BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18831_g1_i1 len=403 path=[1389:0-402]

Length=403
                                                                      Score     E

dbj|BAD02271.1|  heat shock protein 70                                  135   3e-37   Nicotiana benthamiana
ref|XP_010042813.1|  PREDICTED: probable mediator of RNA polymera...    141   3e-37   
dbj|BAD02273.1|  heat shock protein 70                                  132   1e-36   Nicotiana benthamiana
gb|KDO36486.1|  hypothetical protein CISIN_1g020168mg                   138   1e-36   
gb|ABX26256.1|  heat shock protein 70-like protein                      132   2e-36   Panax quinquefolius
ref|XP_011094842.1|  PREDICTED: heat shock cognate 70 kDa protein 2     141   2e-36   
gb|KHG00348.1|  Heat shock 70 kDa 4 -like protein                       140   2e-36   
ref|XP_009592776.1|  PREDICTED: heat shock cognate 70 kDa protein...    140   3e-36   
gb|ABG22609.1|  Heat shock cognate 70 kDa protein, putative, expr...    140   3e-36   
gb|AFG26330.1|  heat shock protein 70                                   131   3e-36   
ref|XP_009136338.1|  PREDICTED: probable mediator of RNA polymera...    130   4e-36   
gb|ABG22608.1|  Heat shock cognate 70 kDa protein, putative, expr...    139   6e-36   
gb|EAY81899.1|  hypothetical protein OsI_37065                          138   6e-36   Oryza sativa Indica Group [Indian rice]
gb|AFK37867.1|  unknown                                                 131   6e-36   
ref|XP_011077460.1|  PREDICTED: heat shock cognate 70 kDa protein...    139   7e-36   
emb|CAA70105.1|  Hsc70-G8 protein                                       130   9e-36   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ19310.1|  hypothetical protein OsJ_34853                          139   1e-35   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001068540.1|  Os11g0703900                                       139   1e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663128.1|  PREDICTED: heat shock cognate 70 kDa protein...    139   1e-35   
ref|XP_006424799.1|  hypothetical protein CICLE_v10027981mg             139   1e-35   
emb|CAA47948.2|  heat shock protein 70                                  139   1e-35   Oryza sativa [red rice]
gb|EYU26579.1|  hypothetical protein MIMGU_mgv1a002667mg                139   1e-35   
ref|XP_006488297.1|  PREDICTED: heat shock cognate 70 kDa protein...    139   1e-35   
gb|ACU17965.1|  unknown                                                 132   3e-35   Glycine max [soybeans]
ref|XP_009338761.1|  PREDICTED: probable mediator of RNA polymera...    138   3e-35   
ref|XP_009112006.1|  PREDICTED: probable mediator of RNA polymera...    137   3e-35   
ref|XP_009374678.1|  PREDICTED: probable mediator of RNA polymera...    137   4e-35   
ref|XP_006408646.1|  hypothetical protein EUTSA_v10002169mg             137   4e-35   
ref|XP_002284008.1|  PREDICTED: heat shock cognate 70 kDa protein 2     137   4e-35   Vitis vinifera
gb|AAB65162.1|  heat shock cognate protein                              134   4e-35   Solanum commersonii
ref|XP_006290203.1|  hypothetical protein CARUB_v10003889mg             137   5e-35   
ref|XP_004142750.1|  PREDICTED: heat shock cognate 70 kDa protein...    137   6e-35   
ref|XP_004142749.1|  PREDICTED: heat shock cognate 70 kDa protein...    137   8e-35   
ref|NP_001234491.1|  heat shock cognate 70 kDa protein 1                137   8e-35   
gb|ABK94007.1|  unknown                                                 128   8e-35   Populus trichocarpa [western balsam poplar]
ref|XP_006350760.1|  PREDICTED: heat shock cognate 70 kDa protein...    136   9e-35   
emb|CCA29120.1|  heat shock protein 70 isoform 1                        136   1e-34   
gb|AAB88009.1|  heat shock cognate protein HSC70                        136   1e-34   Brassica napus [oilseed rape]
gb|AIU34470.1|  putative heat shock protein                             136   1e-34   
gb|AAS57914.1|  70 kDa heat shock cognate protein 3                     136   1e-34   Vigna radiata [mung bean]
ref|XP_006348998.1|  PREDICTED: heat shock cognate 70 kDa protein...    135   2e-34   
gb|AAR17080.1|  heat shock protein 70-3                                 135   2e-34   Nicotiana tabacum [American tobacco]
gb|AAP04522.1|  heat shock protein 70                                   135   2e-34   Nicotiana tabacum [American tobacco]
ref|XP_004250958.1|  PREDICTED: heat shock cognate 70 kDa protein...    135   2e-34   
ref|XP_006392363.1|  hypothetical protein EUTSA_v10023343mg             135   2e-34   
ref|XP_009419750.1|  PREDICTED: heat shock cognate 70 kDa protein...    135   2e-34   
ref|XP_007162654.1|  hypothetical protein PHAVU_001G169000g             135   3e-34   
ref|XP_008458892.1|  PREDICTED: heat shock cognate 70 kDa protein       135   3e-34   
gb|AGZ15406.1|  heat shock cognate 70 kDa protein                       135   3e-34   
gb|KDP44981.1|  hypothetical protein JCGZ_01481                         135   3e-34   
gb|KFK33437.1|  hypothetical protein AALP_AA5G013700                    135   3e-34   
ref|XP_009620324.1|  PREDICTED: heat shock cognate 70 kDa protein...    135   3e-34   
emb|CDY40362.1|  BnaA10g27060D                                          133   4e-34   
gb|ACJ11741.1|  heat shock protein 70                                   134   5e-34   Gossypium hirsutum [American cotton]
gb|KHN48981.1|  Heat shock cognate 70 kDa protein                       134   6e-34   
ref|XP_009409520.1|  PREDICTED: heat shock cognate 70 kDa protein 2     134   6e-34   
gb|AAK59628.2|  putative dnaK-type molecular chaperone hsc70.1 pr...    128   6e-34   Arabidopsis thaliana [mouse-ear cress]
gb|KDP44987.1|  hypothetical protein JCGZ_01487                         134   6e-34   
gb|KDO67650.1|  hypothetical protein CISIN_1g0212722mg                  128   6e-34   
ref|XP_007207158.1|  hypothetical protein PRUPE_ppa024477mg             134   6e-34   
ref|XP_010685795.1|  PREDICTED: heat shock cognate 70 kDa protein 2     134   7e-34   
ref|XP_007027052.1|  Heat shock cognate protein 70-1 isoform 1          134   7e-34   
ref|XP_009122774.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    133   8e-34   
gb|ACA23466.1|  heat shock protein 70                                   127   8e-34   
ref|XP_008241192.1|  PREDICTED: probable mediator of RNA polymera...    134   8e-34   
ref|XP_009407484.1|  PREDICTED: probable mediator of RNA polymera...    134   1e-33   
gb|ADD64906.1|  heat shock protein-like protein                         125   1e-33   Tragopogon dubius [yellow salsify]
dbj|BAD94888.1|  dnaK-type molecular chaperone hsc70.1 - like           132   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009777579.1|  PREDICTED: heat shock cognate 70 kDa protein...    134   1e-33   
ref|XP_009122772.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    134   1e-33   
ref|XP_007220208.1|  hypothetical protein PRUPE_ppa002641mg             134   1e-33   
emb|CDY07820.1|  BnaC03g48020D                                          124   1e-33   
ref|XP_010095022.1|  Heat shock 70 kDa protein 4                        133   1e-33   
ref|XP_008369876.1|  PREDICTED: probable mediator of RNA polymera...    133   1e-33   
ref|NP_195869.1|  heat shock protein 70                                 133   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010423825.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    133   1e-33   
ref|XP_002873055.1|  predicted protein                                  133   1e-33   
ref|XP_010490742.1|  PREDICTED: probable mediator of RNA polymera...    133   2e-33   
dbj|BAD22854.1|  heat shock protein 70                                  130   2e-33   Nicotiana benthamiana
ref|XP_010253202.1|  PREDICTED: heat shock cognate 70 kDa protein 2     133   2e-33   
ref|XP_004287404.1|  PREDICTED: heat shock cognate 70 kDa protein...    133   2e-33   
ref|XP_004307259.1|  PREDICTED: probable mediator of RNA polymera...    132   3e-33   
ref|XP_008371627.1|  PREDICTED: heat shock cognate 70 kDa protein...    132   3e-33   
emb|CDY02231.1|  BnaA03g39360D                                          123   3e-33   
gb|ADZ46371.1|  HSP70                                                   132   3e-33   
gb|KDP44975.1|  hypothetical protein JCGZ_01475                         132   3e-33   
ref|XP_009357719.1|  PREDICTED: heat shock cognate 70 kDa protein...    132   4e-33   
ref|XP_004307527.1|  PREDICTED: heat shock cognate 70 kDa protein...    132   5e-33   
ref|XP_008223372.1|  PREDICTED: probable mediator of RNA polymera...    130   5e-33   
gb|AFK47438.1|  unknown                                                 122   5e-33   
ref|XP_009357717.1|  PREDICTED: heat shock cognate 70 kDa protein...    132   5e-33   
ref|XP_008370710.1|  PREDICTED: heat shock cognate 70 kDa protein 2     132   5e-33   
ref|XP_010253221.1|  PREDICTED: heat shock cognate 70 kDa protein...    132   6e-33   
ref|XP_004492118.1|  PREDICTED: heat shock cognate 70 kDa protein...    132   6e-33   
gb|AEO22185.1|  CytHSP70                                                130   6e-33   
ref|XP_004302715.1|  PREDICTED: probable mediator of RNA polymera...    131   7e-33   
ref|XP_006574857.1|  PREDICTED: heat shock cognate 70 kDa protein...    130   7e-33   
ref|XP_003552691.1|  PREDICTED: heat shock cognate 70 kDa protein...    131   7e-33   
ref|XP_010452091.1|  PREDICTED: probable mediator of RNA polymera...    128   7e-33   
gb|KHN13891.1|  Heat shock cognate 70 kDa protein 2                     131   8e-33   
gb|AHW48175.1|  heat shock protein 70                                   130   8e-33   
ref|XP_010918390.1|  PREDICTED: heat shock cognate 70 kDa protein...    131   8e-33   
gb|AAB97316.1|  cytosolic heat shock 70 protein                         131   9e-33   Spinacia oleracea
ref|XP_010937646.1|  PREDICTED: heat shock cognate 70 kDa protein...    131   9e-33   
ref|NP_001119156.1|  heat shock cognate protein 70-1                    130   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008223380.1|  PREDICTED: heat shock cognate 70 kDa protein...    131   1e-32   
ref|XP_009606077.1|  PREDICTED: heat shock cognate 70 kDa protein...    130   1e-32   
gb|KHN27222.1|  Heat shock cognate 70 kDa protein 2                     130   1e-32   
ref|XP_008784528.1|  PREDICTED: heat shock cognate 70 kDa protein...    130   1e-32   
ref|XP_010463615.1|  PREDICTED: probable mediator of RNA polymera...    130   1e-32   
ref|XP_008802761.1|  PREDICTED: heat shock cognate 70 kDa protein...    130   1e-32   
emb|CDY70331.1|  BnaAnng33370D                                          122   1e-32   
ref|XP_010553033.1|  PREDICTED: probable mediator of RNA polymera...    130   1e-32   
gb|ABD32895.1|  Heat shock protein Hsp70                                130   2e-32   Medicago truncatula
gb|AEP40944.1|  heat shock protein 70 family protein                    124   2e-32   
ref|XP_011027182.1|  PREDICTED: heat shock cognate 70 kDa protein...    130   2e-32   
ref|XP_010456365.1|  PREDICTED: probable mediator of RNA polymera...    132   2e-32   
emb|CAA54419.1|  heat shock cognate 70-1                                130   2e-32   Arabidopsis thaliana [mouse-ear cress]
gb|AAV98051.1|  heat shock protein 70                                   130   2e-32   Medicago sativa [alfalfa]
ref|XP_009784010.1|  PREDICTED: heat shock cognate 70 kDa protein...    122   2e-32   
ref|XP_003621886.1|  Heat shock protein                                 130   2e-32   
ref|XP_003552695.1|  PREDICTED: heat shock cognate 70 kDa protein...    130   2e-32   
dbj|BAD94875.1|  heat-shock protein                                     123   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873056.1|  HSC70-1                                            130   2e-32   
ref|XP_003563611.1|  PREDICTED: heat shock cognate 70 kDa protein...    130   2e-32   
dbj|BAJ86014.1|  predicted protein                                      130   2e-32   
ref|XP_006398709.1|  hypothetical protein EUTSA_v10012922mg             130   2e-32   
gb|KFK38330.1|  hypothetical protein AALP_AA3G100200                    130   2e-32   
ref|XP_010452093.1|  PREDICTED: probable mediator of RNA polymera...    130   3e-32   
gb|ACJ11740.1|  heat shock protein 70                                   130   3e-32   Gossypium hirsutum [American cotton]
ref|XP_006287234.1|  hypothetical protein CARUB_v10000420mg             130   3e-32   
ref|NP_195870.1|  heat shock cognate protein 70-1                       130   3e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CAA52684.1|  heat shock protein 70 cognate                          130   3e-32   Arabidopsis thaliana [mouse-ear cress]
gb|ABP01597.1|  heat shock protein 70                                   126   3e-32   Ageratina adenophora
ref|XP_011027580.1|  PREDICTED: heat shock cognate 70 kDa protein...    129   3e-32   
ref|XP_007144451.1|  hypothetical protein PHAVU_007G157200g             129   4e-32   
ref|XP_009778799.1|  PREDICTED: heat shock cognate 70 kDa protein...    129   4e-32   
ref|XP_007207204.1|  hypothetical protein PRUPE_ppa002646mg             129   4e-32   
ref|XP_006378714.1|  heat shock protein 70 cognate                      129   4e-32   
ref|XP_009414320.1|  PREDICTED: probable mediator of RNA polymera...    129   4e-32   
ref|XP_007009362.1|  Heat shock cognate protein 70-1                    129   4e-32   
ref|XP_002527736.1|  heat shock protein, putative                       129   4e-32   Ricinus communis
gb|AAP42157.1|AF509339_1  heat shock protein 70                         127   4e-32   Saussurea medusa
gb|EAY98319.1|  hypothetical protein OsI_20227                          127   5e-32   Oryza sativa Indica Group [Indian rice]
gb|ACJ85522.1|  unknown                                                 129   6e-32   Medicago truncatula
ref|XP_009123001.1|  PREDICTED: probable mediator of RNA polymera...    120   6e-32   
ref|XP_002311161.1|  heat shock protein 70                              129   6e-32   Populus trichocarpa [western balsam poplar]
ref|XP_007009369.1|  Heat shock protein 70                              129   7e-32   
ref|XP_002316294.1|  heat shock protein 70                              129   7e-32   Populus trichocarpa [western balsam poplar]
ref|XP_011027172.1|  PREDICTED: probable mediator of RNA polymera...    129   7e-32   
ref|XP_010534306.1|  PREDICTED: probable mediator of RNA polymera...    129   7e-32   
emb|CAA67588.1|  70 kD heatshockprotein                                 123   8e-32   Medicago sativa [alfalfa]
gb|KFK24738.1|  hypothetical protein AALP_AA8G018100                    128   8e-32   
gb|AGR45355.1|  HSP70                                                   128   9e-32   
ref|XP_007139240.1|  hypothetical protein PHAVU_008G013000g             128   9e-32   
ref|XP_010423853.1|  PREDICTED: probable mediator of RNA polymera...    128   9e-32   
ref|XP_002884912.1|  hypothetical protein ARALYDRAFT_897465             128   1e-31   
ref|XP_008802766.1|  PREDICTED: probable mediator of RNA polymera...    128   1e-31   
ref|XP_002446329.1|  hypothetical protein SORBIDRAFT_06g014400          127   1e-31   Sorghum bicolor [broomcorn]
ref|NP_001055754.1|  Os05g0460000                                       128   1e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010486515.1|  PREDICTED: heat shock 70 kDa protein 3-like        128   1e-31   
ref|XP_010922357.1|  PREDICTED: heat shock cognate 70 kDa protein 2     128   1e-31   
ref|XP_010555208.1|  PREDICTED: heat shock cognate 70 kDa protein...    128   1e-31   
ref|XP_006429028.1|  hypothetical protein CICLE_v10011260mg             128   1e-31   
ref|XP_004307529.1|  PREDICTED: heat shock cognate 70 kDa protein...    128   1e-31   
gb|AAS57913.1|  70 kDa heat shock cognate protein 2                     128   1e-31   Vigna radiata [mung bean]
ref|XP_006436017.1|  hypothetical protein CICLE_v10033622mg             128   1e-31   
ref|XP_004493886.1|  PREDICTED: probable mediator of RNA polymera...    128   1e-31   
ref|XP_003621869.1|  Heat shock protein                                 128   2e-31   
dbj|BAP90755.1|  heat shock protein 70                                  128   2e-31   
ref|XP_009353696.1|  PREDICTED: probable mediator of RNA polymera...    126   2e-31   
gb|AFS65092.1|  DnaK-type molecular chaperone hsp70                     120   2e-31   
gb|AEO13403.1|  heat shock 70                                           126   2e-31   
gb|ABP35942.1|  heat shock protein 70                                   127   2e-31   Cyclamen persicum
ref|XP_002884737.1|  heat shock cognate 70 kDa protein 3                127   2e-31   
ref|XP_003558228.1|  PREDICTED: heat shock cognate 70 kDa protein...    127   2e-31   
ref|XP_008812042.1|  PREDICTED: heat shock cognate 70 kDa protein...    127   2e-31   
ref|XP_009388623.1|  PREDICTED: heat shock cognate 70 kDa protein...    127   2e-31   
emb|CAA31663.1|  hsp70 (AA 6 - 651)                                     127   2e-31   Petunia x hybrida [garden petunia]
gb|KFK38606.1|  hypothetical protein AALP_AA3G135800                    125   2e-31   
ref|XP_006297174.1|  hypothetical protein CARUB_v10013178mg             127   2e-31   
sp|P09189.1|HSP7C_PETHY  RecName: Full=Heat shock cognate 70 kDa ...    127   2e-31   Petunia x hybrida [garden petunia]
dbj|BAA34919.1|  heat shock protein 70 cognate                          125   2e-31   Salix gilgiana
gb|AAM48131.1|AF509336_1  heat shock protein 70                         127   2e-31   Saussurea medusa
emb|CAA70111.1|  HSC70-G7 protein                                       118   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003521330.1|  PREDICTED: probable mediator of RNA polymera...    127   2e-31   
ref|XP_006644983.1|  PREDICTED: probable mediator of RNA polymera...    127   3e-31   
gb|AAV97978.1|  heat shock protein hsp70                                127   3e-31   Saussurea medusa
ref|XP_010558317.1|  PREDICTED: probable mediator of RNA polymera...    127   3e-31   
ref|XP_006407675.1|  hypothetical protein EUTSA_v10020258mg             126   3e-31   
ref|XP_010464591.1|  PREDICTED: heat shock 70 kDa protein 3             127   3e-31   
gb|ABX76301.1|  heat shock protein 70                                   127   3e-31   Ageratina adenophora
gb|ACJ11742.1|  heat shock protein 70                                   127   3e-31   Gossypium hirsutum [American cotton]
gb|AAN86274.1|  non-cell-autonomous heat shock cognate protein 70       127   4e-31   Cucurbita maxima [Boston marrow]
gb|ACJ11745.1|  heat shock protein 70                                   127   4e-31   Gossypium hirsutum [American cotton]
gb|EMS52605.1|  Heat shock cognate 70 kDa protein 1                     127   4e-31   
ref|XP_003539680.2|  PREDICTED: heat shock cognate 70 kDa protein 2     127   4e-31   
gb|EMS65159.1|  Heat shock cognate 70 kDa protein                       127   4e-31   
ref|XP_009353695.1|  PREDICTED: heat shock cognate 70 kDa protein...    126   4e-31   
ref|XP_002528432.1|  heat shock protein, putative                       126   4e-31   Ricinus communis
emb|CDY49668.1|  BnaC06g01970D                                          125   5e-31   
ref|XP_011027667.1|  PREDICTED: probable mediator of RNA polymera...    125   5e-31   
gb|AIA22210.1|  heat shock protein 70                                   126   6e-31   
ref|XP_006407676.1|  hypothetical protein EUTSA_v10020258mg             126   6e-31   
ref|XP_003625487.1|  Heat shock protein                                 127   6e-31   
gb|EYU19903.1|  hypothetical protein MIMGU_mgv1a002628mg                126   6e-31   
ref|XP_010558794.1|  PREDICTED: probable mediator of RNA polymera...    126   7e-31   
ref|XP_008458906.1|  PREDICTED: heat shock cognate 70 kDa protein...    126   8e-31   
gb|ACM42161.1|  heat shock protein 70.58                                125   8e-31   Ageratina adenophora
ref|XP_010231300.1|  PREDICTED: probable mediator of RNA polymera...    125   8e-31   
gb|KHN17505.1|  Heat shock 70 kDa protein                               124   8e-31   
ref|XP_006436010.1|  hypothetical protein CICLE_v10030928mg             125   9e-31   
gb|KHN21966.1|  Heat shock cognate 70 kDa protein                       125   9e-31   
ref|XP_003537997.1|  PREDICTED: heat shock cognate 70 kDa protein 2     125   9e-31   
ref|XP_007139236.1|  hypothetical protein PHAVU_008G012600g             125   9e-31   
dbj|BAJ34054.1|  unnamed protein product                                125   9e-31   
gb|AAP33015.1|  HSP70                                                   117   1e-30   Citrus x paradisi [grapefruit]
ref|XP_011028442.1|  PREDICTED: heat shock cognate 70 kDa protein...    125   1e-30   
gb|EMT11692.1|  Heat shock cognate 70 kDa protein                       125   1e-30   
ref|XP_010520113.1|  PREDICTED: heat shock cognate 70 kDa protein...    125   1e-30   
gb|AGL07711.1|  heat shock protein 70                                   125   1e-30   
ref|XP_011016414.1|  PREDICTED: heat shock cognate 70 kDa protein 2     125   1e-30   
ref|XP_002532297.1|  heat shock protein, putative                       125   1e-30   Ricinus communis
gb|KEH30132.1|  heat shock cognate 70 kDa protein                       124   1e-30   
ref|XP_002468097.1|  hypothetical protein SORBIDRAFT_01g039530          125   1e-30   Sorghum bicolor [broomcorn]
ref|XP_002312089.1|  heat shock protein 70 cognate                      125   1e-30   Populus trichocarpa [western balsam poplar]
ref|XP_004156719.1|  PREDICTED: heat shock cognate 70 kDa protein...    124   1e-30   
gb|KEH30131.1|  heat shock cognate 70 kDa protein                       125   1e-30   
ref|XP_002312090.1|  heat shock protein 70 cognate                      125   2e-30   Populus trichocarpa [western balsam poplar]
gb|KEH30133.1|  heat shock cognate 70 kDa protein                       125   2e-30   
ref|XP_004246402.1|  PREDICTED: heat shock cognate 70 kDa protein...    125   2e-30   
ref|XP_006341042.1|  PREDICTED: heat shock cognate 70 kDa protein...    125   2e-30   
ref|XP_006649850.1|  PREDICTED: probable mediator of RNA polymera...    125   2e-30   
ref|XP_007016460.1|  Heat shock cognate protein 70-1                    125   2e-30   
ref|XP_010473075.1|  PREDICTED: heat shock 70 kDa protein 3-like        125   2e-30   
ref|XP_010095013.1|  Heat shock 70 kDa protein 4                        124   2e-30   
gb|AAS57912.1|  70 kDa heat shock cognate protein 1                     124   2e-30   Vigna radiata [mung bean]
ref|XP_003578898.1|  PREDICTED: heat shock cognate 70 kDa protein 2     124   2e-30   
ref|XP_006486093.1|  PREDICTED: probable mediator of RNA polymera...    126   2e-30   
gb|EMT07406.1|  Heat shock cognate 70 kDa protein 1                     124   2e-30   
ref|XP_004505872.1|  PREDICTED: heat shock cognate 70 kDa protein...    124   2e-30   
sp|P26413.1|HSP70_SOYBN  RecName: Full=Heat shock 70 kDa protein        124   3e-30   Glycine max [soybeans]
ref|XP_003549537.1|  PREDICTED: heat shock 70 kDa protein-like is...    124   3e-30   
ref|XP_004493999.1|  PREDICTED: heat shock cognate 70 kDa protein...    124   3e-30   
gb|EMS68426.1|  Heat shock cognate 70 kDa protein 4                     124   3e-30   
gb|KDP35613.1|  hypothetical protein JCGZ_09051                         124   4e-30   
ref|XP_008447699.1|  PREDICTED: heat shock cognate 70 kDa protein 2     124   5e-30   
ref|XP_004142076.1|  PREDICTED: probable mediator of RNA polymera...    124   5e-30   
emb|CDP00073.1|  unnamed protein product                                123   5e-30   
tpg|DAA55190.1|  TPA: heat shock protein70-4                            122   5e-30   
ref|XP_007132076.1|  hypothetical protein PHAVU_011G065000g             124   5e-30   
gb|EMS51616.1|  Heat shock cognate 70 kDa protein 1                     124   6e-30   
gb|AEX55235.1|  heat shock protein 70                                   121   6e-30   
gb|AAN86275.1|  non-cell-autonomous heat shock cognate protein 70       123   6e-30   Cucurbita maxima [Boston marrow]
gb|EMS45385.1|  Heat shock cognate 70 kDa protein 1                     124   6e-30   
ref|NP_187555.1|  heat shock protein 70-3                               123   6e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004156718.1|  PREDICTED: heat shock cognate 70 kDa protein...    123   6e-30   
ref|XP_004142745.1|  PREDICTED: heat shock cognate 70 kDa protein...    123   6e-30   
emb|CAB72129.1|  heat shock protein 70                                  123   6e-30   Cucumis sativus [cucumbers]
emb|CAB72130.1|  heat shock protein 70                                  123   6e-30   Cucumis sativus [cucumbers]
gb|EAY89450.1|  hypothetical protein OsI_10982                          121   7e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_001759874.1|  predicted protein                                  123   7e-30   
ref|XP_011027180.1|  PREDICTED: heat shock cognate 70 kDa protein...    123   7e-30   
gb|EMT15100.1|  Heat shock cognate 70 kDa protein 1                     125   7e-30   
ref|XP_006378715.1|  hypothetical protein POPTR_0010s21280g             123   8e-30   
ref|XP_004250959.1|  PREDICTED: heat shock cognate 70 kDa protein       123   8e-30   
emb|CAA83548.1|  PsHSC71.0                                              123   8e-30   Pisum sativum [garden pea]
gb|AAA62445.1|  heat shock protein                                      123   1e-29   Spinacia oleracea
ref|XP_001767839.1|  predicted protein                                  122   1e-29   
gb|AAS09825.1|  heat shock cognate protein 70                           122   1e-29   Eutrema halophilum
dbj|BAJ91305.1|  predicted protein                                      122   1e-29   
ref|XP_008660826.1|  PREDICTED: probable mediator of RNA polymera...    122   1e-29   
emb|CDY52661.1|  BnaC01g38510D                                          122   1e-29   
ref|XP_008228833.1|  PREDICTED: heat shock 70 kDa protein               122   1e-29   
gb|ACR38891.1|  heat shock protein 70                                   122   1e-29   Apopellia endiviifolia (species B)
ref|XP_006833219.1|  hypothetical protein AMTR_s00072p00181720          122   1e-29   
ref|XP_001783063.1|  predicted protein                                  117   2e-29   
emb|CDP09035.1|  unnamed protein product                                122   2e-29   
ref|XP_008674324.1|  PREDICTED: probable mediator of RNA polymera...    122   2e-29   
gb|EMT00219.1|  Heat shock cognate 70 kDa protein 1                     114   2e-29   
ref|XP_010669896.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    123   2e-29   
ref|NP_001049712.1|  Os03g0276500                                       122   2e-29   
emb|CDP09040.1|  unnamed protein product                                122   3e-29   
tpg|DAA44672.1|  TPA: hsp70 protein                                     120   3e-29   
ref|XP_006664117.1|  PREDICTED: heat shock cognate 70 kDa protein...    121   3e-29   
ref|XP_009785159.1|  PREDICTED: heat shock cognate 70 kDa protein...    121   3e-29   
gb|ACB70177.1|  70 kDa heat shock protein                               121   3e-29   
gb|EAY89457.1|  hypothetical protein OsI_10990                          119   4e-29   
ref|NP_001049719.2|  Os03g0277300                                       119   4e-29   
gb|ACD45076.1|  heat-shock protein 70                                   121   4e-29   
gb|AAL85887.1|AF479058_1  70 kDa heat shock protein                     118   4e-29   
gb|ADD71975.1|  heat shock protein 70                                   121   4e-29   
ref|XP_004984743.1|  PREDICTED: heat shock cognate 70 kDa protein...    121   5e-29   
ref|XP_009622753.1|  PREDICTED: heat shock cognate 70 kDa protein...    121   5e-29   
ref|NP_001140835.1|  uncharacterized protein LOC100272911               120   5e-29   
ref|XP_009115390.1|  PREDICTED: probable mediator of RNA polymera...    120   6e-29   
ref|XP_007216991.1|  hypothetical protein PRUPE_ppa002591mg             120   6e-29   
gb|EMT06830.1|  Heat shock cognate 70 kDa protein                       120   6e-29   
ref|NP_001167696.1|  heat shock cognate 70 kDa protein 2                120   6e-29   
ref|XP_003564580.1|  PREDICTED: heat shock cognate 70 kDa protein       120   6e-29   
ref|XP_001785822.1|  predicted protein                                  120   8e-29   
ref|XP_007216987.1|  hypothetical protein PRUPE_ppa002598mg             120   8e-29   
ref|NP_001148198.1|  heat shock cognate 70 kDa protein 2                120   9e-29   
gb|KHG09207.1|  Heat shock 70 kDa 1 -like protein                       118   1e-28   
gb|EMT11425.1|  Heat shock cognate 70 kDa protein 1                     120   1e-28   
ref|XP_008658250.1|  PREDICTED: uncharacterized protein LOC100272...    120   1e-28   
emb|CAA55183.1|  heat shock protein 70 kDa                              115   1e-28   
ref|XP_002465468.1|  hypothetical protein SORBIDRAFT_01g039390          120   1e-28   
ref|XP_009786102.1|  PREDICTED: heat shock cognate 70 kDa protein 2     119   1e-28   
gb|ABF95267.1|  Heat shock cognate 70 kDa protein, putative, expr...    119   1e-28   
ref|XP_003554320.2|  PREDICTED: probable mediator of RNA polymera...    120   1e-28   
ref|XP_002456611.1|  hypothetical protein SORBIDRAFT_03g039360          119   1e-28   
gb|AFW88810.1|  hypothetical protein ZEAMMB73_832667                    120   1e-28   
gb|KHN02428.1|  Heat shock cognate 70 kDa protein                       119   1e-28   
gb|ACJ54890.1|  heat shock protein 70                                   119   2e-28   
ref|XP_001751923.1|  predicted protein                                  119   2e-28   
dbj|BAK00257.1|  predicted protein                                      119   2e-28   
gb|ABK25453.1|  unknown                                                 119   2e-28   
gb|AAX07349.1|  heat shock protein 70                                   117   2e-28   
ref|XP_010911697.1|  PREDICTED: probable mediator of RNA polymera...    114   2e-28   
ref|NP_001183165.1|  uncharacterized protein LOC100501536               119   2e-28   
emb|CAA55184.1|  heat shock protein 70 kDa                              114   2e-28   
gb|AFA51946.1|  heat shock protein 70                                   119   2e-28   
ref|XP_002512742.1|  heat shock protein, putative                       119   3e-28   
ref|XP_009597695.1|  PREDICTED: heat shock cognate 70 kDa protein 2     119   3e-28   
ref|NP_173055.1|  heat shock protein 70B                                119   3e-28   
gb|EEC71767.1|  hypothetical protein OsI_04375                          117   3e-28   
ref|XP_003558220.1|  PREDICTED: heat shock cognate 70 kDa protein...    119   3e-28   
ref|XP_004961848.1|  PREDICTED: probable mediator of RNA polymera...    119   3e-28   
ref|XP_008674843.1|  PREDICTED: heat shock 70 kDa protein-like          119   3e-28   
ref|XP_009120551.1|  PREDICTED: probable mediator of RNA polymera...    119   3e-28   
gb|AAA82974.1|  HSP70b                                                  112   3e-28   
ref|XP_007154870.1|  hypothetical protein PHAVU_003G154800g             118   4e-28   
ref|XP_008784530.1|  PREDICTED: heat shock cognate 70 kDa protein 2     118   4e-28   
ref|XP_009604213.1|  PREDICTED: heat shock cognate 70 kDa protein       118   4e-28   
gb|ABK55692.1|  heat shock protein 70 isoform-1                         110   4e-28   
gb|EMS50129.1|  Heat shock cognate 70 kDa protein 1                     119   4e-28   
gb|ACC93947.1|  heat-shock protein 70                                   118   4e-28   
ref|XP_009102555.1|  PREDICTED: probable mediator of RNA polymera...    118   4e-28   
gb|EPS60056.1|  heat shock protein 70                                   118   4e-28   
emb|CDY50531.1|  BnaA01g30490D                                          118   5e-28   
gb|AEK70336.1|  heat shock protein 70                                   118   5e-28   
ref|XP_001783048.1|  predicted protein                                  118   5e-28   
ref|XP_008776656.1|  PREDICTED: heat shock cognate 70 kDa protein...    118   6e-28   
ref|XP_004981251.1|  PREDICTED: heat shock cognate 70 kDa protein...    118   6e-28   
gb|EPS68565.1|  hypothetical protein M569_06198                         118   6e-28   
ref|XP_006368490.1|  heat shock protein 70 cognate                      117   7e-28   
ref|NP_001044757.1|  Os01g0840100                                       117   7e-28   
emb|CCJ09763.1|  putative heat shock protein-70kDa                      113   7e-28   
ref|XP_004962705.1|  PREDICTED: probable mediator of RNA polymera...    117   7e-28   
ref|XP_006649853.1|  PREDICTED: heat shock cognate 70 kDa protein...    117   8e-28   
emb|CAA27330.1|  heat shock protein 70                                  117   8e-28   
sp|P27322.1|HSP72_SOLLC  RecName: Full=Heat shock cognate 70 kDa ...    117   8e-28   
gb|KDO55354.1|  hypothetical protein CISIN_1g043296mg                   117   8e-28   
ref|XP_006427662.1|  hypothetical protein CICLE_v10025114mg             117   8e-28   
ref|XP_004249574.1|  PREDICTED: heat shock cognate 70 kDa protein 2     117   8e-28   
ref|NP_187864.1|  heat shock protein 70-4                               117   9e-28   
ref|XP_004970526.1|  PREDICTED: probable mediator of RNA polymera...    117   9e-28   
ref|XP_010423858.1|  PREDICTED: probable mediator of RNA polymera...    117   9e-28   
ref|XP_010486980.1|  PREDICTED: probable mediator of RNA polymera...    117   1e-27   
emb|CAA05547.1|  heat shock protein 70                                  117   1e-27   
emb|CCA29121.1|  heat shock protein 70 isoform 2                        117   1e-27   
ref|XP_010446275.1|  PREDICTED: probable mediator of RNA polymera...    117   1e-27   
ref|XP_003610287.1|  Heat-shock protein                                 117   1e-27   
ref|XP_009784009.1|  PREDICTED: heat shock cognate 70 kDa protein       117   1e-27   
sp|P11143.2|HSP70_MAIZE  RecName: Full=Heat shock 70 kDa protein        117   1e-27   
ref|XP_006349004.1|  PREDICTED: heat shock cognate 70 kDa protein...    117   1e-27   
prf||1205208A  heat shock protein hsp70                                 117   1e-27
ref|XP_002442353.1|  hypothetical protein SORBIDRAFT_08g018750          117   1e-27   
gb|EMT17408.1|  Heat shock cognate 70 kDa protein                       117   2e-27   
ref|XP_002441219.1|  hypothetical protein SORBIDRAFT_09g022580          117   2e-27   
sp|P29357.3|HSP7E_SPIOL  RecName: Full=Chloroplast envelope membr...    117   2e-27   
ref|XP_010937656.1|  PREDICTED: probable mediator of RNA polymera...    117   2e-27   
ref|XP_004492129.1|  PREDICTED: heat shock cognate 70 kDa protein...    115   2e-27   
ref|XP_010273662.1|  PREDICTED: heat shock 70 kDa protein               116   2e-27   
ref|XP_011034569.1|  PREDICTED: heat shock 70 kDa protein-like          116   2e-27   
gb|AFU34347.1|  70-kDa heat shock protein                               116   2e-27   
ref|XP_003595270.1|  Heat shock protein                                 118   2e-27   
gb|EYU33210.1|  hypothetical protein MIMGU_mgv1a002616mg                116   2e-27   
ref|XP_001421920.1|  Heat Shock Protein 70, cytosolic                   116   2e-27   
ref|WP_039310754.1|  molecular chaperone DnaK                           116   2e-27   
gb|KFK32679.1|  hypothetical protein AALP_AA6G274700                    116   2e-27   
ref|XP_010063598.1|  PREDICTED: heat shock 70 kDa protein               116   2e-27   
gb|KCW50227.1|  hypothetical protein EUGRSUZ_J00025                     116   3e-27   
gb|AAN86276.1|  cell-autonomous heat shock cognate protein 70           116   3e-27   
emb|CDX93666.1|  BnaA06g03820D                                          112   3e-27   
ref|XP_008233611.1|  PREDICTED: heat shock cognate 70 kDa protein 2     116   3e-27   
emb|CAA82915.1|  heat shock protein 70                                  108   3e-27   
gb|ACD93209.1|  heat shock protein 70                                   116   3e-27   
gb|KCW70839.1|  hypothetical protein EUGRSUZ_F03980                     116   3e-27   
ref|XP_004287145.1|  PREDICTED: heat shock 70 kDa protein-like          115   3e-27   
ref|XP_009414319.1|  PREDICTED: heat shock cognate 70 kDa protein...    115   3e-27   
ref|XP_010484430.1|  PREDICTED: probable mediator of RNA polymera...    115   3e-27   
ref|XP_010094065.1|  Heat shock 70 kDa protein                          115   4e-27   
ref|XP_010253827.1|  PREDICTED: heat shock cognate 70 kDa protein...    115   4e-27   
ref|XP_004492128.1|  PREDICTED: heat shock cognate 70 kDa protein...    115   5e-27   
gb|EMS65063.1|  Heat shock cognate 70 kDa protein                       115   5e-27   
gb|AII99890.1|  heat shock protein                                      116   5e-27   
ref|XP_009380663.1|  PREDICTED: heat shock cognate 70 kDa protein...    115   5e-27   
ref|XP_010465032.1|  PREDICTED: probable mediator of RNA polymera...    115   6e-27   
ref|XP_002263599.1|  PREDICTED: heat shock cognate 70 kDa protein 2     115   6e-27   
gb|AAB99745.1|  HSP70                                                   115   7e-27   
ref|XP_006297173.1|  hypothetical protein CARUB_v10013177mg             115   7e-27   
ref|XP_006427666.1|  hypothetical protein CICLE_v10025102mg             115   8e-27   
gb|ADN03965.1|  heat shock cognate 70 kDa protein                       114   8e-27   
gb|AIZ68155.1|  heat shock protein 70                                   114   9e-27   
ref|XP_007023492.1|  Heat shock protein 70B                             114   9e-27   
ref|XP_002283532.2|  PREDICTED: heat shock cognate 70 kDa protein 2     114   9e-27   
ref|XP_009135236.1|  PREDICTED: probable mediator of RNA polymera...    114   9e-27   
emb|CDX73815.1|  BnaA03g32320D                                          114   1e-26   
gb|ADB85350.1|  putative heat shock cognate                             114   1e-26   
gb|ABR13285.1|  putative dnaK-type molecular chaperone hsc70.1          108   1e-26   
ref|XP_010499184.1|  PREDICTED: probable mediator of RNA polymera...    114   1e-26   
emb|CDY00784.1|  BnaC03g37680D                                          114   1e-26   
ref|XP_003519161.1|  PREDICTED: heat shock 70 kDa protein-like          114   1e-26   
ref|XP_010495044.1|  PREDICTED: probable mediator of RNA polymera...    114   1e-26   
dbj|BAK02194.1|  predicted protein                                      114   1e-26   
ref|XP_006365705.1|  PREDICTED: heat shock cognate 70 kDa protein...    114   1e-26   
ref|XP_006349005.1|  PREDICTED: heat shock cognate 70 kDa protein...    114   2e-26   
ref|XP_006341414.1|  PREDICTED: heat shock cognate 70 kDa protein...    114   2e-26   
emb|CBI29517.3|  unnamed protein product                                109   2e-26   
gb|ABR18415.1|  unknown                                                 114   2e-26   
ref|XP_002976219.1|  hypothetical protein SELMODRAFT_443120             114   2e-26   
ref|XP_002987127.1|  hypothetical protein SELMODRAFT_446858             114   2e-26   
ref|XP_006407319.1|  hypothetical protein EUTSA_v10020257mg             114   2e-26   
ref|XP_011091460.1|  PREDICTED: heat shock cognate 70 kDa protein...    114   2e-26   
gb|KDO55360.1|  hypothetical protein CISIN_1g038511mg                   113   2e-26   
ref|XP_008812036.1|  PREDICTED: probable mediator of RNA polymera...    114   2e-26   
ref|XP_010106444.1|  Heat shock cognate 70 kDa protein                  113   2e-26   
gb|KHN14134.1|  Heat shock 70 kDa protein                               113   2e-26   
ref|XP_009615698.1|  PREDICTED: heat shock 70 kDa protein               113   2e-26   
ref|XP_002968525.1|  hypothetical protein SELMODRAFT_440382             113   2e-26   
ref|XP_006368489.1|  heat shock protein 70 cognate                      113   3e-26   
ref|XP_004507753.1|  PREDICTED: heat shock 70 kDa protein-like          113   3e-26   
ref|XP_007016452.1|  Heat shock cognate protein 70-1                    113   3e-26   
gb|AIU40169.1|  heat shock protein 70                                   113   3e-26   
ref|XP_002466193.1|  hypothetical protein SORBIDRAFT_01g003220          106   3e-26   
ref|XP_011034570.1|  PREDICTED: heat shock 70 kDa protein isoform X1    113   3e-26   
ref|XP_002512741.1|  heat shock protein, putative                       113   3e-26   
ref|XP_006493389.1|  PREDICTED: heat shock 70 kDa protein-like          112   5e-26   
emb|CAA44820.1|  heat shock protein 70                                  112   5e-26   
ref|XP_002284063.1|  PREDICTED: heat shock cognate 70 kDa protein 2     112   6e-26   
ref|XP_008776699.1|  PREDICTED: probable mediator of RNA polymera...    112   6e-26   
ref|XP_002805956.1|  PREDICTED: heat shock cognate 70 kDa protein...    108   6e-26   
ref|XP_009789460.1|  PREDICTED: heat shock 70 kDa protein               112   7e-26   
gb|EEC76425.1|  hypothetical protein OsI_14101                          110   7e-26   
ref|NP_001266213.1|  heat shock protein 70 isoform 3                    112   7e-26   
ref|XP_010319122.1|  PREDICTED: heat shock protein 70 isoform 3 i...    112   7e-26   
emb|CDO98244.1|  unnamed protein product                                112   8e-26   
gb|AGT97046.1|  heat shock protein 70                                   112   8e-26   
ref|XP_010030977.1|  PREDICTED: heat shock cognate 70 kDa protein 2     112   1e-25   
gb|KCW50226.1|  hypothetical protein EUGRSUZ_J00025                     112   1e-25   
gb|AFA36626.1|  putative heat shock cognate 70 kDa protein              103   1e-25   
emb|CEG00633.1|  Heat shock protein 70 family                           111   1e-25   
ref|XP_010459142.1|  PREDICTED: heat shock 70 kDa protein 5-like        111   1e-25   
gb|KCW50224.1|  hypothetical protein EUGRSUZ_J00023                     111   2e-25   
ref|XP_010030975.1|  PREDICTED: heat shock cognate 70 kDa protein...    111   2e-25   
ref|XP_008365320.1|  PREDICTED: heat shock 70 kDa protein               111   2e-25   
gb|KEH37493.1|  heat shock cognate 70 kDa protein                       108   2e-25   
ref|XP_006349514.1|  PREDICTED: heat shock cognate 70 kDa protein...    110   2e-25   
ref|XP_009358419.1|  PREDICTED: heat shock 70 kDa protein-like          110   2e-25   
ref|XP_006346613.1|  PREDICTED: heat shock 70 kDa protein-like          110   2e-25   
gb|KFK37144.1|  hypothetical protein AALP_AA4G218800                    110   2e-25   
gb|AAB42159.1|  Hsc70                                                   110   2e-25   
ref|NP_001051724.1|  Os03g0821100                                       110   3e-25   
ref|XP_008342822.1|  PREDICTED: heat shock 70 kDa protein-like          110   3e-25   
dbj|BAJ34597.1|  unnamed protein product                                110   3e-25   
gb|EYU19900.1|  hypothetical protein MIMGU_mgv1a002641mg                110   3e-25   
ref|XP_006416851.1|  hypothetical protein EUTSA_v10007031mg             110   3e-25   
ref|XP_002277050.1|  PREDICTED: heat shock 70 kDa protein               110   3e-25   
ref|XP_008352210.1|  PREDICTED: heat shock 70 kDa protein-like          107   3e-25   
ref|XP_008353757.1|  PREDICTED: heat shock 70 kDa protein isoform X1    110   3e-25   
ref|XP_002892893.1|  HSP70B                                             110   4e-25   
ref|XP_010318701.1|  PREDICTED: heat shock 70 kDa protein 5             110   4e-25   
gb|ABA95501.2|  Heat shock cognate 70 kDa protein, putative, expr...    109   4e-25   
ref|XP_002303859.2|  heat shock protein 70 cognate                      110   4e-25   
ref|XP_009354217.1|  PREDICTED: heat shock 70 kDa protein-like          110   5e-25   
ref|XP_010476705.1|  PREDICTED: heat shock 70 kDa protein 5             109   5e-25   
ref|XP_008384260.1|  PREDICTED: heat shock 70 kDa protein isoform X1    109   6e-25   
ref|XP_008342821.1|  PREDICTED: heat shock 70 kDa protein-like          109   7e-25   
gb|KHN04195.1|  Heat shock 70 kDa protein                               102   7e-25   
gb|KDP41952.1|  hypothetical protein JCGZ_26970                         109   8e-25   
ref|XP_007203774.1|  hypothetical protein PRUPE_ppa002595mg             109   8e-25   
ref|XP_011082530.1|  PREDICTED: heat shock 70 kDa protein-like          109   8e-25   
gb|ACH61090.1|  heat shock protein 70 kDa                               104   1e-24   
gb|ACH61066.1|  heat shock protein 70 kDa                               104   1e-24   
ref|XP_011073307.1|  PREDICTED: heat shock 70 kDa protein-like          108   1e-24   
ref|XP_009354216.1|  PREDICTED: heat shock 70 kDa protein-like          108   1e-24   
dbj|BAD02272.1|  heat shock protein 70                                  100   2e-24   
ref|XP_006306285.1|  hypothetical protein CARUB_v10012149mg             108   2e-24   
ref|XP_008656365.1|  PREDICTED: probable mediator of RNA polymera...    108   2e-24   
gb|AAA82975.1|  PsHSP71.2                                               108   2e-24   
ref|XP_009366205.1|  PREDICTED: heat shock 70 kDa protein               108   2e-24   
gb|KDO37859.1|  hypothetical protein CISIN_1g041209mg                   105   2e-24   
ref|XP_006826662.1|  hypothetical protein AMTR_s00137p00032560          107   3e-24   
ref|XP_004984739.1|  PREDICTED: probable mediator of RNA polymera...    107   3e-24   
ref|XP_008353759.1|  PREDICTED: heat shock 70 kDa protein isoform X3    107   3e-24   
ref|XP_009622824.1|  PREDICTED: heat shock 70 kDa protein-like          107   5e-24   
gb|KDO55357.1|  hypothetical protein CISIN_1g043979mg                   105   5e-24   
gb|ACT34017.1|  heat shock cognate 70 kDa protein                       107   5e-24   



>dbj|BAD02271.1| heat shock protein 70 [Nicotiana benthamiana]
Length=137

 Score =   135 bits (339),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 82/97 (85%), Gaps = 6/97 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKI  KL+A DKKKIEDA+++AI WLD NQLAEADEFEDKMKE+EGICNPII
Sbjct  42   NMRNTVKDEKISSKLSADDKKKIEDAIDQAISWLDSNQLAEADEFEDKMKELEGICNPII  101

Query  222  AKIYQ-QGGDA-MPMDDEEVPPASA---AGPKIEEVD  127
            AK+YQ  GGDA  PMDD + PPA A   AGPKIEEVD
Sbjct  102  AKMYQGAGGDAGAPMDD-DAPPAGASGGAGPKIEEVD  137



>ref|XP_010042813.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c, partial [Eucalyptus grandis]
Length=415

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 80/95 (84%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL AADKKKIEDA+EEAI WLDGNQLAEADEFEDKMKE+EGICNPII
Sbjct  321  NMRNTIKDEKISAKLPAADKKKIEDAIEEAIHWLDGNQLAEADEFEDKMKELEGICNPII  380

Query  222  AKIYQQGGDAMPMD-DEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G  M    DE+VPPA  S AGPKIEEVD
Sbjct  381  AKMYQGAGPDMGGGMDEDVPPAGGSGAGPKIEEVD  415



>dbj|BAD02273.1| heat shock protein 70 [Nicotiana benthamiana]
Length=108

 Score =   132 bits (332),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 81/96 (84%), Gaps = 5/96 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKIG KL+  DKKKIEDA+++AI WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  14   NMRNTIKDEKIGSKLSPDDKKKIEDAIDQAISWLDSNQLAEADEFEDKMKELESICNPII  73

Query  222  AKIYQQ-GGDA-MPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  GG+A  PMDD + PPA  S AGPKIEEVD
Sbjct  74   AKMYQSAGGEAGAPMDD-DAPPAGGSGAGPKIEEVD  108



>gb|KDO36486.1| hypothetical protein CISIN_1g020168mg [Citrus sinensis]
Length=330

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 80/96 (83%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL  ADKKKIEDA+EEAI+WLDGNQLAEADEFEDKMKE+EGICNPII
Sbjct  235  NMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELEGICNPII  294

Query  222  AKIYQQGG-DAMPMDDEEVPPA---SAAGPKIEEVD  127
            AK+YQ GG DA    DE+ P A   S AGPKIEEVD
Sbjct  295  AKMYQGGGADAGASMDEDGPSAGAGSGAGPKIEEVD  330



>gb|ABX26256.1| heat shock protein 70-like protein [Panax quinquefolius]
Length=125

 Score =   132 bits (333),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 79/95 (83%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKI  KL AADKKK+EDA+E+ I+WL+ NQLAEADEFEDKMKE+E ICNPII
Sbjct  31   NMRNTVKDEKIASKLPAADKKKVEDAIEDTIQWLESNQLAEADEFEDKMKELESICNPII  90

Query  222  AKIYQQGG--DAMPMDDEEVP-PASAAGPKIEEVD  127
            AK+YQ  G    +PMDD+E+P   S AGPK+EEVD
Sbjct  91   AKMYQGAGGEGGVPMDDDEIPVGGSGAGPKLEEVD  125



>ref|XP_011094842.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Sesamum indicum]
Length=646

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 78/93 (84%), Gaps = 1/93 (1%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKI  KL AADKKKIEDA+E +I+WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTVKDEKIASKLPAADKKKIEDAIESSIQWLDGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMDDEE-VPPASAAGPKIEEVD  127
            AK+YQ  G  +PMDD+   P  S AGPKIEEVD
Sbjct  614  AKMYQGAGGDVPMDDDAPAPSGSGAGPKIEEVD  646



>gb|KHG00348.1| Heat shock 70 kDa 4 -like protein [Gossypium arboreum]
Length=570

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 82/97 (85%), Gaps = 5/97 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL AADKKKIEDA+E+AI+WLDGNQLAEADEFEDKMKE+EGICNPII
Sbjct  474  NMRNTIKDEKISSKLPAADKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKELEGICNPII  533

Query  222  AKIYQ-QGGD--AMPMDDE--EVPPASAAGPKIEEVD  127
            AK+YQ  GGD  A PMDD+   V   S AGPKIEEVD
Sbjct  534  AKMYQGAGGDMGAGPMDDDGPSVGGGSGAGPKIEEVD  570



>ref|XP_009592776.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 84/96 (88%), Gaps = 5/96 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KL+  DKKKIEDA+++AI WLD NQLAEADEFEDKMKE+EGICNPII
Sbjct  554  NMRNTVKDEKIGSKLSVDDKKKIEDAIDQAISWLDSNQLAEADEFEDKMKELEGICNPII  613

Query  222  AKIYQ-QGGDA-MPMDDEEVPP--ASAAGPKIEEVD  127
            AK+YQ  GGDA  PMDD +VPP  AS+AGPKIEEVD
Sbjct  614  AKMYQGAGGDAGAPMDD-DVPPAGASSAGPKIEEVD  648



>gb|ABG22609.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=544

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL AADKKKIEDA+++AI+WLDGNQLAEADEF+DKMKE+EGICNPII
Sbjct  449  NMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKELEGICNPII  508

Query  222  AKIYQQGGDAMP--MDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G  M   MD+++ PPA  S AGPKIEEVD
Sbjct  509  AKMYQGAGADMAGGMDEDDAPPAGGSGAGPKIEEVD  544



>gb|AFG26330.1| heat shock protein 70, partial [Eriobotrya japonica]
Length=118

 Score =   131 bits (330),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 80/97 (82%), Gaps = 5/97 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL AADKKKIED ++EAI+WLDGNQLAEADEFEDKMKE+EGICNPII
Sbjct  22   NMRNTIKDDKIASKLDAADKKKIEDTIDEAIQWLDGNQLAEADEFEDKMKELEGICNPII  81

Query  222  AKIYQQGGDAMPMD---DEEVPPA--SAAGPKIEEVD  127
            AK+YQ G     +    DE+VPPA  S AGPKIEEVD
Sbjct  82   AKMYQGGAGGPDVGGGMDEDVPPAGGSGAGPKIEEVD  118



>ref|XP_009136338.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brassica rapa]
Length=96

 Score =   130 bits (328),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 79/96 (82%), Gaps = 5/96 (5%)
 Frame = -2

Query  399  MRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPIIA  220
            MRNTI+DEKIG KL AADKKKIED+VEEAI+WLDGNQ AEADEFEDKMKE++ +CNPIIA
Sbjct  1    MRNTIRDEKIGEKLPAADKKKIEDSVEEAIQWLDGNQTAEADEFEDKMKELKSVCNPIIA  60

Query  219  KIYQ----QGGDAMPMDDEEVPP-ASAAGPKIEEVD  127
            K+YQ    + G    MDD+E PP A  AGPKIEEVD
Sbjct  61   KMYQGAGGEAGGPSGMDDDEAPPFAGGAGPKIEEVD  96



>gb|ABG22608.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=602

 Score =   139 bits (351),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL AADKKKIEDA+++AI+WLDGNQLAEADEF+DKMKE+EGICNPII
Sbjct  507  NMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKELEGICNPII  566

Query  222  AKIYQQGGDAMP--MDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G  M   MD+++ PPA  S AGPKIEEVD
Sbjct  567  AKMYQGAGADMAGGMDEDDAPPAGGSGAGPKIEEVD  602



>gb|EAY81899.1| hypothetical protein OsI_37065 [Oryza sativa Indica Group]
Length=434

 Score =   138 bits (348),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL AADKKKIEDA+++AI+WLDGNQLAEADEF+DKMKE+EGICNPII
Sbjct  339  NMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKELEGICNPII  398

Query  222  AKIYQQGGDAMP--MDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G  M   MD+++ PPA  S AGPKIEEVD
Sbjct  399  AKMYQGAGADMAGGMDEDDAPPAGGSGAGPKIEEVD  434



>gb|AFK37867.1| unknown [Lotus japonicus]
Length=126

 Score =   131 bits (329),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 76/96 (79%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKIGGKL  ADKKKIEDA+E+AI+WLD NQLAEADEFEDKMKE+E I NPII
Sbjct  31   NMRNTIKDEKIGGKLDPADKKKIEDAIEQAIQWLDSNQLAEADEFEDKMKELESIYNPII  90

Query  222  AKIYQQGG----DAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ  G       PMDD+     S AGPKIEEVD
Sbjct  91   AKMYQGAGGPDMGGAPMDDDTPAGGSGAGPKIEEVD  126



>ref|XP_011077460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=646

 Score =   139 bits (351),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 77/93 (83%), Gaps = 1/93 (1%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL AADKKKIEDA+E +I+WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDEKIASKLPAADKKKIEDAIESSIQWLDGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMDDE-EVPPASAAGPKIEEVD  127
            AK+YQ  G   PMDD+   P AS  GPKIEEVD
Sbjct  614  AKMYQGAGGEAPMDDDGPAPGASGPGPKIEEVD  646



>emb|CAA70105.1| Hsc70-G8 protein [Arabidopsis thaliana]
Length=104

 Score =   130 bits (326),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 81/100 (81%), Gaps = 8/100 (8%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL AADKKK+ED++EEAI+WLDGNQL EADEFEDKMKE+E +CNPII
Sbjct  5    NMRNTIRDEKIGEKLPAADKKKVEDSIEEAIQWLDGNQLGEADEFEDKMKELESVCNPII  64

Query  222  AKIYQ-------QGGDAMPMDDEEVPPAS-AAGPKIEEVD  127
            AK+YQ        G  A  MD++E PPAS  AGPKIEEVD
Sbjct  65   AKMYQGGAGGEAGGPGASGMDEDEAPPASGGAGPKIEEVD  104



>gb|EAZ19310.1| hypothetical protein OsJ_34853 [Oryza sativa Japonica Group]
Length=632

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL AADKKKIEDA+++AI+WLDGNQLAEADEF+DKMKE+EGICNPII
Sbjct  537  NMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKELEGICNPII  596

Query  222  AKIYQQGGDAMP--MDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G  M   MD+++ PPA  S AGPKIEEVD
Sbjct  597  AKMYQGAGADMAGGMDEDDAPPAGGSGAGPKIEEVD  632



>ref|NP_001068540.1| Os11g0703900 [Oryza sativa Japonica Group]
 gb|AAX95352.1| dnaK-type molecular chaperone hsp70 - rice (fragment) [Oryza 
sativa Japonica Group]
 gb|ABA95500.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF28903.1| Os11g0703900 [Oryza sativa Japonica Group]
Length=649

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL AADKKKIEDA+++AI+WLDGNQLAEADEF+DKMKE+EGICNPII
Sbjct  554  NMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKELEGICNPII  613

Query  222  AKIYQQGGDAMP--MDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G  M   MD+++ PPA  S AGPKIEEVD
Sbjct  614  AKMYQGAGADMAGGMDEDDAPPAGGSGAGPKIEEVD  649



>ref|XP_006663128.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Oryza brachyantha]
Length=649

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL AADKKKIEDA+++AI+WLDGNQLAEADEF+DKMKE+EGICNPII
Sbjct  554  NMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKELEGICNPII  613

Query  222  AKIYQQGGDAMP--MDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G  M   MD+++ PPA  S AGPKIEEVD
Sbjct  614  AKMYQGAGADMAGGMDEDDAPPAGGSGAGPKIEEVD  649



>ref|XP_006424799.1| hypothetical protein CICLE_v10027981mg [Citrus clementina]
 gb|ESR38039.1| hypothetical protein CICLE_v10027981mg [Citrus clementina]
Length=649

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 80/96 (83%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL  ADKKKIEDA+EEAI+WLDGNQLAEADEFEDKMKE+EGICNPII
Sbjct  554  NMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELEGICNPII  613

Query  222  AKIYQQGG-DAMPMDDEEVPPA---SAAGPKIEEVD  127
            AK+YQ GG DA    DE+ P A   S AGPKIEEVD
Sbjct  614  AKMYQGGGADAGASMDEDGPSAGAGSGAGPKIEEVD  649



>emb|CAA47948.2| heat shock protein 70 [Oryza sativa Indica Group]
Length=648

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL AADKKKIEDA+++AI+WLDGNQLAEADEF+DKMKE+EGICNPII
Sbjct  553  NMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKELEGICNPII  612

Query  222  AKIYQQGGDAMP--MDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G  M   MD+++ PPA  S AGPKIEEVD
Sbjct  613  AKMYQGAGADMAGGMDEDDAPPAGGSGAGPKIEEVD  648



>gb|EYU26579.1| hypothetical protein MIMGU_mgv1a002667mg [Erythranthe guttata]
Length=648

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 78/95 (82%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL AADKKKIEDA+E +I+WLD NQLAE+DEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDEKIASKLPAADKKKIEDAIEASIQWLDANQLAESDEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMDDEEVPPA---SAAGPKIEEVD  127
            AK+YQ  G   PMDD+E  P+   S AGPKIEEVD
Sbjct  614  AKMYQGAGGEAPMDDDEAAPSHGGSTAGPKIEEVD  648



>ref|XP_006488297.1| PREDICTED: heat shock cognate 70 kDa protein-like [Citrus sinensis]
Length=649

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 80/96 (83%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL  ADKKKIEDA+EEAI+WLDGNQLAEADEFEDKMKE+EGICNPII
Sbjct  554  NMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELEGICNPII  613

Query  222  AKIYQQGG-DAMPMDDEEVPPA---SAAGPKIEEVD  127
            AK+YQ GG DA    DE+ P A   S AGPKIEEVD
Sbjct  614  AKMYQGGGADAGASMDEDGPSAGAGSGAGPKIEEVD  649



>gb|ACU17965.1| unknown [Glycine max]
Length=233

 Score =   132 bits (333),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 80/98 (82%), Gaps = 9/98 (9%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKIGGKL  ADKKKIEDA+E+AI+WLD NQL EADEFEDKMKE+E ICNPII
Sbjct  139  NMRNTIKDEKIGGKLDPADKKKIEDAIEQAIQWLDSNQLGEADEFEDKMKELESICNPII  198

Query  222  AKIYQQG-----GDAMPMDDEEVPPA-SAAGPKIEEVD  127
            AK+YQ G     G AM   D++VP A S AGPKIEEVD
Sbjct  199  AKMYQGGAGPDVGGAM---DDDVPAAGSGAGPKIEEVD  233



>ref|XP_009338761.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Pyrus x bretschneideri]
Length=656

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 81/95 (85%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKIG KL  ADKKKIED++E AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  562  NMRNTIKDEKIGAKLPPADKKKIEDSIETAIQWLDSNQLAEADEFEDKMKELESICNPII  621

Query  222  AKIYQ-QGGD-AMPMDDEEVPP-ASAAGPKIEEVD  127
            AK+YQ  GGD A P+DD++ PP AS  GPKIEEVD
Sbjct  622  AKMYQGAGGDGAGPVDDDDAPPSASGPGPKIEEVD  656



>ref|XP_009112006.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Brassica rapa]
Length=517

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 82/94 (87%), Gaps = 2/94 (2%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+D+KIG KL AADKKKIED++E+AI+WL+ NQL EADEFEDKMKE+E ICNPII
Sbjct  424  NMRNTIQDDKIGEKLPAADKKKIEDSIEQAIQWLENNQLGEADEFEDKMKELESICNPII  483

Query  222  AKIYQ-QGGDAMPMDDEEVPPAS-AAGPKIEEVD  127
            AK+YQ  GG+A  MDD++ PPAS  AGPKIEEVD
Sbjct  484  AKMYQGAGGEAAGMDDDDAPPASGGAGPKIEEVD  517



>ref|XP_009374678.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Pyrus x bretschneideri]
Length=647

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 79/94 (84%), Gaps = 2/94 (2%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKIG KL  ADKKKIED++E AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDEKIGAKLPPADKKKIEDSIETAIQWLDSNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQ-QGGD-AMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ  GGD A P+DD+  P AS  GPKIEEVD
Sbjct  614  AKMYQGAGGDGAGPVDDDAPPSASGPGPKIEEVD  647



>ref|XP_006408646.1| hypothetical protein EUTSA_v10002169mg [Eutrema salsugineum]
 gb|ESQ50099.1| hypothetical protein EUTSA_v10002169mg [Eutrema salsugineum]
Length=562

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 78/93 (84%), Gaps = 1/93 (1%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+D KIGGKL+ A KKKIED++EEAI+WLDGNQLAEADEFEDKMK +E +CNPII
Sbjct  470  NMRNTIRDHKIGGKLSGAQKKKIEDSIEEAIQWLDGNQLAEADEFEDKMKALESVCNPII  529

Query  222  AKIYQQ-GGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ+ GG+A   DDE  P +  AGP IEEVD
Sbjct  530  AKMYQRAGGEAGGPDDEAPPSSGGAGPNIEEVD  562



>ref|XP_002284008.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
 emb|CAN81694.1| hypothetical protein VITISV_017873 [Vitis vinifera]
Length=648

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 81/96 (84%), Gaps = 5/96 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKIG KL  ADKKKIEDA+++AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDEKIGAKLTPADKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAM--PMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G  M  PM+D +VPPA  S AGPKIEEVD
Sbjct  614  AKMYQGAGPDMGGPMED-DVPPASGSGAGPKIEEVD  648



>gb|AAB65162.1| heat shock cognate protein [Solanum commersonii]
Length=339

 Score =   134 bits (338),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 81/96 (84%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL A DKKKIEDA+++AI WLD NQLAEADEFEDKMKE+E +CNPII
Sbjct  244  NMRNTIKDDKISSKLGAEDKKKIEDAIDQAISWLDSNQLAEADEFEDKMKELESLCNPII  303

Query  222  AKIYQ-QGGDA-MPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  GG+A  PMDD++ PPA  + AGPKIEEVD
Sbjct  304  AKMYQGAGGEAGAPMDDDDAPPAGSTGAGPKIEEVD  339



>ref|XP_006290203.1| hypothetical protein CARUB_v10003889mg [Capsella rubella]
 gb|EOA23101.1| hypothetical protein CARUB_v10003889mg [Capsella rubella]
Length=650

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 83/96 (86%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL AA+KKKIED++EEAI+WLDGNQLAEADEFEDKMKE+EG+CNPII
Sbjct  555  NMRNTIRDEKIGEKLPAAEKKKIEDSIEEAIQWLDGNQLAEADEFEDKMKELEGLCNPII  614

Query  222  AKIYQ---QGGDAMPMDDEEVPPAS-AAGPKIEEVD  127
            AK+YQ    G  A  MD++E PPAS  AGPKIEEVD
Sbjct  615  AKMYQGGAGGPGAAAMDEDEAPPASGGAGPKIEEVD  650



>ref|XP_004142750.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 2 [Cucumis 
sativus]
 ref|XP_004156713.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 2 [Cucumis 
sativus]
Length=613

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 81/96 (84%), Gaps = 5/96 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIGGKLA ADKKKIEDAVE+AI+WLD NQLAE+DEFEDKMKE+E ICNPII
Sbjct  519  NMRNTIRDEKIGGKLAPADKKKIEDAVEQAIQWLDSNQLAESDEFEDKMKELESICNPII  578

Query  222  AKIYQQGGD--AMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ G D     M+D + PP+  S AGPKIEEVD
Sbjct  579  AKMYQGGADMGGAAMND-DAPPSGGSGAGPKIEEVD  613



>ref|XP_004142749.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
 ref|XP_004156712.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
 gb|KGN51294.1| hypothetical protein Csa_5G514500 [Cucumis sativus]
Length=648

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 81/96 (84%), Gaps = 5/96 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIGGKLA ADKKKIEDAVE+AI+WLD NQLAE+DEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIRDEKIGGKLAPADKKKIEDAVEQAIQWLDSNQLAESDEFEDKMKELESICNPII  613

Query  222  AKIYQQGGD--AMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ G D     M+D + PP+  S AGPKIEEVD
Sbjct  614  AKMYQGGADMGGAAMND-DAPPSGGSGAGPKIEEVD  648



>ref|NP_001234491.1| heat shock cognate 70 kDa protein 1 [Solanum lycopersicum]
 sp|P24629.1|HSP71_SOLLC RecName: Full=Heat shock cognate 70 kDa protein 1 [Solanum lycopersicum]
 emb|CAA37970.1| heat shock protein cognate 70 [Solanum lycopersicum]
Length=650

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 84/96 (88%), Gaps = 5/96 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KL++ DKKKIEDAV++AI WL+ NQLAE DEFEDKMKE+EGICNPII
Sbjct  556  NMRNTVKDEKIGSKLSSDDKKKIEDAVDQAISWLESNQLAEVDEFEDKMKELEGICNPII  615

Query  222  AKIYQ-QGGDA-MPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  GGDA +PMDD + PP+  S+AGPKIEEVD
Sbjct  616  AKMYQGAGGDAGVPMDD-DAPPSGGSSAGPKIEEVD  650



>gb|ABK94007.1| unknown [Populus trichocarpa]
Length=125

 Score =   128 bits (321),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 79/96 (82%), Gaps = 5/96 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKI  KLAA DKKKIEDA+++AI+WLD NQLAEADEF+DKMKE+E ICNPII
Sbjct  31   NMRNTVKDEKISSKLAADDKKKIEDAIDQAIQWLDSNQLAEADEFDDKMKELESICNPII  90

Query  222  AKIYQQGGDAM--PMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G  M   MDD + PP+  S AGPKIEEVD
Sbjct  91   AKMYQGAGPDMGGGMDD-DAPPSGGSGAGPKIEEVD  125



>ref|XP_006350760.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Solanum 
tuberosum]
Length=648

 Score =   136 bits (343),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 84/96 (88%), Gaps = 5/96 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KL++ DKKKIEDAV++AI WL+ NQLAE DEFEDKMKE+EGICNPII
Sbjct  554  NMRNTVKDEKIGSKLSSDDKKKIEDAVDQAISWLESNQLAEVDEFEDKMKELEGICNPII  613

Query  222  AKIYQ-QGGDA-MPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  GGDA +PMDD + PP+  S+AGPKIEEVD
Sbjct  614  AKMYQGAGGDAGVPMDD-DAPPSGGSSAGPKIEEVD  648



>emb|CCA29120.1| heat shock protein 70 isoform 1 [Solanum lycopersicum]
Length=648

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 84/96 (88%), Gaps = 5/96 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KL++ DKKKIEDAV++AI WL+ NQLAE DEFEDKMKE+EGICNPII
Sbjct  554  NMRNTVKDEKIGSKLSSDDKKKIEDAVDQAISWLESNQLAEVDEFEDKMKELEGICNPII  613

Query  222  AKIYQ-QGGDA-MPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  GGDA +PMDD + PP+  S+AGPKIEEVD
Sbjct  614  AKMYQGAGGDAGVPMDD-DAPPSGGSSAGPKIEEVD  648



>gb|AAB88009.1| heat shock cognate protein HSC70 [Brassica napus]
Length=645

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 79/93 (85%), Gaps = 1/93 (1%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL AADKKKIEDA+E+AI+WL+ NQL EADEFEDKMKE+E ICNPII
Sbjct  553  NMRNTIQDEKIGEKLPAADKKKIEDAIEQAIQWLENNQLGEADEFEDKMKELESICNPII  612

Query  222  AKIYQ-QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ  GG+A  MDD+  P +  AGPKIEEVD
Sbjct  613  AKMYQGAGGEAAGMDDDAPPASGGAGPKIEEVD  645



>gb|AIU34470.1| putative heat shock protein, partial [Taraxacum brevicorniculatum]
Length=646

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 77/93 (83%), Gaps = 1/93 (1%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KL  ADKKKIEDA++EAI WLD NQLAEADEFEDKMKE+E +CNPII
Sbjct  554  NMRNTVKDEKIGEKLTPADKKKIEDAIDEAIAWLDTNQLAEADEFEDKMKELENVCNPII  613

Query  222  AKIYQQG-GDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ G G+A  MD+E  P    AGPKIEEVD
Sbjct  614  AKMYQGGAGEAAGMDEEPAPSGGGAGPKIEEVD  646



>gb|AAS57914.1| 70 kDa heat shock cognate protein 3 [Vigna radiata]
Length=650

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 79/98 (81%), Gaps = 6/98 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KD+KIGGKL  ADKKKIEDA+E+AI+WLD NQLAEADEFEDKMKE+E +CNPII
Sbjct  553  NMRNTVKDDKIGGKLDPADKKKIEDAIEQAIQWLDSNQLAEADEFEDKMKELESVCNPII  612

Query  222  AKIYQQG-----GDAMPMDDEEVPP-ASAAGPKIEEVD  127
            AK+YQ G     G A P DDE  P   S AGPKIEEVD
Sbjct  613  AKMYQGGAGPDMGGAPPADDEYTPSGGSGAGPKIEEVD  650



>ref|XP_006348998.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 82/96 (85%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL+A DKKKIEDA+++AI WLD NQLAEADEFEDKMKE+E +CNPII
Sbjct  554  NMRNTIKDDKISSKLSAEDKKKIEDAIDQAISWLDSNQLAEADEFEDKMKELESLCNPII  613

Query  222  AKIYQ-QGGDA-MPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  GG+A  PMDD++ PPA  + AGPKIEEVD
Sbjct  614  AKMYQGAGGEAGAPMDDDDAPPAGSTGAGPKIEEVD  649



>gb|AAR17080.1| heat shock protein 70-3 [Nicotiana tabacum]
Length=648

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 83/96 (86%), Gaps = 5/96 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKIG KL++ DKKKIEDA+++AI WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDEKIGSKLSSDDKKKIEDAIDQAISWLDSNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQ-QGGDA-MPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  GG+A  PMDD + PPA  S+AGPKIEEVD
Sbjct  614  AKMYQGAGGEAGAPMDD-DAPPAGGSSAGPKIEEVD  648



>gb|AAP04522.1| heat shock protein 70 [Nicotiana tabacum]
Length=648

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 83/96 (86%), Gaps = 5/96 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKIG KL++ DKKKIEDA+++AI WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDEKIGSKLSSDDKKKIEDAIDQAISWLDSNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQ-QGGDA-MPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  GG+A  PMDD + PPA  S+AGPKIEEVD
Sbjct  614  AKMYQGAGGEAGAPMDD-DAPPAGGSSAGPKIEEVD  648



>ref|XP_004250958.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 82/96 (85%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL+A DKKKIEDA+++AI WLD NQLAEADEFEDKMKE+E +CNPII
Sbjct  554  NMRNTIKDDKISSKLSADDKKKIEDAIDQAISWLDSNQLAEADEFEDKMKELESLCNPII  613

Query  222  AKIYQ-QGGDA-MPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  GG+A  PMDD++ PPA  + AGPKIEEVD
Sbjct  614  AKMYQGAGGEAGAPMDDDDAPPAGSTGAGPKIEEVD  649



>ref|XP_006392363.1| hypothetical protein EUTSA_v10023343mg [Eutrema salsugineum]
 gb|ESQ29649.1| hypothetical protein EUTSA_v10023343mg [Eutrema salsugineum]
Length=633

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 82/98 (84%), Gaps = 6/98 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL AADKKKIED++EE I+WLDGNQLAEADEFEDKMKE+E +CNPII
Sbjct  536  NMRNTIRDEKIGEKLPAADKKKIEDSIEEVIQWLDGNQLAEADEFEDKMKELESVCNPII  595

Query  222  AKIYQ-----QGGDAMPMDDEEVPPAS-AAGPKIEEVD  127
            AK+YQ      GG A  MDD+E PP+S  AGPKIEEVD
Sbjct  596  AKMYQGAGGEPGGPAAGMDDDEAPPSSGGAGPKIEEVD  633



>ref|XP_009419750.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 81/96 (84%), Gaps = 5/96 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KLAAAD+KKIEDA+E+AI+WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDDKIASKLAAADRKKIEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMP--MDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G  M   MDD +VP A  S AGPKIEEVD
Sbjct  614  AKMYQGAGADMAGEMDD-DVPAAGGSGAGPKIEEVD  648



>ref|XP_007162654.1| hypothetical protein PHAVU_001G169000g [Phaseolus vulgaris]
 gb|ESW34648.1| hypothetical protein PHAVU_001G169000g [Phaseolus vulgaris]
Length=651

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 78/98 (80%), Gaps = 6/98 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIGGKL  ADKKKIEDA+E++I+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTVKDEKIGGKLDPADKKKIEDAIEQSIQWLDSNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQG-----GDAMPMDDEEVPP-ASAAGPKIEEVD  127
            AK+YQ G     G A P D E  P   S AGPKIEEVD
Sbjct  614  AKMYQGGAGPDMGGAPPADTEYTPSGGSGAGPKIEEVD  651



>ref|XP_008458892.1| PREDICTED: heat shock cognate 70 kDa protein [Cucumis melo]
Length=648

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 81/96 (84%), Gaps = 5/96 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKI GKLA ADKKKIEDAVE+AI+WLD NQLAE+DEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIRDEKISGKLAPADKKKIEDAVEQAIQWLDSNQLAESDEFEDKMKELESICNPII  613

Query  222  AKIYQQGGD--AMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ G D  +  M+D + PP+  S AGPKIEEVD
Sbjct  614  AKMYQGGADMGSAAMND-DAPPSGGSGAGPKIEEVD  648



>gb|AGZ15406.1| heat shock cognate 70 kDa protein [Phaseolus vulgaris]
Length=651

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 78/98 (80%), Gaps = 6/98 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIGGKL  ADKKKIEDA+E++I+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTVKDEKIGGKLDPADKKKIEDAIEQSIQWLDSNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQG-----GDAMPMDDEEVPP-ASAAGPKIEEVD  127
            AK+YQ G     G A P D E  P   S AGPKIEEVD
Sbjct  614  AKMYQGGAGPDMGGAPPADTEYTPSGGSGAGPKIEEVD  651



>gb|KDP44981.1| hypothetical protein JCGZ_01481 [Jatropha curcas]
Length=648

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 79/95 (83%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KLA  DKKKIEDA+++AI+WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDEKISSKLATDDKKKIEDAIDQAIQWLDGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQ-QGGDAMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G D     D++VPPA  S AGPKIEEVD
Sbjct  614  AKMYQGAGADVGGSMDDDVPPAGGSGAGPKIEEVD  648



>gb|KFK33437.1| hypothetical protein AALP_AA5G013700 [Arabis alpina]
Length=672

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 81/93 (87%), Gaps = 2/93 (2%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEK+G KLAAADKKKIED+++EAI+WL+GNQL EADEFEDKMKE+EGICN II
Sbjct  581  NMRNTIRDEKVGEKLAAADKKKIEDSIDEAIQWLEGNQLGEADEFEDKMKELEGICNLII  640

Query  222  AKIYQQGGDAMPMDDEEVPPAS-AAGPKIEEVD  127
            +K+Y QG     MDD+E PP+S  AGPKIEEVD
Sbjct  641  SKMY-QGEAGGSMDDDEAPPSSGGAGPKIEEVD  672



>ref|XP_009620324.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 82/96 (85%), Gaps = 5/96 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKIG KL++ DKKKIEDA+++AI WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDEKIGSKLSSDDKKKIEDAIDQAISWLDSNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQ-QGGDA-MPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  GG+A  PMDD + PPA  S AGPKIEEVD
Sbjct  614  AKMYQGAGGEAGAPMDD-DAPPAGGSGAGPKIEEVD  648



>emb|CDY40362.1| BnaA10g27060D [Brassica napus]
Length=454

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 79/93 (85%), Gaps = 1/93 (1%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL AADKKKIE+++E+AI+WL+ NQL EADEFEDKMKE+E ICNPII
Sbjct  362  NMRNTIQDEKIGEKLPAADKKKIEESIEQAIQWLENNQLGEADEFEDKMKELESICNPII  421

Query  222  AKIYQ-QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ  GG+A  MDD+  P +  AGPKIEEVD
Sbjct  422  AKMYQGAGGEAAGMDDDAPPASGGAGPKIEEVD  454



>gb|ACJ11741.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 79/95 (83%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KL+  DKK+IEDA+EEAI+WLD NQLAEADEFEDKMKE+E +CNPII
Sbjct  554  NMRNTVKDEKIGSKLSPDDKKRIEDAIEEAIQWLDSNQLAEADEFEDKMKELESVCNPII  613

Query  222  AKIYQ-QGGDAMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  GGD     DE+ PP+  S AGPKIEEVD
Sbjct  614  AKMYQGAGGDMGGSMDEDAPPSGGSGAGPKIEEVD  648



>gb|KHN48981.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=585

 Score =   134 bits (336),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 80/98 (82%), Gaps = 9/98 (9%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKIGGKL  ADKKKIEDA+E+AI+WLD NQL EADEFEDKMKE+E ICNPII
Sbjct  491  NMRNTIKDEKIGGKLDPADKKKIEDAIEQAIQWLDSNQLGEADEFEDKMKELESICNPII  550

Query  222  AKIYQQG-----GDAMPMDDEEVPPA-SAAGPKIEEVD  127
            AK+YQ G     G AM   D++VP A S AGPKIEEVD
Sbjct  551  AKMYQGGAGPDVGGAM---DDDVPAAGSGAGPKIEEVD  585



>ref|XP_009409520.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 80/96 (83%), Gaps = 5/96 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI D+KI  KLAAADKKKIEDA+E+AI+WLDGNQLAEADEF+DKMKE+E ICNPII
Sbjct  554  NMRNTINDDKIASKLAAADKKKIEDAIEQAIQWLDGNQLAEADEFDDKMKELESICNPII  613

Query  222  AKIYQQGGDAMP--MDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G  M   MDD + PPA  S AGPKIEEVD
Sbjct  614  AKMYQGAGADMAGGMDD-DAPPAGGSGAGPKIEEVD  648



>gb|AAK59628.2| putative dnaK-type molecular chaperone hsc70.1 protein [Arabidopsis 
thaliana]
Length=215

 Score =   128 bits (322),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 79/98 (81%), Gaps = 6/98 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL AADKKKIED++E+AI+WL+GNQLAEADEFEDKMKE+E ICNPII
Sbjct  118  NMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMKELESICNPII  177

Query  222  AKIYQ------QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ       G  A  MDD+  P +  AGPKIEEVD
Sbjct  178  AKMYQGAGGEAGGPGASGMDDDAPPASGGAGPKIEEVD  215



>gb|KDP44987.1| hypothetical protein JCGZ_01487 [Jatropha curcas]
Length=648

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 78/95 (82%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKI  KLAA DKKKIEDA+E+AI WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTVKDEKISSKLAADDKKKIEDAIEQAIHWLDANQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMD-DEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G  M    DE+ PPA  S+AGPKIEEVD
Sbjct  614  AKMYQGSGPDMAGGMDEDAPPAGGSSAGPKIEEVD  648



>gb|KDO67650.1| hypothetical protein CISIN_1g0212722mg, partial [Citrus sinensis]
Length=206

 Score =   128 bits (322),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 78/100 (78%), Gaps = 8/100 (8%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD++IG KL+AADKK+IED +EEA++WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  107  NMRNTIKDDQIGSKLSAADKKRIEDTIEEAMQWLDSNQLAEADEFEDKMKELESICNPII  166

Query  222  AKIYQQGGDAMPMD------DEEVPPA--SAAGPKIEEVD  127
            AK+YQ G             DE  PPA  S+AGPKIEEVD
Sbjct  167  AKMYQGGVAPGAGPAPGPGMDESAPPAGGSSAGPKIEEVD  206



>ref|XP_007207158.1| hypothetical protein PRUPE_ppa024477mg [Prunus persica]
 gb|EMJ08357.1| hypothetical protein PRUPE_ppa024477mg [Prunus persica]
Length=635

 Score =   134 bits (337),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 76/94 (81%), Gaps = 2/94 (2%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKIG KL  ADKKKIED++E AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  542  NMRNTIKDEKIGAKLPPADKKKIEDSIETAIQWLDSNQLAEADEFEDKMKELESICNPII  601

Query  222  AKIYQQGG--DAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ  G   A P+DDE    AS  GPKIEEVD
Sbjct  602  AKMYQGAGADGAGPVDDEAPAGASGPGPKIEEVD  635



>ref|XP_010685795.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Beta vulgaris 
subsp. vulgaris]
Length=648

 Score =   134 bits (337),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 78/95 (82%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL+ ADKKKIEDA+E+A++WLDGNQLAEADEF+DKMKE+EGICNPII
Sbjct  554  NMRNTIKDEKISSKLSEADKKKIEDAIEQAVQWLDGNQLAEADEFDDKMKELEGICNPII  613

Query  222  AKIYQQGGDAMPMDDEEVPP---ASAAGPKIEEVD  127
            AK+YQ   D     DE+ P    AS AGPKIEEVD
Sbjct  614  AKMYQGSADMGGQMDEDGPAPGGASGAGPKIEEVD  648



>ref|XP_007027052.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
 gb|EOY07554.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
Length=646

 Score =   134 bits (337),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 77/93 (83%), Gaps = 1/93 (1%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KL  ADKKKIEDA+E+AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTVKDEKIGAKLPPADKKKIEDAIEQAIQWLDSNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMDDEEVPP-ASAAGPKIEEVD  127
            AK+YQ  G  M   DE+VP   + AGPKIEEVD
Sbjct  614  AKMYQGAGADMGGMDEDVPAGGNGAGPKIEEVD  646



>ref|XP_009122774.1| PREDICTED: LOW QUALITY PROTEIN: heat shock 70 kDa protein 18 
[Brassica rapa]
Length=577

 Score =   133 bits (335),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 79/93 (85%), Gaps = 1/93 (1%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL AADKKKIE+++E+AI+WL+ NQL EADEFEDKMKE+E ICNPII
Sbjct  485  NMRNTIQDEKIGEKLPAADKKKIEESIEQAIQWLENNQLGEADEFEDKMKELESICNPII  544

Query  222  AKIYQ-QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ  GG+A  MDD+  P +  AGPKIEEVD
Sbjct  545  AKMYQGAGGEAAGMDDDAPPASGGAGPKIEEVD  577



>gb|ACA23466.1| heat shock protein 70 [Arachis diogoi]
Length=172

 Score =   127 bits (318),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 78/94 (83%), Gaps = 4/94 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL+ ADK KI+DA+E+AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  81   NMRNTIKDDKISSKLSPADKTKIDDAIEQAIQWLDANQLAEADEFEDKMKELESICNPII  140

Query  222  AKIYQQGGDAMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+Y QGG    +DD + PPA  S AGPKIEEVD
Sbjct  141  AKMY-QGGAGGEVDD-DAPPAGGSGAGPKIEEVD  172



>ref|XP_008241192.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Prunus mume]
Length=647

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 76/94 (81%), Gaps = 2/94 (2%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKIG KL  ADKKKIED++E AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDEKIGAKLPPADKKKIEDSIETAIQWLDSNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGG--DAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ  G   A P+DDE    AS  GPKIEEVD
Sbjct  614  AKMYQGAGADGAGPVDDEAPAGASGPGPKIEEVD  647



>ref|XP_009407484.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
 ref|XP_009407485.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
Length=649

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 77/95 (81%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL AADKKKIEDA+E+AI WLDGNQLAEADEFEDKMKE+EGICNPII
Sbjct  555  NMRNTIKDEKIAAKLPAADKKKIEDAIEKAISWLDGNQLAEADEFEDKMKELEGICNPII  614

Query  222  AKIYQQGGDAMP--MD-DEEVPPASAAGPKIEEVD  127
            AK+YQ  G  M   MD D      S+AGPKIEEVD
Sbjct  615  AKMYQGAGADMAGGMDEDGPTTGGSSAGPKIEEVD  649



>gb|ADD64906.1| heat shock protein-like protein [Tragopogon dubius]
 gb|ADD64907.1| heat shock protein-like protein [Tragopogon porrifolius]
Length=137

 Score =   125 bits (315),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 76/94 (81%), Gaps = 2/94 (2%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KL   DKKKIEDA++EAI WLD NQLAEADEFEDKMKE+E +CNPII
Sbjct  44   NMRNTVKDEKIGEKLTPGDKKKIEDAIDEAIAWLDTNQLAEADEFEDKMKELENVCNPII  103

Query  222  AKIYQ--QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ   GG+A  MD+E  P    AGPKIEEVD
Sbjct  104  AKMYQGGAGGEAGGMDEEPAPSGGGAGPKIEEVD  137



>dbj|BAD94888.1| dnaK-type molecular chaperone hsc70.1 - like [Arabidopsis thaliana]
Length=404

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 80/100 (80%), Gaps = 8/100 (8%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL AADKKK+ED++EEAI+WLDGNQL EADEFEDKMKE+E +CNPII
Sbjct  305  NMRNTIRDEKIGEKLPAADKKKVEDSIEEAIQWLDGNQLGEADEFEDKMKELESVCNPII  364

Query  222  AKIYQ-------QGGDAMPMDDEEVPPAS-AAGPKIEEVD  127
             K+YQ        G  A  MD++E PPAS  AGPKIEEVD
Sbjct  365  GKMYQGGAGGEAGGPGASGMDEDEAPPASGGAGPKIEEVD  404



>ref|XP_009777579.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=648

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 81/96 (84%), Gaps = 5/96 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKIG KL+  DKKKIEDA+++AI WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDEKIGSKLSPDDKKKIEDAIDQAISWLDSNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQ-QGGDA-MPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  GG+A  PMDD + PPA  S AGPKIEEVD
Sbjct  614  AKMYQGAGGEAGAPMDD-DAPPAGGSGAGPKIEEVD  648



>ref|XP_009122772.1| PREDICTED: LOW QUALITY PROTEIN: probable mediator of RNA polymerase 
II transcription subunit 37e [Brassica rapa]
Length=646

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 79/93 (85%), Gaps = 1/93 (1%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL AADKKKIE+++E+AI+WL+ NQL EADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIQDEKIGEKLPAADKKKIEESIEQAIQWLENNQLGEADEFEDKMKELESICNPII  613

Query  222  AKIYQ-QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ  GG+A  MDD+  P +  AGPKIEEVD
Sbjct  614  AKMYQGAGGEAAGMDDDAPPASGGAGPKIEEVD  646



>ref|XP_007220208.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
 gb|EMJ21407.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
Length=649

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 79/96 (82%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL AADKKKIEDA+E+AI+WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDDKIASKLDAADKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMD--DEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G        DE+VPPA  S AGPKIEEVD
Sbjct  614  AKMYQGAGGPDVGGGMDEDVPPAGGSGAGPKIEEVD  649



>emb|CDY07820.1| BnaC03g48020D [Brassica napus]
Length=93

 Score =   124 bits (311),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = -2

Query  399  MRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPIIA  220
            MRNTI D+KIG KL AADKKKIED+VEEA + L GNQLAEADEFEDKMKE E +CNPIIA
Sbjct  1    MRNTIHDDKIGEKLPAADKKKIEDSVEEATKRLCGNQLAEADEFEDKMKEQESVCNPIIA  60

Query  219  KIYQQGG--DAMPMDDEEVPPASAAGPKIEEVD  127
            K+YQ  G   + P DDE  P A  AGPKIEEVD
Sbjct  61   KMYQGAGGESSGPADDEAPPTAGGAGPKIEEVD  93



>ref|XP_010095022.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58128.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=651

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 80/98 (82%), Gaps = 6/98 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKI  KL+ +DKKKIEDA++ AI+WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTVKDEKISSKLSPSDKKKIEDAIDGAIQWLDGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGG----DAMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G        MD+++VPPA  S AGPKIEEVD
Sbjct  614  AKMYQGAGGPDVGGAGMDEDDVPPAGGSGAGPKIEEVD  651



>ref|XP_008369876.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Malus domestica]
Length=648

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 79/95 (83%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKIG KL  ADKKKIED++E AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDEKIGAKLPPADKKKIEDSIETAIQWLDSNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQ--QGGDAMPMDDEEVPP-ASAAGPKIEEVD  127
            AK+YQ   G  A P+DD++ PP AS  GPKIEEVD
Sbjct  614  AKMYQGAGGXGAGPVDDDDAPPSASGPGPKIEEVD  648



>ref|NP_195869.1| heat shock protein 70 [Arabidopsis thaliana]
 sp|P22954.2|MD37D_ARATH RecName: Full=Probable mediator of RNA polymerase II transcription 
subunit 37c; AltName: Full=Heat shock 70 kDa protein 2; 
AltName: Full=Heat shock cognate 70 kDa protein 2; AltName: 
Full=Heat shock cognate protein 70-2; Short=AtHsc70-2; AltName: 
Full=Heat shock protein 70-2; Short=AtHsp70-2 [Arabidopsis 
thaliana]
 emb|CAB85986.1| dnaK-type molecular chaperone hsc70.1-like [Arabidopsis thaliana]
 gb|AAM13151.1| DnaK-type molecular chaperone hsc70.1-like [Arabidopsis thaliana]
 gb|AAP37770.1| At5g02490 [Arabidopsis thaliana]
 dbj|BAE99142.1| dnaK-type molecular chaperone hsc70.1 - like [Arabidopsis thaliana]
 gb|AED90479.1| heat shock protein 70 [Arabidopsis thaliana]
Length=653

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 81/100 (81%), Gaps = 8/100 (8%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL AADKKK+ED++EEAI+WLDGNQL EADEFEDKMKE+E +CNPII
Sbjct  554  NMRNTIRDEKIGEKLPAADKKKVEDSIEEAIQWLDGNQLGEADEFEDKMKELESVCNPII  613

Query  222  AKIYQ-------QGGDAMPMDDEEVPPAS-AAGPKIEEVD  127
            AK+YQ        G  A  MD++E PPAS  AGPKIEEVD
Sbjct  614  AKMYQGGAGGEAGGPGASGMDEDEAPPASGGAGPKIEEVD  653



>ref|XP_010423825.1| PREDICTED: LOW QUALITY PROTEIN: probable mediator of RNA polymerase 
II transcription subunit 37c [Camelina sativa]
Length=658

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 81/100 (81%), Gaps = 8/100 (8%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL AADKKKIED++E+AI+WL+GNQLAE DEFEDKMKE+EG+CNPII
Sbjct  555  NMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAETDEFEDKMKELEGVCNPII  614

Query  222  AKIYQ-------QGGDAMPMDDEEVPPAS-AAGPKIEEVD  127
            AKIYQ        G  A  MD +E PPAS  AGPKIEEVD
Sbjct  615  AKIYQGGAGGEAGGPGAAGMDYDEAPPASGGAGPKIEEVD  654



>ref|XP_002873055.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49314.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=653

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 82/100 (82%), Gaps = 8/100 (8%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL AADKKK+ED++EEAI+WLDGNQLAEADEFEDKMKE+E +CNPII
Sbjct  554  NMRNTIRDEKIGEKLPAADKKKVEDSIEEAIQWLDGNQLAEADEFEDKMKELESVCNPII  613

Query  222  AKIYQ-------QGGDAMPMDDEEVPPAS-AAGPKIEEVD  127
            AK+YQ        G  A  MD+++ PPAS  AGPKIEEVD
Sbjct  614  AKMYQGGAGGEAGGPGAAGMDEDDAPPASGGAGPKIEEVD  653



>ref|XP_010490742.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=654

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 82/100 (82%), Gaps = 8/100 (8%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL AADKKKIED++E+AI+WL+GNQLAEADE+EDKMKE+EG+CNPII
Sbjct  555  NMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEYEDKMKELEGVCNPII  614

Query  222  AKIYQ-------QGGDAMPMDDEEVPPAS-AAGPKIEEVD  127
            AKIYQ        G  A  MD +E PPAS  AGPKIEEVD
Sbjct  615  AKIYQGGAGGEAGGPGAAGMDYDEAPPASGGAGPKIEEVD  654



>dbj|BAD22854.1| heat shock protein 70 [Nicotiana benthamiana]
Length=383

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 78/98 (80%), Gaps = 6/98 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKI  KL+A DKKKIEDA+EEAI+WLDGNQLAEADEFEDKMKE+EG+CNP I
Sbjct  286  NMRNTVKDEKIASKLSAEDKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELEGLCNPFI  345

Query  222  AKIYQ-QGGDAM--PMDDE---EVPPASAAGPKIEEVD  127
            AK+YQ  GG  M   MDD+    V     AGPKIEEVD
Sbjct  346  AKMYQGVGGPDMGGAMDDDGPASVASGGGAGPKIEEVD  383



>ref|XP_010253202.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nelumbo nucifera]
Length=648

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 78/95 (82%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KLA ADKKKIEDA+E+AI+WLDGNQLAEADEF+DKMKE+E ICNPII
Sbjct  554  NMRNTVKDEKIGAKLAPADKKKIEDAIEQAIQWLDGNQLAEADEFDDKMKELESICNPII  613

Query  222  AKIYQQGGDAM--PMDDE-EVPPASAAGPKIEEVD  127
            AK+YQ  G  M   MDDE      S AGPKIEEVD
Sbjct  614  AKMYQGAGPDMGGGMDDEGPSVGGSGAGPKIEEVD  648



>ref|XP_004287404.1| PREDICTED: heat shock cognate 70 kDa protein-like [Fragaria vesca 
subsp. vesca]
Length=649

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 82/97 (85%), Gaps = 6/97 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL A DKKKIEDA+E+AI+WLDGNQLAEA+E++DK+KE+EGICNPII
Sbjct  554  NMRNTIKDEKIASKLDAGDKKKIEDAIEQAIQWLDGNQLAEAEEYDDKVKELEGICNPII  613

Query  222  AKIYQQGGDAMPMD---DEEVPPA--SAAGPKIEEVD  127
            AK+Y QGG A  M    DE+VPPA  S AGPKIEEVD
Sbjct  614  AKMY-QGGAAPDMGGGMDEDVPPAGGSGAGPKIEEVD  649



>ref|XP_004307259.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Fragaria vesca subsp. vesca]
Length=649

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 81/96 (84%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL AADKKK+EDA+E+AI+WLDGNQLAEA+E++DK+KE+EGICNPII
Sbjct  554  NMRNTIKDDKIASKLDAADKKKVEDAIEQAIQWLDGNQLAEAEEYDDKVKELEGICNPII  613

Query  222  AKIYQQGG--DAMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ G   D     DEEVPP+  S AGPKIEEVD
Sbjct  614  AKMYQGGAPPDMAGGIDEEVPPSGGSGAGPKIEEVD  649



>ref|XP_008371627.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Malus domestica]
 gb|AAF34134.1| high molecular weight heat shock protein [Malus domestica]
Length=650

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 81/97 (84%), Gaps = 5/97 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL AADKKKIEDA+++AI+WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDDKIASKLDAADKKKIEDAIDQAIQWLDGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMD---DEEVPPA--SAAGPKIEEVD  127
            AK+YQ G     +    DE+VPPA  S+AGPKIEEVD
Sbjct  614  AKMYQGGAGGPDVGGGMDEDVPPAGGSSAGPKIEEVD  650



>emb|CDY02231.1| BnaA03g39360D [Brassica napus]
Length=96

 Score =   123 bits (308),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 77/96 (80%), Gaps = 5/96 (5%)
 Frame = -2

Query  399  MRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPIIA  220
            MRNTI+DEKIG KL AADKKKIED+VEEAI+WLDGNQ AEADEFEDKMKE+E +CN IIA
Sbjct  1    MRNTIRDEKIGEKLPAADKKKIEDSVEEAIQWLDGNQTAEADEFEDKMKELESVCNLIIA  60

Query  219  KIYQ----QGGDAMPMDDEEVPP-ASAAGPKIEEVD  127
            K+YQ    + G    MDD+E PP A  A PKIEEVD
Sbjct  61   KMYQGAGGEAGGPAGMDDDEAPPSAGGACPKIEEVD  96



>gb|ADZ46371.1| HSP70 [Malus hupehensis]
Length=650

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 81/97 (84%), Gaps = 5/97 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL AADKKKIEDA+++AI+WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDDKIASKLDAADKKKIEDAIDQAIQWLDGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMD---DEEVPPA--SAAGPKIEEVD  127
            AK+YQ G     +    DE+VPPA  S+AGPKIEEVD
Sbjct  614  AKMYQGGAGGPDVGGGMDEDVPPAGGSSAGPKIEEVD  650



>gb|KDP44975.1| hypothetical protein JCGZ_01475 [Jatropha curcas]
Length=617

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 79/95 (83%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KLAAADKKKIEDA+++AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  523  NMRNTIKDEKISSKLAAADKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPII  582

Query  222  AKIYQQGGDAMPMDDE-EVPPA--SAAGPKIEEVD  127
            AK+YQ  G  M    E +VPPA  S AGPKIEEVD
Sbjct  583  AKMYQGAGADMGGGMEDDVPPAGGSGAGPKIEEVD  617



>ref|XP_009357719.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform X2 [Pyrus 
x bretschneideri]
Length=649

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 80/97 (82%), Gaps = 5/97 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL AADKKKIEDA+++AI+WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  553  NMRNTIKDDKIASKLDAADKKKIEDAIDQAIQWLDGNQLAEADEFEDKMKELESICNPII  612

Query  222  AKIYQQGGDAMPMD---DEEVPPA--SAAGPKIEEVD  127
            AK+YQ G     +    DE+VPPA  S AGPKIEEVD
Sbjct  613  AKMYQGGAGGPDVGGGMDEDVPPAGGSGAGPKIEEVD  649



>ref|XP_004307527.1| PREDICTED: heat shock cognate 70 kDa protein-like [Fragaria vesca 
subsp. vesca]
Length=651

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 83/99 (84%), Gaps = 8/99 (8%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL AADKKKIEDA+E+AI+WLDGNQLAEA+E++DK+KE+EGICNPII
Sbjct  554  NMRNTIKDDKIASKLDAADKKKIEDAIEQAIQWLDGNQLAEAEEYDDKVKELEGICNPII  613

Query  222  AKIYQQGGDAMPMD-----DEEVPPA--SAAGPKIEEVD  127
            AK+Y QGG A  M      DE+VPPA  S AGPKIEEVD
Sbjct  614  AKMY-QGGAAPDMGMGGGMDEDVPPAGGSGAGPKIEEVD  651



>ref|XP_008223372.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X1 [Prunus mume]
Length=519

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 76/95 (80%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT++DEKIG KL  ADKKKIED+VE+AI+WLDGNQLAE DEFEDKMKE+E +CNPII
Sbjct  425  NMRNTVRDEKIGSKLNPADKKKIEDSVEDAIQWLDGNQLAECDEFEDKMKELENLCNPII  484

Query  222  AKIYQ---QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ          +DD+  P AS AGPKIEEVD
Sbjct  485  AKMYQGAGAEAGGGGVDDDAPPAASGAGPKIEEVD  519



>gb|AFK47438.1| unknown [Lotus japonicus]
Length=96

 Score =   122 bits (307),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 78/96 (81%), Gaps = 5/96 (5%)
 Frame = -2

Query  399  MRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPIIA  220
            MRNTIKD+KI  KL+A DKKKIEDA+++AI+WLDGNQLAEADEFEDKMKE+E ICNPIIA
Sbjct  1    MRNTIKDDKIASKLSADDKKKIEDAIDQAIQWLDGNQLAEADEFEDKMKELETICNPIIA  60

Query  219  KIYQQGGDAMPMD--DEEVPPA---SAAGPKIEEVD  127
            K+YQ  G  +     DE+ PPA   S AGPKIEEVD
Sbjct  61   KMYQGAGADVGGGAMDEDGPPAGSGSGAGPKIEEVD  96



>ref|XP_009357717.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform X1 [Pyrus 
x bretschneideri]
Length=650

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 80/97 (82%), Gaps = 5/97 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL AADKKKIEDA+++AI+WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDDKIASKLDAADKKKIEDAIDQAIQWLDGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMD---DEEVPPA--SAAGPKIEEVD  127
            AK+YQ G     +    DE+VPPA  S AGPKIEEVD
Sbjct  614  AKMYQGGAGGPDVGGGMDEDVPPAGGSGAGPKIEEVD  650



>ref|XP_008370710.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Malus domestica]
Length=649

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 79/96 (82%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL AADKKKIED +++AI+WLDGNQLAEADEFEDKMKE+EGICNPII
Sbjct  554  NMRNTIKDDKIASKLDAADKKKIEDTIDQAIQWLDGNQLAEADEFEDKMKELEGICNPII  613

Query  222  AKIYQQGG--DAMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G  D     D++VP A  S AGPKIEEVD
Sbjct  614  AKMYQGAGGPDVGGXMDDDVPXAGGSGAGPKIEEVD  649



>ref|XP_010253221.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nelumbo 
nucifera]
Length=648

 Score =   132 bits (331),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 78/95 (82%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KLA ADKKKIEDA+E+AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTVKDEKIGAKLAPADKKKIEDAIEQAIQWLDSNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGG-DAMPMDDEEVPP--ASAAGPKIEEVD  127
            AK+YQ  G DA    DE+ P    + AGPKIEEVD
Sbjct  614  AKMYQGAGPDAGAGMDEDGPSVGGTGAGPKIEEVD  648



>ref|XP_004492118.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   132 bits (331),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 80/96 (83%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKIG KL+  DKKKI+DA+E +I+WLD NQLAEADEFEDKMKE+EG+CNPII
Sbjct  554  NMRNTIKDEKIGSKLSPEDKKKIDDAIEASIQWLDSNQLAEADEFEDKMKELEGLCNPII  613

Query  222  AKIYQQGG--DAMPMDDEEVPP--ASAAGPKIEEVD  127
            AK+YQ GG  D     +++VPP  +S AGPKIEEVD
Sbjct  614  AKMYQGGGAPDMAGGMNDDVPPSGSSGAGPKIEEVD  649



>gb|AEO22185.1| CytHSP70 [Triticum aestivum]
Length=540

 Score =   130 bits (328),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 76/98 (78%), Gaps = 6/98 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL  ADKKKIEDA+E AI WLD NQLAEADEF+DKMKE+EGICNPII
Sbjct  443  NMRNTIKDDKIASKLPEADKKKIEDAIEGAITWLDNNQLAEADEFDDKMKELEGICNPII  502

Query  222  AKIYQQGGDAMPMDDEEVPPASAA------GPKIEEVD  127
            AK+YQ  G  MP   +E  PASAA      GPKIEEVD
Sbjct  503  AKMYQGAGAEMPGGMDEDAPASAAGGSSGPGPKIEEVD  540



>ref|XP_004302715.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Fragaria vesca subsp. vesca]
Length=647

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 76/94 (81%), Gaps = 2/94 (2%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKIG KL  ADKKKIEDA+E AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDEKIGEKLPGADKKKIEDAIEAAIQWLDSNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGG--DAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ  G   A P+DD+    +  AGPKIEEVD
Sbjct  614  AKMYQGSGPDGAGPVDDDVPAGSGGAGPKIEEVD  647



>ref|XP_006574857.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Glycine 
max]
Length=586

 Score =   130 bits (328),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 77/96 (80%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL+  DKKKIEDA+E AI+WLDGNQLAEADEFEDKMKE+E  CNPII
Sbjct  491  NMRNTIKDEKIASKLSGDDKKKIEDAIESAIQWLDGNQLAEADEFEDKMKELESTCNPII  550

Query  222  AKIYQQGG--DAMPMDDEEVPPASA--AGPKIEEVD  127
            AK+YQ  G  D     DE+VPP+ +  AGPKIEEVD
Sbjct  551  AKMYQGAGAPDMAGGMDEDVPPSGSGGAGPKIEEVD  586



>ref|XP_003552691.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform 1 [Glycine 
max]
Length=649

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 78/96 (81%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL+  DKKKIEDA+E AI+WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDEKIASKLSDDDKKKIEDAIESAIQWLDGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGG--DAMPMDDEEVPPASA--AGPKIEEVD  127
            AK+YQ  G  D     DE+VPP+ +  AGPKIEEVD
Sbjct  614  AKMYQGAGAPDMAGGMDEDVPPSGSGGAGPKIEEVD  649



>ref|XP_010452091.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=340

 Score =   128 bits (322),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 79/99 (80%), Gaps = 7/99 (7%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            N+RNTI+DEKIG KL AADKKKIED++ EAI+WL+GNQLAEADEFEDKMKE+EG+CNPII
Sbjct  242  NLRNTIRDEKIGEKLPAADKKKIEDSIGEAIQWLEGNQLAEADEFEDKMKELEGVCNPII  301

Query  222  AKIYQQGGDAMPMD------DEEVPPAS-AAGPKIEEVD  127
            AK+YQ G             DE+ PPAS  AGPKIEEVD
Sbjct  302  AKMYQGGAGGEAGGPGPHAMDEDAPPASGGAGPKIEEVD  340



>gb|KHN13891.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=649

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 78/96 (81%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL+  DKKKIEDA+E AI+WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDEKIASKLSDDDKKKIEDAIESAIQWLDGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGG--DAMPMDDEEVPPASA--AGPKIEEVD  127
            AK+YQ  G  D     DE+VPP+ +  AGPKIEEVD
Sbjct  614  AKMYQGAGAPDMAGGMDEDVPPSGSGGAGPKIEEVD  649



>gb|AHW48175.1| heat shock protein 70, partial [Triticum aestivum]
Length=539

 Score =   130 bits (327),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 76/98 (78%), Gaps = 6/98 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL  ADKKKIEDA+E AI WLD NQLAEADEF+DKMKE+EGICNPII
Sbjct  442  NMRNTIKDDKIASKLPEADKKKIEDAIEGAITWLDNNQLAEADEFDDKMKELEGICNPII  501

Query  222  AKIYQQGGDAMPMDDEEVPPASAA------GPKIEEVD  127
            AK+YQ  G  MP   +E  PASAA      GPKIEEVD
Sbjct  502  AKMYQGAGAEMPGGMDEDAPASAAGGSSGPGPKIEEVD  539



>ref|XP_010918390.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=649

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 77/97 (79%), Gaps = 5/97 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKI  KL  ADKKKIED++EEAI WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  553  NMRNTIRDEKIAAKLPPADKKKIEDSIEEAINWLDGNQLAEADEFEDKMKELESICNPII  612

Query  222  AKIYQQGGDAMPMD-DEEVPPAS----AAGPKIEEVD  127
            AK+YQ  G  M    DE+VP A+     AGPKIEEVD
Sbjct  613  AKMYQGAGAGMADGMDEDVPTAAGSSGGAGPKIEEVD  649



>gb|AAB97316.1| cytosolic heat shock 70 protein [Spinacia oleracea]
 gb|AAB88132.1| cytosolic heat shock 70 protein [Spinacia oleracea]
 gb|AAB88133.1| cytosolic heat shock 70 protein [Spinacia oleracea]
Length=651

 Score =   131 bits (329),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 82/98 (84%), Gaps = 6/98 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKI  K++ ADKKKIE++++ AI WL+ NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTVKDEKISSKISEADKKKIEESIDNAINWLESNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQ-QGGDA--MPMDDEEVPPASAA---GPKIEEVD  127
            AK+YQ  GG+A  +PMDD+EVP A A+   GPKIEEVD
Sbjct  614  AKMYQGAGGEAGGVPMDDDEVPSAGASSGPGPKIEEVD  651



>ref|XP_010937646.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=648

 Score =   131 bits (329),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 78/95 (82%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL AADKKKIEDA+E+AI+WLD NQLAEADEFEDKMKE+EGICNPII
Sbjct  554  NMRNTIKDDKIASKLPAADKKKIEDAIEQAIQWLDNNQLAEADEFEDKMKELEGICNPII  613

Query  222  AKIYQ-QGGDAMPMDDEEVPPA--SAAGPKIEEVD  127
            A++YQ  G D      ++ PPA  S AGPKIEEVD
Sbjct  614  ARMYQGAGADVAGGMGDDSPPAGGSGAGPKIEEVD  648



>ref|NP_001119156.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
 gb|AED90481.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
Length=521

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 79/98 (81%), Gaps = 6/98 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL AADKKKIED++E+AI+WL+GNQLAEADEFEDKMKE+E ICNPII
Sbjct  424  NMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMKELESICNPII  483

Query  222  AKIYQ------QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ       G  A  MDD+  P +  AGPKIEEVD
Sbjct  484  AKMYQGAGGEAGGPGASGMDDDAPPASGGAGPKIEEVD  521



>ref|XP_008223380.1| PREDICTED: heat shock cognate 70 kDa protein 2-like isoform X2 
[Prunus mume]
Length=648

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 76/95 (80%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT++DEKIG KL  ADKKKIED+VE+AI+WLDGNQLAE DEFEDKMKE+E +CNPII
Sbjct  554  NMRNTVRDEKIGSKLNPADKKKIEDSVEDAIQWLDGNQLAECDEFEDKMKELENLCNPII  613

Query  222  AKIYQ---QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ          +DD+  P AS AGPKIEEVD
Sbjct  614  AKMYQGAGAEAGGGGVDDDAPPAASGAGPKIEEVD  648



>ref|XP_009606077.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 77/95 (81%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKIG KL+  DKKKIEDA++EAI WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDEKIGSKLSPDDKKKIEDAIDEAISWLDGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMD-DEEVPP--ASAAGPKIEEVD  127
            AK+YQ  G  M    DE+ P   AS AGPKIEEVD
Sbjct  614  AKMYQGAGPDMAGGMDEDGPSAGASGAGPKIEEVD  648



>gb|KHN27222.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=649

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 77/96 (80%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL+  DKKKIEDA+E AI+WLDGNQLAEADEFEDKMKE+E  CNPII
Sbjct  554  NMRNTIKDEKIASKLSGDDKKKIEDAIESAIQWLDGNQLAEADEFEDKMKELESTCNPII  613

Query  222  AKIYQQGG--DAMPMDDEEVPPASA--AGPKIEEVD  127
            AK+YQ  G  D     DE+VPP+ +  AGPKIEEVD
Sbjct  614  AKMYQGAGAPDMAGGMDEDVPPSGSGGAGPKIEEVD  649



>ref|XP_008784528.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 78/95 (82%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKI  KL AADKKKIEDAVE+AI+WLDGNQLAEADEFEDKMKE+EGICNPII
Sbjct  554  NMRNTIRDEKIASKLPAADKKKIEDAVEQAIQWLDGNQLAEADEFEDKMKELEGICNPII  613

Query  222  AKIYQQGGDAMPMD-DEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G       DE+ P A  S AGPKIEEVD
Sbjct  614  AKMYQGAGADAAGGMDEDGPSAGGSDAGPKIEEVD  648



>ref|XP_010463615.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=652

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 78/98 (80%), Gaps = 6/98 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL AADKKKIED ++EAI+WLDGNQLAEADEFEDKMKE+EG+CNPII
Sbjct  555  NMRNTIRDEKIGEKLPAADKKKIEDLIDEAIQWLDGNQLAEADEFEDKMKELEGVCNPII  614

Query  222  AKIYQQGGDAMPMD-----DEEVPPA-SAAGPKIEEVD  127
            AK+YQ  G           DE+ PPA   +GPKIEEVD
Sbjct  615  AKVYQGAGGEAGGPGPHGMDEDAPPAPGGSGPKIEEVD  652



>ref|XP_008802761.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 76/95 (80%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KLAA DKKKIEDA+E+AI+WL+GNQLAEADEFEDKMKE+EGICNPII
Sbjct  554  NMRNTIKDDKISSKLAADDKKKIEDAIEQAIQWLEGNQLAEADEFEDKMKELEGICNPII  613

Query  222  AKIYQQGGDAMP---MDDEEVPPASAAGPKIEEVD  127
            AK+YQ  G  M     DD      S +GPKIEEVD
Sbjct  614  AKMYQGAGPDMADGMNDDAPAAGGSGSGPKIEEVD  648



>emb|CDY70331.1| BnaAnng33370D [Brassica napus]
Length=121

 Score =   122 bits (306),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 77/93 (83%), Gaps = 3/93 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+D+KIG KL AADKKKIED VEEA + L GNQLAEAD+FEDKMKE+E +CNPII
Sbjct  31   NMRNTIRDDKIGEKLPAADKKKIEDWVEEATQGLCGNQLAEADDFEDKMKELESVCNPII  90

Query  222  AKIYQ-QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ  GG+A    D+E PP  AAGPKIEEVD
Sbjct  91   AKMYQGTGGEAGGPTDDEAPP--AAGPKIEEVD  121



>ref|XP_010553033.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Tarenaya hassleriana]
Length=652

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 81/99 (82%), Gaps = 7/99 (7%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KL AADKKKIEDA+E+AI+WL+GNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTVKDEKIGEKLPAADKKKIEDAIEQAIQWLEGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMD-----DEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G  M        D++VPP+  S AGPKIEEVD
Sbjct  614  AKMYQGAGGDMGGGAPTGMDDDVPPSGGSGAGPKIEEVD  652



>gb|ABD32895.1| Heat shock protein Hsp70 [Medicago truncatula]
 gb|AES81705.2| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 75/96 (78%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI GKL + DKKKIED +E AI+WLD NQLAEADEFEDKMKE+EG+CNPII
Sbjct  554  NMRNTIKDEKIAGKLDSDDKKKIEDTIEAAIQWLDANQLAEADEFEDKMKELEGVCNPII  613

Query  222  AKIYQQGG----DAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ G      A P DD+    A  AGPKIEEVD
Sbjct  614  AKMYQGGAGPDMGAAPGDDDAPSHAGGAGPKIEEVD  649



>gb|AEP40944.1| heat shock protein 70 family protein [Posidonia oceanica]
Length=200

 Score =   124 bits (312),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 77/94 (82%), Gaps = 2/94 (2%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKI  KLAAADKKKIEDA++EAI+WLD NQL EADEF+DKMKE+E +CNPII
Sbjct  107  NMRNTIRDEKISEKLAAADKKKIEDAIDEAIQWLDNNQLGEADEFDDKMKELENVCNPII  166

Query  222  AKIYQ-QGGDA-MPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ  GGD    MD++ +   S  GPKIEEVD
Sbjct  167  AKMYQGAGGDVDGGMDEDGLSAPSGPGPKIEEVD  200



>ref|XP_011027182.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 79/96 (82%), Gaps = 5/96 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKI  KLAA DKKKIEDA+++AI+WLD NQLAEADEF+DKMKE+E ICNPII
Sbjct  554  NMRNTVKDEKISSKLAADDKKKIEDAIDQAIQWLDSNQLAEADEFDDKMKELESICNPII  613

Query  222  AKIYQQGGDAM--PMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G  M   MDD + PPA  S AGPKIEEVD
Sbjct  614  AKMYQGAGPDMGGGMDD-DAPPAGGSGAGPKIEEVD  648



>ref|XP_010456365.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=931

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 82/96 (85%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL AA+KKKIED+++EAI+WL+GNQLAEADEFEDKMKE+EG+CNPII
Sbjct  836  NMRNTIRDEKIGEKLPAAEKKKIEDSIDEAIQWLEGNQLAEADEFEDKMKELEGVCNPII  895

Query  222  AKIYQ---QGGDAMPMDDEEVPPAS-AAGPKIEEVD  127
            AK+YQ    G  A  M+ +E PPAS  AGPKIEEVD
Sbjct  896  AKMYQGGAGGPGAAGMNYDEAPPASGGAGPKIEEVD  931


 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKE  250
            NMRNTI+DEKIG KL AA+KKKIED+++EAI+WL+GNQLAEADEFEDKMK+
Sbjct  555  NMRNTIRDEKIGEKLPAAEKKKIEDSIDEAIQWLEGNQLAEADEFEDKMKD  605



>emb|CAA54419.1| heat shock cognate 70-1 [Arabidopsis thaliana]
Length=637

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 79/98 (81%), Gaps = 6/98 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL AADKKKIED++E+AI+WL+GNQLAEADEFEDKMKE+E ICNPII
Sbjct  540  NMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMKELESICNPII  599

Query  222  AKIYQ------QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ       G  A  MDD+  P +  AGPKIEEVD
Sbjct  600  AKMYQGAGGEAGGPGASGMDDDAPPASGGAGPKIEEVD  637



>gb|AAV98051.1| heat shock protein 70 [Medicago sativa]
Length=649

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 77/96 (80%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL+  DKK+IEDA+E AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDEKISSKLSGGDKKQIEDAIEGAIQWLDANQLAEADEFEDKMKELETICNPII  613

Query  222  AKIYQQG-GDAMPMDDEEVPPAS---AAGPKIEEVD  127
            AK+YQ G G+   +DD+  PP S    AGPKIEEVD
Sbjct  614  AKMYQGGAGEGPEVDDDAAPPPSGSGGAGPKIEEVD  649



>ref|XP_009784010.1| PREDICTED: heat shock cognate 70 kDa protein-like, partial [Nicotiana 
sylvestris]
Length=150

 Score =   122 bits (307),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 75/98 (77%), Gaps = 6/98 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  +L AADKK IEDA++EAI+WLD NQLAE DEFEDKMKE+EGICNPII
Sbjct  53   NMRNTIKDDKISSQLPAADKKIIEDAIDEAIKWLDSNQLAEVDEFEDKMKELEGICNPII  112

Query  222  AKIYQQGGDAMPMDDE------EVPPASAAGPKIEEVD  127
            AK+YQ G     MD++       V   S AGPKIEEVD
Sbjct  113  AKMYQGGAGGATMDEDGPSVCGGVGCGSGAGPKIEEVD  150



>ref|XP_003621886.1| Heat shock protein [Medicago truncatula]
 gb|AES78104.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 77/96 (80%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL+  DKK+IEDA+E AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDEKISSKLSGGDKKQIEDAIEGAIQWLDANQLAEADEFEDKMKELETICNPII  613

Query  222  AKIYQQG-GDAMPMDDEEVPPAS---AAGPKIEEVD  127
            AK+YQ G G+   +DD+  PP S    AGPKIEEVD
Sbjct  614  AKMYQGGAGEGPEVDDDAAPPPSGSGGAGPKIEEVD  649



>ref|XP_003552695.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Glycine 
max]
 gb|KHN13895.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=647

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 77/94 (82%), Gaps = 2/94 (2%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL++ DK KI++A+E+AI+WLD NQLAEADEFEDKMKE+EGICNPII
Sbjct  554  NMRNTIKDEKISSKLSSEDKTKIDNAIEQAIQWLDTNQLAEADEFEDKMKELEGICNPII  613

Query  222  AKIYQQGGDAMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ G       D++ PPA  S AGPKIEEVD
Sbjct  614  AKMYQGGAGTGGDVDDDAPPAGGSGAGPKIEEVD  647



>dbj|BAD94875.1| heat-shock protein [Arabidopsis thaliana]
Length=154

 Score =   123 bits (308),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 75/96 (78%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KLA  DKKKIED++E AI WL+ NQLAE DEFEDKMKE+E ICNPII
Sbjct  59   NMRNTIRDEKIGEKLAGDDKKKIEDSIEAAIEWLEANQLAECDEFEDKMKELESICNPII  118

Query  222  AKIYQQGGDAMPMD---DEEVPP-ASAAGPKIEEVD  127
            AK+YQ G    P     DE+VPP A  AGPKIEEVD
Sbjct  119  AKMYQGGEAGGPAAGGMDEDVPPSAGGAGPKIEEVD  154



>ref|XP_002873056.1| HSC70-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49315.1| HSC70-1 [Arabidopsis lyrata subsp. lyrata]
Length=650

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 79/97 (81%), Gaps = 5/97 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL AADKKKIED++E+AI+WL+GNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQ-----QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ      G  A  MDD+  P +  AGPKIEEVD
Sbjct  614  AKMYQGAGGEAGPGASGMDDDAPPASGGAGPKIEEVD  650



>ref|XP_003563611.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Brachypodium 
distachyon]
Length=648

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 76/94 (81%), Gaps = 2/94 (2%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI DEKI  KL A DKKKIEDAV++AI+WLD NQLAE DEFEDKMKE+EG+CNPII
Sbjct  555  NMRNTISDEKIASKLPADDKKKIEDAVDQAIQWLDNNQLAEVDEFEDKMKELEGLCNPII  614

Query  222  AKIYQQGGDAMPMD-DEEVPPAS-AAGPKIEEVD  127
            AK+YQ  G  MP   DE+ P AS  AGPKIEEVD
Sbjct  615  AKMYQGAGADMPGGMDEDAPAASGGAGPKIEEVD  648



>dbj|BAJ86014.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=651

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 76/98 (78%), Gaps = 6/98 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL  ADKKKIEDA+E AI WLD NQLAEADEF+DKMKE+EGICNPII
Sbjct  554  NMRNTIKDDKIASKLPEADKKKIEDAIEGAITWLDNNQLAEADEFDDKMKELEGICNPII  613

Query  222  AKIYQQGGDAMPMDDEEVPPASAA------GPKIEEVD  127
            AK+YQ  G  MP   +E  PASAA      GPKIEEVD
Sbjct  614  AKMYQGAGAEMPGGMDEDAPASAAGGSSGPGPKIEEVD  651



>ref|XP_006398709.1| hypothetical protein EUTSA_v10012922mg [Eutrema salsugineum]
 gb|ESQ40162.1| hypothetical protein EUTSA_v10012922mg [Eutrema salsugineum]
Length=651

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 79/98 (81%), Gaps = 6/98 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL AADKKKIED++E+AI+WL+GNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQ------QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ       G  A  MDD+  P +  AGPKIEEVD
Sbjct  614  AKMYQGAGGEAGGPGAAGMDDDAPPSSGGAGPKIEEVD  651



>gb|KFK38330.1| hypothetical protein AALP_AA3G100200 [Arabis alpina]
Length=650

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 75/97 (77%), Gaps = 5/97 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KLAA DKKKIED++E AI WL+GNQLAE DEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIRDEKIGEKLAADDKKKIEDSIEGAIEWLEGNQLAECDEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMP-----MDDEEVPPASAAGPKIEEVD  127
            AK+YQ G   +P     MDD+  P     GPKIEEVD
Sbjct  614  AKMYQGGEGGVPGASGGMDDDAPPSTGGPGPKIEEVD  650



>ref|XP_010452093.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X1 [Camelina sativa]
 ref|XP_010452094.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X2 [Camelina sativa]
 ref|XP_010490701.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Camelina sativa]
Length=651

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 79/98 (81%), Gaps = 6/98 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL AADKKKIED++E+AI+WL+GNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQ------QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ       G  A  MDD+  P +  AGPKIEEVD
Sbjct  614  AKMYQGAGGEAGGPGAAGMDDDAPPASGGAGPKIEEVD  651



>gb|ACJ11740.1| heat shock protein 70 [Gossypium hirsutum]
Length=647

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 77/94 (82%), Gaps = 2/94 (2%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KL AADKKKIEDA+E+AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTVKDEKIGAKLPAADKKKIEDAIEQAIQWLDSNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G  M    +E  PA  S AGPKIEEVD
Sbjct  614  AKMYQGAGGDMGGGMDEDVPAGGSGAGPKIEEVD  647



>ref|XP_006287234.1| hypothetical protein CARUB_v10000420mg [Capsella rubella]
 gb|EOA20132.1| hypothetical protein CARUB_v10000420mg [Capsella rubella]
Length=651

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 79/98 (81%), Gaps = 6/98 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL AADKKKIED++E+AI+WL+GNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQ------QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ       G  A  MDD+  P +  AGPKIEEVD
Sbjct  614  AKMYQGAGGEAGGPGAGGMDDDAPPASGGAGPKIEEVD  651



>ref|NP_195870.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
 sp|P22953.3|MD37E_ARATH RecName: Full=Probable mediator of RNA polymerase II transcription 
subunit 37e; AltName: Full=Heat shock 70 kDa protein 1; 
AltName: Full=Heat shock cognate 70 kDa protein 1; AltName: 
Full=Heat shock cognate protein 70-1; Short=AtHsc70-1; AltName: 
Full=Heat shock protein 70-1; Short=AtHsp70-1; AltName: 
Full=Protein EARLY-RESPONSIVE TO DEHYDRATION 2 [Arabidopsis 
thaliana]
 emb|CAB85987.1| dnaK-type molecular chaperone hsc70.1 [Arabidopsis thaliana]
 gb|AAL09715.1| AT5g02500/T22P11_90 [Arabidopsis thaliana]
 gb|AAM53305.1| DnaK-type molecular chaperone hsc70.1 [Arabidopsis thaliana]
 gb|AAO22583.1| putative dnaK-type molecular chaperone hsc70.1 protein [Arabidopsis 
thaliana]
 gb|AED90480.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
Length=651

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 79/98 (81%), Gaps = 6/98 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL AADKKKIED++E+AI+WL+GNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQ------QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ       G  A  MDD+  P +  AGPKIEEVD
Sbjct  614  AKMYQGAGGEAGGPGASGMDDDAPPASGGAGPKIEEVD  651



>emb|CAA52684.1| heat shock protein 70 cognate [Arabidopsis thaliana]
Length=651

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 79/98 (81%), Gaps = 6/98 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL AADKKKIED++E+AI+WL+GNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQ------QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ       G  A  MDD+  P +  AGPKIEEVD
Sbjct  614  AKMYQGAGGEAGGPGASGMDDDAPPASGGAGPKIEEVD  651



>gb|ABP01597.1| heat shock protein 70 [Ageratina adenophora]
Length=301

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 73/96 (76%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KL   DKKKIEDA++EAI WLD NQLAEADEFEDKMKE+E +CNPII
Sbjct  206  NMRNTVKDEKIGEKLTPGDKKKIEDAIDEAIAWLDANQLAEADEFEDKMKELENVCNPII  265

Query  222  AKIYQ----QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ        A  MD+E  P    AGPKIEEVD
Sbjct  266  AKMYQGGAGDAAGAGGMDEEPAPSGGGAGPKIEEVD  301



>ref|XP_011027580.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 75/95 (79%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KL  A+KKKIEDA+++AI WLD NQLAEADEFEDKMKEVE ICNPII
Sbjct  554  NMRNTVKDEKIGSKLNPAEKKKIEDAIDQAIHWLDSNQLAEADEFEDKMKEVESICNPII  613

Query  222  AKIYQ-QGGDAMPMDDEEVPPA--SAAGPKIEEVD  127
            AKIYQ  G D     DE+ P    S AGPKIEEVD
Sbjct  614  AKIYQGDGADMGGRMDEDAPSTGGSGAGPKIEEVD  648



>ref|XP_007144451.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
 gb|ESW16445.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
Length=648

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 78/98 (80%), Gaps = 9/98 (9%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIGGKL  ADKKKIEDAVE+ I+WLD NQL EADEFEDKMKE+E +CNPII
Sbjct  554  NMRNTVKDEKIGGKLDPADKKKIEDAVEQTIQWLDTNQLGEADEFEDKMKELESLCNPII  613

Query  222  AKIYQQG-----GDAMPMDDEEVPP-ASAAGPKIEEVD  127
            AK+YQ G     G AM   D++VP   S AGPKIEEVD
Sbjct  614  AKMYQGGAGPDMGGAM---DDDVPAGGSGAGPKIEEVD  648



>ref|XP_009778799.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=650

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 77/97 (79%), Gaps = 5/97 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKIG KL+  DKKKIEDA+++AI WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDEKIGSKLSPDDKKKIEDAIDQAISWLDANQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMD---DEEVPP--ASAAGPKIEEVD  127
            AK+YQ GG    M    DE+ P   AS AGPKIEEVD
Sbjct  614  AKMYQDGGAGPDMAGGMDEDGPSAGASGAGPKIEEVD  650



>ref|XP_007207204.1| hypothetical protein PRUPE_ppa002646mg [Prunus persica]
 gb|EMJ08403.1| hypothetical protein PRUPE_ppa002646mg [Prunus persica]
Length=649

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 77/96 (80%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT++DEKIG KL  ADKKKIED+VE+AI+WLDGNQLAE DEFEDKMKE+E +CNPII
Sbjct  554  NMRNTVRDEKIGSKLNPADKKKIEDSVEDAIQWLDGNQLAECDEFEDKMKELENLCNPII  613

Query  222  AKIYQ---QGGDAMPMDDEEVPP-ASAAGPKIEEVD  127
            AK+YQ          +DD+  PP AS AGPKIEEVD
Sbjct  614  AKMYQGAGAEAGGGGVDDDAPPPAASGAGPKIEEVD  649



>ref|XP_006378714.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|ERP56511.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 79/96 (82%), Gaps = 5/96 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKI  KLAA DKKKIEDA+++AI+WLD NQLAEADEF+DKMKE+E ICNPII
Sbjct  554  NMRNTVKDEKISSKLAADDKKKIEDAIDQAIQWLDSNQLAEADEFDDKMKELESICNPII  613

Query  222  AKIYQQGGDAM--PMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G  M   MDD + PP+  S AGPKIEEVD
Sbjct  614  AKMYQGAGPDMGGGMDD-DAPPSGGSGAGPKIEEVD  648



>ref|XP_009414320.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
Length=648

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 78/95 (82%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KLAAADKKKIEDA+++AI+WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDDKIASKLAAADKKKIEDAIDQAIQWLDGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMDDEEVPP---ASAAGPKIEEVD  127
            AK+YQ  G  M    ++  P   AS AGPKIEEVD
Sbjct  614  AKMYQGAGADMGGGMDDDAPSAGASGAGPKIEEVD  648



>ref|XP_007009362.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY18172.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=652

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 77/99 (78%), Gaps = 7/99 (7%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KL   DKKKIEDA++ AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTVKDEKIGSKLDPTDKKKIEDAIDGAIQWLDNNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMD-----DEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G  M  D     D++ PPA  S AGPKIEEVD
Sbjct  614  AKMYQGAGADMGADMGAGMDDDAPPAGGSGAGPKIEEVD  652



>ref|XP_002527736.1| heat shock protein, putative [Ricinus communis]
 gb|EEF34649.1| heat shock protein, putative [Ricinus communis]
Length=647

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 76/94 (81%), Gaps = 2/94 (2%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KL+ ADKKKIEDA+E AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTVKDEKIGAKLSPADKKKIEDAIESAIQWLDSNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G  M    +E  PA  S AGPKIEEVD
Sbjct  614  AKMYQGAGGEMGAGMDEDAPAGGSGAGPKIEEVD  647



>gb|AAP42157.1|AF509339_1 heat shock protein 70 [Saussurea medusa]
Length=427

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 74/94 (79%), Gaps = 2/94 (2%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KL   DKKKIEDA++EAI WLD NQLAEADEFEDKMKE+E +CNPII
Sbjct  334  NMRNTVKDEKIGEKLTPGDKKKIEDAIDEAISWLDSNQLAEADEFEDKMKELENVCNPII  393

Query  222  AKIYQ--QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ   G  A  MD++  P    AGPKIEEVD
Sbjct  394  AKMYQGGAGDAAGGMDEDAAPSGGGAGPKIEEVD  427



>gb|EAY98319.1| hypothetical protein OsI_20227 [Oryza sativa Indica Group]
Length=410

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 75/94 (80%), Gaps = 2/94 (2%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KLAA DKK+IEDA++ AI WLD NQLAEADEFEDKMKE+EGICNPII
Sbjct  317  NMRNTIKDEKIASKLAADDKKRIEDAIDGAISWLDTNQLAEADEFEDKMKELEGICNPII  376

Query  222  AKIYQQGGDAMP--MDDEEVPPASAAGPKIEEVD  127
            AK+YQ  G  M   MD++     S AGPKIEEVD
Sbjct  377  AKMYQGPGADMAGGMDEDAPAGGSGAGPKIEEVD  410



>gb|ACJ85522.1| unknown [Medicago truncatula]
 gb|AFK38758.1| unknown [Medicago truncatula]
Length=649

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 76/96 (79%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL+  DKK+IEDA+E A +WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDEKISSKLSGGDKKQIEDAIEGAFQWLDANQLAEADEFEDKMKELETICNPII  613

Query  222  AKIYQQG-GDAMPMDDEEVPPAS---AAGPKIEEVD  127
            AK+YQ G G+   +DD+  PP S    AGPKIEEVD
Sbjct  614  AKMYQGGAGEGPEVDDDAAPPPSGSGGAGPKIEEVD  649



>ref|XP_009123001.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Brassica rapa]
 ref|XP_009123007.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Brassica rapa]
 ref|XP_009123010.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Brassica rapa]
Length=121

 Score =   120 bits (302),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 76/93 (82%), Gaps = 3/93 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRN ++D+KIG KL AADKKKIED VEEA + L GNQLAEADEFEDKMKE+E +CNPII
Sbjct  31   NMRNALRDDKIGEKLPAADKKKIEDWVEEATQGLCGNQLAEADEFEDKMKELESVCNPII  90

Query  222  AKIYQ-QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ  GG+A    D+E PP  AAGPKIEEVD
Sbjct  91   AKMYQGTGGEAGGPTDDEAPP--AAGPKIEEVD  121



>ref|XP_002311161.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE88528.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   129 bits (323),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 75/95 (79%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KL  ADKKKIEDA+++AI WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTVKDEKIGSKLNPADKKKIEDAIDQAIHWLDSNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQ-QGGDAMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G D     DE+ P    S AGPKIEEVD
Sbjct  614  AKMYQGDGADMGGRMDEDAPSTGGSGAGPKIEEVD  648



>ref|XP_007009369.1| Heat shock protein 70 [Theobroma cacao]
 gb|EOY18179.1| Heat shock protein 70 [Theobroma cacao]
Length=649

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 79/97 (81%), Gaps = 6/97 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KL+  DKKKIEDA++ A++WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTVKDEKIGSKLSPDDKKKIEDAIDGAVQWLDGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAM---PMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G  M    M D ++PPA  S AGPKIEEVD
Sbjct  614  AKMYQGAGPDMGGAGMAD-DIPPAGGSGAGPKIEEVD  649



>ref|XP_002316294.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEF02465.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 77/95 (81%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG +L+ ADKKKIEDA+++AI+WLD NQLAE DEFEDKMKE+E ICNPII
Sbjct  554  NMRNTVKDEKIGSQLSPADKKKIEDAIDQAIQWLDSNQLAEVDEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMD-DEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G  M    DE++P    S AGPKIEEVD
Sbjct  614  AKMYQGAGPDMGGSMDEDIPSTGGSGAGPKIEEVD  648



>ref|XP_011027172.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X1 [Populus euphratica]
 ref|XP_011027173.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X2 [Populus euphratica]
Length=648

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 77/95 (81%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG +L+ ADKKKIEDA+++AI+WLD NQLAE DEFEDKMKE+E ICNPII
Sbjct  554  NMRNTVKDEKIGSQLSPADKKKIEDAIDQAIQWLDSNQLAEVDEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMD-DEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G  M    DE++P    S AGPKIEEVD
Sbjct  614  AKMYQGAGPDMGGSMDEDIPSTGGSGAGPKIEEVD  648



>ref|XP_010534306.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=653

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 77/100 (77%), Gaps = 8/100 (8%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL   DKKKIEDA+E+AI+WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIRDEKIGSKLKPEDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGG-----DAMPMDDEEVPPAS---AAGPKIEEVD  127
            A++YQ G       A  MDD+  P A     AGPKIEEVD
Sbjct  614  AQMYQGGAGADMDGAGGMDDDCAPSAGGGRGAGPKIEEVD  653



>emb|CAA67588.1| 70 kD heatshockprotein [Medicago sativa]
Length=214

 Score =   123 bits (308),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 74/96 (77%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL+A DKKKIEDA+E AI+WLDGNQL EADEFEDKMKE+EGICNPII
Sbjct  119  NMRNTIKDDKIASKLSADDKKKIEDAIEGAIQWLDGNQLGEADEFEDKMKELEGICNPII  178

Query  222  AKIYQQGGDAMPMDDEEVPPA----SAAGPKIEEVD  127
             K+YQ  G       +E  PA    S AGPKIEEVD
Sbjct  179  GKMYQGAGGDAGGAMDEDGPAAGSGSGAGPKIEEVD  214



>gb|KFK24738.1| hypothetical protein AALP_AA8G018100 [Arabis alpina]
Length=650

 Score =   128 bits (322),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 78/97 (80%), Gaps = 5/97 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL AADKKKIED++E+AI+WL+GNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQ-----QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ      G  A  MDD+  P +   GPKIEEVD
Sbjct  614  AKMYQGAGGEAGPGAGGMDDDAPPSSGGPGPKIEEVD  650



>gb|AGR45355.1| HSP70 [Dendrobium catenatum]
Length=647

 Score =   128 bits (322),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 78/94 (83%), Gaps = 2/94 (2%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KLAA DKKKIEDA+++AI+WL+ NQLAEADEF+DKMKE+EGICNPII
Sbjct  554  NMRNTIKDEKIASKLAADDKKKIEDAIDQAIQWLESNQLAEADEFDDKMKELEGICNPII  613

Query  222  AKIYQQGGDAMPMDDEEVPP--ASAAGPKIEEVD  127
            AK+YQ  G  M    +++P    S+AGPKIEEVD
Sbjct  614  AKMYQGAGPDMGGMPDDIPTGGGSSAGPKIEEVD  647



>ref|XP_007139240.1| hypothetical protein PHAVU_008G013000g [Phaseolus vulgaris]
 gb|ESW11234.1| hypothetical protein PHAVU_008G013000g [Phaseolus vulgaris]
Length=649

 Score =   128 bits (322),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 76/96 (79%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL+  DKKKIEDA+E AI+WLD NQL EADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDEKIASKLSGDDKKKIEDAIESAIQWLDTNQLGEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGG--DAMPMDDEEVPPASA--AGPKIEEVD  127
            AK+YQ  G  D     DE+VPP+ +  AGPKIEEVD
Sbjct  614  AKMYQGAGAPDMAGGMDEDVPPSGSGGAGPKIEEVD  649



>ref|XP_010423853.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Camelina sativa]
Length=651

 Score =   128 bits (322),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 78/98 (80%), Gaps = 6/98 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL  ADKKKIED++E+AI+WL+GNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIQDEKIGEKLPVADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQ------QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ       G  A  MDD+  P +  AGPKIEEVD
Sbjct  614  AKMYQGAGGEAGGPGAAGMDDDAPPASGGAGPKIEEVD  651



>ref|XP_002884912.1| hypothetical protein ARALYDRAFT_897465 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61171.1| hypothetical protein ARALYDRAFT_897465 [Arabidopsis lyrata subsp. 
lyrata]
Length=650

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 78/99 (79%), Gaps = 9/99 (9%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL AADKKKIEDA+++AI WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDEKIASKLDAADKKKIEDAIDQAIEWLDGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQG----GDAMPMDDEEVPPAS---AAGPKIEEVD  127
            A++YQ      G A  MDD+   PAS    AGPKIEEVD
Sbjct  614  ARMYQGAGPDMGGAAGMDDD--APASGSGGAGPKIEEVD  650



>ref|XP_008802766.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Phoenix dactylifera]
Length=648

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 76/96 (79%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKI  KL  ADKKKIEDA+E+AI WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  553  NMRNTIRDEKIAAKLPQADKKKIEDAIEQAINWLDGNQLAEADEFEDKMKELESICNPII  612

Query  222  AKIYQ-QGGDAMPMDDEEVPPA---SAAGPKIEEVD  127
            AK+YQ  G       DE++P A   S AGPKIEEVD
Sbjct  613  AKMYQGAGAGMAGGMDEDIPAAGGSSGAGPKIEEVD  648



>ref|XP_002446329.1| hypothetical protein SORBIDRAFT_06g014400 [Sorghum bicolor]
 gb|EES10657.1| hypothetical protein SORBIDRAFT_06g014400 [Sorghum bicolor]
Length=575

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 75/93 (81%), Gaps = 4/93 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  +L A DKKKIEDAV+ AI WLD NQLAEADEFEDKMKE+EGICNPII
Sbjct  486  NMRNTIKDDKIASELPAEDKKKIEDAVDGAISWLDSNQLAEADEFEDKMKELEGICNPII  545

Query  222  AKIYQQGGDAMPMDDEEVPPA-SAAGPKIEEVD  127
            AK+YQ  G  M   DE+ P +  AAGPKIEEVD
Sbjct  546  AKMYQGAGVGM---DEDAPASGGAAGPKIEEVD  575



>ref|NP_001055754.1| Os05g0460000 [Oryza sativa Japonica Group]
 gb|AAT39165.1| putative hsp70 [Oryza sativa Japonica Group]
 dbj|BAF17668.1| Os05g0460000 [Oryza sativa Japonica Group]
 dbj|BAH01403.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63984.1| hypothetical protein OsJ_18811 [Oryza sativa Japonica Group]
Length=646

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 75/94 (80%), Gaps = 2/94 (2%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KLAA DKK+IEDA++ AI WLD NQLAEADEFEDKMKE+EGICNPII
Sbjct  553  NMRNTIKDEKIASKLAADDKKRIEDAIDGAISWLDTNQLAEADEFEDKMKELEGICNPII  612

Query  222  AKIYQQGGDAMP--MDDEEVPPASAAGPKIEEVD  127
            AK+YQ  G  M   MD++     S AGPKIEEVD
Sbjct  613  AKMYQGPGADMAGGMDEDAPAGGSGAGPKIEEVD  646



>ref|XP_010486515.1| PREDICTED: heat shock 70 kDa protein 3-like [Camelina sativa]
Length=649

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 76/96 (79%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KLAA DKKKIED++E AI WL+GNQLAE DEFEDKMKE+E +CNPII
Sbjct  554  NMRNTIRDEKIGEKLAADDKKKIEDSIEAAIEWLEGNQLAECDEFEDKMKELESLCNPII  613

Query  222  AKIYQ----QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ     G     MD++  PPA  AGPKIEEVD
Sbjct  614  AKMYQGGEAGGPAPGGMDEDVPPPAGGAGPKIEEVD  649



>ref|XP_010922357.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Elaeis guineensis]
Length=648

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 74/95 (78%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KD+KI  KL A DKKKIEDA+E+AI+WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTVKDDKISSKLTAEDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPM---DDEEVPPASAAGPKIEEVD  127
            AK+YQ  G  M     DD      S +GPKIEEVD
Sbjct  614  AKMYQGAGADMGAGMNDDAPSAGGSGSGPKIEEVD  648



>ref|XP_010555208.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Tarenaya 
hassleriana]
Length=652

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 78/99 (79%), Gaps = 8/99 (8%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL   DKKKIE+A+E+AI+WL+GNQLAE DE EDKMKE+E ICNPII
Sbjct  555  NMRNTIRDEKIGEKLGPEDKKKIEEAIEQAIQWLEGNQLAEVDELEDKMKELESICNPII  614

Query  222  AKIYQQGGDAMP-----MDDEEVPPA--SAAGPKIEEVD  127
            AK+Y QG    P     MDD+ VPP+  S AGPKIEEVD
Sbjct  615  AKMY-QGSAGAPDMAGGMDDDHVPPSSGSGAGPKIEEVD  652



>ref|XP_006429028.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 ref|XP_006480766.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Citrus sinensis]
 gb|ESR42268.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 gb|KDO41235.1| hypothetical protein CISIN_1g006381mg [Citrus sinensis]
Length=647

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 77/94 (82%), Gaps = 2/94 (2%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KLA ADKKKIEDA+++AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTVKDEKIGSKLAPADKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G  M    ++  PA  S AGPKIEEVD
Sbjct  614  AKMYQGAGGDMGGAMDDDVPAGGSGAGPKIEEVD  647



>ref|XP_004307529.1| PREDICTED: heat shock cognate 70 kDa protein-like [Fragaria vesca 
subsp. vesca]
Length=649

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 78/97 (80%), Gaps = 6/97 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  K+  +DKKKIEDA+EEAI WLD NQLAEADEFEDKMKE+E +CNPII
Sbjct  554  NMRNTIKDDKIASKIDPSDKKKIEDAIEEAIHWLDNNQLAEADEFEDKMKELESLCNPII  613

Query  222  AKIYQQGGDAMPMD---DEEVPPA--SAAGPKIEEVD  127
            AK+Y QGG A  M    D +VPP+  S AGPKIEEVD
Sbjct  614  AKMY-QGGAAPDMSGGADADVPPSGGSGAGPKIEEVD  649



>gb|AAS57913.1| 70 kDa heat shock cognate protein 2 [Vigna radiata]
Length=648

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 73/95 (77%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIGGKL  ADKKKIEDAVE+ I+WLD NQL EADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTVKDEKIGGKLDPADKKKIEDAVEQTIQWLDSNQLGEADEFEDKMKELESICNPII  613

Query  222  AKIYQ---QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ          MDD+     S AGPKIEEVD
Sbjct  614  AKMYQGGAGPDMGGGMDDDVPAGGSGAGPKIEEVD  648



>ref|XP_006436017.1| hypothetical protein CICLE_v10033622mg [Citrus clementina]
 ref|XP_006486087.1| PREDICTED: heat shock cognate 70 kDa protein-like [Citrus sinensis]
 gb|ESR49257.1| hypothetical protein CICLE_v10033622mg [Citrus clementina]
Length=653

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 78/100 (78%), Gaps = 8/100 (8%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD++IG KL+AADKK+IED +EEA++WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDDQIGSKLSAADKKRIEDTIEEAMQWLDSNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMD------DEEVPPA--SAAGPKIEEVD  127
            AK+YQ G             DE  PP+  S+AGPKIEEVD
Sbjct  614  AKMYQGGVAPGAGPAPGPGMDESAPPSGGSSAGPKIEEVD  653



>ref|XP_004493886.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Cicer arietinum]
Length=650

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 79/98 (81%), Gaps = 7/98 (7%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI GKL +ADKKKIED++E+AI+WLD NQLAEADEFEDKMKE+E +CNPII
Sbjct  554  NMRNTIKDDKIAGKLDSADKKKIEDSIEQAIQWLDSNQLAEADEFEDKMKELESVCNPII  613

Query  222  AKIYQQGGDAMPMD----DEEVPPA--SAAGPKIEEVD  127
            AK+Y QGG    M     DEE  P+  S AGPKIEEVD
Sbjct  614  AKMY-QGGAGPDMGGAAADEEYAPSGGSGAGPKIEEVD  650



>ref|XP_003621869.1| Heat shock protein [Medicago truncatula]
 gb|AES78087.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=648

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 74/95 (78%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKIG KL+  DKKKI+DA++ AI+WLD NQLAEADEFEDKMKE+E +CNPII
Sbjct  554  NMRNTIKDEKIGSKLSPEDKKKIDDAIDAAIQWLDSNQLAEADEFEDKMKELESLCNPII  613

Query  222  AKIYQ---QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ          MDDE  P A  AGPKIEEVD
Sbjct  614  AKMYQGGGAPDMGGGMDDEVPPAAGGAGPKIEEVD  648



>dbj|BAP90755.1| heat shock protein 70 [Chrysanthemum x morifolium]
Length=647

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 74/94 (79%), Gaps = 2/94 (2%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KL   DKKKIEDA++EAI WLD NQLAEADEFEDKMKE+E +CNPII
Sbjct  554  NMRNTVKDEKIGEKLTPGDKKKIEDAIDEAIAWLDSNQLAEADEFEDKMKELENVCNPII  613

Query  222  AKIYQ--QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ   G  A  MD+E  P    AGPKIEEVD
Sbjct  614  AKMYQGGAGDAAGGMDEEPAPSGGGAGPKIEEVD  647



>ref|XP_009353696.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X2 [Pyrus x bretschneideri]
Length=520

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 78/96 (81%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT++DEKIG KL  ADKKKIEDAVE+AI+WLDGNQL + DEFEDKMKE+E +CNPII
Sbjct  425  NMRNTVRDEKIGSKLNPADKKKIEDAVEDAIQWLDGNQLGDCDEFEDKMKELENLCNPII  484

Query  222  AKIYQQGGDAMPMD--DEEVPPASA--AGPKIEEVD  127
            AK+YQ  G  +     DE+ PPA++  AGPKIEEVD
Sbjct  485  AKMYQGAGADVGGGAPDEDAPPAASGGAGPKIEEVD  520



>gb|AFS65092.1| DnaK-type molecular chaperone hsp70, partial [Elaeis guineensis]
Length=140

 Score =   120 bits (300),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+D+KI  KL AADKKKIEDAVEEAI+WLDGNQLAEADEFEDKMKE+EGICNPII
Sbjct  46   NMRNTIRDDKIASKLPAADKKKIEDAVEEAIQWLDGNQLAEADEFEDKMKELEGICNPII  105

Query  222  AKIYQQGG  199
            AK+YQ  G
Sbjct  106  AKMYQGAG  113



>gb|AEO13403.1| heat shock 70 [Glycine max]
Length=560

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 76/96 (79%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL+A DKKKIEDA+E+AI+WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  465  NMRNTIKDDKIASKLSADDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPII  524

Query  222  AKIYQQGGDAMPMDDEEVPPA----SAAGPKIEEVD  127
            AK+YQ  G       +E  PA    S AGPKIEEVD
Sbjct  525  AKMYQGAGGDAGGAMDEDGPAAGSGSGAGPKIEEVD  560



>gb|ABP35942.1| heat shock protein 70 [Cyclamen persicum]
Length=650

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 80/97 (82%), Gaps = 5/97 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL AADKKKIEDA++ AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDDKISSKLDAADKKKIEDAIDGAIQWLDSNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDA---MPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G A     MDD++VPPA  S AGPKIEEVD
Sbjct  614  AKMYQGAGGAPDMGGMDDDDVPPAGGSGAGPKIEEVD  650



>ref|XP_002884737.1| heat shock cognate 70 kDa protein 3 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60996.1| heat shock cognate 70 kDa protein 3 [Arabidopsis lyrata subsp. 
lyrata]
Length=650

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 77/96 (80%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KLAA DKKKIED++E AI WL+GNQLAE DEFEDKMKE+E ICNPII
Sbjct  555  NMRNTIRDEKIGEKLAADDKKKIEDSIEAAIEWLEGNQLAECDEFEDKMKELESICNPII  614

Query  222  AKIYQQGGDAMPMD---DEEVPP-ASAAGPKIEEVD  127
            AK+YQ G    P     DE+VPP A  AGPKIEEVD
Sbjct  615  AKMYQGGEAGGPAAGGMDEDVPPSAGGAGPKIEEVD  650



>ref|XP_003558228.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Brachypodium 
distachyon]
Length=651

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 75/98 (77%), Gaps = 6/98 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL  ADKKKIEDA++ AI WLD NQLAEADEF+DKMKE+EGICNPII
Sbjct  554  NMRNTIKDDKIASKLPEADKKKIEDAIDGAITWLDNNQLAEADEFDDKMKELEGICNPII  613

Query  222  AKIYQQGGDAMPMDDEEVPPASAA------GPKIEEVD  127
            AK+YQ  G  MP   +E  PAS A      GPKIEEVD
Sbjct  614  AKMYQGAGAEMPGGMDEDTPASTAGGSSGPGPKIEEVD  651



>ref|XP_008812042.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 76/95 (80%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL AADKKKIEDA+E+AI+WLDGNQLAEADEFEDKMKE+EG CNPII
Sbjct  554  NMRNTIKDDKIASKLPAADKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKELEGTCNPII  613

Query  222  AKIYQQGGDAMPMDDEEVPPA---SAAGPKIEEVD  127
            AK+YQ  G  M     +  P+   S AGPKIEEVD
Sbjct  614  AKMYQGAGAGMAGGMGDDSPSGGDSGAGPKIEEVD  648



>ref|XP_009388623.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=649

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 77/96 (80%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKI  KL A DKKKIEDAVE+AI WLDGNQLAEADEFED+MKE+E ICNPII
Sbjct  554  NMRNTIRDEKIAAKLPAEDKKKIEDAVEQAISWLDGNQLAEADEFEDRMKELESICNPII  613

Query  222  AKIYQ-QGGDAMPMDDEEVPP---ASAAGPKIEEVD  127
            AK+YQ  GG      DE++P    +S AGPKIEEVD
Sbjct  614  AKMYQGAGGGMGGGMDEDIPSTGGSSGAGPKIEEVD  649



>emb|CAA31663.1| hsp70 (AA 6 - 651) [Petunia x hybrida]
Length=646

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 76/98 (78%), Gaps = 6/98 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  +L+AADKK+IEDA++EAI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  549  NMRNTIKDDKINSQLSAADKKRIEDAIDEAIKWLDNNQLAEADEFEDKMKELESICNPII  608

Query  222  AKIYQQGGDAMPMDDE------EVPPASAAGPKIEEVD  127
            AK+YQ G     MD++           + AGPKIEEVD
Sbjct  609  AKMYQGGAGGATMDEDGPSVGGSAGSQTGAGPKIEEVD  646



>gb|KFK38606.1| hypothetical protein AALP_AA3G135800 [Arabis alpina]
Length=357

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 75/97 (77%), Gaps = 5/97 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL AADKKKIEDA+++AI WLDGNQLAEADEF+DKMKE+E ICNPII
Sbjct  261  NMRNTIKDEKIASKLDAADKKKIEDAIDQAIEWLDGNQLAEADEFDDKMKELESICNPII  320

Query  222  AKIYQQG----GDAMPMD-DEEVPPASAAGPKIEEVD  127
            A++YQ      G A  MD D     +  AGPKIEEVD
Sbjct  321  ARMYQGAGPDVGGAGGMDEDAHASGSGGAGPKIEEVD  357



>ref|XP_006297174.1| hypothetical protein CARUB_v10013178mg [Capsella rubella]
 gb|EOA30072.1| hypothetical protein CARUB_v10013178mg [Capsella rubella]
Length=649

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 77/96 (80%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KLAA DKKKIEDA+E AI WL+GNQLAE DEFEDKMKE+E +CNPII
Sbjct  554  NMRNTIRDEKIGEKLAADDKKKIEDAIEAAIEWLEGNQLAECDEFEDKMKELESLCNPII  613

Query  222  AKIYQQGGDAMPMD---DEEVPP-ASAAGPKIEEVD  127
            AK+YQ G    P     DE+VPP A  AGPKIEEVD
Sbjct  614  AKMYQGGEAGGPAAAGMDEDVPPSAGGAGPKIEEVD  649



>sp|P09189.1|HSP7C_PETHY RecName: Full=Heat shock cognate 70 kDa protein [Petunia x hybrida]
 emb|CAA30018.1| heat shock protein 70 [Petunia x hybrida]
Length=651

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 76/98 (78%), Gaps = 6/98 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  +L+AADKK+IEDA++EAI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDDKINSQLSAADKKRIEDAIDEAIKWLDNNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMDDE------EVPPASAAGPKIEEVD  127
            AK+YQ G     MD++           + AGPKIEEVD
Sbjct  614  AKMYQGGAGGATMDEDGPSVGGSAGSQTGAGPKIEEVD  651



>dbj|BAA34919.1| heat shock protein 70 cognate [Salix gilgiana]
Length=408

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 76/95 (80%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKI  KL A DKKKIEDA+++AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  314  NMRNTVKDEKISSKLGADDKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPII  373

Query  222  AKIYQQGGDAMPMDDE-EVPP--ASAAGPKIEEVD  127
            AK+YQ  G  M    E + PP  +S AGPKIEEVD
Sbjct  374  AKMYQGAGADMGGGMEDDAPPSGSSGAGPKIEEVD  408



>gb|AAM48131.1|AF509336_1 heat shock protein 70 [Saussurea medusa]
Length=647

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 74/94 (79%), Gaps = 2/94 (2%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KL   DKKKIEDA++EAI WLD NQLAEADEFEDKMKE+E +CNPII
Sbjct  554  NMRNTVKDEKIGEKLTPGDKKKIEDAIDEAISWLDSNQLAEADEFEDKMKELENVCNPII  613

Query  222  AKIYQ--QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ   G  A  MD++  P    AGPKIEEVD
Sbjct  614  AKMYQGGAGDAAGGMDEDAAPSGGGAGPKIEEVD  647



>emb|CAA70111.1| HSC70-G7 protein [Arabidopsis thaliana]
Length=100

 Score =   118 bits (296),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 74/96 (77%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NM NTI+DEKIG KLA  DKKKIED++E AI WL+ NQLAE DEFEDKMKE+E ICNPII
Sbjct  5    NMTNTIRDEKIGEKLAGDDKKKIEDSIEAAIEWLEANQLAECDEFEDKMKELESICNPII  64

Query  222  AKIYQQGGDAMPMD---DEEVPP-ASAAGPKIEEVD  127
            AK+YQ G    P     DE+VPP A  AGPKIEEVD
Sbjct  65   AKMYQGGEAGGPAAGGMDEDVPPSAGGAGPKIEEVD  100



>ref|XP_003521330.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Glycine max]
 gb|KHN09419.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=653

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 77/100 (77%), Gaps = 8/100 (8%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KD+KIG KL  ADKKKIEDA+E+AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTVKDDKIGEKLDPADKKKIEDAIEQAIQWLDSNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQG-----GDAMPMDDEEVPP---ASAAGPKIEEVD  127
            AK+YQ G     G A   +DE   P    S AGPKIEEVD
Sbjct  614  AKMYQGGAGPDVGGAGAAEDEYAAPPSGGSGAGPKIEEVD  653



>ref|XP_006644983.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Oryza brachyantha]
Length=649

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 76/96 (79%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL+A DKKKIEDA++ AI WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDDKIASKLSADDKKKIEDAIDGAINWLDGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAM---PMDDEEVPP-ASAAGPKIEEVD  127
            AK+YQ  G  M      DE+VP   S AGPKIEEVD
Sbjct  614  AKMYQGAGPDMGGATGMDEDVPAGGSGAGPKIEEVD  649



>gb|AAV97978.1| heat shock protein hsp70 [Saussurea medusa]
Length=647

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 74/94 (79%), Gaps = 2/94 (2%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KL   DKKKIEDA++EAI WLD NQLAEADEFEDKMKE+E +CNPII
Sbjct  554  NMRNTVKDEKIGEKLTPGDKKKIEDAIDEAISWLDSNQLAEADEFEDKMKELENVCNPII  613

Query  222  AKIYQ--QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ   G  A  MD++  P    AGPKIEEVD
Sbjct  614  AKMYQGGAGDAAGGMDEDAAPSGGGAGPKIEEVD  647



>ref|XP_010558317.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Tarenaya hassleriana]
Length=654

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 81/101 (80%), Gaps = 9/101 (9%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL AADKKKIEDA+EEAI+WL+GNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIRDEKIGEKLQAADKKKIEDAIEEAIQWLEGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQ-------QGGDAMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ        G  A    D++VPP+  S AGPKIEEVD
Sbjct  614  AKMYQGGAGGDMGGAAAGAGMDDDVPPSGGSGAGPKIEEVD  654



>ref|XP_006407675.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
 gb|ESQ49128.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
Length=561

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 76/97 (78%), Gaps = 5/97 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KLAA DKKKIED++E AI WLD NQLAE DEFEDKMKE+E ICNPII
Sbjct  465  NMRNTIRDEKIGEKLAADDKKKIEDSIEAAIEWLDANQLAECDEFEDKMKELESICNPII  524

Query  222  AKIYQQGGDAMPMD----DEEVPP-ASAAGPKIEEVD  127
            AK+YQ G    P      DE+VPP A  AGPKIEEVD
Sbjct  525  AKMYQGGEAGGPAAAGGMDEDVPPSAGGAGPKIEEVD  561



>ref|XP_010464591.1| PREDICTED: heat shock 70 kDa protein 3 [Camelina sativa]
Length=649

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 78/96 (81%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KLAA DKKKIED++E AI WL+GNQLAE DEFEDKMKE+E +CNPII
Sbjct  554  NMRNTIRDEKIGEKLAADDKKKIEDSIEAAIEWLEGNQLAECDEFEDKMKELESLCNPII  613

Query  222  AKIYQQGGDAMPMD---DEEVPPAS-AAGPKIEEVD  127
            AK+YQ G    P     DE+VPPA+  AGPKIEEVD
Sbjct  614  AKMYQGGEAGGPAAGGMDEDVPPAAGGAGPKIEEVD  649



>gb|ABX76301.1| heat shock protein 70 [Ageratina adenophora]
Length=649

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 73/96 (76%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KL   DKKKIEDA++EAI WLD NQLAEADEFEDKMKE+E +CNPII
Sbjct  554  NMRNTVKDEKIGEKLTPGDKKKIEDAIDEAIAWLDANQLAEADEFEDKMKELENVCNPII  613

Query  222  AKIYQ----QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ        A  MD+E  P    AGPKIEEVD
Sbjct  614  AKMYQGGAGDAAGAGGMDEEPAPSGGGAGPKIEEVD  649



>gb|ACJ11742.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 77/95 (81%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKIG KL  ADKKKIEDA++ AI+WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDEKIGSKLDPADKKKIEDAIDGAIQWLDGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQ-QGGDAMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G D     DE+ PP   S AGPKIEEVD
Sbjct  614  AKMYQGAGADMGGGMDEDAPPTGGSGAGPKIEEVD  648



>gb|AAN86274.1| non-cell-autonomous heat shock cognate protein 70 [Cucurbita 
maxima]
Length=647

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 76/94 (81%), Gaps = 2/94 (2%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+ DEKIG KL+ ADKKKIEDA+E+AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTVNDEKIGAKLSQADKKKIEDAIEQAIQWLDANQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G  M    ++  PA  S AGPKIEEVD
Sbjct  614  AKMYQGAGADMGGGADDSVPAGGSGAGPKIEEVD  647



>gb|ACJ11745.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 78/95 (82%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KL  ADKKKIEDA++ AI+WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTVKDEKIGSKLDPADKKKIEDAIDGAIQWLDGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQ-QGGDAMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G D     DE+ PP   S+AGPKIEEVD
Sbjct  614  AKMYQGAGADMGGGMDEDAPPTGGSSAGPKIEEVD  648



>gb|EMS52605.1| Heat shock cognate 70 kDa protein 1 [Triticum urartu]
Length=647

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 74/94 (79%), Gaps = 2/94 (2%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL A DKKKIEDA++ AI+WLD NQLAEADEFEDKMKE+E +CNPII
Sbjct  554  NMRNTIKDEKIASKLPADDKKKIEDAIDAAIQWLDTNQLAEADEFEDKMKELEALCNPII  613

Query  222  AKIYQQGGDAMP--MDDEEVPPASAAGPKIEEVD  127
            AK+YQ  G  M   MDD+    +  AGPKIEEVD
Sbjct  614  AKMYQGAGADMEGGMDDDTPAASGGAGPKIEEVD  647



>ref|XP_003539680.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
 gb|KHN32117.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=649

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 76/96 (79%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL+A DKKKIEDA+E+AI+WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDDKIASKLSADDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMDDEEVPPA----SAAGPKIEEVD  127
            AK+YQ  G       +E  PA    S AGPKIEEVD
Sbjct  614  AKMYQGAGGDAGGAMDEDGPAAGSGSGAGPKIEEVD  649



>gb|EMS65159.1| Heat shock cognate 70 kDa protein [Triticum urartu]
Length=702

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 76/98 (78%), Gaps = 6/98 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL  ADKKKIEDA++ AI WLD NQLAEA+EF+DKMKE+EGICNPII
Sbjct  605  NMRNTIKDDKIASKLPEADKKKIEDAIDGAITWLDNNQLAEAEEFDDKMKELEGICNPII  664

Query  222  AKIYQQGGDAMPMDDEEVPPASAA------GPKIEEVD  127
            AK+YQ  G  MP   +E  PASAA      GPKIEEVD
Sbjct  665  AKMYQGAGAEMPGGMDEDAPASAAGGSSGPGPKIEEVD  702



>ref|XP_009353695.1| PREDICTED: heat shock cognate 70 kDa protein 2-like isoform X1 
[Pyrus x bretschneideri]
Length=649

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 78/96 (81%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT++DEKIG KL  ADKKKIEDAVE+AI+WLDGNQL + DEFEDKMKE+E +CNPII
Sbjct  554  NMRNTVRDEKIGSKLNPADKKKIEDAVEDAIQWLDGNQLGDCDEFEDKMKELENLCNPII  613

Query  222  AKIYQQGGDAMPMD--DEEVPPASA--AGPKIEEVD  127
            AK+YQ  G  +     DE+ PPA++  AGPKIEEVD
Sbjct  614  AKMYQGAGADVGGGAPDEDAPPAASGGAGPKIEEVD  649



>ref|XP_002528432.1| heat shock protein, putative [Ricinus communis]
 gb|EEF33915.1| heat shock protein, putative [Ricinus communis]
Length=649

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 78/96 (81%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKI  KL+  DKKKIEDA+E+AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTVKDEKISSKLSPDDKKKIEDAIEQAIQWLDANQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQ--QGGDAMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ   G D     DE+VPPA  S AGPKIEEVD
Sbjct  614  AKMYQGAGGPDMGGGMDEDVPPAGGSGAGPKIEEVD  649



>emb|CDY49668.1| BnaC06g01970D [Brassica napus]
Length=498

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 75/95 (79%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+D+KIG KLAAADKKKIED+VEEA++WLDGNQ AEADEFED MK++E +CNPII
Sbjct  404  NMRNTIRDDKIGEKLAAADKKKIEDSVEEAVQWLDGNQTAEADEFEDNMKDLESVCNPII  463

Query  222  AKIYQ---QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            A +YQ    G    P DDE    A  AGPKIEEVD
Sbjct  464  ANMYQGGAGGEAGGPADDESPAAAGGAGPKIEEVD  498



>ref|XP_011027667.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Populus euphratica]
Length=515

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 76/95 (80%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKI  KL A DKKKIEDA+++AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  421  NMRNTVKDEKISSKLGADDKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPII  480

Query  222  AKIYQQGGDAMPMDDEE-VPPASA--AGPKIEEVD  127
            AK+YQ  G  M    EE  PPA +  AGPKIEEVD
Sbjct  481  AKMYQGAGADMGGGMEEDAPPAGSGGAGPKIEEVD  515



>gb|AIA22210.1| heat shock protein 70 [Chrysanthemum indicum]
Length=647

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 73/94 (78%), Gaps = 2/94 (2%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KL   DKKKIEDA++EAI WLD NQLAEADEFEDKMKE+E +CNPII
Sbjct  554  NMRNTVKDEKIGEKLTPGDKKKIEDAIDEAIAWLDSNQLAEADEFEDKMKELENVCNPII  613

Query  222  AKIYQ--QGGDAMPMDDEEVPPASAAGPKIEEVD  127
             K+YQ   G  A  MD+E  P    AGPKIEEVD
Sbjct  614  VKMYQGGAGDAAGGMDEEPAPSGGGAGPKIEEVD  647



>ref|XP_006407676.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
 gb|ESQ49129.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
Length=650

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 76/97 (78%), Gaps = 5/97 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KLAA DKKKIED++E AI WLD NQLAE DEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIRDEKIGEKLAADDKKKIEDSIEAAIEWLDANQLAECDEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMD----DEEVPP-ASAAGPKIEEVD  127
            AK+YQ G    P      DE+VPP A  AGPKIEEVD
Sbjct  614  AKMYQGGEAGGPAAAGGMDEDVPPSAGGAGPKIEEVD  650



>ref|XP_003625487.1| Heat shock protein [Medicago truncatula]
Length=719

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 73/94 (78%), Gaps = 4/94 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI GKL + DKKKIED +E AI+WLD NQLAEADEFEDKMKE+EG+CNPII
Sbjct  554  NMRNTIKDEKIAGKLDSDDKKKIEDTIEAAIQWLDANQLAEADEFEDKMKELEGVCNPII  613

Query  222  AKIYQQGG----DAMPMDDEEVPPASAAGPKIEE  133
            AK+YQ G      A P DD+    A  AGPKIEE
Sbjct  614  AKMYQGGAGPDMGAAPGDDDAPSHAGGAGPKIEE  647



>gb|EYU19903.1| hypothetical protein MIMGU_mgv1a002628mg [Erythranthe guttata]
Length=652

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 76/99 (77%), Gaps = 7/99 (7%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL A DKKK+EDA+E AI+WLD NQL EADEFEDKMKE+EGICNPII
Sbjct  554  NMRNTIKDEKIASKLGADDKKKVEDAIEGAIQWLDANQLGEADEFEDKMKELEGICNPII  613

Query  222  AKIYQQGG--DAMPMDDEEVPPASAA-----GPKIEEVD  127
            AK+YQ  G  D     DE+ PP++A      GPKIEEVD
Sbjct  614  AKMYQGSGGPDMAGGMDEDGPPSAAGGSSGPGPKIEEVD  652



>ref|XP_010558794.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=649

 Score =   126 bits (316),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 78/96 (81%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKIG KL  ADKKKIEDA+++AI+WLDGNQLAEADEFEDKMKE+EGICNPII
Sbjct  554  NMRNTIKDEKIGAKLDPADKKKIEDAIDQAIQWLDGNQLAEADEFEDKMKELEGICNPII  613

Query  222  AKIYQQG----GDAMPMDDEEVPPASAAGPKIEEVD  127
            A++YQ      G A    D++  P+  AGPKIEEVD
Sbjct  614  ARMYQGSGADMGGAGGGMDDDGAPSGGAGPKIEEVD  649



>ref|XP_008458906.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cucumis 
melo]
Length=652

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 77/99 (78%), Gaps = 7/99 (7%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT++DEK   KL  ADKKKIEDA+E+AI+WLD NQLAEADEFEDKMKE+E ICNPI+
Sbjct  554  NMRNTVRDEKFSSKLDPADKKKIEDAIEQAIQWLDNNQLAEADEFEDKMKELESICNPIV  613

Query  222  AKIYQ----QGGDAMPMDDEEVPP---ASAAGPKIEEVD  127
            AK+YQ     G     MDD++VPP    S AGPKIEEVD
Sbjct  614  AKMYQGAGGPGMGGGAMDDDDVPPPSGGSGAGPKIEEVD  652



>gb|ACM42161.1| heat shock protein 70.58 [Ageratina adenophora]
Length=645

 Score =   125 bits (315),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KL+  DKKKIEDA++ A+ WLD NQLAEA EFEDKMKE+E +CNPII
Sbjct  554  NMRNTVKDEKIGEKLSPEDKKKIEDAIDGAVSWLDNNQLAEAGEFEDKMKELENVCNPII  613

Query  222  AKIYQQGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ G     MDD+     S AGPKIEEVD
Sbjct  614  AKMYQGGAGDAAMDDDVPAGGSGAGPKIEEVD  645



>ref|XP_010231300.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brachypodium distachyon]
Length=649

 Score =   125 bits (315),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 76/98 (78%), Gaps = 7/98 (7%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL A DKKK+EDA++ AI WLD NQLAEADEFEDKMKE+EGICNPII
Sbjct  553  NMRNTIKDEKIASKLGADDKKKVEDAIDGAISWLDTNQLAEADEFEDKMKELEGICNPII  612

Query  222  AKIYQQG----GDAMPMDDEEVPP--ASAAGPKIEEVD  127
            AK+YQ      G  M M DE+ P   +S AGPKIEEVD
Sbjct  613  AKMYQGAAPDMGGGMGM-DEDAPAGGSSGAGPKIEEVD  649



>gb|KHN17505.1| Heat shock 70 kDa protein [Glycine soja]
Length=521

 Score =   124 bits (312),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 79/96 (82%), Gaps = 7/96 (7%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKIGGKL+  +K+KIE AVE+AI+WL+GNQ+AE DEFEDK KE+EGICNPII
Sbjct  429  NMRNTIKDEKIGGKLSPDEKQKIEKAVEDAIQWLEGNQMAEVDEFEDKQKELEGICNPII  488

Query  222  AKIYQQ----GGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ     GGD +PM  +   PA+ AGPKIEEVD
Sbjct  489  AKMYQGAAGPGGD-VPMGAD--MPAAGAGPKIEEVD  521



>ref|XP_006436010.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
 gb|ESR49250.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
Length=648

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 80/95 (84%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KL  ADKKKIEDA+++AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTVKDEKIGSKLDPADKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQ-QGGDAMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  GGD     D++ PPA  SAAGPKIEEVD
Sbjct  614  AKMYQGAGGDMGGGMDDDAPPAGGSAAGPKIEEVD  648



>gb|KHN21966.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=646

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 76/96 (79%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL++ DKKKIEDA+E+AI+WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  551  NMRNTIKDDKIASKLSSDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPII  610

Query  222  AKIYQQGGDAMPMDDEEVPPA----SAAGPKIEEVD  127
            AK+YQ  G       +E  PA    S AGPKIEEVD
Sbjct  611  AKMYQGAGGDAGGAMDEDGPAAGSGSGAGPKIEEVD  646



>ref|XP_003537997.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
Length=649

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 76/96 (79%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL++ DKKKIEDA+E+AI+WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDDKIASKLSSDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMDDEEVPPA----SAAGPKIEEVD  127
            AK+YQ  G       +E  PA    S AGPKIEEVD
Sbjct  614  AKMYQGAGGDAGGAMDEDGPAAGSGSGAGPKIEEVD  649



>ref|XP_007139236.1| hypothetical protein PHAVU_008G012600g [Phaseolus vulgaris]
 gb|ESW11230.1| hypothetical protein PHAVU_008G012600g [Phaseolus vulgaris]
Length=647

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 78/94 (83%), Gaps = 2/94 (2%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL++ DK KI++A+E+AI+WLD NQLAEADEFEDKMKE+EGICNPII
Sbjct  554  NMRNTIKDDKISSKLSSEDKTKIDNAIEQAIQWLDSNQLAEADEFEDKMKELEGICNPII  613

Query  222  AKIYQQGGDAMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ G  A    D++ PPA  S AGPKIEEVD
Sbjct  614  AKMYQGGAGAGGDVDDDAPPAGGSGAGPKIEEVD  647



>dbj|BAJ34054.1| unnamed protein product [Thellungiella halophila]
Length=650

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 76/97 (78%), Gaps = 5/97 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KLAA DKKKIED++E AI WLD NQLAE DEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIRDEKIGEKLAADDKKKIEDSIEAAIEWLDANQLAECDEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMD----DEEVPP-ASAAGPKIEEVD  127
            AK+YQ G    P      DE++PP A  AGPKIEEVD
Sbjct  614  AKMYQGGEAGGPAAAGGMDEDIPPSAGGAGPKIEEVD  650



>gb|AAP33015.1| HSP70 [Citrus x paradisi]
Length=92

 Score =   117 bits (292),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL  ADKKKIEDA+EEAI+WLDGNQLAEADEFEDKMKE+EGICNPII
Sbjct  29   NMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELEGICNPII  88

Query  222  AKIY  211
            AK+Y
Sbjct  89   AKMY  92



>ref|XP_011028442.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 80/95 (84%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KLAA DKKKIEDA+++AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDDKISSKLAADDKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQ-QGGDAMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  GGD     D++ PPA  SAAGPKIEEVD
Sbjct  614  AKMYQGAGGDMGGGVDDDAPPASGSAAGPKIEEVD  648



>gb|EMT11692.1| Heat shock cognate 70 kDa protein [Aegilops tauschii]
Length=651

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 75/98 (77%), Gaps = 6/98 (6%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL  ADKKKIED ++ AI WLD NQLAEA+EF+DKMKE+EGICNPII
Sbjct  554  NMRNTIKDDKIASKLPEADKKKIEDTIDGAITWLDNNQLAEAEEFDDKMKELEGICNPII  613

Query  222  AKIYQQGGDAMPMDDEEVPPASAA------GPKIEEVD  127
            AK+YQ  G  MP   +E  PASAA      GPKIEEVD
Sbjct  614  AKMYQGAGAEMPGGMDEDAPASAAGGSSGPGPKIEEVD  651



>ref|XP_010520113.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Tarenaya 
hassleriana]
Length=650

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 77/99 (78%), Gaps = 9/99 (9%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KL+  DKKKIED ++EAI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIRDEKIGSKLSPDDKKKIEDTIDEAIQWLDNNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMD-----DEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G A   +     D + PP+  S AGPKIEEVD
Sbjct  614  AKMYQ--GSAASTEGNADVDADAPPSGGSTAGPKIEEVD  650



>gb|AGL07711.1| heat shock protein 70 [Ziziphus jujuba]
Length=654

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 78/101 (77%), Gaps = 9/101 (9%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL+ ADKKKIEDA+++AI+WLDGNQLAEADEF DKMKE+E ICNP+I
Sbjct  554  NMRNTIKDEKISSKLSDADKKKIEDAIDQAIQWLDGNQLAEADEFGDKMKELESICNPVI  613

Query  222  AKIYQ------QGGDAMPMDDEEVPP---ASAAGPKIEEVD  127
            AK YQ       G D     D++VPP    S+AGPKIEEVD
Sbjct  614  AKTYQGAGAGAGGPDVGGGSDDDVPPPSGGSSAGPKIEEVD  654



>ref|XP_011016414.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Populus euphratica]
Length=648

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 80/95 (84%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KLAA DKKKIEDA+++AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDDKISSKLAADDKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQ-QGGDAMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  GGD     D++ PPA  SAAGPKIEEVD
Sbjct  614  AKMYQGAGGDMGGGVDDDAPPASGSAAGPKIEEVD  648



>ref|XP_002532297.1| heat shock protein, putative [Ricinus communis]
 gb|EEF30081.1| heat shock protein, putative [Ricinus communis]
Length=652

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 77/99 (78%), Gaps = 7/99 (7%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKI  KL AADKK+IEDA++ AI+WLDGNQLAEADEFEDKMKE+E +CNPII
Sbjct  554  NMRNTVKDEKISSKLDAADKKRIEDAIDGAIQWLDGNQLAEADEFEDKMKELESVCNPII  613

Query  222  AKIYQ------QGGDAMPMDDEEVPP-ASAAGPKIEEVD  127
            AK+YQ             M+++  PP AS AGPKIEEVD
Sbjct  614  AKMYQGAGAGAGADVGAGMEEDAPPPGASGAGPKIEEVD  652



>gb|KEH30132.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=578

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 75/96 (78%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL+A DKKKIEDA+E AI+WLDGNQL EADEFEDKMKE+EGICNPII
Sbjct  483  NMRNTIKDDKIASKLSADDKKKIEDAIEGAIQWLDGNQLGEADEFEDKMKELEGICNPII  542

Query  222  AKIYQQGGDAMPMDDEEVPPA----SAAGPKIEEVD  127
            A++YQ  G       +E  PA    S AGPKIEEVD
Sbjct  543  ARMYQGAGGDAGGAMDEDGPAAGSGSGAGPKIEEVD  578



>ref|XP_002468097.1| hypothetical protein SORBIDRAFT_01g039530 [Sorghum bicolor]
 gb|EER95095.1| hypothetical protein SORBIDRAFT_01g039530 [Sorghum bicolor]
Length=649

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 75/96 (78%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+D+KI  KL  ADKKKI+DA+E AI WLD NQLAE DEFEDKMKE+EGICNPII
Sbjct  554  NMRNTIRDDKIASKLPEADKKKIDDAIEGAINWLDNNQLAEVDEFEDKMKELEGICNPII  613

Query  222  AKIYQ--QGGDAMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ   G D     D++ PPA  S AGPKIEEVD
Sbjct  614  AKMYQGAAGPDMAGGMDQDAPPAGGSGAGPKIEEVD  649



>ref|XP_002312089.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89456.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 80/95 (84%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KLAA DKKKIEDA+++AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDDKISSKLAADDKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQ-QGGDAMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  GGD     D++ PPA  SAAGPKIEEVD
Sbjct  614  AKMYQGAGGDMGGGMDDDAPPASGSAAGPKIEEVD  648



>ref|XP_004156719.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 2 [Cucumis 
sativus]
Length=547

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 76/99 (77%), Gaps = 7/99 (7%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT++DEK   KL  ADKKKIEDA+E+A++WLD NQLAEADEFEDKMKE+E ICNPI+
Sbjct  449  NMRNTVRDEKFSSKLDPADKKKIEDAIEQAVQWLDNNQLAEADEFEDKMKELESICNPIV  508

Query  222  AKIYQ----QGGDAMPMDDEEVPP---ASAAGPKIEEVD  127
            AK+YQ     G     MDD++ PP    S AGPKIEEVD
Sbjct  509  AKMYQGAGGPGMGGGAMDDDDAPPPSGGSGAGPKIEEVD  547



>gb|KEH30131.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 76/96 (79%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL+A DKKKIEDA+E AI+WLDGNQL EADEFEDKMKE+EGICNPII
Sbjct  554  NMRNTIKDDKIASKLSADDKKKIEDAIEGAIQWLDGNQLGEADEFEDKMKELEGICNPII  613

Query  222  AKIYQQGGDAMPMD-DEEVPPA---SAAGPKIEEVD  127
            A++YQ  G       DE+ P A   S AGPKIEEVD
Sbjct  614  ARMYQGAGGDAGGAMDEDGPTAGSGSGAGPKIEEVD  649



>ref|XP_002312090.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89457.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 76/95 (80%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKI  KL A DKKKIEDA+++AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTVKDEKISSKLGADDKKKIEDAIDQAIQWLDTNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMDDEE-VPPASA--AGPKIEEVD  127
            AK+YQ  G  M    EE  PPA +  AGPKIEEVD
Sbjct  614  AKMYQGAGADMGGGMEEDAPPAGSGGAGPKIEEVD  648



>gb|KEH30133.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 75/96 (78%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL+A DKKKIEDA+E AI+WLDGNQL EADEFEDKMKE+EGICNPII
Sbjct  554  NMRNTIKDDKIASKLSADDKKKIEDAIEGAIQWLDGNQLGEADEFEDKMKELEGICNPII  613

Query  222  AKIYQQGGDAMPMDDEEVPPA----SAAGPKIEEVD  127
            A++YQ  G       +E  PA    S AGPKIEEVD
Sbjct  614  ARMYQGAGGDAGGAMDEDGPAAGSGSGAGPKIEEVD  649



>ref|XP_004246402.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 75/96 (78%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL  AD+KKIE+A+E+AI+WLD NQLAE+DEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDEKIASKLPEADRKKIEEAIEQAIQWLDANQLAESDEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMDDEEVPPA----SAAGPKIEEVD  127
            AK+YQ  G  M  D  +  PA    S AGPKIEEVD
Sbjct  614  AKMYQGAGGDMGADMGDDGPAPSGGSGAGPKIEEVD  649



>ref|XP_006341042.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 75/96 (78%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL  AD+KKIE+A+E+AI+WLD NQLAE+DEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDEKIASKLPEADRKKIEEAIEQAIQWLDANQLAESDEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMDDEEVPPA----SAAGPKIEEVD  127
            AK+YQ  G  M  D  +  PA    S AGPKIEEVD
Sbjct  614  AKMYQGAGGDMGADMGDDGPAPSGGSGAGPKIEEVD  649



>ref|XP_006649850.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Oryza brachyantha]
Length=655

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 75/97 (77%), Gaps = 5/97 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL  ADKKKIEDA++ AI WLD NQLAEA+EFEDKMKE+EG+CNPII
Sbjct  559  NMRNTIKDDKIASKLPEADKKKIEDAIDGAISWLDSNQLAEAEEFEDKMKELEGVCNPII  618

Query  222  AKIYQ-QGGDAMPMDDEEVPPA----SAAGPKIEEVD  127
            AK+YQ  G D     DE+ PPA    S  GPKIEEVD
Sbjct  619  AKMYQGAGADMAGGMDEDAPPAAGGSSGPGPKIEEVD  655



>ref|XP_007016460.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY34079.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=650

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 75/97 (77%), Gaps = 5/97 (5%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL AADKKKIEDA+E+AI+WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDDKISSKLPAADKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMDDE-----EVPPASAAGPKIEEVD  127
            AK+YQ  G  M   D       V   S AGPKIEEVD
Sbjct  614  AKMYQGAGGDMGGGDMDEDGPSVGGGSGAGPKIEEVD  650



>ref|XP_010473075.1| PREDICTED: heat shock 70 kDa protein 3-like [Camelina sativa]
Length=649

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 77/96 (80%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTI+DEKIG KLAA DKKKIE+++E AI WL+GNQLAE DEFEDKMKE+E +CNPII
Sbjct  554  NMRNTIRDEKIGEKLAADDKKKIEESIEAAIEWLEGNQLAECDEFEDKMKELESLCNPII  613

Query  222  AKIYQQGGDAMPMD---DEEVPP-ASAAGPKIEEVD  127
            AK+YQ G    P     DE+VPP A  AGPKIEEVD
Sbjct  614  AKMYQGGEAGGPAAGGMDEDVPPSAGGAGPKIEEVD  649



>ref|XP_010095013.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58119.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=648

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 80/95 (84%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKI  KL AADKKKIEDA++ AI+WLDGNQLAE+DEFEDKMKE+E +CNPII
Sbjct  554  NMRNTVKDEKIASKLDAADKKKIEDAIDAAIQWLDGNQLAESDEFEDKMKELESVCNPII  613

Query  222  AKIYQ-QGGDAMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  GGD     D++VPP+  S AGPKIEEVD
Sbjct  614  AKMYQGAGGDMGGAMDDDVPPSGGSGAGPKIEEVD  648



>gb|AAS57912.1| 70 kDa heat shock cognate protein 1 [Vigna radiata]
Length=649

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 76/96 (79%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL A DKKKIEDA+++AI+WLDGNQL EADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDEKIASKLPADDKKKIEDAIDQAIQWLDGNQLGEADEFEDKMKELESICNPII  613

Query  222  AKIYQ--QGGDAMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ   G     MD++   PA  S AGPKIEEVD
Sbjct  614  AKMYQGAGGDAGGAMDEDGPAPASGSGAGPKIEEVD  649



>ref|XP_003578898.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Brachypodium 
distachyon]
Length=648

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 74/95 (78%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL A DKKKIEDA++ AI+WLD NQLAEADEFEDKMKE+E +CNPII
Sbjct  554  NMRNTIKDEKIASKLPADDKKKIEDAIDAAIQWLDTNQLAEADEFEDKMKELESLCNPII  613

Query  222  AKIYQQGGDAMPMD--DEEVPPASAA-GPKIEEVD  127
            AK+YQ  G  M     DE+ P AS   GPKIEEVD
Sbjct  614  AKMYQGAGADMEGSGMDEDTPAASGGPGPKIEEVD  648



>ref|XP_006486093.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Citrus sinensis]
Length=1046

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 80/95 (84%), Gaps = 3/95 (3%)
 Frame = -2

Query  402   NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
             NMRNT+KDEKIG KL  ADKKKIEDA+++AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  952   NMRNTVKDEKIGSKLDPADKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPII  1011

Query  222   AKIYQ-QGGDAMPMDDEEVPPA--SAAGPKIEEVD  127
             AK+YQ  GGD     D++ PPA  SAAGPKIEEVD
Sbjct  1012  AKMYQGAGGDMGGGMDDDAPPAGGSAAGPKIEEVD  1046



>gb|EMT07406.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=647

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 73/94 (78%), Gaps = 2/94 (2%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL A DKKKIEDA++ AI+WLD NQLAEADEFEDKMKE+E +CNPII
Sbjct  554  NMRNTIKDEKIASKLPADDKKKIEDAIDAAIQWLDTNQLAEADEFEDKMKELEALCNPII  613

Query  222  AKIYQQGGDAMP--MDDEEVPPASAAGPKIEEVD  127
            AK+YQ  G  M   MDD+    +   GPKIEEVD
Sbjct  614  AKMYQGAGADMEGGMDDDTPAASGGPGPKIEEVD  647



>ref|XP_004505872.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 75/96 (78%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI  KL+  DKKKIEDA+++AI+WLDGNQLAEADEFEDKMKE+EGICNPII
Sbjct  554  NMRNTIKDDKIASKLSTDDKKKIEDAIDQAIQWLDGNQLAEADEFEDKMKELEGICNPII  613

Query  222  AKIYQ----QGGDAMPMDDEEVPPASAAGPKIEEVD  127
            A++YQ      G AM  D       S AGPKIEEVD
Sbjct  614  ARMYQGAGGDAGGAMDEDGPTTGSGSGAGPKIEEVD  649



>sp|P26413.1|HSP70_SOYBN RecName: Full=Heat shock 70 kDa protein [Glycine max]
 emb|CAA44620.1| Heat Shock 70kD protein [Glycine max]
Length=645

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 79/96 (82%), Gaps = 7/96 (7%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKIGGKL+  +K+KIE AVE+AI+WL+GNQ+AE DEFEDK KE+EGICNPII
Sbjct  553  NMRNTIKDEKIGGKLSPDEKQKIEKAVEDAIQWLEGNQMAEVDEFEDKQKELEGICNPII  612

Query  222  AKIYQQ----GGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ     GGD +PM  +   PA+ AGPKIEEVD
Sbjct  613  AKMYQGAAGPGGD-VPMGADM--PAAGAGPKIEEVD  645



>ref|XP_003549537.1| PREDICTED: heat shock 70 kDa protein-like isoform X1 [Glycine 
max]
 ref|XP_006600536.1| PREDICTED: heat shock 70 kDa protein-like isoform X2 [Glycine 
max]
Length=645

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 79/96 (82%), Gaps = 7/96 (7%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKIGGKL+  +K+KIE AVE+AI+WL+GNQ+AE DEFEDK KE+EGICNPII
Sbjct  553  NMRNTIKDEKIGGKLSPDEKQKIEKAVEDAIQWLEGNQMAEVDEFEDKQKELEGICNPII  612

Query  222  AKIYQQ----GGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ     GGD +PM  +   PA+ AGPKIEEVD
Sbjct  613  AKMYQGAAGPGGD-VPMGADM--PAAGAGPKIEEVD  645



>ref|XP_004493999.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=661

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 76/94 (81%), Gaps = 7/94 (7%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKD+KI GKL +ADKKKIED++E+AI+WLD NQLAEADEFEDKMKE+E +CNPII
Sbjct  554  NMRNTIKDDKIAGKLDSADKKKIEDSIEQAIQWLDSNQLAEADEFEDKMKELESVCNPII  613

Query  222  AKIYQQGGDAMPMD----DEEVPPA--SAAGPKI  139
            AK+Y QGG    M     DEE PP+  S AGPKI
Sbjct  614  AKMY-QGGAGPDMGGAAADEEYPPSGGSGAGPKI  646



>gb|EMS68426.1| Heat shock cognate 70 kDa protein 4 [Triticum urartu]
Length=648

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 73/96 (76%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KD+KI  KL A DKKK+E+A+E  I WLD NQLAEADEFEDKMKE+EGICNPII
Sbjct  553  NMRNTVKDDKIASKLGADDKKKVEEAIEGTISWLDANQLAEADEFEDKMKELEGICNPII  612

Query  222  AKIYQQG----GDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ      G  M MD++    A  AGPKIEEVD
Sbjct  613  AKMYQGAAPDMGGGMGMDEDMPAGAGGAGPKIEEVD  648



>gb|KDP35613.1| hypothetical protein JCGZ_09051 [Jatropha curcas]
Length=648

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 74/95 (78%), Gaps = 3/95 (3%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+KDEKIG KL+ ADKKKIEDA+E AI+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTVKDEKIGAKLSPADKKKIEDAIEAAIQWLDSNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMDDEEVPP---ASAAGPKIEEVD  127
            AK+YQ  G  M     +      AS AGPKIEEVD
Sbjct  614  AKMYQGAGGDMGGAAMDDDAPAGASGAGPKIEEVD  648



>ref|XP_008447699.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Cucumis melo]
Length=647

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 76/94 (81%), Gaps = 2/94 (2%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+ DEKIG KL+ ADKKKI+DA+E++I+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTVNDEKIGAKLSPADKKKIDDAIEQSIQWLDANQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G  M    ++  P+  S AGPKIEEVD
Sbjct  614  AKMYQGAGADMGGGADDSAPSGGSGAGPKIEEVD  647



>ref|XP_004142076.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Cucumis sativus]
 ref|XP_004161675.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Cucumis sativus]
 gb|KGN54238.1| Heat shock protein 70 [Cucumis sativus]
Length=647

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 76/94 (81%), Gaps = 2/94 (2%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNT+ DEKIG KL+ ADKKKI+DA+E++I+WLD NQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTVNDEKIGAKLSPADKKKIDDAIEQSIQWLDANQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMDDEEVPPA--SAAGPKIEEVD  127
            AK+YQ  G  M    ++  P+  S AGPKIEEVD
Sbjct  614  AKMYQGAGADMGGGADDSAPSGGSGAGPKIEEVD  647



>emb|CDP00073.1| unnamed protein product [Coffea canephora]
Length=634

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 72/92 (78%), Gaps = 11/92 (12%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL AADKKKIEDA+E AI+WLDGNQLAEADEFEDKMKE+E ICNPII
Sbjct  554  NMRNTIKDEKISSKLPAADKKKIEDAIEGAIQWLDGNQLAEADEFEDKMKELESICNPII  613

Query  222  AKIYQQGGDAMPMDDEEVPPASAAGPKIEEVD  127
            AK+YQ  G      DE       +GPKIEEVD
Sbjct  614  AKMYQGAGGP----DE-------SGPKIEEVD  634



>tpg|DAA55190.1| TPA: heat shock protein70-4 [Zea mays]
Length=521

 Score =   122 bits (306),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 73/96 (76%), Gaps = 4/96 (4%)
 Frame = -2

Query  402  NMRNTIKDEKIGGKLAAADKKKIEDAVEEAIRWLDGNQLAEADEFEDKMKEVEGICNPII  223
            NMRNTIKDEKI  KL A DKKKIEDA++ AI WLD NQLAEADEFEDKMKE+E +CNPII
Sbjct  426  NMRNTIKDEKIASKLPADDKKKIEDAIDAAISWLDANQLAEADEFEDKMKELESLCNPII  485

Query  222  AKIYQQGGDAMPMD---DEEVPPASAA-GPKIEEVD  127
            AK+YQ  G+ M      DE+ P  S   GPKIEEVD
Sbjct  486  AKMYQGAGEDMGGAGGMDEDAPAGSGGPGPKIEEVD  521



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 508466684456