BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18844_g1_i2 len=777 path=[1:0-317 319:318-439 441:440-776]

Length=777
                                                                      Score     E

ref|XP_006360013.1|  PREDICTED: uncharacterized protein LOC102601991    182   1e-53   
ref|XP_009617700.1|  PREDICTED: nifU-like protein 3, chloroplastic      177   1e-51   
ref|XP_004248220.1|  PREDICTED: uncharacterized protein LOC101254243    175   6e-51   
ref|XP_009783949.1|  PREDICTED: uncharacterized protein LOC104232434    175   7e-51   
gb|EYU26226.1|  hypothetical protein MIMGU_mgv1a014182mg                172   1e-49   
ref|XP_011098104.1|  PREDICTED: uncharacterized protein LOC105176868    171   3e-49   
ref|XP_008243465.1|  PREDICTED: uncharacterized protein LOC103341707    171   4e-49   
ref|XP_010542974.1|  PREDICTED: uncharacterized protein LOC104816015    168   5e-48   
ref|XP_007204438.1|  hypothetical protein PRUPE_ppa026994mg             166   8e-48   
ref|XP_010252872.1|  PREDICTED: uncharacterized protein LOC104594327    166   2e-47   
ref|XP_002266103.2|  PREDICTED: uncharacterized protein LOC100252893    166   2e-47   Vitis vinifera
emb|CBI28496.3|  unnamed protein product                                164   6e-47   
ref|XP_010928169.1|  PREDICTED: uncharacterized protein LOC105050...    164   1e-46   
ref|XP_008387066.1|  PREDICTED: uncharacterized protein LOC103449521    163   2e-46   
ref|XP_004494241.1|  PREDICTED: uncharacterized protein LOC101500088    162   9e-46   
gb|KEH24210.1|  hypothetical protein MTR_7g105840                       162   1e-45   
ref|XP_009372571.1|  PREDICTED: uncharacterized protein LOC103961709    162   1e-45   
ref|XP_010676539.1|  PREDICTED: uncharacterized protein LOC104892333    161   2e-45   
gb|AFK48926.1|  unknown                                                 161   2e-45   
ref|NP_001235619.1|  uncharacterized protein LOC100305710               161   2e-45   
ref|NP_001238447.1|  uncharacterized protein LOC100500460               160   3e-45   
gb|KDP20341.1|  hypothetical protein JCGZ_06427                         161   3e-45   
ref|XP_007034493.1|  Uncharacterized protein TCM_020429                 161   6e-45   
ref|XP_006420519.1|  hypothetical protein CICLE_v10006014mg             160   7e-45   
gb|KDO43047.1|  hypothetical protein CISIN_1g030939mg                   160   7e-45   
ref|XP_008796566.1|  PREDICTED: uncharacterized protein LOC103711...    159   7e-45   
emb|CDP06129.1|  unnamed protein product                                159   9e-45   
ref|XP_011002161.1|  PREDICTED: uncharacterized protein LOC105109...    159   1e-44   
emb|CDY37748.1|  BnaA04g19200D                                          159   1e-44   
ref|XP_003578308.1|  PREDICTED: uncharacterized protein LOC100844417    159   1e-44   
dbj|BAJ88117.1|  predicted protein                                      159   2e-44   
ref|XP_003635854.1|  hypothetical protein MTR_013s0001                  158   2e-44   
ref|XP_006492146.1|  PREDICTED: uncharacterized protein LOC102618...    160   2e-44   
ref|XP_010036675.1|  PREDICTED: uncharacterized protein LOC104425636    159   2e-44   
gb|KCW44687.1|  hypothetical protein EUGRSUZ_L01778                     159   3e-44   
ref|XP_006857550.1|  hypothetical protein AMTR_s00061p00050140          158   3e-44   
ref|XP_010509920.1|  PREDICTED: uncharacterized protein LOC104786259    157   6e-44   
ref|XP_009407226.1|  PREDICTED: uncharacterized protein LOC103989969    157   7e-44   
emb|CDY23763.1|  BnaC04g43590D                                          157   9e-44   
ref|XP_002862394.1|  hypothetical protein ARALYDRAFT_497470             157   9e-44   
ref|XP_004303505.1|  PREDICTED: uncharacterized protein LOC101312268    157   9e-44   
ref|XP_010469511.1|  PREDICTED: uncharacterized protein LOC104749555    157   1e-43   
ref|XP_009141292.1|  PREDICTED: uncharacterized protein LOC103865249    157   1e-43   
ref|XP_002297831.2|  hypothetical protein POPTR_0001s14110g             158   2e-43   Populus trichocarpa [western balsam poplar]
ref|XP_010041047.1|  PREDICTED: uncharacterized protein LOC104429953    158   2e-43   
ref|XP_010413905.1|  PREDICTED: uncharacterized protein LOC104700135    156   2e-43   
ref|XP_004957148.1|  PREDICTED: uncharacterized protein LOC101781...    155   3e-43   
ref|XP_008670277.1|  PREDICTED: uncharacterized protein LOC103647530    155   3e-43   
gb|AFK33549.1|  unknown                                                 155   3e-43   
ref|XP_006410454.1|  hypothetical protein EUTSA_v10017331mg             155   5e-43   
ref|XP_008442900.1|  PREDICTED: uncharacterized protein LOC103486663    155   5e-43   
ref|NP_180876.1|  uncharacterized protein                               155   5e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004136506.1|  PREDICTED: uncharacterized protein LOC101205788    154   9e-43   
ref|XP_007162956.1|  hypothetical protein PHAVU_001G194300g             153   3e-42   
gb|KFK31077.1|  hypothetical protein AALP_AA6G065200                    153   3e-42   
ref|XP_011002160.1|  PREDICTED: uncharacterized protein LOC105109...    153   5e-42   
ref|XP_006295125.1|  hypothetical protein CARUB_v10024199mg             152   6e-42   
ref|XP_002462551.1|  hypothetical protein SORBIDRAFT_02g027960          150   3e-41   Sorghum bicolor [broomcorn]
ref|NP_001063498.1|  Os09g0481800                                       149   9e-41   Oryza sativa Japonica Group [Japonica rice]
gb|EEC84769.1|  hypothetical protein OsI_31795                          149   1e-40   Oryza sativa Indica Group [Indian rice]
gb|ABK22227.1|  unknown                                                 149   1e-40   Picea sitchensis
emb|CAN68366.1|  hypothetical protein VITISV_018177                     147   3e-40   Vitis vinifera
emb|CAJ19336.1|  hypothetical protein                                   140   2e-37   Triticum aestivum [Canadian hard winter wheat]
gb|EPS66435.1|  hypothetical protein M569_08346                         137   8e-37   
ref|XP_001754032.1|  predicted protein                                  140   2e-36   
ref|XP_010104787.1|  hypothetical protein L484_018841                   137   6e-36   
ref|XP_002518165.1|  conserved hypothetical protein                     136   8e-36   Ricinus communis
ref|XP_006603669.1|  PREDICTED: uncharacterized protein LOC100500...    126   6e-32   
ref|XP_006603670.1|  PREDICTED: uncharacterized protein LOC100500...    126   7e-32   
ref|XP_008796567.1|  PREDICTED: uncharacterized protein LOC103711...    124   1e-31   
gb|KEH24211.1|  hypothetical protein MTR_7g105840                       125   1e-31   
ref|XP_006368889.1|  hypothetical protein POPTR_0001s14110g             126   2e-31   
ref|XP_006420518.1|  hypothetical protein CICLE_v10006014mg             125   2e-31   
gb|KDO43048.1|  hypothetical protein CISIN_1g030939mg                   124   3e-31   
ref|XP_006492147.1|  PREDICTED: uncharacterized protein LOC102618...    124   9e-31   
ref|XP_004957147.1|  PREDICTED: uncharacterized protein LOC101781...    119   3e-29   
gb|EAZ45145.1|  hypothetical protein OsJ_29783                          117   8e-29   Oryza sativa Japonica Group [Japonica rice]
gb|EYU26225.1|  hypothetical protein MIMGU_mgv1a014182mg                119   9e-29   
gb|EMT10720.1|  hypothetical protein F775_14983                         113   8e-27   
ref|XP_001753929.1|  predicted protein                                  114   1e-26   
gb|EMS52247.1|  hypothetical protein TRIUR3_09460                       107   4e-25   
ref|XP_005833481.1|  hypothetical protein GUITHDRAFT_152388             107   9e-25   
emb|CBJ26822.1|  conserved unknown protein                            99.0    3e-22   
ref|XP_002183763.1|  predicted protein                                95.5    4e-20   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_005792548.1|  hypothetical protein EMIHUDRAFT_222964           93.6    1e-19   
ref|XP_005758674.1|  hypothetical protein EMIHUDRAFT_249978           92.0    4e-19   
ref|XP_002289459.1|  predicted protein                                90.5    3e-18   Thalassiosira pseudonana CCMP1335
gb|EJK62113.1|  hypothetical protein THAOC_17288                      90.5    3e-18   
ref|XP_005770290.1|  hypothetical protein EMIHUDRAFT_209879           79.0    1e-14   
ref|XP_005771116.1|  hypothetical protein EMIHUDRAFT_243582           77.0    3e-14   
ref|XP_005539302.1|  hypothetical protein, conserved                  73.9    5e-13   
gb|EWM30545.1|  hypothetical protein Naga_100013g48                   72.8    3e-12   
ref|XP_002181986.1|  predicted protein                                73.2    5e-12   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_005716541.1|  unnamed protein product                          71.2    5e-12   
gb|EJK52918.1|  hypothetical protein THAOC_27753                      73.2    2e-11   
ref|XP_002292765.1|  predicted protein                                67.0    4e-10   Thalassiosira pseudonana CCMP1335
ref|XP_010928174.1|  PREDICTED: uncharacterized protein LOC105050...  64.7    1e-09   
dbj|BAJ90942.1|  predicted protein                                    62.4    4e-09   
ref|XP_006420520.1|  hypothetical protein CICLE_v10006014mg           57.4    3e-07   
ref|XP_006368888.1|  hypothetical protein POPTR_0001s14110g           57.0    1e-06   
ref|XP_002504672.1|  predicted protein                                57.0    1e-06   Micromonas commoda
gb|KCW44688.1|  hypothetical protein EUGRSUZ_L01778                   55.5    2e-06   
gb|KCW48306.1|  hypothetical protein EUGRSUZ_K02034                   54.7    4e-06   
gb|EYU26227.1|  hypothetical protein MIMGU_mgv1a014182mg              49.3    4e-04   



>ref|XP_006360013.1| PREDICTED: uncharacterized protein LOC102601991 [Solanum tuberosum]
Length=159

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 105/136 (77%), Gaps = 3/136 (2%)
 Frame = -3

Query  658  LPKFHSLSASCRLKNGVVSRPATRRRLISSTKTAFHPTISASL---DLTEDNIKQVLVDA  488
            LP F ++  + +LKNG ++        I   +T +   ISASL   DLTEDNI QVL DA
Sbjct  24   LPNFQNVVCASKLKNGGITSLRLSSSRIRKKRTTYLCRISASLSPLDLTEDNIIQVLEDA  83

Query  487  RTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILE  308
            + ELAQLFDT VGITG+ ELAEVDGPYVK+ LSGKFWH RSTV+ARLGNYLKQRIPEILE
Sbjct  84   KAELAQLFDTTVGITGKAELAEVDGPYVKLRLSGKFWHTRSTVVARLGNYLKQRIPEILE  143

Query  307  VDIEDEKQLDDSPASF  260
            VDIEDEKQLDDSPA+F
Sbjct  144  VDIEDEKQLDDSPANF  159



>ref|XP_009617700.1| PREDICTED: nifU-like protein 3, chloroplastic [Nicotiana tomentosiformis]
Length=158

 Score =   177 bits (448),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 109/140 (78%), Gaps = 15/140 (11%)
 Frame = -3

Query  658  LPKFHSLSAS------CRLKNG-VVSRPATRRRLISSTKTAFHPTISASLDLTEDNIKQV  500
            L  F +LSAS       R+K+  + SRP+ RR ++S++ +         LDLTE+NI QV
Sbjct  27   LLNFQTLSASKVNGSITRVKSQRISSRPSKRRHILSASLSP--------LDLTEENINQV  78

Query  499  LVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIP  320
            L DA+ ELAQLFDT VGITG+ ELAEVDGPYVK+ LSGKFWHKRSTV+ARLGNYLKQRIP
Sbjct  79   LEDAKAELAQLFDTSVGITGKAELAEVDGPYVKLRLSGKFWHKRSTVVARLGNYLKQRIP  138

Query  319  EILEVDIEDEKQLDDSPASF  260
            EILEVDIEDEKQLDDSPA+F
Sbjct  139  EILEVDIEDEKQLDDSPANF  158



>ref|XP_004248220.1| PREDICTED: uncharacterized protein LOC101254243 [Solanum lycopersicum]
Length=161

 Score =   175 bits (444),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 103/138 (75%), Gaps = 5/138 (4%)
 Frame = -3

Query  658  LPKFHSLSASCRLKNGVVSRPATRRRL--ISSTKTAFHPTISASL---DLTEDNIKQVLV  494
            LP F ++    + KNG ++          I   +T +   ISASL   DLTEDNI QVL 
Sbjct  24   LPIFQNVVCVSKFKNGGITSLRLSSSSSRIRKKRTTYLCRISASLSPLDLTEDNIIQVLE  83

Query  493  DARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEI  314
            DA+ ELAQLFDT VGITG+ ELAEVDGPYVK+ LSGKFWH RSTV+ARLGNYLKQRIPEI
Sbjct  84   DAKAELAQLFDTTVGITGKAELAEVDGPYVKLRLSGKFWHTRSTVVARLGNYLKQRIPEI  143

Query  313  LEVDIEDEKQLDDSPASF  260
            LEVDIEDEKQLDDSPA+F
Sbjct  144  LEVDIEDEKQLDDSPANF  161



>ref|XP_009783949.1| PREDICTED: uncharacterized protein LOC104232434 [Nicotiana sylvestris]
Length=153

 Score =   175 bits (443),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 107/136 (79%), Gaps = 8/136 (6%)
 Frame = -3

Query  658  LPKFHSLSASCRLKNGVVSRPATRRRLISSTKTAFHPTISAS---LDLTEDNIKQVLVDA  488
            LP F +LS S    NG ++R  +++  ISS      P ISAS   LDLTEDNI QVL DA
Sbjct  23   LPNFQTLSISKL--NGGITRVKSQK--ISSKIRKRRP-ISASVSPLDLTEDNIIQVLEDA  77

Query  487  RTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILE  308
            + ELAQLFD  VGITG+ ELAEVDGPYVK+ LSGKFWHKRSTV+ARLGNYLKQRIPEILE
Sbjct  78   KAELAQLFDNSVGITGKAELAEVDGPYVKLRLSGKFWHKRSTVVARLGNYLKQRIPEILE  137

Query  307  VDIEDEKQLDDSPASF  260
            VDIEDEKQLDDSPA+F
Sbjct  138  VDIEDEKQLDDSPANF  153



>gb|EYU26226.1| hypothetical protein MIMGU_mgv1a014182mg [Erythranthe guttata]
Length=160

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 101/128 (79%), Gaps = 5/128 (4%)
 Frame = -3

Query  634  ASCRLKNGVVSRPATRRRLISSTKTAFHPTISAS---LDLTEDNIKQVLVDARTELAQLF  464
            A+ + KNG     ++R RL +    +  P+ISAS   LDLTEDNIKQVL DA+TELAQLF
Sbjct  35   AALQPKNGCFM--SSRSRLRNQRHRSCAPSISASSAPLDLTEDNIKQVLADAKTELAQLF  92

Query  463  DTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVDIEDEKQ  284
            DT V ITG+VEL E+DGPYV ISL G+FWH RS VLARLGNYLKQRIPEILEVD+EDEKQ
Sbjct  93   DTSVNITGKVELVELDGPYVTISLKGRFWHTRSMVLARLGNYLKQRIPEILEVDVEDEKQ  152

Query  283  LDDSPASF  260
            LDDSP +F
Sbjct  153  LDDSPENF  160



>ref|XP_011098104.1| PREDICTED: uncharacterized protein LOC105176868 [Sesamum indicum]
Length=157

 Score =   171 bits (433),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 104/141 (74%), Gaps = 9/141 (6%)
 Frame = -3

Query  664  PSLPKFHSLS------ASCRLKNGVVSRPATRRRLISSTKTAFHPTISASLDLTEDNIKQ  503
            P  P +H  S      A+  LK    +R   +R+   S+K A   ++   LDLTEDNIKQ
Sbjct  20   PLTPPYHLASNLLPAPAALNLKKSGATRLRNQRQ--RSSKAAISASL-GPLDLTEDNIKQ  76

Query  502  VLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRI  323
            VL DAR ELAQLFDT V ITG+ ELAEVDGPYVKISLSG+FWHKRSTVLARLGNYLKQRI
Sbjct  77   VLDDARVELAQLFDTSVNITGKAELAEVDGPYVKISLSGRFWHKRSTVLARLGNYLKQRI  136

Query  322  PEILEVDIEDEKQLDDSPASF  260
             EILEVDIEDEKQLDDSP +F
Sbjct  137  QEILEVDIEDEKQLDDSPENF  157



>ref|XP_008243465.1| PREDICTED: uncharacterized protein LOC103341707 [Prunus mume]
Length=167

 Score =   171 bits (432),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 100/130 (77%), Gaps = 5/130 (4%)
 Frame = -3

Query  646  HSLSASCRLKNGVVSRPATRRRLISSTKTA-FHPTISASLDLTEDNIKQVLVDARTELAQ  470
            H+  AS RL+  + + P T R+  S+   A   P  S  LDLTEDNI+QVL DAR E  Q
Sbjct  42   HNHKASQRLR--ICTNPTTTRKRFSTISAATLQP--SQPLDLTEDNIRQVLADARIEFGQ  97

Query  469  LFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVDIEDE  290
            LFDT VG+TG+VELAE+DGPYVKISL G+FWH+RS VLARL NYLKQRIPEILEVDIEDE
Sbjct  98   LFDTSVGMTGQVELAELDGPYVKISLKGRFWHERSVVLARLANYLKQRIPEILEVDIEDE  157

Query  289  KQLDDSPASF  260
            KQLDDSP +F
Sbjct  158  KQLDDSPENF  167



>ref|XP_010542974.1| PREDICTED: uncharacterized protein LOC104816015 [Tarenaya hassleriana]
Length=163

 Score =   168 bits (425),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = -3

Query  604  SRPATRRRLISSTKTAFHPTISASLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELA  425
            ++P TRRR  S             LDLTEDNI+ VL DAR ELAQLFD  VGITG V+LA
Sbjct  49   AKPGTRRRTASEATIGGGGAPPPPLDLTEDNIRLVLSDARVELAQLFDGSVGITGEVDLA  108

Query  424  EVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            E+DGP+VKISL G+FWH RSTVLAR+GNYLKQRIPEILEVDIEDEKQLDDSPA+F
Sbjct  109  ELDGPFVKISLRGRFWHTRSTVLARIGNYLKQRIPEILEVDIEDEKQLDDSPANF  163



>ref|XP_007204438.1| hypothetical protein PRUPE_ppa026994mg, partial [Prunus persica]
 gb|EMJ05637.1| hypothetical protein PRUPE_ppa026994mg, partial [Prunus persica]
Length=119

 Score =   166 bits (419),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 93/118 (79%), Gaps = 3/118 (3%)
 Frame = -3

Query  610  VVSRPATRRRLISSTKTA-FHPTISASLDLTEDNIKQVLVDARTELAQLFDTEVGITGRV  434
            + + P T R+  S+   A   P  S  LDLTEDNI+QVL DAR E  QLFDT VG+TG+V
Sbjct  4    ICTNPTTTRKRFSTISAATLQP--SQPLDLTEDNIRQVLADARIEFGQLFDTSVGMTGQV  61

Query  433  ELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            ELAE+DGPYVKISL G+FWH+RS VLARL NYLKQRIPEILEVDIEDEKQLDDSP +F
Sbjct  62   ELAELDGPYVKISLKGRFWHERSVVLARLANYLKQRIPEILEVDIEDEKQLDDSPENF  119



>ref|XP_010252872.1| PREDICTED: uncharacterized protein LOC104594327 [Nelumbo nucifera]
 ref|XP_010252873.1| PREDICTED: uncharacterized protein LOC104594327 [Nelumbo nucifera]
 ref|XP_010252874.1| PREDICTED: uncharacterized protein LOC104594327 [Nelumbo nucifera]
 ref|XP_010252875.1| PREDICTED: uncharacterized protein LOC104594327 [Nelumbo nucifera]
Length=156

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 91/103 (88%), Gaps = 3/103 (3%)
 Frame = -3

Query  559  AFHPTISASL---DLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLS  389
            ++ PTI ASL   DLTEDN++QVL+DAR+E AQ+FD  VGITG+ ELAE+DGP+VKISL 
Sbjct  54   SYLPTIFASLPTLDLTEDNVRQVLIDARSEFAQIFDASVGITGQAELAELDGPFVKISLK  113

Query  388  GKFWHKRSTVLARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            G+FWHKRSTVL RLGNYLKQRIPEILEVDIEDEKQLDDSP +F
Sbjct  114  GRFWHKRSTVLDRLGNYLKQRIPEILEVDIEDEKQLDDSPENF  156



>ref|XP_002266103.2| PREDICTED: uncharacterized protein LOC100252893 [Vitis vinifera]
Length=161

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 108/152 (71%), Gaps = 12/152 (8%)
 Frame = -3

Query  679  PSLPNPSL-PKFHSLSAS-CRLKNGVVSRPA-------TRRRLISSTKTAFHPTISASL-  530
            P +  PSL P  H +S +  +L  G+ S          +RRR  ++  T     ++ASL 
Sbjct  10   PRISTPSLLPTSHLISNTRSQLTTGMTSAKGPMVPLRWSRRRPSTAVTTPRFAAVTASLS  69

Query  529  --DLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVL  356
              DLTEDN++QVL DAR ELAQ+FD  VGITG  ELAE+DGP+VKISL G+FWHKRSTVL
Sbjct  70   PLDLTEDNVRQVLADARVELAQIFDNSVGITGEAELAELDGPFVKISLRGRFWHKRSTVL  129

Query  355  ARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            AR+ NYLKQRIPEILEVDIEDEKQLDDSP +F
Sbjct  130  ARVANYLKQRIPEILEVDIEDEKQLDDSPENF  161



>emb|CBI28496.3| unnamed protein product [Vitis vinifera]
Length=120

 Score =   164 bits (414),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 93/114 (82%), Gaps = 3/114 (3%)
 Frame = -3

Query  592  TRRRLISSTKTAFHPTISASL---DLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAE  422
            +RRR  ++  T     ++ASL   DLTEDN++QVL DAR ELAQ+FD  VGITG  ELAE
Sbjct  7    SRRRPSTAVTTPRFAAVTASLSPLDLTEDNVRQVLADARVELAQIFDNSVGITGEAELAE  66

Query  421  VDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            +DGP+VKISL G+FWHKRSTVLAR+ NYLKQRIPEILEVDIEDEKQLDDSP +F
Sbjct  67   LDGPFVKISLRGRFWHKRSTVLARVANYLKQRIPEILEVDIEDEKQLDDSPENF  120



>ref|XP_010928169.1| PREDICTED: uncharacterized protein LOC105050026 isoform X1 [Elaeis 
guineensis]
 ref|XP_010928170.1| PREDICTED: uncharacterized protein LOC105050026 isoform X1 [Elaeis 
guineensis]
 ref|XP_010928171.1| PREDICTED: uncharacterized protein LOC105050026 isoform X1 [Elaeis 
guineensis]
 ref|XP_010928172.1| PREDICTED: uncharacterized protein LOC105050026 isoform X1 [Elaeis 
guineensis]
 ref|XP_010928173.1| PREDICTED: uncharacterized protein LOC105050026 isoform X1 [Elaeis 
guineensis]
Length=155

 Score =   164 bits (415),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 105/137 (77%), Gaps = 11/137 (8%)
 Frame = -3

Query  661  SLPKFHSLSASCRLKNGVVSRPATRRRLISSTKTAFHPTISASL---DLTEDNIKQVLVD  491
            ++P F +L        G+  R    RRL +  + +  PTI+A+L   DLTEDNI+QVL+D
Sbjct  27   NIPHFQTL--------GLKRRSFRSRRLKALPRRSRSPTITAALPPLDLTEDNIRQVLID  78

Query  490  ARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEIL  311
            AR+ELAQ+FD+ VGITG V+LA++DGP+VK+ L G+FWH+R+ VLARLGNYLK RIPEIL
Sbjct  79   ARSELAQIFDSSVGITGEVDLADLDGPFVKLRLKGRFWHQRAIVLARLGNYLKNRIPEIL  138

Query  310  EVDIEDEKQLDDSPASF  260
            EVDIEDEKQLDDSP +F
Sbjct  139  EVDIEDEKQLDDSPENF  155



>ref|XP_008387066.1| PREDICTED: uncharacterized protein LOC103449521 [Malus domestica]
 ref|XP_008387067.1| PREDICTED: uncharacterized protein LOC103449521 [Malus domestica]
 ref|XP_008387069.1| PREDICTED: uncharacterized protein LOC103449521 [Malus domestica]
Length=160

 Score =   163 bits (413),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 95/120 (79%), Gaps = 10/120 (8%)
 Frame = -3

Query  598  PATRRRLISSTKTAFHPTISAS-------LDLTEDNIKQVLVDARTELAQLFDTEVGITG  440
            PAT   L + T T F   ++A+       LDLTEDNI+QVL DAR E  QLFDT VG+TG
Sbjct  44   PAT---LGTKTSTKFSTILAAAAVQPSQPLDLTEDNIRQVLADARVEFGQLFDTSVGMTG  100

Query  439  RVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            +V+LAE+DGP+VKISL G+FWH+RS VLARL NYLKQRIPEILEVDIEDEKQLDDSPA+F
Sbjct  101  QVDLAELDGPFVKISLKGRFWHERSVVLARLANYLKQRIPEILEVDIEDEKQLDDSPANF  160



>ref|XP_004494241.1| PREDICTED: uncharacterized protein LOC101500088 [Cicer arietinum]
Length=171

 Score =   162 bits (410),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -3

Query  550  PTISASLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHK  371
            P +   LDLTE+N++Q LVDAR EL Q+FDT VG+TG +EL E+DGP+V+ISL G+FWHK
Sbjct  75   PAVPPPLDLTENNVRQALVDARAELGQIFDTSVGMTGVIELVELDGPFVRISLKGRFWHK  134

Query  370  RSTVLARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            RSTVLAR+GNYLKQRIPEILEV+IEDEKQLDDSPA+F
Sbjct  135  RSTVLARVGNYLKQRIPEILEVEIEDEKQLDDSPANF  171



>gb|KEH24210.1| hypothetical protein MTR_7g105840 [Medicago truncatula]
Length=158

 Score =   162 bits (409),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 92/116 (79%), Gaps = 9/116 (8%)
 Frame = -3

Query  580  LISSTKTAFH---PTISASL------DLTEDNIKQVLVDARTELAQLFDTEVGITGRVEL  428
            L S+T+   H     +SASL      DLTEDN++Q LVDAR EL Q+FDT VG+TG VEL
Sbjct  43   LTSTTRCKLHRKLKPLSASLSVEPPLDLTEDNVRQALVDARGELGQIFDTSVGMTGVVEL  102

Query  427  AEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
             E+DGPYV ISL G+FWHKRSTVLARL NYLKQRIPEILEVDIE+EKQLDDSPA+F
Sbjct  103  VELDGPYVTISLKGRFWHKRSTVLARLANYLKQRIPEILEVDIENEKQLDDSPANF  158



>ref|XP_009372571.1| PREDICTED: uncharacterized protein LOC103961709 [Pyrus x bretschneideri]
 ref|XP_009372572.1| PREDICTED: uncharacterized protein LOC103961709 [Pyrus x bretschneideri]
Length=160

 Score =   162 bits (409),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 102/136 (75%), Gaps = 12/136 (9%)
 Frame = -3

Query  646  HSLSASCRLKNGVVSRPATRRRLISSTKTAFHPTISAS-------LDLTEDNIKQVLVDA  488
            H+ +   RL+  + + PAT   L + T T F   ++A+       LDLTEDNI+QVL DA
Sbjct  30   HNHTQRPRLR--ISTFPAT---LGTKTSTKFSTILAAATVQPSQPLDLTEDNIRQVLADA  84

Query  487  RTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILE  308
            R E  QLFD  VG+TG+V+LAE+DGP+VKISL G+FWH+RS VLARL NYLKQRIPEILE
Sbjct  85   RVEFGQLFDISVGMTGQVDLAELDGPFVKISLKGRFWHERSVVLARLANYLKQRIPEILE  144

Query  307  VDIEDEKQLDDSPASF  260
            VDIEDEKQLDDSPA+F
Sbjct  145  VDIEDEKQLDDSPANF  160



>ref|XP_010676539.1| PREDICTED: uncharacterized protein LOC104892333 [Beta vulgaris 
subsp. vulgaris]
Length=159

 Score =   161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 97/133 (73%), Gaps = 3/133 (2%)
 Frame = -3

Query  655  PKFHSLSASCRL-KNGVVSRPATRRRLISSTKTAFHPTISASLDLTEDNIKQVLVDARTE  479
            P  H+     RL +    +   T RRL      AF  +    LDLTE+NI +VL DAR E
Sbjct  29   PTIHTTLTFFRLHQTPTTALGQTVRRLPLPVVAAF--SAMQPLDLTEENIDKVLADARVE  86

Query  478  LAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVDI  299
            LAQLFDT VGITG+VELAE+DGP+VKI L GKFWH RSTV+ARL NYLKQRIPEILEVDI
Sbjct  87   LAQLFDTSVGITGQVELAELDGPFVKIRLRGKFWHMRSTVVARLENYLKQRIPEILEVDI  146

Query  298  EDEKQLDDSPASF  260
            EDEKQLDDSPA+F
Sbjct  147  EDEKQLDDSPANF  159



>gb|AFK48926.1| unknown [Medicago truncatula]
Length=158

 Score =   161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 91/116 (78%), Gaps = 9/116 (8%)
 Frame = -3

Query  580  LISSTKTAFH---PTISASL------DLTEDNIKQVLVDARTELAQLFDTEVGITGRVEL  428
            L S+T+   H     +SASL      DLTEDN++Q LVDAR EL Q+FDT VG+TG VEL
Sbjct  43   LTSTTRCKLHRKLKPLSASLSVEPPLDLTEDNVRQALVDARGELGQIFDTSVGMTGVVEL  102

Query  427  AEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
             E+DGPYV ISL G+FWHKRSTVLARL NYLKQRIPEILEVDIE EKQLDDSPA+F
Sbjct  103  VELDGPYVTISLKGRFWHKRSTVLARLANYLKQRIPEILEVDIESEKQLDDSPANF  158



>ref|NP_001235619.1| uncharacterized protein LOC100305710 [Glycine max]
 gb|ACU13536.1| unknown [Glycine max]
Length=161

 Score =   161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 93/116 (80%), Gaps = 2/116 (2%)
 Frame = -3

Query  607  VSRPATRRRLISSTKTAFHPTISASLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVEL  428
            ++R   RRR++     A        LDLTE+N+KQVL DAR EL Q+FDT VG+TG VEL
Sbjct  48   LTRGKPRRRMLKPISAAL--PAPPPLDLTENNVKQVLDDARKELGQIFDTSVGMTGVVEL  105

Query  427  AEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            A++DGP+VKISLSG+FWHKRSTVLAR+ NYLKQRIPEILEVDIEDEKQLDDSP +F
Sbjct  106  ADLDGPFVKISLSGRFWHKRSTVLARVANYLKQRIPEILEVDIEDEKQLDDSPENF  161



>ref|NP_001238447.1| uncharacterized protein LOC100500460 [Glycine max]
 ref|XP_006603671.1| PREDICTED: uncharacterized protein LOC100500460 isoform X3 [Glycine 
max]
 gb|ACU15547.1| unknown [Glycine max]
 gb|KHN02179.1| hypothetical protein glysoja_002203 [Glycine soja]
Length=159

 Score =   160 bits (406),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 91/109 (83%), Gaps = 1/109 (1%)
 Frame = -3

Query  586  RRLISSTKTAFHPTISASLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPY  407
            RR+IS   +A  P     LDLTE+N+KQVL DAR EL Q+FD+ VGITG VELA++DGP+
Sbjct  52   RRMISKPISAALPA-PPPLDLTENNVKQVLEDARKELGQIFDSSVGITGVVELADLDGPF  110

Query  406  VKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            VKISL G+FWHKRSTVLAR+ NYLKQRIPEILEVDIEDEKQLDDSP +F
Sbjct  111  VKISLKGRFWHKRSTVLARVANYLKQRIPEILEVDIEDEKQLDDSPENF  159



>gb|KDP20341.1| hypothetical protein JCGZ_06427 [Jatropha curcas]
Length=178

 Score =   161 bits (407),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -3

Query  541  SASLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRST  362
            S  LDLTEDN++QVL DAR E  QLFDTEVGITG  +LAE+DGP+VKISL G+FWHKRST
Sbjct  85   SPPLDLTEDNVRQVLADAREEFGQLFDTEVGITGEADLAELDGPFVKISLKGRFWHKRST  144

Query  361  VLARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            VLARL NYLKQRIPEILEVDIE+EKQLDDSP +F
Sbjct  145  VLARLANYLKQRIPEILEVDIENEKQLDDSPENF  178



>ref|XP_007034493.1| Uncharacterized protein TCM_020429 [Theobroma cacao]
 gb|EOY05419.1| Uncharacterized protein TCM_020429 [Theobroma cacao]
Length=213

 Score =   161 bits (408),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -3

Query  532  LDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLA  353
            LDLTE+NI+ VL DAR ELAQLFDT VGITG+VELAE+DGP+VKISL G+FWHKRSTV++
Sbjct  123  LDLTEENIELVLADARVELAQLFDTSVGITGQVELAELDGPFVKISLKGRFWHKRSTVVS  182

Query  352  RLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            R+GNYLKQRIPEILEVDIEDEKQLDDSP +F
Sbjct  183  RVGNYLKQRIPEILEVDIEDEKQLDDSPENF  213



>ref|XP_006420519.1| hypothetical protein CICLE_v10006014mg [Citrus clementina]
 gb|ESR33759.1| hypothetical protein CICLE_v10006014mg [Citrus clementina]
Length=181

 Score =   160 bits (405),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -3

Query  532  LDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLA  353
            LDLTEDN++QV+ DAR ELAQLFDT VGITG  ELAE+DGP+VKI L G+FWHKRSTV+A
Sbjct  91   LDLTEDNVRQVIADARGELAQLFDTSVGITGVAELAELDGPFVKIRLRGRFWHKRSTVIA  150

Query  352  RLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            RL NYLKQRIPEILEVDIEDEKQLDDSP +F
Sbjct  151  RLANYLKQRIPEILEVDIEDEKQLDDSPENF  181



>gb|KDO43047.1| hypothetical protein CISIN_1g030939mg [Citrus sinensis]
Length=169

 Score =   160 bits (404),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = -3

Query  568  TKTAFHPTISASLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLS  389
            T+TA        LDLTEDN++QV+ DAR ELAQLFDT VGITG  ELAE+DGP+VKI L 
Sbjct  67   TRTAAGGVPPPPLDLTEDNVRQVIADARGELAQLFDTSVGITGVAELAELDGPFVKIRLR  126

Query  388  GKFWHKRSTVLARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            G+FWHKRSTV+ARL NYLKQRIPEILEVDIEDEKQLDDSP +F
Sbjct  127  GRFWHKRSTVIARLANYLKQRIPEILEVDIEDEKQLDDSPENF  169



>ref|XP_008796566.1| PREDICTED: uncharacterized protein LOC103711985 isoform X1 [Phoenix 
dactylifera]
Length=155

 Score =   159 bits (403),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 102/136 (75%), Gaps = 11/136 (8%)
 Frame = -3

Query  658  LPKFHSLSASCRLKNGVVSRPATRRRLISSTKTAFHPTISASL---DLTEDNIKQVLVDA  488
            +P F +LS        + SR    R+L +  +    PTI+A+L   DL EDNI+QVL+DA
Sbjct  28   IPHFQTLS--------LKSRSFRSRKLKALPRGLRSPTITAALPPLDLNEDNIRQVLIDA  79

Query  487  RTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILE  308
            R+E AQ+FD+ VGITG V+LAE+DGP+VK+ L G+FWH+R+ VLARLGNYLK RIPEILE
Sbjct  80   RSEFAQIFDSSVGITGEVDLAELDGPFVKLRLQGRFWHQRAIVLARLGNYLKNRIPEILE  139

Query  307  VDIEDEKQLDDSPASF  260
            VDIEDE+QLDDSP +F
Sbjct  140  VDIEDERQLDDSPENF  155



>emb|CDP06129.1| unnamed protein product [Coffea canephora]
Length=156

 Score =   159 bits (402),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 108/147 (73%), Gaps = 12/147 (8%)
 Frame = -3

Query  679  PSLPNPSLPKFHSLSASCRLKN----GVVSRPATRRRLISSTKTAFHPTISASL---DLT  521
            P + +     F ++SA  +LK     G+ SR   RR L     ++ + ++SASL   DLT
Sbjct  15   PQILHHPFKNFRAVSA-LKLKESPNVGLKSR--RRRTLPLFFDSSKYNSVSASLSPLDLT  71

Query  520  EDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGN  341
            EDNIKQVL DAR  L QLFD  VG+TG+ ELA++DGPYVKISL G+FWHKRSTVLARLGN
Sbjct  72   EDNIKQVLADAR--LGQLFDDSVGMTGQAELADLDGPYVKISLRGRFWHKRSTVLARLGN  129

Query  340  YLKQRIPEILEVDIEDEKQLDDSPASF  260
            YLKQRIPEILEVDIEDEKQLDDSP +F
Sbjct  130  YLKQRIPEILEVDIEDEKQLDDSPENF  156



>ref|XP_011002161.1| PREDICTED: uncharacterized protein LOC105109229 isoform X2 [Populus 
euphratica]
 ref|XP_011012218.1| PREDICTED: uncharacterized protein LOC105116519 [Populus euphratica]
Length=173

 Score =   159 bits (403),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = -3

Query  607  VSRPATRRRLISSTKTAFHPTISASLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVEL  428
            V RP  +   +++   A        LDLTE+N+KQVLVDAR EL Q+FDT VGITG+VEL
Sbjct  58   VQRPNRKPSPLTTITAAAAGVPLPPLDLTEENVKQVLVDARAELGQIFDTSVGITGQVEL  117

Query  427  AEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            AE+DGP+V ISL G+FWH+RS VLAR+GNYLKQRIPEILEV+IEDEKQLDDSP +F
Sbjct  118  AELDGPFVVISLKGRFWHERSMVLARIGNYLKQRIPEILEVEIEDEKQLDDSPENF  173



>emb|CDY37748.1| BnaA04g19200D [Brassica napus]
 emb|CDX84201.1| BnaC04g09630D [Brassica napus]
Length=166

 Score =   159 bits (402),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 91/115 (79%), Gaps = 5/115 (4%)
 Frame = -3

Query  604  SRPATRRRLISSTKTAFHPTISASLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELA  425
            SRP T  + +S    +  P     LDLTEDNI+ VL +AR ELAQLFD  VGITG+VEL 
Sbjct  57   SRPLTTVKAVSGGGVSLPP-----LDLTEDNIRLVLSEARVELAQLFDLSVGITGQVELV  111

Query  424  EVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            E+DGP+VKISL GKFWH R+ VLAR+GNYLKQRIPEILEV+IEDEKQLDDSPA+F
Sbjct  112  ELDGPFVKISLRGKFWHTRAMVLARIGNYLKQRIPEILEVEIEDEKQLDDSPANF  166



>ref|XP_003578308.1| PREDICTED: uncharacterized protein LOC100844417 [Brachypodium 
distachyon]
 ref|XP_010238287.1| PREDICTED: uncharacterized protein LOC100844417 [Brachypodium 
distachyon]
 ref|XP_010238288.1| PREDICTED: uncharacterized protein LOC100844417 [Brachypodium 
distachyon]
Length=157

 Score =   159 bits (401),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = -3

Query  544  ISASLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRS  365
            I+ASLDLTEDN++Q +VDA+ ELAQLFDT VGITG+V+LAE+DGP+VK+ L GKFWH R+
Sbjct  63   ITASLDLTEDNVRQAIVDAKAELAQLFDTSVGITGQVDLAELDGPFVKLRLKGKFWHTRA  122

Query  364  TVLARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            TV+AR+GNYLK RIPEILEV+IEDE QLDDSPA++
Sbjct  123  TVVARIGNYLKNRIPEILEVEIEDENQLDDSPAAY  157



>dbj|BAJ88117.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=157

 Score =   159 bits (401),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  547  TISASLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKR  368
            +I+ASLDLTEDN++Q +VDA+ ELAQLFDT VGITG+V+LAE+DGP+VK+ L GKFWH R
Sbjct  62   SITASLDLTEDNVRQAIVDAKAELAQLFDTSVGITGQVDLAELDGPFVKLRLKGKFWHTR  121

Query  367  STVLARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            +TV+AR+GNYLK RIPEILEV+IEDE QLDDSPA++
Sbjct  122  ATVVARIGNYLKNRIPEILEVEIEDEDQLDDSPAAY  157



>ref|XP_003635854.1| hypothetical protein MTR_013s0001 [Medicago truncatula]
Length=153

 Score =   158 bits (400),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 96/131 (73%), Gaps = 12/131 (9%)
 Frame = -3

Query  580  LISSTKTAFH---PTISASL------DLTEDNIKQVLVDARTELAQLFDTEVGITGRVEL  428
            L S+T+   H     +SASL      DLTEDN++Q LVDAR EL Q+FDT VG+TG VEL
Sbjct  13   LTSTTRCKLHRKLKPLSASLSVEPPLDLTEDNVRQALVDARGELGQIFDTSVGMTGVVEL  72

Query  427  AEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVDIEDEKQLDDSPASF*SEA  248
             E+DGPYV ISL G+FWHKRSTVLARL NYLKQRIPEILEVDIE+EKQLDDSP  F    
Sbjct  73   VELDGPYVTISLKGRFWHKRSTVLARLANYLKQRIPEILEVDIENEKQLDDSPKLF---Y  129

Query  247  LIFNLILLICP  215
            L   ++ L+ P
Sbjct  130  LAVRMLKLVAP  140



>ref|XP_006492146.1| PREDICTED: uncharacterized protein LOC102618883 isoform X1 [Citrus 
sinensis]
Length=218

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -3

Query  532  LDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLA  353
            LDLTEDN++QV+ DAR ELAQLFDT VGITG  E+AE+DGP+VKI L G+FWHKRSTV+A
Sbjct  128  LDLTEDNVRQVIADARGELAQLFDTSVGITGVAEVAELDGPFVKIRLRGRFWHKRSTVIA  187

Query  352  RLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            RL NYLKQRIPEILEVDIEDEKQLDDSP +F
Sbjct  188  RLANYLKQRIPEILEVDIEDEKQLDDSPENF  218



>ref|XP_010036675.1| PREDICTED: uncharacterized protein LOC104425636 [Eucalyptus grandis]
 gb|KCW48305.1| hypothetical protein EUGRSUZ_K02034 [Eucalyptus grandis]
Length=174

 Score =   159 bits (401),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = -3

Query  541  SASLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRST  362
            S  LDLTE+NI+ VL DAR ELAQ+FDT VGITG++ELAE+DGP+VKISL G+FWH+RS 
Sbjct  81   SPPLDLTEENIRLVLADARVELAQIFDTSVGITGQIELAELDGPFVKISLKGRFWHERSM  140

Query  361  VLARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            VLAR+GNYLKQRIPEILEVDIEDEKQLDDSP +F
Sbjct  141  VLARVGNYLKQRIPEILEVDIEDEKQLDDSPENF  174



>gb|KCW44687.1| hypothetical protein EUGRSUZ_L01778 [Eucalyptus grandis]
Length=175

 Score =   159 bits (401),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = -3

Query  541  SASLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRST  362
            S  LDLTE+NI+ VL DAR ELAQ+FDT VGITG++ELAE+DGP+VKISL G+FWH+RS 
Sbjct  82   SPPLDLTEENIRLVLADARVELAQIFDTSVGITGQIELAELDGPFVKISLRGRFWHERSM  141

Query  361  VLARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            VLAR+GNYLKQRIPEILEVDIEDEKQLDDSP +F
Sbjct  142  VLARVGNYLKQRIPEILEVDIEDEKQLDDSPENF  175



>ref|XP_006857550.1| hypothetical protein AMTR_s00061p00050140 [Amborella trichopoda]
 gb|ERN19017.1| hypothetical protein AMTR_s00061p00050140 [Amborella trichopoda]
Length=155

 Score =   158 bits (399),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -3

Query  532  LDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLA  353
            LDLTEDN+ +VL+DA++ELAQ+FDT VGITG  ELAE+DGP+VK+SL G+FWHKRSTVLA
Sbjct  65   LDLTEDNVNRVLMDAKSELAQIFDTSVGITGEAELAELDGPFVKLSLKGRFWHKRSTVLA  124

Query  352  RLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            RLGNYLK+RIP+ILEVDIEDE+QLDDSP +F
Sbjct  125  RLGNYLKKRIPDILEVDIEDEQQLDDSPENF  155



>ref|XP_010509920.1| PREDICTED: uncharacterized protein LOC104786259 [Camelina sativa]
Length=166

 Score =   157 bits (398),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 100/140 (71%), Gaps = 10/140 (7%)
 Frame = -3

Query  649  FHSLSASCRLKN---------GVVSRPATRRRLISSTKTAFHPTISAS-LDLTEDNIKQV  500
            F+S+  + R  N         G +    +R R +++ +      +S   LDLTEDNI  V
Sbjct  27   FNSIGLAVRFNNVKTRKPVYLGTILTEKSRARTLTTAEAVSGGGVSLPPLDLTEDNIHLV  86

Query  499  LVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIP  320
            L +AR ELAQLFD+ VGITG+VEL E+DGP+VKISL GKFWH R+ VLAR+GNY+KQRIP
Sbjct  87   LSEARIELAQLFDSSVGITGQVELVELDGPFVKISLRGKFWHTRAMVLARIGNYMKQRIP  146

Query  319  EILEVDIEDEKQLDDSPASF  260
            EILEV+IEDEKQLDDSPA+F
Sbjct  147  EILEVEIEDEKQLDDSPANF  166



>ref|XP_009407226.1| PREDICTED: uncharacterized protein LOC103989969 [Musa acuminata 
subsp. malaccensis]
Length=149

 Score =   157 bits (396),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 100/142 (70%), Gaps = 22/142 (15%)
 Frame = -3

Query  679  PSLPNPSL--PKFHSLSASCRLKNGVVSRPATRRRLISSTKTAFHPTISASLDLTEDNIK  506
            PSL NPSL  P+  + S                RR  S T +A  P     LDLTE+NI+
Sbjct  28   PSLRNPSLHPPRLKAFS----------------RRWRSLTISAALP----PLDLTEENIR  67

Query  505  QVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQR  326
            QVL+DAR+E AQLFDT VGITG+V+LAE+DGP+VKI L G+FWH R+TVL R+ NYLK R
Sbjct  68   QVLIDARSEFAQLFDTSVGITGQVDLAELDGPFVKIRLKGRFWHMRNTVLERISNYLKNR  127

Query  325  IPEILEVDIEDEKQLDDSPASF  260
            IPEILEVDIEDEKQLDDSP +F
Sbjct  128  IPEILEVDIEDEKQLDDSPENF  149



>emb|CDY23763.1| BnaC04g43590D [Brassica napus]
Length=166

 Score =   157 bits (396),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 98/132 (74%), Gaps = 1/132 (1%)
 Frame = -3

Query  652  KFHSLSASCRLKNGVVSRPATRRRLISSTKTAFHPTISAS-LDLTEDNIKQVLVDARTEL  476
            +F ++  +     G++     R R +++ K      +S   L+LTEDNI+ VL +AR EL
Sbjct  35   RFRNVRMTKLTYEGMILAETPRARTLTTVKAVSGGGVSLPPLELTEDNIRLVLTEARVEL  94

Query  475  AQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVDIE  296
            AQLFD  VGITG+VEL E+DGP+VKISL GKFWH R+ VLAR+GNYLKQRIPEILEV+IE
Sbjct  95   AQLFDLSVGITGQVELVELDGPFVKISLRGKFWHTRAMVLARIGNYLKQRIPEILEVEIE  154

Query  295  DEKQLDDSPASF  260
            DEKQLDDSPA+F
Sbjct  155  DEKQLDDSPANF  166



>ref|XP_002862394.1| hypothetical protein ARALYDRAFT_497470 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002879432.1| hypothetical protein ARALYDRAFT_482253 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38652.1| hypothetical protein ARALYDRAFT_497470 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55691.1| hypothetical protein ARALYDRAFT_482253 [Arabidopsis lyrata subsp. 
lyrata]
Length=166

 Score =   157 bits (396),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = -3

Query  613  GVVSRPATRRRLISSTKTAFHPTISAS-LDLTEDNIKQVLVDARTELAQLFDTEVGITGR  437
            G +    +R R +++T+      +S   LDLTEDNI  VL +AR ELAQLFD+ VGITG+
Sbjct  48   GTILTKKSRARTLTTTEAVSGGGVSLPPLDLTEDNIHLVLSEARIELAQLFDSSVGITGQ  107

Query  436  VELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            VEL E+DGP+VKISL GKFWH R+ VLAR+GNYLKQRIPEILEV+IEDEKQLDDSPA+F
Sbjct  108  VELVELDGPFVKISLRGKFWHTRAMVLARIGNYLKQRIPEILEVEIEDEKQLDDSPANF  166



>ref|XP_004303505.1| PREDICTED: uncharacterized protein LOC101312268 [Fragaria vesca 
subsp. vesca]
Length=170

 Score =   157 bits (397),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 87/104 (84%), Gaps = 2/104 (2%)
 Frame = -3

Query  571  STKTAFHPTISASLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISL  392
            ST  A  P  S  LDLTEDNI+QVL DAR E   LFDT VG+TG+V+LA++DGP+VKISL
Sbjct  69   STAAAAQP--SQPLDLTEDNIRQVLADARDEFGHLFDTSVGMTGQVDLADLDGPFVKISL  126

Query  391  SGKFWHKRSTVLARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
             G+FWH+RS VLARL NYLK+RIPEILEVDIEDEKQLDDSPA+F
Sbjct  127  KGRFWHERSLVLARLANYLKKRIPEILEVDIEDEKQLDDSPANF  170



>ref|XP_010469511.1| PREDICTED: uncharacterized protein LOC104749555 [Camelina sativa]
Length=166

 Score =   157 bits (396),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 100/132 (76%), Gaps = 1/132 (1%)
 Frame = -3

Query  652  KFHSLSASCRLKNGVVSRPATRRRLISSTKTAFHPTISAS-LDLTEDNIKQVLVDARTEL  476
            +F ++S    +  G++    +R R +++ +      +S   LDLTEDNI  VL +AR EL
Sbjct  35   RFRNVSMRKPVYLGMILSEKSRARTLTTAEAVSGGGVSLPPLDLTEDNIHLVLSEARIEL  94

Query  475  AQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVDIE  296
            AQLFD+ VGITG+VEL E+DGP+VKISL GKFWH R+ VLAR+GNY+KQRIPEILEV+IE
Sbjct  95   AQLFDSSVGITGQVELVELDGPFVKISLRGKFWHTRAMVLARIGNYMKQRIPEILEVEIE  154

Query  295  DEKQLDDSPASF  260
            DEKQLDDSPA+F
Sbjct  155  DEKQLDDSPANF  166



>ref|XP_009141292.1| PREDICTED: uncharacterized protein LOC103865249 [Brassica rapa]
Length=166

 Score =   157 bits (396),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = -3

Query  613  GVVSRPATRRRLISSTKTAFHPTISAS-LDLTEDNIKQVLVDARTELAQLFDTEVGITGR  437
            G++     R R +++ K      +S   LDLTEDNI+ VL +AR ELAQLFD  VGITG+
Sbjct  48   GMILAETPRARTLTTVKAVSGGGVSLPPLDLTEDNIRLVLSEARVELAQLFDLSVGITGQ  107

Query  436  VELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            VEL E+DGP+VKISL GKFWH R+ VLAR+GNYLKQRIPEILEV+IEDEKQLDDSPA+F
Sbjct  108  VELVELDGPFVKISLRGKFWHTRAMVLARIGNYLKQRIPEILEVEIEDEKQLDDSPANF  166



>ref|XP_002297831.2| hypothetical protein POPTR_0001s14110g [Populus trichocarpa]
 gb|EEE82636.2| hypothetical protein POPTR_0001s14110g [Populus trichocarpa]
Length=236

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -3

Query  532  LDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLA  353
            LDLTE+N+KQVLVDAR EL Q+FDT VGITG+VELAE+DGP+V ISL G+FWH+RS V+A
Sbjct  146  LDLTEENVKQVLVDARAELGQIFDTSVGITGQVELAELDGPFVVISLKGRFWHERSMVVA  205

Query  352  RLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            R+GNYLKQRIPEILEV+IEDEKQLDDSP +F
Sbjct  206  RIGNYLKQRIPEILEVEIEDEKQLDDSPENF  236



>ref|XP_010041047.1| PREDICTED: uncharacterized protein LOC104429953 [Eucalyptus grandis]
Length=229

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = -3

Query  541  SASLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRST  362
            S  LDLTE+NI+ VL DAR ELAQ+FDT VGITG++ELAE+DGP+VKISL G+FWH+RS 
Sbjct  136  SPPLDLTEENIRLVLADARVELAQIFDTSVGITGQIELAELDGPFVKISLRGRFWHERSM  195

Query  361  VLARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            VLAR+GNYLKQRIPEILEVDIEDEKQLDDSP +F
Sbjct  196  VLARVGNYLKQRIPEILEVDIEDEKQLDDSPENF  229



>ref|XP_010413905.1| PREDICTED: uncharacterized protein LOC104700135 [Camelina sativa]
Length=166

 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 100/139 (72%), Gaps = 10/139 (7%)
 Frame = -3

Query  646  HSLSASCRLKN---------GVVSRPATRRRLISSTKTAFHPTISAS-LDLTEDNIKQVL  497
            H +  + R +N         G+V    +R R +++ +      +S   LDLTE+NI  VL
Sbjct  28   HCIGLALRFRNVSMRKPVYLGLVLSEKSRARTLTTAEAVSGGGVSLPPLDLTEENIHLVL  87

Query  496  VDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPE  317
             +AR ELAQLFD+ VGITG+VEL E+DGP+VKISL GKFWH R+ VLAR+GNY+KQRIPE
Sbjct  88   SEARIELAQLFDSSVGITGQVELVELDGPFVKISLRGKFWHTRAMVLARIGNYMKQRIPE  147

Query  316  ILEVDIEDEKQLDDSPASF  260
            ILEV+IEDEKQLDDSPA+F
Sbjct  148  ILEVEIEDEKQLDDSPANF  166



>ref|XP_004957148.1| PREDICTED: uncharacterized protein LOC101781670 isoform X2 [Setaria 
italica]
 ref|XP_004957149.1| PREDICTED: uncharacterized protein LOC101781670 isoform X3 [Setaria 
italica]
 ref|XP_004957150.1| PREDICTED: uncharacterized protein LOC101781670 isoform X4 [Setaria 
italica]
Length=154

 Score =   155 bits (392),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = -3

Query  544  ISASLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRS  365
            I+ASLDLTEDN++  L +A++EL QLFDT VGITG+V+LAE+DGP+VK+ L GKFWH R+
Sbjct  60   ITASLDLTEDNVRLALEEAKSELGQLFDTSVGITGQVDLAELDGPFVKLRLKGKFWHTRA  119

Query  364  TVLARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            TV+AR+GNYLK RIPEILEV+IEDEKQLDDSPA+F
Sbjct  120  TVVARIGNYLKNRIPEILEVEIEDEKQLDDSPAAF  154



>ref|XP_008670277.1| PREDICTED: uncharacterized protein LOC103647530 [Zea mays]
Length=156

 Score =   155 bits (392),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -3

Query  547  TISASLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKR  368
             I+ASLDLTEDN++  L +A++EL QLFDT VGITG+V+LAE+DGP+VK+ L GKFWH R
Sbjct  61   AITASLDLTEDNVRVALDEAKSELGQLFDTSVGITGQVDLAELDGPFVKLRLKGKFWHTR  120

Query  367  STVLARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            +TV+AR+GNYLK RIPEILEV+IEDEKQLDDSPA+F
Sbjct  121  ATVVARIGNYLKNRIPEILEVEIEDEKQLDDSPAAF  156



>gb|AFK33549.1| unknown [Lotus japonicus]
Length=174

 Score =   155 bits (393),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 101/140 (72%), Gaps = 11/140 (8%)
 Frame = -3

Query  670  PNPSLP--KFHSLSASCRL-KNGVVSRPATRRRLISSTKTAFHPTISASLDLTEDNIKQV  500
            P PSL   +FH  ++   L KNG   +P    + +S+  +A  P     LDLTE N+KQV
Sbjct  43   PKPSLKTTQFHMHNSLLHLTKNG---KPKRELKPLSAALSAPPP-----LDLTESNVKQV  94

Query  499  LVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIP  320
            L DAR E  Q+FDT  G+TG VELAE+DGP+VKISL G+FWH+RS VLAR+ NYLKQRIP
Sbjct  95   LADARGEFGQIFDTSAGMTGIVELAELDGPFVKISLKGRFWHERSMVLARIANYLKQRIP  154

Query  319  EILEVDIEDEKQLDDSPASF  260
            EILEVDIEDEKQLDDSP +F
Sbjct  155  EILEVDIEDEKQLDDSPENF  174



>ref|XP_006410454.1| hypothetical protein EUTSA_v10017331mg [Eutrema salsugineum]
 gb|ESQ51907.1| hypothetical protein EUTSA_v10017331mg [Eutrema salsugineum]
Length=166

 Score =   155 bits (392),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -3

Query  532  LDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLA  353
            LDLTEDNI+ VL +AR ELAQLFD  VGITG+VEL E+DGP+VKISL GKFWH R+ +LA
Sbjct  76   LDLTEDNIRLVLSEARIELAQLFDLSVGITGQVELVELDGPFVKISLRGKFWHTRAMILA  135

Query  352  RLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            R+GNYLKQRIPEILEV+IEDEKQLDDSPA+F
Sbjct  136  RIGNYLKQRIPEILEVEIEDEKQLDDSPANF  166



>ref|XP_008442900.1| PREDICTED: uncharacterized protein LOC103486663 [Cucumis melo]
Length=158

 Score =   155 bits (391),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -3

Query  532  LDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLA  353
            LDLTE+N+KQ L +AR ELAQ+FD  VGITG VELAE+DGP+VKISL G+FWHKRSTV+A
Sbjct  68   LDLTEENVKQALGEARVELAQIFDDSVGITGVVELAELDGPFVKISLKGRFWHKRSTVVA  127

Query  352  RLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            R+GNYLK RIPEILEV+IEDE QLDDSPASF
Sbjct  128  RVGNYLKNRIPEILEVEIEDESQLDDSPASF  158



>ref|NP_180876.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAC04905.1| unknown protein [Arabidopsis thaliana]
 gb|AAL36191.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51286.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08795.1| uncharacterized protein AT2G33180 [Arabidopsis thaliana]
Length=166

 Score =   155 bits (391),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 100/142 (70%), Gaps = 10/142 (7%)
 Frame = -3

Query  655  PKFHSLSASCRLKNGVVSRPA---------TRRRLISSTKTAFHPTIS-ASLDLTEDNIK  506
            P  + +  + R  N  + +PA         +R R +++ +      +S   LDLTEDNI 
Sbjct  25   PVANRIGQALRFSNVRMRKPAYLGTILSEKSRARTLTTAEAVSGSGVSLPPLDLTEDNIH  84

Query  505  QVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQR  326
             VL +AR ELAQLFD+ VGITG+VEL E+DGP+V ISL GKFWH R+ VLARLGNYLKQR
Sbjct  85   LVLSEARIELAQLFDSSVGITGQVELVELDGPFVTISLRGKFWHTRAMVLARLGNYLKQR  144

Query  325  IPEILEVDIEDEKQLDDSPASF  260
            IPEILEV+IEDEKQLDDSPA+F
Sbjct  145  IPEILEVNIEDEKQLDDSPANF  166



>ref|XP_004136506.1| PREDICTED: uncharacterized protein LOC101205788 [Cucumis sativus]
 ref|XP_004164604.1| PREDICTED: uncharacterized protein LOC101226086 [Cucumis sativus]
 gb|KGN59186.1| hypothetical protein Csa_3G778420 [Cucumis sativus]
Length=160

 Score =   154 bits (389),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -3

Query  532  LDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLA  353
            LDLTE+N++Q L +AR ELAQ+FD  VGITG VELAE+DGP+VKISL G+FWHKRSTV+A
Sbjct  70   LDLTEENVRQALGEARVELAQIFDDSVGITGVVELAELDGPFVKISLKGRFWHKRSTVVA  129

Query  352  RLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            R+GNYLK RIPEILEV+IEDE QLDDSPASF
Sbjct  130  RVGNYLKNRIPEILEVEIEDESQLDDSPASF  160



>ref|XP_007162956.1| hypothetical protein PHAVU_001G194300g [Phaseolus vulgaris]
 gb|ESW34950.1| hypothetical protein PHAVU_001G194300g [Phaseolus vulgaris]
Length=161

 Score =   153 bits (386),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = -3

Query  586  RRLISSTKTAFHPTISASLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPY  407
            RR++     A    +   +DLTE+N+KQVL DAR EL Q+FDT VG+TG VELA++DGP+
Sbjct  55   RRMLKPLSAAL--PVPPPIDLTENNVKQVLEDARQELGQIFDTSVGMTGVVELADLDGPF  112

Query  406  VKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            VK+SL G+FWH+RS VLAR+ NYLKQRIPEILEVDIEDEKQLDDSP +F
Sbjct  113  VKLSLRGRFWHERSMVLARIANYLKQRIPEILEVDIEDEKQLDDSPENF  161



>gb|KFK31077.1| hypothetical protein AALP_AA6G065200 [Arabis alpina]
Length=166

 Score =   153 bits (386),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -3

Query  532  LDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLA  353
            LDLTEDNI  VL +AR ELAQLFD  VGITG+VEL E+DGP+V ISL GKFWH RS VLA
Sbjct  76   LDLTEDNIHLVLSEARVELAQLFDLSVGITGQVELVELDGPFVTISLRGKFWHTRSMVLA  135

Query  352  RLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            R+GNYLKQRIPEILEV+IEDEKQLDDSPA+F
Sbjct  136  RIGNYLKQRIPEILEVEIEDEKQLDDSPANF  166



>ref|XP_011002160.1| PREDICTED: uncharacterized protein LOC105109229 isoform X1 [Populus 
euphratica]
Length=180

 Score =   153 bits (386),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 92/123 (75%), Gaps = 7/123 (6%)
 Frame = -3

Query  607  VSRPATRRRLISSTKTAFHPTISASLDLTEDNIKQVLVDARTE-------LAQLFDTEVG  449
            V RP  +   +++   A        LDLTE+N+KQVLVDAR E       L Q+FDT VG
Sbjct  58   VQRPNRKPSPLTTITAAAAGVPLPPLDLTEENVKQVLVDARAEDVCLFLQLGQIFDTSVG  117

Query  448  ITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVDIEDEKQLDDSP  269
            ITG+VELAE+DGP+V ISL G+FWH+RS VLAR+GNYLKQRIPEILEV+IEDEKQLDDSP
Sbjct  118  ITGQVELAELDGPFVVISLKGRFWHERSMVLARIGNYLKQRIPEILEVEIEDEKQLDDSP  177

Query  268  ASF  260
             +F
Sbjct  178  ENF  180



>ref|XP_006295125.1| hypothetical protein CARUB_v10024199mg [Capsella rubella]
 gb|EOA28023.1| hypothetical protein CARUB_v10024199mg [Capsella rubella]
Length=166

 Score =   152 bits (384),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -3

Query  532  LDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLA  353
            LDLTEDNI  VL +AR ELAQLFD+ VGITG+VEL E+DGP+V ISL GKFWH R+ VLA
Sbjct  76   LDLTEDNIHLVLSEARIELAQLFDSSVGITGQVELVELDGPFVTISLRGKFWHTRAMVLA  135

Query  352  RLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            R+GNY+KQRIPEILEV+IEDEKQLDDSPA+F
Sbjct  136  RIGNYMKQRIPEILEVEIEDEKQLDDSPANF  166



>ref|XP_002462551.1| hypothetical protein SORBIDRAFT_02g027960 [Sorghum bicolor]
 gb|EER99072.1| hypothetical protein SORBIDRAFT_02g027960 [Sorghum bicolor]
Length=157

 Score =   150 bits (379),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -3

Query  535  SLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVL  356
            SLDLTEDN++  L +A++EL QLFDT VGITG+V+LAE+DGP+VK+ L GKFWH R+TV+
Sbjct  66   SLDLTEDNVRLALDEAKSELGQLFDTSVGITGQVDLAELDGPFVKLRLKGKFWHTRATVV  125

Query  355  ARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            AR+GNYLK RIPEILEV+IEDEKQLDDSPA+F
Sbjct  126  ARIGNYLKNRIPEILEVEIEDEKQLDDSPAAF  157



>ref|NP_001063498.1| Os09g0481800 [Oryza sativa Japonica Group]
 dbj|BAD33404.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF25412.1| Os09g0481800 [Oryza sativa Japonica Group]
 dbj|BAG88405.1| unnamed protein product [Oryza sativa Japonica Group]
Length=154

 Score =   149 bits (375),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -3

Query  535  SLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVL  356
            SLDL EDN++  + +A+ EL QLFDT VGITG+V+LAE+DGP+VK+ L GKFWH R+TVL
Sbjct  63   SLDLNEDNVRLAIDEAKAELGQLFDTSVGITGQVDLAELDGPFVKLRLKGKFWHTRATVL  122

Query  355  ARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            AR+GNYLK RIPEILEV+IEDEKQLDDSPA+F
Sbjct  123  ARIGNYLKNRIPEILEVEIEDEKQLDDSPAAF  154



>gb|EEC84769.1| hypothetical protein OsI_31795 [Oryza sativa Indica Group]
Length=154

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -3

Query  535  SLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVL  356
            SLDL EDN++  + +A+ EL QLFDT VGITG+V+LAE+DGP+VK+ L GKFWH R+TVL
Sbjct  63   SLDLNEDNVRLAIDEAKAELGQLFDTSVGITGQVDLAELDGPFVKLRLKGKFWHTRATVL  122

Query  355  ARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            AR+GNYLK RIPEILEV+IEDEKQLDDSPA+F
Sbjct  123  ARIGNYLKNRIPEILEVEIEDEKQLDDSPAAF  154



>gb|ABK22227.1| unknown [Picea sitchensis]
Length=182

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -3

Query  532  LDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLA  353
            LDLTE+N+ QVL+DAR+EL QLFD+ VGI+G VELAEVDGP+VK+ L G+FWH+RS VLA
Sbjct  92   LDLTEENVNQVLIDARSELMQLFDSAVGISGVVELAEVDGPFVKLRLKGRFWHERSMVLA  151

Query  352  RLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            R+G YL++RIPEILEVDIEDE QLDDSP +F
Sbjct  152  RIGTYLQKRIPEILEVDIEDEAQLDDSPENF  182



>emb|CAN68366.1| hypothetical protein VITISV_018177 [Vitis vinifera]
Length=153

 Score =   147 bits (371),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 102/152 (67%), Gaps = 20/152 (13%)
 Frame = -3

Query  679  PSLPNPSL-PKFHSLSAS-CRLKNGVVSRPA-------TRRRLISSTKTAFHPTISASL-  530
            P +  PSL P  H +S +  +L  G+ S          +RRR  ++  T     ++ASL 
Sbjct  10   PRISTPSLLPTSHLISNTRSQLTTGMTSAKGPMVPLRWSRRRPSTAVTTPRFAAVTASLS  69

Query  529  --DLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVL  356
              DLTEDN++Q        LAQ+FD  VGITG  ELAE+DGP+VKISL G+FWHKRSTVL
Sbjct  70   PLDLTEDNVRQ--------LAQIFDNSVGITGEAELAELDGPFVKISLRGRFWHKRSTVL  121

Query  355  ARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            AR+ NYLKQRIPEILEVDIEDEKQLDDSP +F
Sbjct  122  ARVANYLKQRIPEILEVDIEDEKQLDDSPENF  153



>emb|CAJ19336.1| hypothetical protein [Triticum aestivum]
 emb|CAJ19351.1| hypothetical protein [Triticum aestivum]
Length=169

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 85/111 (77%), Gaps = 18/111 (16%)
 Frame = -3

Query  544  ISASLDLTEDNIKQVLVDARTE----------------LAQLFDTEVGITGRVELAEVDG  413
            I+ASLDLTEDN++Q +VDA+ E                LAQLFDT VGIT  V+LAE+DG
Sbjct  61   ITASLDLTEDNVRQAIVDAKAEASKASFPLTSTPKNISLAQLFDTSVGIT--VDLAELDG  118

Query  412  PYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            P+VK+ L GKFWH R+TV+AR+GNYLK RIPEILEV+IEDE QLDDSPA++
Sbjct  119  PFVKLRLKGKFWHTRATVVARIGNYLKNRIPEILEVEIEDEDQLDDSPAAY  169



>gb|EPS66435.1| hypothetical protein M569_08346, partial [Genlisea aurea]
Length=123

 Score =   137 bits (346),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -3

Query  535  SLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVL  356
            +LDLTE+N+KQ L DAR ELAQLFD  V ITG+ E+AE+DGPYVKISLSG+FWHKRSTVL
Sbjct  32   TLDLTEENVKQALGDARVELAQLFDDSVNITGKAEVAEIDGPYVKISLSGRFWHKRSTVL  91

Query  355  ARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            ARLGNYLK+RIPEI+EV+IEDEKQLDDSP +F
Sbjct  92   ARLGNYLKRRIPEIVEVEIEDEKQLDDSPENF  123



>ref|XP_001754032.1| predicted protein [Physcomitrella patens]
 gb|EDQ81354.1| predicted protein [Physcomitrella patens]
Length=236

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -3

Query  532  LDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLA  353
            LDLTE+N++QVL+DAR+EL QLFD +VGITG V+LAE+DGP+V + LSG+FWH RS VLA
Sbjct  75   LDLTEENVQQVLLDARSELLQLFDLKVGITGVVQLAEIDGPFVTLRLSGRFWHTRSMVLA  134

Query  352  RLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            R+ NYL++RIPEI+EV IEDE QLDDS   F
Sbjct  135  RVANYLQKRIPEIVEVQIEDESQLDDSIVEF  165



>ref|XP_010104787.1| hypothetical protein L484_018841 [Morus notabilis]
 gb|EXC01928.1| hypothetical protein L484_018841 [Morus notabilis]
Length=172

 Score =   137 bits (344),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 75/88 (85%), Gaps = 7/88 (8%)
 Frame = -3

Query  547  TISAS-------LDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLS  389
            TISAS       LDLTEDNI+ VL DAR EL+QLFD  VGITG+V+LAE+DGP+VKISL 
Sbjct  54   TISASSLSQPQPLDLTEDNIRLVLADARLELSQLFDDSVGITGQVQLAELDGPFVKISLK  113

Query  388  GKFWHKRSTVLARLGNYLKQRIPEILEV  305
            G+FWHKRSTVLARLGNYLKQRIPEILEV
Sbjct  114  GRFWHKRSTVLARLGNYLKQRIPEILEV  141



>ref|XP_002518165.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44298.1| conserved hypothetical protein [Ricinus communis]
Length=164

 Score =   136 bits (343),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 73/91 (80%), Gaps = 11/91 (12%)
 Frame = -3

Query  532  LDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLA  353
            LDLTE+N             QLFDT V ITG+ ELAE+DGP+VKISL G+FWHKRSTVLA
Sbjct  85   LDLTEEN-----------FGQLFDTSVNITGQAELAELDGPFVKISLKGRFWHKRSTVLA  133

Query  352  RLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            RLGNYLKQRIPEILEVDIEDEKQLDDSP +F
Sbjct  134  RLGNYLKQRIPEILEVDIEDEKQLDDSPENF  164



>ref|XP_006603669.1| PREDICTED: uncharacterized protein LOC100500460 isoform X1 [Glycine 
max]
Length=170

 Score =   126 bits (317),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 74/91 (81%), Gaps = 1/91 (1%)
 Frame = -3

Query  586  RRLISSTKTAFHPTISASLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPY  407
            RR+IS   +A  P     LDLTE+N+KQVL DAR EL Q+FD+ VGITG VELA++DGP+
Sbjct  52   RRMISKPISAALPA-PPPLDLTENNVKQVLEDARKELGQIFDSSVGITGVVELADLDGPF  110

Query  406  VKISLSGKFWHKRSTVLARLGNYLKQRIPEI  314
            VKISL G+FWHKRSTVLAR+ NYLKQRIP++
Sbjct  111  VKISLKGRFWHKRSTVLARVANYLKQRIPKL  141



>ref|XP_006603670.1| PREDICTED: uncharacterized protein LOC100500460 isoform X2 [Glycine 
max]
Length=161

 Score =   126 bits (316),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 74/91 (81%), Gaps = 1/91 (1%)
 Frame = -3

Query  586  RRLISSTKTAFHPTISASLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPY  407
            RR+IS   +A  P     LDLTE+N+KQVL DAR EL Q+FD+ VGITG VELA++DGP+
Sbjct  52   RRMISKPISAALPA-PPPLDLTENNVKQVLEDARKELGQIFDSSVGITGVVELADLDGPF  110

Query  406  VKISLSGKFWHKRSTVLARLGNYLKQRIPEI  314
            VKISL G+FWHKRSTVLAR+ NYLKQRIP++
Sbjct  111  VKISLKGRFWHKRSTVLARVANYLKQRIPKL  141



>ref|XP_008796567.1| PREDICTED: uncharacterized protein LOC103711985 isoform X2 [Phoenix 
dactylifera]
Length=138

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 83/116 (72%), Gaps = 11/116 (9%)
 Frame = -3

Query  658  LPKFHSLSASCRLKNGVVSRPATRRRLISSTKTAFHPTISASL---DLTEDNIKQVLVDA  488
            +P F +LS        + SR    R+L +  +    PTI+A+L   DL EDNI+QVL+DA
Sbjct  28   IPHFQTLS--------LKSRSFRSRKLKALPRGLRSPTITAALPPLDLNEDNIRQVLIDA  79

Query  487  RTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIP  320
            R+E AQ+FD+ VGITG V+LAE+DGP+VK+ L G+FWH+R+ VLARLGNYLK RIP
Sbjct  80   RSEFAQIFDSSVGITGEVDLAELDGPFVKLRLQGRFWHQRAIVLARLGNYLKNRIP  135



>gb|KEH24211.1| hypothetical protein MTR_7g105840 [Medicago truncatula]
Length=147

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  547  TISASLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKR  368
            ++   LDLTEDN++Q LVDAR EL Q+FDT VG+TG VEL E+DGPYV ISL G+FWHKR
Sbjct  63   SVEPPLDLTEDNVRQALVDARGELGQIFDTSVGMTGVVELVELDGPYVTISLKGRFWHKR  122

Query  367  STVLARLGNYLKQRIP  320
            STVLARL NYLKQRIP
Sbjct  123  STVLARLANYLKQRIP  138



>ref|XP_006368889.1| hypothetical protein POPTR_0001s14110g [Populus trichocarpa]
 gb|ERP65458.1| hypothetical protein POPTR_0001s14110g [Populus trichocarpa]
Length=225

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = -3

Query  532  LDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLA  353
            LDLTE+N+KQVLVDAR EL Q+FDT VGITG+VELAE+DGP+V ISL G+FWH+RS V+A
Sbjct  146  LDLTEENVKQVLVDARAELGQIFDTSVGITGQVELAELDGPFVVISLKGRFWHERSMVVA  205

Query  352  RLGNYLKQRIPEILEVDIE  296
            R+GNYLKQRIP  L + IE
Sbjct  206  RIGNYLKQRIPVSLFIAIE  224



>ref|XP_006420518.1| hypothetical protein CICLE_v10006014mg [Citrus clementina]
 gb|ESR33758.1| hypothetical protein CICLE_v10006014mg [Citrus clementina]
Length=169

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -3

Query  532  LDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLA  353
            LDLTEDN++QV+ DAR ELAQLFDT VGITG  ELAE+DGP+VKI L G+FWHKRSTV+A
Sbjct  91   LDLTEDNVRQVIADARGELAQLFDTSVGITGVAELAELDGPFVKIRLRGRFWHKRSTVIA  150

Query  352  RLGNYLKQRIP  320
            RL NYLKQRIP
Sbjct  151  RLANYLKQRIP  161



>gb|KDO43048.1| hypothetical protein CISIN_1g030939mg [Citrus sinensis]
Length=157

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -3

Query  568  TKTAFHPTISASLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLS  389
            T+TA        LDLTEDN++QV+ DAR ELAQLFDT VGITG  ELAE+DGP+VKI L 
Sbjct  67   TRTAAGGVPPPPLDLTEDNVRQVIADARGELAQLFDTSVGITGVAELAELDGPFVKIRLR  126

Query  388  GKFWHKRSTVLARLGNYLKQRIP  320
            G+FWHKRSTV+ARL NYLKQRIP
Sbjct  127  GRFWHKRSTVIARLANYLKQRIP  149



>ref|XP_006492147.1| PREDICTED: uncharacterized protein LOC102618883 isoform X2 [Citrus 
sinensis]
Length=206

 Score =   124 bits (311),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -3

Query  532  LDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLA  353
            LDLTEDN++QV+ DAR ELAQLFDT VGITG  E+AE+DGP+VKI L G+FWHKRSTV+A
Sbjct  128  LDLTEDNVRQVIADARGELAQLFDTSVGITGVAEVAELDGPFVKIRLRGRFWHKRSTVIA  187

Query  352  RLGNYLKQRIP  320
            RL NYLKQRIP
Sbjct  188  RLANYLKQRIP  198



>ref|XP_004957147.1| PREDICTED: uncharacterized protein LOC101781670 isoform X1 [Setaria 
italica]
Length=160

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  544  ISASLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRS  365
            I+ASLDLTEDN++  L +A++EL QLFDT VGITG+V+LAE+DGP+VK+ L GKFWH R+
Sbjct  60   ITASLDLTEDNVRLALEEAKSELGQLFDTSVGITGQVDLAELDGPFVKLRLKGKFWHTRA  119

Query  364  TVLARLGNYLKQRIP  320
            TV+AR+GNYLK RIP
Sbjct  120  TVVARIGNYLKNRIP  134



>gb|EAZ45145.1| hypothetical protein OsJ_29783 [Oryza sativa Japonica Group]
Length=145

 Score =   117 bits (293),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 71/92 (77%), Gaps = 9/92 (10%)
 Frame = -3

Query  535  SLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVL  356
            SLDL EDN++  + +A+ E +           +V+LAE+DGP+VK+ L GKFWH R+TVL
Sbjct  63   SLDLNEDNVRLAIDEAKAEAS---------LRQVDLAELDGPFVKLRLKGKFWHTRATVL  113

Query  355  ARLGNYLKQRIPEILEVDIEDEKQLDDSPASF  260
            AR+GNYLK RIPEILEV+IEDEKQLDDSPA+F
Sbjct  114  ARIGNYLKNRIPEILEVEIEDEKQLDDSPAAF  145



>gb|EYU26225.1| hypothetical protein MIMGU_mgv1a014182mg [Erythranthe guttata]
Length=198

 Score =   119 bits (297),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 85/150 (57%), Gaps = 40/150 (27%)
 Frame = -3

Query  634  ASCRLKNGVVSRPATRRRLISSTKTAFHPTISAS---LDLTEDNIKQVLVDARTE-----  479
            A+ + KNG     ++R RL +    +  P+ISAS   LDLTEDNIKQVL DA+TE     
Sbjct  35   AALQPKNGCFM--SSRSRLRNQRHRSCAPSISASSAPLDLTEDNIKQVLADAKTEASFLL  92

Query  478  ------------------------------LAQLFDTEVGITGRVELAEVDGPYVKISLS  389
                                          LAQLFDT V ITG+VEL E+DGPYV ISL 
Sbjct  93   FSLLQLQFLLHDNNNVANLDYEFVFQFSLQLAQLFDTSVNITGKVELVELDGPYVTISLK  152

Query  388  GKFWHKRSTVLARLGNYLKQRIPEILEVDI  299
            G+FWH RS VLARLGNYLKQRIP  L + I
Sbjct  153  GRFWHTRSMVLARLGNYLKQRIPVSLMLFI  182



>gb|EMT10720.1| hypothetical protein F775_14983 [Aegilops tauschii]
Length=202

 Score =   113 bits (283),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 83/143 (58%), Gaps = 47/143 (33%)
 Frame = -3

Query  547  TISASLDLTEDNIKQVLVDARTE-------LAQLFDTEVGIT--------GRVELAEVDG  413
            +I+ASLDLTEDN++Q +VDA+ E       L  L  T V I         G+V+LAE+DG
Sbjct  60   SITASLDLTEDNVRQAIVDAKAEASRTSSLLKFLVHTAVPICFAQPSTAHGQVDLAELDG  119

Query  412  PYVKISLSGKFWHKRSTVLARLGNYLKQRIP-----------------------------  320
            P+VK+ L GKFWH R+TV+AR+GNYLK RIP                             
Sbjct  120  PFVKLRLKGKFWHTRATVVARIGNYLKNRIPVSSFSFRHAILPPGASEGRFCHEYDELFR  179

Query  319  ---EILEVDIEDEKQLDDSPASF  260
               EILEV+IEDE+QLDDSPA++
Sbjct  180  LGQEILEVEIEDEEQLDDSPAAY  202



>ref|XP_001753929.1| predicted protein [Physcomitrella patens]
 gb|EDQ81251.1| predicted protein [Physcomitrella patens]
Length=250

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -3

Query  499  LVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIP  320
            L +  +EL QLFD +VGITG V+LAE+DGP+V + LSG+FWH RS VLAR+ NYL++RIP
Sbjct  100  LTERSSELLQLFDLKVGITGVVQLAEIDGPFVTLRLSGRFWHTRSMVLARVANYLQKRIP  159

Query  319  EILEVDIEDEKQLDDSPASF  260
            EI+EV IEDE QLDDS   F
Sbjct  160  EIVEVQIEDESQLDDSIVEF  179



>gb|EMS52247.1| hypothetical protein TRIUR3_09460 [Triticum urartu]
Length=117

 Score =   107 bits (266),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = -3

Query  478  LAQLFDTEVGI-TGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVD  302
            L   F ++VG  +G+V+LAE+DGP+VK+ L GKFWH R+TV+AR+GNYLK RIPEILEV+
Sbjct  44   LQGWFWSKVGCASGQVDLAELDGPFVKLRLKGKFWHTRATVVARIGNYLKNRIPEILEVE  103

Query  301  IEDEKQLDDSPASF  260
            IEDE QLDDSPA++
Sbjct  104  IEDEDQLDDSPAAY  117



>ref|XP_005833481.1| hypothetical protein GUITHDRAFT_152388 [Guillardia theta CCMP2712]
 gb|EKX46501.1| hypothetical protein GUITHDRAFT_152388 [Guillardia theta CCMP2712]
Length=169

 Score =   107 bits (267),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 78/121 (64%), Gaps = 6/121 (5%)
 Frame = -3

Query  616  NGVVSRPATRRRLISSTKTAFHPTISAS-LDLTEDNIKQVLVDARTELAQLF-----DTE  455
             G+ S P   R+ ++   +   P +    LDLTEDN++Q L +++  L  +F     + E
Sbjct  42   GGLTSLPLQTRKGVALRLSVGGPPMDKEPLDLTEDNVQQALEESKEILGTMFGNSQENRE  101

Query  454  VGITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVDIEDEKQLDD  275
            +GITG V+L  +DGP+  + L G+FWHKRS VLAR+ NY+K R+PEI+EV IED  QLDD
Sbjct  102  IGITGDVQLVNLDGPFASVRLVGRFWHKRSDVLARVENYVKTRVPEIVEVSIEDPMQLDD  161

Query  274  S  272
            +
Sbjct  162  N  162



>emb|CBJ26822.1| conserved unknown protein [Ectocarpus siliculosus]
Length=108

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 69/93 (74%), Gaps = 5/93 (5%)
 Frame = -3

Query  535  SLDLTEDNIKQVLVDARTELAQLF-----DTEVGITGRVELAEVDGPYVKISLSGKFWHK  371
            +L LTE+N+  VL +A+ EL+ LF     +T VGITG  E   +DGP V + L+G+FWH+
Sbjct  5    TLILTEENVVAVLAEAKRELSTLFGNNAENTAVGITGDCEFVCLDGPSVVVRLTGRFWHE  64

Query  370  RSTVLARLGNYLKQRIPEILEVDIEDEKQLDDS  272
            ++TVLAR+GN+++ RIPE ++V+IED  QL+D+
Sbjct  65   KTTVLARVGNFVQTRIPECVDVEIEDPSQLEDA  97



>ref|XP_002183763.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC44945.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=203

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 73/118 (62%), Gaps = 14/118 (12%)
 Frame = -3

Query  589  RRRLISSTKTAFHPTISASLD-------LTEDNIKQVLVDARTELAQLF-----DTEVGI  446
            R+  I S+  A  PTI  S D       LTE+ +  VL   R EL  LF     +  VGI
Sbjct  83   RKAEIGSSLKA--PTIDRSADPIQVPAELTEETVLGVLSACRGELGTLFGYSAENRGVGI  140

Query  445  TGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVDIEDEKQLDDS  272
            TG V+  ++DGP V +SL G+FWH+R+ VL R+GNYL+QRIPEI++V +ED  QL D+
Sbjct  141  TGGVDYVDLDGPSVILSLKGRFWHQRTAVLERVGNYLQQRIPEIVDVQVEDPWQLTDA  198



>ref|XP_005792548.1| hypothetical protein EMIHUDRAFT_222964 [Emiliania huxleyi CCMP1516]
 gb|EOD40119.1| hypothetical protein EMIHUDRAFT_222964 [Emiliania huxleyi CCMP1516]
Length=168

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 79/130 (61%), Gaps = 17/130 (13%)
 Frame = -3

Query  643  SLSASCRLKNGVVSRPAT-RRRLISSTKTAFHPTISASLDLTEDNIKQVLVDARTELAQL  467
            S SAS R      +RPA+ R R  + T+      I   L LTE+N++ VL +A  +L  +
Sbjct  27   SASASWR------ARPASLRHRCGARTRP-----ILLELVLTEENVQAVLDEAERDLGTM  75

Query  466  FDTE-----VGITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVD  302
            F +      VGITGR EL E+DGP V I LSG+FWH R+ VL RL  ++ +RIPE + V+
Sbjct  76   FGSNPESAAVGITGRAELVELDGPTVVIRLSGRFWHARARVLERLEAFVLERIPECIGVE  135

Query  301  IEDEKQLDDS  272
            IED  QL+D+
Sbjct  136  IEDPSQLEDA  145



>ref|XP_005758674.1| hypothetical protein EMIHUDRAFT_249978 [Emiliania huxleyi CCMP1516]
 gb|EOD06245.1| hypothetical protein EMIHUDRAFT_249978 [Emiliania huxleyi CCMP1516]
Length=168

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 79/130 (61%), Gaps = 17/130 (13%)
 Frame = -3

Query  643  SLSASCRLKNGVVSRPAT-RRRLISSTKTAFHPTISASLDLTEDNIKQVLVDARTELAQL  467
            S SAS R      +RPA+ R R  + T+      I   L LTE+N++ VL +A  +L  +
Sbjct  27   SASASWR------ARPASLRHRCGARTRP-----ILLELVLTEENVQAVLDEAERDLGTM  75

Query  466  FDTE-----VGITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVD  302
            F +      VGITGR +L E+DGP V I LSG+FWH R+ VL RL  ++ +RIPE + V+
Sbjct  76   FGSNPESAAVGITGRADLVELDGPTVVIRLSGRFWHARARVLERLEAFVLERIPECIGVE  135

Query  301  IEDEKQLDDS  272
            IED  QL+D+
Sbjct  136  IEDPSQLEDA  145



>ref|XP_002289459.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED92996.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=207

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 62/94 (66%), Gaps = 5/94 (5%)
 Frame = -3

Query  541  SASLDLTEDNIKQVLVDARTELAQLFDTE-----VGITGRVELAEVDGPYVKISLSGKFW  377
             + L+L+E+ ++ VL   R E+  +F  +     VGITG V+  E+DGP V + L G+FW
Sbjct  107  GSQLELSEETVQGVLAACRQEIGTMFGYQAENRGVGITGGVDFVELDGPTVVLHLKGRFW  166

Query  376  HKRSTVLARLGNYLKQRIPEILEVDIEDEKQLDD  275
            H+R TVL R+G YL  RIPEI++V ++DE +L D
Sbjct  167  HQRPTVLNRVGAYLMARIPEIVDVTVQDEYELTD  200



>gb|EJK62113.1| hypothetical protein THAOC_17288 [Thalassiosira oceanica]
Length=214

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 62/94 (66%), Gaps = 5/94 (5%)
 Frame = -3

Query  541  SASLDLTEDNIKQVLVDARTELAQLFDTE-----VGITGRVELAEVDGPYVKISLSGKFW  377
             + L L E+ ++ VL   R E+  +F  +     VGITG V+  ++DGP V +SL G+FW
Sbjct  114  GSQLALDEETVQGVLAACRQEIGTMFGYQAENRGVGITGGVDFVDLDGPTVIVSLKGRFW  173

Query  376  HKRSTVLARLGNYLKQRIPEILEVDIEDEKQLDD  275
            H+R TVL+R+ +YL  RIPEI+EV +EDE QL D
Sbjct  174  HQRPTVLSRVSSYLIARIPEIVEVIVEDEYQLTD  207



>ref|XP_005770290.1| hypothetical protein EMIHUDRAFT_209879 [Emiliania huxleyi CCMP1516]
 gb|EOD17861.1| hypothetical protein EMIHUDRAFT_209879 [Emiliania huxleyi CCMP1516]
Length=162

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 54/89 (61%), Gaps = 5/89 (6%)
 Frame = -3

Query  526  LTEDNIKQVLVDARTELAQLF----DT-EVGITGRVELAEVDGPYVKISLSGKFWHKRST  362
              E  ++  L D +     +F    DT  +GITG + LAEVDGP V +SLSG+FWHKR T
Sbjct  20   FGEAAVRATLDDFKAAAPSMFGGHPDTVAIGITGDIALAEVDGPVVVLSLSGRFWHKRET  79

Query  361  VLARLGNYLKQRIPEILEVDIEDEKQLDD  275
            VLA  G +L+QR PEI +V + D   L D
Sbjct  80   VLANAGAFLRQRWPEICDVIVGDPGSLRD  108



>ref|XP_005771116.1| hypothetical protein EMIHUDRAFT_243582 [Emiliania huxleyi CCMP1516]
 gb|EOD18687.1| hypothetical protein EMIHUDRAFT_243582 [Emiliania huxleyi CCMP1516]
Length=124

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -3

Query  454  VGITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVDIEDEKQLDD  275
            +GITG + LAEVDGP V +SLSG+FWHKR TVLA  G +L+QR PEI +V + D   L D
Sbjct  11   IGITGDIALAEVDGPVVVLSLSGRFWHKRETVLANAGAFLRQRWPEICDVIVGDPGSLRD  70



>ref|XP_005539302.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM83266.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=145

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 52/78 (67%), Gaps = 4/78 (5%)
 Frame = -3

Query  526  LTEDNIKQVLVDARTELAQLFDTE----VGITGRVELAEVDGPYVKISLSGKFWHKRSTV  359
            LTE+N++ VL +A+   + +F +E    VGITG V L  +DG  V ++L G+FWH+R  V
Sbjct  50   LTEENVQAVLHEAKETFSTVFGSEENRQVGITGEVSLVGIDGATVVLALKGQFWHQRVVV  109

Query  358  LARLGNYLKQRIPEILEV  305
            L RL  +++ RIPE +EV
Sbjct  110  LQRLDKFIRDRIPECIEV  127



>gb|EWM30545.1| hypothetical protein Naga_100013g48 [Nannochloropsis gaditana]
Length=219

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 56/94 (60%), Gaps = 8/94 (9%)
 Frame = -3

Query  532  LDLTEDNIKQVLVDARTELAQLF-----DTEVGITGRVELAEVDGPYVKISLSGKFWHKR  368
            L LTE+N   VL  AR EL  +F     +  VGITG V+L  V+G  + + L  +FWH R
Sbjct  118  LILTEENAALVLEAARQELGTMFGYTKENQAVGITGEVDLVAVEGISIIVRLKNRFWHDR  177

Query  367  STVLARLGNYLKQRIPEILEVDIEDEKQL--DDS  272
              VL R+  ++  RIPE + V+IED +QL  DD+
Sbjct  178  KMVLTRISKFITDRIPEAM-VEIEDVEQLKGDDA  210



>ref|XP_002181986.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC46526.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=258

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 70/127 (55%), Gaps = 14/127 (11%)
 Frame = -3

Query  613  GVVSRPATRRRLISSTKTAFHP-------TISASLDLTEDNIKQVLVD-ARTELAQ-LFD  461
            G  + P T    ISST   ++         +  ++ LTE+NI++ L    ++   Q +F 
Sbjct  76   GASALPFTLPTTISSTVLRYNAYDDWRSDAVVPTVTLTEENIQECLETLVQSNYGQTMFG  135

Query  460  TE-----VGITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVDIE  296
                   VGITGRVEL E+ GP V + L G FWH+R TVL R   +L   +PE+++V ++
Sbjct  136  CHERPASVGITGRVELVELQGPEVVLRLEGSFWHRRETVLGRAAVWLNACMPELIQVRVD  195

Query  295  DEKQLDD  275
            D ++L+D
Sbjct  196  DLEELED  202



>ref|XP_005716541.1| unnamed protein product [Chondrus crispus]
 emb|CDF36722.1| unnamed protein product [Chondrus crispus]
Length=156

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 57/95 (60%), Gaps = 5/95 (5%)
 Frame = -3

Query  607  VSRPATRRRLISSTKTAFHPTISASLDLTEDNIKQVLVDARTELAQLFDTE-----VGIT  443
            V R + RR ++SS  +    +   +L LTE+N+ Q L + R +L  +F        VGIT
Sbjct  50   VHRRSHRRPVVSSPFSVPIASADDTLVLTEENVVQALNEVRVKLGSVFGNSAENRGVGIT  109

Query  442  GRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNY  338
            G V L+E+DGP V +SL G+FWHKR+ V++R   Y
Sbjct  110  GDVSLSELDGPIVVLSLKGRFWHKRADVVSRFLPY  144



>gb|EJK52918.1| hypothetical protein THAOC_27753 [Thalassiosira oceanica]
Length=398

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -3

Query  454  VGITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVDIEDEKQLDD  275
            VGITG +E  E+DGP V +SL+G+FWH+R TVL +   YL  RIPEI  V + D   L+D
Sbjct  18   VGITGSIEFVELDGPEVLLSLAGQFWHRRETVLGKAAIYLNARIPEITSVRVSDPADLED  77



>ref|XP_002292765.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED89961.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=235

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -3

Query  454  VGITGRVELAEVDGPYVKISLSGKFWHKRSTVLARLGNYLKQRIPEILEVDIEDEKQLDD  275
            VGITG +E   ++GP   ++L+GKFWHKR TVL +   YL  RIPE+  + +   ++L D
Sbjct  122  VGITGSIEFVSLEGPECVLALTGKFWHKRETVLGKAAMYLNARIPELTTITVSTAEELQD  181



>ref|XP_010928174.1| PREDICTED: uncharacterized protein LOC105050026 isoform X2 [Elaeis 
guineensis]
Length=141

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 51/77 (66%), Gaps = 11/77 (14%)
 Frame = -3

Query  661  SLPKFHSLSASCRLKNGVVSRPATRRRLISSTKTAFHPTISASL---DLTEDNIKQVLVD  491
            ++P F +L        G+  R    RRL +  + +  PTI+A+L   DLTEDNI+QVL+D
Sbjct  27   NIPHFQTL--------GLKRRSFRSRRLKALPRRSRSPTITAALPPLDLTEDNIRQVLID  78

Query  490  ARTELAQLFDTEVGITG  440
            AR+ELAQ+FD+ VGITG
Sbjct  79   ARSELAQIFDSSVGITG  95



>dbj|BAJ90942.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=108

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -3

Query  547  TISASLDLTEDNIKQVLVDARTELAQLFDTEVGITGRV  434
            +I+ASLDLTEDN++Q +VDA+ ELAQLFDT VGITG++
Sbjct  62   SITASLDLTEDNVRQAIVDAKAELAQLFDTSVGITGQL  99



>ref|XP_006420520.1| hypothetical protein CICLE_v10006014mg [Citrus clementina]
 gb|ESR33760.1| hypothetical protein CICLE_v10006014mg [Citrus clementina]
Length=124

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -3

Query  532  LDLTEDNIKQVLVDARTELAQLFDTEVGITG  440
            LDLTEDN++QV+ DAR ELAQLFDT VGITG
Sbjct  91   LDLTEDNVRQVIADARGELAQLFDTSVGITG  121



>ref|XP_006368888.1| hypothetical protein POPTR_0001s14110g [Populus trichocarpa]
 ref|XP_006368892.1| hypothetical protein POPTR_0001s14110g [Populus trichocarpa]
 ref|XP_006368893.1| hypothetical protein POPTR_0001s14110g [Populus trichocarpa]
 gb|ERP65457.1| hypothetical protein POPTR_0001s14110g [Populus trichocarpa]
 gb|ERP65461.1| hypothetical protein POPTR_0001s14110g [Populus trichocarpa]
 gb|ERP65462.1| hypothetical protein POPTR_0001s14110g [Populus trichocarpa]
Length=178

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -3

Query  532  LDLTEDNIKQVLVDARTELAQLFDTEVGITG  440
            LDLTE+N+KQVLVDAR EL Q+FDT VGITG
Sbjct  146  LDLTEENVKQVLVDARAELGQIFDTSVGITG  176



>ref|XP_002504672.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65930.1| predicted protein [Micromonas sp. RCC299]
Length=192

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 63/113 (56%), Gaps = 15/113 (13%)
 Frame = -3

Query  604  SRPA----TRRRLISSTKTAFHPTISASLDLTEDNIKQVLVDARTELAQLFDTEVGITGR  437
            SRP     +R R I + + A   +IS  L+LT DN+++VL + R  L       +   G 
Sbjct  11   SRPGRAAGSRVRRIVTVRAAGESSISEKLELTADNVEKVLDEVRPYL-------IADGGD  63

Query  436  VELAEVDGPYVKISLSGKFWH-KRSTVLARLG--NYLKQRIPEILEVD-IEDE  290
            VEL E+DG  V++ L+G       STV  R+G    L ++IPEI+EV+ I+DE
Sbjct  64   VELVEIDGLVVRLKLNGACGSCPSSTVTMRMGIEKRLMEKIPEIMEVEQIQDE  116



>gb|KCW44688.1| hypothetical protein EUGRSUZ_L01778 [Eucalyptus grandis]
Length=133

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 36/58 (62%), Gaps = 6/58 (10%)
 Frame = -3

Query  541  SASLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELAEVDGPYVKISLSGKFWHKR  368
            S  LDLTE+NI+ VL DAR ELAQ+FDT VGITG +       P VK + S    H +
Sbjct  82   SPPLDLTEENIRLVLADARVELAQIFDTSVGITGDIN------PAVKKAFSLSPLHDK  133



>gb|KCW48306.1| hypothetical protein EUGRSUZ_K02034 [Eucalyptus grandis]
Length=151

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  541  SASLDLTEDNIKQVLVDARTELAQLFDTEVGITGRVELA  425
            S  LDLTE+NI+ VL DAR ELAQ+FDT VGITG +  A
Sbjct  81   SPPLDLTEENIRLVLADARVELAQIFDTSVGITGDINPA  119



>gb|EYU26227.1| hypothetical protein MIMGU_mgv1a014182mg [Erythranthe guttata]
Length=142

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 47/104 (45%), Gaps = 40/104 (38%)
 Frame = -3

Query  634  ASCRLKNGVVSRPATRRRLISSTKTAFHPTISAS---LDLTEDNIKQVLVDARTE-----  479
            A+ + KNG     ++R RL +    +  P+ISAS   LDLTEDNIKQVL DA+TE     
Sbjct  35   AALQPKNGCFM--SSRSRLRNQRHRSCAPSISASSAPLDLTEDNIKQVLADAKTEASFLL  92

Query  478  ------------------------------LAQLFDTEVGITGR  437
                                          LAQLFDT V ITG 
Sbjct  93   FSLLQLQFLLHDNNNVANLDYEFVFQFSLQLAQLFDTSVNITGE  136



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1389194222792