILKKMEVGLGIEEYIPDGKASKPFWARGIDMVGYGLNSLRFCNLKFMDSESTR  250

Query  906   HSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVV  727
              S VVKLQLN   T  IL GCK+ GIKLCG+L AAGL+AAHS +      + Q +KY +V
Sbjct  251   GSQVVKLQLNKQETDHILDGCKTRGIKLCGLLAAAGLIAAHSLKGL---KENQWEKYAIV  307

Query  726   TLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSD  547
             TL +CRSILDP LS    GFYHSAILN H VKGG+ LW++AKRSY++F N+K  NKHF+D
Sbjct  308   TLINCRSILDPVLSPDFPGFYHSAILNTHDVKGGDDLWELAKRSYTSFINAKNNNKHFTD  367

Query  546   MADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHG  367
             M DLNFLMC+AIDNPGLT SSSLR+++I+VFE+ V+ D S+ + +E+G+ED++GC+SVHG
Sbjct  368   MGDLNFLMCRAIDNPGLTPSSSLRTSLISVFEDTVI-DTSSTMHQEIGLEDFIGCASVHG  426

Query  366   VGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILID  232
             VGPSIAIFDT+ DG LDCACVYP PLH+REQ+ EL+ EMK+ILID
Sbjct  427   VGPSIAIFDTIRDGHLDCACVYPFPLHTREQIQELIGEMKKILID  471



>ref|XP_006430164.1| hypothetical protein CICLE_v10011692mg [Citrus clementina]
 gb|ESR43404.1| hypothetical protein CICLE_v10011692mg [Citrus clementina]
Length=453

 Score =   472 bits (1215),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 255/456 (56%), Positives = 325/456 (71%), Gaps = 22/456 (5%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNAA  1423
             R+  GTE+ WCRAV GGTGI VLA L S K  +T  L++AL+K+ + HPILRS+L  N +
Sbjct  16    RIASGTEYSWCRAVPGGTGIAVLAILTS-KVPETSGLQDALNKLQSYHPILRSRLHTNPS  74

Query  1422  TKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAWRN  1243
                FSF  S T  IQ+  F+  ST +IL S      +  S +P  +ILEHEL+ NA W N
Sbjct  75    KNTFSFVTSPTTFIQVKSFNLSSTSKILES-----SERFSIAPLQLILEHELNENA-WCN  128

Query  1242  PASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLKGI  1063
                   S  D+L+AS YALP+    V+ALR H A CDRTT VSLL EL+ ++     +  
Sbjct  129   LKC--TSTTDMLYASSYALPD-AKWVVALRLHVAACDRTTAVSLLKELLLVLVSDDDQEQ  185

Query  1062  KNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLVVKLQ  883
             +  GE +  IE ++P  K+KK LWA G DML YSVNS + TNLKF D K PR S VV+LQ
Sbjct  186   EGRGEVNLAIEALIPKGKAKKALWARGRDMLTYSVNSLKSTNLKFIDAKSPRSSQVVRLQ  245

Query  882   LNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTDCRSI  703
             LN   T RIL    S GIKLCG+L AAGL+AAH+S +Q        +KY V TLTDCRSI
Sbjct  246   LNKDDTERILL---SRGIKLCGMLAAAGLIAAHNSDNQ--------RKYAVATLTDCRSI  294

Query  702   LDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADLNFLM  523
             L+PPLS+H +GFYHSAI+N H +K GE+L D+AK+ Y+AF NSK  N+HFSDMADLNFLM
Sbjct  295   LEPPLSNHRFGFYHSAIMNTHLIKRGEKLGDLAKKIYTAFANSKHCNRHFSDMADLNFLM  354

Query  522   CKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPSIAIF  343
             CKAI+NP LT +SSLRS+ ++VFE+  V+D S ++Q+++G+EDY+GC+SVHG+GPSIA+F
Sbjct  355   CKAIENPSLTPASSLRSSFMSVFEDS-VFDSSNEMQQQVGLEDYMGCASVHGIGPSIALF  413

Query  342   DTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILI  235
             DT+ DG+LDC CVYPSPLHSREQM ELV++MK +L+
Sbjct  414   DTIRDGRLDCVCVYPSPLHSREQMQELVEKMKSVLV  449



>ref|XP_010245495.1| PREDICTED: uncharacterized protein LOC104589017 isoform X2 [Nelumbo 
nucifera]
Length=466

 Score =   472 bits (1215),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 266/468 (57%), Positives = 326/468 (70%), Gaps = 24/468 (5%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R VGGTE+ WCRAV GGTGITV+A L+S  A +   L+NAL+K+ N+HPILRSKL +N
Sbjct  9     KGRPVGGTEYSWCRAVPGGTGITVVALLLS-GALEPSSLQNALNKLQNSHPILRSKLTHN  67

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
             A T +FSF IS TP +QI  FD   T  +L S         S SPFH I+EHEL+ N  W
Sbjct  68    ATTNSFSFTISPTPYLQIQSFDVSFTSHLLHSN-------HSVSPFHRIVEHELNQNP-W  119

Query  1248  RNPASFPP--SGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmr---  1084
                   PP     DV FASLYALP+    V+ LR HT+VCDR + VSLL EL+ L+    
Sbjct  120   SAEDLQPPVHPETDVFFASLYALPDRKW-VVTLRLHTSVCDRRSAVSLLNELLGLIAGEG  178

Query  1083  egtLKGIKNE----GEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVK  916
             +   KGI+ E     E S GIE ++PS K+ K  WA G+D+LGYS+NSFR  NL F D  
Sbjct  179   KEDKKGIEQEVGKEDEVSLGIEALIPSGKANKPFWARGVDLLGYSLNSFRFVNLDFKDTT  238

Query  915   GP-RHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKK  739
                R S VV LQ++   T R+L  CK+  IKLCG L AA L+AA SSR   D   QQ++K
Sbjct  239   ASLRSSEVVSLQMDPDETRRLLTACKARDIKLCGALAAAALIAARSSR---DLPDQQQEK  295

Query  738   YGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNK  559
             Y  V L DCR++LDPPL  +H GFYHSAILN H +KGGE LW++A+R Y +  NS K+NK
Sbjct  296   YATVILIDCRNLLDPPLQYNHLGFYHSAILNTHDIKGGEDLWELAERCYMSLSNSMKSNK  355

Query  558   HFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCS  379
             HFSDM DLNFLMCKAIDNP LT SSS+R+++I+VFE+PV  D + ++  E+GVEDY+ CS
Sbjct  356   HFSDMGDLNFLMCKAIDNPRLTPSSSMRTSLISVFEDPVTDDFN-ELHHEIGVEDYISCS  414

Query  378   SVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILI  235
             SVHGVGPSIA+FD + DG+LDCACVYPSPLHSREQM ELVD MKR+L+
Sbjct  415   SVHGVGPSIAVFDRLRDGRLDCACVYPSPLHSREQMLELVDNMKRMLV  462



>ref|XP_008243526.1| PREDICTED: uncharacterized protein LOC103341757 [Prunus mume]
Length=461

 Score =   472 bits (1214),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 262/463 (57%), Positives = 319/463 (69%), Gaps = 16/463 (3%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R VGGTE  WC AV GGTGITVLA   S K  D   L+ AL K+ N+HPIL S+L  N
Sbjct  5     KGRPVGGTETSWCHAVPGGTGITVLALHAS-KPPDVLNLQTALLKVQNSHPILNSRLHTN  63

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
               T   SF  S TP +QI  F   STL+IL +   S     S S FH+ILEHEL+ N  W
Sbjct  64    PKTNTLSFVPSPTPYVQIKSFSLSSTLEILET-LYSPISNPSVSAFHLILEHELNQNP-W  121

Query  1248  RNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmr-----  1084
             +   +   +  D+ FAS+YALP     V+ALR H + CDRTT VS L E++ LM      
Sbjct  122   QLKNTTCTTDQDMFFASIYALPS-ATWVVALRLHVSACDRTTSVSFLREVVGLMGGGDEG  180

Query  1083  egtLKGIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRH  904
                   I N+G+ + GIE+++P  K KK +W  G+DML YSVNS RLTN+KF D K  R 
Sbjct  181   REVNMEIGNKGDVNLGIEDLIPCGKGKKAMWVRGMDMLSYSVNSLRLTNMKFTDTKSARV  240

Query  903   SLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVT  724
             S VV+LQ+N   T R+L GCK+ GIKLC  L AAGLMA        D+  + +KKYGVVT
Sbjct  241   SRVVRLQMNEDDTQRVLNGCKTRGIKLCAALVAAGLMAVD------DYRLENQKKYGVVT  294

Query  723   LTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDM  544
             LTDCRS L P LS  H+GFYHSAILN H  KGGE LW++A ++Y AF +SK  NKHFSDM
Sbjct  295   LTDCRSNLHPALSHKHFGFYHSAILNTHATKGGETLWELANKTYRAFASSKSNNKHFSDM  354

Query  543   ADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGV  364
             ADLNFLMCKAIDNP LT+SSSLR++ ++VFE+PV+ D S D QRELG+E+Y+GC+SVHG+
Sbjct  355   ADLNFLMCKAIDNPTLTSSSSLRTSFMSVFEDPVIDD-SNDKQRELGLEEYMGCASVHGI  413

Query  363   GPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILI  235
             GPSIAIFDT+ DG+LDC CVYP+PLHSREQM  LVD+MK IL+
Sbjct  414   GPSIAIFDTIRDGRLDCVCVYPAPLHSREQMQGLVDDMKTILV  456



>ref|XP_002308465.2| hypothetical protein POPTR_0006s22750g [Populus trichocarpa]
 gb|EEE91988.2| hypothetical protein POPTR_0006s22750g [Populus trichocarpa]
Length=478

 Score =   472 bits (1215),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 262/466 (56%), Positives = 325/466 (70%), Gaps = 20/466 (4%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R VG TE+ WCR+V  GTGITVLA L+S K  D  LL+  L K+ N+ P+LR+KLR+N
Sbjct  19    KARPVGATEYSWCRSVPLGTGITVLALLLS-KQPDIHLLQTTLDKLQNSRPLLRTKLRFN  77

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNA--  1255
             + T  FSF     P +QI PFD PST  I+ +         +  P+HIILEHEL+ N+  
Sbjct  78    STTNTFSFITPPAPHVQIQPFDLPSTADIISN------SDQNIDPYHIILEHELNKNSWS  131

Query  1254  AWRNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregt  1075
             A+ + +S   +  +V F +LY L E    V+ LR HT+ CDR   V LL EL+ LM    
Sbjct  132   AYLDQSS--DAETNVFFITLYTLSENRWAVV-LRLHTSTCDRAAAVGLLRELLVLMGGEN  188

Query  1074  LKGI----KNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPR  907
               GI    +NE E S GIE+ +PS K  K  WA GIDMLGYS+NSFRL+NL F D   PR
Sbjct  189   QGGITKEYENEVEVSLGIEDYIPSGKGNKPFWARGIDMLGYSLNSFRLSNLDFVDADSPR  248

Query  906   HSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVV  727
              S VV+LQ+N   T ++L GC S GIKL G L AAGL+AA S++   DH   Q +KY VV
Sbjct  249   GSQVVRLQMNSDDTQKLLDGCMSRGIKLSGALAAAGLIAAQSTKDLPDH---QMEKYAVV  305

Query  726   TLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSD  547
             TL DCRSILDP LS  H GFYHSA+LN H V GG  LWD+AKR Y A+ N+K  NKHF+D
Sbjct  306   TLIDCRSILDPVLSGDHIGFYHSAMLNTHDVSGGVMLWDLAKRCYMAYTNAKNNNKHFTD  365

Query  546   MADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHG  367
             M DLNFLMCKAI+NPGLT SSS+R+A I+VFE+PV+ D + ++  ++GVEDYVGCSSVHG
Sbjct  366   MGDLNFLMCKAIENPGLTPSSSMRTAFISVFEDPVIDD-TNEMHGKVGVEDYVGCSSVHG  424

Query  366   VGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDA  229
             VGPS+AIFDTV +G+LDCACVYPSPLHSR+QM +L+D+MKRIL+D 
Sbjct  425   VGPSVAIFDTVRNGRLDCACVYPSPLHSRDQMQKLIDDMKRILVDG  470



>ref|XP_006481747.1| PREDICTED: uncharacterized protein LOC102616692 isoform X1 [Citrus 
sinensis]
Length=478

 Score =   471 bits (1211),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 256/469 (55%), Positives = 327/469 (70%), Gaps = 19/469 (4%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNAA  1423
             R VGGTE+ WC+AV  GTGITVLA L+S K  +  LLR AL+ + N HPILRSKL  +A 
Sbjct  18    RPVGGTEYSWCKAVPTGTGITVLALLLS-KHPNIQLLRTALNNLQNNHPILRSKLHSSAD  76

Query  1422  TKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAWRN  1243
              K FSF     P I I   D  ST Q +  +T +         F +ILEHEL+ N  W N
Sbjct  77    AKTFSFITPPEPHILIQQCDISSTSQTISDKTGAGSP------FQLILEHELNRNT-WTN  129

Query  1242  PA--SFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLK  1069
             P+  S   S +++ + S+Y  P E   V+ LR HT++CDR + V++  EL+ LM      
Sbjct  130   PSHQSNTNSDSNLFYVSIYT-PSETQWVVTLRLHTSICDRASAVAVSKELLRLMTGRDEG  188

Query  1068  GIKNE----GEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHS  901
             GI+ E    GE S GIE  +PS K+ K  WA G+DMLGYS+NS RL+N+ F D   PR S
Sbjct  189   GIEKEYDRKGEVSLGIEEFIPSGKANKPFWARGVDMLGYSLNSLRLSNISFVDADSPRFS  248

Query  900   LVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTL  721
              V++LQLN   T+R++ GCKS GIKLCG L AAGL+AA S++    H   Q++KY VVTL
Sbjct  249   QVLRLQLNRDETARLVEGCKSRGIKLCGALAAAGLIAARSTKYFPSH---QREKYAVVTL  305

Query  720   TDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMA  541
              DCRSIL+P LS  + GFYHSAILN H V G E LW++A RSY++F N+K ++KHF+DM 
Sbjct  306   VDCRSILEPVLSDDYLGFYHSAILNTHDVNGEEELWELATRSYTSFANAKNSDKHFTDMN  365

Query  540   DLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVG  361
             DLNFLMCKAIDNPGLT +SSLR+AVI+VFE+P+V D +  + +E+G+EDY+GCSSVHGVG
Sbjct  366   DLNFLMCKAIDNPGLTPASSLRTAVISVFEDPIV-DETNKLHQEIGLEDYIGCSSVHGVG  424

Query  360   PSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDATKFID  214
             PSIAIFDT+ DG LDCACVYPSPLHSREQ+ +L+D+MK+IL++   F D
Sbjct  425   PSIAIFDTIRDGWLDCACVYPSPLHSREQLQQLIDDMKKILVEGGSFGD  473



>ref|XP_004494047.1| PREDICTED: uncharacterized protein LOC101494882 [Cicer arietinum]
Length=464

 Score =   467 bits (1201),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 259/460 (56%), Positives = 326/460 (71%), Gaps = 17/460 (4%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNAA  1423
             R VGGTE+GWC+AV GGTG TVL+ L+S K     LL+NALHK+  +HPILRSK+ ++  
Sbjct  18    RPVGGTEYGWCKAVPGGTGSTVLSLLLS-KPPQIPLLQNALHKLQISHPILRSKIHFDHT  76

Query  1422  TKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAWRN  1243
             T  F F     P +QI  FD  ST QIL+S+T+   D      FH +LEHE+ N   WR+
Sbjct  77    TNTFQFVTPPNPSVQIQSFDLQSTSQILQSQTNDLIDP-----FHALLEHEM-NRDTWRD  130

Query  1242  PASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLKGI  1063
             P       ADV++AS Y + EE   V  LR HT+ CDR   V+LL EL+ L+      G 
Sbjct  131   PKE---GDADVMYASSYTISEERFAVF-LRLHTSSCDRAAAVALLKELLRLVAGRN-GGD  185

Query  1062  KNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLVVKLQ  883
               E + +  IE+++P  K+ K  WA G+D+LGYS+N+FR +NL F +V  PR S +V+LQ
Sbjct  186   GREAKVNLAIEDLIPEGKTNKPFWARGLDVLGYSLNAFRFSNLSFVNVDSPRSSRMVRLQ  245

Query  882   LNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTDCRSI  703
             LN   T  +LAGCKS GIKLCG L AAG++AA +S+   DH   Q +KY VVTL DCR I
Sbjct  246   LNADETMSLLAGCKSRGIKLCGALAAAGMIAAWTSKHLPDH---QTEKYAVVTLIDCRPI  302

Query  702   LDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADLNFLM  523
             LDP LSS++ GFYHSAILN H V  GE LW++AKRSY++F N+ K NKHFSDM+DLNFLM
Sbjct  303   LDPVLSSNNCGFYHSAILNTHDV-CGETLWELAKRSYTSFANAVKCNKHFSDMSDLNFLM  361

Query  522   CKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPSIAIF  343
             CKAIDNPGLT SSSLR+A+I+VFE+ VV D S ++  ELG+ DYVGCSS HGVGPS+AIF
Sbjct  362   CKAIDNPGLTPSSSLRTALISVFEDLVVDD-STEMHEELGLVDYVGCSSAHGVGPSLAIF  420

Query  342   DTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDATK  223
             DTV +GKLDCAC+YPSPLHSREQ+  +VD+MKRIL++  K
Sbjct  421   DTVRNGKLDCACIYPSPLHSREQIQGIVDDMKRILVNGCK  460



>ref|XP_003537075.2| PREDICTED: uncharacterized protein LOC100791257 [Glycine max]
Length=499

 Score =   468 bits (1204),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 256/465 (55%), Positives = 312/465 (67%), Gaps = 35/465 (8%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R VG TE  WCRAV GGTGI VLAF  S    D  +L+ +L  +  +HPILRS+L+ N
Sbjct  63    KSRTVGDTERSWCRAVRGGTGIAVLAFRTS-IPPDISMLQTSLRTLQTSHPILRSRLQTN  121

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
             A T  FSF  S TP I I     P+ +                 P   ILE EL+ N  W
Sbjct  122   ATT--FSFLTSPTPSINILTLTLPTNV---------------TDPLTHILELELNRNT-W  163

Query  1248  RNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLK  1069
              +  +      +V FA+LYA P     V+ALR H + CDRTT + LL EL  L+ E   K
Sbjct  164   HDSTT----EENVFFATLYAGPSTNTWVVALRLHVSACDRTTALLLLRELFTLVEENNNK  219

Query  1068  GIKNE---GEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSL  898
              + N+      S  IE+++P  K KK +W  G+DML YS+NSFRLTNLKF D K PR S 
Sbjct  220   SLINQYPQEATSLAIEDLLPRGKGKKPMWTRGLDMLKYSLNSFRLTNLKFVDAKNPRFSQ  279

Query  897   VVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLT  718
             VV+L+LN + T  +LAGCK +GIKLCG L AAGLMA H S+       +  +KYGVVTLT
Sbjct  280   VVRLELNQNDTKEVLAGCKLSGIKLCGALVAAGLMAVHCSK-------RSSRKYGVVTLT  332

Query  717   DCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMAD  538
             DCRS L+P L+   +GFYHSAILN H +KGGE LWD+AKR+Y AF NSKK NKHFSDMAD
Sbjct  333   DCRSSLEPSLTDK-FGFYHSAILNSHEMKGGETLWDLAKRTYEAFANSKKCNKHFSDMAD  391

Query  537   LNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGP  358
             LNFLMCKAI+NPGLT SSSLR+++++VFE+  V+D     QRE+GVEDY+GC+SVHGVGP
Sbjct  392   LNFLMCKAIENPGLTPSSSLRTSIMSVFED-TVFDNGGKKQREIGVEDYMGCASVHGVGP  450

Query  357   SIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDATK  223
             SIAIFDT+ D  LDC CVYP+PLHSREQM E V++MK ILI+ATK
Sbjct  451   SIAIFDTIRDESLDCLCVYPTPLHSREQMIEFVEKMKVILIEATK  495



>ref|XP_009627514.1| PREDICTED: uncharacterized protein LOC104118047 [Nicotiana tomentosiformis]
Length=480

 Score =   467 bits (1202),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 261/472 (55%), Positives = 336/472 (71%), Gaps = 22/472 (5%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             + R  G TEH WC+AV  GTGITVLA L+S K+ DT LL+NALHK+ N++PIL+SKL Y 
Sbjct  17    QTRPAGNTEHSWCKAVPSGTGITVLALLLS-KSPDTSLLQNALHKLQNSNPILKSKLHYE  75

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
               T ++S+ I +T  +QI PFD  ST QIL+     + +  S S FH+ILEHE++ N+ W
Sbjct  76    PTTNSYSYIIPSTSHLQIQPFDLSSTAQILQQ--LQNPNHTSISDFHLILEHEINKNS-W  132

Query  1248  RNPA-SFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtL  1072
              N A S   S  +V FAS+Y L +E   V  LR HT++CDR   ++LL +L+ELM    +
Sbjct  133   VNTATSSEISDTNVFFASIYRLSDEKWAV-TLRIHTSMCDRAAALALLRKLLELMSSEKI  191

Query  1071  KGI-KNEGEGS-----------FGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKF  928
             +G+ +NEG G             GIE  +P+ K+ K  WA GIDM+GY +N+ R  NLKF
Sbjct  192   QGMNENEGGGVELELGEKMEVVLGIEEYIPTGKANKPFWARGIDMVGYGLNALRFANLKF  251

Query  927   NDVKGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQ  748
              D +  R S VVKLQLN   T RIL GCK+  IKLCG+L AAGLMAAHSS+      + Q
Sbjct  252   IDSESTRGSQVVKLQLNKEDTDRILDGCKTRDIKLCGLLAAAGLMAAHSSKGL---PEDQ  308

Query  747   KKKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKK  568
              +KY VVTL +CR ILDP L     GFYHSAILN H VKGGE +W++A RSY++F N+K 
Sbjct  309   WEKYAVVTLINCRPILDPVLRPDFPGFYHSAILNTHDVKGGEDIWELAMRSYTSFINAKN  368

Query  567   TNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYV  388
              NKHFSDM DLNFLMCKAIDNPGLT +SSLR+++I+VFE+PV+ D S+ + +E+G+ED++
Sbjct  369   NNKHFSDMGDLNFLMCKAIDNPGLTPASSLRTSLISVFEDPVI-DTSSTVHQEIGLEDFI  427

Query  387   GCSSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILID  232
             GC+SVHGVGPSIAIFDT+ +G+LDCACVYP PLH+REQ+ EL+ EMKRIL+D
Sbjct  428   GCASVHGVGPSIAIFDTIRNGQLDCACVYPFPLHTREQIQELIGEMKRILVD  479



>ref|XP_004494204.1| PREDICTED: uncharacterized protein LOC101488848 [Cicer arietinum]
Length=464

 Score =   466 bits (1199),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 248/472 (53%), Positives = 325/472 (69%), Gaps = 27/472 (6%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R VGGTE+ WC+A+ GGTGI VL+ L++ +  D    + AL+K+ N HPILRS++ ++
Sbjct  7     KTRTVGGTEYSWCKAIRGGTGIAVLSLLLT-EPLDIPRFQVALNKLQNYHPILRSRIHHS  65

Query  1428  AATK-----AFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELS  1264
               +       F+F  S TP I+I       + +IL    +    V        ILEHEL+
Sbjct  66    NTSSLTQDTTFTFITSPTPFIKIESHSVNVSSEILGRNPNDAVSVSP---LQQILEHELN  122

Query  1263  NNAAWRNPASFPPSGADVLFASLYALPEEGG-HVMALRFHTAVCDRTTVVSllge----l  1099
              N  W++ +    +G+D+L AS+YA+P +    V+ +R H A CDRTT VSLL E    +
Sbjct  123   RNT-WQDRSR--TTGSDMLVASIYAMPPDAKTSVVVMRLHVAACDRTTAVSLLRELLVLM  179

Query  1098  melmregtLKGIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDV  919
              E      ++   N+GE    IE++VP  K KK +W  G+D++ YS+NSFRLTNLKFND 
Sbjct  180   KEEEENVVVRENDNKGEVCLAIEDLVPCRKGKKNIWTRGLDVISYSLNSFRLTNLKFNDT  239

Query  918   KGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKK  739
             K  R S V++LQLN   T R+LAGCK + IKLCG +TAAGLMAAHSS++         KK
Sbjct  240   KNARFSQVIRLQLNDVDTKRVLAGCKHSEIKLCGAITAAGLMAAHSSKNS-------SKK  292

Query  738   YGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNK  559
             YG++TLTDCRS L PPLS H++GFYH+AILN H +KGGE LW++AKR+Y AF NSK  +K
Sbjct  293   YGIITLTDCRSTLYPPLSIHNFGFYHAAILNNHVIKGGESLWELAKRTYGAFANSKNNDK  352

Query  558   HFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCS  379
             HFSDMAD+NFLM KAIDNP LT  +SLR+++++VFE+ VV D   D QRE+GV+DY+GC+
Sbjct  353   HFSDMADMNFLMNKAIDNPSLT--TSLRTSIMSVFEDMVVDD-GGDKQREVGVDDYMGCA  409

Query  378   SVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDATK  223
             SVHG+GPSIAIFDT+ DG+LDC CVYPSPLHSREQM ELV+ MK ILI+  K
Sbjct  410   SVHGLGPSIAIFDTIRDGRLDCVCVYPSPLHSREQMQELVNNMKAILIEGGK  461



>ref|XP_006430166.1| hypothetical protein CICLE_v10011628mg [Citrus clementina]
 gb|ESR43406.1| hypothetical protein CICLE_v10011628mg [Citrus clementina]
Length=478

 Score =   466 bits (1200),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 255/467 (55%), Positives = 324/467 (69%), Gaps = 19/467 (4%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNAA  1423
             R VGGTE+ WC+AV  GTGITVLA L+S K  +   L+ AL+ + N HPILRSKL   A 
Sbjct  18    RPVGGTEYSWCKAVPTGTGITVLALLLS-KHPNIQRLQTALNNLQNNHPILRSKLHSGAD  76

Query  1422  TKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAWRN  1243
              K FSF     P IQI   D  ST Q +  +T +         F +ILEHEL+ N  W N
Sbjct  77    AKTFSFITPPEPHIQIQHLDISSTSQTISDKTGAVSP------FQLILEHELNRNT-WTN  129

Query  1242  PA--SFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLK  1069
             P+  S   S +++   S+Y  P E   V+ LR HT++CDR + V++L EL+ LM      
Sbjct  130   PSHQSNTNSDSNLFNVSIYT-PSETQWVVTLRLHTSICDRASAVAVLKELLRLMTGREEG  188

Query  1068  GIKNE----GEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHS  901
             GI+ E    GE S GIE  +PS K+ K  WA G+DMLGYS+NS RL+N+ F D   PR S
Sbjct  189   GIEKEYDRKGEVSLGIEEFIPSGKANKPFWARGVDMLGYSLNSLRLSNISFVDADSPRFS  248

Query  900   LVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTL  721
              V++LQLN   T R++ GCKS GIKLCG L AAGL+AA S++    H   Q++KY VVTL
Sbjct  249   QVLRLQLNRDETGRLVEGCKSRGIKLCGALAAAGLIAARSTKYFPSH---QREKYAVVTL  305

Query  720   TDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMA  541
              DCRSIL+P LS  + GFYHSAILN H V G E LW++A RSY++F N+K ++KHF+DM 
Sbjct  306   VDCRSILEPVLSDDYLGFYHSAILNTHDVNGEEELWELATRSYTSFANAKNSDKHFTDMN  365

Query  540   DLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVG  361
             DLNFLMCKAIDNPGLT +SSLR+AVI+VFE+P+V D +  + +E+G+EDY+GCSSVHGVG
Sbjct  366   DLNFLMCKAIDNPGLTPASSLRTAVISVFEDPIV-DETNKLHQEIGLEDYIGCSSVHGVG  424

Query  360   PSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDATKF  220
             PSIAIFDT+ DG LDCACVYPSPLHSREQ+ +L+D+MK+IL++   F
Sbjct  425   PSIAIFDTIRDGWLDCACVYPSPLHSREQLQQLIDDMKKILVEGGSF  471



>ref|XP_009336970.1| PREDICTED: uncharacterized protein LOC103929485 [Pyrus x bretschneideri]
Length=477

 Score =   465 bits (1196),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 258/470 (55%), Positives = 333/470 (71%), Gaps = 18/470 (4%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R VGGTE  WC+AV  GTGITVLA L+S +  +   L+ ALH + N+HPILRSK +++
Sbjct  18    KTRPVGGTELSWCKAVPSGTGITVLALLLS-RPPNFSNLQTALHNLQNSHPILRSKHQFD  76

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
              AT  +SF    TP +QI PFD PST  IL+       +  + +P H ILEHE+++N  W
Sbjct  77    PATGTYSFLTPPTPHLQIQPFDLPSTAPILQ------INPDNIAPLHQILEHEMNSNT-W  129

Query  1248  RNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLK  1069
             +N      S  DV++AS YA+  E   V+ LR HTA CDR   V++L EL+  ++     
Sbjct  130   QNLDPSLESDTDVMYASTYAI-SESRWVLVLRLHTAACDRAAAVAVLKELLGELKSTGGG  188

Query  1068  G----IKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHS  901
             G    +K +GE S GIE+++P+ K+ K  WA G+DMLGYS+NS RL+NL+F D    R S
Sbjct  189   GAERELKGDGEVSLGIEDLIPNGKANKPFWARGVDMLGYSLNSLRLSNLEFQDASAERRS  248

Query  900   LVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTL  721
              VVKLQL+   T R+LAGCKS  IKLCG L AAG++AA +S+   DH   Q +KYGVVTL
Sbjct  249   QVVKLQLSPEDTDRLLAGCKSRDIKLCGALAAAGMIAARASKQLPDH---QWEKYGVVTL  305

Query  720   TDCRSILDPPLSSHHYGFYHSAILNMHTVKG-GERLWDMAKRSYSAFENSKKTNKHFSDM  544
              DCR ILDPPLS +H GFYHSAI+N H + G G  LWD+AKR Y +F  +K +NKHF+DM
Sbjct  306   LDCRPILDPPLSINHLGFYHSAIMNTHDINGEGNTLWDLAKRCYMSFAGAKNSNKHFTDM  365

Query  543   ADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGV  364
             ADLNFLMCKAI+NPGLT SS++R+A I+VFE+ V+ D S+++ +ELGVEDY GC+SVHGV
Sbjct  366   ADLNFLMCKAIENPGLTPSSAMRTAFISVFEDTVI-DESSEVNKELGVEDYEGCASVHGV  424

Query  363   GPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDATKFID  214
             GPSIAIFDT+ DG L+CAC+YPSPLHSREQM +L+D MK IL+D  K ++
Sbjct  425   GPSIAIFDTIRDGCLNCACIYPSPLHSREQMQDLMDRMKSILVDGCKDVE  474



>ref|XP_009342999.1| PREDICTED: uncharacterized protein LOC103934958 [Pyrus x bretschneideri]
Length=477

 Score =   464 bits (1193),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 260/470 (55%), Positives = 332/470 (71%), Gaps = 18/470 (4%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R VGGTE  WC+AV  GTGITVLA L+S +  +   L+ ALH + N+HPILRSK +++
Sbjct  18    KTRPVGGTELSWCKAVPSGTGITVLALLLS-RPPNFSNLQTALHNLQNSHPILRSKHQFD  76

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
              AT  +SF    TP +QI PFD PST  IL+       +  + +P H ILEHE++ N  W
Sbjct  77    PATGNYSFLTPPTPHLQIQPFDLPSTAPILQ------INPDNIAPLHQILEHEMNLNT-W  129

Query  1248  RNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLK  1069
             +N      S  DV++AS YA+  E   V+ LR HTA CDR   V++L EL+  ++     
Sbjct  130   QNLDPSLESDTDVMYASTYAI-SESRWVLVLRLHTAACDRAAAVAVLKELLGELKSTGGG  188

Query  1068  G----IKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHS  901
             G    +K +GE S GIE+++P+ K+ K  WA G+DMLGYS+NS RL+NL+F D    R S
Sbjct  189   GAERELKGDGEVSLGIEDLIPNGKANKPFWARGVDMLGYSLNSLRLSNLEFQDASAERRS  248

Query  900   LVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTL  721
              VVKLQL+   T R+LAGCKS  IKLCG L AAG++AA +S+   DH   Q +KYGVVTL
Sbjct  249   QVVKLQLSPEDTDRLLAGCKSRDIKLCGALAAAGMIAARASKQLPDH---QWEKYGVVTL  305

Query  720   TDCRSILDPPLSSHHYGFYHSAILNMHTVKG-GERLWDMAKRSYSAFENSKKTNKHFSDM  544
              DCR ILDPPLS +H GFYHSAI+N H + G G  LWD+AKR Y +F  +K +NKHF+DM
Sbjct  306   LDCRPILDPPLSINHLGFYHSAIMNTHDINGEGNTLWDLAKRCYMSFAGAKNSNKHFTDM  365

Query  543   ADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGV  364
             ADLNFLMCKAI+NPGLT SS++R+A I+VFE+ V+ D S+++ +ELGVEDY GC+SVHGV
Sbjct  366   ADLNFLMCKAIENPGLTPSSAMRTAFISVFEDTVI-DESSEVNKELGVEDYEGCASVHGV  424

Query  363   GPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDATKFID  214
             GPSIAIFDTV DG L+CACVYPSPLHSREQM +L+D MK IL+D  K ++
Sbjct  425   GPSIAIFDTVRDGCLNCACVYPSPLHSREQMQDLMDRMKSILVDGCKDVE  474



>ref|XP_010059639.1| PREDICTED: uncharacterized protein LOC104447615 [Eucalyptus grandis]
 gb|KCW90535.1| hypothetical protein EUGRSUZ_A02649 [Eucalyptus grandis]
Length=488

 Score =   462 bits (1188),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 253/475 (53%), Positives = 324/475 (68%), Gaps = 23/475 (5%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNAA  1423
             R VGGTE+ WCRAV GGTGITVLA L++ K  D  LLRNALH +  +HPILRS++R++ A
Sbjct  19    RPVGGTEYSWCRAVPGGTGITVLALLLA-KPPDLSLLRNALHGLQKSHPILRSRIRFDPA  77

Query  1422  TKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvsp-----------sPFHIILE  1276
               AFSF I ++P ++I PFD  ST +IL        +               +P H ILE
Sbjct  78    ANAFSFVIPSSPHLEIAPFDLSSTSRILNGEDGGGGEGEGGGAGGEGDAAGATPLHRILE  137

Query  1275  HELSNNAAWRNPASFPPSGAD----VLFASLYALPEEGGHVMALRFHTAVCDRTTVVSll  1108
             HE++ NA WR+       G      V  ASLY L E+    +ALR HT  CDR    +LL
Sbjct  138   HEMNRNA-WRDSGGGGDDGDGAGTDVFHASLYHLSEDRW-ALALRLHTGACDRAAAAALL  195

Query  1107  gelmelmregtLKGIKNE--GEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNL  934
               L+ +  E      + E   + + GIE ++PS K+ K  WA G+D+LGYS+NSFRL +L
Sbjct  196   RRLLLVAAEEGRDRDREEEAADANRGIEELIPSGKANKPFWARGMDLLGYSLNSFRLAHL  255

Query  933   KFNDVKGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQ  754
             +F D + PR S +++L++N   T R++ GCKS  IKLCGVL AA L+AAH+S+ Q   +Q
Sbjct  256   EFVDAESPRCSRMMRLKMNREDTQRLIEGCKSREIKLCGVLAAAALIAAHTSKQQPTDNQ  315

Query  753   QQKKKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENS  574
              +K  Y VVTL DCRS L+PPLS  H GFYHSAILN H + G E+LWD+AKR+Y+AF N+
Sbjct  316   WEK--YAVVTLVDCRSYLNPPLSVQHPGFYHSAILNTHDISGSEKLWDLAKRTYTAFANA  373

Query  573   KKTNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVED  394
             K  NKHF+DM DLNFLMCKAIDNPGLT SSSLR+A ++VFE+  V+D S  +  E+GV D
Sbjct  374   KNWNKHFTDMGDLNFLMCKAIDNPGLTVSSSLRTAFVSVFED-TVFDESNPLHEEIGVRD  432

Query  393   YVGCSSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDA  229
             Y+GC+SVHG+GPSIA FDT+ DG+LDCAC YPSPLHSREQM +L+D+MKRIL DA
Sbjct  433   YIGCASVHGIGPSIAFFDTIRDGELDCACAYPSPLHSREQMQKLIDDMKRILADA  487



>ref|XP_011077851.1| PREDICTED: uncharacterized protein LOC105161749 [Sesamum indicum]
Length=468

 Score =   461 bits (1186),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 258/476 (54%), Positives = 331/476 (70%), Gaps = 15/476 (3%)
 Frame = -3

Query  1641  MSVRKGADENNKERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNA  1462
             +S R   D   K R  G TE  WC+AV GGTGITVLA L+  K  D   L+NAL K+  +
Sbjct  3     LSPRSVHDAEPKIRPAGTTELSWCKAVPGGTGITVLALLLC-KPLDIPFLQNALRKLQIS  61

Query  1461  HPILRSKLRYNAATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHII  1282
             HPI+ SKLR+++ +  FS+    TP I++ PFD PST QIL ++    ++  S SPFH+I
Sbjct  62    HPIINSKLRFDSVSNTFSYVTPPTPHIRVQPFDLPSTSQILEAQ--FPEESNSVSPFHLI  119

Query  1281  LEHELSNNAAWRNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllge  1102
             LEHEL+ N+ W+NP   P S  DV FASLY L E+   V+ALR HT+ CDR   ++LL E
Sbjct  120   LEHELNTNS-WQNPD--PSSDTDVFFASLYTL-EKSKWVLALRLHTSACDRAAALALLRE  175

Query  1101  lm----elmregtLKGIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNL  934
             LM    E   EG       E E S GIE  +PS +  K  WA G+DMLGYS+NS RL NL
Sbjct  176   LMGLVGEGEGEGVETEQGKEMEVSLGIEEYIPSGQGNKPFWARGVDMLGYSLNSLRLANL  235

Query  933   KFNDVKGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQ  754
              F D + PR S  ++LQ+N   T RIL+ C+   IKLC +L AA L+A+HSS+   D + 
Sbjct  236   SFKDTESPRMSRFIRLQMNTEDTCRILSSCERQEIKLCALLAAAALIASHSSKGIPDDYW  295

Query  753   QQKKKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENS  574
             +   KY VVTL DCR ILDP LSS+H GFYHSAILN H +KGGE LW++AKR +++F N+
Sbjct  296   E---KYAVVTLMDCRPILDPVLSSNHVGFYHSAILNTHDIKGGEDLWELAKRVHTSFTNA  352

Query  573   KKTNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVED  394
             K   KHFSDMAD+NFLMCKAI+NPGLT S SLR++++++FE+ V+ D S  + + +G+ED
Sbjct  353   KNNKKHFSDMADINFLMCKAIENPGLTPSGSLRTSLVSIFEDCVIDD-SNKLHQVIGLED  411

Query  393   YVGCSSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDAT  226
             +VGC+SVHGVGPSIAIFDT+ DGK+D ACV+P PLHSREQM EL+DE+KRIL+D T
Sbjct  412   FVGCASVHGVGPSIAIFDTIRDGKMDSACVFPFPLHSREQMQELIDELKRILLDGT  467



>ref|XP_003625849.1| hypothetical protein MTR_7g104960 [Medicago truncatula]
 gb|ABD32680.1| hypothetical protein MtrDRAFT_AC150442g12v2 [Medicago truncatula]
Length=460

 Score =   458 bits (1178),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 248/470 (53%), Positives = 331/470 (70%), Gaps = 21/470 (4%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R VGGTE  WC+A+ GGTGI VL+ L++ K  D    + +LHK+ N+HPILRSKL  +
Sbjct  7     KGRNVGGTECSWCKAIRGGTGIAVLSLLIT-KPIDISRFQTSLHKLQNSHPILRSKLHTS  65

Query  1428  AATKAFSFA--ISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNA  1255
             +++   +F+   S TP I+I   +   T  IL     + +D VS SP   I+EHEL+ N 
Sbjct  66    SSSTDTTFSFLTSHTPFIKIESHNINVTSNIL---AKNKNDTVSISPLQQIMEHELNRNT  122

Query  1254  AWRNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregt  1075
              W++         D+  AS+YA+P+E   V+ +R H A CDRTT VSLL EL+ LM++  
Sbjct  123   -WQDRTGID---TDMFVASIYAMPDEKTWVVVMRLHVAACDRTTAVSLLRELLVLMKDEE  178

Query  1074  LKGIKNEGEGS--FGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHS  901
              +      E      IE++VP  K KK +WA G+D+L YSVNSFR TNLKFND K  R S
Sbjct  179   KEENVVVVEDVVPLAIEDLVPGRKGKKHIWARGLDVLSYSVNSFRFTNLKFNDTKNARFS  238

Query  900   LVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTL  721
              VV++QLN   T R+L GCK + IKLCG +TAAGLMAAHS+++         KKYG++TL
Sbjct  239   QVVRMQLNQTDTKRVLDGCKQSRIKLCGAITAAGLMAAHSNKTN------SSKKYGIITL  292

Query  720   TDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMA  541
             TDCRS LDPPLS+H++GFYH+AILN H +KGGE LW++AKR+Y AF NSK  +KHF+DMA
Sbjct  293   TDCRSTLDPPLSNHNFGFYHAAILNNHVIKGGESLWELAKRTYGAFANSKNNDKHFTDMA  352

Query  540   DLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVG  361
             D+NFLM KAI+NPGLT  SSLR+++++VFE+ VV D    +Q+E+GVEDY+GC+SVHG+G
Sbjct  353   DMNFLMSKAIENPGLT--SSLRTSIMSVFEDTVVDD-DGMMQQEVGVEDYMGCASVHGLG  409

Query  360   PSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDATKFIDD  211
             PS+ IFDT+ DG+LDC CVYP+PLH+REQM EL+++MK ILI+  K  ++
Sbjct  410   PSMGIFDTIRDGRLDCVCVYPAPLHAREQMQELINKMKAILIEGGKTYEE  459



>ref|XP_002276400.1| PREDICTED: uncharacterized protein LOC100257880 [Vitis vinifera]
Length=465

 Score =   458 bits (1178),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 260/460 (57%), Positives = 324/460 (70%), Gaps = 9/460 (2%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R  GGTE+ WC+AV GGTGIT LA L+S KA D  LL+ ALHK+ NA+PILRSKL ++
Sbjct  10    KGRAAGGTEYSWCKAVPGGTGITALAILLS-KAPDFSLLQAALHKLQNAYPILRSKLHFD  68

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
               T AFSF  +  P +Q+  FD  ST  IL+  T  D +  S SPFH I EH+L+ N  W
Sbjct  69    PKTNAFSFFTTQNPYLQLETFDLSSTFGILQ--TLPDPETDSVSPFHRIFEHQLNLNT-W  125

Query  1248  RNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLK  1069
              NP     +  D+ FAS+Y L  +   V+ LR HTA CDRT+ V+LL +L+ LM  G  K
Sbjct  126   HNPDPSSNTETDLFFASVYTLSNDE-WVVTLRLHTAACDRTSAVALLRKLLALMGGGREK  184

Query  1068  GIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLVVK  889
              ++ E E S GIE+++P+ K+ K  WA G++MLGYS+NSFRL+NL F D   PR S VV+
Sbjct  185   ELEKETELSLGIEDMIPNGKANKPFWARGVNMLGYSLNSFRLSNLNFIDANSPRSSEVVR  244

Query  888   LQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTDCR  709
             L L   HT+ I A C+S  IKLCG L AA L+AAH+S    D    +  KYGVVTL DCR
Sbjct  245   LHLPADHTALITAACESREIKLCGALAAAALIAAHASNHLPD---GRWAKYGVVTLIDCR  301

Query  708   SILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADLNF  529
             SILDP L S H GFYHSAILN H V G E LW++A+R+Y ++ N K  NKHFSDMADLNF
Sbjct  302   SILDPVLPSDHIGFYHSAILNTHDVNGSETLWELARRTYGSYANDKNYNKHFSDMADLNF  361

Query  528   LMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPSIA  349
             LMC+AI+NPGLT S SLR+++++VFE+  V D S  + +E+GV+DYVGC S HGVGPSIA
Sbjct  362   LMCRAIENPGLTPSGSLRTSLVSVFED-CVMDESNQLYQEMGVKDYVGCGSAHGVGPSIA  420

Query  348   IFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDA  229
             +F T+ DG+LDCACVYPSPLHSREQM ELVD MKR+L+D 
Sbjct  421   LFHTIRDGQLDCACVYPSPLHSREQMLELVDAMKRVLVDG  460



>emb|CAN71367.1| hypothetical protein VITISV_014691 [Vitis vinifera]
Length=465

 Score =   456 bits (1174),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 260/460 (57%), Positives = 324/460 (70%), Gaps = 9/460 (2%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R  GGTE+ WC+AV GGTGIT LA L+S KA D  LL+ ALHK+ NA+PILRSKL ++
Sbjct  10    KGRAAGGTEYSWCKAVPGGTGITALAILLS-KAPDFSLLQAALHKLQNAYPILRSKLHFD  68

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
               T AFSF  +  P +Q+  FD  ST  IL+  T  D +  S SPFH I EH+L+ N  W
Sbjct  69    PKTNAFSFFTTQNPYLQLETFDLSSTSGILQ--TLPDPETDSVSPFHRIFEHQLNLNT-W  125

Query  1248  RNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLK  1069
              NP     +  D+ FAS+Y L  +   V+ LR HTA CDRT+ V+LL +L+ LM  G  K
Sbjct  126   HNPDPSSNTETDLFFASVYTLSNDEW-VVTLRLHTAACDRTSAVALLRKLLALMGGGREK  184

Query  1068  GIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLVVK  889
              ++ E E S GIE+++P+ K+ K  WA G++MLGYS+NSFRL+NL F D   PR S VV+
Sbjct  185   ELEKETELSLGIEDMIPNGKANKPFWARGVNMLGYSLNSFRLSNLNFIDANSPRSSEVVR  244

Query  888   LQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTDCR  709
             L L   HT+ I A C+S  IKLCG L AA L+AAH+S    D    +  KYGVVTL DCR
Sbjct  245   LHLPADHTALITAACESREIKLCGALAAAALIAAHASNHLPD---GRWAKYGVVTLIDCR  301

Query  708   SILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADLNF  529
             SILDP L S H GFYHSAILN H V G E LW++A+R+Y ++ N K  NKHFSDMADLNF
Sbjct  302   SILDPVLPSDHIGFYHSAILNTHDVNGSETLWELARRTYGSYANDKNYNKHFSDMADLNF  361

Query  528   LMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPSIA  349
             LMC+AI+NPGLT S SLR+++++VFE+  V D S  + +E+GV+DYVGC S HGVGPSIA
Sbjct  362   LMCRAIENPGLTPSGSLRTSLVSVFED-CVMDESNQLYQEMGVKDYVGCGSAHGVGPSIA  420

Query  348   IFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDA  229
             +F T+ DG+LDCACVYPSPLHSREQM ELVD MKR+L+D 
Sbjct  421   LFHTIRDGQLDCACVYPSPLHSREQMLELVDAMKRVLVDG  460



>ref|XP_010245489.1| PREDICTED: uncharacterized protein LOC104589017 isoform X1 [Nelumbo 
nucifera]
Length=496

 Score =   457 bits (1175),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 265/498 (53%), Positives = 324/498 (65%), Gaps = 54/498 (11%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R VGGTE+ WCRAV GGTGITV+A L+S  A +   L+NAL+K+ N+HPILRSKL +N
Sbjct  9     KGRPVGGTEYSWCRAVPGGTGITVVALLLS-GALEPSSLQNALNKLQNSHPILRSKLTHN  67

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
             A T +FSF IS TP +QI  FD   T  +L S         S SPFH I+EHEL+ N  W
Sbjct  68    ATTNSFSFTISPTPYLQIQSFDVSFTSHLLHSN-------HSVSPFHRIVEHELNQNP-W  119

Query  1248  RNPASFPP--SGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelm---elmr  1084
                   PP     DV FASLYALP+    V+ LR HT+VCDR + VSLL EL+       
Sbjct  120   SAEDLQPPVHPETDVFFASLYALPDRKW-VVTLRLHTSVCDRRSAVSLLNELLGLIAGEG  178

Query  1083  egtLKGIKNE----GEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVK  916
             +   KGI+ E     E S GIE ++PS K+ K  WA G+D+LGYS+NSFR  NL F D  
Sbjct  179   KEDKKGIEQEVGKEDEVSLGIEALIPSGKANKPFWARGVDLLGYSLNSFRFVNLDFKDTT  238

Query  915   GP-RHSLVVKLQLNLHHTSRILA------------------------------GCKSAGI  829
                R S VV LQ++   T R+L                                CK+  I
Sbjct  239   ASLRSSEVVSLQMDPDETRRLLTFHGSTFHLQFEDRMERRRRSSVLGTGLLDNACKARDI  298

Query  828   KLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTDCRSILDPPLSSHHYGFYHSAIL  649
             KLCG L AA L+AA SSR   D   QQ++KY  V L DCR++LDPPL  +H GFYHSAIL
Sbjct  299   KLCGALAAAALIAARSSR---DLPDQQQEKYATVILIDCRNLLDPPLQYNHLGFYHSAIL  355

Query  648   NMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADLNFLMCKAIDNPGLTASSSLRSA  469
             N H +KGGE LW++A+R Y +  NS K+NKHFSDM DLNFLMCKAIDNP LT SSS+R++
Sbjct  356   NTHDIKGGEDLWELAERCYMSLSNSMKSNKHFSDMGDLNFLMCKAIDNPRLTPSSSMRTS  415

Query  468   VITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPSIAIFDTVIDGKLDCACVYPSPL  289
             +I+VFE+PV  D + ++  E+GVEDY+ CSSVHGVGPSIA+FD + DG+LDCACVYPSPL
Sbjct  416   LISVFEDPVTDDFN-ELHHEIGVEDYISCSSVHGVGPSIAVFDRLRDGRLDCACVYPSPL  474

Query  288   HSREQMHELVDEMKRILI  235
             HSREQM ELVD MKR+L+
Sbjct  475   HSREQMLELVDNMKRMLV  492



>emb|CBI30315.3| unnamed protein product [Vitis vinifera]
Length=441

 Score =   453 bits (1165),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 250/460 (54%), Positives = 310/460 (67%), Gaps = 33/460 (7%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R  GGTE+ WC+AV GGTGIT LA L+S KA D  LL+ ALHK+ NA+PILRSKL ++
Sbjct  10    KGRAAGGTEYSWCKAVPGGTGITALAILLS-KAPDFSLLQAALHKLQNAYPILRSKLHFD  68

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
               T AFSF  +  P +Q+  FD  ST  IL+  T  D +  S SPFH I EH+L+ N  W
Sbjct  69    PKTNAFSFFTTQNPYLQLETFDLSSTFGILQ--TLPDPETDSVSPFHRIFEHQLNLNT-W  125

Query  1248  RNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLK  1069
              NP     +  D+ FAS+Y L  +   V+ LR HTA CDRT+ +S               
Sbjct  126   HNPDPSSNTETDLFFASVYTLSNDEW-VVTLRLHTAACDRTSALS---------------  169

Query  1068  GIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLVVK  889
                       GIE+++P+ K+ K  WA G++MLGYS+NSFRL+NL F D   PR S VV+
Sbjct  170   ---------LGIEDMIPNGKANKPFWARGVNMLGYSLNSFRLSNLNFIDANSPRSSEVVR  220

Query  888   LQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTDCR  709
             L L   HT+ I A C+S  IKLCG L AA L+AAH+S    D    +  KYGVVTL DCR
Sbjct  221   LHLPADHTALITAACESREIKLCGALAAAALIAAHASNHLPD---GRWAKYGVVTLIDCR  277

Query  708   SILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADLNF  529
             SILDP L S H GFYHSAILN H V G E LW++A+R+Y ++ N K  NKHFSDMADLNF
Sbjct  278   SILDPVLPSDHIGFYHSAILNTHDVNGSETLWELARRTYGSYANDKNYNKHFSDMADLNF  337

Query  528   LMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPSIA  349
             LMC+AI+NPGLT S SLR+++++VFE+  V D S  + +E+GV+DYVGC S HGVGPSIA
Sbjct  338   LMCRAIENPGLTPSGSLRTSLVSVFED-CVMDESNQLYQEMGVKDYVGCGSAHGVGPSIA  396

Query  348   IFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDA  229
             +F T+ DG+LDCACVYPSPLHSREQM ELVD MKR+L+D 
Sbjct  397   LFHTIRDGQLDCACVYPSPLHSREQMLELVDAMKRVLVDG  436



>ref|XP_010271627.1| PREDICTED: uncharacterized protein LOC104607647 [Nelumbo nucifera]
Length=478

 Score =   454 bits (1168),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 255/464 (55%), Positives = 323/464 (70%), Gaps = 14/464 (3%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R  G TE  WCR V GGTGITVLA L+S KA D   L+ ALH++  +HPILRSKL ++
Sbjct  19    KGRPAGVTESSWCRGVVGGTGITVLALLLS-KAPDVSALQTALHRLQTSHPILRSKLSHD  77

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
             AAT  FSF I +T  +Q+  FDA ST  +L+ R  +       SPFH ILEHEL+ N  W
Sbjct  78    AATNTFSFIIPSTSHLQLESFDATSTSHLLK-RLPTSASDHLVSPFHRILEHELNRNP-W  135

Query  1248  RNPASFPPSGAD--VLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregt  1075
              +         D  V FASLYALP+    V+ALR HT+VCDRT+ V+LL EL+ + +E  
Sbjct  136   SSSKQEHHKHPDTAVFFASLYALPDNNW-VLALRLHTSVCDRTSAVTLLRELLVVAKEVK  194

Query  1074  LKGIKNE----GEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPR  907
                +K E    GE +  IE +VP  K+ K LWAHG+D+L YS+ S R +N+ F D   PR
Sbjct  195   EGQLKGEQGKRGEFNVAIEELVPRGKANKTLWAHGVDLLAYSLKSLRFSNMDFKDSIAPR  254

Query  906   HSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVV  727
              S VV+LQ+    T R++A C++ GIKLCG L AAGLMAAH S++  DH   Q++KY V 
Sbjct  255   SSEVVRLQMKPDETRRLVAACEARGIKLCGALAAAGLMAAHLSKNLRDH---QREKYAVA  311

Query  726   TLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSD  547
             TL DCRS+L+PPL S + GFYHSA+ +   +KGG+ LW++A +   +   S KTNKHFSD
Sbjct  312   TLMDCRSLLEPPLQSCNLGFYHSALQHTFDIKGGKDLWELATKFCMSLSKSIKTNKHFSD  371

Query  546   MADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHG  367
             M DLNFLMCKAIDNP LT SS+LR AV++VFE+PV+ D S +  R++G+EDY+GCSSVHG
Sbjct  372   MDDLNFLMCKAIDNPRLTPSSALRLAVLSVFEDPVI-DASNESYRDIGLEDYMGCSSVHG  430

Query  366   VGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILI  235
              GPSIA+FDT+ DG+LDCACVYPSPLHSREQM EL+D MKRIL+
Sbjct  431   AGPSIAVFDTIRDGRLDCACVYPSPLHSREQMQELIDNMKRILV  474



>ref|XP_010683704.1| PREDICTED: uncharacterized protein LOC104898342 [Beta vulgaris 
subsp. vulgaris]
Length=467

 Score =   449 bits (1156),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 247/466 (53%), Positives = 327/466 (70%), Gaps = 16/466 (3%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R + GTE+ WC+A SGGTGIT+L+ L+  K  +  LL N+LHK+  +HPILRSKL +N
Sbjct  10    KTRPISGTENSWCKAASGGTGITILSLLLI-KQPNFTLLHNSLHKLQFSHPILRSKLHFN  68

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
             + +  FS  I ++  +++T  D  ST +I++S   S D   +   F I+LEHEL+ N  W
Sbjct  69    SLSSTFSLLIPSSSTLRLTHHDFQSTAKIIQSNPPSSDPTTT---FQILLEHELNTNP-W  124

Query  1248  RN-PASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtL  1072
              N   S      DVL AS+Y + E G   + ++ HT VCDRT  V+LL EL  LM+    
Sbjct  125   ENLDRSSISCSVDVLHASVYEIDEVGKWAVMIKVHTGVCDRTAAVALLKELTGLMKSSNG  184

Query  1071  KGIKNEG------EGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGP  910
              G  +E       E S G+E  +PS K  K  W+ G+DMLGYS+NSFRL+NL+F D    
Sbjct  185   GGDLDESGEIKEREVSLGVEEYIPSGKMSKPFWSRGVDMLGYSLNSFRLSNLEFVDPDSR  244

Query  909   RHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGV  730
             R S VV+L L+  HTS++L GCK+ GIKLCG L+AA L+AA +S+S  D    + +KY V
Sbjct  245   RSSRVVRLMLDSDHTSKLLEGCKTRGIKLCGALSAAALIAARASKSLTD---GEWEKYAV  301

Query  729   VTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFS  550
             VTL DCR +L+P LSSHH GFYHSAILN H +KG E LWD+A+R+YS+FE++K +NKHFS
Sbjct  302   VTLIDCRKLLEPALSSHHVGFYHSAILNTHDMKGSEDLWDLARRTYSSFEDAKNSNKHFS  361

Query  549   DMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVH  370
             DMADLNFLMC+AI+NPGLT SSSLR++ I+VFE+PV+ + + + + ELG+ED +GC+S H
Sbjct  362   DMADLNFLMCRAIENPGLTPSSSLRTSFISVFEDPVIDETNENYE-ELGIEDCMGCASTH  420

Query  369   GVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILID  232
             GVGPSIAIFDT+   KLDCACVYP PLHSR+QM +L++ MK+ILID
Sbjct  421   GVGPSIAIFDTIRQNKLDCACVYPFPLHSRKQMQDLIENMKKILID  466



>ref|XP_007027791.1| GATA zinc finger domain-containing protein C1393.08 isoform 1 
[Theobroma cacao]
 gb|EOY08293.1| GATA zinc finger domain-containing protein C1393.08 isoform 1 
[Theobroma cacao]
Length=478

 Score =   449 bits (1154),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 253/467 (54%), Positives = 319/467 (68%), Gaps = 19/467 (4%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R  GGTE+ WCRAV GGTGITVL+ L+S    D  LL  AL ++  +HPILRS+L ++
Sbjct  16    KVRPAGGTEYSWCRAVPGGTGITVLSLLLS-NPPDISLLEAALCRLQVSHPILRSRLHFD  74

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
                  FSF     P  +I  FD PST  IL+S +   +          +LEHEL+ N+ W
Sbjct  75    TCRNTFSFITHRNPHAKIQSFDLPSTSHILQSLSGDPNIDS----HQFLLEHELNRNS-W  129

Query  1248  RNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLK  1069
               P     +  DV F SLY L  E   V+  R HT+ CDR   V+LL EL+EL+  G  K
Sbjct  130   NLPDG-DQADRDVFFVSLYTL-SETRWVVVFRLHTSACDRAAAVALLKELLELVGGGRSK  187

Query  1068  -------GIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGP  910
                      + E E S GIE+++PS K+ K  WA G+DMLGYS+NSFRL NL F D    
Sbjct  188   VEEIAKGNDEKEVELSLGIEDLIPSGKANKPFWARGVDMLGYSLNSFRLANLNFVDANSA  247

Query  909   RHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGV  730
             R S VV+LQ+N   T  ++AGCKS GIKLCG L AAGL+AA S+++  +H   Q++KY V
Sbjct  248   RRSQVVRLQMNPDETDGLVAGCKSRGIKLCGALAAAGLIAARSTKAYPEH---QREKYAV  304

Query  729   VTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFS  550
             VTLTDCRSILDP L S+H GFYHSAILN H V   E++W++A+R Y +F N+K  +KHF+
Sbjct  305   VTLTDCRSILDPVLGSNHLGFYHSAILNTHDVTAHEQVWELARRCYMSFSNAKNNDKHFT  364

Query  549   DMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVH  370
             DM DLNFLMCKAIDNPGLTASSS+R+A I+VFE+PV+ D S ++ +++G+ DYVGCSSVH
Sbjct  365   DMNDLNFLMCKAIDNPGLTASSSMRTAFISVFEDPVI-DESNELHQKIGLVDYVGCSSVH  423

Query  369   GVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDA  229
             GVGPS+AIFDT+ DG LDCACVYP+PLHSREQM +L+D MK IL DA
Sbjct  424   GVGPSLAIFDTIQDGCLDCACVYPAPLHSREQMQQLIDSMKSILADA  470



>gb|KHN42802.1| hypothetical protein glysoja_036976 [Glycine soja]
Length=444

 Score =   447 bits (1149),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 248/471 (53%), Positives = 301/471 (64%), Gaps = 44/471 (9%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R VG TE  WC+AV GGTGI VLA L S K  D   L+ +L  +  +HPIL S+L+ N
Sbjct  5     KSRTVGNTERSWCQAVRGGTGIAVLALLTS-KPPDIPKLQTSLRTLQTSHPILSSRLQTN  63

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
             A T  FSF  S TP I+I                          P   ILE EL+ N+ W
Sbjct  64    ATT--FSFLTSPTPSIKIL---------------TLTLPTNLTDPLTQILELELNRNS-W  105

Query  1248  RNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSll---------gelm  1096
             ++         +V FA+LYA P     V+ALR H + CDRTT + LL             
Sbjct  106   QD-------SENVFFATLYAGPSTNTWVVALRLHVSACDRTTALLLLRELLTLTEENNNT  158

Query  1095  elmregtLKGIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVK  916
                +         E E S  IE++VP  K KK +W  G+DML YS+NSFRLTNLKF D K
Sbjct  159   ASEQNNLANQCPKEKEMSLAIEDLVPRGKGKKSMWTRGLDMLAYSLNSFRLTNLKFVDAK  218

Query  915   GPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKY  736
              PR S VV+LQLN + T  +LAGCK +GIKLCG L AAGLMAAH S+       +  + Y
Sbjct  219   NPRFSQVVRLQLNQNDTKEVLAGCKWSGIKLCGALVAAGLMAAHCSK-------RSSRNY  271

Query  735   GVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKH  556
             GVVTLTDCRS L+  L+ + +GFYHSAILN H +KGGE LWD+AKR+Y  F NSKK NKH
Sbjct  272   GVVTLTDCRSSLESSLTDN-FGFYHSAILNSHEMKGGETLWDLAKRAYEEFANSKKCNKH  330

Query  555   FSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSS  376
             FSDMADLNFLMCKAI+NPGLT SSSLR+++++VFE+ V+ D     QRE+GVEDY+GC+S
Sbjct  331   FSDMADLNFLMCKAIENPGLTPSSSLRTSIMSVFEDTVI-DNGGKNQREVGVEDYMGCAS  389

Query  375   VHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDATK  223
             VHGVG SIAIFDT+ DG LDC CVYP+PLHSREQM ELV +MK IL++  K
Sbjct  390   VHGVGSSIAIFDTIRDGSLDCVCVYPTPLHSREQMLELVGKMKVILMEGAK  440



>gb|KHN42803.1| hypothetical protein glysoja_036977, partial [Glycine soja]
Length=447

 Score =   446 bits (1147),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 239/456 (52%), Positives = 321/456 (70%), Gaps = 20/456 (4%)
 Frame = -3

Query  1593  GGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNAATKA  1414
             GGTE  WC+AV  GTG+TVL+ L+S K     +++NALHK+ N+HPILRSK+  + +   
Sbjct  1     GGTEFSWCKAVPIGTGVTVLSLLLS-KPPQIAVVQNALHKLQNSHPILRSKIHLDPSNNT  59

Query  1413  FSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAWRNPAS  1234
             F F    TP +QI PFD  ST  I++ ++D  D       FH++LEHE++    WR+ A+
Sbjct  60    FHFLTPPTPTVQIHPFDLASTAHIIQCQSDGHDP------FHVLLEHEMNQEDTWRDYAA  113

Query  1233  FPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLKGIKNE  1054
                   DVL A++Y++  +   V  LR HTA CDR   V+LL EL+  +  G    ++  
Sbjct  114   ----DVDVLHAAVYSISHDRFAVF-LRLHTASCDRAAAVALLNELLRFVAGGDEASVEKV  168

Query  1053  GEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLVVKLQLNL  874
                   IE+++P  K+ K  WA G+D+LGY++N+FR  NL F D   PR S +++LQLN+
Sbjct  169   NSP---IEDLIPEGKTNKPFWARGLDVLGYTLNAFRFANLSFVDAGSPRSSRIIRLQLNV  225

Query  873   HHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTDCRSILDP  694
               T  +LAGCKS GIKLCG L AAG++AA +SR   D+   Q++KY VVTL DCRS+LDP
Sbjct  226   AETENLLAGCKSRGIKLCGALAAAGMIAAWTSRCLPDY---QREKYAVVTLVDCRSLLDP  282

Query  693   PLSSHHYGFYHSAILNMHTVKG-GERLWDMAKRSYSAFENSKKTNKHFSDMADLNFLMCK  517
              L S+H GFYHSA+LN H V G  E LW++AK+SY+AF N+   NKHF+DM+DLN+LMCK
Sbjct  283   VLPSNHAGFYHSAVLNTHDVCGETETLWELAKKSYTAFVNAMNCNKHFTDMSDLNYLMCK  342

Query  516   AIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPSIAIFDT  337
             AI+NPGLT SSSLR+A+I+VFE+PV +D SA++  E+G+EDYVGC+S HGVGPSIA+FDT
Sbjct  343   AIENPGLTPSSSLRTALISVFEDPV-FDDSAEMHGEIGLEDYVGCASAHGVGPSIAVFDT  401

Query  336   VIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDA  229
             + +GKLDCAC+YPSPLHSREQ+  LVD MKRIL++ 
Sbjct  402   IRNGKLDCACIYPSPLHSREQIQGLVDHMKRILVEG  437



>ref|XP_007145292.1| hypothetical protein PHAVU_007G226800g [Phaseolus vulgaris]
 gb|ESW17286.1| hypothetical protein PHAVU_007G226800g [Phaseolus vulgaris]
Length=493

 Score =   446 bits (1147),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 245/458 (53%), Positives = 304/458 (66%), Gaps = 33/458 (7%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNAA  1423
             R VG TEH WCRAV GGTGI VLA L + K  D   L+ +L  +  +HPILRS+L +N  
Sbjct  63    RTVGDTEHSWCRAVRGGTGIAVLA-LRTFKPPDISYLQASLRTLQTSHPILRSRLLHNNN  121

Query  1422  TKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAWRN  1243
             T  FSF  S TP I +T    P+ +    ++               ILE EL+ N  W +
Sbjct  122   T--FSFLTSPTPSITLTSLTLPTNVSDPLTQ---------------ILELELNRNT-WHD  163

Query  1242  PASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLKGI  1063
                   +   V FA++Y LP     V+ALR H + CDRTT + LL EL+ LM E    G 
Sbjct  164   S-----TDDQVFFATVYTLPNANTWVVALRLHVSACDRTTALLLLRELLALMDEEHGTGQ  218

Query  1062  KNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLVVKLQ  883
               + E S  IE++V   K KK +W  G+DML YS+NS RL+NLKF D K PR S VV+LQ
Sbjct  219   NQKEEPSLAIEDLVARGKGKKPVWTRGLDMLAYSLNSLRLSNLKFIDAKNPRFSQVVRLQ  278

Query  882   LNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTDCRSI  703
             LN H T  +LAGCK  GIKLCGVL AAGLMA H S+          KKYGVVTLTDCRS 
Sbjct  279   LNQHETKGLLAGCKLRGIKLCGVLVAAGLMATHCSK-------LSSKKYGVVTLTDCRSS  331

Query  702   LDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADLNFLM  523
             L+ PL+ + +GFYHSAILN H +KGGE LW++AKR+Y  F  SK  NKHF+DMADLNFLM
Sbjct  332   LESPLTDN-FGFYHSAILNSHQMKGGETLWELAKRTYQTFTESKNCNKHFADMADLNFLM  390

Query  522   CKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPSIAIF  343
             C+AI+NP LT ++SLR+++++VFEE VV D     QRE+GVEDY+GC+SVHGVGPSIA+F
Sbjct  391   CRAIENPSLTPAASLRTSLMSVFEETVV-DNGGAKQREVGVEDYMGCASVHGVGPSIAVF  449

Query  342   DTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDA  229
             DT+ DG LDC CVYP+PLHSRE + ELV +MK IL++A
Sbjct  450   DTIRDGSLDCVCVYPAPLHSRELVQELVGKMKAILVEA  487



>ref|XP_003518211.1| PREDICTED: uncharacterized protein LOC100781279 [Glycine max]
Length=447

 Score =   442 bits (1138),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 245/471 (52%), Positives = 300/471 (64%), Gaps = 41/471 (9%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R VG TE  WC+AV GGTGI VLA L S K  D   L+ +L  +  +HPIL S+L+ N
Sbjct  5     KSRTVGNTERSWCQAVRGGTGIAVLALLTS-KPPDIPKLQTSLRTLQTSHPILSSRLQTN  63

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
             A T  FSF  S TP I+I                          P   ILE EL+ N+ W
Sbjct  64    ATT--FSFLTSPTPSIKIL---------------TLTLPTNLTDPLTQILELELNRNS-W  105

Query  1248  RNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSll---------gelm  1096
             ++  +      +V F ++YA P     V+ALR H + CDRTT + LL             
Sbjct  106   QDSTT----EENVFFTTIYAGPTTNTWVVALRLHVSACDRTTALLLLRELLTLTEENNNT  161

Query  1095  elmregtLKGIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVK  916
                +         E E S  IE++VP  K KK +W  G+DML YS+NSFRLTNLKF D K
Sbjct  162   ASEQNNLANQCPKEKEMSLAIEDLVPRGKGKKSMWTRGLDMLAYSLNSFRLTNLKFVDAK  221

Query  915   GPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKY  736
              PR S VV+LQLN + T  +LAGCK +GIKLCG L AAGLMAAH S+       +  + Y
Sbjct  222   NPRFSQVVRLQLNQNDTKEVLAGCKWSGIKLCGALVAAGLMAAHCSK-------RSSRNY  274

Query  735   GVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKH  556
             GVVTLTDCRS L+  L+ + +GFYHSAILN H +KGGE LW +AKR+Y  F NSKK NKH
Sbjct  275   GVVTLTDCRSSLESSLTDN-FGFYHSAILNSHEMKGGETLWGLAKRAYEEFANSKKCNKH  333

Query  555   FSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSS  376
             FSDMADLNFLMCKAI+NPGLT SSSLR+++++VFE+ V+ D     QRE+GVEDY+GC+S
Sbjct  334   FSDMADLNFLMCKAIENPGLTPSSSLRTSIMSVFEDTVI-DNGGKNQREVGVEDYMGCAS  392

Query  375   VHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDATK  223
             VHGVG SIAIFDT+ DG LDC CVYP+PLHSREQM ELV +MK IL++  K
Sbjct  393   VHGVGSSIAIFDTIRDGSLDCVCVYPTPLHSREQMLELVGKMKVILMEGAK  443



>ref|XP_002530334.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32050.1| conserved hypothetical protein [Ricinus communis]
Length=474

 Score =   443 bits (1140),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 247/460 (54%), Positives = 321/460 (70%), Gaps = 14/460 (3%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNAA  1423
             R VGGTEH WC+A+  GTGITVL  L+S KA +    + ALH++ ++HPILRSKL ++  
Sbjct  17    RAVGGTEHSWCKAIPAGTGITVLGLLLS-KAPNIPFFQAALHQLQSSHPILRSKLHFDTP  75

Query  1422  TKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsP-FHIILEHELSNNAAWR  1246
             T +FS+    +P +QI  FD PST  I  S T +  D       +H++LEHE++     +
Sbjct  76    TASFSYITPPSPHLQIQFFDLPSTTAIHNSITTTTTDNNDNITPYHLLLEHEMN-----K  130

Query  1245  NPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLKG  1066
             N  S   S  D+ FAS+Y L  E   V+ LR HT+ CDR +  +LL EL+E M  G    
Sbjct  131   NSWSSSSSDNDLFFASVYTL-SETRWVLVLRLHTSACDRASAAALLRELLEQMGGGGE--  187

Query  1065  IKN-EGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLVVK  889
             I+N + E    IE+ +P  KS K  WA G+D++GYS+NSFRL NL F D    R S V++
Sbjct  188   IENYKEELGVPIEDCIPDGKSSKWFWARGMDVVGYSLNSFRLANLNFIDASSARRSQVIR  247

Query  888   LQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTDCR  709
             LQ+N   T +++ GCKS GIKLCG L AAGL+AAHS++   D    Q  KY VVTL DCR
Sbjct  248   LQINSDQTFKLVEGCKSRGIKLCGALAAAGLIAAHSTK---DLPHDQSHKYAVVTLVDCR  304

Query  708   SILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADLNF  529
             SILDP LSSH+ GFYHSAILN H + GG++LW++A+R Y +F N+KK NKHF+DM DLNF
Sbjct  305   SILDPVLSSHNLGFYHSAILNTHDINGGDKLWEVAQRCYMSFANAKKNNKHFTDMGDLNF  364

Query  528   LMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPSIA  349
             LM KAIDNPGLT SSS R+A I+VFE+PV+ +    +  ELG+EDYVGC+SVHGVGPS+A
Sbjct  365   LMGKAIDNPGLTPSSSSRTACISVFEDPVIDESDNAMHGELGLEDYVGCASVHGVGPSLA  424

Query  348   IFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDA  229
              FDT+ +G+LDCACVYPSPLHSREQ+ +L+D+MKRIL+D+
Sbjct  425   FFDTIRNGRLDCACVYPSPLHSREQIQKLIDDMKRILVDS  464



>gb|KEH42006.1| condensation domain protein [Medicago truncatula]
Length=469

 Score =   442 bits (1138),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 248/462 (54%), Positives = 315/462 (68%), Gaps = 20/462 (4%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNAA  1423
             R VGGTE+GWC+AV GGTG TVL+ L+S K      L+NALHK+ N+HPILRS++ ++  
Sbjct  18    RPVGGTEYGWCKAVPGGTGSTVLSLLLS-KPPQIPHLQNALHKLQNSHPILRSRIHFDNT  76

Query  1422  TKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHEL---SNNAA  1252
             T  F F     P +QI  FD   T QIL      D        FH +LEHE+   S+   
Sbjct  77    TNTFLFITPPNPTVQIQSFDLQQTEQILNGHDHDDLVDP----FHKLLEHEMNLDSDTRR  132

Query  1251  WRNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtL  1072
             +RN         DV++AS YA+ E+   V  LR HT+ CDR   V+LL EL+ L+  G  
Sbjct  133   YRNDVD-----VDVMYASTYAIDEKRLAVF-LRLHTSACDRAAAVALLNELLRLVAAGGG  186

Query  1071  KGIK-NEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLV  895
              G    E + +  IE+++P  K  K  WA G D+LGYS+N+FR +NL F +   PR S +
Sbjct  187   DGGGVKEDKVNLAIEDLIPEGKKNKPFWARGFDVLGYSLNAFRFSNLSFVNADSPRRSRM  246

Query  894   VKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTD  715
             V+LQLN   T R+L GCKS GIKLC  L AAG++AA  S+   D+   Q +KY VVTL D
Sbjct  247   VRLQLNADETKRLLDGCKSRGIKLCAALAAAGMIAAWVSKHLPDY---QSEKYAVVTLID  303

Query  714   CRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADL  535
             CR +LDP LSS H GFYHSAILN H V  GE LW++AKRSY++FEN+   NKHFSDMADL
Sbjct  304   CRPLLDPVLSSSHCGFYHSAILNTHDV-CGETLWELAKRSYTSFENALSYNKHFSDMADL  362

Query  534   NFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPS  355
             NFLMCKAIDNPGLT SSSLR+A+++VF++ +V D S ++  ELG+EDY+GC+S HGVGPS
Sbjct  363   NFLMCKAIDNPGLTPSSSLRTALVSVFDD-LVIDDSNEMHEELGLEDYLGCASAHGVGPS  421

Query  354   IAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDA  229
             +A+FD + +GKLDCAC+YPSPLHSREQ+ ELVD MKRIL+DA
Sbjct  422   LAMFDAIRNGKLDCACIYPSPLHSREQIQELVDHMKRILVDA  463



>gb|KDP37320.1| hypothetical protein JCGZ_06774 [Jatropha curcas]
Length=472

 Score =   442 bits (1137),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 241/474 (51%), Positives = 321/474 (68%), Gaps = 23/474 (5%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNAA  1423
             R+V  TEHGWC AV GGTGI VLA L S K+ +     NAL K+ N+HP L+ KL  +  
Sbjct  10    RIVSATEHGWCHAVRGGTGIAVLAILTS-KSPEIPHFENALKKLQNSHPTLKCKLHSHTK  68

Query  1422  TKAFSFAISATPD--IQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
             +   +F++  +P   I++  FD  ST +IL +   S  +  + SP H++LEHEL+ N   
Sbjct  69    SSRSTFSLLTSPPNFIKVKHFDLSSTFKILEN--ISGSENQNLSPLHVLLEHELNLNPWV  126

Query  1248  RNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLK  1069
             +N  +      D+ FA+ YALP     V+ LR H   CDRTT +SLL EL  ++ +    
Sbjct  127   KNSDN---GIYDMFFATTYALPNSKW-VVVLRLHGVGCDRTTAISLLRELQVVLVQEGEG  182

Query  1068  G----------IKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDV  919
             G          I+N+G+   G+E+++P  K KK +W  G+DMLGYSVNS  LTNLKF D 
Sbjct  183   GSGGGGRVEMQIENKGKICLGMEDLIPDGKVKKTIWTRGVDMLGYSVNSLGLTNLKFKDA  242

Query  918   KGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKK  739
             K PR S VV+LQLN   T +I+AGCKS GI+LCG L AAGL+AA  SRS+ D H    +K
Sbjct  243   KSPRSSQVVRLQLNQDDTQKIIAGCKSKGIRLCGALGAAGLIAAQRSRSRIDKH----RK  298

Query  738   YGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNK  559
             YG+VTL DCRS+L PPLS H YGFYHS ILN H VKG E+LW++A++ Y+ F N K  N+
Sbjct  299   YGIVTLIDCRSLLQPPLSPHQYGFYHSTILNTHVVKGKEKLWELAEKVYTEFTNYKNDNR  358

Query  558   HFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCS  379
             HF+DMADL+FLMCKAIDNP LT SSSLR++++++FE+ V+++     +  +G+EDY+GC+
Sbjct  359   HFTDMADLSFLMCKAIDNPSLTPSSSLRTSILSIFEDTVIHNSDDKGKDVVGLEDYMGCA  418

Query  378   SVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDATKFI  217
             SVHG+GPSI IFDT+ DG+LDC CVYPSPLHSR+QM E V++MK +L+D    I
Sbjct  419   SVHGIGPSIGIFDTIRDGRLDCLCVYPSPLHSRDQMEEFVEKMKSVLVDGANHI  472



>ref|XP_008442856.1| PREDICTED: uncharacterized protein LOC103486624 [Cucumis melo]
Length=462

 Score =   441 bits (1135),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 234/462 (51%), Positives = 321/462 (69%), Gaps = 8/462 (2%)
 Frame = -3

Query  1614  NNKERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLR  1435
             + + R+   TE  WCRAV GGTGI +LA L S +      L NALHK+ N+HP+L+SKL 
Sbjct  5     DTRRRLASSTETAWCRAVPGGTGIAILA-LSSTEPPSLQRLENALHKLQNSHPVLKSKLH  63

Query  1434  YNAATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNA  1255
             +N  +  FSF  S TP +Q+  F  P T +IL +  ++    +S SPF I+LE EL++N 
Sbjct  64    FNHISSTFSFLTSPTPFVQLKIFGIPETSKILLNDQNALKGNISISPFQILLERELNDNT  123

Query  1254  AWRN-PASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmreg  1078
             AWR+  +S   + AD+LF +LY +   G  V   R H A CDRTT VSLL EL+ LM   
Sbjct  124   AWRSLNSSGSDAAADILFVNLYEVGI-GKWVAIFRLHVAACDRTTAVSLLEELLVLMTND  182

Query  1077  tLKGIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSL  898
                G + +GE   G+E +VP    KK L A G++ML +SVNS RLTNLKF DVK  R S 
Sbjct  183   GRGGGEKKGEVERGLEELVPRNLMKKPLLARGLNMLSHSVNSLRLTNLKFKDVKSARRSQ  242

Query  897   VVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQ-WDHHQQQKKKYGVVTL  721
             + + Q+N   T++IL+ CK  GIKL  VL AAGLMAAHSS S  +D H    +KYG++TL
Sbjct  243   LARFQINQTETNKILSECKLRGIKLSSVLVAAGLMAAHSSGSHGFDRHH---RKYGIITL  299

Query  720   TDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMA  541
              DCR  L+PPL+SHH+GFYH+AI N +T+KGGE LW++A++  +  E SK +NKHF+DM+
Sbjct  300   VDCRRFLEPPLTSHHFGFYHAAIFNSYTIKGGEDLWELAEKVSTTVEASKNSNKHFTDMS  359

Query  540   DLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVG  361
             DLNFLMC+ I+NP LTAS ++R++++T+FE+  V+D S  +Q+++G+ DYVGC+S+HG+G
Sbjct  360   DLNFLMCRVIENPSLTASGAMRTSLMTIFED-TVFDNSGGMQKDIGINDYVGCASIHGIG  418

Query  360   PSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILI  235
             PS A+FDTV +G+LDCAC+YPSPLHSR+QM  L+  +K +L+
Sbjct  419   PSAAMFDTVRNGRLDCACIYPSPLHSRDQMEALLTNIKTLLV  460



>ref|XP_010093750.1| hypothetical protein L484_019153 [Morus notabilis]
 gb|EXB54583.1| hypothetical protein L484_019153 [Morus notabilis]
Length=442

 Score =   439 bits (1130),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 247/476 (52%), Positives = 319/476 (67%), Gaps = 48/476 (10%)
 Frame = -3

Query  1617  ENNKERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKL  1438
             +NN  R VGGTE+ WCRAV GGTGITVLA LVS K  D  +L+NAL  +  +HPIL +KL
Sbjct  6     DNNLFRAVGGTEYSWCRAVPGGTGITVLALLVS-KQPDIEILQNALRALQASHPILNTKL  64

Query  1437  RYNAATKAFSF-AISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSN  1261
              +N ATK FSF +   TP+++I  FD  ST +ILR++                     ++
Sbjct  65    HFNPATKTFSFLSYGPTPNLRIQLFDLQSTAEILRAK---------------------ND  103

Query  1260  NAAWRNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTV------VSllgel  1099
             +    +P              LY L  E    +ALR HTA CDRT        +      
Sbjct  104   DGEAVSP--------------LYCL-SEAERALALRLHTAACDRTAAAALLRGLVKELGG  148

Query  1098  melmregtLKGIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDV  919
               +   G  +G +  GEGS GIE ++P  K+ K  WA G+D+LGYS+N+FRL+NL+F D 
Sbjct  149   GGVGEGGAEQGFEGSGEGSLGIEEIIPKGKADKPFWARGVDVLGYSLNAFRLSNLEFRDA  208

Query  918   KGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKK  739
               PR S VV+LQ+N   T R+L GCKS  IKLCG L AAGL+AA SS++  DH   Q++K
Sbjct  209   VSPRSSRVVRLQINRRDTERLLEGCKSREIKLCGALAAAGLIAARSSKNLPDH---QREK  265

Query  738   YGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNK  559
             YGVVTLT+CRSIL+PPLSS H GFYHSAILN H + GGE LW++A R+Y AF N+K+ NK
Sbjct  266   YGVVTLTNCRSILEPPLSSQHLGFYHSAILNTHDITGGETLWELATRTYMAFANAKENNK  325

Query  558   HFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCS  379
             HF+DM+DLN+LMCKAID PGLT SSSLR+A I+VFE+PVV + + ++ ++L +EDY+GC+
Sbjct  326   HFTDMSDLNYLMCKAIDTPGLTPSSSLRTAFISVFEDPVV-NQTDELHKDLCLEDYIGCA  384

Query  378   SVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDATKFIDD  211
             SVHGVGPSIA+FDT+ DG LD A VYPSPLHSREQ+ EL+D MKR+LID    +++
Sbjct  385   SVHGVGPSIAVFDTIRDGSLDSALVYPSPLHSREQIQELIDHMKRVLIDGCANVEN  440



>emb|CCH47179.1| hypothetical protein [Lupinus angustifolius]
Length=466

 Score =   437 bits (1124),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 256/475 (54%), Positives = 327/475 (69%), Gaps = 23/475 (5%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R VGGTEH WC+AV GGTGI VLA L+S K  D    + AL+K+ N+HPIL++KL  N
Sbjct  5     KVRTVGGTEHSWCKAVHGGTGIAVLA-LLSSKNPDISRFQIALNKLQNSHPILKTKLHSN  63

Query  1428  AATKAFSFAISATPD--IQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNA  1255
               T   +F         ++I   +   T +I  S    +++ VS  PF +ILEHEL+ N 
Sbjct  64    TTTSDTTFTFITLTTPFVKIQYHNVCVTSKIFGSN---ENEAVSVPPFQLILEHELNQNT  120

Query  1254  AWRNPASFPPSGAD----VLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelm  1087
              W N      S +     +  AS+YA+P     V+ +R H A CDRTT +SLL EL+ LM
Sbjct  121   -WHNHNHSSSSLSSYSDNMFVASIYAMPN-ATWVVVMRLHVAACDRTTAISLLRELLVLM  178

Query  1086  regtLKGIK---NEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVK  916
             +E   +      N+GE  F +E++VPSEK KK +WAHG D+L YSVNS RLTNLKF D K
Sbjct  179   KEEESENESEEWNKGEVGFAMEDLVPSEKGKKGIWAHGFDVLSYSVNSLRLTNLKFCDTK  238

Query  915   GPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKY  736
               R S VV+LQLN + T R+L GCK   IKLCG L+AAGLM AHS       ++   +KY
Sbjct  239   TTRFSQVVRLQLNNNDTKRVLDGCKHRRIKLCGALSAAGLMGAHS-------YKNSSRKY  291

Query  735   GVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKH  556
             G++TLTDCRS L PPLS H++GFYHSAILN HT+KGGE  WD+AK++Y  F NSK  NKH
Sbjct  292   GIITLTDCRSSLQPPLSLHNFGFYHSAILNSHTMKGGESFWDLAKKTYETFSNSKNNNKH  351

Query  555   FSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSS  376
             F+DM+D+NFLMCKAI NP LT+SSSLR+++++VFE+ V+ D    +Q E+GVEDY+GC+S
Sbjct  352   FTDMSDMNFLMCKAIQNPSLTSSSSLRTSMMSVFEDTVIDD-GGKVQNEVGVEDYMGCAS  410

Query  375   VHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDATKFIDD  211
             VHGVGPSIAIFDT+ DG+LDC CVYP+PLHSREQM ELV++MK ILI+  K  D+
Sbjct  411   VHGVGPSIAIFDTIRDGRLDCICVYPAPLHSREQMIELVNKMKVILIEGGKTYDE  465



>ref|XP_007027792.1| GATA zinc finger domain-containing protein C1393.08 isoform 2 
[Theobroma cacao]
 gb|EOY08294.1| GATA zinc finger domain-containing protein C1393.08 isoform 2 
[Theobroma cacao]
Length=481

 Score =   436 bits (1121),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 250/470 (53%), Positives = 317/470 (67%), Gaps = 22/470 (5%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R  GGTE+ WCRAV GGTGITVL+ L+S    D  LL  AL ++  +HPILRS+L ++
Sbjct  16    KVRPAGGTEYSWCRAVPGGTGITVLSLLLS-NPPDISLLEAALCRLQVSHPILRSRLHFD  74

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
                  FSF     P  +I  FD PST  IL+S +   +          +LEHEL+ N+ W
Sbjct  75    TCRNTFSFITHRNPHAKIQSFDLPSTSHILQSLSGDPNIDS----HQFLLEHELNRNS-W  129

Query  1248  RNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLK  1069
               P     +  DV F SLY L  E   V+  R HT+ CDR   V+LL EL+EL+  G  K
Sbjct  130   NLPDG-DQADRDVFFVSLYTL-SETRWVVVFRLHTSACDRAAAVALLKELLELVGGGRSK  187

Query  1068  -------GIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGP  910
                      + E E S GIE+++PS K+ K  WA G+DMLGYS+NSFRL NL F D    
Sbjct  188   VEEIAKGNDEKEVELSLGIEDLIPSGKANKPFWARGVDMLGYSLNSFRLANLNFVDANSA  247

Query  909   RHSLVVKLQLNLHHTSRILA---GCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKK  739
             R S VV+LQ+N   T  ++A     +S GIKLCG L AAGL+AA S+++  +H   Q++K
Sbjct  248   RRSQVVRLQMNPDETDGLVAVSDELQSRGIKLCGALAAAGLIAARSTKAYPEH---QREK  304

Query  738   YGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNK  559
             Y VVTLTDCRSILDP L S+H GFYHSAILN H V   E++W++A+R Y +F N+K  +K
Sbjct  305   YAVVTLTDCRSILDPVLGSNHLGFYHSAILNTHDVTAHEQVWELARRCYMSFSNAKNNDK  364

Query  558   HFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCS  379
             HF+DM DLNFLMCKAIDNPGLTASSS+R+A I+VFE+PV+ D S ++ +++G+ DYVGCS
Sbjct  365   HFTDMNDLNFLMCKAIDNPGLTASSSMRTAFISVFEDPVI-DESNELHQKIGLVDYVGCS  423

Query  378   SVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDA  229
             SVHGVGPS+AIFDT+ DG LDCACVYP+PLHSREQM +L+D MK IL DA
Sbjct  424   SVHGVGPSLAIFDTIQDGCLDCACVYPAPLHSREQMQQLIDSMKSILADA  473



>ref|XP_004164824.1| PREDICTED: uncharacterized LOC101208663 [Cucumis sativus]
Length=463

 Score =   435 bits (1118),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 230/460 (50%), Positives = 319/460 (69%), Gaps = 7/460 (2%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             + R+   TE+ WCRA+ GGTG  +LA L S +        +ALHK+ N+HP+L+SKL +N
Sbjct  7     RRRLASTTENAWCRALPGGTGTGILA-LSSTEPPSLQRFEHALHKLQNSHPVLKSKLHFN  65

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
               +  FSF  S TP +Q+  F  P T +IL +  ++ D  VS SPF I+LE EL++N AW
Sbjct  66    HTSSTFSFLTSPTPFVQLKIFGIPETSKILLNDQNAVDGNVSISPFQILLERELNDNTAW  125

Query  1248  RN-PASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtL  1072
             R+  +S   + AD+LF +LY +   G  V   R H A CDRTT VSLL EL+ LM     
Sbjct  126   RSLNSSGSDAAADILFVNLYEVGI-GKWVAIFRLHVAACDRTTAVSLLEELLVLMTSDGG  184

Query  1071  KGIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLVV  892
              G + + E   G+E +VP    KK L A G++ML +SVNSFRLTNLKF DVK  R S + 
Sbjct  185   GGGEKKWEVERGLEELVPRNLMKKPLLARGLNMLSHSVNSFRLTNLKFKDVKSARRSQLA  244

Query  891   KLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQ-WDHHQQQKKKYGVVTLTD  715
             + Q+N   T +IL+ CK  GIKL  VL AAGL+AAHSS S  +D H    +KYG++TL D
Sbjct  245   RFQINQTETHKILSECKLRGIKLSSVLVAAGLVAAHSSGSHGFDRHHH--RKYGIITLVD  302

Query  714   CRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADL  535
             CR  L+PPL+SH +GFYH+AI N +T+KGGE LW++A+R  +  E SK +NKHF+DM+DL
Sbjct  303   CRRFLEPPLTSHDFGFYHAAIFNSYTIKGGEDLWELAERVSTTVEASKNSNKHFTDMSDL  362

Query  534   NFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPS  355
             NFLMC+AI+NP LTAS ++R++++T+FE+  V+D S  +Q+++G+ DYVGC+S+HG+GPS
Sbjct  363   NFLMCRAIENPNLTASGAMRTSLMTIFED-TVFDNSGGMQKDIGINDYVGCASIHGIGPS  421

Query  354   IAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILI  235
              A+FD+V +G+LDC+C+YPSPLHSR+QM  L+  +K +L+
Sbjct  422   AAMFDSVRNGRLDCSCIYPSPLHSRDQMEALLTNIKTLLV  461



>gb|KDP37316.1| hypothetical protein JCGZ_06770 [Jatropha curcas]
Length=471

 Score =   435 bits (1118),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 240/470 (51%), Positives = 328/470 (70%), Gaps = 17/470 (4%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             + R+VGGTE+ WC+AV GGTGI V+A L+S +  +  LL+NA H +  +HPILRSKL ++
Sbjct  14    RARLVGGTEYSWCKAVPGGTGIAVVALLLS-ETPNLHLLQNAFHHLQISHPILRSKLHFD  72

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
              +T  FSF    +  IQI  FD  ST  I+ + +D+   V     +HI+LEHE++ N+ W
Sbjct  73    TSTATFSFVTPPSSHIQIQFFDLSSTATIISNNSDNTLTVTP---YHILLEHEINKNS-W  128

Query  1248  RNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLK  1069
                 S P +  ++LFAS+Y L  E   V+ LR HTA CDR + V LL EL++L  +    
Sbjct  129   S--TSNPETDLELLFASVYTL-SESEWVLVLRLHTAACDRASAVYLLRELVKLASDCNNN  185

Query  1068  GIKNEGE----GSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHS  901
               +   E    GS  IE+++P+ K+ K  W  G+D++GYS+NSFRL NL F D + PR S
Sbjct  186   NNQELNENNEIGS-KIEDLIPNGKANKPFWLRGMDVVGYSLNSFRLANLSFVDCESPRIS  244

Query  900   LVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTL  721
              VV+LQ+N   T ++L GC+S GIKLC  L AAGL+A +SS    +   +Q++KY VVTL
Sbjct  245   QVVRLQMNSDETQKLLQGCESRGIKLCAALAAAGLIATYSSE---NFPHEQRQKYAVVTL  301

Query  720   TDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMA  541
              DCRS+LDP LS HH GFYHSAI+N H + G ++LW++AKR Y +F N+K  NKHF+DM 
Sbjct  302   VDCRSLLDPVLSVHHLGFYHSAIMNTHDISGDDKLWEVAKRCYMSFANAKNNNKHFTDMG  361

Query  540   DLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVG  361
             DLNFLM KAIDNPGLT SS+LR+A I+VFE+PV+ D   ++ +E GV+D++GC+SVHGVG
Sbjct  362   DLNFLMGKAIDNPGLTPSSALRTACISVFEDPVIDD-HNELYKEFGVQDFIGCASVHGVG  420

Query  360   PSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDATKFIDD  211
             PS+A+FDT+ +G+LD ACVYPSPLHSREQM  L+ +MKRIL+D+   ++D
Sbjct  421   PSVAVFDTIRNGQLDSACVYPSPLHSREQMQNLIGDMKRILVDSCVNVED  470



>ref|XP_004149220.1| PREDICTED: uncharacterized protein LOC101208663 [Cucumis sativus]
 gb|KGN59147.1| hypothetical protein Csa_3G777550 [Cucumis sativus]
Length=463

 Score =   434 bits (1117),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 229/460 (50%), Positives = 319/460 (69%), Gaps = 7/460 (2%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             + R+   TE+ WCRA+ GGTG  +LA L S +        +ALHK+ N+HP+L+SKL +N
Sbjct  7     RRRLASTTENAWCRALPGGTGTGILA-LSSTEPPSLQRFEHALHKLQNSHPVLKSKLHFN  65

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
               +  FSF  S TP +Q+  F  P T +IL +  ++ D  +S SPF I+LE EL++N AW
Sbjct  66    HTSSTFSFLTSPTPFVQLKIFGIPETSKILLNDQNAVDGNLSISPFQILLERELNDNTAW  125

Query  1248  RN-PASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtL  1072
             R+  +S   + AD+LF +LY +   G  V   R H A CDRTT VSLL EL+ LM     
Sbjct  126   RSLNSSGSDAAADILFVNLYEVGI-GKWVAIFRLHVAACDRTTAVSLLEELLVLMTSDGG  184

Query  1071  KGIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLVV  892
              G + + E   G+E +VP    KK L A G++ML +SVNSFRLTNLKF DVK  R S + 
Sbjct  185   GGGEKKWEVERGLEELVPRNLMKKPLLARGLNMLSHSVNSFRLTNLKFKDVKSARRSQLA  244

Query  891   KLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQ-WDHHQQQKKKYGVVTLTD  715
             + Q+N   T +IL+ CK  GIKL  VL AAGL+AAHSS S  +D H    +KYG++TL D
Sbjct  245   RFQINQTETHKILSECKLRGIKLSSVLVAAGLVAAHSSGSHGFDRHHH--RKYGIITLVD  302

Query  714   CRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADL  535
             CR  L+PPL+SH +GFYH+AI N +T+KGGE LW++A+R  +  E SK +NKHF+DM+DL
Sbjct  303   CRRFLEPPLTSHDFGFYHAAIFNSYTIKGGEDLWELAERVSTTVEASKNSNKHFTDMSDL  362

Query  534   NFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPS  355
             NFLMC+AI+NP LTAS ++R++++T+FE+  V+D S  +Q+++G+ DYVGC+S+HG+GPS
Sbjct  363   NFLMCRAIENPNLTASGAMRTSLMTIFED-TVFDNSGGMQKDIGINDYVGCASIHGIGPS  421

Query  354   IAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILI  235
              A+FD+V +G+LDC+C+YPSPLHSR+QM  L+  +K +L+
Sbjct  422   AAMFDSVRNGRLDCSCIYPSPLHSRDQMEALLTNIKTLLV  461



>ref|XP_010520704.1| PREDICTED: uncharacterized protein LOC104799759 [Tarenaya hassleriana]
Length=476

 Score =   432 bits (1110),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 239/482 (50%), Positives = 316/482 (66%), Gaps = 25/482 (5%)
 Frame = -3

Query  1635  VRKGADENNKERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHP  1456
             +R+   EN   R VGGTE+ WCRAV GGTGITV+A L+  +  D   L+NAL K+ N HP
Sbjct  5     IRRPGSEN-ATRPVGGTEYSWCRAVPGGTGITVIALLLR-QPPDMRNLQNALEKLHNYHP  62

Query  1455  ILRSKLRYNAATKAFSFAIS---ATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHI  1285
             ILRSKLR++A T  FSF      A   +QI  F++ ST +ILRS      D +S  P  I
Sbjct  63    ILRSKLRFDAPTNTFSFLTLPPLAASHVQIQTFNSSSTAEILRS-----TDDLSGEPHRI  117

Query  1284  ILEHELSNNAAWRNPASFPPSGADVLFASLYALPEEGGH----VMALRFHTAVCDRTTVV  1117
             ILEHEL+NN  W +P  +    A V F SLY L +        V+  R HTA CDRT  V
Sbjct  118   ILEHELNNNT-WTDPERWIDGEASVFFVSLYDLGDGECDSRRCVVTFRLHTAACDRTAAV  176

Query  1116  SllgelmelmregtLKGIKNEG--EGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRL  943
             +LL + +E +      G   E   E S  IE+++P+ K+ K  WA G+D+LGYS+N+ R 
Sbjct  177   TLLRDFLEAVTAEGDGGAAEEKAEEISPAIEDLIPTGKANKPFWARGMDVLGYSLNALRF  236

Query  942   TNLKFNDVKGPRHSLVVKLQLNLHHTSRILAG-----CKSAGIKLCGVLTAAGLMAAHSS  778
             +NL F + + P+ S VV++Q+N   T +++A      C   G+KL   + AAG+++AHSS
Sbjct  237   SNLDFVEAESPKESQVVRMQMNRDETRKLVASLLLHECDGRGMKLWAAIAAAGMISAHSS  296

Query  777   RSQWDHHQQQKKKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKR  598
             ++     ++Q++KY VVTL DCR IL+PPL S  +GFYHS IL+ H +   E LWD+A+R
Sbjct  297   KNL---PEKQREKYAVVTLMDCRPILEPPLISKDFGFYHSGILHTHDLTEEETLWDLAER  353

Query  597   SYSAFENSKKTNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADI  418
               S+F   K ++KHF+DM DLNFLMCKAI+NP LT SSSLR+A+I+VFE+PV    +  +
Sbjct  354   LNSSFTTLKNSDKHFTDMPDLNFLMCKAIENPRLTPSSSLRTALISVFEDPVFDASTGQV  413

Query  417   QRELGVEDYVGCSSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRIL  238
              R+ GVEDY+GCSSVHGVGPSIA+FDT+ DG LDC CVYPSPLHSR+QM  LV  MK IL
Sbjct  414   LRDKGVEDYLGCSSVHGVGPSIAVFDTMRDGCLDCMCVYPSPLHSRDQMQGLVQSMKAIL  473

Query  237   ID  232
             +D
Sbjct  474   LD  475



>ref|XP_006291061.1| hypothetical protein CARUB_v10017176mg [Capsella rubella]
 gb|EOA23959.1| hypothetical protein CARUB_v10017176mg [Capsella rubella]
Length=469

 Score =   431 bits (1109),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 232/465 (50%), Positives = 308/465 (66%), Gaps = 18/465 (4%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVS--PKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             R VGGTE+ WCRA+ GGTGI V+A L+S  PK  +   L+N L K+   HP LRS LRY+
Sbjct  13    RPVGGTEYSWCRAIDGGTGIAVIALLLSRTPKLQN---LQNTLDKLQIYHPTLRSTLRYD  69

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
             A+  +FSF ++    + I PFD+ ST QI+R       D     P  IILEHEL+ N  W
Sbjct  70    ASANSFSFFVADDSRVVIHPFDSQSTAQIIRD-----SDDPRADPHRIILEHELNKNT-W  123

Query  1248  RNPASFPPSGADVLFASLYALPEEGGH-VMALRFHTAVCDRTTVVSllgelmelmregtL  1072
              +P S+  S + V   SLY L ++G   V+  R +T  CDRT  V+LL E M+       
Sbjct  124   IDPHSWINSESAVFIVSLYNLTDDGEQRVLTFRLNTGACDRTAAVTLLREFMKETAADGC  183

Query  1071  KGIKNEGEGSFG--IENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGP-RHS  901
                    E   G  IE ++PS K  K  WA GID+LGYS+N+FR +NL F D     R S
Sbjct  184   GNGPVAAEEGLGKAIEELIPSGKGNKPFWARGIDVLGYSLNAFRFSNLNFVDADDSNRRS  243

Query  900   LVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTL  721
              VV+L+L    T +++AGCK+ GIKL   L ++GL+AA+SS+    +   Q +KY VVTL
Sbjct  244   QVVRLRLERDQTLKLVAGCKARGIKLWAALASSGLIAAYSSKKLPPY---QGEKYAVVTL  300

Query  720   TDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMA  541
             +DCRSILDPPL+S+ +GFYH+ IL+ H + G E LWD+AKR Y +F ++K +NKHF+DM+
Sbjct  301   SDCRSILDPPLTSNDFGFYHAGILHTHDITGEETLWDLAKRCYDSFTSAKNSNKHFTDMS  360

Query  540   DLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVG  361
             DLNFLMCKAI+NP LT SSSLR+A I++FE+PV+ +        LGV+DY+GC+S+HGVG
Sbjct  361   DLNFLMCKAIENPNLTPSSSLRTAFISIFEDPVIDESPEPELASLGVQDYIGCASIHGVG  420

Query  360   PSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDAT  226
             PS+A+FD + DGKLDCA VYPSPLHSREQM  L+  MK IL++ +
Sbjct  421   PSVAVFDALRDGKLDCAFVYPSPLHSREQMDGLIQHMKTILLEGS  465



>gb|KFK34513.1| hypothetical protein AALP_AA5G155100 [Arabis alpina]
Length=463

 Score =   431 bits (1108),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 233/466 (50%), Positives = 317/466 (68%), Gaps = 23/466 (5%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVS--PKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             R VGGTE+ WCRA++GGTGI V+A L+S  PK  +   L+N L K+   HP LRS LRY+
Sbjct  10    RPVGGTEYSWCRAITGGTGIAVIALLLSSSPKLQN---LQNTLDKLQIHHPTLRSNLRYD  66

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
              +  +FSF  SA   +QI PFD+ ST QI+R+      D  S  P  IILEHEL+ N  W
Sbjct  67    ESANSFSFVTSADSRVQIQPFDSESTAQIIRN-----SDGPSSEPHRIILEHELNKNT-W  120

Query  1248  RNPASFPPSGADVLFASLYALPE-EGGHVMALRFHTAVCDRTTVVSllgelmelmregtL  1072
              +P     SG  V F SLY L + EG  ++  R +T  CDRT+ V+LL E M+    G  
Sbjct  121   IDPHG--ESG--VFFVSLYDLTDGEGARILTFRLNTGACDRTSAVTLLREFMKETAAGDG  176

Query  1071  KG---IKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKF-NDVKGPRH  904
              G   +   G G   IE+++PS K  K  WA GID+LGYS+N+FR  NL+F N     R 
Sbjct  177   CGNGEVTVVGLGQ-AIEDLIPSGKGDKPFWARGIDVLGYSLNAFRFANLRFVNADDSNRR  235

Query  903   SLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVT  724
             S VV+L+L    T +++AGCK+ G++L   + AAGL++A+SS++   +H  +K  Y VVT
Sbjct  236   SQVVRLKLEKDQTIKLVAGCKARGMRLWAAVAAAGLISAYSSKNLPQNHGGEK--YAVVT  293

Query  723   LTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDM  544
             L+DCRS+L+PPL+ + +GFYHS IL+ H + G E+LWDMAKR Y +F ++K +NK F+DM
Sbjct  294   LSDCRSVLEPPLTPNDFGFYHSGILHTHDITGEEKLWDMAKRCYDSFTSAKNSNKQFTDM  353

Query  543   ADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGV  364
             +DLNFLMCKAI+NP LT SSSLR+A +++FE+PV+ + +      +GV+DY+GC+S+HGV
Sbjct  354   SDLNFLMCKAIENPNLTPSSSLRTAFMSIFEDPVIDEYTEPALASVGVQDYIGCASIHGV  413

Query  363   GPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDAT  226
             GPSIA+FD++ DGKLDCA VYPSPLHSREQM  L+  MK IL++ +
Sbjct  414   GPSIAVFDSLRDGKLDCAFVYPSPLHSREQMDGLIQHMKSILLEGS  459



>emb|CDX73618.1| BnaC08g23850D [Brassica napus]
Length=471

 Score =   431 bits (1109),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 229/468 (49%), Positives = 310/468 (66%), Gaps = 22/468 (5%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVS--PKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             R VGGTE+ WCRA++GGTGI V+A L+S  PK  +   L+N L K+   HP LRS  RY+
Sbjct  13    RPVGGTEYSWCRAIAGGTGIAVIALLLSRTPKLEN---LQNTLDKLQIHHPTLRSTFRYD  69

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
             A+T +FS A SA+  + I PFD+ ST QI+R       D     P  IILEHEL+ N  W
Sbjct  70    ASTSSFSLATSASSRVVIHPFDSSSTAQIIRD-----SDDPCAEPHRIILEHELNKNT-W  123

Query  1248  RNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLK  1069
              +P  +      V F SLY L      V+  R +T  CDRT+ V+LL E M         
Sbjct  124   IDPHRWSNGECGVFFVSLYDLSGGEERVLTFRLNTGACDRTSAVTLLREFMRETTVAEGD  183

Query  1068  GI------KNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVK-GP  910
             G       K  G G   IE ++PS K  K  WA GID+LGYS+N+FR +NL F D +   
Sbjct  184   GCCDGHVAKEAGLGK-AIEEMIPSGKGDKPFWARGIDVLGYSLNAFRFSNLSFVDAEESN  242

Query  909   RHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGV  730
             R S VV+++L    T +++AGCK+ GIKL   + AAG+++A++S+   +  Q Q +KY V
Sbjct  243   RRSQVVRMKLERDQTLKLVAGCKARGIKLWAAIAAAGMISAYTSK---NLSQYQGEKYAV  299

Query  729   VTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFS  550
             VTL+DCRSIL+PPL+ + +GFYHS IL+ H + G E+LWD+AKR Y +F ++K +NKHF+
Sbjct  300   VTLSDCRSILEPPLTPNDFGFYHSGILHTHDITGEEKLWDLAKRCYDSFTSAKNSNKHFT  359

Query  549   DMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVH  370
             DM+DLNFLMCKAI+NP LT SSSLR+A+I++FE+PV  +         GV+DY+GC+S+H
Sbjct  360   DMSDLNFLMCKAIENPTLTPSSSLRTALISIFEDPVTDEYPEQALASAGVKDYIGCASIH  419

Query  369   GVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDAT  226
             GVGPSIA+FD++ DGKLDC+ VYPSP+HSREQM  L++ MK IL++ +
Sbjct  420   GVGPSIAVFDSLRDGKLDCSFVYPSPVHSREQMDGLIEHMKAILLEGS  467



>ref|XP_008442855.1| PREDICTED: uncharacterized protein LOC103486623 [Cucumis melo]
Length=477

 Score =   431 bits (1109),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 241/466 (52%), Positives = 322/466 (69%), Gaps = 13/466 (3%)
 Frame = -3

Query  1611  NKERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRY  1432
             +K R VGGTEH WCRAV GGTG TVL  L+S K  D   L+++LH + N HPILRSK+ +
Sbjct  13    SKSRPVGGTEHSWCRAVPGGTGTTVLGLLLS-KPPDIPHLQSSLHTLQNLHPILRSKIHH  71

Query  1431  NAATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAA  1252
             +   + FSF I A+P + +   D  +T + + S  D+DD  VS   FH I EHE+ N   
Sbjct  72    DPLRRDFSFLIPASPSLHLQILDLAATTRAIASHPDADDPSVSD--FHKIHEHEI-NRVI  128

Query  1251  WRNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmreg-t  1075
             W +P     S  DV+FA++Y + E    V  L  HTA CDR    +LL EL+ L  +G  
Sbjct  129   WFDPTHPSYSDTDVMFATVYTVSESQWAVF-LSLHTATCDRAAAAALLRELLVLAADGGE  187

Query  1074  LKG----IKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPR  907
             ++G    I + GE   GIE+++P+ K+ K LWA G DMLGYS+NSFRL NL+F D    R
Sbjct  188   IEGGRFEIGDNGEIGLGIEDLIPNGKANKSLWARGFDMLGYSLNSFRLANLEFKDPNSER  247

Query  906   HSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVV  727
              S +++L++N   T ++LAGCK  GIKLCG L AAGL+A   S+     +Q  K+KY VV
Sbjct  248   FSQMIRLKMNSDETQKLLAGCKLRGIKLCGALAAAGLIATRCSKDHLPPYQ--KEKYAVV  305

Query  726   TLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSD  547
             TL DCRS+LDPPL+SHH GFYHSAILN H +   ++LW++A R Y +F N+K  NKHFSD
Sbjct  306   TLNDCRSLLDPPLTSHHLGFYHSAILNTHDISAEDKLWEVANRCYFSFSNAKDNNKHFSD  365

Query  546   MADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHG  367
             M+DLNFLMCKAI+NP LT SSS+R+A+I+VFE+P++ + S    + LG+ DY+G +S HG
Sbjct  366   MSDLNFLMCKAIENPSLTPSSSMRTALISVFEDPII-ETSGPGHQNLGLNDYIGYASAHG  424

Query  366   VGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDA  229
             VGPSIA+FDT+ DG+LDCACVYPSPL SR+QM+++ DEMK+IL+++
Sbjct  425   VGPSIALFDTIRDGQLDCACVYPSPLFSRDQMNQIFDEMKKILVNS  470



>gb|EPS70664.1| hypothetical protein M569_04096, partial [Genlisea aurea]
Length=445

 Score =   429 bits (1102),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 230/458 (50%), Positives = 307/458 (67%), Gaps = 21/458 (5%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNAA  1423
             RV+G  E  WCRAV  GTGIT+L   +S + A+   L   L  +   HP+L  KL Y+ +
Sbjct  7     RVLGNAEKSWCRAVISGTGITILGLRLSKQLAEKSRLTEILDALKRTHPLLGCKLAYDRS  66

Query  1422  TKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAWRN  1243
              K F F         + P ++P   ++   R+ +            ++E E+S N  W +
Sbjct  67    GKTFKF---------VKPEESPPPTEV-SFRSIAKRADGGVPTLQEMVEQEMSENEIWSD  116

Query  1242  PASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLK-G  1066
             P ++P  GADVL AS+YA+      V+ LRFHT+VCDRTT VSLL EL+E +  G LK  
Sbjct  117   PNAYPADGADVLLASVYAI-SGSESVVILRFHTSVCDRTTAVSLLRELLERVSAGGLKMT  175

Query  1065  IKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKF-NDVKGPRHSLVVK  889
             +KN GEG + +EN++P+  +KKR+WAHG  MLGYS+ S R+TNL+F N  K PR S +++
Sbjct  176   VKNGGEGEWALENLIPNGLTKKRIWAHGKAMLGYSLGSLRMTNLEFVNCKKMPRKSEIIR  235

Query  888   LQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTDCR  709
             LQLN   TS ILAGCK+  IKLCG ++AA ++AAH +++         + YGVVTLTDCR
Sbjct  236   LQLNQQITSHILAGCKAREIKLCGAISAAAILAAHPNKAA-------SRNYGVVTLTDCR  288

Query  708   SILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADLNF  529
             S+L PPLS  HYGFYH AILN+H +KG E LWD+A   Y+ F   K+ NK F+DM DL F
Sbjct  289   SLLQPPLSPQHYGFYHLAILNIHPIKGTETLWDLATSCYTDFSKFKQNNKQFTDMTDLQF  348

Query  528   LMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPSIA  349
             LM KA++NP LT  S+LRS+++TVFE+PV+ D S D++R++GV DY+GCSSVHG+GPSI 
Sbjct  349   LMTKALENPVLTPQSALRSSLVTVFEDPVI-DNSGDMRRDVGVGDYIGCSSVHGIGPSIG  407

Query  348   IFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILI  235
             IFDTV DG+LDC  VYPSPLHSR+QM E+V +M  IL+
Sbjct  408   IFDTVRDGELDCIIVYPSPLHSRQQMEEIVAKMAAILV  445



>ref|XP_010515732.1| PREDICTED: uncharacterized protein LOC104791518 [Camelina sativa]
Length=473

 Score =   429 bits (1104),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 234/469 (50%), Positives = 313/469 (67%), Gaps = 22/469 (5%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVS--PKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             R VGGTE+ WCRA+ GGTGI V+A L+S  PK  +   L+N L K+   HP LRS LRY+
Sbjct  13    RPVGGTEYSWCRAIDGGTGIAVIALLLSRTPKLQN---LQNTLDKLQIYHPTLRSTLRYD  69

Query  1428  AATKAFSFAISATPD-IQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAA  1252
             A+  +FSFA+SA    + I PFD+ ST QI+R       D     P  IILEHEL+ N  
Sbjct  70    ASANSFSFAVSAADSRVVIHPFDSESTAQIIRD-----SDDPRADPHRIILEHELNKNT-  123

Query  1251  WRNPASFPPSGADVLFASLYALPEEGGH-VMALRFHTAVCDRTTVVSllgelmelmregt  1075
             W +P  +  S + V   SLY L ++G   V+  R +T  CDRT  V+LL E M+    G 
Sbjct  124   WIDPHRWINSESAVFVVSLYDLTDDGEQRVLTFRLNTGACDRTAAVTLLREFMKETAAGD  183

Query  1074  LKG---IKNEGEGSFG--IENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGP  910
              +G   +  E     G  IE ++PS K  K  WA G+D+LGYS+N+FR +NL F D + P
Sbjct  184   GRGNGPVAEETTVRLGKAIEELIPSGKGNKPFWARGMDVLGYSLNAFRFSNLNFVDAEEP  243

Query  909   -RHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYG  733
              R S VV+L+L    T +++AGCK+ GIKL   L ++GL+AA+SS+   +    Q +KY 
Sbjct  244   NRRSQVVRLKLERDETLKLVAGCKARGIKLWAALASSGLLAAYSSK---NLPPDQGEKYA  300

Query  732   VVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHF  553
             VVTL+DCRSIL+PPL+S+ +GFYH+ IL+ H + G E LW +AKR Y +F ++K +NKHF
Sbjct  301   VVTLSDCRSILEPPLTSNDFGFYHAGILHTHDITGEETLWYLAKRCYDSFTSAKNSNKHF  360

Query  552   SDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSV  373
             +DM+DLNFLMCKAI+NP LT SSSLR+A I++FE+PV+ +        LGV DY+GC+S+
Sbjct  361   TDMSDLNFLMCKAIENPNLTPSSSLRTAFISIFEDPVIDESPEPELASLGVRDYIGCASI  420

Query  372   HGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDAT  226
             HGVGPS+A+FD + DGKLDCA VYPSPLHSREQM  L+  MK IL++ +
Sbjct  421   HGVGPSLAVFDALRDGKLDCAFVYPSPLHSREQMDGLIQHMKTILLEGS  469



>ref|XP_009115959.1| PREDICTED: uncharacterized protein LOC103841192 [Brassica rapa]
Length=470

 Score =   427 bits (1098),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 227/466 (49%), Positives = 311/466 (67%), Gaps = 19/466 (4%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVS--PKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             R VGGTE+ WCRA++GGTGI V+A L+S  PK  +   L+N L K+   HP LRS  R++
Sbjct  13    RPVGGTEYSWCRAIAGGTGIAVIALLLSRTPKLEN---LQNTLDKLQIHHPTLRSTFRFD  69

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
             A+T +FS A  A+  + I PFD+ ST QI+R       D     P  IILEHEL+ NA W
Sbjct  70    ASTSSFSLATPASSRVVIHPFDSSSTAQIIRD-----SDDPCAEPHRIILEHELNKNA-W  123

Query  1248  RNPASFPPSGADVLFASLYALPEEGGH-VMALRFHTAVCDRTTVVSllgelmelmregt-  1075
              +P  +      V F SLY L   G   V+  R +T  CDRT+ V+LL E M        
Sbjct  124   IDPHRWSNGECGVFFVSLYDLRGGGEERVLTFRLNTGACDRTSAVTLLREFMRETTVADG  183

Query  1074  --LKGIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGP-RH  904
                  +  E      IE+++PS K  K  WA GID+LGYS+N+FR +NL F D + P R 
Sbjct  184   CCDGHVAKEAGLGKAIEDMIPSGKGDKPFWARGIDVLGYSLNAFRFSNLSFVDAEEPNRR  243

Query  903   SLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVT  724
             S VV+++L    T +++AGCK+ GIKL   + AAG+++A++S+   +  Q Q +KY VVT
Sbjct  244   SQVVRMKLERDQTLKLVAGCKARGIKLWAAIAAAGMISAYTSK---NLPQYQGEKYAVVT  300

Query  723   LTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDM  544
             L+DCRSIL+PPL+ + +GFYHS IL+ H + G E+LWD+AKR Y +F ++K +NKHF+DM
Sbjct  301   LSDCRSILEPPLTPNDFGFYHSGILHTHDITGEEKLWDLAKRCYDSFTSAKNSNKHFTDM  360

Query  543   ADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGV  364
             +DLNFLMCKAI+NP LT SSSLR+A+I++FE+PV  +         GV+DY+GC+S+HGV
Sbjct  361   SDLNFLMCKAIENPTLTPSSSLRTALISIFEDPVTDEYPEQALASAGVKDYIGCASIHGV  420

Query  363   GPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDAT  226
             GPSIA+FD++ DGKLDC+ VYPSP+HSREQM  L++ MK IL++ +
Sbjct  421   GPSIAVFDSLRDGKLDCSFVYPSPVHSREQMDGLIEHMKAILLEGS  466



>ref|XP_004149221.1| PREDICTED: uncharacterized protein LOC101208906 [Cucumis sativus]
 gb|KGN59146.1| hypothetical protein Csa_3G777540 [Cucumis sativus]
Length=526

 Score =   429 bits (1102),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 242/489 (49%), Positives = 323/489 (66%), Gaps = 17/489 (3%)
 Frame = -3

Query  1665  LCNKTTTIMSVRKGA----DENNKERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTC  1498
             LC  T T   +   +       +K R VGGTEH WCRAV GGTG TVL  L+S K  D  
Sbjct  40    LCTPTVTTSEMSDQSLPPPPAESKSRPVGGTEHSWCRAVPGGTGTTVLGLLLS-KPPDIP  98

Query  1497  LLRNALHKILNAHPILRSKLRYNAATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsd  1318
              L+++LH + N HPILRSK+ ++ + + FSF I  +P + +   D  +T + + S  D+D
Sbjct  99    HLQSSLHTLQNLHPILRSKIHHDPSRRDFSFLIPPSPPLHLQILDLAATARAIASHPDAD  158

Query  1317  ddvvspsPFHIILEHELSNNAAWRNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAV  1138
             D  VS   FH I EHE+ N   W +P     S  DV+FA++Y + E    V  L  HTA 
Sbjct  159   DPSVSD--FHKIHEHEI-NRVMWFDPTHPSYSDTDVMFATVYTVSESQWAVF-LSLHTAT  214

Query  1137  CDRTTVVSllgelmelmregtLKGIK-----NEGEGSFGIENVVPSEKSKKRLWAHGIDM  973
             CDR    +LL EL+ L   G           + GE   GIE+++P+ K+ K LWA G DM
Sbjct  215   CDRAAAAALLRELLVLAAGGGEIEGGGFETGDNGEVGLGIEDLIPNGKANKSLWARGFDM  274

Query  972   LGYSVNSFRLTNLKFNDVKGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLM  793
             LGYS+NSFRL NL+F D    R S +++L++N   T ++LAGCK  GIKLCG L AAGL+
Sbjct  275   LGYSLNSFRLANLEFKDPNTERFSQMIRLRMNSDETQKLLAGCKLRGIKLCGALAAAGLI  334

Query  792   AAHSSRSQWDHHQQQKKKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLW  613
             A   S+     +Q  K+KY VVTL DCRS+LDPPL+SHH GFYHSAILN H +   + +W
Sbjct  335   ATRCSKDHLPPYQ--KEKYAVVTLNDCRSLLDPPLTSHHLGFYHSAILNTHDISAEDTVW  392

Query  612   DMAKRSYSAFENSKKTNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYD  433
             ++A R Y +F N+K  NKHFSDM+DLNFLMCKAI+NP LT SSS+R+A+I+VFE+P++ +
Sbjct  393   EVASRCYFSFSNAKDNNKHFSDMSDLNFLMCKAIENPSLTPSSSMRTALISVFEDPII-E  451

Query  432   ISADIQRELGVEDYVGCSSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDE  253
             IS   Q+ LG+ DY+G +S HGVGPSIAIFDT+ DG+LD ACVYPSPL SR+QM+ + D+
Sbjct  452   ISGPEQQNLGLHDYIGYASAHGVGPSIAIFDTIRDGQLDSACVYPSPLFSRDQMNRIFDD  511

Query  252   MKRILIDAT  226
             MK+IL++++
Sbjct  512   MKKILVNSS  520



>ref|XP_004164825.1| PREDICTED: uncharacterized LOC101208906 [Cucumis sativus]
Length=526

 Score =   428 bits (1101),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 242/489 (49%), Positives = 323/489 (66%), Gaps = 17/489 (3%)
 Frame = -3

Query  1665  LCNKTTTIMSVRKGA----DENNKERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTC  1498
             LC  T T   +   +       +K R VGGTEH WCRAV GGTG TVL  L+S K  D  
Sbjct  40    LCTPTVTTSEMSDQSLPPPPAESKSRPVGGTEHSWCRAVPGGTGTTVLGLLLS-KPPDIP  98

Query  1497  LLRNALHKILNAHPILRSKLRYNAATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsd  1318
              L+++LH + N HPILRSK+ ++ + + FSF I  +P + +   D  +T + + S  D+D
Sbjct  99    HLQSSLHTLQNLHPILRSKIHHDPSRRDFSFLIPPSPPLHLQILDLAATARAIASHPDAD  158

Query  1317  ddvvspsPFHIILEHELSNNAAWRNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAV  1138
             D  VS   FH I EHE+ N   W +P     S  DV+FA++Y + E    V  L  HTA 
Sbjct  159   DPSVSD--FHKIHEHEI-NRVMWFDPTHPSYSDTDVMFATVYTVSESQWAVF-LSLHTAT  214

Query  1137  CDRTTVVSllgelmelmregtLKGIK-----NEGEGSFGIENVVPSEKSKKRLWAHGIDM  973
             CDR    +LL EL+ L   G           + GE   GIE+++P+ K+ K LWA G DM
Sbjct  215   CDRAAAAALLRELLVLAAGGGEIEGGGFETGDNGEIGLGIEDLIPNGKANKSLWARGFDM  274

Query  972   LGYSVNSFRLTNLKFNDVKGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLM  793
             LGYS+NSFRL NL+F D    R S +++L++N   T ++LAGCK  GIKLCG L AAGL+
Sbjct  275   LGYSLNSFRLANLEFKDPNTERFSQMIRLRMNSDETQKLLAGCKLRGIKLCGALAAAGLI  334

Query  792   AAHSSRSQWDHHQQQKKKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLW  613
             A   S+     +Q  K+KY VVTL DCRS+LDPPL+SHH GFYHSAILN H +   + +W
Sbjct  335   ATRCSKDHLPPYQ--KEKYAVVTLNDCRSLLDPPLTSHHLGFYHSAILNTHDISAEDTVW  392

Query  612   DMAKRSYSAFENSKKTNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYD  433
             ++A R Y +F N+K  NKHFSDM+DLNFLMCKAI+NP LT SSS+R+A+I+VFE+P++ +
Sbjct  393   EVASRCYFSFSNAKDNNKHFSDMSDLNFLMCKAIENPSLTPSSSMRTALISVFEDPII-E  451

Query  432   ISADIQRELGVEDYVGCSSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDE  253
             IS   Q+ LG+ DY+G +S HGVGPSIAIFDT+ DG+LD ACVYPSPL SR+QM+ + D+
Sbjct  452   ISGPEQQNLGLHDYIGYASAHGVGPSIAIFDTIRDGELDSACVYPSPLFSRDQMNRIFDD  511

Query  252   MKRILIDAT  226
             MK+IL++++
Sbjct  512   MKKILVNSS  520



>ref|XP_006403785.1| hypothetical protein EUTSA_v10010329mg [Eutrema salsugineum]
 gb|ESQ45238.1| hypothetical protein EUTSA_v10010329mg [Eutrema salsugineum]
Length=477

 Score =   426 bits (1095),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 225/475 (47%), Positives = 310/475 (65%), Gaps = 26/475 (5%)
 Frame = -3

Query  1611  NKERVVGGTEHGWCRAVSGGTGITVLAFLVS--PKAADTCLLRNALHKILNAHPILRSKL  1438
             ++ R VGGTE+ WCRA++GGTGI V+A L+S  PK  +   L+N L K+   HPILRS +
Sbjct  12    SETRPVGGTEYSWCRAITGGTGIAVIALLLSRTPKLEN---LQNTLDKLQIYHPILRSNI  68

Query  1437  RYNAATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNN  1258
             R++A++ +FSF  SA   ++I PFD+ ST QI+R       D     P  IILEHEL+ N
Sbjct  69    RFDASSNSFSFVTSADSRVEIQPFDSASTAQIIRD-----SDDPCAEPHRIILEHELNKN  123

Query  1257  AAWRNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmreg  1078
               W +P  +    A V F S+Y + +    ++  R +T  CDRT+ V+LL E M      
Sbjct  124   T-WIDPHRWTNGEAGVFFVSIYDVRDGEERILTFRLNTGACDRTSAVTLLREFMRETATA  182

Query  1077  tLKGI----------KNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKF  928
                            +  G G   IE +VPS K  K  WA GID+LGYS+N+FR +NL F
Sbjct  183   AAGDGCGGGGNGPVAETAGLGK-AIEEMVPSGKGNKPFWARGIDVLGYSLNAFRFSNLSF  241

Query  927   NDVKGP-RHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQ  751
              D +   R S VV+++L    T +++AGCK+ GIKL   + A+GL++A+SS+      Q 
Sbjct  242   VDAEDSNRRSQVVRMKLERDETLKLVAGCKARGIKLWAAIAASGLISAYSSKKL---PQN  298

Query  750   QKKKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSK  571
             Q +KY VVTL+DCRSIL+PPL+ + +GFYHS IL+ H + G E+LWD+AKR Y +F ++K
Sbjct  299   QGEKYAVVTLSDCRSILEPPLTPNDFGFYHSGILHTHDITGEEKLWDLAKRCYDSFTSAK  358

Query  570   KTNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDY  391
              +NK F+DM+DLNFLMCKAI+NP LT SSSLR+A I++FE+PV  + +      + V DY
Sbjct  359   NSNKQFTDMSDLNFLMCKAIENPNLTPSSSLRTAFISIFEDPVTDEYTEPALVSVAVRDY  418

Query  390   VGCSSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDAT  226
             +GC+S+HGVGPS+A+FD++ DGKLDCA VYPSPLHSREQM  L+  MK IL+  +
Sbjct  419   IGCASIHGVGPSVAVFDSLRDGKLDCAFVYPSPLHSREQMDGLIQHMKAILLQGS  473



>ref|XP_002876159.1| hypothetical protein ARALYDRAFT_906638 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52418.1| hypothetical protein ARALYDRAFT_906638 [Arabidopsis lyrata subsp. 
lyrata]
Length=470

 Score =   425 bits (1092),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 227/466 (49%), Positives = 311/466 (67%), Gaps = 19/466 (4%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVS--PKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             R VGGTE+ WCRA+ GGTGI V+A L+S  PK  +   L+N L K+   HP LRS +R++
Sbjct  13    RPVGGTEYSWCRAIDGGTGIAVIALLLSRTPKLQN---LQNTLDKLQIYHPTLRSNIRFD  69

Query  1428  AATKAFSFAISATPD--IQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNA  1255
             A+  +FSF +++  D  ++I PFD+ ST QI+R       D     P  IILEHEL+ N 
Sbjct  70    ASANSFSFVVTSAADSRVEIHPFDSESTAQIIRD-----SDDPCADPHRIILEHELNKNT  124

Query  1254  AWRNPASFPPSGADVLFASLYALPEEGGH-VMALRFHTAVCDRTTVVSllgelmelmreg  1078
              W NP  +  S + V   SLY L ++G   ++A R +TA  DRT  V+LL E M+     
Sbjct  125   -WINPHRWINSESRVFIVSLYDLTDDGEQRILAFRLNTAAVDRTAAVTLLREFMKETASH  183

Query  1077  tLKGIKNEGEG-SFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGP-RH  904
               +       G  + IE ++PS K  K  WA GID+LGYS+N+FR TNL F D +   R 
Sbjct  184   GCENGPVTAAGLGYPIEELIPSGKGNKPFWARGIDVLGYSLNAFRFTNLNFVDAENSNRR  243

Query  903   SLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVT  724
             S VV+L+L    T +++AGCK+ G+KL   L A+GL+AA+SS++   +   Q +KY VVT
Sbjct  244   SQVVRLKLERDQTLKLVAGCKARGLKLWATLAASGLIAAYSSKNPTPY---QGEKYAVVT  300

Query  723   LTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDM  544
             L+DCRSIL+PPL+S+ +GFYH+ IL+ H + G E LWD+AKR Y +F ++K +NK F+DM
Sbjct  301   LSDCRSILEPPLTSNDFGFYHAGILHTHDLTGEETLWDLAKRCYDSFTSAKNSNKQFTDM  360

Query  543   ADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGV  364
             +DLNFLMCKAI+NP LT SSSLR+A I++FE+PV+ +        +GV DY+GC+S+HGV
Sbjct  361   SDLNFLMCKAIENPNLTPSSSLRTAFISIFEDPVIDESPEPELASVGVHDYIGCASIHGV  420

Query  363   GPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDAT  226
             GPS+A+FD + DGKLDC  VYPSPLHSREQM  L+  MK IL++ +
Sbjct  421   GPSVAVFDALRDGKLDCTFVYPSPLHSREQMDGLIQHMKTILLEGS  466



>emb|CDX78109.1| BnaA09g33040D [Brassica napus]
Length=470

 Score =   422 bits (1085),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 225/466 (48%), Positives = 309/466 (66%), Gaps = 19/466 (4%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVS--PKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             R VGGTE+ WCRA++GGTGI V+A L+S  PK  +   L+N L K+   HP LRS   ++
Sbjct  13    RPVGGTEYSWCRAIAGGTGIAVIALLLSRTPKLEN---LQNTLDKLQIHHPTLRSTFGFD  69

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
             A+T +FS A  A+  + I PFD+ ST QI+R       D     P  IILEHEL+ NA W
Sbjct  70    ASTSSFSLATPASSRVVIHPFDSSSTAQIIRD-----SDDPCAEPHRIILEHELNKNA-W  123

Query  1248  RNPASFPPSGADVLFASLYALPEEGGH-VMALRFHTAVCDRTTVVSllgelmelmregt-  1075
              +P  +      V F SLY L   G   V+  R +T  CDRT+ V+LL E M        
Sbjct  124   IDPHRWSNGECGVFFVSLYDLRGGGEERVLTFRLNTGACDRTSAVTLLREFMRETTVADG  183

Query  1074  --LKGIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGP-RH  904
                  +  E      IE+++PS K  K  WA GID+LGYS+N+FR +NL F D + P R 
Sbjct  184   CCDGHVAKEAGLGKAIEDMIPSGKGDKPFWARGIDVLGYSLNAFRFSNLSFVDAEEPNRR  243

Query  903   SLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVT  724
             S VV+++L    T +++AGCK+ GIKL   + AAG+++A++S+   +  Q Q +KY VVT
Sbjct  244   SQVVRMKLERDQTLKLVAGCKARGIKLWAAIAAAGMISAYTSK---NLPQYQGEKYAVVT  300

Query  723   LTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDM  544
             L+DCRSIL+PPL+ + +GFYHS IL+ H + G E+LWD+AKR Y +F ++K +NKHF+DM
Sbjct  301   LSDCRSILEPPLTPNDFGFYHSGILHTHDITGEEKLWDLAKRCYDSFTSAKNSNKHFTDM  360

Query  543   ADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGV  364
             +DLNFLMCKAI+NP LT SSSLR+A+I++FE+PV  +         GV+DY+GC+S+HGV
Sbjct  361   SDLNFLMCKAIENPTLTPSSSLRTALISIFEDPVTDEYPEQALASAGVKDYIGCASIHGV  420

Query  363   GPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDAT  226
             GPSIA+FD++ DGK DC+ VYPSP+HSREQM  L++ MK IL++ +
Sbjct  421   GPSIAVFDSLRDGKFDCSFVYPSPVHSREQMDGLIEHMKAILLEGS  466



>ref|XP_010426882.1| PREDICTED: uncharacterized protein LOC104711812 [Camelina sativa]
Length=475

 Score =   422 bits (1084),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 231/471 (49%), Positives = 311/471 (66%), Gaps = 24/471 (5%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVS--PKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             R VGGTE+ WCRA+ GGTGI V+A L+S  PK  +   L+N L K+   HP LRS LRY+
Sbjct  13    RPVGGTEYSWCRAIDGGTGIAVIALLLSRTPKLQN---LQNTLDKLQIYHPTLRSTLRYD  69

Query  1428  AATKAFSFAISATPD-IQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAA  1252
             A+  +FSF +SA    + I PFD+ ST +I+R       D     P  IILEHEL+ N  
Sbjct  70    ASANSFSFVVSAVDSRVVIHPFDSESTARIIRD-----SDDPRADPHRIILEHELNKNT-  123

Query  1251  WRNPASFPPSGADVLFASLYALPEEGGH-VMALRFHTAVCDRTTVVSllgelmelmregt  1075
             W +P  +  S + V   SLY L ++G   V+  R +T  CDRT  V+LL E M+    G 
Sbjct  124   WIDPHRWINSESAVFVVSLYDLTDDGEQRVLTFRLNTGACDRTAAVTLLREFMKETAAGD  183

Query  1074  LKG---IKNEGEGSFG----IENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVK  916
               G   +  E     G    IE ++PS K  K  WA G+D+LGYS+N+FR +NL F D +
Sbjct  184   GCGNGPVAAETTVKLGLGKAIEELIPSGKGNKPFWARGMDVLGYSLNAFRFSNLNFVDAE  243

Query  915   GP-RHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKK  739
              P + S VV+L+L    T +++AGCK+ GIKL   L ++GL+AA+SS+   +    Q +K
Sbjct  244   EPNKRSQVVRLKLERDETLKLVAGCKARGIKLWAALASSGLIAAYSSK---NLPPDQGEK  300

Query  738   YGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNK  559
             Y VVTL+DCRSIL+PPL+S+ +GFYH+ IL+ H + G   LWD+AKR Y +F ++K +NK
Sbjct  301   YAVVTLSDCRSILEPPLTSNDFGFYHAGILHTHDITGEGTLWDLAKRCYDSFTSAKNSNK  360

Query  558   HFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCS  379
             HF+DM+DLNFLMCKAI+NP LT SSSLR+A I++FE+PV+ +        LGV DY+GC+
Sbjct  361   HFTDMSDLNFLMCKAIENPNLTPSSSLRTAFISIFEDPVIDESPEPELASLGVRDYIGCA  420

Query  378   SVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDAT  226
             S+HGVGPS+A+FD + DGKLDCA VYPSPLHSREQM  L+  MK IL++ +
Sbjct  421   SIHGVGPSLAVFDALRDGKLDCAFVYPSPLHSREQMDGLIQHMKTILLEGS  471



>ref|XP_007145293.1| hypothetical protein PHAVU_007G226900g [Phaseolus vulgaris]
 ref|XP_007145294.1| hypothetical protein PHAVU_007G226900g [Phaseolus vulgaris]
 gb|ESW17287.1| hypothetical protein PHAVU_007G226900g [Phaseolus vulgaris]
 gb|ESW17288.1| hypothetical protein PHAVU_007G226900g [Phaseolus vulgaris]
Length=471

 Score =   420 bits (1079),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 242/460 (53%), Positives = 321/460 (70%), Gaps = 17/460 (4%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             + R  GGTE+ WC+AV  GTG+TVL  L+S K  +  +L+NALH + N+HPILRSK+  +
Sbjct  19    EARAFGGTEYSWCKAVPIGTGVTVLGLLLS-KPPEITILQNALHNLQNSHPILRSKIHLD  77

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
              +T+ F F   A+ ++Q+  FD  ST +I++++++ DDD      FH +LE +L N+  W
Sbjct  78    PSTQTFQFLTPASSNVQVQQFDLASTARIVQAQSNGDDDP-----FHTLLEDQL-NDKTW  131

Query  1248  RNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLK  1069
                  + P   DVL+AS+Y L  +   V  LR HTA CDR   V+LL EL+ L       
Sbjct  132   ---CDYAPRNLDVLYASVYTLAHDRVAVF-LRLHTAACDRAAAVALLRELLHLFSGAGTA  187

Query  1068  GIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLVVK  889
              I  EG+ S  IE+++P  K  K  WA G+D+LGYS N+ R +NL F D    R S +V+
Sbjct  188   EI-GEGKVSLAIEDLIPEGKMHKPFWARGLDVLGYSFNALRFSNLNFVDAASLRRSRIVR  246

Query  888   LQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTDCR  709
             LQLN   T  +LAGCKS GIKLCG L AAG+MAA +S+   ++   Q++KY VVTL DCR
Sbjct  247   LQLNAEETKNLLAGCKSRGIKLCGALAAAGMMAAWTSKCLPNY---QREKYAVVTLVDCR  303

Query  708   SILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADLNF  529
              +LDP L S+H GFYHSAILN H V   E LW++AKRSY++F N+   NKHFSDM+DLN+
Sbjct  304   PLLDPVLPSNHAGFYHSAILNTHDV-CEEALWELAKRSYTSFINAMNCNKHFSDMSDLNY  362

Query  528   LMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPSIA  349
             LMCKAIDNPGLT SSSLR+A+I+VFE+PV  D SA++  E+G+EDYVGC+S HGVGPSIA
Sbjct  363   LMCKAIDNPGLTPSSSLRTALISVFEDPVFGD-SAEMHGEIGLEDYVGCASAHGVGPSIA  421

Query  348   IFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDA  229
             +FDT+ +GKLDCAC+YP PLHSREQ+  LVD MKR+L+++
Sbjct  422   LFDTIRNGKLDCACIYPWPLHSREQIQGLVDHMKRLLVES  461



>ref|XP_009383682.1| PREDICTED: uncharacterized protein LOC103971395 [Musa acuminata 
subsp. malaccensis]
Length=459

 Score =   412 bits (1059),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 223/462 (48%), Positives = 310/462 (67%), Gaps = 16/462 (3%)
 Frame = -3

Query  1620  DENNKERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSK  1441
             D     R VGGTE+ WCRAV GGTGITVLA L+S +     LL +ALH++ ++HP+LR+ 
Sbjct  3     DGTADGRPVGGTEYSWCRAVEGGTGITVLALLLS-RPVSRPLLDSALHQLQSSHPLLRAH  61

Query  1440  LRYNAATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSN  1261
             L   A+   F FAI ATP  ++       +   L     +    VS SPFH +LEHE + 
Sbjct  62    LVTVASRHPF-FAI-ATPRSEVL---RLLSSSDLLLPPPASASAVSVSPFHALLEHEFN-  115

Query  1260  NAAWRNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmre  1081
                 +NP S       VLFA+LY +PE G   +ALR HTAVCDRT+ V++L EL+ LM  
Sbjct  116   ----QNPWSDGGPTHQVLFATLYEMPEPGRSTLALRLHTAVCDRTSAVAVLKELLALMDA  171

Query  1080  gtLKGIKNEGEG-SFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRH  904
                + I  E +G + GI++++P + + K  WA G D++GYS+N+ R + L+F D    R 
Sbjct  172   SGER-IHGEADGFNRGIDDLIPKQDAWKPFWARGKDLVGYSLNALRTSTLRFEDAASERR  230

Query  903   SLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVT  724
             S V +L L    T ++L  C+  GIKLCG L+AA ++A  +S+ QWD+ + +   Y V+T
Sbjct  231   SQVARLVLGTDDTQKLLTACRKRGIKLCGALSAAAMVATRASK-QWDNDRYET--YSVIT  287

Query  723   LTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDM  544
             L DCR  LDPPL  H+ GFYHSA++N H++ GGE LW++A+R   ++  +    KH  D+
Sbjct  288   LIDCRKYLDPPLHDHNIGFYHSALINTHSIHGGEGLWEVAERCQCSYSTAMTNKKHLKDI  347

Query  543   ADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGV  364
              ++N+LM +AID+P LT SS+LR+A+++VFEEPVVY+ SA +Q +LG++DYVGC+S HGV
Sbjct  348   GEVNYLMGRAIDHPHLTNSSALRTALVSVFEEPVVYESSAALQHQLGLDDYVGCASAHGV  407

Query  363   GPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRIL  238
             GPSIA+FDT+ DG+LDCACVYPSPLHSR+QM ELV++MKRIL
Sbjct  408   GPSIAVFDTIRDGQLDCACVYPSPLHSRKQMQELVEQMKRIL  449



>ref|XP_010504007.1| PREDICTED: uncharacterized protein LOC104781109 [Camelina sativa]
Length=469

 Score =   412 bits (1058),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 231/466 (50%), Positives = 312/466 (67%), Gaps = 20/466 (4%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVS--PKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             R VGGTE+ WCRA+ GGTGI V+A L+S  PK  +   L+N L K+   HP LRS LRY+
Sbjct  13    RPVGGTEYSWCRAIDGGTGIAVIALLLSRTPKLQN---LQNTLDKLQIYHPTLRSTLRYD  69

Query  1428  AATKAFSFAISATPD-IQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAA  1252
             A+T +FSF +SA    + I PFD+ ST QI+R       D     P  IILEHEL+ N  
Sbjct  70    ASTSSFSFVVSAADSRVVIHPFDSESTAQIIRD-----SDDPRADPHRIILEHELNKNT-  123

Query  1251  WRNPASFPPSGADVLFASLYALPEEGGH-VMALRFHTAVCDRTTVVSllgelmelmregt  1075
             W +P  +  S + V   SLY L ++G   V+  R +T  CDRT  V+LL E M+    G 
Sbjct  124   WIDPHRWINSESAVFVVSLYDLTDDGEQRVLTFRLNTGACDRTAAVTLLREFMKETAAGN  183

Query  1074  --LKGIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGP-RH  904
                  +   G G   IE ++PS K  K  WA G+D+LGYS+N+FR +NL F D + P R 
Sbjct  184   GCDGPVTAAGLGK-AIEELIPSGKGNKPFWARGMDVLGYSLNAFRFSNLNFVDAEEPNRR  242

Query  903   SLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVT  724
             S VV+L+L    T +++AGCK+ G+KL   + ++GL+AA+SS++       Q +KY VVT
Sbjct  243   SQVVRLKLERDETLKLVAGCKARGLKLWAAIASSGLIAAYSSKNL---PPDQGEKYAVVT  299

Query  723   LTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDM  544
             L+DCRSIL+PPL+S+ +GFYH+ IL+ H + G E LWD+AKR Y +F ++K +NKHF+DM
Sbjct  300   LSDCRSILEPPLTSNDFGFYHAGILHTHDITGEETLWDLAKRCYDSFTSAKNSNKHFTDM  359

Query  543   ADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGV  364
             +DLNFLMCKAI+NP +T SSSLR+A I++FE+PV+ +        LGV DY+GC+S+HGV
Sbjct  360   SDLNFLMCKAIENPNVTPSSSLRTAFISIFEDPVIDESPEPELASLGVRDYIGCASIHGV  419

Query  363   GPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDAT  226
             GPS+A+FD + DGKLDCA VYPSPLHSREQM  L+  MK IL++ +
Sbjct  420   GPSLAVFDALRDGKLDCAFVYPSPLHSREQMDGLIQHMKTILLEGS  465



>ref|XP_009393392.1| PREDICTED: uncharacterized protein LOC103979089 [Musa acuminata 
subsp. malaccensis]
Length=451

 Score =   409 bits (1052),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 221/469 (47%), Positives = 303/469 (65%), Gaps = 27/469 (6%)
 Frame = -3

Query  1623  ADENNKERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRS  1444
             AD     R VGGTEH WCR+V GGTG+ VL F +S +     LL +ALH++  +HP+LRS
Sbjct  2     ADPTAAGRRVGGTEHSWCRSVPGGTGVLVLGFFLS-RPVPRPLLESALHRLQTSHPLLRS  60

Query  1443  KLRYNAATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELS  1264
             +L      + F F+I+ +P + + P  A   LQ             SPS FH +LEHEL+
Sbjct  61    RLNTAGPDQPF-FSIAHSPSLTVRPLSASDILQ---------SPPASPSHFHALLEHELN  110

Query  1263  NNAAWRNPASFPPSGADVLFASLYA-LPEEGGHVMALRFHTAVCDRTTVVSllgelmelm  1087
              N  W +PA   P    +LFA+ Y  +PE G  V+ALRFH+A CDRT+  ++L EL+ L+
Sbjct  111   ENP-WSSPAPSHP----ILFATAYDDMPEAGRTVVALRFHSAACDRTSAAAILKELLRLI  165

Query  1086  regtLKGIKNEGEGSF--GIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKG  913
                     K E E  F   +E+++P + + K  WA G D++GYS+N  R + L+F D   
Sbjct  166   AG----STKEEEEEGFHRAMEDLIPKQDAWKPFWARGKDLVGYSLNGLRTSTLRFEDAGS  221

Query  912   PRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYG  733
              R S VV+L L +  T ++L  CK+  IKLCG ++AA L+A +SS+      + + + Y 
Sbjct  222   DRRSEVVRLVLGVDDTQKLLNACKAREIKLCGAMSAAALVATNSSKHL---EKDRAETYT  278

Query  732   VVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHF  553
             VVTL DCR  LDP L  H  G YHSA++N H V GGE LW++A+R + ++ N+    KH 
Sbjct  279   VVTLIDCRKYLDPVLHDHSIGSYHSAVINTHNVHGGEELWEVAERCHESYSNAVHKKKHL  338

Query  552   SDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSV  373
              D+ ++NFL+CKAIDNP LT SSS R+A+I+VFEEPVVYD S+++Q+ELGVEDY+ C+SV
Sbjct  339   KDITEINFLLCKAIDNPQLTPSSSQRTALISVFEEPVVYD-SSELQQELGVEDYIWCASV  397

Query  372   HGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDAT  226
             HG GPSIA+FDT+ DG+LDCA VYP+PLHSR+QM ELV+ MK IL   +
Sbjct  398   HGAGPSIAVFDTIRDGRLDCAFVYPTPLHSRKQMQELVEHMKTILTQGS  446



>emb|CAB89222.1| putative protein [Arabidopsis thaliana]
Length=465

 Score =   408 bits (1048),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 227/474 (48%), Positives = 315/474 (66%), Gaps = 30/474 (6%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVS--PKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             R VGGTE+ WCRA+ GGTGI V+A L+S  PK  +   L+N L K+   HP LRS +R++
Sbjct  3     RPVGGTEYSWCRAIDGGTGIAVIALLLSRTPKLQN---LQNTLDKLQIYHPTLRSNIRFD  59

Query  1428  AATKAFSFAISATPD--IQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNA  1255
             A+  +FSF +++  D  ++I PFD+ ST QI+R       D     P  IILEHE++ N 
Sbjct  60    ASANSFSFVVTSAADSHVEIHPFDSVSTAQIIRD-----SDDPCADPHRIILEHEMNKNT  114

Query  1254  AWRNPASFPPSGADVLFASLYALPEEGGH-VMALRFHTAVCDRTTVVSllgelmelmreg  1078
              W NP  +  S + V   SLY L ++G   ++  R +TA  DRT  V+LL E M+     
Sbjct  115   -WINPHRWIKSESRVFIVSLYDLTDDGEQRILTFRLNTAAVDRTAAVTLLREFMKETAA-  172

Query  1077  tLKGIKN-----EGEGSFG----IENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFN  925
                G  N       E + G    IE ++PS K  K  WA GID+LGYS+N+FR +NL F 
Sbjct  173   --DGFGNGPVVAATETAVGLGKAIEELIPSGKGDKPFWARGIDVLGYSLNAFRFSNLNFV  230

Query  924   DVKGP-RHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQ  748
             D +   R S +V+L+L+   T +++AGCK+ G+KL   L ++ L+AA+SS++   +   Q
Sbjct  231   DAENSNRRSQLVRLKLDRDQTLKLVAGCKARGLKLWAALASSALIAAYSSKNLPPY---Q  287

Query  747   KKKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKK  568
              +KY VVTL+DCRSIL+PPL+S+ +GFYH+ IL+ H + G E+LWD+AKR Y +F +SK 
Sbjct  288   GEKYAVVTLSDCRSILEPPLTSNDFGFYHAGILHTHDLTGEEKLWDLAKRCYDSFTSSKN  347

Query  567   TNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYV  388
             +NK F+DM+DLNFLMCKAI+NP LT SSSLR+A I++FE+PV+ +        LGV+DY+
Sbjct  348   SNKQFTDMSDLNFLMCKAIENPNLTPSSSLRTAFISIFEDPVIDESPEPELASLGVQDYI  407

Query  387   GCSSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDAT  226
             GC+S+HGVGPS+A+FD + DGKLDCA VYPSPLHSREQM  L+  MK IL++ +
Sbjct  408   GCASIHGVGPSVAVFDALRDGKLDCAFVYPSPLHSREQMDGLIQHMKTILLEGS  461



>ref|NP_566970.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAN13043.1| unknown protein [Arabidopsis thaliana]
 gb|AEE78969.1| uncharacterized protein AT3G52610 [Arabidopsis thaliana]
Length=475

 Score =   408 bits (1048),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 227/474 (48%), Positives = 315/474 (66%), Gaps = 30/474 (6%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVS--PKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             R VGGTE+ WCRA+ GGTGI V+A L+S  PK  +   L+N L K+   HP LRS +R++
Sbjct  13    RPVGGTEYSWCRAIDGGTGIAVIALLLSRTPKLQN---LQNTLDKLQIYHPTLRSNIRFD  69

Query  1428  AATKAFSFAISATPD--IQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNA  1255
             A+  +FSF +++  D  ++I PFD+ ST QI+R       D     P  IILEHE++ N 
Sbjct  70    ASANSFSFVVTSAADSHVEIHPFDSVSTAQIIRD-----SDDPCADPHRIILEHEMNKNT  124

Query  1254  AWRNPASFPPSGADVLFASLYALPEEGGH-VMALRFHTAVCDRTTVVSllgelmelmreg  1078
              W NP  +  S + V   SLY L ++G   ++  R +TA  DRT  V+LL E M+     
Sbjct  125   -WINPHRWIKSESRVFIVSLYDLTDDGEQRILTFRLNTAAVDRTAAVTLLREFMKETAA-  182

Query  1077  tLKGIKN-----EGEGSFG----IENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFN  925
                G  N       E + G    IE ++PS K  K  WA GID+LGYS+N+FR +NL F 
Sbjct  183   --DGFGNGPVVAATETAVGLGKAIEELIPSGKGDKPFWARGIDVLGYSLNAFRFSNLNFV  240

Query  924   DVKGP-RHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQ  748
             D +   R S +V+L+L+   T +++AGCK+ G+KL   L ++ L+AA+SS++   +   Q
Sbjct  241   DAENSNRRSQLVRLKLDRDQTLKLVAGCKARGLKLWAALASSALIAAYSSKNLPPY---Q  297

Query  747   KKKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKK  568
              +KY VVTL+DCRSIL+PPL+S+ +GFYH+ IL+ H + G E+LWD+AKR Y +F +SK 
Sbjct  298   GEKYAVVTLSDCRSILEPPLTSNDFGFYHAGILHTHDLTGEEKLWDLAKRCYDSFTSSKN  357

Query  567   TNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYV  388
             +NK F+DM+DLNFLMCKAI+NP LT SSSLR+A I++FE+PV+ +        LGV+DY+
Sbjct  358   SNKQFTDMSDLNFLMCKAIENPNLTPSSSLRTAFISIFEDPVIDESPEPELASLGVQDYI  417

Query  387   GCSSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDAT  226
             GC+S+HGVGPS+A+FD + DGKLDCA VYPSPLHSREQM  L+  MK IL++ +
Sbjct  418   GCASIHGVGPSVAVFDALRDGKLDCAFVYPSPLHSREQMDGLIQHMKTILLEGS  471



>gb|AAK59422.1| unknown protein [Arabidopsis thaliana]
Length=475

 Score =   407 bits (1047),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 227/474 (48%), Positives = 315/474 (66%), Gaps = 30/474 (6%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVS--PKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             R VGGTE+ WCRA+ GGTGI V+A L+S  PK  +   L+N L K+   HP LRS +R++
Sbjct  13    RPVGGTEYSWCRAIDGGTGIAVIALLLSRTPKLQN---LQNTLDKLQIYHPTLRSNIRFD  69

Query  1428  AATKAFSFAISATPD--IQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNA  1255
             A+  +FSF +++  D  ++I PFD+ ST QI+R       D     P  IILEHE++ N 
Sbjct  70    ASANSFSFVVTSAADSHVEIHPFDSVSTAQIIRD-----SDDPCAGPHRIILEHEMNKNT  124

Query  1254  AWRNPASFPPSGADVLFASLYALPEEGGH-VMALRFHTAVCDRTTVVSllgelmelmreg  1078
              W NP  +  S + V   SLY L ++G   ++  R +TA  DRT  V+LL E M+     
Sbjct  125   -WINPHRWIKSESRVFIVSLYDLTDDGEQRILTFRLNTAAVDRTAAVTLLREFMKETAA-  182

Query  1077  tLKGIKN-----EGEGSFG----IENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFN  925
                G  N       E + G    IE ++PS K  K  WA GID+LGYS+N+FR +NL F 
Sbjct  183   --DGFGNGPVVAATETAVGLGKAIEELIPSGKGDKPFWARGIDVLGYSLNAFRFSNLNFV  240

Query  924   DVKGP-RHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQ  748
             D +   R S +V+L+L+   T +++AGCK+ G+KL   L ++ L+AA+SS++   +   Q
Sbjct  241   DAENSNRRSQLVRLKLDRDQTLKLVAGCKARGLKLWAALASSALIAAYSSKNLPPY---Q  297

Query  747   KKKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKK  568
              +KY VVTL+DCRSIL+PPL+S+ +GFYH+ IL+ H + G E+LWD+AKR Y +F +SK 
Sbjct  298   GEKYAVVTLSDCRSILEPPLTSNDFGFYHAGILHTHDLTGEEKLWDLAKRCYDSFTSSKN  357

Query  567   TNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYV  388
             +NK F+DM+DLNFLMCKAI+NP LT SSSLR+A I++FE+PV+ +        LGV+DY+
Sbjct  358   SNKQFTDMSDLNFLMCKAIENPNLTPSSSLRTAFISIFEDPVIDESPEPELASLGVQDYI  417

Query  387   GCSSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDAT  226
             GC+S+HGVGPS+A+FD + DGKLDCA VYPSPLHSREQM  L+  MK IL++ +
Sbjct  418   GCASIHGVGPSVAVFDALRDGKLDCAFVYPSPLHSREQMDGLIQHMKTILLEGS  471



>gb|EPS67523.1| hypothetical protein M569_07254 [Genlisea aurea]
Length=481

 Score =   405 bits (1041),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 232/487 (48%), Positives = 307/487 (63%), Gaps = 49/487 (10%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNAA  1423
             R  G TE  WC+AV GGTGITVL+ L+S +  D+ LL+N+L K+  AHPILRSK+R++  
Sbjct  13    RPTGKTELSWCKAVPGGTGITVLSILISNRI-DSQLLQNSLRKLQIAHPILRSKIRFDPD  71

Query  1422  TKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAWRN  1243
             + +FS+AI   P +Q+  FD  ST QIL+S         S SP  ++LEHEL+ N  W N
Sbjct  72    SNSFSYAIPVNPAVQLQRFDLQSTAQILQS----SPAAASISPHQLLLEHELNINP-WGN  126

Query  1242  PASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLKGI  1063
              A  PPS  DV FASLY L E G  V+ALRFH +VCDR +  +LL EL+       +   
Sbjct  127   SA--PPSDTDVFFASLYEL-ESGKRVLALRFHASVCDRASASALLEELLRFAAAPEMAA-  182

Query  1062  KNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLVVKLQ  883
                 E   GIE  +PS ++ K  WA   DM GYS+NS R  +L F D   PR S V + Q
Sbjct  183   -ETAESGLGIEEYIPSGQADKPFWARAADMAGYSLNSLRFAHLNFVDRNSPRTSRVARFQ  241

Query  882   LNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSR--SQWDHHQQQKKKYGVVTLTDCR  709
             +    T +IL+ C++ G+KL   + AAGL+AAHSS+  S+ D+     +KY VVTL +CR
Sbjct  242   IGEQETDKILSECEAQGMKLSAAIAAAGLIAAHSSKRISEDDY-----EKYAVVTLVNCR  296

Query  708   SILDPPLSSHHYG-------------------------FYHSAILNMHTVKGGERLWDMA  604
              +LDP L ++  G                         FYHSAI+N H VKGGE LW +A
Sbjct  297   PLLDPVLDANQIGKRRPPPEKKKQFHRPLIAFITADAGFYHSAIINSHDVKGGETLWPLA  356

Query  603   KRSYSAFENSKKTNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISA  424
             KR +S+   +K   KHF+DM D+NF+ CKAI+NPG T S SLR++++TVFEEPV     +
Sbjct  357   KRVHSSLAKAKANRKHFTDMDDINFMTCKAIENPGFTPSRSLRTSLVTVFEEPV-----S  411

Query  423   DIQREL-GVEDYVGCSSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMK  247
             + QR + G+ED +GC SVHG+GPS+A+FD +  G+LDCACVYP PLHSREQ+ EL+DEMK
Sbjct  412   EEQRFVDGLEDVLGCFSVHGIGPSVAVFDAIRGGRLDCACVYPFPLHSREQIRELIDEMK  471

Query  246   RILIDAT  226
             RIL+D +
Sbjct  472   RILVDGS  478



>ref|XP_011004708.1| PREDICTED: uncharacterized protein LOC105111136, partial [Populus 
euphratica]
Length=385

 Score =   397 bits (1019),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 216/379 (57%), Positives = 267/379 (70%), Gaps = 16/379 (4%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R VGGTEH WCRAV GGTGI VLA L S K     +L NALHK+ N+HPILRS+L   
Sbjct  15    KARAVGGTEHSWCRAVPGGTGIAVLAILTS-KLPRNSVLENALHKLQNSHPILRSRLHSG  73

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
             + T  FSF  S TP I++  F+  ST +IL +    +    S SP H++LEHEL+ N+ W
Sbjct  74    SNTNTFSFITSPTPFIKLKAFNLSSTFKILEN--PLNPKNQSLSPLHLVLEHELNQNS-W  130

Query  1248  RNPASFPPSG---ADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmreg  1078
              N    P S     D+ FA+ YALP     V+ LR H + CDRTT VSLL EL+ L+ E 
Sbjct  131   YNHNKAPSSINEIQDMFFATTYALPN-AKWVLVLRLHASACDRTTAVSLLQELVVLVSEE  189

Query  1077  t----LKGIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGP  910
                   K I NEGE +  IE++VP++K+KK LW  GIDMLGYSVNS RLTNLKF D + P
Sbjct  190   ERGALQKEIANEGEVTSRIEDLVPNKKAKKGLWERGIDMLGYSVNSLRLTNLKFKDSRSP  249

Query  909   RHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGV  730
             R S VV+LQ+N   T  I+AGCKS GIKLCG L +AGL+AAH S+S+ D    +++KY V
Sbjct  250   RSSQVVRLQMNQKDTETIIAGCKSRGIKLCGALASAGLIAAHKSKSRVD----KQRKYAV  305

Query  729   VTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFS  550
             VTLTDCRS+LDP LS+HH+GFYHSAILN H +KGGE+LW++A+++Y+AF + K  N+HFS
Sbjct  306   VTLTDCRSVLDPTLSNHHFGFYHSAILNAHMMKGGEKLWELAQKTYAAFASYKNCNRHFS  365

Query  549   DMADLNFLMCKAIDNPGLT  493
             DMADLNFLMCKAIDNPGLT
Sbjct  366   DMADLNFLMCKAIDNPGLT  384



>ref|XP_006851439.1| hypothetical protein AMTR_s00040p00100620 [Amborella trichopoda]
 gb|ERN13020.1| hypothetical protein AMTR_s00040p00100620 [Amborella trichopoda]
Length=476

 Score =   398 bits (1022),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 214/464 (46%), Positives = 296/464 (64%), Gaps = 16/464 (3%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNAA  1423
             R  GGTE+ WCRAV GGTGITVL+ L+S K  D  +++  L  I+   P+LR KL + + 
Sbjct  23    RFTGGTENSWCRAVMGGTGITVLSLLLS-KPMDPTIIQETLQTIMTQSPLLRHKLVWESN  81

Query  1422  TKAFSFAISATPDIQITPFDAPSTLQILRSRTdsd-ddvvspsPFHIILEHELSNNAAWR  1246
             +K  SF++S+ P       D   TL++L   +D           FH +LEHEL+ N+ W 
Sbjct  82    SKNPSFSLSSNPSPNFEIIDTSPTLKLLGVLSDQTHLGNFIGDAFHCLLEHELNRNS-WC  140

Query  1245  NPASFPPSGADVLFASLYALPEEGGH-VMALRFHTAVCDRTTVVSllgelmelmregtLK  1069
             +  +  P   ++ F +LY L   G H +++LR HTA+CDR + V +L +++ L+ E    
Sbjct  141   DGLNEKP--MNMFFVTLYFLG--GSHSILSLRLHTAICDRASAVCILRKILRLVYERESG  196

Query  1068  GIKNEGEGSF---GIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSL  898
              I     G     GIE+++P  K+ K  WAHGID+LGYS+ S RLTN++F + K PR S 
Sbjct  197   VIGASETGDVVHEGIEDLIPKGKADKPFWAHGIDLLGYSLGSKRLTNIQFQETKLPRSSQ  256

Query  897   VVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLT  718
             +++LQ+    T R+LA C+  G+KLCG + AAGLMA   S+        Q + Y +VTL 
Sbjct  257   MIRLQMGYEETGRLLAECRRKGVKLCGAIAAAGLMAVSLSKQL----HNQCENYAIVTLI  312

Query  717   DCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMAD  538
             DCR +L+P L   + GFYHSAI+N  ++ G E LW +A R   A   +   NKHF+DM+D
Sbjct  313   DCRKMLEPALHDDNLGFYHSAIMNTISINGEEDLWQLANRFKEALNGTISRNKHFTDMSD  372

Query  537   LNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGP  358
             +N+LMCKAI  P  T  SSLR++ + VFE+ ++ D + D+Q ELGV DYVGCSSVHGVGP
Sbjct  373   VNYLMCKAISCPAFTPYSSLRTSFMVVFEDTLMDD-TQDLQEELGVLDYVGCSSVHGVGP  431

Query  357   SIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDAT  226
             SIA+FDTV +G+LDCACVYPSPLHSR+QMH L++ MK IL  A+
Sbjct  432   SIAVFDTVRNGQLDCACVYPSPLHSRKQMHGLIENMKNILTGAS  475



>emb|CBI30316.3| unnamed protein product [Vitis vinifera]
Length=387

 Score =   392 bits (1008),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 184/280 (66%), Positives = 228/280 (81%), Gaps = 5/280 (2%)
 Frame = -3

Query  1065  IKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLVVKL  886
             ++++GE S GIE+ +PS K+KK LW  G+DML YSVNS +LTNLKF D K PR S VV+L
Sbjct  103   MRDDGEVSLGIEDFIPSGKAKKALWVRGVDMLSYSVNSLQLTNLKFKDAKSPRSSEVVRL  162

Query  885   QLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTDCRS  706
             QLN   T  +LAGC + GIKLCG L AA L+A HSS+   DHH   K+KY VVTLTDCR 
Sbjct  163   QLNQDDTESLLAGCSAKGIKLCGALVAAALIAGHSSKRPADHH---KEKYAVVTLTDCRP  219

Query  705   ILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADLNFL  526
             ILDPPLS+HH+GFYHSA+LN  ++KGGE+LW++A+RSY AF NSK  NKHFSDMADLNFL
Sbjct  220   ILDPPLSTHHFGFYHSAVLNTLSMKGGEKLWELARRSYMAFANSKNCNKHFSDMADLNFL  279

Query  525   MCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQREL-GVEDYVGCSSVHGVGPSIA  349
             M KAI+NPGLT++SSLR++ +TVFE+PV ++ + +I RE+ G+EDY+GC+SVHG+GPSIA
Sbjct  280   MRKAIENPGLTSASSLRTSFLTVFEDPV-FETNDEIYREIVGLEDYIGCASVHGIGPSIA  338

Query  348   IFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDA  229
             IFDT+  G LDCACVYPSPLHSREQM EL+  MKR+L+DA
Sbjct  339   IFDTIRGGMLDCACVYPSPLHSREQMEELLHNMKRLLVDA  378


 Score = 83.2 bits (204),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNAA  1423
             R VGGTE+ WCRAV GGTG+  +A L+S K  +  LL++ALH + N H +L SKL Y   
Sbjct  13    RAVGGTENSWCRAVLGGTGVVTVALLLS-KPPEASLLQSALHTLQNRHALLGSKLHYGTT  71

Query  1422  TKAFSFAISATPDIQITPFDAPST  1351
             T  FSF  S  P +Q+  F+  ST
Sbjct  72    TNTFSFITSPIPPLQVKSFNLSST  95



>gb|KHN46024.1| hypothetical protein glysoja_040942 [Glycine soja]
Length=376

 Score =   388 bits (997),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 210/427 (49%), Positives = 265/427 (62%), Gaps = 57/427 (13%)
 Frame = -3

Query  1497  LLRNALHKILNAHPILRSKLRYNAATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsd  1318
             +L+ +L  +  +HPILRS+L+ NA T  FSF  S TP I I     P+ +          
Sbjct  1     MLQTSLRTLQTSHPILRSRLQTNATT--FSFLTSPTPSINILTLTLPTNV----------  48

Query  1317  ddvvspsPFHIILEHELSNNAAWRNPASFPPS--GADVLFASLYALPEEGGHVMALRFHT  1144
                    P   IL+         +  +S PPS          L+ L EE  +   +  + 
Sbjct  49    -----TDPLTHILDATRGTTPPPKKTSSSPPSTRAPAPTPGELFTLVEENNNKSLINQYP  103

Query  1143  AVCDRTTVVSllgelmelmregtLKGIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGY  964
                                          +   S  IE+++P  K KK +W  G+++L Y
Sbjct  104   -----------------------------QEATSLAIEDLLPRGKGKKPMWTRGLELLKY  134

Query  963   SVNSFRLTNLKFNDVKGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAH  784
             S+NSFRLTNLKF D K PR S VV+L+LN + T  +LAGCK +GIKLCG L AAGLMA H
Sbjct  135   SLNSFRLTNLKFVDAKNPRFSQVVRLELNQNDTKEVLAGCKLSGIKLCGALVAAGLMAVH  194

Query  783   SSRSQWDHHQQQKKKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMA  604
              S+       +  +KYGVVTLTDCRS L+P L+   +GFYHSAILN H +KGGE LWD+A
Sbjct  195   CSK-------RSSRKYGVVTLTDCRSSLEPSLTDK-FGFYHSAILNSHEMKGGETLWDLA  246

Query  603   KRSYSAFENSKKTNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISA  424
             KR+Y AF NSKK NKHFSDMADLNFLMCKAI+NPGLT SSSLR+++++VFE+  V+D   
Sbjct  247   KRTYEAFANSKKCNKHFSDMADLNFLMCKAIENPGLTPSSSLRTSIMSVFED-TVFDNGG  305

Query  423   DIQRELGVEDYVGCSSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKR  244
               QRE+GVEDY+GC+SVHGVGPSIAIFDT+ D  LDC CVYP+PLHSREQM E V++MK 
Sbjct  306   KKQREIGVEDYMGCASVHGVGPSIAIFDTIRDESLDCLCVYPTPLHSREQMIEFVEKMKV  365

Query  243   ILIDATK  223
             ILI+ATK
Sbjct  366   ILIEATK  372



>emb|CDP15443.1| unnamed protein product [Coffea canephora]
Length=419

 Score =   384 bits (986),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 188/280 (67%), Positives = 228/280 (81%), Gaps = 5/280 (2%)
 Frame = -3

Query  1065  IKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLVVKL  886
             +K + +   GIE+++PS  +KK LWAHGID+L YSVNS RLTNLKF DVK PR S V +L
Sbjct  144   VKYQEKMQQGIEDLIPSGMAKKTLWAHGIDVLEYSVNSLRLTNLKFKDVKWPRFSEVARL  203

Query  885   QLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTDCRS  706
             ++N H T++IL GCK  GIKLCG L AA L+AAHSSRS  D    Q+KKYGV+TLTDCRS
Sbjct  204   RMNPHETNQILVGCKLRGIKLCGALAAAALIAAHSSRSSPD----QRKKYGVLTLTDCRS  259

Query  705   ILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADLNFL  526
             ILDPPLS H++GFYH AILN H VKGG+ LWD+A R Y AF+NSKK NKHFSDMADLNFL
Sbjct  260   ILDPPLSPHNFGFYHGAILNSHAVKGGDNLWDLASRCYLAFDNSKKCNKHFSDMADLNFL  319

Query  525   MCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPSIAI  346
             +C+AI+NP LTASSSLR++ I+VFEEPV+ D S  IQ+ +G++DY+GC+S+HG GPSIA 
Sbjct  320   LCRAIENPSLTASSSLRTSFISVFEEPVI-DNSNQIQKGVGLDDYLGCASIHGAGPSIAF  378

Query  345   FDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDAT  226
             FDT+ DGKLDC CVYPSPLHSR QM ELV++MK +L+DAT
Sbjct  379   FDTIRDGKLDCLCVYPSPLHSRAQMEELVEKMKAVLVDAT  418


 Score = 84.0 bits (206),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 58/94 (62%), Gaps = 7/94 (7%)
 Frame = -3

Query  1626  GADENNKERV------VGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILN  1465
             G + N+ +RV       G TEH WCRA+S GTG+ VL   +S +A +  + + AL K+ +
Sbjct  38    GKNHNDGQRVEPISRPAGNTEHSWCRALSQGTGVAVLTLQLS-QAIEIPIFQQALRKLQD  96

Query  1464  AHPILRSKLRYNAATKAFSFAISATPDIQITPFD  1363
             AHPILRSKL YN + KAFSF   AT  IQ+   +
Sbjct  97    AHPILRSKLHYNPSKKAFSFTTPATSHIQVQSLE  130



>ref|XP_008806095.1| PREDICTED: uncharacterized protein LOC103718873 [Phoenix dactylifera]
Length=467

 Score =   376 bits (966),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 217/463 (47%), Positives = 296/463 (64%), Gaps = 21/463 (5%)
 Frame = -3

Query  1611  NKERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRY  1432
             +K R VGGTE  WC+AV GGTGITVLA  +S +      L++AL  +  +HPIL + L  
Sbjct  11    SKGRPVGGTEFSWCQAVPGGTGITVLAIFLS-RPVSLPALQSALQSLQTSHPILSAVLAA  69

Query  1431  NAATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAA  1252
                 +      S+ P +++    A   +  L S +            H +LEHEL+    
Sbjct  70    ADTPQPLLSIPSSPPPLRLRRLPAADLIAALPSASH----------LHSLLEHELN----  115

Query  1251  WRNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtL  1072
              +NP S P     V FA+LY LPE G  V+ALRFHTAVCDRT  V++L EL++ +   + 
Sbjct  116   -QNPWSDPADETGVFFATLYELPEPGRSVLALRFHTAVCDRTAGVAVLKELLDRLGGDSG  174

Query  1071  KGIKNEGEGS-FGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLV  895
                K + EG   GIE+++P + + K  WA G D++GYS+N  R + L+F+D    R S V
Sbjct  175   NSGKGKEEGIILGIEDLIPKKDAWKPFWARGRDLVGYSMNGLRASTLRFDDAGSDRASRV  234

Query  894   VKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTD  715
             V+L L+L  T  +L  CK+  +KLC  ++AA L+AAHSS+        Q++ Y V TL D
Sbjct  235   VRLVLSLEETQGLLTACKAREVKLCAAMSAAALVAAHSSQH---FESNQQRSYMVATLID  291

Query  714   CRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADL  535
              R  L P L  ++ GFYHS I+N + V GGE LW++A R  SA+ N+ K  KH +D+ +L
Sbjct  292   SRKYLKPVLHDNNIGFYHSGIINSYAVHGGEDLWELANRCQSAYSNAMKNKKHLTDIGEL  351

Query  534   NFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPS  355
             NFLMCKAI NP LT +SSLR+A+I+VF+EPV+ + S+++Q+ LGVEDYVGCSSVHGVGPS
Sbjct  352   NFLMCKAIQNPHLTPASSLRTALISVFDEPVISE-SSELQQYLGVEDYVGCSSVHGVGPS  410

Query  354   IAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDAT  226
             IA FDT+ DG+LDCACVYPSPLHS +Q+ ELV+ MK ILI+ +
Sbjct  411   IAFFDTIRDGQLDCACVYPSPLHSNKQIQELVEHMKGILIEGS  453



>gb|KDO70474.1| hypothetical protein CISIN_1g0479151mg, partial [Citrus sinensis]
Length=376

 Score =   367 bits (943),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 208/378 (55%), Positives = 258/378 (68%), Gaps = 18/378 (5%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNAA  1423
             R+  GTE+ WCRAV GGTGI VLA L S K  +T  L++AL+K+ + HPILRS+L  N +
Sbjct  16    RIASGTEYSWCRAVPGGTGIAVLAILTS-KVPETSGLQDALNKLQSYHPILRSRLHTNPS  74

Query  1422  TKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAWRN  1243
                FSF  S T  IQ+  F+  ST +IL S      +  S +P  +ILEHEL+ NA W N
Sbjct  75    KNTFSFVTSPTTFIQVKSFNLSSTSKILES-----SERFSIAPLQLILEHELNENA-WCN  128

Query  1242  PASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLKGI  1063
                   S  D+L+AS YALP+    V+ALR H A CDRTT VSLL EL+ ++     +  
Sbjct  129   LKC--TSTTDMLYASSYALPD-AKWVVALRLHVAACDRTTAVSLLKELLLVLVSDDDQEQ  185

Query  1062  KNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLVVKLQ  883
             +  GE +  IE ++P  K+KK LWA G DML YSVNS + TNLKF D K PR S VV+LQ
Sbjct  186   EGRGEVNLAIEALIPKGKAKKALWARGRDMLTYSVNSLKSTNLKFIDAKSPRSSQVVRLQ  245

Query  882   LNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTDCRSI  703
             LN   T RIL  CKS GIKLCG+L AAGL+AAH+S +Q        +KY V TLTDCRSI
Sbjct  246   LNKDDTERILLTCKSRGIKLCGMLAAAGLIAAHNSDNQ--------RKYAVATLTDCRSI  297

Query  702   LDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADLNFLM  523
             L+PPLS+H +GFYHSAI+N H +K GE+L D+AK+ Y+AF NSK  N+HFSDMADLNFLM
Sbjct  298   LEPPLSNHRFGFYHSAIMNTHLIKSGEKLGDLAKKIYTAFVNSKHCNRHFSDMADLNFLM  357

Query  522   CKAIDNPGLTASSSLRSA  469
             CKAI+NP LT +SSLRS+
Sbjct  358   CKAIENPSLTPASSLRSS  375



>gb|EYU38650.1| hypothetical protein MIMGU_mgv1a011240mg [Erythranthe guttata]
Length=288

 Score =   357 bits (916),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 168/277 (61%), Positives = 215/277 (78%), Gaps = 6/277 (2%)
 Frame = -3

Query  1056  EGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLVVKLQLN  877
             + E S GIE   PS +  K  WA G+DMLGYS+NS RL+NL F D   PR S VV+L++N
Sbjct  15    DAEVSLGIEEYFPSGQGSKPFWARGVDMLGYSLNSLRLSNLDFKDTVSPRLSRVVRLKMN  74

Query  876   LHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSS-RSQWDHHQQQKKKYGVVTLTDCRSIL  700
                T RIL+ C   GIKL G+L AAG++A+HSS R  +D    Q +KY VVTL DCRSIL
Sbjct  75    AEDTRRILSSCDKNGIKLSGILAAAGVIASHSSKRVPYD----QWEKYAVVTLMDCRSIL  130

Query  699   DPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADLNFLMC  520
             DP LSSHH GFYHSAILN H ++GGE+LW++A+R +S+FENSK   KHFSDMADLNFLMC
Sbjct  131   DPALSSHHVGFYHSAILNTHDIEGGEKLWELAERIHSSFENSKSYKKHFSDMADLNFLMC  190

Query  519   KAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPSIAIFD  340
             +AI+NP LT S+SLR+++I+VFE+ +++  S  + + +G+ED++GC+SVHG+GPSIAIFD
Sbjct  191   RAIENPSLTPSASLRTSLISVFEDRMIHQ-SNKLHQAIGLEDFIGCASVHGIGPSIAIFD  249

Query  339   TVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDA  229
             T+ DG LDCACV+P PLHSREQM EL+D+MKRIL+D 
Sbjct  250   TIRDGALDCACVFPFPLHSREQMQELIDDMKRILLDG  286



>dbj|BAJ94035.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=478

 Score =   354 bits (908),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 199/482 (41%), Positives = 297/482 (62%), Gaps = 36/482 (7%)
 Frame = -3

Query  1641  MSVRKGADENNKERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNA  1462
             M  R GA    + R + GTE+ WCRA  GGTG +V+A  +S   A       AL    NA
Sbjct  27    MDSRAGA-AAWRSRALCGTEYSWCRAAPGGTGTSVIALRLSRGGAAAEAAVRALQ---NA  82

Query  1461  HPILRSKLRYNAATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHII  1282
             HP+LR+ LR   ++   +F  SA P + + P   PS L                  FH +
Sbjct  83    HPVLRAHLRGTPSSPTLAFPSSA-PQLSLAP--QPSVLD-----------------FHSL  122

Query  1281  LEHELSNNAAWRNPASFPPSGADVLFASLYALPEE-GGHVMALRFHTAVCDRTTVVSllg  1105
             LE E++ N  W   A+  P GA VLFA+LY LP   GG  + +  HTAVCDR    +LL 
Sbjct  123   LEREINRNP-WAA-AAPEPDGAPVLFAALYQLPPPAGGAALFILIHTAVCDRAASEALLS  180

Query  1104  elmelmregtLKGIKNEGEGSF---GIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNL  934
             EL+ L+    +   + +GE +    G+E  +  + ++K LWA G+DM+GYS++  R + L
Sbjct  181   ELLALLGGAGVGDPEVKGETAAVEAGLEKRIRKKDARKPLWARGVDMVGYSIDGLRASTL  240

Query  933   KFNDVKGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQ  754
              F +    R + +V+L+L+   T+R+L  CK  G++LC  + AA ++AA  S+     + 
Sbjct  241   PFEETGTARSTKMVRLRLDREDTTRLLDACKENGVRLCSAMAAATMLAARQSK-----NS  295

Query  753   QQKKKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENS  574
              Q++ Y V TL +CR  L+PPL+ H+ GF++SA++N H +     LW +AKR + A+ N+
Sbjct  296   SQQETYSVATLINCREFLEPPLNDHNVGFFYSAVINTHKINREGGLWALAKRCHDAYSNA  355

Query  573   KKTNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVED  394
             K   KH +D+ DLNFLMC+AI+NP LT +S+LR+++++VFEEP  +D+S D+Q + GVED
Sbjct  356   KHNKKHLTDIRDLNFLMCRAIENPQLTTASALRTSLVSVFEEPATFDVS-DLQSKAGVED  414

Query  393   YVGCSSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDATKFID  214
             YV C++VHG+GPSI++FD++ DG LDCAC+YPSPLHSR Q+HE++D++K IL + +   D
Sbjct  415   YVCCATVHGIGPSISVFDSIRDGGLDCACMYPSPLHSRRQIHEVLDKVKMILHEGSNPSD  474

Query  213   DL  208
             +L
Sbjct  475   EL  476



>gb|ACN31186.1| unknown [Zea mays]
Length=465

 Score =   350 bits (897),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 190/459 (41%), Positives = 278/459 (61%), Gaps = 28/459 (6%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             + R +GGTE+ W RAV GGTG T+LA  +S   A        LH + +AHP+LR++LR +
Sbjct  19    RTRALGGTEYSWLRAVPGGTGTTLLALRLSRGDA----AEAGLHSLRDAHPVLRARLRTS  74

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
             + +          P   + P  AP +                   FH +LEHEL+ N   
Sbjct  75    SPSGPTLAFPDPAPPFLLAPIPAPGS----------------APDFHALLEHELNRNPWA  118

Query  1248  RNPASFPPSGADVLFASLYALPEE-GGHVMALRFHTAVCDRTTVVSllgelmelmregtL  1072
              +PAS     A VLFA+LY LP   GG  + +R HT  CDR+   +L  EL+ L+     
Sbjct  119   DDPAS--SDDAPVLFATLYELPAATGGAALFVRIHTVACDRSAASALARELVALLAGAGG  176

Query  1071  KGIKNE-GEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLV  895
             +    E      G+E  +P   + K  WA G+DM+GYS+N  R + L F +    R + +
Sbjct  177   EEPDPEDAAAEAGLEARIPQRDTWKPFWARGLDMVGYSINGLRTSTLPFVETGTERSTQM  236

Query  894   VKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTD  715
             ++L L L  T+R+L  CK  G++LC  + AA ++AA  S+        Q++ Y VVTL +
Sbjct  237   LRLGLGLDETTRLLDACKENGVRLCSAVAAATMLAARQSKPL---ESGQQETYSVVTLIN  293

Query  714   CRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADL  535
             CR  L+P L   + GF++SAI N HT+ GGE LW++AKR + ++ ++K   KH +D+ DL
Sbjct  294   CRKFLEPVLEDRNVGFFYSAITNTHTIHGGEGLWELAKRCHDSYTSAKSNKKHLTDINDL  353

Query  534   NFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPS  355
             NFLMC+AI+NP LT + +LR+A+++VFE+PVV D+ A++Q + GVED V C++VHG+GPS
Sbjct  354   NFLMCRAIENPQLTTAGALRTALVSVFEDPVVADV-AELQSKAGVEDCVCCATVHGIGPS  412

Query  354   IAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRIL  238
             I +FD++ DGKLD ACVYPSPLHSR+Q+ E+ D++K+IL
Sbjct  413   IGVFDSIKDGKLDWACVYPSPLHSRKQVQEIFDKVKQIL  451



>ref|NP_001151279.1| transposon protein Mutator sub-class [Zea mays]
 gb|ACG42214.1| transposon protein Mutator sub-class [Zea mays]
Length=465

 Score =   347 bits (889),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 190/459 (41%), Positives = 277/459 (60%), Gaps = 28/459 (6%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             + R +GGTE+ W RAV GGTG T+LA  +S   A    LR+    + +AHP+LR++LR +
Sbjct  19    RTRALGGTEYSWLRAVPGGTGTTLLALRLSHGDAAEAALRS----LRDAHPVLRARLRTS  74

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
             + +          P   + P  AP +                   FH +LEHEL+ N   
Sbjct  75    SPSGPTLAFPDPAPPFLLAPIPAPGS----------------APDFHALLEHELNRNPWA  118

Query  1248  RNPASFPPSGADVLFASLYALPEE-GGHVMALRFHTAVCDRTTVVSllgelmelmregtL  1072
              +PAS     A VLFA+LY LP   GG  + +R HT  CDR+   +L  EL+ L+     
Sbjct  119   DDPAS--SDDAPVLFATLYELPAATGGAALFVRIHTVACDRSAASALARELVALLAGAGG  176

Query  1071  KGIKNE-GEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLV  895
             +    E      G+E  +P     K  WA G+DM+GYS+N  R + L F +    R + +
Sbjct  177   EEPDPEDAAAEAGLEARIPQRDIWKPFWARGLDMVGYSINGLRTSTLPFVETGTERSTQM  236

Query  894   VKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTD  715
             ++L L L  T+R+L  CK  G++LC  + AA ++AA  S+        Q++ Y VVTL +
Sbjct  237   LRLGLGLDETTRLLDACKENGVRLCSAVAAATMLAARQSKPM---ESGQQETYSVVTLIN  293

Query  714   CRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADL  535
             CR  L+P L   + GF++SAI N HT+ GGE LW++AKR   ++ ++K   KH +D++DL
Sbjct  294   CRKFLEPVLEDRNVGFFYSAITNTHTIHGGEGLWELAKRCQDSYTSAKSNKKHLTDISDL  353

Query  534   NFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPS  355
             NFLMC+AI+NP LT + +LR+A+++VFE+PVV D+ A+ Q + GVED V C++VHG+GPS
Sbjct  354   NFLMCRAIENPQLTTAGALRTALVSVFEDPVVADV-AEAQSKAGVEDCVCCATVHGIGPS  412

Query  354   IAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRIL  238
             I +FD++ DGKLD ACVYPSPLHSR+Q+ E+ D++K+IL
Sbjct  413   IGVFDSIKDGKLDWACVYPSPLHSRKQVQEIFDKVKQIL  451



>gb|KHN46023.1| hypothetical protein glysoja_040941 [Glycine soja]
Length=308

 Score =   335 bits (860),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 164/270 (61%), Positives = 214/270 (79%), Gaps = 5/270 (2%)
 Frame = -3

Query  1035  IENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLVVKLQLNLHHTSRI  856
             IE+++P  K  K  WA G+D+LGY++N+FR +NL F DV  PR S +++LQLN+  T  +
Sbjct  22    IEDMIPEGKMNKPFWARGLDVLGYTLNAFRFSNLSFIDVGSPRSSRIIRLQLNVDETKNL  81

Query  855   LAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTDCRSILDPPLSSHH  676
             LAGCKS GIKLCG L AAG++AA +S+   ++   Q++KY VVTL DCRS+LDP L S++
Sbjct  82    LAGCKSRGIKLCGALAAAGMIAAWTSKCLPNY---QREKYAVVTLVDCRSLLDPVLPSNN  138

Query  675   YGFYHSAILNMHTVKG-GERLWDMAKRSYSAFENSKKTNKHFSDMADLNFLMCKAIDNPG  499
              GFYHSAILN H V G  E LW++AK+SY+A  N+   NKHF+DM+DLN+LMCKAI+NPG
Sbjct  139   AGFYHSAILNTHDVCGETETLWELAKKSYTAIVNAMNCNKHFTDMSDLNYLMCKAIENPG  198

Query  498   LTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPSIAIFDTVIDGKL  319
             LT SSSLR+A+I+VFE+PV +D SA++  E G+EDYVGC+S HGVGPSIA+FDT+ +GKL
Sbjct  199   LTPSSSLRTALISVFEDPV-FDDSAEMLGEFGLEDYVGCASAHGVGPSIAVFDTIRNGKL  257

Query  318   DCACVYPSPLHSREQMHELVDEMKRILIDA  229
             DCAC+YPSPLHSREQ+  LVD MKRIL++ 
Sbjct  258   DCACIYPSPLHSREQIQGLVDHMKRILVEG  287



>ref|XP_003567292.1| PREDICTED: uncharacterized protein LOC100834188 [Brachypodium 
distachyon]
Length=469

 Score =   338 bits (866),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 199/483 (41%), Positives = 285/483 (59%), Gaps = 26/483 (5%)
 Frame = -3

Query  1641  MSVRKGADENNKERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNA--LHKIL  1468
             M       E  + R VGGTEH WCRAV GGTG T+LA  +S              +  + 
Sbjct  1     METEHAGAEEWRARAVGGTEHSWCRAVPGGTGTTLLALRLSAAGGAADAEALQAAVRSLQ  60

Query  1467  NAHPILRSKLRYNAATKA--FSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsP  1294
              AHPILR+ LR + +  A   +F  S++P +Q++    P++   L               
Sbjct  61    KAHPILRAHLRASPSGGAATLAFPASSSP-LQLSLAPQPASEPAL--------------D  105

Query  1293  FHIILEHELSNNAAWRNPASFPPSGADVLFASLYALPEE-GGHVMALRFHTAVCDRTTVV  1117
             FH +LE EL+ N  W + +    + A VLFA+LY LP   GG  + +R HT  CDR    
Sbjct  106   FHSLLERELNRNP-WASASGPDAAAAPVLFAALYELPPPAGGVALLVRIHTVACDRAASA  164

Query  1116  SllgelmelmregtLKGIKNEGEG-SFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLT  940
             +L  EL+ L+      G + E      G+E  +P   S K  WA G+DM+GYS+N  R +
Sbjct  165   ALARELIALLAGAGDPGEEEEAAAVDAGLEERIPQRDSWKPFWARGVDMVGYSINGLRTS  224

Query  939   NLKFNDVKGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDH  760
              L F +    R + +++L      T+R+L  CK  G++LC  + AA L+AA  S+ + D 
Sbjct  225   TLPFVETGTARSTQMLRLGFGREETARLLDACKENGVRLCSAMAAATLLAARRSK-KLDS  283

Query  759   HQQQKKKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFE  580
              QQ+   Y + TL +CR  L+P L  H+ GF++SAI N H + G E LW++AKR + A+ 
Sbjct  284   GQQET--YSIATLINCREFLEPALDDHNVGFFYSAITNTHKIHGEEVLWELAKRCHGAYS  341

Query  579   NSKKTNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGV  400
             N+K + KH +D+ DLNFLMC+AI+NP LT +S+LR+A+I+VFEEPV YD S D Q + GV
Sbjct  342   NAKNSKKHLTDIGDLNFLMCRAIENPQLTTASALRTALISVFEEPVTYDTS-DQQSKAGV  400

Query  399   EDYVGCSSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDATKF  220
             ED+V  ++VHG+GPSI +FD++ DG+LDCAC+YPSPLHSR+QM E+ D +K+IL +    
Sbjct  401   EDFVCGATVHGIGPSIGMFDSIRDGQLDCACMYPSPLHSRKQMQEIFDRVKQILHEGCNV  460

Query  219   IDD  211
              D+
Sbjct  461   NDE  463



>gb|AFW84477.1| transposon protein Mutator sub-class [Zea mays]
Length=465

 Score =   332 bits (851),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 186/459 (41%), Positives = 274/459 (60%), Gaps = 28/459 (6%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             + R +GGTE+ W RAV GGTG T+LA  +S   A    LR+    + +AHP+LR++LR +
Sbjct  19    RTRALGGTEYSWLRAVPGGTGTTLLALRLSRGDAAEAALRS----LRDAHPVLRARLRTS  74

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
             + +          P +                         S   FH +LEHEL+ N   
Sbjct  75    SPSG---------PTLA-------FPDPAPPFPLAPLPAPGSAPDFHALLEHELNRNPWA  118

Query  1248  RNPASFPPSGADVLFASLYALPEEGGHV-MALRFHTAVCDRTTVVSllgelmelmregtL  1072
              +PAS     A VLFA+LY LP   G   + +R HT  CDR+   +L  EL+ L+     
Sbjct  119   DDPAS--SDDAPVLFATLYELPAATGDAALFVRIHTVACDRSAASALARELVALLAGAGG  176

Query  1071  KGIKNE-GEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLV  895
             +    E      G+E  +P   + K  WA G+DM+GYS+N  R + L F +    R + +
Sbjct  177   EEPDPEDAAAEAGLEARIPQRDTWKPFWARGLDMVGYSINGLRTSTLPFVETGTERSTQM  236

Query  894   VKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTD  715
             ++L L L  T+R+L  CK  G++LC  + AA ++AA  S+        Q++ Y VVTL +
Sbjct  237   LRLGLGLDETTRLLDACKENGVRLCSAVAAATMLAARQSKPL---ESGQQETYSVVTLIN  293

Query  714   CRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADL  535
             CR  L+P L   + GF++SAI N HT+ GGE LW++AKR + ++ ++K   KH +D+ DL
Sbjct  294   CRKFLEPVLEDRNVGFFYSAITNTHTIHGGEGLWELAKRCHDSYTSAKSNKKHLTDINDL  353

Query  534   NFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPS  355
             NFLMC+AI+NP LT + +LR+A+++VFE+PVV D+ A++Q + GVED V C++VHG+GPS
Sbjct  354   NFLMCRAIENPQLTTAGALRTALVSVFEDPVVADV-AEVQSKAGVEDCVCCATVHGIGPS  412

Query  354   IAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRIL  238
             I +FD++ DGKLD ACVYPSPLHSR+Q+ E+ D++ +IL
Sbjct  413   IGVFDSIKDGKLDWACVYPSPLHSRKQVQEIFDKVTQIL  451



>ref|XP_002458807.1| hypothetical protein SORBIDRAFT_03g040670 [Sorghum bicolor]
 gb|EES03927.1| hypothetical protein SORBIDRAFT_03g040670 [Sorghum bicolor]
Length=470

 Score =   330 bits (845),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 189/461 (41%), Positives = 279/461 (61%), Gaps = 27/461 (6%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             + R  GGTE+ W RAV GGTG T+LA  +S       + + ALH + NAHP+LR++LR +
Sbjct  19    RTRAPGGTEYSWLRAVPGGTGTTLLALHLSRGD----VAQAALHSLRNAHPVLRARLRTS  74

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
              +    +F   A            +                S   FH +LEHEL+ N  W
Sbjct  75    PSGPTLAFPDPA------------APAPSPPLPLAPLPAPDSAPDFHALLEHELNRNP-W  121

Query  1248  RNPASFPPSGADVLFASLYALPE-EGGHVMALRFHTAVCDRTTVVSllgelmelmregtL  1072
              +PAS     A VLFA+LY LP   GG  + +R HT  CDR+   +L  EL+ L+  G  
Sbjct  122   ADPAS--SDDAPVLFATLYELPPATGGAALFVRIHTVACDRSAANALARELVALLAGGDE  179

Query  1071  KGIKNEGEGSFGIENV---VPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHS  901
              G +++ E +     +   +P   + K  WA G+DM+GYS+N  R + L F +    R +
Sbjct  180   GGERSDPEDAAAEAALEERIPQRDTWKPFWARGLDMVGYSINGLRTSTLPFVETGTERST  239

Query  900   LVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTL  721
              +++L L+   T+R+L  CK  G+K+C  + AA ++AA  S+        Q++ Y +VTL
Sbjct  240   QMLRLGLDRDETTRVLDACKENGVKVCSAMAAATMLAARQSKPL---ESGQQETYSIVTL  296

Query  720   TDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMA  541
              +CR  L+PPL   + GF++SAI N HTV G E LW++AKR + ++ ++K   KH +D++
Sbjct  297   INCRKFLEPPLDDRNVGFFYSAITNTHTVHGEEGLWELAKRCHDSYTSAKNNKKHLTDIS  356

Query  540   DLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVG  361
             DLNFLMC+AID P LT + +LR+A+++VFEEPVV D+ A+ Q + GVED V C++VHG+G
Sbjct  357   DLNFLMCRAIDAPQLTTAGALRTALVSVFEEPVVDDM-AEAQSKAGVEDCVCCATVHGIG  415

Query  360   PSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRIL  238
             PSI +FD++ DGKLD  C+YPSPLHSR+Q+ E+ D++K+IL
Sbjct  416   PSIGVFDSIKDGKLDWTCMYPSPLHSRKQVQEIFDKVKQIL  456



>gb|EEC71848.1| hypothetical protein OsI_04522 [Oryza sativa Indica Group]
Length=490

 Score =   326 bits (836),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 197/470 (42%), Positives = 282/470 (60%), Gaps = 31/470 (7%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLV---SPKAADTCLLRNALHKILNAHPILRSKLRY  1432
             R VGG E+GW RAV GGTG T+LA  +   +  A     ++ AL  IL+AHP+LR++LR 
Sbjct  22    RAVGGMEYGWYRAVPGGTGTTLLALRLVRGAEAAVAAATVQAALRAILDAHPVLRARLRG  81

Query  1431  NAATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAA  1252
             +A         S +P +      + +         +      S   F  +LEHEL+ N  
Sbjct  82    SA---------SGSPTLAFP---SAAAPPPPPLALELLPVPESAPDFPSLLEHELNRNP-  128

Query  1251  WRNPA------SFPPSGADVLFASLYALPEE--GGHVMALRFHTAVCDRTTVVSllgelm  1096
             W   A         P    VLFA+LY LP    GG  + +R HTA CDR    SL+ EL+
Sbjct  129   WTAAAATATAFEHEPDAPPVLFATLYELPPPAGGGSALFVRIHTAACDRAASASLVRELL  188

Query  1095  elmr-egtLKGIKNEGEGSF---GIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKF  928
               +  +G      +E E +     +E  +P   S K  WA G+DM+GYS+N  R + L F
Sbjct  189   AQLSGDGAAAAAGSEPEDAAVRASLEERIPQRDSWKPFWARGLDMVGYSINGLRTSTLPF  248

Query  927   NDVKGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQ  748
                   R + +++L  +   T+R+L  CK  G+KLC  + AA L+AA  S+ Q   +QQ+
Sbjct  249   EVTGTERSTQMLRLGFDRDETTRLLDACKQNGVKLCAAMAAATLLAARQSKLQLASNQQE  308

Query  747   KKKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKK  568
                Y + TL +CR  L+P L  H+ GFYHSAI N H + GGE LW++AKR   ++ N+K 
Sbjct  309   T--YSIATLINCRKFLEPALDDHNVGFYHSAITNTHAIHGGEELWELAKRCQDSYTNAKN  366

Query  567   TNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYV  388
               KH +D+ADLNFLMC+AI+NP LT  S+LR+AV++VFEEPVVYD+S D+Q + GVE++V
Sbjct  367   NKKHLTDIADLNFLMCRAIENPQLTTGSALRTAVVSVFEEPVVYDLS-DLQSKAGVEEFV  425

Query  387   GCSSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRIL  238
              C++VHGVGPSI +FD++ DG+L+ AC+YP PLHSR+QM ++++++K+IL
Sbjct  426   CCATVHGVGPSIGLFDSIRDGQLEFACMYPCPLHSRKQMQKILNKVKQIL  475



>ref|NP_001044878.1| Os01g0861900 [Oryza sativa Japonica Group]
 dbj|BAB63795.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAB91773.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF06792.1| Os01g0861900 [Oryza sativa Japonica Group]
Length=490

 Score =   325 bits (834),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 192/468 (41%), Positives = 273/468 (58%), Gaps = 31/468 (7%)
 Frame = -3

Query  1596  VGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNA---LHKILNAHPILRSKLRYNA  1426
             VGG E+GW RAV GGTG T+LA  ++  A            L  IL+AHP+LR++LR +A
Sbjct  24    VGGMEYGWYRAVPGGTGTTLLALRLARGAEAAVAAATVQAALRAILDAHPVLRARLRGSA  83

Query  1425  ATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAWR  1246
                      S +P +      + +         +      S + F  +LEHEL+ N  W 
Sbjct  84    ---------SGSPTLAFP---SAAAPPPPPLALELLPVPESATDFPSLLEHELNRNP-WT  130

Query  1245  NP------ASFPPSGADVLFASLYALPEE--GGHVMALRFHTAVCDRTTVVSllgelmel  1090
                     +   P    VLFA+LY LP    GG  + +R HTA CDR    SL+ EL+  
Sbjct  131   AAAATATASEHEPDAPPVLFATLYELPPPAGGGSALFVRIHTAACDRAASASLVRELLAQ  190

Query  1089  mregtLKGIKNEGEGSFGI----ENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFND  922
             +                 +    E  +P   S K  WA G+DM+GYS+N  R + L F  
Sbjct  191   LAGDGAAAAAASEPEDAAVRASLEERIPQRDSWKPFWARGLDMVGYSINGLRTSTLPFEV  250

Query  921   VKGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKK  742
                 R + +++L  +   T+R+L  CK  G+KLC  + AA L+AA  S+ Q   +QQ+  
Sbjct  251   TGTERSTQMLRLGFDRDETTRLLDACKQNGVKLCAAMAAATLLAARQSKLQLASNQQET-  309

Query  741   KYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTN  562
              Y + TL +CR  L+P L  H+ GFYHSAI N H + GGE LW++AKR   ++ N+K   
Sbjct  310   -YSIATLINCRKFLEPALDDHNVGFYHSAITNTHAIHGGEELWELAKRCQDSYTNAKNNK  368

Query  561   KHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGC  382
             KH +D+ADLNFLMC+AI+NP LT  S+LR+AV++VFEEPVVYD+S D+Q + GVE++V C
Sbjct  369   KHLTDIADLNFLMCRAIENPQLTTGSALRTAVVSVFEEPVVYDLS-DLQSKAGVEEFVCC  427

Query  381   SSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRIL  238
             ++VHGVGPSI +FD++ DG+L+ AC+YP PLHSR+QM E+++++K+IL
Sbjct  428   ATVHGVGPSIGLFDSIRDGQLEFACMYPCPLHSRKQMQEILNKVKQIL  475



>gb|KHG10988.1| Serpentine receptor class alpha-12 [Gossypium arboreum]
Length=339

 Score =   320 bits (819),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 187/351 (53%), Positives = 237/351 (68%), Gaps = 23/351 (7%)
 Frame = -3

Query  1614  NNKERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLR  1435
             + + R VGGTEH WCRAV GGTGI VLA ++S K  D   L+NALHK+  +HPILRS+L 
Sbjct  2     STQSRAVGGTEHNWCRAVVGGTGIAVLA-IISSKTPDVSHLKNALHKLQISHPILRSRLH  60

Query  1434  YNAATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNA  1255
             Y+    ++SF  S +P I+I  F+  +T QIL +         + SP H+ILEHEL+ NA
Sbjct  61    YSPTANSYSFVTSPSPFIEIKYFNHSTTCQILENN-------QNISPLHLILEHELNQNA  113

Query  1254  AWRNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregt  1075
                +  +      DV FAS+YALP     V+ LR H A CDRTT VSLL EL+ LM    
Sbjct  114   WVSSSCTIK---HDVFFASVYALPGATRWVLVLRLHAAACDRTTAVSLLRELLTLMAIEE  170

Query  1074  -----LKGIK----NEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFND  922
                   +G K    N+GE S  +E+++P    KK LWA G+DML YSVNS R TNL+F D
Sbjct  171   EETGFQQGQKEITMNKGEISLAMEDLLPKGIVKKTLWARGVDMLSYSVNSLRFTNLRFKD  230

Query  921   VKGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKK  742
              K PR + VV+L +N   T +IL GCK+ GIKLCG L AAGL+AAHSS+S+ DH   QKK
Sbjct  231   AKSPRSTQVVRLLINPDDTQKILTGCKARGIKLCGALGAAGLIAAHSSKSRSDH---QKK  287

Query  741   KYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYS  589
             KYGVVTLTDCRSIL+PPLS+HH+GFYHSAILN H +KGGE+LW++A++ Y+
Sbjct  288   KYGVVTLTDCRSILEPPLSNHHFGFYHSAILNTHAIKGGEKLWELAEKVYT  338



>ref|XP_006481748.1| PREDICTED: uncharacterized protein LOC102616692 isoform X2 [Citrus 
sinensis]
Length=417

 Score =   304 bits (778),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 200/471 (42%), Positives = 262/471 (56%), Gaps = 84/471 (18%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNAA  1423
             R VGGTE+ WC+AV  GTGITVLA L+S K  +  LLR AL+ + N HPILRSKL  +A 
Sbjct  18    RPVGGTEYSWCKAVPTGTGITVLALLLS-KHPNIQLLRTALNNLQNNHPILRSKLHSSAD  76

Query  1422  TKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAWRN  1243
              K FSF     P I I   D  ST Q +  +T +         F +ILEHEL+ N  W N
Sbjct  77    AKTFSFITPPEPHILIQQCDISSTSQTISDKTGAGSP------FQLILEHELNRNT-WTN  129

Query  1242  PA--SFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLK  1069
             P+  S   S +++ + S+Y  P E   V+ LR HT++CDR + V++  EL+ LM      
Sbjct  130   PSHQSNTNSDSNLFYVSIYT-PSETQWVVTLRLHTSICDRASAVAVSKELLRLMTGRDEG  188

Query  1068  GIKNE----GEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHS  901
             GI+ E    GE S GIE  +PS K+ K  WA G+DMLGYS+NS RL+N+ F D   PR S
Sbjct  189   GIEKEYDRKGEVSLGIEEFIPSGKANKPFWARGVDMLGYSLNSLRLSNISFVDADSPRFS  248

Query  900   LVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTL  721
              V++LQLN   T+R++ GCKS GIKLCG L AAGL+AA S++    H   Q++KY VVTL
Sbjct  249   QVLRLQLNRDETARLVEGCKSRGIKLCGALAAAGLIAARSTKYFPSH---QREKYAVVTL  305

Query  720   TDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENS--KKTNKHFSD  547
              DCRSIL+P LS      Y ++ L    +              S FE+    +TNK   +
Sbjct  306   VDCRSILEPVLSDD----YLASSLRTAVI--------------SVFEDPIVDETNKLHQE  347

Query  546   MADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHG  367
             +   +++ C +                                              VHG
Sbjct  348   IGLEDYIGCSS----------------------------------------------VHG  361

Query  366   VGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDATKFID  214
             VGPSIAIFDT+ DG LDCACVYPSPLHSREQ+ +L+D+MK+IL++   F D
Sbjct  362   VGPSIAIFDTIRDGWLDCACVYPSPLHSREQLQQLIDDMKKILVEGGSFGD  412



>emb|CAN71366.1| hypothetical protein VITISV_014690 [Vitis vinifera]
Length=279

 Score =   298 bits (763),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 173/205 (84%), Gaps = 5/205 (2%)
 Frame = -3

Query  840  SAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTDCRSILDPPLSSHHYGFYH  661
            + GIKLCG L AA L+A HSS+   DHH   K+KY VVTLTDCR ILDPPLS+HH+GFYH
Sbjct  70   AKGIKLCGALVAAALIAGHSSKRPADHH---KEKYAVVTLTDCRPILDPPLSTHHFGFYH  126

Query  660  SAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADLNFLMCKAIDNPGLTASSS  481
            SA+LN  ++KGGE+LW++A+RSY AF NSK  NKHFSDMADLNFLM KAI+NPGLT++SS
Sbjct  127  SAVLNTLSMKGGEKLWELARRSYMAFANSKNCNKHFSDMADLNFLMRKAIENPGLTSASS  186

Query  480  LRSAVITVFEEPVVYDISADIQREL-GVEDYVGCSSVHGVGPSIAIFDTVIDGKLDCACV  304
            LR++ +TVFE+PV ++ + +I RE+ G+EDY+GC+SVHG+GPSIAIFDT+  G LDCACV
Sbjct  187  LRTSFLTVFEDPV-FETNDEIYREIVGLEDYIGCASVHGIGPSIAIFDTIRGGMLDCACV  245

Query  303  YPSPLHSREQMHELVDEMKRILIDA  229
            YPSPLHSREQM EL+  MKR+L+DA
Sbjct  246  YPSPLHSREQMEELLHNMKRLLVDA  270



>gb|KDO70471.1| hypothetical protein CISIN_1g0117482mg, partial [Citrus sinensis]
Length=213

 Score =   278 bits (710),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 173/212 (82%), Gaps = 4/212 (2%)
 Frame = -3

Query  849  GCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTDCRSILDPPLSSHHYG  670
            GCKS GIKLCG L AAGL+AA S++    H   Q++KY VVTL DCRSIL+P LS  + G
Sbjct  1    GCKSRGIKLCGALAAAGLIAARSTKYFPSH---QREKYAVVTLVDCRSILEPVLSDDYLG  57

Query  669  FYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADLNFLMCKAIDNPGLTA  490
            FYHSAILN H V G E LW++A RSY++F N+K ++KHF+DM DLNFLMCKAIDNPGLT 
Sbjct  58   FYHSAILNTHDVNGEEELWELATRSYTSFANAKNSDKHFTDMNDLNFLMCKAIDNPGLTP  117

Query  489  SSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPSIAIFDTVIDGKLDCA  310
            +SSLR+AVI+VFE+P+V D +  + +E+G+EDY+GCSSVHGVGPSIAIFDT+ DG LDCA
Sbjct  118  ASSLRTAVISVFEDPIV-DETNKLHQEIGLEDYIGCSSVHGVGPSIAIFDTIRDGWLDCA  176

Query  309  CVYPSPLHSREQMHELVDEMKRILIDATKFID  214
            CVYPSPLHSREQ+ +L+D+MK+IL++   F D
Sbjct  177  CVYPSPLHSREQLQQLIDDMKKILVEGGSFGD  208



>gb|EMS46893.1| hypothetical protein TRIUR3_22779 [Triticum urartu]
Length=333

 Score =   279 bits (714),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/267 (48%), Positives = 189/267 (71%), Gaps = 3/267 (1%)
 Frame = -3

Query  1038  GIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLVVKLQLNLHHTSR  859
             G+E+ +P + + K  WA G+DM+GYS+N  R + L F +    R + +V+L      T+R
Sbjct  25    GLEDRIPQKDAWKPFWARGVDMVGYSINGLRTSTLPFEETGTARSTQMVRLAFGREETTR  84

Query  858   ILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTDCRSILDPPLSSH  679
             +L  CK  G+KLC  + AA L+AA  S+ + D  QQ+   Y V TL +CR  L+P L  H
Sbjct  85    LLDACKENGVKLCSAMAAATLLAARQSK-KLDSGQQET--YSVATLINCRQFLEPALDDH  141

Query  678   HYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADLNFLMCKAIDNPG  499
             + GF++SAI N H + G E LW++AKR + ++ ++K + KH +D ADLNFLMC+AI+NP 
Sbjct  142   NVGFFYSAITNTHKIHGEEGLWELAKRCHDSYISAKNSKKHLTDTADLNFLMCRAIENPQ  201

Query  498   LTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPSIAIFDTVIDGKL  319
             LT +S+LR+A+++VFEEP  YD  + +Q + GVE+YVGC++VHG+GPSI +FD+V DG+L
Sbjct  202   LTTASALRTALVSVFEEPATYDGLSGLQSKAGVEEYVGCATVHGIGPSIGVFDSVRDGQL  261

Query  318   DCACVYPSPLHSREQMHELVDEMKRIL  238
             DCAC+YPSPLHSR+Q+ E+ D++K IL
Sbjct  262   DCACMYPSPLHSRKQIQEMFDKVKLIL  288



>ref|XP_010943826.1| PREDICTED: uncharacterized protein LOC105061470 [Elaeis guineensis]
Length=446

 Score =   281 bits (720),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 178/415 (43%), Positives = 246/415 (59%), Gaps = 22/415 (5%)
 Frame = -3

Query  1653  TTTIMSVRKGADENNKERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHK  1474
             + + M  +  A + +K R VGGTE  WC+AV GGTGITVLA L+S +      L++AL  
Sbjct  46    SQSAMDSQTLASDLSKGRPVGGTEFSWCQAVPGGTGITVLAILLS-RPVSLPALQSALQS  104

Query  1473  ILNAHPILRSKLRYNAATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsP  1294
             +   HPIL + L             S  P + +    A + L  + S             
Sbjct  105   LQTFHPILSAVLAAADTPSPHLSIPSPPPPLLLHRLPAANLLAAVPS----------AFH  154

Query  1293  FHIILEHELSNNAAWRNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVS  1114
              H +LEHEL+     +NP S P +   V FA+LY LPE G  V++LRFHTAVCDRT  V+
Sbjct  155   LHSLLEHELN-----QNPWSEPANETTVFFATLYELPEPGRSVLSLRFHTAVCDRTAAVA  209

Query  1113  llgelmelmregtLKGIKNEGEG-SFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTN  937
             LL EL++ M   +    K + EG   GIE+++P   + K  WA G D++GYSVN  R +N
Sbjct  210   LLKELLDRMGGDSGNSGKGQAEGVMLGIEDLIPKRDAWKPFWARGKDLVGYSVNGLRASN  269

Query  936   LKFNDVKGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHH  757
             L+F+D    R S VV+L +++  T  +L  CK+  +KLC  ++AA L+AAHSS+    H 
Sbjct  270   LRFDDAGSDRASRVVRLVMSVEETRGLLMACKAREVKLCAAMSAAALVAAHSSQ----HF  325

Query  756   Q-QQKKKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFE  580
             Q  Q+K Y V TL D R  L+P L  ++ GFYHS I+NMH V G E LW++A R  SA+ 
Sbjct  326   QTNQQKPYLVGTLIDSRKYLEPVLHDNNIGFYHSGIINMHGVHGEEDLWELANRCQSAYS  385

Query  579   NSKKTNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQ  415
             ++ K  KH +D+ +LNFLMCKAI+NP LT +SSLR+A+ITVF+EPV+ + S   Q
Sbjct  386   DAMKNKKHLTDIGELNFLMCKAIENPHLTPASSLRTALITVFDEPVISESSKQEQ  440



>gb|EMT25090.1| hypothetical protein F775_29349 [Aegilops tauschii]
Length=254

 Score =   273 bits (699),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 120/246 (49%), Positives = 172/246 (70%), Gaps = 3/246 (1%)
 Frame = -3

Query  975  MLGYSVNSFRLTNLKFNDVKGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGL  796
            M+GYS+N  R + L F +    R + +V+L      T+R+L  CK  G+KLC  +  A L
Sbjct  1    MVGYSINGLRTSTLPFEETGTARSTQMVRLGFGREETTRLLDACKENGVKLCSAMAGATL  60

Query  795  MAAHSSRSQWDHHQQQKKKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERL  616
            +AA  S+        Q++ Y V TL +CR  L+P L  H+ GF++SAI N H + G E L
Sbjct  61   LAARQSKKL---ESGQQETYSVATLINCRQFLEPALDDHNVGFFYSAITNTHKIHGEEGL  117

Query  615  WDMAKRSYSAFENSKKTNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVY  436
            W +AKR + ++  +K + KH +D ADLNFLMC+AI+NP LT +S+LR+A+++VFEEP  Y
Sbjct  118  WALAKRCHDSYITAKNSKKHLTDTADLNFLMCRAIENPQLTTASALRTALVSVFEEPATY  177

Query  435  DISADIQRELGVEDYVGCSSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVD  256
            D  +D+Q + GVE+YVGC++VHG+GPSI +FD+V DG+LDCAC+YPSPLHSR+Q+ E+ D
Sbjct  178  DDLSDLQSKAGVEEYVGCATVHGIGPSIGVFDSVRDGQLDCACMYPSPLHSRKQIQEMFD  237

Query  255  EMKRIL  238
            ++KRIL
Sbjct  238  KVKRIL  243



>ref|XP_002983162.1| hypothetical protein SELMODRAFT_179994 [Selaginella moellendorffii]
 gb|EFJ15971.1| hypothetical protein SELMODRAFT_179994 [Selaginella moellendorffii]
Length=454

 Score =   278 bits (712),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 174/465 (37%), Positives = 259/465 (56%), Gaps = 34/465 (7%)
 Frame = -3

Query  1620  DENNKERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSK  1441
             +E    R++G TEH WCRAV  GTGITVL  L   ++ +  + + AL  +L  HP L S+
Sbjct  14    EEGPFNRILGATEHNWCRAVESGTGITVLGLLFC-RSVNVGVFQCALDAVLARHPRLLSQ  72

Query  1440  LRYNAATK-AFSFAISATPDIQ-ITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHEL  1267
             L +    K AF    +AT  IQ +   D      +L++                 +E E+
Sbjct  73    LVWIEPDKPAFQVNANATVAIQELAHGDDDREDWLLQT-----------------IESEM  115

Query  1266  SNNAAWRNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTV-VSllgelmel  1090
             ++N      A  P     V FA L+ L E+   +  +R HTA CDR    V +   L  L
Sbjct  116   NSNPWTDRDAPVP-----VFFARLHRLGEKS--LFVIRVHTAACDRAAAAVIMSEFLHRL  168

Query  1089  mregtLKGIKNEG-EGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKG  913
               +   +G   +G E    IE+ +P  ++ K  WAHG+D+LGYS+ S R   L F++V+ 
Sbjct  169   RGDDEQEGKDGDGVEELVSIEDAIPRGQANKPFWAHGVDLLGYSLGSLRHALLPFDNVEA  228

Query  912   PRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYG  733
             PR + +V+  L+L HT  +   C      L G L AAGL A     + +     + + + 
Sbjct  229   PRRTELVRASLSLEHTKSLTKRCVLEKTNLFGALVAAGLRAT----TIYKQLGNRSEHFA  284

Query  732   VVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHF  553
             ++ L DCR+ +D  LS    GFYHSAILN H V      WD+++R   +F N+ K  KHF
Sbjct  285   IIGLVDCRNHIDS-LSRSTAGFYHSAILNTHHVNQDTGFWDLSRRCSDSFSNAIKNRKHF  343

Query  552   SDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSV  373
             +DM D+N+LM +A+ +P LT S +LR++++ VF++ +  +   + +  LG+EDYVGC+SV
Sbjct  344   TDMGDINYLMFQALQHPNLTPSGTLRTSLMVVFQDVIADESEEETKHTLGLEDYVGCASV  403

Query  372   HGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRIL  238
             HGVGPS+A+FD++ DG L C  VYP+PLHSREQ+ ++VD+M  IL
Sbjct  404   HGVGPSLALFDSIRDGCLHCNVVYPAPLHSREQIRKVVDDMMEIL  448



>ref|XP_002965922.1| hypothetical protein SELMODRAFT_407067 [Selaginella moellendorffii]
 gb|EFJ33342.1| hypothetical protein SELMODRAFT_407067 [Selaginella moellendorffii]
Length=454

 Score =   277 bits (709),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 174/465 (37%), Positives = 259/465 (56%), Gaps = 34/465 (7%)
 Frame = -3

Query  1620  DENNKERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSK  1441
             +E    R++G TEH WCRAV  GTGITVL  L   ++ +  + + AL  +L  HP L S+
Sbjct  14    EEGPFNRILGATEHNWCRAVESGTGITVLGLLFC-RSVNVGVFQCALDAVLARHPRLLSQ  72

Query  1440  LRYNAATK-AFSFAISATPDIQ-ITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHEL  1267
             L +    K AF    +AT  IQ +   D      +L++                 +E E+
Sbjct  73    LVWIEPDKPAFQVNANATVAIQELAHGDDDPEDWLLQT-----------------IESEM  115

Query  1266  SNNAAWRNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTV-VSllgelmel  1090
             ++N      A  P     V FA L+ L E+   +  +R HTA CDR    V +   L  L
Sbjct  116   NSNPWTDRDAPVP-----VFFARLHRLGEKS--LFVIRVHTAACDRAAAAVIMSEFLHRL  168

Query  1089  mregtLKGIKNEG-EGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKG  913
               +   +G   +G E    IE+ +P  ++ K  WAHG+D+LGYS+ S R   L F++V+ 
Sbjct  169   RGDDEQEGKDGDGVEELVSIEDAIPRGQANKPFWAHGVDLLGYSLGSLRHALLPFDNVEE  228

Query  912   PRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYG  733
             PR + +V+  L+L HT  +   C      L G L AAGL A     + +     + + + 
Sbjct  229   PRRTELVRASLSLEHTKSLTKRCVLEKTNLFGALVAAGLRAT----TIYKQLGNRSEHFA  284

Query  732   VVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHF  553
             ++ L DCR+ +D  LS    GFYHSAILN H V      WD+++R   +F N+ K  KHF
Sbjct  285   IIGLVDCRNHIDS-LSRSTAGFYHSAILNTHHVNQDTGFWDLSRRCSDSFSNAIKNRKHF  343

Query  552   SDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSV  373
             +DM D+N+LM +A+ +P LT S +LR++++ VF++ +  +   + +  LG+EDYVGC+SV
Sbjct  344   TDMGDINYLMFQALQHPNLTPSGTLRTSLMVVFQDVIADESEEETKHTLGLEDYVGCASV  403

Query  372   HGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRIL  238
             HGVGPS+A+FD++ DG L C  VYP+PLHSREQ+ ++VD+M  IL
Sbjct  404   HGVGPSLALFDSIRDGCLHCNVVYPAPLHSREQIRKVVDDMMEIL  448



>ref|XP_001783329.1| predicted protein [Physcomitrella patens]
 gb|EDQ51874.1| predicted protein [Physcomitrella patens]
Length=509

 Score =   278 bits (710),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 168/468 (36%), Positives = 249/468 (53%), Gaps = 19/468 (4%)
 Frame = -3

Query  1605  ERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNA  1426
             +R++G TEH WCRAVS GTGITVL FL   +  +   L+ A+  +   HP LRS+L +  
Sbjct  48    DRLLGDTEHNWCRAVSVGTGITVLGFLFR-RLLNPLTLQAAIDIVQIQHPRLRSQLIWIH  106

Query  1425  ATKAFSFAISATPDIQITPFDAPSTLQILRSR----TdsdddvvspsPFHIILEHELSNN  1258
                AF   I         P  +      +R           +      +   +E EL+ N
Sbjct  107   GRPAFQSQIVEDVSDDTVPMPSEKANSDMRDEDPHLISDSSEECDEKGWVKFVEEELNIN  166

Query  1257  AAWRNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmreg  1078
                       P    +    LY L  E    M LR HTA CDR +  ++  ++++ +   
Sbjct  167   IWPEREHCLQP--VQLFVVRLYLL-SENRSAMILRIHTAACDRVSASTVSADILKALSNV  223

Query  1077  tLKGI------KNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVK  916
             + + +       N G     +E+ +P  K+ K  WAHGID+LGYS+ S R   L F D  
Sbjct  224   SKRELAASDVNTNTGPDLLSVEDTIPPGKANKPFWAHGIDLLGYSLGSRRHALLPFQDPD  283

Query  915   GPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKY  736
              PR + +++  L+  HT  +L  C  A   L G L AAGL AA ++++       + + Y
Sbjct  284   SPRRTGLIRSSLSFDHTQALLQACNEAKASLYGALCAAGLKAAAATKNL----GGRGEHY  339

Query  735   GVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKH  556
              V++L DCR  L+P +S +  GFYHSA++  H +      W++AKR   + +N+    KH
Sbjct  340   AVISLVDCRRFLEPAISDNTVGFYHSALMLTHHLNEKVEFWELAKRCSGSLDNAMNNRKH  399

Query  555   FSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSS  376
             F+DM DLN+LM +AI  P LT S SLR++++  F + +  ++  D+   L +ED+VGCSS
Sbjct  400   FTDMGDLNYLMYQAISRPNLTPSGSLRTSLLVTFRDSMTDEL-GDLATALDIEDFVGCSS  458

Query  375   VHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILID  232
             VHGVGPS+AIFDT+  G+L CA V+P+PLHSR+QM   VD M   L++
Sbjct  459   VHGVGPSLAIFDTICKGELHCANVFPTPLHSRQQMQAYVDTMMSYLVE  506



>ref|XP_006645061.1| PREDICTED: uncharacterized protein LOC102701397, partial [Oryza 
brachyantha]
Length=327

 Score =   271 bits (694),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 138/315 (44%), Positives = 209/315 (66%), Gaps = 5/315 (2%)
 Frame = -3

Query  1176  GGHVMALRFHTAVCDRTTVVSllgelmelmregtLKGIKNEGEGSF--GIENVVPSEKSK  1003
             GG  + +R HTA CDR    SL+ EL+ L+         +  + +    +E  +P   S 
Sbjct  1     GGSALFVRIHTAACDRAASASLVRELVALLASDGAAPAADPEDAAVHAALEERIPQRDSW  60

Query  1002  KRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLVVKLQLNLHHTSRILAGCKSAGIKL  823
             K  WA G+DM+GYS+N  R + L F      R + +++L  +   T+R+L  CK  G+KL
Sbjct  61    KPFWARGLDMVGYSINGLRTSTLPFEVTGTERSTQMLRLGFDREETTRLLDACKQNGVKL  120

Query  822   CGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNM  643
             C  + AA L+AA  ++      QQ+   Y +  L +CR  L+P L  H+ GF+HSAI N 
Sbjct  121   CSAMAAATLLAARQAKQLKSDDQQET--YSIAILINCRKFLEPALDDHNVGFFHSAITNT  178

Query  642   HTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVI  463
             HTV GGE LW++AKR   ++ ++K + KH +D++DLNFLMC+AI+NP LT +++LR+AV+
Sbjct  179   HTVHGGEGLWELAKRCQDSYASAKNSKKHLTDISDLNFLMCRAIENPQLTTATALRTAVV  238

Query  462   TVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHS  283
             +VFEEPVVY++S D+Q + GVE++V  ++VHGVGPSI +FD++ DG+L+ AC+YP PLHS
Sbjct  239   SVFEEPVVYELS-DLQGKAGVEEFVCGATVHGVGPSIGLFDSIRDGQLELACMYPCPLHS  297

Query  282   REQMHELVDEMKRIL  238
             R+QM E+++++K+IL
Sbjct  298   RKQMQEIMNKVKQIL  312



>gb|EMS47722.1| hypothetical protein TRIUR3_22027 [Triticum urartu]
Length=331

 Score =   267 bits (682),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/281 (44%), Positives = 189/281 (67%), Gaps = 3/281 (1%)
 Frame = -3

Query  1047  GSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLVVKLQLNLHH  868
             G  G+E  +  + ++K LWA G+DM+GYS++  R + L F +    R + +V+L+     
Sbjct  50    GRAGLEKRIRKKDARKPLWARGVDMVGYSLDGLRASTLPFEETGTARSTHMVRLRFGRED  109

Query  867   TSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTDCRSILDPPL  688
             T+R+L  CK  G++LC  + AA ++AA  SR      QQ+   Y V TL +CR  L+P L
Sbjct  110   TTRLLHACKENGVRLCSAMAAATMLAARQSRKHSSSGQQET--YYVATLINCREFLEPAL  167

Query  687   SSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADLNFLMCKAID  508
             + H+ GF++S + N H V    RLW +A+R + A  N++   KH +D+ DLNFLMC+AI+
Sbjct  168   NDHNVGFFYSGVTNTHKVNREGRLWALARRCHDAHSNARNNKKHLTDIGDLNFLMCRAIE  227

Query  507   NPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPSIAIFDTVID  328
             NP LT +S+LR+A+++VF+E   +D+  D+Q + GVEDYV C++VHG+GPSI +FD++ D
Sbjct  228   NPQLTTASALRTALVSVFDELATFDV-PDLQSKAGVEDYVCCATVHGIGPSIGVFDSIRD  286

Query  327   GKLDCACVYPSPLHSREQMHELVDEMKRILIDATKFIDDLN  205
             G+LDCAC+YPSPLHSR+Q+ E++D +K IL + +   DD N
Sbjct  287   GELDCACMYPSPLHSRKQIQEVLDRVKMILHEGSNPSDDKN  327



>gb|EPS70645.1| hypothetical protein M569_04115 [Genlisea aurea]
Length=214

 Score =   254 bits (649),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 128/213 (60%), Positives = 163/213 (77%), Gaps = 6/213 (3%)
 Frame = -3

Query  876  LHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTDCRSILD  697
            +   S    GCKS GIKLCG+LTAA L+AA S+ ++     +   KYGVVTLTDCRS L+
Sbjct  1    MKKASIFFQGCKSRGIKLCGILTAAILLAAASANAK-----KNLNKYGVVTLTDCRSFLN  55

Query  696  PPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADLNFLMCK  517
            PPLS HHYGFYHSAILN + ++G E LW++A   Y+ F   K+ NKH +DMAD+NFLM K
Sbjct  56   PPLSVHHYGFYHSAILNTYAIQGTETLWELATGCYADFSKMKQNNKHLTDMADINFLMTK  115

Query  516  AIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPSIAIFDT  337
            A++NPGLT+ SSLRSA++TVFE+ V+ D S  ++R +GV+DY+GCSSVHG+GPSIA+FDT
Sbjct  116  AVENPGLTSRSSLRSALVTVFEDAVIDD-SGGMRRLIGVDDYIGCSSVHGIGPSIAVFDT  174

Query  336  VIDGKLDCACVYPSPLHSREQMHELVDEMKRIL  238
            V DG+LDC  VYPSPLHSREQ+ E+  +M  IL
Sbjct  175  VRDGELDCILVYPSPLHSREQIEEIAAKMTTIL  207



>ref|XP_002308464.2| hypothetical protein POPTR_0006s22730g [Populus trichocarpa]
 gb|EEE91987.2| hypothetical protein POPTR_0006s22730g [Populus trichocarpa]
Length=175

 Score =   237 bits (605),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 128/161 (80%), Gaps = 1/161 (1%)
 Frame = -3

Query  702  LDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADLNFLM  523
            LDPP      GFYHSA LN H +KGGE+LW+MAK+ Y+AF NSK  N+HF DMADLNFLM
Sbjct  10   LDPPTIQSTRGFYHSATLNTHEMKGGEKLWEMAKKIYTAFANSKNCNRHFLDMADLNFLM  69

Query  522  CKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPSIAIF  343
            CKAIDNPGLT SSSLR+A+++VFEEPV  D    +Q E+GVEDY+GC+S HG+GPSIAIF
Sbjct  70   CKAIDNPGLTPSSSLRTALLSVFEEPVKDDYGG-LQEEVGVEDYMGCASAHGIGPSIAIF  128

Query  342  DTVIDGKLDCACVYPSPLHSREQMHELVDEMKRILIDATKF  220
            D V DG+LDC CVYPSPLHSREQM E +D MK +L++  + 
Sbjct  129  DRVRDGRLDCVCVYPSPLHSREQMQEFIDNMKSVLVEGCRL  169



>gb|KHG06935.1| pab-dependent poly (a)-specific ribonuclease subunit pan2 [Gossypium 
arboreum]
Length=331

 Score =   238 bits (606),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 147/313 (47%), Positives = 196/313 (63%), Gaps = 12/313 (4%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R VG  E+ WCRAV GGTGITVL+ L++    D   L   L ++  +HPILRS++R++
Sbjct  20    KVRAVGLAEYSWCRAVPGGTGITVLSLLLT-NVPDISFLEALLCRLQVSHPILRSRVRFD  78

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
             A+   F F   + P +QI  FD  ST  IL+S              H++LEHEL+ N+ W
Sbjct  79    ASCNTFYFVTPSNPHVQIQSFDLQSTSHILQS----SLGDSHIDSHHVLLEHELNRNS-W  133

Query  1248  RNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLK  1069
              N      +  DV FASLY +  +    +  R HT+ CDR   V LL EL+E++  G  K
Sbjct  134   -NRTDGDQADWDVFFASLYTI-SDARWFLVFRLHTSACDRAAAVGLLRELLEMVGGGRAK  191

Query  1068  GIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLVVK  889
               + E E   GIE+++PS K+ K LWA G+D+LGYS+NSF+L NL F D    RHS VV+
Sbjct  192   A-EEEIEQEVGIEDLIPSGKANKPLWARGVDLLGYSLNSFKLANLNFIDANSARHSQVVR  250

Query  888   LQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTDCR  709
             L++N   T R++AGCKS GIKLCG L AAG++AA S++   DH   QK+KY VVTL DCR
Sbjct  251   LKMNPDDTDRLVAGCKSRGIKLCGALAAAGMIAARSTKPFPDH---QKEKYAVVTLIDCR  307

Query  708   SILDPPLSSHHYG  670
             SIL+P LSS+H+G
Sbjct  308   SILEPVLSSNHFG  320



>ref|XP_006588846.1| PREDICTED: uncharacterized protein LOC100782381 [Glycine max]
Length=176

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 126/149 (85%), Gaps = 2/149 (1%)
 Frame = -3

Query  672  GFYHSAILNMHTVKG-GERLWDMAKRSYSAFENSKKTNKHFSDMADLNFLMCKAIDNPGL  496
            GFYHSAILN H V G  E LW++AK+SY+A  N+   NKHF+DM+DLN+LMCKAI+NPGL
Sbjct  8    GFYHSAILNTHDVCGETETLWELAKKSYTAIVNAMNCNKHFTDMSDLNYLMCKAIENPGL  67

Query  495  TASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPSIAIFDTVIDGKLD  316
            T SSSLR+A+I+VFE+PV +D SA++  E G+EDYVGC+S HGVGPSIA+FDT+ +GKLD
Sbjct  68   TPSSSLRTALISVFEDPV-FDDSAEMLGEFGLEDYVGCASAHGVGPSIAVFDTIRNGKLD  126

Query  315  CACVYPSPLHSREQMHELVDEMKRILIDA  229
            CAC+YPSPLHSREQ+  LVD MKRIL++ 
Sbjct  127  CACIYPSPLHSREQIQGLVDHMKRILVEG  155



>ref|XP_011016010.1| PREDICTED: uncharacterized protein LOC105119559, partial [Populus 
euphratica]
Length=269

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 134/260 (52%), Positives = 165/260 (63%), Gaps = 12/260 (5%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             K R VGGTEH WCRAV GGTGI VLA L S K     +L NALHK+ N+HPILRS+L   
Sbjct  15    KARAVGGTEHSWCRAVPGGTGIAVLAILTS-KLPRNSVLENALHKLQNSHPILRSRLHSG  73

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
             + T  FSF  S TP I++  F+  ST +IL +    +    S SP H++LEHEL+ N+ W
Sbjct  74    SNTNTFSFITSPTPFIKLKAFNLSSTFKILEN--PLNPKNQSLSPLHLVLEHELNQNS-W  130

Query  1248  RNPASFPPSG---ADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmreg  1078
              N    P S     D+ FA+ YALP     V+ LR H + CDRTT VSLL EL+ L+ E 
Sbjct  131   YNHNKAPSSINEIQDMFFATTYALPN-AKWVLVLRLHASACDRTTAVSLLQELVVLVSEE  189

Query  1077  t----LKGIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGP  910
                   K I NEGE +  IE++VP++K+KK LW  GIDMLGYSVNS RLTNLKF D + P
Sbjct  190   ERGALQKEIANEGEITSRIEDLVPNKKAKKGLWERGIDMLGYSVNSLRLTNLKFKDSRSP  249

Query  909   RHSLVVKLQLNLHHTSRILA  850
             R S VV+LQ+N   T  I+A
Sbjct  250   RSSQVVRLQMNQKDTETIIA  269



>ref|XP_001758098.1| predicted protein [Physcomitrella patens]
 gb|EDQ76920.1| predicted protein [Physcomitrella patens]
Length=471

 Score =   211 bits (537),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 154/471 (33%), Positives = 227/471 (48%), Gaps = 36/471 (8%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCL----LRNALHKILNAHPILRSKLR  1435
             R +G TE  W   V  GTGI++ + L      D C+    L  AL ++L  +P LRSK+ 
Sbjct  11    RRLGKTEANWVAVVKTGTGISISSILF-----DRCIPAADLDFALQELLAKNPRLRSKIT  65

Query  1434  YNAATKAFSFAISATPD-IQITPFDAPSTLQILRSRT--dsdddvvspsPFHIILEHELS  1264
             Y  A K        TPD + IT    PS    L        D +     P+H+I E EL 
Sbjct  66    YAEADKKQQ--CFETPDEVSITVPVIPSRFDSLLQSNGGAEDSEGEIREPWHLITEEEL-  122

Query  1263  NNAAWRNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmr  1084
              N  +     FP     V    LY L +    V+ LR H+A  D  +   ++ ++M+   
Sbjct  123   -NTPFPTDCPFP-----VFECKLYILSDSNCLVI-LRLHSAAADIASTGIIVKQIMQDSA  175

Query  1083  egtLKGIKNEGEGSFG---------IENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLK  931
                 K    +   + G         IE+VVP  + KK  WAHG+D++GY + S R + L 
Sbjct  176   TVGQKVADPKLLATTGGKLNYHLPCIESVVPPGEGKKPFWAHGMDVVGYGLGSRRYSYLP  235

Query  930   FNDVKGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQ  751
             F D   PR S +++  L    T+ +L  C+  G+ + G + AAGL A  + +        
Sbjct  236   FQDTVSPRSSKLIRAALTAEGTNLLLKECEKRGVSIGGAINAAGLKAVAAVK----MLGM  291

Query  750   QKKKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSK  571
             +++ Y    L  CR  L+P L+    GFYHSAIL    V      W++A +    F  + 
Sbjct  292   KEENYSSAVLVQCRHRLEPKLADSAVGFYHSAILRTMDVSESMPFWEVATKCTKDFNEAI  351

Query  570   KTNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDY  391
             +  KHF+DM DLN L+ +A+  P LT S +LR+A +++  +PV+ D+       +GV+DY
Sbjct  352   RNKKHFTDMGDLNTLLGQALRFPNLTPSKTLRTATLSMTLDPVLEDV-GPAAAAVGVKDY  410

Query  390   VGCSSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEMKRIL  238
             + CS+ HGVGP + IF  +    L  + VYPSPL S  Q   LVD +   L
Sbjct  411   MSCSAAHGVGPCLGIFSFMRQRSLQFSFVYPSPLFSTSQTQRLVDHILNYL  461



>ref|XP_001781819.1| predicted protein [Physcomitrella patens]
 gb|EDQ53373.1| predicted protein [Physcomitrella patens]
Length=459

 Score =   202 bits (515),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 146/467 (31%), Positives = 222/467 (48%), Gaps = 38/467 (8%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNAA  1423
             R +G TE  W  AV  GTGIT+ + L   +   T  L  AL  +L  HP LRS +    A
Sbjct  8     RKLGKTEANWVAAVDEGTGITISSILFERRIPVTD-LEAALRDVLALHPRLRSTI--EQA  64

Query  1422  TKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAWRN  1243
                F F    T  + ++       +   +   + D+D  +   +H I E EL N    + 
Sbjct  65    HNEFFFQTPETVSVSLS-----EIVWSAQGEEEGDEDNRAQQLWHGITEDEL-NIPYQKC  118

Query  1242  PASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTV------VSllgelmelmre  1081
             P         V    LY LPE    ++ LR H A  D  +       V           +
Sbjct  119   PVP-------VFEPKLYLLPESQS-LLVLRLHAAAADMASTPIIIKQVVSSLYKRSGTEK  170

Query  1080  gtLKGIKNEGEGSF----------GIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLK  931
              + +G+++  E              IE+ +PS ++KK  WAHG+D++GY + S R   L 
Sbjct  171   ESAEGVEDNLEKLKLSEPQEVLLPCIEDAIPSGQAKKPFWAHGVDVVGYGLVSRRHAYLP  230

Query  930   FNDVKGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQ  751
             F++ +G R S +++  L    T  +L  C+   + + G + AA L     + + +     
Sbjct  231   FDNPEGLRQSKLLRAGLTAEATDLLLKECEKRSVSIHGAINAAAL----KTVTAYKRVGP  286

Query  750   QKKKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSK  571
             + + YG   L  CR+ L P L     GFYH+A++        E  WD+A R    F+ + 
Sbjct  287   RGEHYGTTVLLQCRNRLHPVLPDSTVGFYHAALMRTIHTTEPESFWDLATRCSEDFDTAI  346

Query  570   KTNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDY  391
             K  KHF+DM DLN LM +A+  P LT S SLR++V++    PVV D+  +    +GV+DY
Sbjct  347   KNRKHFTDMGDLNALMVQAMRFPNLTPSGSLRTSVLSTMFTPVVEDLGEEAA-AVGVKDY  405

Query  390   VGCSSVHGVGPSIAIFDTVIDGKLDCACVYPSPLHSREQMHELVDEM  250
             + CSS HGVGP +A+F  + +  L  + V+ SPL+SR  M  LVD +
Sbjct  406   LSCSSTHGVGPCLALFPFMRESALQFSFVFSSPLYSRTLMQSLVDSI  452



>gb|EAZ14233.1| hypothetical protein OsJ_04157 [Oryza sativa Japonica Group]
Length=784

 Score =   206 bits (525),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 141/385 (37%), Positives = 197/385 (51%), Gaps = 58/385 (15%)
 Frame = -3

Query  1596  VGGTEHGWCRAVSGGTGITVLAFLV---SPKAADTCLLRNALHKILNAHPILRSKLRYNA  1426
             VGG E+GW RAV GGTG T+LA  +   +  A     ++ AL  IL+AHP+LR++LR + 
Sbjct  444   VGGMEYGWYRAVPGGTGTTLLALRLARGAEAAVAAATVQAALRAILDAHPVLRARLRGH-  502

Query  1425  ATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAWR  1246
                          ++   P+ A +                         EHE        
Sbjct  503   -------------ELNRNPWTAAAATATAS-------------------EHE--------  522

Query  1245  NPASFPPSGADVLFASLYALPEE--GGHVMALRFHTAVCDRTTVVSllgelmelmregtL  1072
                  PP    VLFA+LY LP    GG  + +R HTA CDR    SL+ EL+  +     
Sbjct  523   --PDAPP----VLFATLYELPPPAGGGSALFVRIHTAACDRAASASLVRELLAQLAGDGA  576

Query  1071  KGIKNEGEGSFGI----ENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRH  904
                         +    E  +P   S K  WA G+DM+GYS+N  R + L F      R 
Sbjct  577   AAAAASEPEDAAVRASLEERIPQRDSWKPFWARGLDMVGYSINGLRTSTLPFEVTGTERS  636

Query  903   SLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVT  724
             + +++L  +   T+R+L  CK  G+KLC  + AA L+AA  S+ Q   +QQ+   Y + T
Sbjct  637   TQMLRLGFDRDETTRLLDACKQNGVKLCAAMAAATLLAARQSKLQLASNQQE--TYSIAT  694

Query  723   LTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDM  544
             L +CR  L+P L  H+ GFYHSAI N H + GGE LW++AKR   ++ N+K   KH +D+
Sbjct  695   LINCRKFLEPALDDHNVGFYHSAITNTHAIHGGEELWELAKRCQDSYTNAKNNKKHLTDI  754

Query  543   ADLNFLMCKAIDNPGLTASSSLRSA  469
             ADLNFLMC+AI+NP LT  S+LR+A
Sbjct  755   ADLNFLMCRAIENPQLTTGSALRTA  779



>gb|KDO70472.1| hypothetical protein CISIN_1g0117481mg, partial [Citrus sinensis]
Length=265

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 117/256 (46%), Positives = 153/256 (60%), Gaps = 15/256 (6%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNAA  1423
             R VGGTE+ WC+AV  GTGITVLA L+S K  +  LL+ AL+ + N HPILRSKL  +A 
Sbjct  18    RPVGGTEYSWCKAVPTGTGITVLALLLS-KHPNIQLLQTALNNLQNNHPILRSKLHSSAD  76

Query  1422  TKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAWRN  1243
              K FSF     P IQI  FD  ST Q +  +T +         F +ILEHEL+ N  W N
Sbjct  77    AKTFSFITPPEPHIQIQHFDISSTSQTISDKTGAVSP------FQLILEHELNRNT-WTN  129

Query  1242  PA--SFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelmelmregtLK  1069
             P+  S   S +++   S+Y  P E   V+ LR HT++CDR +  ++  EL+ LM      
Sbjct  130   PSHQSNTNSDSNLFNVSIYT-PSETQWVVTLRLHTSICDRASAAAVSKELLRLMTGREEG  188

Query  1068  GIKNE----GEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHS  901
             GI+ E    GE S GIE  +PS K+ K  WA G+DMLGYS+NS RL+N+ F D   PR S
Sbjct  189   GIEKEYDRKGEVSLGIEEFIPSGKANKPFWARGVDMLGYSLNSLRLSNISFVDADSPRFS  248

Query  900   LVVKLQLNLHHTSRIL  853
              V++LQLN   T R++
Sbjct  249   QVLRLQLNRDETGRLV  264



>ref|XP_009343013.1| PREDICTED: uncharacterized protein LOC103934971 [Pyrus x bretschneideri]
Length=260

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 123/259 (47%), Positives = 152/259 (59%), Gaps = 21/259 (8%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNAA  1423
             R VGGTE  WCRAV GGTGITVLAFL+S K+     L+ ALHKI N+HPIL S+L  N  
Sbjct  8     RPVGGTETSWCRAVPGGTGITVLAFLLS-KSPKMLNLQTALHKIQNSHPILSSRLHTNPK  66

Query  1422  TKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAWRN  1243
             T  FS   S T  +Q+  F+  STL IL   T ++    S SP H+I EHEL+ N  W++
Sbjct  67    TNTFSLVTSPTSYVQLKSFNLSSTLNILE--TLANPSNRSVSPLHLICEHELNENT-WQH  123

Query  1242  PASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSllgelm---------el  1090
               +  P   D+ FAS          V+ LR H + CDRTT VSLL EL          + 
Sbjct  124   HNTADPD-QDMFFASTT-------WVLVLRLHVSACDRTTAVSLLRELAGLMSGRDEGKE  175

Query  1089  mregtLKGIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGP  910
                   K I N+GE + GIE+++PS K+ K LW  G+DML YSVNS RL NLKF D K  
Sbjct  176   REVVVKKKIGNKGEVNLGIEDLIPSGKANKGLWLRGMDMLSYSVNSLRLANLKFKDNKSA  235

Query  909   RHSLVVKLQLNLHHTSRIL  853
             R S VV+LQ+N   T R+L
Sbjct  236   RFSQVVRLQMNRDETQRVL  254



>gb|EPS73214.1| hypothetical protein M569_01543 [Genlisea aurea]
Length=266

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 108/261 (41%), Positives = 153/261 (59%), Gaps = 14/261 (5%)
 Frame = -3

Query  1620  DENNKERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSK  1441
             DEN   R++GGTE  WCRAV+ GTG TVL   +S  +++T  L   L  +  +HP+L  K
Sbjct  6     DENG--RILGGTEKAWCRAVTSGTGNTVLGLKLSRSSSETSRLTKILSVLERSHPLLGRK  63

Query  1440  LRYNAATKAFSFA-ISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELS  1264
             L Y+ A K F FA  +A P  +I   D   T  +L +      +     P   I+E E+ 
Sbjct  64    LDYDPAGKTFRFAKPAANPPPEIAFHDGEKTRTLLNN-----PEKSEIPPLQQIVEREMR  118

Query  1263  NNAAWRNPASFPPSGADVLFASLYAL-PEEGGHVMALRFHTAVCDRTTVVSllgelmelm  1087
                 W +P SFP  G  ++FA++YAL P E   V+  RFHT+VCDRTT VS L EL+EL+
Sbjct  119   AGEIWSDPDSFPRGGVPLIFAAVYALSPSE--SVVVFRFHTSVCDRTTAVSFLSELLELV  176

Query  1086  regtLKG---IKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVK  916
                   G   +KN GEG   +E+++PS  + K +W  G DMLGYS+++ R+TNL+F ++K
Sbjct  177   STAEDSGRKPLKNSGEGEAALESLIPSGLTGKGIWTRGKDMLGYSLSALRMTNLEFVNLK  236

Query  915   GPRHSLVVKLQLNLHHTSRIL  853
              PR S +++L +N   TS IL
Sbjct  237   MPRKSNLIRLHVNQRLTSDIL  257



>dbj|BAK04361.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=374

 Score =   160 bits (406),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 111/315 (35%), Positives = 164/315 (52%), Gaps = 30/315 (10%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRY-  1432
             + R V GTE+ WCRAV GGTG T+LA  +S + +       A+  + +AHP+LR+ +R  
Sbjct  14    RSRAVCGTEYSWCRAVPGGTGTTLLALRLSRRGSSAA--EAAVRSLQSAHPVLRAHIRAA  71

Query  1431  NAATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAA  1252
             +A++   +F  +A    Q+     PS L                  F  +LE EL++N  
Sbjct  72    SASSPTLAFPSTAA---QLALAPQPSALD-----------------FSSLLERELNSNPW  111

Query  1251  WRNPASFPPSGADVLFASLYALPE-EGGHVMALRFHTAVCDRTTVVSllgelmelmregt  1075
               +P    P GA VLFA+LY LP   GG  + +R HTA CDR    +LL EL+  +    
Sbjct  112   ASDPG---PEGAPVLFAALYDLPPPSGGTALFVRIHTAACDRAASGALLRELLAHLGGAG  168

Query  1074  LKGIKNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVKGPRHSLV  895
                 +       G+E+ +P + + K  WA G+DM+GYS+N  R + L F +    R + +
Sbjct  169   DPEEEEAAAVEAGLEDRIPKQDAWKPFWARGVDMVGYSINGLRTSTLPFEEAGTARSTQM  228

Query  894   VKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTD  715
             V+L      T+R+L  CK  G+KLC  + AA L+AA  S+ + D  QQ+   Y V TL +
Sbjct  229   VRLAFGREDTTRLLDACKENGVKLCSAMAAATLLAARQSK-KLDSGQQE--TYSVATLIN  285

Query  714   CRSILDPPLSSHHYG  670
             CR  L+P L  H+ G
Sbjct  286   CRQFLEPVLDDHNVG  300



>ref|XP_002994738.1| hypothetical protein SELMODRAFT_432639 [Selaginella moellendorffii]
 gb|EFJ04195.1| hypothetical protein SELMODRAFT_432639 [Selaginella moellendorffii]
Length=481

 Score =   152 bits (385),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 125/491 (25%), Positives = 223/491 (45%), Gaps = 54/491 (11%)
 Frame = -3

Query  1605  ERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNA  1426
             +R +G +E  W R  +GGTGI +    +  +   T  +  A   +   H +LR++L  +A
Sbjct  9     KRELGSSEENWTRCTAGGTGIGIFGMALR-QIVQTPSILLAAKAVCENHSMLRAQLVPDA  67

Query  1425  --ATKAFSFAI----SATPDIQITPFDAPSTL--------QILRSRTdsdddvvspsPFH  1288
               ++K  +F +    S  P ++  P+    TL         +++S   +        PFH
Sbjct  68    KSSSKKLAFEVRSVDSFAPVVESLPWPEEGTLGSCDGDEEALVKSALQAVVTNELNLPFH  127

Query  1287  IILEH-ELSNNAAWRNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVSl  1111
                EH EL +               D+    +Y     G  ++ LRFH+  CDR +  + 
Sbjct  128   K--EHKELDHTV-------------DIFQIHVYEEASSGSSIIVLRFHSGACDRYSSSTA  172

Query  1110  lgelmelmregtLKGIKNEGEGSFG---------IENVVPSEKSKKRLWAHGIDMLGYSV  958
               E +  +      G++ E +             +E++VP  K+ K  +  GID +GY++
Sbjct  173   AQEFVAALDRCVEAGVECERQEQQRQDRDGLLPCMEDLVPKSKASKGFFKKGIDAVGYAL  232

Query  957   NSFRLTNLKFNDV------KGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGL  796
             NS +   L F           P  S ++   L    T    A CK     +   L+AA L
Sbjct  233   NSSKSALLPFQPGFTKQPHATPFRSEILSYSLGKPGTEDFFAACKRESTTIAAALSAAFL  292

Query  795   MAAHSSRSQWDHHQQQKKKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERL  616
               A S        ++++  +    + DCR   +PPL +   G Y + + +   VK G   
Sbjct  293   KTAASVT-----KEKKQDTFSFTNVLDCRGYFEPPLDASVVGNYSAGLPHDEQVKEGVPF  347

Query  615   WDMAKRSYSAFENSKKTNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVY  436
             WD+A++  S+ E +   ++HFS+++ LN L+ + I +P +T SSS+R+A+ TVF +    
Sbjct  348   WDLARQISSSTEKNLAKSRHFSELSVLNMLLSQVIKHPSVTPSSSMRTALFTVFVDGPTK  407

Query  435   DISADIQRELGVEDYVG-CSSVHGVGPSIAIFDTVIDG-KLDCACVYPSPLHSREQMHEL  262
                 ++ + L +   +G  +S+H VGP  ++ + ++DG +L    VY +P++SR Q+ +L
Sbjct  408   CSWGNV-KNLKLAGTIGPLASMHYVGPCFSVAEALLDGPELSLTFVYTTPMYSRSQLQDL  466

Query  261   VDEMKRILIDA  229
             V     +L  A
Sbjct  467   VSSSLDLLKSA  477



>gb|ABK25083.1| unknown [Picea sitchensis]
Length=213

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 77/203 (38%), Positives = 115/203 (57%), Gaps = 4/203 (2%)
 Frame = -3

Query  846  CKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTDCRSILDPPLSSHHYGF  667
            C+S    L G+L AA L A     +++     + + Y  V L +CRS+L+P +     GF
Sbjct  8    CESESSDLNGLLIAASLRAV----AKFKGTGSRGEHYASVLLLNCRSMLEPVIPDSTAGF  63

Query  666  YHSAILNMHTVKGGERLWDMAKRSYSAFENSKKTNKHFSDMADLNFLMCKAIDNPGLTAS  487
            YHS IL        E L  +A R  +    + K  KHF+DM DLN LM +A+ +P LT S
Sbjct  64   YHSGILKTFHATETEPLLKLATRITNDVNEAVKNRKHFTDMGDLNMLMAQAMGHPALTPS  123

Query  486  SSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPSIAIFDTVIDGKLDCAC  307
            +S+R+A+I+   EP  +D   +    L ++D+V CSS++GVGP +A++     G L  + 
Sbjct  124  ASMRTALISNVREPPCHDADKESTSYLNLKDWVTCSSINGVGPCLALYPDFRYGCLRVSF  183

Query  306  VYPSPLHSREQMHELVDEMKRIL  238
            VY SPL S E MH+LVD++  +L
Sbjct  184  VYCSPLFSAETMHKLVDDISSML  206



>ref|NP_001235706.1| uncharacterized protein LOC100527924 [Glycine max]
 gb|ACU17150.1| unknown [Glycine max]
Length=197

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 100/165 (61%), Gaps = 12/165 (7%)
 Frame = -3

Query  1608  KERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYN  1429
             + R VGGTE  WC+AV  GTG+TVL+ L+S K     +++NALHK+ N+HPILRSK+  +
Sbjct  16    EARPVGGTEFSWCKAVPIGTGVTVLSLLLS-KPPQIAVVQNALHKLQNSHPILRSKIHLD  74

Query  1428  AATKAFSFAISATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNNAAW  1249
              +   F F    TP +QI PFD  ST  I++ ++          PFH++LEHE++    W
Sbjct  75    PSNNTFHFLTPPTPTVQIHPFDLASTAHIIQCQS------DGHDPFHVLLEHEMNQEDTW  128

Query  1248  RNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTVVS  1114
             RN A    +  DVL A++Y++  +   V  LR HTA CDR + V+
Sbjct  129   RNYA----ADVDVLHAAVYSISHDRFAVF-LRLHTASCDRASAVA  168



>ref|XP_001785784.1| predicted protein [Physcomitrella patens]
 gb|EDQ49410.1| predicted protein [Physcomitrella patens]
Length=482

 Score =   132 bits (332),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 122/463 (26%), Positives = 211/463 (46%), Gaps = 28/463 (6%)
 Frame = -3

Query  1602  RVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLRYNAA  1423
             RV+G +E  W +A + GTGI V+   +  +  ++  +  A  +++  H +LR++   NA 
Sbjct  13    RVMGPSEENWTKATALGTGIAVMTIAMR-RLVESHHVAQACREVMYQHAMLRAQAVENAK  71

Query  1422  TKAFSFAI-----SATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELSNN  1258
              K    AI     S  P ++I P+   S+       T   DD       + ++  EL  N
Sbjct  72    GK---LAILVKNDSVAPCLEICPWPQTSSSCEAGDVTIEGDDDGLADAVNKVVRDEL--N  126

Query  1257  AAWRNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTV-VSllgelmelmre  1081
               + N  + P    D     +Y        ++ LRFH+   DR +  ++    L  L   
Sbjct  127   IPFVNSENNPSPPLDFFQVHMYTETSRSHTIIVLRFHSGGLDRPSAYIASRQFLTALNAI  186

Query  1080  gtLKGIK---NEGEGSF--GIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFNDVK  916
                + +    N G+ +    IE +VP  KS K ++  G D +GY++++ + T L F    
Sbjct  187   VDGQTVGLPLNHGKDAILPTIEELVPKGKSSKNIFQKGFDTVGYALSANKYTLLPFQPSF  246

Query  915   GPRH-----SLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQ  751
             G +      S ++   L    T+R+L  CK     L   L AA L  A + +       +
Sbjct  247   GEQKKEKFKSDILTYSLGTVETARLLEACKKEKTTLAAALGAAFLKTAANVKE---LKDK  303

Query  750   QKKKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFENSK  571
             +K ++   +L DCR   +P LS+   G + + +     VK G   WD+A+   ++     
Sbjct  304   KKDEFSFTSLVDCRKYFEPSLSADTIGNFVAGVPQGQQVKEGVSFWDLARSVSASTAKEL  363

Query  570   KTNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELGVEDY  391
               +K FS++  LN L  + + +P LT  SS+R+A+ ++F +     +  + QR L V   
Sbjct  364   SKSKQFSEIPVLNMLFSQVLKHPNLTPQSSMRTALFSLFVDEAPLQLYKEYQR-LQVAAV  422

Query  390   VG-CSSVHGVGPSIAIFDTVIDG-KLDCACVYPSPLHSREQMH  268
              G   S+HGVGP  A+ +   +G  L  + +YP P+++R QM 
Sbjct  423   AGPFPSMHGVGPCFAVSEAFCEGNNLSISLIYPQPVYTRSQMQ  465



>gb|AEX12714.1| hypothetical protein 2_6438_02 [Pinus taeda]
 gb|AEX12715.1| hypothetical protein 2_6438_02 [Pinus taeda]
 gb|AEX12716.1| hypothetical protein 2_6438_02 [Pinus taeda]
 gb|AEX12717.1| hypothetical protein 2_6438_02 [Pinus taeda]
 gb|AEX12718.1| hypothetical protein 2_6438_02 [Pinus taeda]
 gb|AEX12719.1| hypothetical protein 2_6438_02 [Pinus taeda]
 gb|AEX12720.1| hypothetical protein 2_6438_02 [Pinus taeda]
 gb|AEX12721.1| hypothetical protein 2_6438_02 [Pinus taeda]
Length=91

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 75/92 (82%), Gaps = 1/92 (1%)
 Frame = -3

Query  495  TASSSLRSAVITVFEEPVVYDISADIQRELGVEDYVGCSSVHGVGPSIAIFDTVIDGKLD  316
            T SSSLR+++I VFE P+V ++  +++R +G+EDY+GCSSVHGVGPS+A+FDTV +G LD
Sbjct  1    TPSSSLRTSLIVVFEGPMVDEMD-ELKRAIGLEDYMGCSSVHGVGPSLAVFDTVKNGALD  59

Query  315  CACVYPSPLHSREQMHELVDEMKRILIDATKF  220
            CACVYP+ LHSR+Q+  L++ MK ILI A K 
Sbjct  60   CACVYPASLHSRKQVQTLINCMKSILIGAAKL  91



>ref|XP_001764918.1| predicted protein [Physcomitrella patens]
 gb|EDQ70360.1| predicted protein [Physcomitrella patens]
Length=476

 Score =   111 bits (277),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 115/468 (25%), Positives = 207/468 (44%), Gaps = 38/468 (8%)
 Frame = -3

Query  1614  NNKERVVGGTEHGWCRAVSGGTGITVLAFLVSPKAADTCLLRNALHKILNAHPILRSKLR  1435
             ++  RV+G +E+ W +A + GTGI V+A  +  +   +  +  A  ++++ H  LR+++ 
Sbjct  9     DDNTRVLGPSEYNWTKATALGTGIAVVAVALR-RLVKSHQVALACQEVMDQHATLRAQVV  67

Query  1434  YNAATKAFSFAI---SATPDIQITPFDAPSTLQILRSRTdsdddvvspsPFHIILEHELS  1264
                  K  +F I   S  P+++I P+   S    +   T   DD    +  + ++  EL 
Sbjct  68    ETPKGK-LAFHIKGNSIAPNVEIYPWPQTSESYSVGDITVDGDDDGLAAAVNKVVRDEL-  125

Query  1263  NNAAWRNPASFPPSGADVLFASLYALPEEGGHVMALRFHTAVCDRTTV-VSllgelmelm  1087
              N  +  P   P    ++    +Y    +   ++ LRFH+   DR +  V+L   L  L 
Sbjct  126   -NTPFVIPEDSPSPPLNLFQVHMYTESFQSQTIIVLRFHSGGLDRPSASVALDQFLTALN  184

Query  1086  regtLKGIK---NEGEGSF--GIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFND  922
                  + +    N G+ +    IE +VP  KS K  +  G D +GY++++ R + L F+ 
Sbjct  185   SIVDGQPVSLPHNPGKDAILPTIEELVPKGKSSKNFFQKGFDTVGYALSANRYSLLPFHP  244

Query  921   -----VKGPRHSLVVKLQLNLHHTSRILAGCKSAGIKLCGVLTAAGLMAAHSSRSQWDHH  757
                   K    S V+   L    T+ +LA CK     L   L  A L  A   +   D  
Sbjct  245   NFAEHRKEKFKSDVLTYSLGKAGTASLLAACKKENTTLAAALGTAFLKTAAGVKELKD--  302

Query  756   QQQKKKYGVVTLTDCRSILDPPLSSHHYGFYHSAILNMHTVKGGERLWDMAKRSYSAFEN  577
              ++K ++            +P L+    G + + +      K G   WD+A+   +    
Sbjct  303   -RKKDEFSFTRF------FEPSLAVDAMGNFVAGVPQGQQAKEGCSFWDLARTVSALTAK  355

Query  576   SKKTNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQ----RE  409
                 +KH S++   N L  + + +P +T  SS+R+++ ++F      D +  +Q    + 
Sbjct  356   ELSKSKHLSEIPVPNMLFSQVLKHPNVTPQSSMRTSLFSLF-----VDEAPKLQWRGYQN  410

Query  408   LGVEDYVG-CSSVHGVGPSIAIFDTVIDGK-LDCACVYPSPLHSREQM  271
             L V    G   S+HGVGP  AI +T+ +G  L  + +Y  P+ +R QM
Sbjct  411   LQVGVVAGPFPSMHGVGPCFAISETLREGNDLSISFIYAQPVFTRSQM  458



>ref|XP_001787135.1| predicted protein [Physcomitrella patens]
 gb|EDQ48051.1| predicted protein [Physcomitrella patens]
Length=129

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 35/117 (30%), Positives = 64/117 (55%), Gaps = 3/117 (3%)
 Frame = -3

Query  582  ENSKKTNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELG  403
            E     +K FS++  LN L  + + +PG+T  SSLR+A+ ++F +   ++   +  + L 
Sbjct  6    EKELAKSKQFSEIPVLNMLFSQVLKHPGVTPQSSLRTALFSLFVDETPFNQWTNTDK-LQ  64

Query  402  VEDYVG-CSSVHGVGPSIAIFDTVIDGK-LDCACVYPSPLHSREQMHELVDEMKRIL  238
            V    G   S+H +GP  A+ DT++DG  +  + +YP+ ++SR QM      +  +L
Sbjct  65   VAAVCGPFPSMHRIGPCFAVCDTMLDGNDISISLMYPTQVYSRAQMKAFAASVMNLL  121



>ref|XP_001752297.1| predicted protein [Physcomitrella patens]
 gb|EDQ83030.1| predicted protein [Physcomitrella patens]
Length=329

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 64/117 (55%), Gaps = 3/117 (3%)
 Frame = -3

Query  582  ENSKKTNKHFSDMADLNFLMCKAIDNPGLTASSSLRSAVITVFEEPVVYDISADIQRELG  403
            E     +K FS++  LN L  + + +PG+T  SSLR+A+ ++F +   ++   +  + L 
Sbjct  140  EKELAKSKQFSEIPVLNMLFSQVLKHPGVTPQSSLRTALFSLFVDETPFNQWTNTDK-LQ  198

Query  402  VEDYVG-CSSVHGVGPSIAIFDTVIDGK-LDCACVYPSPLHSREQMHELVDEMKRIL  238
            V    G   S+H +GP  A+ DT++DG  +  + +YP+ ++SR QM      +  +L
Sbjct  199  VAAVCGPFPSMHRIGPCFAVCDTMLDGNDISISLMYPTQVYSRAQMKAFAASVMNLL  255



>emb|CDY68762.1| BnaAnng28290D [Brassica napus]
Length=64

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -3

Query  1062  KNEGEGSFGIENVVPSEKSKKRLWAHGIDMLGYSVNSFRLTNLKFND  922
             K+ G G   IE ++PS +  K  WAH +D+LGYS+N+FR +NL F D
Sbjct  17    KDVGLGK-AIEEMIPSGEGDKLFWAHWMDVLGYSLNAFRFSNLSFVD  62



>ref|XP_010263434.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Nelumbo 
nucifera]
Length=343

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 41/59 (69%), Gaps = 3/59 (5%)
 Frame = -3

Query  846  CKSAGIKLCGVLTAAGLMAAHSSRSQWDHHQQQKKKYGVVTLTDCRSILDPPLSSHHYG  670
            CK  GIKL G L AAGL+AAHSS+   +HH +   KY VVTL DCRS+LDP L S H G
Sbjct  285  CKERGIKLSGALAAAGLIAAHSSKDLLNHHPE---KYAVVTLIDCRSLLDPVLHSCHLG  340



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4885834314610